3WU1A

Crystal structure of the ets1-runx1-dna ternary complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
123
structure length
123
Chain Sequence
LADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
total genus 20
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wu1A00
1HJBC 2BIOA 3D05A 2IOOA 5G4MA 1KZYA 4IJTA 2H1LM 1EAQA 2J6WA 4LOFA 4L0YA 5ECGA 5LAPA 2AC0A 3D06A 3VD0A 4MZIA 2BINA 2J21A 4AGMA 4LOEA 4IBYA 5AOIA 2BIMA 3WTVA 1T4WA 4HJEA 3QYMA 2FEJA 1YCSA 2X0VA 3VD2A 4A63A 1TSRA 3D09A 4XR8C 4QO1B 5G4OA 2J20A 1IO4C 3KMDA 2WGXA 3TS8A 2J1WA 4G83A 4IBZA 3US0A 3KZ8A 1CO1A 2AHIA 4GUQA 4IBVA 3D0AA 3Q06A 1HJCA 5AOKA 3D07A 3ZMEA 4L18A 2X0WA 4LO9A 2OCJA 2MEJB 4IBWA 1EAOA 3D08A 2XWRA 1GZHC 4AGNA 5BUAA 4IBQA 3IGLA 2ADYA 3QYNA 4IBUA 2BIPA 2IOIA 2ATAA 3EXLA 3WTYA 2IOMA 2VUKA 1GZHA 4AGOA 3WTSA 5A7BA 4IBSA 3WTWA 5AOLA 5AOMA 4AGQA 5AOJA 4GUOA 2X0UA 4G82A 1HU8A 3US1A 3WTXA 5KBDA 1UOLA 3Q05A 3WTUA 1E50A 2J1XA 1LJMA 2BIQA 2J1ZA 3VD1A 3EXJA 4AGLA 2YBGA 2XWCA 2GEQA 4MZRA 4KVPA 3Q01A 1TUPA 2J1YA 4IBTA 3IGKA 2P52A 2PCXA 5LGYA 5AB9A 1H9DA 5G4NA 3WU1A 1EANA 4AGPA 1CMOA 5ABAA 3WTTA 2RMNA 4L0ZA
chains in the Genus database with same CATH superfamily
2HKHL 1ETA1 1LEIB 3EW3B 2DWEA 4M61A 3K1DA 2EKJA 2CAKA 2UX6A 2BHFA 3CVHB 4JFWA 5DCCA 3VWKB 4HPOH 4Z18A 3WN5A 4BXVA 5T1KB 1BD2B 1FJ1A 3WD5L 3DOIA 4LSUL 3L5WA 5FO2A 5HPMA 5GSVA 2B08A 2IH3B 3ZKMC 1AKJA 3DARA 4FQJH 1C12A 3GQFA 1KXQA 4Y5VB 1XAUA 2ZKYA 1RZQA 2FX9L 4HD9A 2X3BA 1KLUB 2C9RA 2ZUQC 1R1CA 4JN1L 2FEJA 3BP7B 4N0FB 2VXSH 2OPCA 1A3LL 5HHXL 3GO1L 4HEPG 2PR4L 1UC6A 4K7FB 3DI2B 4MBRA 5F3HB 2MQGA 2OSLA 7TAAA 4PIBA 3DUUB 4JY6A 5C0AB 2ALWA 2FGWL 3NA9H 1N8OE 1T1YA 3OKOA 4AZUA 2EZ0C 3TS8A 3KYKL 4R4BB 1CO1A 4WRLA 1QSZA 5DD1L 3KJ4B 3PL6D 4UAOB 1HFUA 4FFZL 2ZNXA 4AMXA 3OWEA 1OGTB 1BAFL 5HHNA 3MRDB 1X5ZA 1XSOA 3LYRA 5E7BA 1NIEA 1VESA 3W11C 1FZJB 3GSVB 1GZPA 3QZMA 1XIWB 5BS0D 2IDTA 3NJKA 3KPMB 4GRLD 4KOCA 3BUTA 1AI1L 5IHLB 1D6EA 4U1GB 3FT9A 3L7FA 2K9FB 3L7EB 2CJTA 4OM0H 4Y8AA 1FZOB 2E4TA 2NY0D 1P4UA 2GVYA 4RGMC 3HJ0A 1KB5A 1D7DA 1IGJB 4X0KA 4D9LH 2ERJB 4ODSH 5J1SC 2PYEE 3HLAB 3S5YA 1CDBA 5GHWH 1M7DB 3BEVB 5FGCB 1HOEA 4P4KC 1JVLA 3GSNL 1JCKA 5DK2A 3WXVH 2Z91B 4AQAB 2KDYA 1JGEA 4GMSL 1IJNA 3AT9A 4NGHL 1SVBA 4Z7VF 4IK7A 5E4EB 2WWMC 3NGBC 4UTBH 3EDFA 3H42L 1JNNL 2M1KA 2X41A 1PSKH 3ZHDA 4R0LC 1YN7B 4WI5A 3VFSB 4WY7L 2XOTA 1A3QA 5L4MA 4JRWA 4U1IA 1KXTA 4JGMA 3MBXH 3GF8A 1F45A 1R3JA 1QLEL 4X6DF 5IKCA 3O6FD 1S78D 2XACC 3CXDH 3TZVC 4C55A 5HYQA 2IPTH 4KO6A 3VU1A 2D0GA 3Q6GH 2VSKB 1R3HA 3D6GA 7PCYA 4YDLC 1NMAH 3ATEA 3IAPA 2YKLL 5DRXA 5I15H 5CFAA 1IEHA 1GYWA 1CN4A 3DV6A 4LVNC 4O58L 4ZMLA 3DMMB 4PRIE 3K6NA 3KHQA 4UQ2B 4B41A 1S9VB 9CGTA 2MOGA 1U8QB 4UB0H 1GRWA 4ZXBD 1CD9B 1TU2B 4PGDB 5I1EL 4ECNA 1Q0XL 1J1PH 1Q94A 4PJGF 4OH2A 3MR9B 3PGDA 3P1VA 2Y22A 3NN8B 4FTVA 5H37G 3MLTB 3Q13A 3D85A 2Z8WC 2Z92A 3SCMD 1I1AD 1JHTB 5F1OB 3VTAA 5J12B 2X4PB 1A9EB 1E90A 2GJ6A 4J4PA 3BISA 4NM4L 2QQKL 5GRVL 1G6RA 2HA1A 2L3BA 4PQXA 3UPRA 4IOSA 2ZKXA 1F11B 4R6UA 1RULL 4OZGF 3P69A 2ITCA 2NY1D 4PLNC 1YA5A 4M3HA 1SYSB 3U6XS 3X1FA 1NEUA 1AY1H 5J89A 2O5ZL 3QZWB 4GT7A 4ZO6A 4BFJA 1GZQA 2Q8AL 1AXSB 2GIXA 3V0WL 2Q86A 5F7UA 4XP9H 4MBOA 4GKZB 3LD8B 2GCYB 3UAJA 2X09A 4RNRA 3EYQC 1MCLA 2FH6A 2JI2A 4DN3L 3S36X 2VUKA 1A14H 1BYPA 3HI1A 5I30H 3QDHA 1F4XL 4XC1L 2FTAA 5LKNA 3WFZA 1WBYA 4UT7L 1N59A 3QORB 5KBDA 3U2JA 3P40A 2DLHA 2AP2A 2E9JA 5IQ7L 3D0LA 2F19H 1N64H 5F72S 3RDTA 2IFFH 1EHLL 4HS6A 4X8JA 1LYQA 3MACL 4QTIH 1MCJA 4ZUTB 3FN0H 2BLFA 3N41F 5JPMA 4YUEL 2LFGA 4C83A 4KVPA 4XPGL 4OAWB 3ZK0A 1TUPA 3PREA 4R90H 1WBXB 3DVGB 4HHGA 3S3BB 4MAUL 2ESVA 4JQIL 4NWTH 3MJWA 5EG6C 1RMFL 1OB0A 1KFGA 3CN4A 5CZKA 4AGPA 4OCWH 1XH0A 3ZKMD 3GHBH 2KLRA 2X4QB 3PDDA 4PJCE 2MCG1 4FQHA 3FB7A 4P2RE 3VXUB 1JD7A 2NDGA 4G3YL 1JIBA 1A7QH 4S10A 2BY1A 3F05A 2LAGB 1NUFA 2WBJD 4JO1H 3WO4B 1O5PA 3LN4A 2VC2H 3BGAA 3GZPA 1KTDB 2P5WE 2WINB 1JI2A 4XC3L 4KTGA 4GQ9L 4JHWL 2V2XA 1JMZA 4X50A 1G94A 1XWVA 3INOA 2C7FA 2DTSA 4LKXB 3UBXG 3QPXH 3IMWA 4NAMA 2EZ0D 1EERB 1UB5B 2ADIB 4XP6L 4GUPA 4YHOH 2AQTA 4OD3H 4ZS6C 1FNFA 2F1BA 1SXAA 3P3UA 1N4XH 2BVPA 4KJPC 2XVLA 2DQIL 2ZX7A 4Z7QF 1IFRA 3WGVB 2E7HA 3QARA 1HSBA 2DOCA 5GGTL 4HKZA 5DT1H 3ZO0A 3KXFD 2R0WL 1RZJL 3UGXA 1DL7H 1A6VL 1M7IA 4HZ1A 3L08A 1BOGA 1UACH 5JO5A 3S37L 1WUZA 3IFNH 3FQ4A 4ALAH 3A0OA 4BRVA 3VA2C 4IJ3B 3WEBA 2MKLC 1H3VA 4UQEA 4Z7UB 1XR8B 1P7QD 3ABLB 1K4CA 2OMZB 3OKKA 2AW2A 1H8SA 3V0VA 3LKPA 2Y5TB 4LO9A 5AAPA 1TZGL 1CI3M 4IU3B 3L9RA 3IFPB 3MCLL 2FCBA 2YFOA 2YSSA 5ANMB 2VW6A 1SLVA 4P4KD 5KJ7E 4ELMA 4TQHA 4BFNA 1BIIA 1FZMA 5JA8B 1AGBA 2WY3B 2CD0A 3VNYA 1WYJA 2WWMD 4JFVA 4PJ9A 3MRKB 4GFXA 4I5BB 1ND0B 2YGQA 4XXCA 4WEBH 3SPVB 3LX9A 4DTGH 3O6MH 1EVTC 1FP5A 1N7ML 1BZ7B 1U4FA 2H0JA 4N2BA 3TFBA 4YHLL 4RMTA 1PVHA 2H32B 4XCNB 4N6QA 3TZVD 3VQ2C 2ITDB 3VI3B 1LNUB 4N0RA 3ZY7A 4AE0A 3CPLA 4OM1L 3S88H 3T0EB 2F8VA 1IGTA 4NZFA 4AYFB 4HOWA 3WE6A 1ZD6A 1LMIA 1TKWA 4TVUA 5HI4C 4IEFA 4N68A 3L3HA 3OXSB 3BLKA 3IWVA 3OL2A 3PAVA 4MCNA 2BVEA 1MUJB 5H2BB 1M6UA 