3WU1A

Crystal structure of the ets1-runx1-dna ternary complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
123
structure length
123
Chain Sequence
b'LADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 20
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wu1A00
3WTXA 3QYNA 4A63A 3VD2A 5AOKA 2IOMA 5LAPA 4L0ZA 2J1YA 1HU8A 4MZRA 4AGNA 4IBSA 3Q05A 3WTYA 2J1ZA 4IBZA 3Q01A 4LOFA 5G4MA 3US0A 2IOOA 3D06A 2X0VA 3US1A 2YBGA 4XR8C 2ATAA 5ABAA 1EANA 2BIQA 4AGOA 2BIOA 3WTVA 5AB9A 4IJTA 5ECGA 2J6WA 4G82A 1GZHA 1EAOA 2PCXA 2RMNA 3D0AA 1HJCA 3TS8A 5AOIA 2MEJB 4GUOA 5G4OA 1E50A 1TSRA 3WTUA 1LJMA 4L18A 3KZ8A 2X0WA 5G4NA 2J20A 1HJBC 2OCJA 3QYMA 1EAQA 3IGLA 3D07A 1CO1A 3D05A 4G83A 4IBTA 3VD1A 4IBYA 4MZIA 2H1LM 3EXJA 1H9DA 4AGLA 5KBDA 2IOIA 5AOLA 1CMOA 4AGQA 2BIPA 4AGMA 3D08A 4IBWA 4AGPA 3D09A 2XWCA 1T4WA 3KMDA 2AC0A 5BUAA 4QO1B 2J1XA 3VD0A 2ADYA 4IBQA 2X0UA 1TUPA 3Q06A 2BINA 2GEQA 4GUQA 3WTSA 2J1WA 3EXLA 5LGYA 1IO4C 2VUKA 3WTWA 3WTTA 2BIMA 1YCSA 3IGKA 2AHIA 4LOEA 5AOMA 2XWRA 3ZMEA 2FEJA 2WGXA 4HJEA 2J21A 4LO9A 2P52A 4IBUA 1GZHC 5AOJA 3WU1A 5A7BA 4KVPA 4IBVA 1KZYA 4L0YA 1UOLA
chains in the Genus database with same CATH superfamily
4LQFH 2EVGA 1PZ5B 2V4LA 4XCYB 4JQIL 3D30A 3K0YA 1KTDA 1BVKB 5I0YA 2ZOLB 3D34A 3RHWF 5C6PB 1UWGL 2VDOL 5B21A 1GMIA 3CHXA 3L45A 4K9EC 4PGCA 1ZLVK 2MCAA 2B08A 2FYVA 3LV3A 2X1WL 5I17A 2OZ4H 1MI5B 1GL4B 3BUYA 1ACZA 1ACYH 1AKJB 4PJAB 4QTIL 3AACA 3CFKA 1VEMA 3B8SA 1TJIH 3E9UA 1JDAA 4QRUB 4Y1AB 3U0WL 3ZYJA 1PCSA 4JFEE 4HUVB 2IGTA 4PGZA 5INCB 4U3SB 3B37A 5I9QB 5CLYA 2X9WA 1IQDB 4BH8A 5C0AB 5DR5L 5KVFH 2EIBA 3S36X 5KBKA 3WUZA 5E7FA 5IB2A 3NCEB 3O2WL 3QUKA 3C6SA 4L1LA 4LCVA 5DRWA 3W1ZA 4DTGL 4MJ4A 1KPVB 4RMBA 3SGKC 2HTKC 3L7EA 3MUJA 1IZJA 2WZAA 1OAXH 3ZUCA 1FZOB 2FEEI 2DQUH 4PJDB 1UG9A 4AENA 3EG9A 1INEL 4NNYA 1QWHA 1KUMA 1WA1X 3GPSA 3IE9A 3SKNB 3W39B 4Y19D 3SQOL 1JOIA 2WTOA 1E43A 3KH4A 3P2TA 3QIUC 4P8QA 5AOLA 4JDZB 3VA2C 2AV7A 3V0IA 3LKSB 1A25A 4NEHB 5KYWB 2FJGB 4JZJA 2FLBT 1ZJAA 1AR1C 4EIBA 1PBYA 2UV3A 1U8CB 4N2LA 4NQUA 1PY4A 4NO0B 4G8EB 1SHXA 5D7LD 4WK2B 4WVRA 1QR4A 2FTAA 1AY1H 4Q2ZB 2VQTA 3JWOC 4XHQA 1JGDA 4RVBA 1DN0A 3CZJA 2NT0A 5EO0A 5CZKA 1TKWA 2J1WA 5E8NB 2C9SA 2EVHA 2BMKB 4QXGL 5E24E 1G6RL 1RLBA 2O5XH 4Y7OC 2YUVA 1FFTB 2ZAHA 5F93C 1OZTG 2HJKB 4ZPVA 3BKYH 3R0MA 1FL5B 4JHBA 1NBYB 2A0LC 3RDTA 4XN8A 4TVUA 5FO9A 1N9PA 1RPKA 1ID5I 1P1VA 1QLRB 4NQSB 4I85A 2LW3A 1DLFH 1KTKE 2XWJB 2VAAA 5DYOB 3Q5TA 4JO1L 4RETB 4EI6B 4HUCA 4UDTB 5GS0H 4UV4L 2VLJE 4AVIA 1ZWIA 4M29A 2ZIDA 1QQDA 2F58L 2LU3A 4FFYH 4PSPA 5CIPB 2C9RA 5BW7A 1XGUB 1MRFH 5B8CC 2FD6H 2ERJB 4EVNB 1QBMH 4MD0A 1CICB 1PPIA 4HIEB 1T5KA 3RE0A 4OQ1A 4P57B 3LNEA 5DUJA 5G4MA 2DMBA 4RGNE 4BWWA 1S9YA 1THAA 3VW3L 2ZPKL 5AB1A 1KLFA 5DJ0A 3UPCA 4XWOC 3HHSB 4QXUL 1IBYA 1KYUA 2AKRA 2EECA 4N3TA 1G87A 4RNRA 3AS1A 4JZJC 4XMUA 3W11D 4AC4A 4JK0D 5E94B 4QHKI 3ZTJG 2DBLL 1B9KA 3LEYL 4L9LA 5CILH 4TOYL 1A9VA 3MNZB 3JV4A 3P4OB 1AJ7H 3FJTA 3L81A 4LLMB 2H8PB 1MFNA 4GXUN 5FFLA 1ORSA 2EZ0D 5DF0A 3STLB 5IMOB 5J5EA 4L4TB 3MQIA 3PGCB 4NC1C 1ZHLA 3L4ZA 4KKZA 4RX4A 4YL9A 3ATAA 3OLIA 5DUPL 5EU3A 2YGNA 3PP4H 3O2VL 2YPVL 1PZDA 5IB5A 4KWUA 3WY2A 1MF2L 1AS7A 3BDYH 5JQ6L 5FPIA 3RDTC 1IEAB 4UOW1 3SKMB 5KSAA 4PJBE 2Z0BA 4AGLA 4NWTH 4HWZA 2WXOA 3KPOA 4AZ8B 4N6RB 1A3LH 3TEUA 1TJXA 1WGVA 4GKSA 5KTEL 3EJSA 2NX5E 1AP2B 1WS8A 3TBVB 2OMNA 4CC1A 4KV5F 2BK8A 5CEXB 5F70A 3W9DA 2EE2A 4TMPA 2ZWSA 1FH5L 2B1HH 5BW7C 2YA2A 1XB6A 3FYEB 3Q06A 3KR3H 3QIUD 1TTFA 1WF5A 2BSED 1T5WA 3UO1H 3O4LE 4N0FB 2JJUA 4PJBF 1O6SB 5T1DL 1T1ZA 5J6HB 1AR1D 3BDXA 3GMLB 4YHNA 1OHQA 1UD8A 3FT0A 1ZLVH 3UAJD 4KTEH 4KZ0A 4OM0L 2ENYA 2CGRH 5D9SA 2XZZA 3WLWC 3JTTB 4L9LC 2PR4L 4UAOB 1NA8A 15C8H 2XWBB 5DURB 2G30A 1UJ3B 3DOHA 2AXGA 3UZVB 4A38A 4HJEA 4PRIA 4WI4A 1SOXA 2X4TA 4MAYA 2IJ0C 4HFUL 3K6SA 1B0RA 1I85A 1JZ3A 2OYPA 3GRWA 4JB9H 4KK6C 4OZ4B 1AACA 4YHLH 3U6XA 4JREB 2IANB 3NTCH 4FRWA 1T66C 4OCSH 4YC2C 1NUDA 2DRUA 2CK0H 2C9XA 4X99A 2DQDH 1J5OL 3DHUA 1AZRA 2A0LD 2HVJA 4QHMB 3NSYA 1HWWA 5AOKA 5HDBB 3ARGB 1A64A 1FZJB 2F74A 3GIVB 5CGBA 2EUZA 2EYSA 1ZAGA 1SXBA 2JFCA 3T8XB 1FFRA 1DSWA 1HHIA 3DPBB 2KKQA 5KSAC 4N2NA 5TK2A 5E8DL 2V17H 1V7NL 5FS5A 1D5RA 5FKPB 4F57H 1VGKA 4UM8A 1NGYB 1Y7VA 2VR9A 3S3DB 5BRPA 2YS4A 2DIEA 3LZFL 2XRAH 2D7TL 2J2ZA 2XYBA 2ZOWA 3VXUE 4Z95L 4M8RA 5DC0A 2V7HA 5EBLA 3VH8B 4KRMB 3LN5B 1BFOA 3MV01 5BZZA 5I5RA 3FCSA 3ZT7A 4H26B 3L3DA 5G55A 1GH7A 1ZV5A 5JO5A 1BFTA 4N2KA 4WFED 5I75C 2X0WA 1GAFH 4JFHD 2I27N 3LN9A 4HU2A 2ZJSL 3P54A 2J4WH 4OVUA 5DVOA 2VDPL 3LB6D 4RISH 4X6EA 3FBKA 3FQ1A 1P4IH 4N1CA 3VGBA 1BQHA 2C3VA 5K39A 3DIFA 4MAYC 1TNNA 2J73A 3VSTA 4K2UH 5DWPA 5FUOL 5DMKB 1I85C 1U3HB 3D08A 4YHIA 5M94B 1QW8A 3GRGA 2F18A 4GI6A 3WGVB 1OWWA 3ZL4L 3NRPA 1DVFA 3OJMB 1WZ1L 1IZKA 1V54B 2F7QA 3NVQA 4R7NA 4G7QB 1X7QA 3TN0B 3BGFB 2M1KA 3RDTD 1RZKH 3TASA 1IGYB 9PCYA 1DEEB 4QHLB 2VDRL 2BVPA 2IGFL 3NIDB 4D94A 2W60B 1LEKA 3BXNA 2AJSH 2BCKA 4IMKA 3VFOA 4HZLA 4JHWL 2KQNA 4WHCA 5J7CC 4JPVH 4BINA 3QR1A 5SX5K 3D87B 3WKQA 4OZIA 5CD5C 1AGEB 