3WU1A

Crystal structure of the ets1-runx1-dna ternary complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
123
structure length
123
Chain Sequence
LADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 20
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wu1A00
1EANA 1T4WA 2RMNA 3Q06A 2PCXA 1E50A 2XWRA 2J1YA 1GZHC 4IBVA 3D05A 3WTUA 3KZ8A 4AGQA 3ZMEA 4XR8C 2H1LM 5AOJA 4IBSA 2X0WA 4L0ZA 3WTTA 1YCSA 1LJMA 4AGMA 1HJCA 4HJEA 2X0UA 4IBQA 4IBUA 4L18A 5G4NA 3IGKA 1IO4C 2IOMA 1TUPA 3D08A 2YBGA 5ABAA 3WTVA 3Q01A 2IOOA 2J1ZA 2BIPA 2J20A 2VUKA 1HJBC 5AOLA 3D07A 2BIQA 4A63A 3VD2A 1KZYA 1GZHA 3WTWA 5BUAA 4MZIA 1EAOA 5AOKA 3TS8A 2WGXA 4IBZA 5G4MA 4IBWA 2BINA 5G4OA 4MZRA 2AC0A 3US1A 1CMOA 2ADYA 3D06A 1TSRA 4IBYA 4AGLA 4AGNA 5KBDA 2FEJA 3Q05A 1H9DA 4GUQA 3D0AA 3EXLA 4QO1B 5AOIA 3WTYA 2MEJB 3WU1A 3QYMA 4IBTA 4GUOA 3WTSA 2AHIA 3US0A 5A7BA 3EXJA 5LGYA 3QYNA 4AGPA 4LOFA 2J21A 3KMDA 2X0VA 2P52A 2ATAA 1HU8A 2BIOA 3IGLA 2OCJA 2BIMA 5AOMA 5LAPA 1UOLA 5AB9A 2GEQA 5ECGA 3VD0A 4IJTA 4G82A 4AGOA 3D09A 2IOIA 4G83A 4LO9A 2XWCA 2J6WA 2J1XA 1EAQA 4KVPA 4L0YA 2J1WA 4LOEA 1CO1A 3WTXA 3VD1A
chains in the Genus database with same CATH superfamily
7CGTA 4GIOA 3QJHB 3T65B 1P4LB 3KHOA 4AIXA 4JHUA 4GRWF 3A4AA 4N22A 5BVJB 4N8VG 4NUQA 3IDJB 2JJTA 5K93A 3X11B 3FMGL 4TTDC 1UA6L 1PEZA 4N9GB 1DQDL 1RERA 3E3QE 3ZL1A 3OHMB 3KE0A 5C6PB 4PLJD 1I4FA 1AZBA 2G9KA 1A4KA 4WHTA 4KK5D 4Y0GA 5D1XD 4O58L 5C0JB 2X4NB 3DX8A 4AITA 4HC1A 4R2GD 5JHDD 4GBXA 3MDJA 5B22A 2IPKB 3D48R 3WAJA 1R0AL 1R6VA 5DSCA 3N85H 1DBJL 4MMZB 5AW3B 3W0WA 1DEEB 1GZPA 3VXME 1Z5LB 4LIQH 2D7QA 3DGGA 3ES6B 4IRJB 3ROOB 4IIZA 2WWMD 3OKDB 3BP4B 3NJMA 4K5OA 5HHMB 4DGWC 4G43B 2OYLA 5DGQA 1HHKB 5L88L 3TH2T 1RUQL 3QUZD 3CVIH 5F9OH 3PWJA 2EXTA 2VLKA 