5FA3A 2VOTA 2FBJL 4FQIL 3D05A 4ODHL 2LAAA 4WW2C 1YEGL 1AHKA 2H3KA 3V9FA 3ZDYE 1YY8B 1UADC 3TJEH 4ADIA 3QXAA 4D8PA 4MQ7A 5DZPA 4MJ6A 4L5FL 3HNSH 2BHYA 2NX5A 1N0XH 1QZ1A 4OZ4A 4N28A 4P99A 5KUKA 3QNZB 3VXPA 3O2WH 4LAQL 2G75B 4WWKB 1JD9A 5C9JA 3OKDB 4WUKH 1U30A 5CBEA 1QKZH 1NGPH 1ZLWH 2DI7A 2QKSA 3PWNA 1T20B 4HCRH 3OXRA 3P0YL 1XO8A 4ZOCA 5EZPA 1G6VK 3H7BA 4LL4A 3HS8A 1L9PA 4E41B 5EZOH 3UMTA 1YNTF 1VF5C 2SEBB 2V6HA 3Q8FA 3GSUB 5K39B 2HFGH 4GI6A 4MYWB 4QRUB 4P23C 3VH8A 4KKZA 1FNGA 5GISL 1YNKL 5EA0L 2GT9A 1RZ7L 1WCBB 2DM4A 3EYQD 3LZRA 3NCWA 2FWOA 2F6AA 3MA7A 1YYLH 3PXLA 4PRNA 1REIA 2XFGB 3GBMH 1GS7A 1A6UH 2PYFB 4W9DC 3VGDA 2AI0L 3H9YA 4LHUD 2TSAA 3ZZ1A 5ICZA 3MV8E 1WWWX 3WBDA 2VKXA 3NACH 3TBSB 5J6GA 2DIBA 4L23A 4JNXA 3T6VA 4NQDA 4P9MH 4RBPH 4ZMNA 3GJFH 3IE9A 4YSSA 1SN2A 1N67A 2AV7A 2OS7A 3S98A 2B4CL 1NMCC 3QUMA 3ARRA 1SJHA 3K4DA 4OLVL 3BDXA 1B90A 2VWEC 4PJEE 3WHE1 4LLDB 1ZXQA 3QR0A 3PWPE 5EU6A 2V2TB 2O61A 4PBVC 4QOKB 4GG6B 3DRQB 1CYGA 3FS9A 2FIRT 3O3EA 4DUWA 1ZAGA 3QXUA 3I9GL 3LIZA 1XGYH 2NMSA 4U6HB 1F8TH 3V95A 3W39A 5CP3H 3VW3L 5DURD 5CGMA 1MCQA 3IDGA 3EOBA 2WB1A 3U0TA 2GJZA 3C8DA 3AS0A 2ZJSH 3U7AA 3WUWA 4L3CB 1T5XB 4HDIB 5D5MB 2H26A 3A3YB 3RNKB 3HS0B 3T3PF 1SMAA 1Z5LA 5D93C 1WAAA 4IRSD 3LY6A 3U25A 1KPRB 4HGWB 1RJYA 3NJNA 5AZ2L 2I9LA 1ZLUK 2K4WA 3S0PA 1DN0A 1ADWA 2DKUA 4HJSA 1X9UA 1ED3A 3UBGA 1SEBB 1TQBB 3BFOA 5IK3B 2Y3AA 4GRWE 4MB5A 2YWZA 3V4PB 4U4BA 4FFWC 4WI9A 4MMXA 1J5OL 3FONB 1KLFB 2VR7A 2E7LC 2QSQA 4PJIA 4ZS6D 4NOFA 5HDBF 3V0IA 2OMXA 5ICYA 1YEEH 5L8LB 4EIZC 3U46B 3LEYH 3B5HA 1ZLSL 1EV2E 4F7PA 3C6LB 4KY2A 3A4FA 3QNYB 3TXAA 3TESA 3I6LE 4JQIA 2J2ZB 1Q9LA 4S1RL 2IANB 2HLAA 1KBKA 2WOYA 5CGBA 2ODIA 2ZYSA 2R69L 2VRQA 3KLAB 3T65A 4BSWB 1Z3RA 5B1KA 2PWHA 4GQQA 1FBIH 3SDXA 5HYSA 2J8UB 1QABA 1R5VB 4JFEE 3WNNA 2YAQA 3RWIB 2BNRD 3IETA 3SGDH 1UM6L 1HK6A 1R3KA 3FFDA 3QEGH 4LMQI 4ZMYA 3PQYA 1QFWM 4ZNEA 2IAAC 4DGUA 2XPYA 4JFDE 1G7HB 5B7FA 2G3ZA 4KKAC 5T5FL 4EF3A 5KSAB 1ZXKA 4P46C 5ETUA 1AXTH 4UMGA 4F7CA 3PPEA 1JUFA 3F12A 3QUXC 1UWEH 5D71L 4FNLL 1VCAA 1A4KA 4BQCA 1HL8A 3D52A 1E43A 4PR5A 4L3EB 4F24A 3N6YA 4X9GA 3MUUA 3QNFA 4V1DE 4CMMA 3KPQB 5I8OH 4FQPA 2X3AA 3QFJB 5JW4M 2OMVA 4YXLH 2YEZB 1L7TH 5DJ8A 4EDWL 1UD6A 4UT6H 1D5RA 1G87A 1B2YA 3L81A 1J8HD 5KVFL 4WIQA 1TCMA 3P2TA 3QZWG 5EFIA 4Y5YB 5IBTH 1VRSA 4Z3TA 5IHWA 1PZ5B 1NIBA 2DLFL 2VSDA 4NWUH 4WJKB 4UDTA 4KAQH 2G2PA 3ARZA 1H0DB 5D9SB 4L8SA 3IDIB 3WFCL 2WKLA 3TM6A 3UO8B 3VNZA 1E40A 1XGUA 1KOAA 3AACA 3L4ZA 4N22A 4CKVX 5JMOC 2ZPKH 3QDJD 1ML0A 2I07A 1Z3GH 3ZRSA 5FXCH 4FQCL 3WN6A 5JHLL 5ESVB 2BIQA 2EYRB 2FAUA 5HI4D 1OP3H 3VXSA 2PO6B 5IZ7A 4LDOB 1XF5A 4A6YH 5D7IF 3ZPDA 1OKEA 1E5ZA 4P9HC 3LZLA 4RDQG 4J28A 2P42B 3UTSE 3FULA 5IJDC 5C0IA 1U8HB 3CU7A 4J3SA 4D9RD 4Z7NB 3GKWL 5CSGA 1ZHNB 4RGOL 5KS9B 3T4YA 1WA0X 2Y7QA 4HFUL 3UO1L 3MRCA 4WJG3 3S3DB 4TL4A 1MQKL 3CFEB 2YIHA 2Z1PA 3PNWA 2A74B 4G7RB 1MCFA 4YDNA 4AH2A 1S9WA 2QADB 1QRND 5C7ZA 3ZYJA 3JV4A 4FCHA 2QDWA 2ZXEB 4AVJA 5AD0A 2QFRA 2CA4A 2R2BB 3I3DA 3MC0A 3P4MA 1CXIA 3UBXI 5B4MD 3ZT7A 1KZYA 4TVPL 4JN2B 1GPOH 2X87A 3EHBC 1SDYA 3KDPB 4IKJA 3U9PH 2IJ0C 4LCCB 3VTMA 3SHSA 1ZIAA 4UQIM 1WISA 4P5MB 1LGVA 1ZA6A 3BGMA 3LPPA 4J6RH 1HS6A 1R5IB 2UWEE 3LJ3A 1KY7A 5JXAH 2NY4B 1UTDA 1M9SA 3RZCA 4P23D 3TN0C 5E08H 2YD6A 3DX6A 3QWNA 4HIIB 1JCVA 1DQML 1SDDA 3M07A 5D2NB 3GXTA 4AXWB 4EBQL 1IAKA 1UQSB 1QFWH 3KPPA 5KZCD 3AMLA 1KCLA 2AFNA 3MKGA 1WV7T 1UM5L 3WN5C 2WIIA 4XO3A 5E6IB 1OM3H 5B8CA 4TNWF 3VFOB 1E8ZA 4MNQB 3DJTA 5AWNH 4NYLB 1JV2B 4LCWA 3CDYA 3W9EB 4O00A 4FL4C 2C9XA 2ZONA 3RU8H 5ALCH 4D3CH 1ZSHA 2BFVH 3FOLA 1FO0B 3HG4A 2XG5A 5CUSL 7FABH 1PX3A 4H8UA 4X99A 4DGIH 3F7KA 1FVEA 4G8GB 3QJVB 3VFRA 5KVEH 4JO3L 1RQ5A 5CJXA 1KIQB 4ZQTA 4TNEA 1JZ8A 2RTTA 1FORL 1WTLA 1Z0NA 3ILEA 3O3DA 2O1AA 3D08A 1WHOA 4WU7B 4ZUSA 3STBA 2NW2A 3WDJA 1QAWA 4KJWC 3K0YA 4UIKL 2ISDA 5E1IA 2Y7NA 3K8MA 3PRZA 5BV7C 3RY6A 5JMRA 3B9VA 3FRUB 3LOWA 3V5HB 3MLUL 1OOWA 1RJZB 3F84A 2FWLB 3ZVVA 3CD4A 4M7LH 2FBRA 3OGCB 4ZQKB 3NFSL 5HDWA 2ZT9C 1E5YA 1HL4A 3KPLA 5HHMD 3F85A 3UBHA 2F53D 1GGBH 5KBMA 4HZAA 1V10A 2X1PA 2V9QA 4KHXH 1OQOA 3K7UA 4FFWD 3R8BB 1J87A 4OCLC 3VFGL 3RFRA 3F64A 5K9KA 2XIDA 1TNNA 2V9UA 1KGCE 5DMGD 4I13B 1MJ8L 4A37A 1JFHA 4PGEB 1RUKH 2R1YB 1P4LA 4TSAL 3SGEI 2WGNB 4UTBA 2O93L 3RPBA 3HE6A 1UT9A 3H3PL 2ZF9A 5C9KA 1DSFL 2OX5B 3A4DA 1RK1A 3MNVB 3JWNG 3MLRL 3BDBA 2XIBA 4NQEA 3VFTB 1S7XB 1CQKA 4Q8BA 3OAZH 4GT0A 4X7TB 1HHHA 1LO0H 1NBZA 5T3XD 1FSKC 5F0JB 5D2LB 3K72A 2P7TA 4ILDA 2BSTA 4GPVA 4I48B 3TONA 3NSCA 5CCKL 3KPSE 5BQDA 5IIEB 1AR1B 4XHJC 5CSZA 4BSVB 4MWFB 4P3DA 2K3TA 4XN4A 3PYCA 3GMPB 4P46D 2YXWA 3POCA 4E5XA 5B39A 3DXAA 2YAPA 3UC0H 3X1BA 1RUMH 3RI5F 4WI4A 1PD6A 1YLBB 3QUXD 4AQOA 1T04B 2BIMA 5DZAA 3QYMA 3DJZA 5EO9A 4TUOB 1W0VA 4KFZC 4NRZA 4XNXL 3HAEH 5BZDB 1V55B 4OFVA 3HEIB 4NKMB 4Z0BL 1NDGB 3GJEA 1EGJL 2V4LA 4YQXH 1I75A 5C97A 2VDKL 1BBJB 3U1SH 3LH2L 4PS3A 1TNMA 3F7YA 2Q10A 4MLIA 3QB7C 1I3RB 4AMKL 4KH9A 3QEQB 2IO5A 4ZX5A 5L88H 5IEKA 3L5IA 3OAUH 1EHXA 1K4DB 1C5CH 1OWWA 2CIKA 2HJFB 4PJXA 