5IFAH 4K7PX 3STZA 2HLAA 4IMLA 2EDJA 2BDNH 5LGKA 4IKKA 2AMUA 1JHTB 2DI9A 3TIEB 1T0MB 3IETB 3BPLC 3QDME 3JT2A 2CHZA 3LQMA 1PEWA 2IH8A 3N44B 1CGUA 4DP2X 4B9IA 1VFMA 3COOA 4ZI8A 3QIBD 4IBVA 4UTAL 1M4KA 4BKLA 3CLWA 4FS0A 5T3XD 3F04A 3ZTJH 1QFUL 4Z7AA 3CDZB 3V55A 4OCWL 2NLJA 4NQVB 4L23A 4GSRA 1AR2A 3EFOA 3JWNH 1D5ZA 5EIIG 5ANME 5GIRA 1U8LB 4OFVA 2C3HA 4HCRH 3L6FA 1JGLH 1IAMA 5HP5A 2H2SC 4HKJB 1FC1A 2DIJA 1M1XA 4LZKA 4HVBA 4YSQA 2PTVA 3T0AA 4MKTA 1WCBB 5G5DB 3EGXB 4M7KL 1ZS8B 3OC8A 1NCDH 1L9PA 3FTGA 4IW4C 4QHKJ 3GSOB 2PETA 4RX4D 4E2OA 4MB5A 4NOBA 3UYPB 1DVFC 1KULA 2V0AA 2B15A 4NENB 2ATAA 2GC7C 3NA4A 3QUXB 3ULSA 2OTPA 5J57B 4QXTB 5KSAD 5DT1H 1AHWB 5A2IH 1CLYL 1JFHA 3IKKA 3PXLA 4YO0B 2ARJB 4UQ9A 4DKEL 3KXFA 1FFNB 1WFMA 2HMIC 5HYSA 1E50A 4MJ6B 3GM0A 4M7ZC 3QDJB 1E4KA 4IMKC 3SJVA 1YECL 3NH7L 5BVJA 3FL7A 3DI2B 1FVCB 1T0NA 2Y36L 4PH8A 2APTA 3FN9A 5IHUL 4NC2B 2CPCA 2XVKA 3HI1A 4PW4A 4U1KB 2WXQA 1IBGH 1AG6A 2OL3L 3DV4B 5IV2B 2VDMB 1EBPA 1RK1A 1SJHA 5IJBC 1FL3A 1H3VA 4HS8H 3MUGB 2FEEL 3O81A 1FHNA 4NKOB 2CMRL 4XVTH 4UQBA 1JWMB 5E5MA 5IMLB 5C08B 1QSED 4M43L 1OQXA 5DRZB 4TSAL 3VU2A 4RGNC 4M7JL 5MERA 4PRDA 2D0HA 3N85H 2DLFL 3PQYA 4LHQB 1ZLWK 5IB4A 5BOJA 2ADYA 4K7FB 1JXGA 3M86A 1W2KT 4Z7VE 1JV2B 2AQ3A 1FNEB 3ERXA 5GRYA 3S5LA 3VTAA 4XP1L 5C0EA 5KJ7E 5JOEA 4CADA 4HEME 4H8UA 4JFPB 3UYOD 1U4EA 4PG9A 2PP9A 1BXAA 3VXSE 1T1WA 2CHDA 4XN2A 4QKTA 4BFIB 1BZ7A 2VIRA 3PUCA 2A9BA 2BIMA 4OGQC 1PZBA 2D3JA 3W0WD 4FD0A 1EAPB 4IOSD 1RZFL 4KXDA 1WBYA 4FTVB 3P3YA 2OZ4L 3MRQB 1A9EB 3VVVA 5HYJE 4F2MB 1ACYL 1PJ9A 1A5FH 3AS2A 5J6GA 1K4DA 4ZYKB 5CJ8A 4IBLT 2XG4B 4NDMB 1OTUC 3BO8B 3FQYA 1T0OA 4PJFF 4UNIA 2DF3A 3FDWA 1E4KC 1DE4B 4N2BA 1IM9A 1HZKA 1CDGA 1HEHC 5CD5D 4NRZB 4JVWA 1ZD6A 2VZTA 4YBQD 4MDIB 5DD3H 4UT7H 3L1GA 2HRHA 1BAWA 4UT6H 4BD4A 3LKNB 2E9WA 2V37A 1Q72H 4QLWA 4KH9A 3VFWB 3NIFF 3OGOE 1A7NH 3LRSA 4NXKA 4C4BA 4CU6A 4ZX6A 1OAXL 3SDCA 3SZKC 2DQUL 1DBAH 5GGUB 3INUH 4G80A 1SLXA 5EU4A 4HYTB 4NIYE 3V6ZB 5L4FA 1KIUB 4TSCH 5C7ZA 2WLKA 3T3MB 4W9GC 4MJHA 1I8KA 2P5WA 3HG1B 2E8ZA 4H7VA 2H2SD 4LCCA 3ZVVA 2PWEA 3QS3A 4UOQA 1DLHB 2FHFA 3FFCD 4FZ8L 1ZLUH 5J0BA 1JYWA 1L0YA 1NGXA 1ZPUA 4PRHD 1FFPB 5IFJA 5A2BA 2X3AA 4RCAA 4M4RA 4XVJL 5JZ7C 4FADA 1F4YL 4QRSA 3MLZL 3ZHLA 4XNQA 1HJBC 5JNYB 3DSNA 1EVUA 1AY1L 5IQ7H 4PGDA 4JM4H 4JM2F 2OLDA 1QOKA 2BZCA 4OFIA 3ARED 3CN3A 4M48H 2E6PA 1BMWA 4B41A 3VFMB 2H9GB 4U1SA 2O5XL 4RH4A 4M8QA 5SX5H 3P3TA 2XN0A 2Y7QB 3HZVB 3FUMA 2XTJD 4KY1H 3VA6A 4NXSA 2JB6A 5EOCL 2OMYB 3BKYL 4HULB 4LLVA 4NPJA 1RHHA 4UILH 5BOPA 4GRWH 3KVPA 1QA9B 1M3IA 4ODTH 3HUJB 1CXHA 4FQXA 1Q0YL 4XVUD 5JA9A 3X1BA 3L9EA 1DLFL 1WYJA 1FJ1B 1N3NA 1OT1A 3EOTH 2R4RL 4NT6B 4WHYH 2DTMH 1AKPA 1A14L 1D9KB 1INDL 3UTPD 1YNTF 3GBNH 1KJ2H 2K9UA 5T3ZL 1FVEB 1OQOA 1TXKA 3ZE0B 1CFQB 5DDHB 5ITBL 4HFWB 3NBNA 3SDCC 3HJ0A 1GGIH 2ICCA 3LY6A 1MRFL 5CBAA 2VJXA 4UTCA 3DETD 2XQYA 5AB0A 1M6UA 3FH5A 3ABLB 4BFEA 4WFGE 4AG4H 4LCCC 3U4KA 3SPVA 4C83A 1E2ZA 1DVZA 3EH2A 4EE2A 3ZX1A 1N8ZB 2WMPB 4QYAA 2ZCKH 1J87A 4FQIL 1A6TA 4QOKA 2YD6A 1CYGA 2EQDA 2W0FA 4AGNA 3RVXD 4RAUB 2RFXB 5CILL 2NSXA 4PR5A 5A7EA 3ABKB 1AJ7L 2EP6A 5HGDB 3BUIA 1GZPA 5DRXB 1XSJA 2DM2A 5I15H 5C2BL 2QZQA 1L5GB 2A9ML 5E1IA 5JPNB 4MQTB 1OTUD 3VRLE 4HOXA 1FUNA 1M3JA 3GD1C 2BNRA 4G9FE 1P84K 4OCYL 3OKMB 1G7PA 1IGJB 3M7FB 4TVPD 5KJRL 3B3BA 4TUUA 4N8UA 3ULVF 4FCHA 3M1OA 1BXUA 3P30H 1XR8B 4J3BA 4DFIA 4FQXC 4U1JA 1D5MA 4NWTL 1TJGH 1FG2A 4NFBA 4UYQA 1NCJA 1XGPA 2Z4TA 4MMZB 4Y19B 4PVMA 5EOTB 1NFAA 4OLYL 1E2VA 4HJSA 4K5LA 3CHPA 4QWWC 3FS9A 4QYOB 1FNLA 4WGWB 1ZLWH 4L5FH 3RWEA 4L48A 4OI8A 3HBZA 1OPGH 3RLSA 2WNWA 1WAAF 4K5OA 3K1KC 4C4KT 1XGYL 4JCLA 2FO1A 4FG2A 2R69H 1ZLSL 1GC1C 1K8IB 1D5BB 1YUKB 5JHDB 5D7LB 1FVDA 3RWCB 1T89A 1QATA 2LFGA 3FHAA 3WFDL 3AVEA 4UNTA 1L6ZA 1LXMA 1BOYA 4NUJA 4PJFA 3QXAB 1UB5B 1UXMA 4ODSL 5D71L 4DP0X 1S7QB 1ZDQA 2W07A 5FYKD 2ZXGA 3O8XD 3BW9B 1CFTB 3DHPA 4AE1A 2X2YA 5FYLD 3V5HB 1H3GA 1X5LA 2Q7AA 4C56D 2DYSB 2NY1C 2DMKA 3VD7A 2I7OA 4N8VG 5IJVB 4YX2H 1NC4D 1PCXA 3J07A 5IIEA 4JG9A 4OF5A 3ZIMA 3RIAF 1A2YB 4GUQA 4MCZA 1MHCB 3FT1A 2NUTB 4JB9L 4YHLL 3VFNA 2MRYA 3BUBA 4QRRE 3ECVA 4IS6A 4L05A 4R4FH 2X2JA 2XG5A 4KGLA 1NCUA 4BHUA 2G9HB 1JD7A 1E0OB 1HHKA 2O61A 3K6FA 1JMXA 2F6AA 4JFYB 4WSJA 3QPXH 3VD4A 5BXFA 5IBLD 3RU8H 3KWWA 3KCWA 4OT1L 5H94A 2VDMH 2HRGA 4F57L 2ED8A 4QNPF 1BZDA 3ZSSA 3VXRD 4LEEA 4P46A 1E6OL 5KANG 5EPMA 2JKLA 4JM2A 3B3IB 3WTXA 4OBSA 4NLAA 1E9OB 1FC2D 2P5WD 3QCTL 1JYNA 1N67A 5HVHB 5L88L 3ILPA 2WVUA 3BCDA 4TNFA 5KWYC 4L0ZA 4JFSA 4RIRB 1T89C 3D39A 3HN3A 4NKMB 1IGFH 3HZYB 4WI5A 1DFXA 1EHLH 1L9RA 4H5SB 3A47A 1DBKH 4NQEE 4NB7A 4HUKB 4Z3HA 3CXFA 2WXPA 2WHVA 4RISL 4Z7UE 5B7MA 5BZDB 1JPST 4L3EA 4HOZA 2AK1H 4QY8A 4PW3A 4G71B 5AW0B 2FGWL 2B5IC 2W94A 5I6LA 4J1UA 5DJ8B 1YNTA 4L4JA 5I0VA 4X6FA 3LAFA 3BX7C 2JXMA 1HZHL 1LE9B 4FP8H 4K71C 4S2SB 2ZUYA 3LQAL 5L0QB 3ZXAC 3D0VB 1W72B 1F3JA 5CS7A 3HI5L 2MH4A 4GRMA 1UD6A 1UOWA 2IALB 2WINA 5IESH 5HJ3A 1TYJA 3UC2A 2WUBH 1TEGA 1RZKL 1JCKA 3EOAB 4WW2B 5IUSA 3IBEA 4FQXD 2F7RA 1JNHA 4IBYA 2R7EA 