4OGXL 4OZFA 5AOKA 3V5HB 2O5YL 2FHCA 5IKCB 3R1GH 5EN2B 3K4AA 5EUKA 4ZX3A 3ZQWA 1JHLH 4NENA 4FNTA 1YNTF 4ZMNA 3ARQA 1JGIA 4MCZA 4G5ZH 1T5WB 3UIYA 3OJDA 3RVXD 2HTKC 4G59C 3WNMA 4HZ1A 2ZICA 4M6NL 3VDBA 1JN6B 3MCKA 2WOYA 4NQQA 4TM9A 2VISA 3GMMA 3DDGA 2X4OB 3B56A 1MPAH 3N6YA 4MBRA 1NTDA 3HRZB 3MRDB 5A2KH 1INDL 3TA3C 1CXEA 4DP6X 5E4AA 5IIEA 4PJCE 3RE0A 3MC0A 3N1FC 1SLWA 1TZIB 1YEDA 2L0DA 3VFRA 5GRUL 3WKQA 3QUHA 4IRZA 1EPFA 2BW4A 2NTFA 4WW2F 4JFFA 2XQBH 5TFSH 2A6KB 3FFCA 2FWLB 2Z93B 1OSZA 1DQQA 4X4YA 5LCVH 3GMOB 1IEHA 1TQBC 1VFUA 4UV4L 5GZND 3ZYZA 3ALXA 3C5SB 2EJ1A 2YUXA 5GGQL 3MNVB 3MLXH 4K55A 5DZJA 1UA7A 3IJYA 3LY6A 3PDOA 3SE4A 4R96A 1D9KA 4JHWL 2RB8A 4B9ZA 1T3FA 2DQHH 2KHAA 5K9QI 1SN2A 1N4XL 3VWKB 2BO0A 2XZQL 5JIMA 3T9WA 3W39B 3PG2A 3ILPA 1E3XA 3UG3A 1KULA 1P69B 1MI5A 4DK6A 1YZZA 5C92A 4WF7A 7PAZA 1KB3A 1NGPH 2R2CA 4XWOC 5DUJA 3IMTA 1AVAA 4N9OB 3AU1A 1PZ3A 3RWDB 2YWZA 1GS7A 2ICWI 3OAZK 3SBWC 4JE0A 4PWFA 5JO5B 1LD9A 3RLSA 2VXQL 3KPPA 1I85A 4XODA 4XR8C 5D1QA 2BFVH 5AW6B 1GC1L 2VABB 2J8UA 1KIQB 3LX9A 3V0JA 3ZZ1A 3PUUA 1I7ZA 2ZYRA 3HW7A 2GSGA 1IIKA 3C09B 1NMBH 4K23L 3VXTA 4JUSA 4QO1A 2ESVA 2XIIA 2QADC 4GS7B 4LAQH 3ZT5A 1MRCL 2BOLA 5ICZA 5D1XE 1NJ9A 1GAFH 1T83A 3D7PA 3NFPA 5HPOA 1A7RH 2X2JA 3CC5B 1NCGA 4IM8A 4JJ5A 4JM2C 4FQ1L 1I9JH 1X44A 5G55A 3TV8A 4YDJA 2CCLA 1RP8A 4YE0A 5E9DD 2CM5A 4S1RL 1CFTA 4ZDHA 3NJLA 5HDOA 1UZ6E 3WENA 1DZBA 3OX8A 4HUXA 3N1QC 1IILE 3NCBB 2P5WB 4ZTPH 5H2BA 2XRAH 5IESH 4GXVH 2RA1A 3CAFA 3QZPA 2EVGA 5HYQA 1KUMA 1MCFA 3PCYA 2AERT 3DJZA 4UI2A 5D8JH 2F54A 3WE1A 1N10A 2J1KA 2FJHB 2OXGB 3IFOA 3UAAA 2XU9A 2GJ6D 2F7IA 1E5BA 3B7TA 4M7LT 1TKWA 4F33A 3SDCB 3ZKND 3OXSB 3QR0A 3F6LA 4M1DH 1HHIA 4LMQI 4D8PB 1DVYA 3GBNL 4DW2H 1DBAH 1HE7A 4U4IA 4U1LB 1OPGL 1VGKB 3QFJA 1KYOK 