4WNQB 4BZ2L 4AIZB 1QSEA 4DP6X 3T2OA 2EO7A 3LZOA 3CBKB 1B4JH 4TQIA 4BZ1L 5FFGA 1IEAA 4PWGA 4LCVA 3T6WA 4OGXL 3M1BB 4W9HC 1HIML 5A2KH 2CLVB 1N0LB 4J8RA 5DUBB 1BMWA 4L1BA 4Y19B 5FK9A 2E9BA 4POZC 3WIIH 1ECYA 4AGQA 3LMJL 2H3XC 1GIGL 4F57H 1NH6A 1DJGA 1L9TA 1VPOL 4HMEA 4OFKA 5B3NA 3DJRA 3RTQB 2RALA 1H5BB 4PCTA 1WIOA 3V5DB 3ZUCA 3UAJC 2FQDA 2VZ1A 5IQLA 3CMOL 2HH0L 3LRLA 1T89A 1PF3A 5EWIH 2HZHA 3HS9A 5HGHA 2VITB 2I9TA 3IJ8A 1OHZA 3BAEH 3TH3T 2WBKA 3TYFB 1T6BX 4YDVA 4YSOA 3HZKA 2BRRL 2CUHA 5KG9A 1FV1B 4CVWA 2VLRA 3JUYA 1KUMA 2P52A 2XBTA 3EHBD 4UM9A 4TL5A 5D1XE 2D3JA 2J88L 5KYYA 2JJTC 1I4FA 5CBAB 4DZBB 2A4EA 4KRPB 3NZHH 1WGVA 5I5JA 3MBWB 4NB7A 4L0ZA 3BT2L 3TN0D 3I85A 3UPCA 3B2UC 1NUGA 5D6CA 4JZJA 2VLKB 4GKSB 4WFHE 4CVUA 2RFXB 3L3DA 4XPAL 1I8LA 2UXTA 3HPJA 1JZ5A 2DKMA 5CEYB 4ODXB 4PJHB 4M7KH 1LHZA 2CBOA 3HZYA 1BEYH 1YNTA 1IGCL 5IF0A 1TJMA 4KK9C 5CZRA 5ERWA 1XZ0A 2BZ7A 2IH1B 2HWZH 1TJIH 4HKXA 1K72A 3P9LA 4N90E 5JLZB 1TYEB 3FCTA 4GO9A 4PP2B 4WEUD 2ZKHH 2KT6A 3LS4L 3ZDXE 1ZWIA 1CGSH 3RBGA 5JXEC 3AT0A 4U49A 3SBQA 4AEIH 2FT8A 3U79A 4PJ5A 5JW4N 3E80A 3RGVB 3L1OL 4WJ5B 1J8KA 3MPCA 4FYTA 3SE3C 2JMRA 4L8BA 5DHYA 4FI6A 5J4MA 4PBXA 3PF2A 4TV3A 3U4BL 3ZE0E 2CDEB 2OSWA 3E8UL 3WS3A 3COOA 4HZLB 5E6YA 1HCYA 1RK0A 1YC7A 3BD4A 3L3GB 3WG7B 5T3XL 1CDUA 1SM3H 5I73C 5JQHC 3GIZL 3VXRA 3MBEC 2V0AA 2F61A 4KJWD 2HXAA 2XBZA 2WXGA 3DHPA 2KPWA 2NY5H 1Q9OB 1YUKB 5I17A 4LP4A 4AOFA 4U7SA 4N0UA 3SE9H 1MVUB 1FLRL 2A1WL 4C58B 1L4IA 1P5VB 3C5JB 5HI5C 3MNWB 1V5JA 5DVOA 2P47B 5CXPA 4YLCA 2IALB 1OSPL 1CG9B 3ULUE 4J8QA 3HG1A 2BSEA 4I0PB 2ATPA 4NFDA 1K3IA 12E8L 1RSFA 4JFYB 4K3EL 3DBXB 4XCYA 1CD8A 5I71B 4YIQB 3PS6A 3IM1A 5CM1A 5E8DL 2YMOA 3KWTA 2XQBL 4XRCB 1G7QB 3ML9A 3NIGB 3OKEA 3MROB 4NKDA 4MA8L 5AYTA 5GRJH 1OTTD 2F0CA 1A9BA 4MB3A 3NIFE 2IPUG 4YNYA 4YK4B 1L9RA 2J57A 5EN2A 3T0VA 4RFNB 1XDTT 5TF1L 5GGRB 1F4HA 1K8DA 3GSNB 2D4FA 4F92B 2PCPA 3RGBA 4BV1A 4IBTA 3RTLA 4NM8H 3QE5A 1ZT4B 1CDCA 4Y4HB 1QVOA 3BO8B 2Y0SA 4HUXB 4P2QA 1HC1A 4AKOA 2XRAL 1ACYL 5HJBA 3ZGIA 2IAMA 5H94A 4PG2C 4R7LA 1TT6A 25C8L 4X9HA 5DJ0A 3QG6A 1RKRA 3H9SB 1JZDC 2ZXQA 5ICXB 5F1SA 1T1XA 4QWWD 4UZGA 5D7HA 5C09B 4BSJA 4I89A 4WK0B 2Y69B 1QLEB 2MRYA 4M6OH 4XOBA 4HIJA 2FT6A 2FJFB 4G42A 4F7TA 2OMYA 1YDPA 3SJVE 4P07A 3O11B 1BMGA 3RWHA 4LASL 5C08D 1FUNA 3AGVA 3N42F 3QQXA 4PJFA 2DEXX 2RB8A 4HH8A 3TPUA 3S2CA 2H9GA 2WSPA 4XP4H 3DVNB 4ELKB 2AQ2A 4K3HA 2ICEB 3HNVH 4P5KA 1XSJA 3D85D 1KBGH 1XGPB 2MNJB 5LAXB 1NMBL 3GIVB 4RIRB 3W9DA 5IFHH 3ZL4L 4JDVA 3MV01 2E27L 2F5AH 4WO0A 3KWXA 1TJHL 4JO4L 1LP9F 1TG8A 2C4FU 3MRNB 3DWTA 2CO1A 2G2RB 3K1KC 2UZIH 4UAHA 4IOSD 1AZUA 1YJDL 1GCYA 1I9JH 1NPNA 3QCTH 1VFBA 4Q52A 5EUOB 3D25B 4Z0XA 3NFPB 1MCPL 1BYOA 4POZD 3CK0H 2DYSB 4LF3B 4L3FA 3T6ZA 4E42B 2VQ1A 4R97B 5CWSA 3KR3H 1LO4H 3MQIA 2DQTH 5IGXL 3QZNA 1HEHC 1Q9WA 1PG7L 1MELA 2MOQA 4LP5A 4YSAA 1BQRA 5T1JA 3CSYB 3ESVF 1ZHBA 1CFQA 3BPLB 4IMLA 2D4DA 3UAJD 1D6VH 1HKLH 2XHNA 1UWXH 2PPDA 4CSSA 2ADJA 4S1SH 2E6PA 3RL2B 4XBEL 1H3TA 4IBSA 1CE1L 3SY0A 5C0BE 4BZ2A 1P7HL 1T3FA 1D5MA 1QBAA 1ZGLP 1UVQA 4A7VA 32C2B 1U8LA 3CBJB 5ABDE 2ENQA 5BV7L 4F8OA 2V17H 5JOPD 1SY6H 3I6KA 1YY9D 4XBGA 3S3SA 3B2UD 2IV9A 1AQKL 3H4HA 2A6IB 3JZ7A 1R47A 2P5PA 4KO7A 3TNMB 4CILA 3FQTB 1KV7A 1AGEB 1QBBA 1JZEA 1A1OB 4QXVA 4PRHB 3VYPA 1AQDA 4JKLA 1XR9B 2QBWA 3TCLA 4KK9D 2ESVD 1F3DH 4M9PA 5BS0B 3BRGC 5IB5B 3C09B 2R7EB 4X6EB 5AKRA 1RFDL 1U8CA 2Z8VC 4DKEL 2BWIA 4GRLB 5LCVH 2BWDA 3V9CA 4NQXA 3HC4L 4RAVB 1BOYA 4MNGB 2NY0B 4M4PA 1XF4A 3V0JA 2QQQA 3SBWA 2NQCA 4JZOB 4V33A 8FABA 2NY6C 3LKOB 3MLVL 3QQDB 2H45A 4CSTA 3IJHB 4LARH 2X2IA 4LSTH 4XMZA 4ZUVA 3VGHA 4NPJA 4YO0A 3UZQB 4KTYA 4AENA 2JB5H 4CBZA 1C08B 1VJSA 3SQRA 2HLFC 3MBED 1G7LB 1H3WM 1KYUA 2APXA 2YXVA 4FMKA 4M5YH 3ZTJG 3MXWL 5L8KB 3HRZB 5F0LB 3RVTC 1ZK5A 5D72L 3KD4A 3Q48A 2W65A 4E9XA 4IOIB 4IU2A 4WNSA 2WLMA 1NINA 1JGVL 4GS7B 4JFFA 4JHAH 5HI5D 4AV4A 4ZFGH 4K8RL 4HLEA 4WHYG 4JM4L 1J9SA 4XAKD 2A83B 3UTTE 5IQOA 3B6SA 1JWSB 1P1ZB 3PWLB 1BVKB 2AHIA 4LSVH 3TJHC 2NT1A 4F91B 4MCZA 4IBVA 3G6JE 4HKBA 3QH3A 3PWVA 3VGFA 5ADOH 2BXZA 2VDLH 3L2LA 3Q2WA 3SBPA 4EUPA 2P43B 3QZPA 1DJYA 3FH7A 3Q8CA 3TO2B 2VR3A 4AK2A 5HVHB 1WLHA 5GRUH 1T2QL 5K1VA 1E3FA 1OE3A 1O6SB 1O6VA 2VDQL 4UT6A 4RRPG 2X70A 2XWBB 4DKFH 5BUAA 4YDMA 4Y2LA 4EPSA 1PZ3A 3SCMB 1EJ8A 5ENWB 3FTYA 5SWZA 1AMYA 1FIGH 1HXYA 2UY7A 4BRJA 1QATA 1RZPA 4U3SA 4LMQE 4MMZB 5KYUB 5EIIA 3D34A 1U93B 4K15A 3PHQB 4RAUA 2R83A 2WQ8A 3WTUA 2FR4B 5GZNA 3LKSB 1VLXA 3T71A 3MMEB 1U3HC 4NZUH 1ZA3A 3P4NB 2ZUXA 1ODAA 1WFNA 1OP4A 4A6YA 1UA6H 5L0QC 3IMVA 2EILB 4MAYA 2BOCB 4RA0C 3GSRA 4K73A 1J5DA 5CEZL 4XPFH 4LSPH 5AYQA 1G1YA 1IC0A 3LZPA 3UEQA 4NQVA 5T3ZL 2JJVA 4I1PA 4R84A 3BKML 5EBLA 3RWGA 4JE4B 3UJJH 3WU1A 4Z5RB 4OD1H 2NCMA 3DTDA 4XT1C 1R3IH 1I9RL 1YEJH 4HAGA 2V2WA 1CYWA 3LQAC 4JANA 3NQKA 1UG9A 3MGTA 2JCCE 2XWXA 4GAGL 4U2YA 4W4NA 1EUTA 2NW3A 3CU1A 4DVBA 5I1IH 4OGYL 3RVXC 2A99A 2EICA 5C6PB 1HQ4B 4QRQA 3QUGA 3SN6N 2LE9A 3QDAA 1Q1JL 2OP4L 4OVUA 3S5LB 3BIKB 1QPKA 2VO5A 4Y9EA 1IC7H 3FO2B 1GHFH 1U91A 3V6ZA 3VVWA 2WLNA 