1AGCB 1MLCB 4XBPA 2VQ1A 3DMMD 4U2ZA 5E8OA 4CKQA 4LLDB 4ORGA 5FA3B 4QWWD 4ZMQA 4FLHA 3SE4A 5HD8C 1JHLH 3HCVB 3S2AA 1AS6A 1UZGA 4GAYA 4NQDD 5F8QC 4DQOH 1OAYH 5ID0B 3VCLA 4MB1A 1HQRA 3V0JA 2EDQA 1GYUA 3O11A 4P46C 1T4WA 4FFWD 3VI3B 1XMWA 2GIXA 3HHMA 4AYSA 4ZFFA 1K6QL 1RPQA 4JM2C 4LKCB 4YE0A 1T0PB 5D2NA 2CBPA 3IFPB 4ZMXA 1LE5A 3QZOA 3PNWB 3QPQC 3TBTA 1I8LA 1JTPA 1MJUL 1IBHA 4Y9BA 1HFUA 1EBAA 4JJOA 4LSUL 2ICEB 5DC9B 4PG2A 2NUPB 2VJ0A 5CCHE 3RPKA 3BSZL 3TWCH 3IJ8A 3ARSA 1MN4A 2OA9A 4G7VL 1NAML 1XBDA 4MDRA 3ROOB 4G42B 4ODUB 3BRGC 3PGDB 3S88H 1L9SA 1HOCA 3QHFH 4G3YL 2VDPB 4QTHA 3SDDD 4KNQA 3WEXB 1OD7A 2H3KA 5DRNA 1YY8A 3KAAA 3OXRB 1ED3B 3BLPX 3IGKA 4XP5H 3TNMB 5C0BA 4EI0A 2MCPL 1RXLA 4MJID 5EBWB 4YUEH 2Q5BA 4I3RH 3VRIB 3BOVA 1NCDL 1WAAA 2FECI 4TUKH 5JIDA 1OGAA 2IH3A 3DBXB 4M7LL 5ALCH 2H6OA 5E2WL 2YO3A 2AJXL 1TVDA 5BO1H 2WP3T 3MBXH 1EO8H 4M1DH 3DO3A 3KPRD 5J6SA 5ECJE 1R3JB 4OCXL 5DZOA 1SVBA 4GNKB 2ORBH 4L1SA 4URKA 1H0DA 1TF4A 1QRNE 4R4BB 5IW1A 3ISYA 3CGTA 3F3HA 3OMAB 4LDCA 3PDDA 1VERA 5C3LD 2BOBA 2DQEL 2YUZA 2YGVA 4PY7B 4KH2A 3WXVL 2OYLA 5K59F 3SE4C 1X5YA 3PP3K 2CA3A 4UIMB 3UBFA 2YK1L 1E5UI 3MA9H 3GBDA 3CVHA 1OLZA 5BJTB 1UA6L 3GMRB 2CDEB 1AXSA 5D96C 1Q1JH 2CHWA 4QMEA 1AMXA 5D2NC 5AVSB 3UP6A 4APXA 3IS1X 1RUQH 2AMGA 2Y1YA 1JZFA 3HNTH 2Y5EA 1I8LC 5I5MA 4IRZA 1JF1B 1IMHC 4HS8L 1N0LB 1ZRUA 3UROR 4U1MA 4JL2A 3UL4A 3K4DA 4HF5H 1X4XA 5JHBA 2A73A 4WU7A 3U83A 4JPWH 4PG2C 1ZHKA 4PTUB 3ZDXE 5IUCA 1TSRA 1IARB 1KXTB 1RSYA 1DBMH 3TP4A 3EYQC 3TBYB 3N85L 2EC9U 4TUJB 3ULVC 1F90L 2NTSP 1KDIA 3PY9A 3T8MA 1DQVA 4JHVA 2LLLA 2QQQA 1HC1A 1UWEL 4PWEA 3LVTA 1GHFH 3CFNA 3ARPA 4OI7A 4HUNB 2FQDA 4FLRA 3QRLA 1D6EB 1JF5A 2L8AA 4HT1H 5D93C 2JCCB 3RKDC 4F80A 4IIQA 4KROC 3U36B 5IMMB 3IDNB 1PEZA 1CFSA 2DW5A 3D09A 4JY6A 2XCMC 4PRPE 4RFNB 1ETZB 4GEJA 3FOMB 4M93B 3R19A 3GJFB 4YEEA 5DEZA 3CSGA 3A3YB 1CXKA 4GIPD 3OJDA 1TFPA 3QUYA 4XMKH 4J8QA 4HXAL 1HSBA 4XRCB 3WDIA 5BZWA 1A5FL 3VX1A 2R29A 4IDJL 4O2FB 1D5IH 2QKSA 5F7DA 2HN7A 4DT2A 3FO0L 4GAJH 3LNGA 3WE1A 2GJPA 5BQ7A 1IO4C 2B0SH 4P46D 3SYCA 4LSQH 3QIBB 1Q9OB 1AOHA 3VDAA 1DQJA 3H42L 4AQOA 4OLXH 4ZX3A 2IH1A 2OL3B 4JFDD 4ODHL 5E9NA 4B9ZA 4NQCA 4PJXF 5E95B 1G7HA 4WEBH 4DO5A 5T1KA 3SDAA 4E0RB 3TYFB 1CI5A 2WLLB 4E9SA 3WU1A 1S7WB 2YRZA 5CEZD 1UTDA 3WIHL 4AJWA 1YC8A 2ZG1A 1KIRB 4TSCL 4AITA 4R7DB 4L0YA 2J8UB 4DGIL 3BEVB 1JSYA 5GGQL 4DO6A 3NJGA 1LMIA 3HS0B 2CU9A 1MW2A 4LLAA 3BZEA 4F8PA 3FO9A 3LKQB 4ES9A 2WVSA 2Q8BH 4POZC 2H26A 2P3YA 3RWGA 3HZKB 2OQJB 3BZDA 2CRIA 3D69A 1J05B 2AK4E 2EDOA 3P77A 4IIQC 1ITCA 4TPRL 1P1ZB 4YSCA 4MX7A 1LK2A 2ZSWB 5IQ7L 2WKLA 1CD1A 4M48L 1DQKA 3BEWA 3KPQB 1VZGA 2BFVH 4NNXA 3SDXB 1YPZF 3Q2LA 1U21A 3T4AA 3QUYC 4AYFB 4EZJA 3P4MB 1EJFA 4FQLL 3VXQA 3QJFA 4NAJA 4B6ZA 4YGAB 2Q6WA 4I4WB 3GZOA 1MHEB 1S3RA 1KJMB 1RZ8A 3DUUA 3OPZL 1UXLA 2XACC 4HETA 5DQ9A 5BNXD 4UILL 4LHUD 5MP6H 3UTSD 4YHZL 3ESPA 1BWWA 2XOTA 4ZMOA 3DVNB 3ARFA 4OQTL 1QSEB 3K6NA 5FEBA 4P2YA 1JN6B 2ZOKA 4Z7WF 3X1NA 1PX4A 2VLLA 4RMRA 4WWID 2DTML 4JFOB 4K9EH 3SDAC 4BA0A 1TZAA 3NJKA 1C12A 5IG7A 2B3IA 2WWMC 4YOKA 2UZYA 1RV6X 4KKRA 3ULVD 4HUXA 5D7SL 5MI0C 3L13A 1VGEL 5BUAA 4UQ3B 1G7QB 3VWJD 2YWZA 3U4BH 2C9QA 4RSYA 1MCWW 3MJ8A 4LPTA 3U0PA 2XN9E 1F4AA 4D2NA 3ZN6A 1OAQL 2DLTA 3W0WB 2D2CC 4N8CL 4J3SA 2X4OB 4Y2OA 1S7RA 3C09C 2Z91A 5SWSE 2WY3B 2HLFC 2XWDA 4Q0XL 4U6HA 4HIHB 4Y0GA 3MVSA 1U9KA 5E8PA 4Z7QF 1W72H 3DNKA 3GMNB 4D8PB 1FN4A 1CJYA 1MFCH 3MJWA 3ZKND 2XTLA 5J06A 2N0MA 2ZUQB 3BWSA 4K94L 3WFEH 5I15L 4U05A 3T4AC 4L8SB 4FQHB 1MREH 3R4RA 1RERA 3OG6B 4NPKA 1BLNA 4KVPA 1SDDA 4MNQB 3O2DA 1QHPA 4HALA 4FYRA 5DXWA 4O02L 5DMJB 3P30L 3P9MB 3ARFC 4YDJB 5GGRY 1BV8A 5T1JA 1QWNA 1JWUA 5K9QG 3OHXB 1UM5H 3MNMA 5I0WA 4AH2A 3I2CH 3JWOH 3HC0B 4PRAB 5CSZB 4G6KH 3IFOA 3HG5A 4L5FL 3I9PA 1OPGL 4HC1A 5HDWA 1MVUB 4AVJA 3FFCB 4IIZA 3BSHA 1PF3A 4RSVA 5C09D 1LWRA 2Y1ZA 4PRHB 1DUZB 3AABA 1T6WA 3SE9H 4JY5H 1JIBA 1FYTB 1HKFA 3KWTA 4LLUA 3SE3A 1LO4H 4H0HB 1ID2A 5DHVB 3SGJA 2VL4A 2Y72A 5T8IA 1A4KA 1W9XA 3NSDA 1WTGT 2F53D 2EVIA 1OEZW 3WLBA 1ETA1 3KPNA 3AT8A 1U8IA 2VZUA 3JVGA 1ND0A 3AREB 3MBWB 4AV4A 3BZFB 3CZFB 1X5XA 1PGRB 3L3KA 3PWVA 4R97B 4FL4B 4MNGB 3WKNA 5DJAA 3N43F 3BLKA 2NXYB 3QNXB 5E9DE 4A2DA 2XTJB 1UQSA 4HUUB 4YHOL 4PJXA 3PG2A 5BVPH 4GKOA 4YX2L 1CFMA 1KEMH 2PO6D 3QUZA 4WEUD 3RVUC 2HT4D 4KK8D 5AWNH 4YDLB 4HV8A 4A7UA 3ZE1E 1P84J 4XX5A 4YXLH 3L08A 1XIWA 1IT9L 2CM6A 1U8PB 2N0KA 2OCFD 1HTYA 3C9NB 1LNUB 5ADPL 4D0DA 2EIZB 1XMEB 4ES8A 1OB1A 1IC0A 1QUNB 3KW8A 2ATKB 5DS8B 2EE6A 4RFOH 4N9GA 1G7JA 3V4UL 3BPCA 4G6AD 1OP3K 3NABH 3D3VB 1FIEA 1DJZA 1J48A 1RFDH 2VN4A 2QHLA 4MQ7A 3DX9B 3EO1B 1NSNH 2R1WA 4J6IA 2G5BA 1A4JA 4P5MA 3ATEA 5F7BA 4ZPTB 4WHTA 1HSAA 1EXUA 2Q0ZX 2GSMB 1ADQA 2Z65C 2Y7MA 4TF4A 3U2IA 3SE3C 3Q43A 1NJ9A 4R2GD 3SGJC 3X13A 1YPZA 2WLMA 5TGBA 4X5WA 3P3RA 4IRJD 4ODVH 4N20A 2WLYA 2YA1A 5EEUA 4LVNB 1ZT7B 3TV8A 3MU3A 1I7TB 3JVGC 2Z93A 4M3JA 3MLPA 1MCNA 4QAMB 4AL8C 1DBKL 4FFZL 4HS3B 2EXWC 2WXKA 3ZHFA 5MEQA 4C57C 2FR4A 1NH6A 3QH3B 2AK4A 4ISVB 3LRLA 4HK0A 1YVLA 3KYNA 1AQDA 4Z7WA 3OKDA 