4JRWA 2YRBA 1JHKH 1IIIA 5C0FA 2AJZB 4OF3A 2VSMB 3KDPB 1NBYA 5KS9E 3T4AA 4QTIH 3IPEA 1BQUA 2FR4B 5INCA 4GKSB 2C4FT 1ZEAL 4JKMA 3D8MA 1RULL 4W93A 2YLHA 4YSAA 1NPNA 2PPEA 2B4CC 4KRPD 3MOAL 4Z3FA 1MRFH 5BMFH 4WGKA 2H3NA 4UDTA 3U36B 2APFA 2CXGA 4WKZA 4EI6B 2ORBH 3F7LA 3HMWH 1RV6X 2Y7LA 4I3SL 1WD9A 3APCA 4EMZA 4LPCA 3TL5A 4HUVB 1DJXA 1U92B 2VDPB 3T0WA 2WBXA 3RIFK 1QUPA 2F7OA 4O4YL 5HI5C 5I8CB 4PRPA 3P3SA 1DN0B 2Z1KA 2A9ML 1QO3A 2ZD0A 3KLKA 3BUIA 4CMHB 4YHZL 4R90H 1C12B 2HN7B 1WAAF 1JTOA 3LEXB 2V37A 4XXDA 4Q74A 3ZDXB 3ZHNA 3MGTB 1XIWB 5EUOB 4FG0A 3C6SA 1A3RH 2BNQA 3QDGA 3Q8AA 1AIZA 1QSED 1HHGB 4OUOA 3AXIA 3GLEA 1KBGL 3S36H 2C9SA 4APQB 3G7TA 4KQ4L 4I1NB 4JPWH 3UC0H 3OD3A 4DN4L 5A6IA 2P4AB 2G5UA 4JY5L 1HKLL 4HJ1A 2PPDA 3FQ2A 1MFMA 4I9WE 5CIPH 3WHE1 1KEGL 2XY1A 1MQKL 2IGLA 4PJ9B 4PJ5B 3SPVA 4YX2L 1X5XA 5ADOH 1FL5B 2CBQA 3WNNA 1G9HA 3I9PA 1BJ1H 4J8RB 2RQEA 1BA9A 2XQYK 1XF3B 4XMTA 2NYYD 2VAJA 2Y6SC 3OB8A 1UOWA 3ZE2F 3Q2VA 3VI3F 4X42A 2XG4B 5E9DE 4FXLA 2FWSA 3OF6A 2WQAA 5JHLL 4P4KD 4UBDC 5CILL 2CXKA 1EGJA 1JGEA 4RX4A 3JUYA 4H40A 1BIIB 4OCRH 5LWYL 4GUQA 3RPBA 3JUZA 4D3CL 5FGRA 4Z3EA 4OCMC 4KVNH 1I9IH 1KELL 4RZKA 3W3BA 3WFBL 2Y06L 1IBHA 1CZ8H 5D7JB 2GJ6E 2V3DA 1ZE3H 4NRYB 1PZAA 4P2OC 4WW2C 3CU7A 5C0CE 3LKPA 3QIUC 5B38A 2XV3A 4GFXA 2GEEA 2H1PH 2YPLB 1EHNA 1P4IH 1UQSB 4M7KH 4UQCA 5B39B 2VXTL 3DVNB 3EG9B 4G8FA 1TJGH 3NIDE 1SGKA 4JO5A 4R83A 1WHOA 1HZHH 1W9XA 1E6OL 3BMWA 3C8KB 2J4WH 3IGLA 3QJXA 4NO5B 2P5EA 3AGWA 4JQIH 4Z0BH 3U46B 3BFOA 1G6RA 2FL5A 3FQXB 4TSCL 1EVUA 1DANU 1MHPL 1MQ8A 1OT4A 1ZVNA 3OB0K 1QVOA 3OKEA 4QCIB 5IV2A 5GGTL 4OFPA 3ZW3A 3LHPH 5I9QC 1SEQH 4JPQA 1A9EB 1EQWA 3HI6L 1I8IA 3ML8A 3OB0H 2ZG1A 4G8IA 4PJGE 4R4FH 2P7TA 5E5MA 2OMYB 1FVDB 3SQRA 3QO0B 4KXZH 4YHKL 3F12A 4K8RD 