4WI8A 3VD5A 4UQBA 2MPAL 1NFKA 2GEEA 1M7UA 4DN4L 3P02A 1N9PA 2XTSA 2AJZA 3OX8B 5MENA 2QPDB 4JKPH 1N19A 5EOQH 5I19H 1Q0EA 3WMQA 4ZSOE 2VUYA 1IGMH 1HZHL 2QHRH 3MFFB 3A6CH 1HHKB 4JPWH 3QRBA 4XBPB 3MZGB 3QWOB 2H0PA 2WW8A 2C7UB 2XWDA 1UXWB 1IL1A 4H7VA 3TU6A 1NFDE 4BCXA 4FHJA 1AYOA 3CVCA 2QT6A 2GBAA 5INDB 3S6CA 1T0NB 2Q2LA 3MTXA 3TX4A 2ORBH 4CC4A 1D7CA 4ZO8A 1UD5A 1RVFL 4QNPF 4E9TA 1KJ3L 3DDGA 3D7PA 3NCCB 3THMH 3TYGL 2BW5A 4AJ0A 1IVTA 3ZT6A 1EAOA 3LNHA 1VFAA 3EGXB 4HX1A 2A9AA 1EPFA 2CO2A 4NQDD 1MRFL 2ZKMX 1QNIA 1FYTA 5I6NA 2D3VA 3GRBA 4IBQA 4K94L 3PP4H 1GXEA 4L37B 1BDYA 5ISZB 4ZTPL 3FUKA 4GP5B 3BD5A 1N68A 5AOMA 4Y2DB 3MN8A 4MMYA 4QKXB 5EU6D 2OL3H 1GJUA 2X9XA 4N24A 2CGYA 1F1GA 3DURA 3MRIB 1IFHH 2QPEB 1MCKA 5F96L 5I66A 4GSDL 1YYML 2C3WA 1Q90A 3QUZA 3FSOA 3I84A 2XPGB 4ZPVB 2Y06L 4WFGD 5HGBB 3D3VB 1NCTA 2N7AA 3NJIA 1DLHB 1ACZA 3K4AA 1HNFA 2NOYA 4HF5H 5C92A 2X6AA 1P7QB 3RY6C 2VR6A 5CINL 1GVIA 2QR0A 1QO3B 2X1OA 2XN0A 1KJ2L 3T1FB 2VMEA 3MOBL 4RGMB 2DIEA 3QUYC 5LJYH 3NFNB 1U95B 3RX9A 3BRDA 5IMKA 4XHQA 4HISA 2NY6D 2WHVA 2NR6C 1DLFH 4AEFA 4Q7DA 3G04A 5F7BA 3MNZB 4X6CF 2BH0A 4X5LA 1QTSA 2HLFD 4PJDB 3CZNA 2LW3A 4FFVC 5K1NA 2XIIA 3NGBB 4LAJH 5SWSE 4PV9A 5EZIL 4JKMA 3RVTD 3K0WA 3ZT5A 5CD5C 4R0LB 3WFDH 3HE6C 1UZGA 1YPZB 5FHBL 3JYCA 2VIRB 3QXTA 4I0KA 4M1DH 4XNYH 5BZWA 2WXPA 4H0IA 4ONFL 5E9NA 2ROYA 5DVMA 4P5RA 4LLUB 2WJ5A 3HZVB 1NFIA 1CU4L 1MHEB 3TZVB 3QZBA 4ENEC 5B22A 2BC4A 5E23A 5HJDA 1VADB 4OSUH 3I3EA 4LSQL 5K9OA 4IGBC 3KGSA 3FJTA 1WS8A 3HAEA 3Q5YA 5DJXB 5DUPH 1JYNA 2I60H 4LVNB 3PQYD 1WBZB 2X4OB 4K9EL 2IV8A 3I2CL 3VH8G 5IMOA 5IVZA 1M3IA 2X6MA 1HHIA 1U36A 3X14B 2WO2B 3OM3B 1F41A 3F7VA 4YFDB 3LN5A 4RCAA 3GRWA 1EX0A 2Y2TA 5E1QA 1PX4A 3EF4A 3FNKA 3T8VA 4N2HA 4OV6F 3RVWC 2VN3A 2FECI 2ZWNA 3RA7H 4JM2B 4UU9B 5CD3A 1A9VA 2PW1B 2XT1B 4X5XB 2AZAA 3NIDF 1BD2E 4IKLA 3MRQA 1KYAA 3O45A 5AVSB 2C9AA 2JE8A 3QPKA 3DYOA 4HUCA 1HCVA 4UV7L 3QIBA 5DJ6B 4W1TA 2G60L 3CSBA 4RETB 1U3HD 1F18A 1CLZL 1P7KB 1KBWA 5TE6H 1FLTX 1A21A 4PRIA 5EU4B 1I1YB 3NYKA 3WTWA 2EDDA 5FWRA 4Z3HA 3BZEA 2DQFA 4KGLA 1ZLEA 4LIQE 5C0AE 1SOXA 4MQTB 3CFDB 2ENPA 4NIKB 3E6FB 2NNRA 1SXBA 3QJHA 1NCDL 1D9KC 1GAFL 3OR7B 1F0LA 1CZ8L 4X42A 4LOUC 1IC1A 1UGKA 3PGFH 4G80B 4U1HB 3KL5A 4L8DA 5DLMH 1BQHB 1DHKA 2EXTA 3TEUA 2V7HA 2AQPA 4NZRL 4LHUB 4KJYB 4MS6A 4LT7A 2AXJA 3RVXD 5TF0A 3APNA 3O3BA 1ODUA 1U33A 5DQJB 4NKQB 4P49A 4D0BB 1DP0A 3W37A 1E4XI 2GUYA 2OMWA 1NGZB 3CC1A 4BE6A 5IM7A 1NAMA 2NY7H 1B88A 4E9WA 2EKSA 1NCUA 2CRIA 3FYEB 5F9JA 1SF3A 2HJKB 1NCCH 1MRCH 3GMLB 4F2MB 1MCWW 2AXFA 1E9OB 4J5VA 4N9GB 3KLSA 2B3RA 3MGAA 3BN9C 4LPUA 5DRZA 5I8CA 1LP9A 3PIQB 4GUCA 4KQ0A 4UOQA 4G7SB 3BEWB 1S5HA 4XE5B 5HYSG 1G84A 5FGCE 4WHTB 4MZIA 1WD8A 3RZCD 3O41A 4TSCL 2WXJA 3M8OL 3QAQA 4XZUA 1DUYB 1KC5H 4KTDL 3T2NL 3REVB 1IFGA 4M6MH 1I8LC 3V2AR 2A9BA 3V52L 3ME0B 4OT1H 1J12A 2QSTA 3WFEL 3GHEL 1WT5C 1BZ9B 1RZKL 4X4MA 2XFXA 3EYSH 4YXKL 3U4EA 3OJ2C 1GSKA 3OQRA 2N1TE 2EUWA 4B60A 5A2CA 2JB6A 4GRMA 3U82B 4G83A 2YR3A 1S7RA 5EORH 1PW3A 2YEVB 1DQVA 4P5TC 1I9IH 3DDFA 1AS8A 4HWBL 4KXCA 1KWGA 3HBPA 2DMKA 5AL0A 1PS3A 5TQ0L 1MW0A 4PCSA 5J06A 4MD4B 1WIPA 2AQNA 4A55A 5L2KB 3X13A 1BWWA 3OJVC 3NPSC 4LQFL 3JWOH 4HFWA 4PJCA 4GQRA 3U2SA 5FFLA 4X5RA 3CLFL 3E9TA 4OTXH 4P2RA 1KPVA 5DEZA 4Z95L 1DFBL 4O9HH 3S35H 1BF5A 3PHOA 3SDDC 3UTPE 1KZQA 2XKNB 4JLRA 2GIYA 3KVPA 1IC5H 3HR6A 3X12B 4ALAC 3GTVA 4YH6A 5JYMA 1UWGL 4JFQB 5ESQB 5I1HL 1MRDL 2Q8BL 4PB9H 3QUYD 5EB9A 4FQ1H 3QIUA 3ATAA 4FN0A 3VGGA 5KW9H 3U30C 4JMNA 4KZCA 4YXHH 3JV5A 3WIFA 4MHHI 1IVLA 4PD4K 4FERA 2LLLA 1QI4A 2VGLM 1T7WA 5I8EB 2KZKA 4X4XA 3UAFA 4LP8A 3MREB 4MRBA 4PTTA 2A9NL 5E9DD 5L2JB 5B1JC 3GLDA 4O02L 5MP6H 1PY9A 2AJ3A 4HVBA 3KH4A 1U58B 2FYYA 3EJZC 4FFVD 3G08B 4EKXA 1WA2X 4EVNA 4POYA 3IGKA 3U2IA 3S37X 4BFRA 4XOCA 2XWJA 1J8HB 4DH2A 5CD5D 2Y6TE 4OLZL 3HE6D 1FG2B 1ANUA 3FO1A 3OB0K 3OZ9L 4JDTH 5A2AA 1DBJL 2J6EL 5C0EB 4OLXH 1LEKA 2VDNL 3PABB 4OIAA 4I4WA 1BLIA 4M5SA 1VFUA 2IGFL 5F6IB 1RD6A 3FRPA 1NWPA 4MD0B 2OMUA 4XBMA 3W5MA 1I82A 5HPOA 5CKAA 4Q58C 5F3FA 1FC2D 1QZNA 4FXGA 4IGBD 1JTPA 4KROB 5FM5M 3ULUH 4ZX3A 4XVUC 1JP5A 1ZT7A 4CNIB 2FVNA 4GI9A 2I24N 3TBTB 3QDJB 1QSFB 1NGXB 3TVMA 1ES0A 3T6XA 1E9PB 3FO9A 2IAMC 2OZ4H 1UA7A 4W6WB 5CLWA 1SFHA 1I31A 3NEXA 3DXAD 4ZRGA 1AD0A 3G5WA 4BFIB 5CEXA 1BG1A 1OPOA 2IQ9H 3S5LG 2GK0A 2F8OA 1H3GA 1WG3A 4KO5A 4L29B 3RVWD 1AOHA 4DEPC 1YQVH 4XMVA 2AGJH 3O2DH 2MQCA 5FUOL 1INDL 2FB4H 2H41A 3P30L 1CURA 5C71A 5KTEH 1H6EA 5F7DB 1MFUA 3MA9H 2VDKB 2W91A 1H15B 5TFSH 3US0A 3VXUE 4BKSC 3SEPA 1A6ZB 4Y4KB 2BERA 3TASA 1EFXA 2P8PB 4L4TE 4A7GF 2EVHA 3DTXB 2EH8L 4JRFA 1ZHLB 4OZHB 3SKJH 1QSED 4HD5A 3TA3A 5J1AB 3CIAA 2DWTA 2YPLB 4DGYH 2VL5A 4P23B 1AE6H 2CHZA 2V9RA 4PJAF 4OLWH 2FWSA 4HPYH 5GJSL 2V5TA 2VUOA 1QBLH 1N5AB 1M05A 1D9KD 3M7FB 1UD4A 3JZYA 4N2CA 1N2RB 5BW7C 5KZCB 4MLSA 3H9HB 1JTOA 3FUDA 2A6DA 2VW4A 3QHZL 4HSCX 4TLUA 3ZKXB 4LEXH 3IJEB 3GUTA 1X44A 4I7ZC 1Z7JA 3QUKA 2W9EL 2X4RA 3MHZA 1KB9J 3D0VA 4XXWC 2OKMA 3TT1H 5F21B 1NMCB 4BWUA 3FB6A 1UXLA 1S46A 2PWEA 2W60B 4FMFA 1EMTH 