5HPMB 2AK1L 4N2FA 1MAKA 3WCYA 1H8LA 4LP4A 1VFAA 1RZ7H 1QX1A 2GTWB 2WJ5A 3QUZC 3ZW3A 3RPIB 3LQZA 1YNKL 3H9ZA 3P9LA 2FBJH 4RWHA 2L3BA 1BA9A 1HHJB 4FP8L 5T1LD 1XIWC 4P5RA 3C5JA 4DP5X 3BP4B 3PRZA 3DKHA 3JV0A 3GMMA 5I1EH 3D4GA 4BDVB 1P53A 4EOWH 3CVCA 5DZJA 5KVDH 3CWGA 3ULUC 4CDHA 3QC6X 3RWFA 2BVYA 3WMSA 3MRBB 5ABDE 1QSVA 5T3XH 2OYMA 5IF0B 3WTVA 1KT2A 1TG8A 3IMSA 2AEQL 1GA2A 4C59B 1J0ZA 3P0YL 1JHLL 5FHBH 1Q9KB 4AQEB 5HBBA 2MHAB 1RY7B 2F15A 1RD6A 4G8GA 1H6EA 2DQGH 3O41A 4C47A 4R0LA 1KNOB 4AUJA 5TD4A 5FV1L 1RK0A 4XZUB 2KYIA 3O8XB 3LRMA 2IPKB 1LEGA 2BIHA 3U4EA 3N55A 5FKAA 3BYYA 4W68A 3UO8B 4C56B 2YAQA 4I0PD 2M2DA 3MV9A 3LOWA 1NC4B 3U9UA 5BS0E 2C7UA 1JPGA 2CJUL 2I60H 1TQSA 4CN6A 3N40P 4JQVA 3RWJA 4OD3H 4WU5B 5L7XH 3KJ4C 2X88A 3UAAA 1KWGA 2XT1B 1Z1WA 2IBZX 3DXAA 1D5XB 4DAGH 4Z76A 1QLEB 2OMTB 4F7MB 2IMNA 5I1LB 5I1GH 4XP5L 1QZNA 3OR7A 4G9DA 4HU8A 3B2UC 2YSSB 5HYSG 3DECA 2GUYA 1L7IH 3HRPA 1FP5A 1ORQB 5KUMA 4J3OF 1YNLH 3MO1A 4NJ9H 1R5VA 4U7SA 4MRCA 3C5SA 3CDCA 2HT2C 1KSRA 2MJWA 1FBIH 5ALCL 4KUCD 2J7LA 4ZUWA 5BO1L 3FMGL 1IGTA 4M1DL 1UACL 4GP8B 3VGGA 4Q6YA 1NFDF 1U8QB 3B7YA 3VXRB 1RMFH 3GKWL 4Y9GA 3BP7B 2XWTB 4YDKH 1ZIAA 5L9DL 5HDQL 4HX1A 3CSYA 2APSA 5AFAA 2PCFA 3DTXB 3MUUA 1KPRB 2ADIB 4WJG3 4ONGL 3V79C 3HVNA 2BIIA 4HHAA 4TL5A 3V7AE 1XAKA 5E6IB 4ETYA 3S98A 4FNUA 3JV6B 5GRVK 4R0LC 1GGBH 2NNFA 3GRWH 1INQB 2W0KA 8CGTA 3MJ9H 2WZ5A 4UDUA 3GSWB 4FNLH 4NP4L 4ZUSA 1VAHA 1J18A 1QHQA 2EDYA 2HFFB 4KOCA 4DZ8A 2Z6FA 1KYOK 2PKDA 5DK0A 5IVNA 2EXWD 2VABA 3V5KB 3VDCA 3D0LB 4JQVC 3HPLA 2UY7A 4ZW3A 2CJTA 3U1SL 1ZLEA 1UUSA 2EABA 4U1HB 3SGDH 3MRPB 5IK3B 3N0AA 2FIKB 3K71A 4PGEB 4LSVH 1IAIL 1S7XA 3X14A 3LPFA 2PP8A 2ZP9A 3S2CA 5E56A 4GQ9L 2V5TA 4UM9A 3DMMB 4NRXB 1OP3H 1CF8H 1DVSA 3VFPA 4D0BB 2WAHA 5C0RL 2NRDA 4NQDB 3G08A 3ULUD 3HB3B 5FYJL 1AE6H 2BNQD 3OAWA 1KPUB 3QDHA 4XCNA 5GJSH 2G3XA 2NZIA 2AJVH 3U2SA 4RWYH 4JKPL 4XMKL 4L29A 3WELA 4ZBJA 1E9QA 4W9EC 3VWKA 1BIIA 5F9JA 5AW3B 3L3GA 3WJMB 3RRQA 1D5IL 2VH5L 4WCYH 3ZIYA 4HKBB 2E3VA 2GJ6E 1CBJA 2MFNA 1K5NB 3CU7A 4GAJL 1YMME 4XWGH 4ZXBD 6PAZA 5KVEH 3NK4A 5KN5A 5DEFA 3H9YA 4GAGL 3BPNC 1FLRH 4ZQKA 2UY6A 3PGFL 5DHVH 2APBA 3QDGA 3SDDB 4OZFA 4DEUA 1DN2A 2A74A 2B8OT 4Y5XA 1DQDH 2R15A 4OZHB 4P5TA 2YRPA 3DX7B 2TSAA 5ISZD 3QG7H 4FFVC 4MJIB 4WZ9A 1BJ1H 3TONA 2B1AL 1IGIL 2IAMA 5DMGC 5DQDL 2FQEA 5EZIH 2FNBA 4GP4B 4PLJC 4FZEH 2R1YB 1O9WA 1JGIA 1BD2D 3KPRB 3MCKA 3QFJD 1G9NC 3SGDI 2VQUA 3GSRA 2HT2D 1UYWL 3H53A 2WP3O 1Z5YD 1ZXKA 1XF5A 3QCUL 4RRPM 3QJHB 3Q8CA 3Q1SL 5HPOA 1B0WA 3BQUA 3C5ZA 4P5SA 2DQHH 1K3ZA 4LSPL 1DO6A 4QF1B 2SEBA 1A4CA 3FT4A 4RGMB 5CHNA 3VWKC 2Q3XA 1SYSA 1YO4A 1FL6B 2IDSA 2F1AA 1KCVL 1AXTH 3H4HA 1F86A 2V5SA 1EJ6A 4ZFQA 4PLNC 5I1CH 5IOPB 3JUZA 3FB5B 1RLWA 2XQYG 4QI3A 3US0A 1CQKA 2EYTB 2R9HC 2HB0A 1A6ZA 4HPOH 5AAMA 2XQYK 4KKAC 1PQZB 1KIQA 2WQXA 4TQIA 1X5AA 4TKWA 2UWEB 4HLZG 3QNYB 1T22A 5CUSH 4X83A 2KT6A 4W4NA 3EO0B 2HX7A 4G1EB 3I6KB 2A74C 3KS0H 2XNAA 4Y5XC 1TQUA 3LS5H 1RURL 1F11A 2V8LA 2VSMB 2ZUXA 4P5TC 3QVAA 5I74B 4HHWA 5EWIL 2PYEA 3V6FB 3NFPA 5LNDA 2VR6A 4G7YL 3A4FA 3RWDB 4JHAL 3U6XS 1NFDA 4JPSA 2ZOOA 3DXAD 2IAMC 3N9GL 2BHFA 1I7UB 1AO7A 3OPUA 3U4BL 3MTRA 2VXTH 2CDFA 3EHBC 5D7KE 5B1BB 3FH7A 4KU1A 4A68A 2FX9H 4TVPH 4B9KC 1KBPA 2BXZA 1HCZA 3HBGA 1SRDA 1W0WB 2XV3A 5I19L 1RUPH 3GXDA 1E4WL 1IFHL 5HYQB 3GHBH 5C0CD 5L2JB 2F1EA 4N68A 2CLVA 4QRQB 4UBDC 2O5NA 4WUUA 4XMZA 4KTDL 4OVVA 5CR8A 2OI9B 1MFCL 3KDPB 1HT6A 3BIBX 3BQUC 3C5ZC 3SPHA 1LK3H 3U79A 1Q38A 3K6OA 2WTRB 3BWAA 4N0UE 3S4SB 4Z3JA 3CBJB 3IKCB 4J6RH 4CVUA 4JFDB 3FTXA 4DOHE 4L4VE 2X05A 3OV6A 3RBSA 1V5JA 3FRPB 4H25B 1J8RA 4EIZC 5CXPA 4KHXH 1XCQA 1HYRC 1OHZA 3D50A 1XF4B 3E8VA 5L2KD 1FNGB 4XCFH 4JJ5B 3EH5B 1E8YA 3OZKA 4KK5C 5EFIA 5AAMC 4N2AA 1F13A 2AEPL 5C0GA 2A3TA 1NWPA 5FYKH 5JLZB 2V9RA 1UM5L 2R51A 1OAUH 4J3OC 4QR7A 5HGHA 2FBOJ 1AGBA 3I2CL 1OLLA 1YYML 2YPLB 4I18B 1KG0A 4JFXB 1YEEH 4F7KA 3WD5L 1WZKA 5IP4A 2EYRA 2HXAA 3K6IA 3N3EA 4ZO7A 3SE9L 2ZT9C 1HAUA 3NIGB 3LSOB 2VDLL 1EHNA 1QLEH 1D7CA 4PBWD 4YK4B 4JGNA 1TETH 1U8KB 2DQ6A 4NUGH 1OKEA 3IVKA 1J5IA 2IPTH 4CSSA 1FZKB 2EEBA 1LEIA 4BZ2L 4OIFA 1ZT4B 1U58B 1DJYA 3I74A 4DEPC 3TV3L 4UM9D 4X8GA 4XTRC 1LWJA 1CURA 3DIVA 1A7PH 2F5BL 1T21B 3BRDA 5ILTH 1YEHL 3MV7A 4AUYA 2VE6A 2PW1A 2GJJA 4GYBA 1X9RA 4XNBA 3AY2A 2MPAH 1KEML 5DEGA 4LHUB 3UTSB 5AWNL 4W81A 4H2AA 1M71B 2IADB 3GMQB 3F5WA 5EU5B 3S4SG 2R23B 4ICXA 4PJ7B 4V1DE 1KCSL 3CIAA 1BM3L 1E5BA 4XXDA 5CSGA 1SJEB 3G6JB 2NY6D 4FERA 4GW5B 2N1TE 4AZUA 2W65B 3MRKB 4J2QA 2X40A 4KKAD 4ZUUB 3TEZA 4JFFE 1BAFH 3GNMH 4PJEE 1AOZA 5F6HI 2BC4B 3VXTB 5E1QA 4PS7A 4DGYL 2OCJA 3NABL 5EU7C 2IFGA 2CG9X 3Q3GA 1E4HA 1ZSDA 3HFMH 4MAUH 5K9JH 3BPOB 4PHZA 4NZ8A 1YA5A 1NSNL 3VWJB 3I6GB 2ZCLL 2Y25A 4P5TD 5IFHL 3IGFA 3L8QA 1ZTMA 3LNFA 3QI9D 1J8HE 4XP4L 1MY7A 1X7SA 2I26N 3HBQA 1W0YT 3CBRA 1GS6X 2EUWA 4BK4A 4LCYA 3CH1A 1JF6A 3MFFA 1HL9A 1MIEH 5J12C 5EU6A 1U2YA 2AGJH 2AC0A 2VERN 3EFFA 4PUBH 4H1LA 5CMAB 4WJ5B 4GMSH 3LIZH 4LKXB 4NZRH 4MTMA 1RJLB 4B9FA 3QG6A 3A6BL 1FV1B 3IDIB 3U0TA 3OF6D 1MJ8L 3EXLA 3SE8H 