1EBPA 1XZWA 3LSOB 2X87A 3N9GH 4LLDB 4YBHA 4DOHE 3HC2A 3QUYA 4PB9L 4S2SB 3PHQB 3S3JA 4F57H 1I53A 3GI9L 3MO1A 5GXBB 2I9LB 2LVCA 2H0FA 3X14A 4EOWH 4Z76A 2GVYA 3D30A 1RZFH 2NNFA 4QHKJ 1M42A 5JZ7C 1R5VB 3BAYA 4W9LC 4WW1B 3MA9L 8PAZA 3CVHA 5AOJA 3T5WA 5CJ8A 1LMIA 1SOXA 2E7DA 4XGZA 5A6LA 4LSDA 3HG4A 1OALA 3P77B 2ZSVA 4QHNB 1MCJA 2DQUL 5FGCE 1QSEE 5FYLH 5I2IB 1QTYT 4X6FB 5E56A 1YJDC 3HE6A 12E8L 3GIVA 3K2UH 4ZI8A 2G5BA 5F8QC 4JFDA 5HDBB 4WNJA 1PDKA 5C0RH 5INDA 1JRHI 1JGLL 1CE1H 3T08A 1SVCP 1FE8H 5HJ3B 4U6VH 3T8VA 2VRQA 1WWAX 2YQ2A 1G43A 1RK0A 4FLSA 2YJQA 3VJ6A 2APSA 1U95B 3QB7C 4XVJH 1BMGA 4WHCA 4XZ4A 5LBSH 4M93C 3EF4A 3NGBC 4KX9A 3NABH 2XZCH 3FQWA 3WEOA 2QQNH 3QDAA 1KB5B 1QTSA 1SJHB 4OD2A 4Y2DD 1IBDA 4EAEA 2MPVA 2C8NA 2DQIL 4XP5H 1MCOH 4HISA 1Q0XL 4U7SA 2J57A 3DMMC 32C2B 1OLLA 5E6IC 5HYJD 3BPNC 3VE0B 1QP1A 2APWA 1XVSA 1CXIA 3VYPA 1TYEB 2XC8A 4NC0B 1L5GA 1M9SA 3LKNA 3GC3A 2PCPB 2FJGB 1X6NA 1AHWC 3MRFA 5IMLA 1WZ1L 5JXEA 4NKIH 5D9SA 1SN0A 4YAQB 4AVKA 3AT8A 5HHOA 5T1KA 4CKVX 1D3CA 4IGBD 1IC5H 2KZBA 4LXFA 1FVCB 3O3AA 5I30H 4MCYA 1FH5H 4K3JL 1KPUB 1TTGA 3CN4A 4JFED 4QRQA 1E9QB 4LKXA 4ZUVB 2DAVA 4ERSL 2DLFL 4TVPD 4LHJB 1JV2B 4FS0A 4PQXA 5B8CA 1LE9A 1EFQA 1TETH 1OWRM 3EO1B 3CFIC 3V5KA 5T1LA 1WUNT 3AWGA 3PGDB 3CFUA 5I18L 3PWPB 4JFUA 4X5QA 2HLAB 1TR7A 1NCTA 3KPMB 3FQNB 4HWZB 3VFNB 4FQPA 5EFIA 3KYOB 5DZAA 4PJHF 4ALAC 4JFPA 2UY7B 3DBSA 2P1YA 3X3FH 3BKYH 1ZSHA 5DEGB 1N3NB 1RURL 3DC0A 4W9IC 1AXSA 5DDHA 1J0YA 3EFOA 1FZMA 2CIKB 2FWOA 4FC3E 5MEQB 4IU3B 5SWSA 4MQSB 1VSCA 2XN9B 4QRSA 2ZYIA 3FDWA 1CGWA 2AQ1A 1UXWB 2XTJB 3P0YH 5IR1A 3S96A 1BFVL 2CKBB 4DTGH 1I1RA 3T3PB 2ZWLT 2XQYG 4WHDA 3LAFA 3N41B 4JGNA 1SY6H 3UYOD 5HYIA 3KH3A 4GQRA 4IMKC 1QBAA 1Z9LA 3TZVB 2BZCA 4CSZA 3F00A 4OIIH 3VG0H 3HE7B 