5A2BA 4Z7UE 4A7QA 4G8IB 5BMFL 1IAIH 2AEPH 1KBBA 1QTPA 4PCKA 1J7VR 4HQQH 1F6FB 4UM9D 2WVSA 4AX3A 4X7CC 5LQBH 3IJYA 4HHAB 3RUGF 3BN9D 4MD5A 5ANME 3HCVA 2HG5A 4C56B 4EQ2A 5D4JA 2PCFB 4PJ8C 4OM0L 3MV8A 4O2CA 5LCVA 3WXWL 1WA1X 2EEBA 5GRXG 2CMRL 2GITA 4N0YH 3AB0B 1IBYA 4H5SA 1E6OL 1NCGA 5HHMB 3ZZQA 2GSGB 3NAAH 1AVAA 2DWXA 3C6SB 1T7XA 3QZLA 4PJEA 3WXVL 3PWPA 4UQCA 2ZG3A 4EE2A 1MH5B 2ICCA 3WELA 1Y18A 3Q3GB 3JWNE 3GC3A 4Y4FC 4QJ5B 3VI3E 1J0IA 4O2FB 4CAGA 1T1WB 2FUTA 4UNTA 3T0EE 5JIPA 3CHRA 1QWUA 1TVHB 3SBWC 3SKNB 3NH7H 1CGVA 2X7LB 3D09A 1WZKA 3P73A 5IHBA 4E2OA 3H9ZA 4BD4A 1XH3B 4CDGC 4E9RA 3AS3A 2J20A 3CXDL 4U6YB 3B2VH 3U7YH 4BBWA 2QMKA 3KZ8A 1ITBB 4ANVA 3SDDD 4E0RA 3VXRD 2DQHH 1WRFA 1JXDA 1FFRA 1V7NH 1UASA 4LDEB 5JIQA 1DVSA 4ONHB 1EZSA 5I15L 1DUZB 1JNHA 2BMKB 4XCCH 1HJCA 1AFVL 3KPNB 5E8OA 5IT2L 3G9VA 2EIJB 2RQEA 1ZVHA 4P46B 3ARBA 3OAWA 5FYKH 1OK8A 3EH4B 1F4YH 5EOCL 1WZMA 4PGBB 5BQ7A 1QEWB 1XGQB 3JTTB 3IE4A 3QUXB 4XI5C 1FDLH 2FO8A 3DTUB 4W9EC 1BFOA 3CFJB 1QI3A 3PNRB 4HWBA 4U1JA 4ZK8A 4E41E 1V7MH 4GUOA 3EJZD 3V6OE 3IRZA 4PG9B 1DVFA 3MV9D 5E00B 4JB9H 5EC1A 5C0DA 2BP8B 5I0YA 1FAIH 1NEPA 4JFEA 3QJRB 4KKCC 5GIRB 3WJLA 3L3OB 5IW6B 2W80C 4JRYB 5HGDA 1DZ0A 4ZMAT 5EPMA 3CFCL 4JKKA 5LLIC 1NCAL 4KZEL 3RJOA 2FNWA 5J7CC 1DQQB 2WAQA 3MRLA 4Z3JA 1A6WH 4EI6B 1FNAA 3ES6B 1U8IA 4ANWA 1CXFA 1HXMA 3CFQA 2AEQH 3WFHA 1G7IB 4PREA 2G0KA 4XP9L 4XVUD 2DIJA 3WIHL 3QGVA 4HU8A 3AAZA 3N1GC 4LLWA 1KJVA 2G0LA 4GXVH 1BQHG 4GLRI 3GXNA 1ZJAA 4B9ZA 2IAMD 2CO3A 4LHUG 5IOKA 3CXHK 4ZS7H 4V1DA 5F0MB 4TTDD 5H37H 1A3RL 2DV6A 3CDGA 1A1NB 4TQEH 3FQ1A 4X5WA 2FNBA 5E8EA 1G9ML 4O02A 4QOKE 4GG6E 5H8DA 3BW9A 1BX2B 3GT6A 1JDCA 1XAKA 2BNUA 1XZWA 4U1LA 3W81A 5EU3B 5FYKU 4UM8B 3D69B 4HV8B 3BQUC 2IFFL 5MHSE 2DM2A 2WWKT 4KQ3L 4HJJH 5FX3A 1ZKAA 2EDHA 3FN0L 1T6VN 2O6FA 3N04A 1SOSA 4LNRB 5DJZB 1LO2L 4DKDC 2KI6A 2DBLH 2D0FA 2ICWA 2A6JA 5D5ME 4K3GA 3W2DH 1AHMA 1THAA 4YSDA 4HJUA 1HEJC 3S3JA 1PPIA 5HDQL 5HJGA 3GSWA 4R90L 3EHBB 1ZLWK 3UP1A 1BECA 1KN4L 5F88A 2JI1A 1T4KB 2J5LB 1XMEB 4ZX4A 1FZKA 4P0DA 1T0MA 3IYLW 5H35A 3KBFA 3MYJB 3GMNB 2H3NA 2WCPA 3KL3A 4KKLC 4CJ1A 1E0OB 5JR1L 1PY4A 4U1MB 3EOTL 5DHEA 4MJ2A 3RNQB 4KMTL 4NZJA 3IMSA 3UTSA 1D7FA 1NEZB 1JNLL 4A2HA 1BVLA 4HJTA 4MCYB 4EZJA 2EDKA 2EADA 1A7QL 1JG9A 1OLLA 3C8KB 4JO1L 4O2EB 1YMMD 2VC2L 1XCWA 4ODTH 5IVXF 5K9JH 4BKTC 3L54A 3TP4A 2XDHA 5LGJB 2IANE 1HWWA 2WTRA 1R5WA 2X1QA 4JM0A 1EJFA 1KLGA 5DD6A 3ARGA 2YZ8A 1KIUA 1PJ9A 3GS7A 4FL4B 2J8UE 1NSNL 2PXYC 5D1QC 4G5ZL 4RBPK 3GJFK 4PJ7F 1EEUA 4Y9FA 5AG9A 4BDVB 2IOMA 3I50L 4OW6A 3DX7A 5AOLA 4YPGA 5DD0L 4CC4C 3LPOA 3HBZA 1BZEA 1GGUA 1OB1A 2FYVA 5GS0L 5I1JL 2X0UA 5DS8B 1AZBA 3HKZA 2OL3A 5FOBA 3US1A 2CCVA 2OLDA 4LFHD 2IWKA 3UBFA 1IZJA 3F58L 5IBLC 4ISVA 1OV8A 2FBOJ 4WHCA 1CDHA 5SV3A 1TLKA 1MCHA 4L3EE 5BV7B 2X6BA 1F90L 4PJ8D 4YDZA 3L6FA 5MEQB 4LLYB 3QFJE 4IDJL 1OO2A 4QF1B 4LDCA 3DPBA 1ZEAH 3C2SA 1LD9A 4KDWA 1VGKB 4QGYA 2WMPB 2LTQC 4RZCA 2VDPL 2Q3ZA 3L3JA 1OAQL 3QUZC 1PFOA 3CAFA 3IDNB 3T8MA 1FH5L 1F6AA 1AJ7H 5CJ8A 3QRGH 4NO0A 2M83A 3B56A 5EEWA 1D6EB 2FZ3A 3K2IA 3L7FB 3LPGA 3MUY1 5A2IH 1JPTH 2VLME 5DR5L 1U6AH 3L4YA 3QI9A 1HSAB 1PLGH 4NKOA 2Z4TA 4HJ0C 4B9PA 2KDGA 3HUJB 5CN2A 3DETC 1BREA 3GLZA 1AHWB 3BHBB 4F8NA 2R0ZH 3SPGA 6PCYA 2XKUA 1MDTA 3VD0A 2X4TB 2B16A 1SHSA 1X4XA 5JQ6H 2X4UA 1UXSB 4K4KA 3MZTA 3LKQB 1MCDA 3N1QC 1JGEB 1N6VA 4HJEA 2Y72A 3QFDB 4NO5A 2IGLA 3RYMA 4APXA 2ED6A 2OJ1A 4XWGH 4HIXL 4AZ8B 4Z7NE 1R9FA 3ZQ9A 4DFHA 15C8H 5KS9E 3S9DB 2Y1YA 3B9KA 3OTTA 4M3JA 1QR1A 1HNGA 1ADQH 4NENA 4UBDC 4DOHB 4JK0D 2KQNA 3EJCA 4ZDHB 4XI5D 2YD9A 1E67A 3B9AA 4FS0A 5JIKA 1FL6A 4NO3A 4QXUH 3TJEL 4XN8A 1Z9SB 2WB7A 4ZFZA 2BVOB 1N0XL 4PLOB 3VD3A 3FQNA 2YD1A 4DFIA 1M71B 2AJXL 4AT6B 3O2WL 7CGTA 5C08B 3RIAK 1KCUL 4BZYA 3C2AH 4Y9GA 5GS1A 2Q3XA 1NANH 4KKCD 1SJXA 1J9CT 1NGPL 3MXVH 5D2NE 1LE5B 1OAJA 5DMJB 1D5IH 1VKXA 5AW9B 3QCVH 3D85B 5EZOL 4XCFH 3AADB 5SWZD 4BFGA 1KCRL 3UXFA 2MHAB 4NAJA 2BVQA 5I0WA 5EBWB 2FHBA 2GTWB 5CU5A 3KWWA 4R2GC 1FCCA 2DWSA 3VFUB 2QTVA 1G6RB 4I18A 2JXMB 4MNQE 5HHQA 3LXCA 4AVIA 3QIBC 2ITCB 2Q76A 3Q0HA 4NC0B 4XP1H 1FNEB 1ORQA 3GBML 3SPJA 2BW4A 4J3BA 3O3AB 4LEOA 4M29A 1JWMB 4N2MA 4G8GE 3FU3A 4XOEA 3X2QB 4DEWA 2K4AA 4PY7A 2W5PA 4OZIB 5C2BL 3BQUD 5FECB 5DSCA 5T1MB 2PTVA 1X5FA 4QXTA 4S1DC 3S4SA 3WTTA 2R4RH 3PHAA 3GSOA 2ARJB 3NK4A 1B0RB 3RI5K 6TAAA 1JZGA 3P3YA 1CFNB 5G5DA 3O4LB 1HINL 2NSMA 4OD2A 5BRPA 4J3UA 1XGYL 1JV5B 3F5WA 5ECJE 3DX4A 3UYPB 3C5SB 2YBRA 3L9EA 1DJHA 5I16B 1BBDL 5M94B 3NDZE 1T21A 4HT1H 4QJ3B 4XVSL 2QVKA 3D0LB 2FDBP 4KKLD 2XZQH 2BOBA 2EP6A 1MF2H 4X8JB 1SZNA 1BM3H 4WWOA 3VMNA 1R0AH 4NJAH 4ZYKB 4C57C 1KGYE 5D6DA 1OK0A 4F7EA 4OGAC 3FCBA 1CFTB 3Q8EA 3INUL 1MIML 3OKMA 2XV0A 4GW5B 4QAMB 4A7GA 1AIFA 3B8YA 1RURL 5MEND 1JF6A 4M62H 3LQZB 4IW4C 4P4RA 3EJTA 3IK2A 2XLLA 3DGCR 3NSYA 3K74B 3VCLA 3SKMB 1H9VA 1SJMA 2AK4A 4NNPH 2PXYD 4JQVA 4X7FC 5D1QD 5DHVA 3ZYOA 2EUZA 5F7LB 1HILA 1OP9A 2CRMA 2P24A 2PTTB 4DGVL 1J11A 1T6WA 3T2PA 4CN6A 5D2LE 1ZTXE 2NNXA 1WAPA 5AKSA 3LN4B 3JWDH 1BPVA 2ZSVB 3H55A 3R4DA 1ZVSA 