4XPGH 5IHHA 4JO4L 4RZKA 3C5ZD 1UZ8A 3VQLA 3VXNB 4M1CC 3F58H 5FCUH 1HNYA 3A0OA 3NACH 2DPKA 4PJIB 4ILDA 1I3UA 1GJUA 1E5CA 3U1PA 4KQ4L 4NO2A 1GC1H 2YAOA 2HUHA 5AKRA 5DJ6B 4LHUG 2FEJA 3CUPB 3EAKA 3E6FB 5JW4Q 4CSTA 4YSPA 3HPJA 3KPMB 5I1EL 1C1EH 1ZOXA 2IWKA 2NSQA 3HAEA 4KKPA 2H4EA 4KK5D 4KRPB 1SHMA 4TXVB 4QTFA 1YN7B 2AEOA 5DD6A 2VLRD 3FQ2A 5C09B 2D4DA 3ESNA 1A47A 4GOSA 1MEXH 5C0DB 4I2XA 4UOJA 2EDEA 5DJXA 2DJMA 3AFLA 2BH0A 4JJHA 1H3PL 3K5SA 2XHNA 1J12A 2F53B 2GJZA 2PYED 4DKFH 1OY3B 2DQGL 3MXWH 2K8MA 2EDWA 1YQVL 2GBUA 1CCZA 4M5YL 2C4XA 4QHUB 1EZUA 4HK3N 3GUFA 4NQTA 2E27H 1J88A 4NKDB 2CDGB 4HKXB 5IEKA 3GSQB 2A6IA 3RL2B 3I3BA 3UCRA 1RULH 4LGPB 4IU2A 1MNUH 2CBQA 2PO6B 3TGXA 3C08H 1HH6B 4FQJH 1C08B 1I1FA 3QHZH 4HXBH 3EDDA 3T2LA 1MJ7H 3F83A 1PKQA 4XBGA 1BJ1J 3OMNB 1G5GA 3FU7A 3QB7C 2AZUA 3OKOA 2NR6A 3VO0A 3S34H 3CFCL 1EXGA 1ZA6B 1KCUL 1J1PH 3LXUX 5ICXA 4XNMB 3AQYA 5HI4C 3CU1A 3SKOB 1RUKH 1TITA 4ETQB 1T03L 3Q6FB 2VN7A 5EUOE 2RCSH 4X98B 2C3WA 3ZU8A 3FU9A 1WFNA 5AG9A 1FBIL 4XPHL 3B9KD 4R3SB 4GG6E 2DQIH 1F18A 4YSTA 3RB7A 3V4VA 4LRNL 1YAZA 3FU0A 1FPTL 1ECZA 3H7BA 1RMFL 3S37H 1NCWH 3RIAK 3T6QC 3X3FH 1GSMA 2CO4A 4NGHH 5DJYA 5IMKB 4HKZA 1HH9B 2VITB 4YDVB 2V9UA 4R2GB 4QGYA 2Q9OA 2X0UA 2DYPB 4WW1A 2FWOB 5HHME 3VFGH 4IRJB 5J11C 3QEUB 3KYMA 4G5ZH 3TBSA 3UBHA 1V7MH 3QAZB 2EKSB 2J57A 3KE0A 1AH1A 4FCAA 4OW6A 1OSYA 1UM4L 4I8DA 5T1MB 1T7WA 4JO3H 4PM1A 1JFQH 1TU2A 3CDGA 5BZXA 1IQWL 1WG3A 3A67H 1CIUA 1V27A 4F33A 1I1RA 5E1HB 4GG6F 4PJCF 2AV1B 3EGDA 4XC1H 1FHGA 2R1XA 3H9SE 1FNHA 4NQXA 4JN2A 4J23A 3KS0J 3HLAA 1RCYA 3TH2T 1L0XA 1PLBA 2NSMA 4X4KA 1U4FA 1NICA 4KZDH 3JWDL 4BWUA 1FRGH 3CBKB 1N4XH 1ZHBA 2WBXA 3IAGC 5T1LB 4YSDA 2NR6C 3JTSA 4MCMA 4KZEH 3OHMB 4OUOA 4IKJA 1URIA 2ZKWA 5AW4B 1W8OA 4XZ4A 3LCYA 3BKCH 3T3PE 3LXCA 3BAEL 2GK0A 3IJEB 5E1GA 3V4PA 3ZUNC 2EDKA 2PABA 1IKFL 5B38G 1NOLA 4F58L 2A77H 5GRZA 1NGQH 3HR6A 2DQJL 2VLJD 3ZTEA 4NRYA 4P9HL 1R0AH 1I1AA 3NFSH 3EGSA 3WNLA 5F3BB 3CHOA 4RWYL 4LNRB 5CEZH 2BWQA 2DMCA 2WAQA 4M6AA 4NBYB 4FG4A 3OQRA 2GK2A 3QXWA 2Y5QA 4MCYA 1U95A 2X4QA 1M1SA 4FX5A 4I0PB 2WBJD 1TIUA 3T3PF 5F6HJ 1A0QL 2PW2A 4HZAA 4X6DE 1MELA 1P0SE 1FLRL 2J6EA 2JIXD 5DK2A 5EU6D 1EZLA 3VXMA 5J8OA 3KHOA 1BPVA 1KYOJ 1EFXA 4J27A 2ED9A 4RMQA 3ALWA 4ZG1A 3WIIH 3G6AB 2I07A 3B1TA 4NZJA 3ZKSD 1R3LB 4WO4D 1XSIA 1A8ZA 1BXVA 1P7KA 2ZYHA 3QG7L 5AYTA 4BHUI 1C9SA 5TH2B 4WAFA 1E6JH 1S9XA 4PYGA 2ITDB 1PDKA 4TNEA 4JFQB 4OLZL 4M61A 2Y3AA 4MMXA 4D3CH 5CJQL 1F0LA 4KUZH 1LQSR 3S96A 5A6LA 3UPRB 2B9BA 1H5BB 4FZEL 4JZOA 2E56A 3MRDB 2WIIA 5I1AA 3CC1A 3H55A 4HD9A 1HCVA 3GZKA 5I76B 1XGRB 4Z7OF 2NX5D 1VACA 3BP6B 2L7QA 4WIQA 2WZ6A 1NC2A 1GGUA 1ZLDA 4KO9A 2DQFB 3Q8AA 3MRLB 3RUGB 4MBRA 4ZUTA 1PX3A 1AD0B 2ESVE 3HVDA 3MOAL 3GKZA 4HWEH 1X3DA 5H8DA 1RAMA 4YZWA 4O4YH 3GSNB 5HDOA 4ANVA 1DYZA 3ULVH 2VXSH 3WUWA 1RI8A 2AJYH 5FDWA 1CDCA 3U6RB 1G5AA 5I1CL 1BHGA 1B4LA 3KPSE 4YR6B 4JRYA 5DHDA 4XNZB 3AB0C 4ABQA 3MV11 5EBMA 2C3XA 3GSUA 1MUJB 5KYUB 4IGBD 3B7RL 1S7UB 3GJEA 4LMQI 4HPYL 3SHSA 2EDLA 2H32B 2H0EA 3MRFA 4UIKL 5BMFH 5HGAA 3UCQA 4K3HA 4WKZB 1Q9LA 1VLXA 4FXGA 2JQAA 2WB1A 3LJ3A 4DN3L 2OSLA 1DEDA 3MR9B 4JE0A 3D4CA 4U1GC 1S9WA 3RZWA 4YAQA 4LOFA 3QAQA 4C55A 1G4MA 5D1ZA 1HINH 1RZIA 3EW3B 1NGPL 4MMXC 3C75A 4XMLL 5ERWA 1GIGH 2QKIB 3MJ7A 1PX8A 4MNHA 3KWUA 3QUHA 2FX8L 1EPFA 1N5YL 3SY0B 4UU9A 1C16A 3VE0A 3CVHH 1FF5A 1IBFA 1S5IL 2BNQB 2BP5M 2DQTH 3QNZB 3BH9B 4Z1PA 1OO2A 3EOYG 3BIKB 2OMZA 4YNYB 3DLQR 2UUDK 5D7IB 2JB5L 1NAKH 1IAKB 3QQNA 4IRZH 1CE6B 4JPIB 3DO4A 4C4UA 3M17A 2ZP0T 1LK3L 4ZXBB 4F3FA 2FX7H 2YUWA 1F2QA 3HIZA 4PJCA 1S7VB 4F9PA 5TDPA 1ANUA 3VXUD 3EBHA 2ZXEB 2P8PB 1CZ8H 2OR9H 1R24B 1IGMH 3H6JA 2AJZB 4Z8FH 1E3XA 4XPTH 1NMCC 5A2FA 2RQ8A 4YPGB 2ZG3A 4PVLA 1GMEA 1A6AA 4XCFL 3PAVA 4X4MA 2UXVA 5ISZB 2OTUB 4RRPG 2CO6B 4ZD3H 4PS4L 4RDQG 4Y16D 5K69A 1JZDC 2VNCA 3QZWB 4LDEB 2PWHA 4AQZA 2BSTB 4EBQH 2YD4A 3MX0B 1B2WH 5F3HB 2X1PA 2N59A 4Q9CA 4FXGC 1DANU 4ELMB 4P2QA 1G0DA 3ASOB 1BD2B 5JXAH 1RKRA 3MACL 3RWHA 3QFJB 4X6CE 3EBGA 2WO4A 1UVQB 5JQIB 1LP9E 1Q8MA 5KAQG 1TQBB 2QDWA 1BQLL 4A66A 3ELAT 4KKLC 5D1ZC 4Q9QH 4LARH 4R7LA 4XOEA 4DFHA 1LL1A 5AQ0A 4LSSL 3IMWA 2DZEA 4J8RB 5EEZA 3D85A 2IG2H 2NZ9C 3FT3B 1LDPH 2VISA 5DO2C 4HEPA 4Z7NE 2F54E 2OXHA 1PNDA 4OFQA 1A7PL 2Y7SA 1M6OB 2WNXA 3NCYP 3O3DB 5DA0B 4Y5VA 2AITA 3L5WB 5JDSA 2G9KA 3BZ4B 1NBZB 5LGJB 3QA3A 2B59A 5F88B 4F9PC 1FI8C 2Z92B 2YZ1A 5KYYB 1FIGH 3M45A 3G3LA 3TC9A 5ADOH 3QDMD 4ENZA 2RBLA 5JIQA 3MLRH 5F7KC 1WFJA 4ZNCD 4BCXA 1TMQA 3UXFA 4YLCA 2WXJA 3GNML 2LV4A 2YAEA 4Q74A 5E0FA 1XGQB 2AI0H 1M57B 4PJGE 2MNUA 1EFXD 3HFML 5K9JL 3IYLW 5EOQH 4E41B 4PJ5A 2CNZA 2BSSB 4M9PA 4EMZA 4NKQB 5CP7B 3X11B 3QZWG 4XPFL 3VGDA 4P4RB 4OCRH 1S46A 4AT6A 5J13B 3VI4B 2HH0H 3QQ9C 4PJ8A 2X3CA 1DSFH 2X6AA 1IVTA 1KBGH 3G5XB 3HS8A 1XV8A 5C0CB 5E1AB 4G2AA 1NL0H 4NWUL 4PUBL 4RFEB 1JGEA 3ZHDA 5KEZA 3IDMA 3KL3A 2O6FA 4LQ1A 2OMUB 3TJHD 4W4OA 4GMSL 5FA4B 2P7TA 4FQQA 5D7JD 3HS9A 1TR7A 3G5ZA 4NZRL 1BFVL 4PJGF 1H8OA 3R06B 1A1OB 5A43C 2YXVA 4Y5VC 3C6SB 4R26L 1OOWA 2BIPA 1AC6A 5FGCB 1KGCD 1WP6A 