1XB8A 4WWKB 1P1ZB 1HSAB 5TDPB 4HGMA 1VFAA 1X5FA 1T03H 4I0PB 2AABL 3AT0A 1DJZA 3MRHB 2CKBL 2FATL 5GSRA 3QQ4A 1BXXA 1AD0A 1QRNB 2I5YH 4K7PX 3UC2A 4KO5A 4O51B 4BZYA 5HHPA 4QY8A 5JXAH 1WFTA 3MUUA 2P26A 2R0KL 2NY7L 5KVGL 1ES0B 4M43H 1AC0A 4MNGE 5CBAB 4N5ED 4JN1H 1O5DT 1VACA 4AJVA 4CADB 1J11A 1B0RB 3L3OA 2DYRB 4KO9A 4Z7NB 4L1LA 4PRNA 4XNUL 3A0OA 1N5YH 1IKFH 4ZMTA 2WBJA 3SY6A 4BUHA 5F72S 3VGFA 5TE4L 2BVUA 4FLHA 1KTRL 1O9ZA 4RNRB 1E67A 4JRXB 3LCYA 2DDQH 4G6KL 4JVPA 5DRNA 3WUWA 2WZPD 4U6HA 2YK1L 1TMQA 3I3EA 1X5ZA 4G6JL 4I5BA 4PJ8C 5GJSL 3KPSB 4G7YH 4RQQA 1BYPA 5IBTL 3TCXA 3SKUD 4UT9H 2R69A 1XZ0A 1V10A 3N43F 3IXTB 4PIBA 4CN4A 2IANA 5JQIB 5KYYB 3IDMA 4OQTA 4YSPA 3IJSB 1ZWIB 4RDQG 2ZXGA 1RZGA 3ARBD 1EXUA 5I1JH 1WC7B 4UF7C 2A2QT 5KTEH 1BXAA 1COBA 4RAHA 2XV6B 4E9QA 5IVXB 1AI1H 2BVYA 4M1GL 5EC2B 1OB1B 1LP9A 4PBWD 5B4MD 1JBJA 4BK8A 3JT2A 1OLZA 1JGDB 3CXFA 4NDMB 3MJ8A 4N0CC 2IAMC 4WV1A 5L2JA 3LB6D 5I76A 1RLBA 3PHSA 4BE6A 4ZW5A 3FCUB 1JZJA 1OAZL 3C5ZA 1W6WA 5DO8A 3WIFB 4PIRF 5IJDC 5LDUA 3TTSA 1A47A 3K72A 3Q9PA 4AXWA 3C6LC 5IUCA 1XCXA 2XY2A 4L4VA 4EKJA 1I3GL 1KLFA 4XN5A 1ZKAA 2WP3T 3LIZA 1NCJA 3MODL 5F9AC 3HZYA 1OV8A 4YDKH 4HUWB 3L4CA 1G9ML 1TEFA 1NAKL 3EO0B 4QAMB 5EU5A 2X4PA 3IDIB 1REIA 3QRGH 1DUYB 3ABZA 4AI7A 1F6FB 4QHLB 5KBPA 4OV5A 4LCIL 4PN6A 5IK3A 3BRGC 4L8BA 1MFBL 3D12B 4C56B 2GTWB 4NUJB 3KWUA 4PYGA 1MZZA 1MN4A 4DZ8B 4PTUA 3FT9A 1TUPA 5CS7A 3VXUD 1E8WA 1SXAA 3ILDA 3X3GL 1FGNL 3KPQA 1ORQB 5DT1L 3P3TA 3CSTA 3RY4A 4X8GA 5CJOH 3NJIA 5KAQG 2C1PB 3BD5A 4LQFL 1C5DB 2BNRE 4ODXB 1Z9SA 5DHVB 4QR7A 4KKAD 1K4DB 3V8CA 5A2LH 4J39A 3D18A 5C0AB 3STLA 1JZFA 4D8OA 1ZHLB 5I8KH 5IB1B 3MRQA 5CP7B 2Y1ZA 4PY7B 2EDLA 1WZAA 3BRFA 3NZ8B 4I89A 1CYXA 4MNHB 4KK6D 2K9FB 2P80D 3CMOH 5FAAA 1JF5A 1KJ2B 1A1MB 