3DX8A 1CYXA 4LNVA 3NZ8B 4CW1B 2V2XB 4YHKH 3OKNB 4LSRL 2J7LA 3GTTA 1HE8A 2ENJA 3F8UB 3N0PB 4UT9L 3RWFB 5I73B 3WLBA 5GS2H 1S7SA 2FE0A 5IBLD 4GUPB 3MBEB 2WZPA 4RWYL 1FYTD 3EYOB 1KNOB 3GXUB 5GGSA 5HD8C 3QEGL 3RBSA 5ID1B 1YEIL 5F1NB 2GJPA 4Y16B 2NY5C 4R3SA 5FM5O 3KAAA 4HC1A 1HSBB 3H2WA 2VJ8A 2YD8A 3KE0A 3FUFA 5HBBA 1BJ1J 4HKZB 2CXGA 4CL7A 1NGYA 3LRGA 2FQFA 1GC1H 4M5ZH 4G43B 3I6GB 3PV6B 4PEEA 5I1CH 4U3CA 1BOGB 1OQXA 3QUZD 2WWOA 3QEQE 3IFOA 1H3XA 2VYRE 3BP6B 3DSFH 5DLLA 4IHBA 1NGWA 1HI6B 3NK3A 4ZUUB 5LNEA 5IB3B 2BS9A 1MJUH 4LPCA 3V8CA 1NBYA 3QQ9C 2CCLA 4AJVA 4YXLL 3S36L 1I1FA 5FV1L 1WC7A 5K93A 1PBYA 5C0RH 3RWCA 3LKPB 4HJ0D 1KJ2B 3QIUC 1VEMA 3L9RB 1B6UA 2Q3AA 1S7VA 4N8UA 1CGWA 1DTUA 4M43H 5B1CA 2Q6WA 2YSSB 3UZVA 4Z8FH 1XEDA 4I77H 4ELMB 4Y19E 5ESAB 4M8RA 4TVSa 4FC3E 2Q7YA 2C1PA 4UILL 3SDYL 3OAZK 1UM4H 1CS6A 1TQTA 2WLIA 4GH7B 1QHQA 1X7TA 4U3HA 3PDOA 2XNAA 1E30A 1W72L 2WXIA 4WTZA 3RY5A 1WZAA 4MJ5B 4FP8H 2YLHA 4G6KH 3TCXA 2BZCA 4U1SB 1J0KA 5J11C 3H6JA 3ESNA 1FWXA 3ABGA 4UBDD 2OZ4A 5CP7A 3P4LA 3ZQXA 2Q2EB 1AOZA 1JFQL 5DA4A 3S8GB 4JG1L 1TMQA 4FXGC 4N2KA 2AABL 2VRKA 2B20A 3AREB 4R5TA 5BUPA 4K23H 2ZYIA 3GS4A 1KJMB 2GSIB 5CIPA 4XODA 4B3EA 1W9XA 3V0EA 4N87A 1CLOL 4Z77A 2KH2B 1VSCA 2VLKE 2Y24A 4NQSB 1D5XB 3MLWL 4F8LA 1GPOL 3U9PL 1X7SA 1JHLL 2OCFD 4NPKA 4PJHE 1UKQA 2B3IA 2XV3A 3HOGA 4QCIA 4P2OA 1Z66A 3UTOA 5DGQA 3HC0A 3QXAB 3T0XA 5AYUH 1NEZG 2VO8A 4R2GD 4GIOA 2YPKB 4MDIA 4HULB 5IB2B 1TJGL 3ECUA 4MQSB 1J86A 1BCIA 4H20L 3QIBD 2Y1ZA 2OI9B 3UJIL 3P2DA 3B34A 5HYEA 1CICC 1D2PA 1JHKH 2FD6L 3SJVA 4NDMB 3H7BB 3MV7B 4GW1B 4WAFA 3WTYA 4TNVK 3TEXA 1ZDSA 4PW4A 3ULSA 1G5AA 1YEKH 3D5OF 3QNXB 3PG2A 3TIEB 2HVKB 2YA2A 5FHAH 1PFCA 3TA3C 4W9IC 2J3SA 3KJ6L 1CK0H 5TDOA 1QMUA 3U0PB 1R75A 4FAAB 3BQVA 4UTAH 3VMPA 3R1GH 5J8OA 3IDXL 4I8DA 4S1DD 3HHMA 4HS3A 4WW1A 1BMZA 3HMXH 3WNPA 2VE6B 5F1IB 2C3VB 5I1GL 5I26A 3VFMA 3ZUNC 3C08H 1TMCB 1JZ7A 1SBSL 3QO0B 1GS6X 2R23A 4DGIL 4PRNB 1BVNT 5AAMA 5JOEA 4ZW6A 5DVNA 3K6FA 1LILA 2P49B 3B43A 1K5WA 4M6NL 3U36A 3G5XA 1S4IA 2X2JA 2ZOLA 4ANXA 5JPNA 1I8AA 4OF5A 2AV7B 2G9KA 3L3IA 3P4OB 3ZQWA 3QUMB 4ZFOL 3ETTA 2ZUUA 3WEAA 4AIOA 2CLZA 3IS0X 3BKJL 2EE6A 2WKOA 2CBMA 4OGAD 4XMPH 4YZFE 5D1ZB 4TULH 4P8QA 5EU6B 2O61B 2NXZC 2W92A 3ARDC 1P4IL 5SWQA 3NIGE 3BH4A 3O0RL 4GKNA 4GAYA 3RJQB 4JO8A 1TVBA 3BX7C 2J4WH 1GGBL 4BGDA 3W39B 1J5IA 5KN5A 2JKSA 3HLKA 1AIZA 4KHXL 3ZIMA 2F74B 2X9YA 4OZFB 3EOBB 3LN9A 3VU2A 3GSXB 1W8EA 3FK3A 3BVNB 3OGOE 3TBYB 3VRJA 1PNCA 3V4VL 5C0BA 1B0WA 3WUWB 1JN6B 1DZBA 2WYHA 3OZLA 5KUMA 5IUSA 2NNAB 1IQWH 3A23A 4QRPA 1EEYB 5TDNB 1I7UB 5TK4A 3EIFA 4GAJH 1KGIA 5JDJA 3OJDA 4KNTA 4AM0B 2NY6B 4P57A 4DPBX 4HKJA 5KVGH 5FB8A 3DROA 4NNXA 3KPRD 1FNLA 3H9SE 5JHBA 1LM8V 1MEXH 3KCPB 3U0WH 1EA9C 3RFZA 3QK0A 3T0DA 2LFEA 3CFTA 2W59A 3CH8A 4XPTL 4PGCA 4PJ7A 1YQ2A 5JOFA 2COQA 4X6BB 3KDMA 5FYJE 3D12B 5HD8D 1OM9A 4IIQA 5EC2B 1A66A 4M93C 5IFAH 2DS4A 1IRAY 3QJQB 2QZ5A 3AG2B 1IBBA 1TITA 4PJBF 3QXDB 2X5PA 3EZJB 4W9CC 1RUML 4AIEA 4HJGB 4PRAB 3ARVA 2L7EA 4RFOH 3QWQB 4FLQA 3QRFM 5KSBF 2UYLB 3QIWB 3MOAL 4N1HB 4NQUA 3HNTH 3CVIL 2BIPA 2OQJA 4DEUA 1GGYA 2HRPH 4YQXL 3FOMB 4ZW3A 2WN3A 3PQYB 5CO1A 1KIPA 3FQWA 1U8NA 2A73A 1B3IA 1MAML 1RCYA 3I9IA 3PJNA 4YSCA 2NLJB 4FRWA 5JORA 4MFHA 1S3KH 3QIUD 5ETUB 1TTBA 2B1OA 4UT9A 5L88L 1GGCH 2JQAA 2BJML 4PYHA 5TDPA 5EUOE 2ZXBA 2MMXA 1TYJA 2RD0A 1E2ZA 3DBSA 3V4LA 5GJTH 4NLAA 1D3CA 3L1FA 3CVBA 3EYUH 4NN7C 5FUCE 1GKOA 4G7VH 4XCEB 4NHUA 1F58L 1C5BH 3WHE0 3QXVA 1GYAA 4D9QD 3UTTA 4PWJA 1EO5A 4B53A 4M5TA 4R26H 4H88H 2XXCB 1U3HB 3G6JA 4KK8C 3PGCA 3UTZB 4Q9RH 4Z7WF 3BAXA 1CJYA 4HWNA 2FRGP 2VDNB 3G6AA 5H37A 5F7KC 2Q9OA 2EC9T 4Z7VB 3KVDD 5ACLA 3IF1A 2VLLA 5C0GA 2ZWSA 2LABA 3M1CA 3CVDA 3O81A 2XETA 4LL9A 4YSUA 4LCIH 5LO7A 2W38A 3AU1A 3G5VA 3IDYB 1KFAH 3UH8A 2CPUA 3O9WC 1KT2A 2XQYA 4EN3C 1FFNA 4X6DB 5LB1A 1J1XH 3ULVH 1LE9B 1AQHA 4M8QA 4XNUL 2WVVB 4PRHE 4TUJA 5BRZA 1A7RH 4RFEA 1MFEH 2JELL 1YCSA 1F3JB 4I9XA 5B3JE 5F7HA 3VXQB 2WQUA 4DF9A 3CDFA 5BS0E 3UJTH 1UOWA 3FAWA 4NPYA 4BH7B 1FL5A 3GMQA 4HK0A 5F9DC 4PJGB 4NN5C 2DJUA 2MKWA 1NLBH 2VMFA 4NP9A 2WIMA 2D7NA 4N8CL 4MNGE 1BEYL 2OTWA 3VX0A 4OUUB 1JS4A 4PVBA 1JDDA 3H56A 3T4AA 4XPBL 2HWZL 3KYNB 1X7QA 5B7MA 4CBPA 3TA3D 3V7AE 5CZVL 3TWCL 2YPVL 3ESPA 4PUBL 2VMCA 4WFFE 3VGAB 4OFPA 2JCCA 3DX6B 4OZGB 4WVRA 1F56A 2MQ0A 1ONQB 1QHPA 4OLUH 3T2QA 2P8LA 4ZMPA 4FZ8L 3SO5A 1Y7VA 3TFKC 1BG9A 1FFPA 1N8ZA 1UWXK 4R7XA 1PAZA 3EDJA 5D7LB 3HZMB 2WIIB 4GBXC 3B7TA 3GLAA 5E5MB 4KRNA 3EFDH 2C9QA 4NT6A 1PJWA 4F1SA 4Q9QL 3FAXA 1CFVL 1ORSA 2H4EA 4B97A 5IVNA 2VDML 4P2AA 4Z3FA 5I76A 2LVCA 3NSJA 3SOBL 1ZV9A 2FL5A 4D0CA 4EOWH 3G6DL 1ZSDB 1KXHA 5IBUB 1KCVL 4ZSOA 4WW2F 5EOTA 1Y1DA 4F7MA 2VR9A 1PY0A 3LAFA 4MYPA 1XTLA 2CUMA 2NXZD 4YDKL 1OGAD 3MCKA 1IM3A 1S7TB 2E9WA 1PZDA 1QPPA 3CFKB 4FQXA 1CFBA 2XV6B 1NFDA 5IR1A 2W1NA 2BIIA 4M56A 1LL1A 1MREH 1IKNC 3ORJA 4DT2A 1VZHA 1U92B 3UBXA 2NW2B 5E94A 2QELA 1FE8H 3N41B 1G7MA 4LPYA 2W0FA 4XNBA 3VRLF 3FXIC 1M1XB 3MV8D 1TZHA 1J0ZA 3QULA 1UOVA 3GXPA 4F3FA 4Q6IB 1NL0L 3VG9C 3SGJA 3QUYB 1IGFL 