2NW3B 3BMVA 3A22A 3OKKB 1SXNA 3RIFF 1ET8A 4AENB 4OCNC 5HYFA 4O00A 1HE8A 5FCUL 1G9MC 1KLGA 2IBBA 5L2KB 1WA2X 3LH8A 3MLYH 5DUBB 2NDFA 2XZQL 3DGDA 4LU5L 1HI6A 1YN6A 4TSBH 5FK9A 1GC1L 5DLMH 4EDXA 5FO7B 4WV1A 1U91A 2EADA 1JK8A 1F4HA 4F8TA 3E1ZA 1G7MB 4X7DC 5ACZA 4JRYD 2QGEA 1C1EL 3N6YA 4CVXA 3IGAA 2P5EB 3IGUA 3HR5A 2CH8A 2D7NA 3I3EA 1L7TL 1WCQA 2J3SA 4DVBA 1J1OH 4P07A 1AC0A 4RQQA 1AAJA 3QXVA 2HCZX 4Q58C 4PS3A 5I8KH 5F9OH 5ITFA 5C07B 3RWIA 4MS8D 4FNSA 4P9MH 5C9JB 5MHSE 1S78D 1A6WH 3M1BA 4PJ8C 2Q2EB 1VRSA 1DDHA 4GPVA 1ESOA 2E27L 2ZAIA 3AWFA 4S1RL 5D1ZD 5KSVB 5SWQA 2BVQB 3OXSB 5FHAH 5AVZB 3SBRA 3AM8A 1JK9A 4P2RE 3Q2VA 1RULL 2UUDH 3DROB 2YQ2A 5C6TH 5KBNC 4W4OC 1I8IA 2JKSA 4ZO6A 5DO2D 3C08L 4ANWA 4MSWA 3QHZL 4HOWA 5KZCD 5HYJD 3QZNA 3NJNA 4KJYA 2DEXX 2EAEA 1SY6A 1CIDA 4R6UA 1P4BH 43C9A 3HW7A 1U6AH 1JG9A 4HC1H 1N59A 5IKCA 1UWFA 2NY6B 5B7EA 3T0EA 4I89A 4UB0L 5EG6C 4X5XA 1BGXH 4I9WD 3LZLA 3GSNH 4HJ0D 2BIOA 2IQ9L 4K3EH 3X2QB 4WV1C 3SD2A 4LIQH 5EORL 4JGJA 4WUKL 2XQ0A 3QI9B 4B60A 4ZFZA 5EC1A 1F1DA 1TO4A 3S37L 5EEXA 5IVXF 1MFBH 4WK0B 4YHML 3VFRA 4NGHL 3W57A 4X80L 3TF7C 4H8VA 3E1F1 4M00A 4DP4X 5EZLB 1CO1A 3I50H 2WZPA 5HI3C 3SE6A 3P1VA 1AZCA 3BN9C 3RY5A 3DX6B 3QQ9D 4PJHB 1PVHA 5DC2A 3SCMA 4CC0A 2RQEA 2JI2A 4NX0A 2E7BA 4EI5B 2OX5A 3L4XA 4TM9A 5I1DA 3UTZA 5ETUA 2NNAB 1HZLA 5JMRA 5BV7L 2JQZA 5H35B 5E2TH 2X7LA 1MQKH 3OKNA 5B1CA 3AM8C 4OI9A 2A83A 4B9GA 2OTWB 3DK0A 4AC2A 2X4PB 2NW2B 3UTTE 3ULUH 1T04A 4U0RC 3ROLA 4NZTL 4YQXH 5F6IC 5AVWB 4S0TD 3TH4T 1N4XL 1M9WA 1PL3A 4FFYA 4PJAF 2JKIS 3WNJA 3GXNA 1FYHB 3I85A 1DQLL 2D3NA 2V2TA 2PYFA 2I5YH 4J7RA 1BPLB 5MENA 3C6LA 4K7PY 2VLME 2AJ3A 3DUHA 2QELA 32C2B 3T0EC 3QEQE 5SWZA 3PDOA 1HILB 1XL6A 2CO2A 4NO5A 2VLRB 4NPYA 4XH2B 2G3NA 1G43A 4ZSOE 2V9TA 4KJWC 1W6LA 3RX7A 3V8CA 3JWNE 4DP8X 1AMYA 1EEZA 2ADJB 4P2OB 4WLCA 3S0PA 2H0FA 3NFSL 5DVMA 3GS4A 4PWGA 2I9LB 1RZQA 2JTYA 4PJDF 5JR1H 3OKLA 5D5ME 3H2QA 5FC9A 4PJ5D 3DYPA 2XA8L 2OMWA 3HZMB 3M07A 3F6LA 3PFQA 4JLRB 1B0RB 4AM0A 3SCMC 4PJ8D 3IAPA 1G7IA 3C8DA 3EBAA 4FE9A 3H3PH 5C0FB 1ILUA 1SHSA 4HMCA 3HG3A 5HHOA 12E8H 3EO9L 5JXEA 3BVUA 5GGRA 2R4SH 5J89A 3O4OC 1OK0A 1S8DA 2EYSB 4JFEB 1KACB 5IROD 1VESA 3L7FA 3F7YB 5GS0C 1TLKA 1LO5A 1WAPA 3OL2A 3DJZA 4UQEA 1AIFA 2IEPA 5BCAA 4Y4KD 4XN5A 1IVLA 4KUZL 2R2CA 4G9FD 2ZTBA 1HDMB 3B9KB 3EF4A 3MJ6A 3QEGH 1SBSH 5AZEL 5TE4H 3C6LC 2A6JB 3MI6A 4G1MA 4MDJB 2WQVA 5K9OA 4U6TA 2VSKB 5CZXC 1TVHB 1AVAA 4UQ2B 5C0NC 1HYSD 3UEZA 3K72B 3L3DB 1ODAA 1Q0XL 1I9RL 4ZS7H 2R8SH 5KYNA 4XVSL 5LUMA 2VR5A 3AT9A 1M7UA 4HWEL 3IEAA 1CGWA 5GHWH 2WYZA 1T5XA 5EF0A 2X4RA 1BMZA 1KCBA 4O4YL 5EZPA 2OKMA 3B2XA 3UZQB 2BS8A 2CLZA 3S35H 4ELDA 5HI3D 3QARA 3UMNA 2H6UA 3NZ8A 5ANHA 2B4CL 4HJGA 2Q7NA 5K39B 1J5HA 3GIZL 5I6XC 1PFOA 3F7VA 5GPRA 2BVOB 3RTQD 4LSRH 1O7DC 1SEBA 3GWJA 4LCWA 5D4JA 5DJZB 3WHXB 1DVFB 1YG9A 1AD9A 5I30H 4QRAA 2FJFB 3GB7B 2X3BA 2WGNB 5FYJU 5JXEC 1JNNL 1OW0A 1VJSA 3NFNA 2R2EB 2EVJA 4K23H 4WJKB 4X0KA 3QDAA 3BT2H 3H0TA 4KXAA 2VKXA 4KAQH 4O2EA 1JZGA 4JZNB 4FKKA 1HN1A 1BEYH 4RZCA 3OSKA 1O5PA 3K2UL 3RZCA 3BT0A 2J88L 2FB4H 2N7AA 3FW6A 5D4HA 4A2LA 1VDGA 4M7ZB 1UKQA 1UFGA 3FSZA 1HINL 1K8DA 3CMOH 4QRRD 4QJ3B 3U7WL 5IVXA 2VLJB 4YHPB 4JRXA 3FU8A 1CWVA 2QQNL 2GT9B 3WIFB 4J4PA 1ZGLA 2HLAB 1P7QA 2LAAA 4KMTL 4O51B 3H85A 4XCEA 3VD2A 4G8AC 3KWVA 3BKJL 3GFUA 1VB9A 3KLDA 4ZMZA 2OPCA 1XZ0A 4IRZL 1WIUA 1E3FA 2HX9A 3L3IB 1VADA 4DKDC 5GGSB 1PZ5A 3RVVC 4XCYA 5I8OH 3BE1L 2A7BA 4RGNB 1BVKA 2WBJB 3P0VH 2D7QA 1DVYA 2ZOLA 3NEXA 4PREB 3WYRA 3BAWA 2EUVA 1UC6A 1SDYA 2D0FA 1A3QA 1MFEL 3GBMH 2DM4A 1VPOH 3AU1B 1MI5A 2ALAA 4L0PB 4DVRH 1AKJA 4PJAA 3OAZK 4BJLA 1FNFA 1SN0A 4ODXB 3SCMD 1JZ8A 3AUWB 1G9NH 4A2HA 1U42A 1GZHA 2A4CA 5FFOA 4HIQA 4QRUA 4Y1AA 4HUVA 3IF1B 4K3GA 4MXQC 4KJPD 4NQED 4LVOB 4WFHE 4Y2LA 5INCA 3NGBC 4U3SA 3BCFA 4WWKB 3IDYB 1QNZH 1QFWL 1KEGH 2VDKH 1IQDA 4NC0B 5C0AA 1UH3A 3HJEA 5DVLA 1OW0C 3MV8E 3UJJH 1CPUA 1O7VA 1P4LB 3EADA 2G2RB 2WSDA 5EZJB 3NESA 4IU3B 3QC5X 4GRWE 3RZCC 4PJBB 1KPVA 1SXSA 3QE5A 4ZO9A 2R29L 2R2HB 1FZOA 4PJDA 1JVLA 1N70A 3X1EA 1RP8A 1QWUA 3FXIC 2NX5B 1NKOA 3SKNA 3W39A 1XQ4A 3C6LD 3SKJH 2HX8A 5SWZD 1GZQB 2KH2B 3IN2A 2DI8A 4J4PC 4K8RD 1QPXA 5JW4N 2OK0H 1LDPL 3HA0A 4BFFA 1FA4A 2FSEA 3LKSA 5C0ND 2NYZA 2VWEE 5KYWA 3NP4A 2FJGA 5BRZE 3IJSA 3IDGB 4CN1A 4NKIL 1U8CA 4NO0A 1WHPA 2WBKA 3TPKA 4GRWF 4Q2ZA 3O4LB 2XY2A 3ILQC 1OP9A 3EYUL 4KX7A 4ZW7A 3KLHD 1FIGL 1WD9A 1A7QH 1HL8A 4IGBB 1BF2A 1R3IL 4BSWB 5E8NA 2BMKA 3QRBA 3MSPA 1M56B 2D4FA 5F97E 3TF4A 3LKOB 2RAMA 4ZUVB 1VEOA 5AKTA 1HXMB 2HJKA 1GZHC 2J43A 2NQDA 4H1LG 3MRCB 2AI0L 2OW7A 1FL5A 5HHOD 2PUQT 5JXED 3T1WA 5EOQL 3NDZE 5I9QC 2EC9T 2V6HA 4AJYV 3G7TA 3B6SB 1QLRA 3E8UH 4NQSA 2X4NB 1MHPH 4N2GA 1JPFB 2DWEB 2XWJA 5DYOA 5DZ9A 2QQKL 4EI6A 4UDTA 4OZGE 5KS9E 2PXYB 1FAKT 2YKLL 2X4SB 3PL6D 1ASPA 3GRBA 5DHMC 4P4KD 4K8RL 1OT2A 2JF1A 5CIPA 4GXUM 4AW7A 1WUNT 5IB1B 3EJCA 3B9DA 4GY4A 1IIIA 3AWGA 1XGUA 4UQAA 3ZRSA 5D1XE 4EVNA 4KVNL 5I82A 1CICA 4WWOA 3EDEA 5CD3B 4HIEA 4L5FE 5IY5B 3B9VA 4P57A 2O5YH 1EIBA 3HAEG 1QRND 3VXUB 1Z5LB 1T2QL 