4ZW3A 3BWAA 4OLWH 2HVKA 4PJ7A 1DJIA 1ZT4B 3TT1H 1AXTL 1MIML 2FX8L 1I8MA 5TE6H 3TBSB 4NN6B 5BQDA 2Z65C 3SODB 3CDGA 1NMAL 2G3ZA 5CWSA 3MBXH 5H35B 5E5LA 2AZUA 1NWPA 3WEMA 3BZ4B 4HKZB 3W5MA 4NXKA 1P5UA 1FNEB 3G9AB 3MLZH 4L3ED 4BFNA 1BOGA 3GM8A 3EW3B 3T09A 4EI5B 1I1AC 2X4SB 2ZG2A 3QQ3B 5ECGA 3TPKA 4LOVA 3V5DA 1I7TA 3BQUC 3M17B 2K70A 3L6FB 4OQ1A 3SDXA 5JW3L 3OAUH 1Z32X 3BUDA 4MLSA 2OMNA 4OZHA 4TUKL 3MV11 5CEXB 4J6IA 4HJGA 1VFBB 4KROD 1JXFA 2D4DA 5I6MA 5JMOC 3LKQB 4WGWB 3U2JA 3JWOC 3ARSA 2DKSA 1PZUB 1A6WL 1GOGA 1CDGA 3L5XH 5LAXA 3LV3A 2WM0A 1BD2B 1BWWA 1LO5A 1O6TA 2NY4D 3CG8A 2VN7A 2ZOUA 3WO4C 1DCLA 1XT5A 2Y7SA 1TVHB 1ZIBA 1LWJA 2L7QA 1WS8A 3O2DL 1HNFA 4PRBA 4RRPM 2YRZA 4MSWB 5C97A 2CJTA 2L3BA 5E95B 2IG2L 1AE6H 5KJ7E 2DTSA 5FIEA 1XGYH 5TF0A 3FT4B 3GXMA 3B43A 2XWTB 1Z5LA 2H1LM 5F6IB 1M53A 3LZFH 2YC1A 1KTDA 3BP4A 3OKDA 4AW4A 1XGTA 5AKRA 5BS0D 5H37H 4LCUA 2YXVA 2VZUA 4KY2A 4QRPD 3TO4C 2NSMA 5AB2A 3CXDH 2NNCA 1YEJH 4PRAA 2VXUL 2YAHA 4XC1H 3QGVA 5I6PA 4ZQKB 3W81A 3VQLA 4DQOH 1H5BB 3NK3A 4OD1L 1QWNA 5HI4C 1MVUB 4NT6B 5C0NC 3L1OH 4YLCA 3PGFH 4JNXA 1DO5A 2G60L 1IE5A 4OLUL 1JRHL 1XGZA 1T5WA 4M8VA 2GAZA 2KI6A 2JH2A 1OIOA 3IJ9A 2ATPB 4G1EB 2IDUA 3GSXA 4JY6B 1JV5A 1A6TB 4DGYH 1D9KC 5BV7H 2X38A 2ENQA 1IC1A 4JKKA 4W9KC 3SOTA 5ID1B 5B21A 3TXAA 4PGJA 3CBKB 1U8HB 3ZHFA 3BPCB 3HLAB 4YSOA 1RZKC 2I26N 2X4OA 1NH6A 4KKNA 5T3XH 4PFEA 3JV4B 5DC2A 1MAML 5AENA 3FO1B 4AGLA 1X5HA 5A6MA 5ETUB 2BSBA 2F19H 4NZJA 3H2QA 3MJ9L 1KDJA 2WO3B 5JYLA 3BGMA 4GG6F 1KN2L 3C6EA 5FEBA 1NBCA 5JNYB 3UTSB 4XO5A 3ZT6A 1M2VA 3QRFM 3H7BB 2BVOB 2J3SA 3PV7A 3N2JA 4WO4D 2E4TA 2Z3FA 4OFYD 3RL2B 2Z93A 3M7OA 4XCEA 5EEXA 1PLGH 5DR5H 3CFQA 2OP4L 3GMOA 2JK5B 3MBEA 2ICEC 3GJEB 2ADIB 3ELQA 4HJSA 3VDCA 4KMTL 5IW1A 5LQBH 3CHPA 2B2XH 3SKMA 