5CNHA 5DEGB 5GRJL 5I1DA 1FPTH 1QA9B 3ROLA 5AUMB 1BV8A 1IGIL 1MHPL 3CXFA 4Q2ZB 1CI5A 2NRDA 3AG4B 3MRJA 1MKFA 3QZOA 4JO2H 4BFEA 3HG0A 1S7QA 3KYMB 4RQQB 5E9DB 4YZWA 4AIXA 3IGAB 3ALWA 3PWPD 3WAJA 3B7SA 3P11H 3FO0H 1N6QH 2YGPA 4BFOA 5BPPA 4N0CC 1DBAH 2VXUL 5E1AB 3RRQA 5LBSL 3ECBA 1NC4A 4NM8L 2WQAA 3UGUA 5DC9B 3QI9C 1PG7W 2WXOA 1OD7A 1T2JA 3AXLA 5GGUA 3IBEA 3EGSA 4WO4A 1R19A 1ICTA 2QEJA 3DI3B 5GSRA 1T83C 4FABL 1EO8H 1WUNT 4MA7H 3RPIA 4TUKL 1QLFA 1KTJA 1ADQA 2Z6FA 4ZD3L 1IO4C 2KUTA 2IG2L 1XXFC 3V4VA 4KO9A 4MXVF 5T8IA 5F8QC 3T8XB 1AD9B 4IGBB 5D70L 4RX4A 3ULVF 3D2UB 1NBZB 3TT3L 4L1DA 1L0QA 4Z7QB 4LLAA 3TNNB 2XWTA 4L8CA 4OV5B 5HYJB 1K2DB 3VJ6B 5C0NC 5A2LH 3HG2A 4X9BA 3TBWB 2B1AL 4L5FE 1C7SA 5JHMA 1HT6A 2B9BA 5SWSA 3UROR 1PKQE 3RL1A 2EVJA 2BNQA 1EEQA 4NRZB 1EXUA 2K3HA 4NUGH 1GZHA 1O5DT 2FJGA 4L4VB 1FH2A 3I6LD 1G9NL 3MJ8A 5CJQH 4DK6A 1T1ZA 1E6JH 3GJEB 1AP2A 5FCUL 3P0GB 4JQXA 2JIXA 2UZIL 4NQCD 5HGAB 1DVFD 3CE1A 4OCYH 3Q9QA 1I9JL 4TMPA 5GS1C 2A7BA 2ARWA 3OG4B 3CSTA 4OQTH 1YN6A 3B8SA 3SE4A 2OXGA 2AJVH 4KK8D 4HIEA 2IIJA 1U41A 2Y5QA 5DFTA 4JRXD 4JEGB 1QSEB 5AW7B 1LO4L 3DUHA 2DQTL 2EDXA 1BXXA 1DVXA 2O4EA 3GK8H 4HMCA 4QYAA 3F6IA 3NTCL 4E9SA 1LEIA 5IG7B 5LGYA 1OAYL 4IKNA 5I2IB 1NBVH 4P05A 1F6LL 1D9KB 2R2HB 2DQDH 3CVHA 4JGUA 4S1SL 3ET9F 3VWKA 1DO6A 5ISZE 4V1DD 4F58H 5T1KA 3AU0A 4WWNA 1BD2A 3EO1B 4XH2B 3LXBA 1EAJA 2OYKA 2WWKO 2IH3A 3Q44A 4CVXA 1TR7A 4W6XB 4D7PA 3ARTA 4HBCL 2XN9B 2EIKB 4XP5H 1KLUA 2UY6B 1SY6L 3F7QA 1MJJA 3T1WA 1BGXL 4N0FA 5KVMC 3U9UB 3LV3B 4LVHB 4MXWL 3D3VE 1CR9L 2MIZA 4FXLA 5JW3H 4JX0A 4JPSA 2WO3B 1OARL 1V3LA 3DUUA 3HZKB 1KGUA 4Q4EA 1SXNA 5FUZH 3LNGA 5C0AA 4P59H 2HN7B 3LKRA 4OY9A 4UM9B 4OZFG 4XMKH 3GGWB 4R4BA 3L45A 5D7JC 3L5XL 4FQQB 3SE8H 4ZJ9A 4LRIC 4DW2L 1MCWM 4FNRA 5HHVH 5FCSH 3BT0A 4RRPM 5AAWA 5D6CB 1OGTA 1KY6A 1Q0YH 4Y7MA 4PJDE 3MRDA 4DQOH 1NCBH 4OI7A 5ITBL 1KB5H 2GK2A 3BZDA 5F89B 1FZJA 3GSVA 2WLYA 1Q4NX 3ZDZF 1S7UA 3MLXH 1XZ0B 1YPZE 1L5GB 1R3LB 4GBXD 3RVVD 4PCYA 2VC2B 4XO9A 4YGAB 5C70A 4GW4B 2D9CA 2JB5L 1AGDA 4G11A 3MLZH 4MNHB 1Y0LB 1GR7A 1ZWIB 2NY2B 1FZOA 1TYRA 4OLYL 5KBKA 4WU5B 3AMKA 4JQVC 2GHWB 1IGJA 4P5TB 4NHCH 3ABKB 3MJ7B 1GYUA 1BLNA 3HLAA 2PWDA 4JPQA 4CRPA 2ARJQ 1M7DA 3BEVA 4QD2E 5DHYB 1T22B 5LGHL 3LZFL 3NPSB 1U8PB 1IKFH 4YVNA 5FYLL 2Z91A 4AQAA 3VFWB 2GSMB 2YPVA 2R29H 3JWOC 3DIVA 3SDDB 1S9XB 4YSPA 4OJFL 5ADOL 1YN7A 1Y6KR 3VFSA 4OB5L 3UAAA 5DEJA 4TOYL 4LLQB 2TRHA 1PYWB 4ZMWA 4PI0A 2VT0A 3IFLH 3JV6B 3U30B 5D7SH 2E7MA 3UG4A 4G9FB 1O7SA 2YMXH 2VJXA 3D51A 2ATPB 4PWKA 1Z32X 1A64A 5KVFE 4NQQA 3ZTJH 3DMMA 1JPFB 1D5BB 3B9DA 4UQ2A 3T3PB 4NO0D 1U8QA 4L0PB 3MV9B 4DP0X 3QI9D 1TU2A 4PGDA 1HHJB 4CGTA 1PEZA 1MOEA 4NKDB 4WHYH 3MR9A 3NN8A 4QT5B 1C16B 2ZXGA 3MLTA 2X88A 3CFNA 3MLSH 3UZEA 1RIUH 4NP4H 4ZX6A 1C1EH 1JHTA 4XVTH 2X4PA 1A9EA 2YJLA 5HDBB 4G7YH 1K8DB 4N20A 1EJOH 4LBAA 3GMRB 3K8LA 3BXNB 3KLLA 3QXWA 1TQCC 5HHPB 1F11A 5FPIA 4NIYE 1UB6B 1QVOB 1FQ9C 3ULUC 3Q7JA 4N6RA 3FQYA 1EWHA 2BZDA 3HB3C 2EVGA 2HFEB 1SYSA 2IAMB 4XMLH 5C0ND 1R3IL 1DBMH 1YEJL 1MAKA 2DJ4A 1KGCD 1OPGH 2R2CA 3QJUB 4FG2A 3QZWA 4MZ3A 1F3RB 2WNXA 5TJWK 4AG4H 3IMUA 1AXSA 2YA0A 4M7JH 5E2TH 2IDQA 5DZOA 3NCBB 2ZAGA 4HIJB 3O8XA 1UJ3B 2EINB 1NM4A 2GCYA 3TTSA 4F2ME 3TEYA 2V8MA 2EYSB 2XTJB 4QI3A 3FSAA 4ZI8A 3FTVA 1H8OA 3QSKB 1IC7L 2LQRA 1Q8MA 1LK2B 2XBDA 2D31A 1L6PA 5DJCA 2OYMA 4LOVA 2HVJB 1A8JH 1J48A 1NC2D 4UIMB 4UOW0 1NGQH 3NJHA 1WFOA 4KVCL 3QORA 1DVYA 4WCYH 1YNLH 2VXTH 1RIHH 4MA3B 4J3TA 2X05A 4FQ2H 4L4JA 1OD9A 3A6CL 3V4PL 2AQSA 4JPWL 5IMMB 2XSKA 3FKUS 4ZUTA 1JK9B 3MJGX 4DP1X 3GNMH 2BY0A 1KCSH 5LXGH 3CPUA 4OAWA 1S7WB 1KPUB 1WBXA 3AY4A 3DVGA 1YMMB 4GB9A 1EIBA 3P9MB 4A2EA 1CD1B 2AEOA 2ITEA 4FOMA 2CJUL 3IDMA 2EC9U 5L2KE 5IY5B 2ADGB 3LZQA 4UDUB 4DAGH 4H8WH 2X4QA 4KRLB 4K07A 1IJ9A 2GKIA 4KK5C 4R8WH 1X5YA 4WGWB 3TH2T 2DM3A 4LCYB 2HKHH 4OKVB 3VXUA 4TTGA 3HFML 2DJSA 4L4TA 1Z1WA 3GJFB 2AERT 3MRBB 5D7IB 1KCWA 3J27A 1KTDA 2HP4A 2WINA 2QPUA 5AAMC 5ADPL 3WD5H 2YC1A 1QFUH 4LSUH 4YSEA 4LKXA 1OY3B 2Z1KA 3L4TA 1KEGL 1UB5A 2PP9A 3PWUB 1TLMA 4FLOA 3JXAA 1U8LB 2WLJA 5D7JD 1RJLB 5K33A 2X53A 5JPNC 2FX9H 3CN3A 3Q1EA 3WJJA 1OZUA 1R4XA 4XBGB 1MW1A 3EFFB 4N8VB 1A3LH 4PJ8B 3T04D 3EAKA 5HHXH 2CHXA 5F7EL 2BXYA 3ENEA 2IMNA 3L48A 3KS0H 4HWEH 4FI8A 4NO2B 4X2UA 5L9DH 3QQ3B 1F1AA 3QJZA 3RWJA 1J8HE 4JREB 2NYYC 1DLFL 3K4ZA 4J2QA 3KYKH 1WFIA 2NT0A 1XR8A 4JVPA 3BPCB 5IJBC 4A04A 2OMZA 4FFZH 3VSVA 4Y4FB 3EZ8A 5AVRB 4A2LA 2AK4D 1BAFH 2Y5TA 2ZCKH 3BVVA 4IU3A 4YR6B 3IFPA 4H40A 4HCIA 3X17A 2CALA 4H8QA 5ANMA 4N26A 4UV4L 4H1LG 1QSFE 4M1DL 3QBTB 2XC8A 1QSVA 5E1HB 2NQ3A 4YO0B 2CNZA 4AENB 4JHVA 5E4AA 3RFZC 1AI1H 4K7PH 3VRIB 2F7PA 3ECVA 2WZPD 4D9RE 3MRKA 4ONOA 4KMQA 5DUPL 4I5BA 1CFMA 4IIQC 1ND0A 4JPKL 3AQXA 2JI3A 3VXTB 4WFED 1K5NB 3OBAA 1BF2A 3OMZA 4F5CE 1MW3A 3OG6B 3ALXA 1BZ7A 3FQ2A 4ICXA 1COBA 1JPST 4XCNA 2H32A 5AG8A 2QTEA 2WCSA 4FYQA 5DQ9A 3VI3A 1HESA 1LNUA 3CFMA 4GMSH 4NGHH 3B6SB 4N2FA 3X3FL 3T0EA 2YARA 3H42H 5CHNB 1JNNH 4MCZB 5J6HB 1QD0A 5BO0D 4QHMB 5CJBA 5K69A 4UQ9A 4G5AA 4CN4A 4ZODA 4OZHE 4WY7H 