3NIDF 4B5ZA 4PWKA 2F08A 4J3OH 4JQXC 2QQLH 3HHSA 2OP4H 4FMFA 3O6MH 3MBEB 5E94A 5GGTA 2Z7ZA 2WC7A 4OZGF 3T08A 4OLVL 3P4OA 4LLMA 4LPWA 1BM7A 2H8PA 4TSBL 5E99L 4FEIA 5DLML 1EAQA 2XN2A 5ESVB 5IBTH 3STLA 4Y16B 2NY3D 4FDWA 3I9IA 4L4TA 5IMOA 3PGCA 4NZUH 3N44F 3RFRA 1JZ4A 1CU4H 4FEMA 4FXKB 3FUDA 2QV2A 1NCCH 3VYPA 4MXQD 4AIOA 2NYYD 1ZSHA 3F8UB 4AMKL 2EDRA 1TDQA 1M53A 1R5IB 2CKBB 1YLBB 5LAXB 1CLVA 5CGYC 1IEAA 1CQYA 1NLDL 4WNQA 4ANKA 3SKMA 4CGTA 5E00B 5F9OL 5TQ0H 4N6RA 4AZ8A 4TS6A 1CFBA 5CKGA 4P9ML 3GQFA 1AP2A 3TBVA 3ZE2E 3RZCD 1A02N 1TUPA 2VC2H 4F1ZA 3L2LA 1MLBB 4WTWA 4W70A 5CEXA 4AIZB 3BFQG 5FHAL 1L6XA 4PRPD 1NBQA 4FNQA 4I5BB 1PG7L 3O2DL 4EKJA 2ERJC 2APFA 1QPPA 4UT6A 4X7FC 2DLEA 4XNYL 1CICC 1P7QD 1MHHB 4YFDB 2A4EA 3RJOA 1Q4NX 4IOIB 4N0FA 3W56A 4BSVB 1O6SA 5J6HA 3MLVL 3GMLA 4YH6A 3O0RH 3QDMB 1EJOH 4CMMB 3ILQD 3ZE2F 5FUCE 4OD2B 2P47B 3JTTA 3PIQB 1HCFX 2XWBA 3OAZH 2VSDA 1MCSA 1I31A 1UJ3A 3UZVA 1RL1A 4NP9A 1WGOA 4K3EL 1PLGL 5ANMB 5A3IC 3BUQA 2LLNA 4LIQL 1KELL 2GSGB 1EDQA 4OZ4A 5EDXA 2IANA 1CDYA 4GKZB 2AW2A 1EK3A 4Y1AD 3CFMA 3APFA 1RK7A 4AL8L 5E6RB 4QHMA 3UADA 5HXMA 1RIVH 1AFVH 2G4GA 3ARGA 3V0GA 1FZJA 4CVZB 4MASA 4PAZA 3T8XA 2VDNH 4A67A 4RESB 3DPBA 2A9NL 2GAZB 2X89A 3FONB 1MWOA 3U9WA 3TYGH 4GAFB 2D2OA 1L4IA 1UM6H 4GSXA 3IS0X 1TEYA 5FKPA 1NGYA 4MXVF 1CFVH 1KXQE 4BWTA 4QRFA 2FH8A 3MAWA 5ECGA 1SZNA 35C8L 4ZTOH 1NM4A 1JCVA 1L9QA 1MPAH 1WBXB 2Y5TB 3JYBA 3NJVA 3WO3B 3WSQH 1MQKL 1DBBH 3PWJB 4LLQB 3VH8A 4AEHH 3LN5A 5D7EA 1F3DJ 3IJ7A 2F8IA 3MJGX 1WD8A 2VZVA 3BIAX 2H1PH 1XGPB 4H26A 1RU9H 3U7AA 4F24A 4PLOB 3ABGA 3KBHE 5GSRB 3WFBH 5ICYB 5FGSA 2DOCA 2R59A 5LCVL 3RGVB 1H9DA 4JAMB 3EYSH 2I5YL 5E6ZA 3RA7H 4ESKA 4NO0D 1A65A 1EWHA 3D33A 5BRZA 4AGMA 2VR4A 1SOKA 2CLRB 1O5DT 1ADQL 4HH8A 4UAOC 3MLWH 1U33A 3I9GH 4DJMA 3MUZ1 5ACLA 1UJ3C 3HRZB 3D5OF 4I77L 1U41A 5DMKA 1W8NA 1U3HA 2EDDA 2BWDA 3L5XH 2NY2B 3FO2B 4H1LH 3INOA 3L2MA 4Z7VB 4CW1B 4DN4L 4JREC 3WNIA 1E7UA 2V2WB 1U8OB 3OAUL 4ZDHB 4MA8H 3MREB 3TN0A 1E5AA 1WFOA 1KJ3H 2JJSA 4GO9A 3OVUB 3T3MF 4GO6B 4MBOA 5CGYD 3WXWL 3ARGC 3H4FA 4M6ML 2VLKE 1IGYA 3IWUA 1DEEA 3VXSB 4P05A 4QHLA 2YFOA 2MNJB 4HCIA 1ZVSB 2W60A 2CWRA 3RPBA 2XN9D 2GG1A 1MDTA 5GRJL 2ZX5A 3EYVB 4JFZL 5BV7B 1USQA 5KZCB 5HYJB 12E8L 4EAEA 1AGEA 1JV5B 3L3HB 5I1JL 3OWRA 3ZDZE 2WBWB 1JHTA 3HAEH 1T0MA 1UCBH 3IETA 5J1SC 3HMWH 1AQ8A 1U8HB 4E68A 1KENH 3QCVH 5LB1A 2UXTA 3PWPE 3TEWA 5KJ4A 5H94B 5E51A 5TE7H 3ECWA 3CDZA 1WA0X 4NQVA 2FVNA 1CE1L 3GYRA 2J1ZA 3QEGL 4AEIH 3Q01A 3AQZA 4YFLF 1YEWA 5DS1A 4OTXL 1E8XA 3QYCA 4FN0A 1DCEA 2ZUSA 3TJEH 3KGTA 3NDYE 1BQRA 4HKJA 5A3ID 4EIUA 2YJQA 4L4TD 4UINH 1WCBA 5G5DA 4OY9A 5I18H 2Z4QB 3EGXA 4LFHD 1ZS8A 4F7CB 1FGVH 1U3HC 3KLAB 4EO5A 1I53A 1P5VB 2F68X 3FN0H 3GSOA 3U25A 2R8SL 1WWBX 2BSRB 4U1IB 3OJ2C 2QVFB 3K91A 3UYPA 1J0YA 3CQFA 4NENA 5GHWL 3QJXA 1RZPA 3K8LA 5D1QE 1SXCA 3BGFC 3RX5A 3TN0C 3HBPA 3I3DA 3QUXA 4IDLA 2JJSC 3FB8B 1IM3B 2KLSA 4QXTA 4L8DB 2DDQL 3S35L 1AHWA 1QYGH 2N1KA 4XPAL 4YO0A 2ARJA 1IC5L 3A24A 1FFNA 4LF3A 4GXFA 4MJ6A 2XVLA 3QDJA 2F19H 4WO0A 5FYJE 1M42A 1SLUA 3VGFA 1JZHA 1FVCA 3FFDB 2FH6A 1U92B 3NA9L 3U30B 5I30L 1J0HA 3KM2A 5BUPA 5E9DD 1KGJA 4U1KA 2WVVB 3DV4A 3V4VH 3KVQA 5IV2A 2XZAH 4XBEL 3MUGA 4NKOA 1AHKA 1JWMA 5IMLA 1CD0A 5C08A 3ZZSA 3S8WA 2CSPA 3CMOL 1ET7A 5DRZA 3UX9B 4LESA 1Z3GL 2Z8WC 1AZVA 5ICZB 1MCOH 1SVCP 3DA0A 4K7FA 2OCCB 1JV2A 4OV5B 1FNEA 4OD1H 2PPCA 1LE5B 2V33A 3QSKB 4K4KA 1MIML 5AW6B 5I5JA 3WTTA 4JFPA 1VKXB 3GI9H 1BZ9B 5FECA 3UAEA 2IAND 3P73B 3C6EA 3SO3B 1HWGB 2ENSA 3QUMB 3ZT6A 4BFIA 1KXVA 4ERSL 2QPFA 2AXWA 3ARGD 4MWFB 2CKBH 4ZNEE 3QUXC 1QACA 1EAPA 4LPVA 1CBVH 1K72A 4Z23A 3JZ7A 4FTVA 4PI0A 2FEDC 1AHWC 5HHXH 3MRQA 1IE5A 1A9EA 2E76C 2P49B 4F2MA 1TJHH 2KC0A 1G1OA 2BS71 3UMTA 4ZYKA 1XXDC 2NDGA 3J7HA 1BG9A 2XG4A 1G9NL 3BO8A 4NDMA 2DM7A 2ADGB 4IOFC 5H4ZA 5LKNA 3MOBH 2WVTA 1DE4A 1DUYB 3V4PH 3LD8B 4AWJC 4D7PA 4NRZA 1KEGL 3NJXA 1NUFA 2W92A 4MDIA 3MRJB 3CLFL 4G9FB 4MLSA 2KZ1B 3UJJL 1Q90A 3LKNA 3V0VB 3V6OE 2V7NA 2EH8H 4NI3A 5B22A 2Z8SA 2ZKHL 3J8F7 3VFWA 5CR1A 3POCA 1YAIA 1U8JB 1I9IH 2RGSA 5GGUA 3V6ZA 5F9WB 1OE1A 1KIUA 3NRQA 2Z7YA 2Y7LA 1ZANH 3R7RA 4YLQT 3HG1A 4L18A 4PRBB 1ADWA 4H0LC 4IEFB 1DLHA 5FLUA 3HC4L 2J6EH 1XTMA 4ZMNA 4NYLB 4O9HL 3VU1A 2ZCZA 1XCTB 3IRZA 3NPSB 4F8QA 2UXFA 3AAZB 2TRYA 4CMHB 4QRPE 4I0KA 3WEMA 1CXFA 5JNYA 5L6YL 2F9BT 4F9LA 5I1KL 1WAEA 3AG2B 4P3WA 1KXVC 1YEFL 1G84A 3RTQB 1C5DB 2GABA 1A7QL 4UTBH 1QSFE 3ZTNL 3EDJA 2XJLA 3VFMA 2H9GA 1QKZH 2FO8A 2Y7QA 3HZVA 1K5WA 2ADFL 4X7SH 43CAA 5BS0D 4IRSD 2BRRL 2OMYA 3Q6GL 2B20A 2H2PC 3GHEH 4Z18A 1KN2L 1NBCA 3AQDA 5T33H 1M05B 4M1GL 1QA9A 2YR3A 5LXGH 3HUJA 5KVMC 2Z8VC 5FM8A 4QRRB 1CDBA 4Z3IA 3GUTB 4K5MA 1VCBC 2BW5A 4U31A 1FJ1A 2JKNA 4JN1H 3E9TA 1DSYA 1UXWB 3DSFH 4TL4A 4NT6A 3S48A 4F8LA 3ISRA 4XXCA 1D9KA 1HSBB 3H2PA 2E7MA 3TEXA 2WLIB 1FVEA 2HT3D 2GPZA 1VSCA 1WPCA 4R90L 2XWRA 3FHEA 1CFQA 5DDHA 1EX0A 4HFWA 4PJ9B 2P52A 4X9FA 3EIFA 5BQ7B 1IBBA 4GIAA 4H8HA 4PGJA 2NTFB 4WW2F 3VXOB 3N04A 3UJIL 3TTYA 4TLKA 1Z2KA 4MGXA 3UGXA 1N8ZA 2WMPA 3GTVA 1KCWA 3ASNB 4LNVA 