1ZVSB 5EB9A 5IWLC 2AQSA 5CP3A 2CO3A 5KVFE 3IS1X 1Q0YH 1KJMB 1I1FB 4UNUA 1OVZA 3QUXD 4P5KB 1YEKL 2VC2H 4NUGL 3TJEH 3MA7A 4H26A 1ASPA 4P5MB 4P48A 3LN4A 4Y19B 2AJVH 5FHBH 4XVSH 1QLEH 2C3VA 1G7LB 4ILDA 2BIIA 2NR6A 2XICA 4HS3A 4I87A 2P42B 3ZO0A 3B7YA 4WFFD 4YS4A 3QZBA 2HMID 4PW4A 4I3GA 2VN6A 1GIGL 1LVEA 4IRSC 1SYSB 2HLFC 2SEBB 5GRJL 4M8QB 1UD2A 3OKYA 4UM9B 1BYNA 2X6MA 1E40A 5GRVL 4ADIA 2VW4A 2JI2A 2YAFA 3AB0C 5F88B 4FHKA 5DEFB 1AMXA 5JIDA 2GJPA 1EZVX 5B3JE 2GC7C 3NCYP 4PW9A 2P44B 3CH1A 3CX5J 4U3SB 3HR5B 2R27A 1W0VB 3CC5A 1NKRA 1V3JA 1E43A 2FT6A 5T5FL 3S34H 2VDOB 2MPAH 3MRIB 3QDMD 1FCGA 4ZFZB 1T4KA 2F7QA 2VMFA 4XMPL 1UG9A 1P4BH 3B9KC 5BS0E 4ZW7A 2FK9A 1P9MC 2XTLA 3LOWA 1AZZC 4KI1A 4QRPE 4ZAKD 4XCCH 1B4RA 4MNQA 4MD4A 4H8WC 5EU3A 4A2GA 3TF4A 2OI9C 2PLTA 4K9EL 5E8PB 3KDMB 4UT6H 1M56B 5E00A 2FJHA 3GNMH 2J56A 2VDOL 4K3EH 3NH7L 2DTML 4LSTH 5I0VA 2EVFA 3RVWD 5J5EA 3UJTH 3OXSA 1H8OA 4D9RD 1IQWL 3EYQD 1IC4L 3HB3B 1BF5A 3CK0L 3MLVL 4ZXBB 5GHWL 1G7PB 4AQ8A 5CEYB 4UZGA 5C0GB 1WZLA 4PBXA 5JMRA 2XZAL 4I77H 2W0LA 3E2HC 2ZKWA 4PJEF 3ZKXB 4PY8J 3WE6B 3L08A 5E8EB 4L8CB 5I1AA 4UNVA 2FX7L 3FHEA 3TIEB 1DQMH 4B9IA 1KG0B 2UXGA 3LPOA 5GGSY 4LGRB 4TN9A 5JOFA 4YL4A 4LSVL 3ZTNH 1YEGL 2H6PB 2VL5A 3DURA 3RPIB 3T0EA 2WB1A 3JVGC 1NC2D 2KBGA 1UWEH 1XH0A 4KC3B 1E4JA 2F7PA 4HUVA 3NIGB 1S9YA 2Q7YA 2FO4B 3P9MA 4UM8B 3B34A 1JYVA 4ELKB 4DKTA 2OTPA 4FMFA 3AXHA 3IK2A 2G0KA 4J3XA 1RZJC 3HUJA 3IDGA 3EYVB 1HYRC 5K39B 1FYTA 5H37G 5ECJE 3A67H 1JXJA 1KTBA 2FHFA 4H1LA 5DJAA 4BGDA 2HVJA 4F92B 4KQ3L 4UYQA 1ILSA 4R7NB 1MUJB 4MA8H 4OGQC 4KHTL 5EUOA 4YSRA 3BKJL 3TFKC 3VCLA 1RUPL 5CHNB 1S8DB 5AYUL 1NKOA 3MRNB 4NXSA 3ARFC 1GSKA 1KT2A 4X7TB 1A6PA 5M94B 1U93B 1RI8A 2OLDA 4WFFE 2XG5B 1KCUL 2UZXB 3GK8L 4N2DA 1IKOP 4HU8A 4N8VA 