2G3MA 1SHMA 2ENSA 3OXSA 2YPLE 3N50A 1MUJA 5H2BA 5BZZA 1JRHI 2WN2A 3BP4B 2ZCZA 2CK2A 1TFHA 1FF5A 1YY8A 4H44C 1QUPA 5TE6L 1A22B 4N2AA 4AM0Q 5BO1H 2KYIA 2YKLH 2UY7B 2C34A 3QNZA 5E8PB 3OKLA 1JMXA 5G4MA 4HEME 1ZIBA 4Z7AA 1F5WA 2G75A 4WWKA 3STZB 3OKDA 3VAEA 1V27A 4O51B 3ULUD 5I1EH 1T20A 1Q0XH 4LZKA 4M48H 5JTWA 1W72B 3HB3D 1FNHA 2VN7A 4S0TD 3ZKQD 1VEOA 2FECL 4HK3J 4E41A 5DHXB 1QRKA 3PP3H 4K2UL 3GSUA 5K39A 3V6OA 3PLYA 3WO3B 3K2UL 5D8JH 2C3XA 3V6FB 4ACTA 2IF7A 3GSRB 4PV8A 4YHYC 1MLCB 4W81A 2YK1L 4NRXB 5MEPB 1M42A 3KG5A 1OW0A 1WCBA 1BQSA 3BQUB 3GMMA 2DQJH 1RULH 4A63A 5GGVL 3U4KA 3QVAA 4MJ4A 4C56E 2N56A 3B3IB 3KMDA 2PYFA 2FIKB 1OHQA 1Q38A 2O5ZH 2V2WB 3PL6C 2QQLH 1YEDB 4U1KB 5DD3L 2BVUA 3L9YA 1HH9A 2NW3B 3G5YB 1S6NA 1ZGLB 1OAUL 3V0WH 4WTXA 5TQ2L 1A4JB 1XF3A 1RZGB 1A1MB 5HHME 1GY1A 2BO0A 4FGMA 3U4AA 2GYSA 4WKZB 4LLDA 2R4SL 3S48A 2V2TA 2V7NA 4QOKA 4NQTA 4GG6A 2B5IB 3DRQA 3TCTA 4WEMB 1JVOA 4NERA 3HI6L 1F4XH 4OT1L 4RISL 4U33A 4UT7H 5J13C 3RAJL 4AQ1C 5D7KD 4LVOC 5IQ7H 3T4AC 3ETSA 1O9ZA 1BZ8A 1BW8A 1J0JA 1GGIL 3L2MA 1QYGL 3MNDA 1EHLH 3BOVA 1LLAA 2DQGL 3ZE2F 4FNPA 3MACH 4L3CA 2WCGA 2IMMA 1T5XA 4HDIA 4TQPA 5D5MA 2C5DC 4KK5D 3RNKA 4HJIA 3HS0A 3DC0A 1VFMA 5E2VL 3X11B 4B5EA 2PXYB 2WUBL 5D1QB 2J1ZA 1KPRA 1ZTXL 4HGWA 5T3XE 4L9LC 5DXWA 4MRCA 4OBRA 3EUDA 3HHSB 4MAUH 1SEBA 4JQIH 4P48A 5IK3A 3GXIA 1RMFH 2BCKA 4U6XB 5KVDH 3JWOL 4ICWA 3FONA 4X80L 1KLFA 3WFBL 4LXFA 4OTXL 4XNQB 2IVFC 3O6FC 3D4CA 1E5UI 1A7BA 1FYTB 3U46A 3DGDA 5C3LD 1KMGA 4G3YH 3ETBF 4KXZH 2P8MA 3OMIB 1LO5B 3QDGB 3C6LA 3QNYA 3LSOA 2J2ZA 2CDFB 1F4WL 4PB9L 2IANA 4CADB 3NPZB 1O7DC 2DQCL 4KK6D 4XC3H 1IE5A 3KLAA 4GQ9H 4JHWH 4BSWA 1MFDH 3VA6A 1QBML 3ILQC 2CQVA 2XPZA 1V3MA 1R5VA 4FQXC 5I6MA 3K6SB 2FSDA 2NYYD 4GEJA 4JRYE 1YEFL 4XP6H 3QUZB 4PVMA 4K3JL 5F9OL 2JWYA 4XPHL 4JY5L 5AW5B 1RPKA 1E2WA 1WWCA 2IPKB 3ELAT 1KBPA 2YN5A 1I7TB 2DQIH 1G7HA 1I1AC 3EF7A 5C0BD 2KERA 3IU4L 5GGTH 5KSAA 3M17B 3CZUB 2FATL 1HYSC 3EH1A 3M1OA 4G2AA 4QRPD 4X4YB 3CX2A 2R0WH 1EZVY 3SGJC 1RZJH 1JGLH 5C6TL 1A6VH 2PW2A 4JDTL 5DA0B 4KXDA 2XICA 3R7QA 4ABUA 4XVJL 4XO5A 3UACA 4YDIL 2JK5B 2EUXA 1I3VA 2ZWYA 3GSQB 3KPQA 4GMTL 2DQEL 3QFJA 1Y07A 2XVGA 2YEZA 5DZ9A 5T1DL 2P48B 5IJKA 3IRCA 5HGGS 4D94A 3SQOL 3F00A 3HZ3A 1FVDB 3MCLH 2WNWA 2LU4A 1AQMA 3CZJA 5AOKA 4DCQA 3LRMA 3M45A 5BNXD 1MNUL 5BZXA 2H6OA 4FJZA 4J3VA 43CAA 1PZ5A 1U3YA 4I9WD 2YOCA 4TNFA 5EUOF 2W0PA 2DMCA 2EDYA 5FYKD 4KX9A 4PN6A 5D9SA 3BSGA 3IDIA 4KVNL 2UUDK 4DO6A 4PBWD 5FIEA 1EHNA 1NLDH 1HE7A 3RDJA 3VQLA 5EULV 1A0QL 4Q9BA 3SGKA 2GQHA 2OCCB 2AGJL 2CDGB 1M6OB 2IXQA 5ESVA 2EYRA 5EOCJ 3KBEA 4B9YA 4A38A 3OF6A 4J12A 2J12B 1W15A 1XCQB 1N7MH 2WUCL 2E59A 4YHLH 2MNUA 3WTXA 1UOLA 3FH8A 3LVTA 5I74C 5TFSL 2EACA 1E50A 3F7VB 5T5NG 4A2MA 4POUB 4W9ZA 1ZHNA 2BWQA 2QLYA 3Q1SL 4OQTA 4JO5A 4TKWA 3UYRL 3C87A 5KS9A 5DGRA 2E86A 2YBGA 1WAAF 3SKJL 3H53A 3HMWL 3RKDD 1KTLB 5CD3B 3CFEA 2A74A 4R2GB 3QG7H 4F9PC 1YYCA 4NNYB 5ELIA 2A6KB 4URTB 3ASWA 3MX0B 4JQXC 4Q6YA 4OLWL 5FAAA 1MPAL 2PCXA 3UTTD 2R2BA 4DUXA 2J56A 4M1GL 5IV2B 4JN2A 2FBJH 4ZZFA 4FQIH 4ODHH 4LCCA 3SE4C 1YEGH 4PJIF 4Q97A 2X42A 3P0VL 2R1XB 2A5UA 2WBJC 1R5IA 3NQIA 3RGHA 4JHBA 4ABQA 4L5FH 2NUTB 4KDVA 1WQVT 4HIIA 3VMOA 1MXGA 5D2NA 2X2HA 4LAQH 4HALA 1UQSA 1F00I 3RB5A 3K6IA 3SDXF 3NCJL 4I3SL 2YEQA 5IJVB 3P0YH 1H3PL 3CUPB 5EZJB 2YGNA 1VHPA 2R15A 2E3VA 1IAIL 5E6IA 2AEPL 3PFUA 3WLWC 1O9VA 4MNQA 2CJSA 4HQQL 4NYLA 4NX0A 4YBQC 1WWBX 5BRZD 3W9EA 2FJSA 1AC0A 3NCEB 3PAUA 2EDRA 1U0QA 1YNKH 4N8VG 1QX1A 1N3NB 4WWPA 5EA0H 1RZ7H 1FO0A 2BP5M 2OMWB 1DVQA 3N42B 1SMDA 4FKKA 5G4OA 3BLBA 4DP8X 2ZE0A 2WGXA 2PWGA 4G8GA 5MEOB 1KIQA 1SJEB 2AI0H 3ZZLA 5FO8B 3LHPH 3SYCA 2FSEB 1JVKA 3FHEA 1V05A 3N9GH 1J88A 4S2SB 4WU7A 5GGSY 2BSRB 3HUJE 3O6KL 4HUUB 3NAAL 1KACB 4K5PA 5DRZB 1LP9B 3UDWA 4Z76B 2B4CH 4ZAKA 3L13A 4TRPH 1BYNA 2A4CA 6FABL 1QOKA 3KJ4C 4OLVH 2E75C 5T1LB 5AAWC 4NSKB 4QRSA 2GJRA 2EUVA 4BFBD 3B9EA 3DUSA 4E68A 3F04A 1K85A 1ZS2A 1U3ZA 2Z31B 3OB0H 2X3CA 1HTYA 3TJPA 3N91A 3A6BH 1QUNB 3VW3H 3KYOB 4WV1B 2CRYA 3JWDC 2EDEA 4OJAA 4XN2A 3KPRB 4DOHE 2AV1B 2WXQA 4UZUA 2VJ0A 2NYKA 5FM4A 5FYJL 1T0PB 4EJ1C 2O5XL 2R1YA 2R29A 4QLRA 2E74C 2OA9A 5AW1B 1O75A 2VDMB 3MJ9L 5DJYB 4KXAA 4GXFA 4EIUA 3VXNB 4LLVB 5AZ2H 5E0FA 2OX5A 3K46A 3MNVA 1NCJA 3NVQA 3VDAA 3VFTA 4KJQD 3BN3B 4FX5A 2J1YA 5C08E 1IM3D 2MQ3A 4NZ8A 5FO9B 3RWEB 5AZUA 4X7TA 3ILQD 4FQXD 4DKAA 1J5OH 1KPVB 1VB9A 4KI1A 4ZMQA 1GC1C 1IC4H 3MODH 3N5AA 3FUHA 4UUJB 5D2LA 1A5FH 3NDYE 2YMTA 4I48A 1Q72L 1RLBA 1ZLSH 4QRRB 5IIEA 5DUJA 4MWFA 3IPFA 5I1KH 5JUEH 1IV8A 1AG0A 1SVCP 1HYSD 3WSQH 2YD5A 2W95A 2GB2A 4BINA 3DHJA 3QIUB 1T04A 2XQYG 1E5AA 5JW5B 4TUOA 5BZDA 2DDQL 3WIFB 3BAYA 4X9YA 3V7MA 1UM6H 1EH9A 1NDGA 3SD2A 5HJ3B 3HW7A 3DMMC 2KPNA 2WXLA 1L0XA 3U1QA 1T5WB 1BBJA 1DCLA 4JR9L 3V0FA 3L16A 2Y23A 5T5FH 4B6ZA 3IRPX 4JG9A 1MFAH 1RY7B 1SNRA 1PD0A 1I3RA 3POHA 1KYOJ 4OZIE 1WH0A 5CEZE 4WI6A 3CZFB 4ZS7L 2F7QA 3JTSA 1JWUB 1LEKB 3AABA 4I1NB 4QO1B 4RRPA 5T3ZE 5J11B 5DEFB 2HJFA 1OF2B 4FFYA 4WNQA 5EO1B 2VISB 4AIZA 4K3DH 5J12C 2P80D 2V5MA 3C60C 4LE8A 1EXGA