3VVWA 3B2VL 1RJCA 2OP4L 4G70B 8FABB 1WZLA 3O6ML 3S3SA 1CYWA 4N8VA 2YPKB 1ZY9A 4Y89A 5F1IB 4RAUA 2RFXA 2XN1A 4WI0B 2X2IA 4KITB 4F9LC 2O1AA 3VI3F 1JL8A 5HGDA 4DCQB 5DRXA 2IC2A 1SEQH 4NQEB 1UXSB 3NZHL 2L0DA 4OFPA 1XH3B 4MQSB 2EVFA 2W9DL 4NZUL 4Z7UB 5JPNA 3TVMD 1CU4L 4IKNA 4G7SB 3QDJD 3LH2H 1QUPA 3OKMA 4O5LH 1MCCA 3ECBA 3DK2A 2AXHA 2A1WH 4RMVA 2OXGB 1PMYA 4P3CH 4Q56A 4LAQL 3SDYH 5G4OA 3VM5A 1XR8A 5DU7A 4NHUB 4Q8BA 5TE6H 1GVIA 2YEQA 1A6VH 4Y19A 3BEWB 4EXKA 1XWVA 5EOTA 5AW7B 2CCVA 4XXCC 1D9KC 4QYOA 2CR0A 4FG6D 4LOUD 4BQ8A 2LFEA 3MGOB 2XV2A 3QJFB 4U6VH 5D72L 3M88A 2Q6WB 3LKRB 4ONFH 2WXLA 1EEUA 3H6AA 3RL1B 3DUUB 2Z7UA 4D9QE 3B7UX 3LMJL 3QQXA 1K8IA 1D5BA 3BKMH 1TZGH 5D7LA 3RWCA 1JZ6A 1P5UB 4GFTB 4E42B 1WLHA 2VAJA 1NCAH 4NC1E 3QXAA 1UB5A 1W0VB 1S7QA 4F5CA 5CINL 4MA7L 3BW9A 1CFTA 4A2FA 4S0HA 4X5RA 3FZUC 4ZK8A 4BFJA 3ULAB 1JGVH 1Z9PA 1E2WA 2BJMH 3ZDYE 3V5HA 4LPCA 4YSUA 3IPFA 1A6UH 5F3FA 1FZMB 5HVWA 5IJVA 3DX8B 3MGTA 4P04A 1CT8B 3EDKA 3D25B 4HAFA 5DD1H 5CCKH 1B4JL 3MNVB 1A2YA 3BH8A 4B97A 3U0PB 4JDEB 4Q4EA 3SPIA 4OSUL 2NUTA 1KV7A 5CN2A 5JPNC 5D1ZI 5AG8A 1NFIB 2FZ3B 3VQMA 4X8CA 2YPVA 2C1PB 4TQEH 3CLEH 4OLWH 4ZMLA 4FXLA 3SOBH 3DGGB 2G9HA 4E9QA 2NQ3A 2WPGA 3PL6B 1RIVL 1AFVL 3OX8B 2OSWA 4PU2A 1NLBL 4P4KB 1UB6B 1I3RA 4JFYA 1N6QL 1KZYA 3C8KB 4GUPB 4P2CG 3REWB 2TAAA 4QHNB 1N7MH 3Q2CA 1G9MH 4GSDL 4R4ND 1UM6L 1JZJA 1NCOA 2MKLC 4OLUL 5KVDE 4LGRB 1I3GH 3SOTA 3SY6A 1N68A 2F0CA 1JHKH 1BREA 2JCCF 1GW6A 1QRNB 4ZTOL 1UUNA 3UJTL 3WSQL 2M8XA 3LEXB 3B3IA 3SYAA 1KIPB 4XNXH 1TTUA 4KTYA 3QJTB 5GS2D 1DL7H 1QBAA 1E9OA 3RILA 2E59A 3DVFA 1BG1A 3QORB 4KKBD 4X7TB 2Z31B 1WDAA 2AABH 4U1NB 2H1PL 1JNJA 3DX0A 4RIRA 4N26A 4NKMA 3CZLA 4NCC1 2P5PA 3HZYA 1D6VL 3KEDA 4H5SA 2NY3B 3Q9QA 4L1HA 1WITA 2NPLX 1NMAH 2ZONA 3OQ3B 1KB5B 4GEIA 25C8L 2K8QA 4DPRA 5BZDA 2WXFA 3RFZB 3ZDXB 3BZ5A 3FQXB 3N1PC 3R7QA 3V5DB 3PWNB 5C1MB 3L5XL 2ZWYA 1LE9A 4S2SA 2HWZL 5FO2A 4PV8B 3RIFK 3EXJA 2VRQA 1GPOL 1W72A 2WYTA 3D0VA 5AYUL 3ZR5A 4GS7B 2DWSA 2PTUA 2EO1A 2IALA 1KJ3L 4LE8A 4K5PA 3EOAA 4WW2A 3AG4B 3TA4D 3NPZB 2AXFB 2VMJA 5F1SA 1S9VB 3KD4A 4PY8I 1IKNA 4ATWA 5F7EH 4ZMPA 4PRPB 1AGCA 1MLCA 5AENA 4LLDA 1X7TA 1BF8A 1D9KD 3V95A 1B3JA 3HCVA 4F2FA 4E9LA 1NDMB 3FQWB 4MA1B 3WS6A 5K5YA 2FQGA 5IBUG 3FU3A 3X12A 5ID0A 5JUEL 5A2AA 3II3A 3QIWB 3VI3A 1JD9A 2HKAA 4LKCA 1X4YA 4K3JL 2JMRA 3IFPA 1J9QA 4S1DD 3PNWA 2Q7YB 3UAJA 3W11C 1TYEB 3UTOA 5HVHC 3JUYA 4PRIE 3SDXF 3QCVL 1X9QA 3AU0A 3FCGA 2ICEA 3CPUA 1F8TH 2NUPA 4U3HA 5TE7L 3ZO0A 4L4VD 2J12B 1JYXA 3NAAL 1ZTXL 5L4IA 5KBMA 4TQPA 3ROOA 2EZ0C 4G42A 4ODUA 5I16B 2R56L 3PGDA 3FZUD 3MRGB 3DHMA 3KNBA 4KTGA 1U93B 3I9AA 3HZ3A 4WHTB 4AEIL 3WEXA 2CA4A 2QMKA 5I26A 1X5FA 3DOIA 1MAMH 3L1FA 1CL7H 3OXRA 1ED3A 2VRKA 4LPUA 3TJEL 1GR7A 3HN5A 4HJ1A 3TNMA 5LGHL 2E0PA 5E08H 5EBWA 3X13B 3MRNB 5I18L 1KY7A 3VRIA 1RUML 3IDXH 4G6FD 4APQB 1GTNA 4OGXL 3DJTA 2IOMA 4HIJB 3ARUA 3DBXA 5KYXB 2ICWB 5L0QC 1Z0MA 1DFBH 1TFHA 1XF3B 4Z0BL 4DO4A 2HFEB 2R0KH 1EGJA 5LBSH 3II2A 1MWAL 1XGTB 3DBSA 4EPSA 1R3JA 3CPLB 1KV3A 4MFHA 4M02A 2AK4B 4WW2C 5E2VH 1SY6H 1QYGL 4R4BA 1IKNC 3L4TA 4XP6L 1SMOA 3S9DB 4PY7A 1RZGB 4O2CB 3KGUA 2P8MA 3GSXB 3GI8H 1KY6A 5HHNB 3SPGA 3TO2B 3II1A 4UIMA 3WS6C 4EUPB 3B4NA 1UWYA 5F72S 2XYCA 5BJTA 3L95B 3GMRA 2CDEA 4Z3GA 2PCYA 1I1YB 2A9CA 1NMBL 1J5DA 1CGSH 2X5PA 4LCUB 3UAJC 3ZKMD 5JHDD 5KVEE 2XZAL 3VDBA 3N42B 4N0CC 1JF1A 3KM1A 3NG5A 3HI6H 3RAJL 3VFVB 1N0LA 4JY4B 4F92B 1T7ZA 2B2XL 2ICEC 4GW4B 5DO8A 2V2XB 4KGJA 2XFXB 4PTUA 4V1DD 3EH3B 1KXTA 5HDLA 1FO0L 4W9JC 5D6CB 1CC3A 1KCKA 3L3JB 1UT9A 1SQ2N 3IU4H 3TBYA 4GQZA 4TUJA 3IBOA 4XMTA 2ZF8A 2IAAC 5EO9B 4JFFD 4CILA 5KVGH 2RD0A 1QTYT 1F6AB 1BQKA 4OD1L 1HAWA 5FB8B 2QJDA 1MJJB 4AQAA 4B7IA 1CL7I 2DY2A 1TZOA 1D6EA 2VN3A 3QFGA 3FRUB 3BAXA 2JCCA 4PB0H 1RIUL 5KW9L 2A6KB 3U1QA 1OTTD 3U36A 5IMMA 2C7UB 3IDNA 2XN9B 3KBEA 5IEHB 3ARVA 4IYKA 2VXQL 5IVZB 4OZIE 1UKSA 1ETZA 2OSYA 2G5RA 3FOMA 4HMEA 4MJ2A 3GJFA 4FLQA 3B56A 1A21A 2APVA 4WWNA 5SWSB 4FABL 3GZQA 2Q10A 2A9AA 3NJHA 5E6YA 1UH4A 4QPEA 4WKXA 4XRCA 4G9DB 1TJHL 4ZX4A 1R19A 3WTWA 4MQXD 5JHLL 4NM8L 4O2FA 5JOPE 4JKLA 1KCRH 1B0IA 2H7WA 4JPKL 4AOFA 3MOBL 1L6PA 3QIBA 1Q9OA 1FE8L 2YGPA 4EUPG 2OL3A 5FOJA 3ZQWA 3O45B 1NOFA 1XCXA 3BD4A 3FPYA 4OZIF 3LB6C 3CV5A 3GMPB 2ZF9A 4D9LL 4E0RA 3RDJA 2WLLA 3ZHKA 4KV5E 1S7WA 2D7OA 2GI0A 3LZQA 1I9IL 1WTLA 1KIRA 3MODH 4R7DA 3DWTA 3B8YA 3QBTB 5EN2A 1OTSD 4UOZA 3BEVA 3QISA 1B9ZA 4GMTH 3HS0A 4BFNA 4FQ2H 2VDQH 5I24A 1OM3L 3LKQA 3KPPB 4UDUB 3VXPB 1Y1DA 3KXFE 3HZKA 4LBAA 2OQJA 3FN3A 4MJJA 3SBWA 2D31B 2G4EA 1J05A 1AZNA 3IU3B 2CD0A 3FO1B 5T5FL 3SJVE 1TJMA 4AIXA 5IR1B 4HBCL 1JXKA 2WKGA 4NSKB 1P1ZA 5DI8B 4HS6B 4RFNC 4TVPE 2ZSWA 5DFTA 3V8OA 3AADB 4MJ5B 5AZ2H 4N25A 4EN3D 4LCIH 2UY7B 2CIKB 3O3BA 4M93C 4U33A 5IQOA 1E27B 1RJZB 3KLSA 2D9CA 3KPQA 3SDXA 1G1CA 4AYFA 5E9DB 3LS4L 1X4ZA 3ELQA 3P4MA 3QYMA 3BVNB 3EKCA 1S4IA 3VTTA 2Z7WA 1UZ6E 4I4WA 3D05A 4WY7H 3T09A 1MHEA 1KJMA 4OKDA 3K5RA 2KI6A 3ZE1B 3PF2A 5T33L 3QIBC 2XQBL 4PY8J 5LXGL 3DVNA 3HMXA 3PQYE 1IX2A 1QSEA 3V52H 3OR6B 3ZYIA 4CJ0A 1JN6A 1FCGA