2N7SA 3DOIA 2YRPA 5DUPH 3LEYL 2PPCA 1LNUB 1BQLH 3LZPA 4BQCA 2LHAA 3LHAA 3PJNA 2AJXL 4M7LL 1TTUA 1RJYA 1ZRUA 4YHYB 4PJ9A 4Y2OB 4IOFD 3GMNA 3ULSB 4J8RA 1JWSA 1ZJBA 4PJIB 3L5HA 3LH9A 5D7LA 4M9PA 1TZAA 2AQRA 4LEOB 4UQ2A 3K74B 3QDME 2ZJSH 5FYKD 3K8KA 4AZUA 4XE0A 3T2NH 3RVTD 1MCCA 3WSQH 1QNZL 4G8GB 4CRPA 5JYMA 1PZDA 1RZIB 2N3JA 2WQXA 4Y4HC 4ZFQA 2BC4B 4ENED 1MCWW 1KACB 3KXFA 4POZC 3GS4A 5DQJB 5DUBA 2PWFA 4XH2A 1IGFL 3QH3B 4KXCA 4KUCF 1T66D 2NY6D 3QUYC 5CGYC 1TSRA 3ILQC 3WD5H 5F3FA 1T0PB 2DYPD 4D9RE 2W60B 2YPLA 3FFDA 4XNQB 1OCWL 4NB7A 4OLEA 3DROB 5B39A 3GFUA 2R0LH 4PD4J 4DVRH 4OGAD 2HT4C 2CMRL 1J8HD 1G7HA 1IC0A 2E4FA 2FQGA 3QUMB 4JO2L 3TVMD 1DLHA 3WDJA 3C8KA 2ZXBA 4V2BA 1S5IH 4Y5VA 4NO2B 2ZUVA 4MAYA 2IFGA 1U8IB 3BD4A 4LHUG 5AWNL 4BBWA 3FQXA 2Y5TA 2A99A 3LZRA 2WLIA 4J6RH 5F3BA 2KUTA 1KF9B 3ZQ9A 4L37B 3SCMC 3BHBA 2NZ9D 5TTRA 3QUML 4LDCA 1ZAGA 5JHMA 1FBIL 4X7SH 4X6DB 2Y5EA 1CLOL 2XT1B 1FVDA 2Z6FA 4M1CD 4EZLA 4QXUL 1TQCC 4C4KO 2HT3C 2IFFL 3IPFA 1ZVHA 3WGVB 2EE2A 3MSPA 1E2WA 2GUOA 2NCEA 3HHSB 5BW7C 3MROB 3GWJA 4HF5L 4MJ5B 4X0KA 2JSFA 5E08L 4NQEB 4KV5F 1KIPA 2GB2A 1WCBB 1XMWA 4LSSH 4W9FC 3SOBL 4JFYA 4A55A 4OI8A 3C12A 3GI8H 5DD1H 1R3IL 1JP5A 2BMKB 4AIEA 3Q5OA 2QPSA 3FN0H 1S7XB 3BZFA 3ECBB 2PXYA 1XF4A 4QHNA 2XBZA 4QGTA 4U1KA 1FG2A 5D7IA 2ODIA 1YEWA 3UTQA 2I60H 1FPTL 4P9HC 1EO8H 4C8XA 3EJYD 3VI4B 3MJ7A 4FFVD 4J23A 3H9HB 3IAGC 4U1IB 2E7LA 3KW7A 1GOFA 3NUKA 2PTTA 4NZDA 3HI1B 1XH3B 3Q3GA 4OF8A 1FAIH 4PSPA 4I7ZC 4PM1A 4YDIL 4PREA 3GXIA 3PQYB 1AR1C 1AQKL 1WISA 3V6BR 4G3YL 4AL8L 3QIBB 5EOQH 4MGXA 1XFPA 5KW9H 4QLWA 1SJHA 3MRRA 3MV9B 3SGKA 5E2UL 4A6YH 4PW3A 2ZPKH 2VKXA 5HPMA 2A4EA 3EGSB 4CNIB 4DN3H 5A2FA 1R33A 2E59A 3EOYG 5D7SL 3CFBA 2H26B 2YKLL 4U6YA 2C9RA 3LQMA 4QLRA 5FYKE 3U1SH 4UMSA 4OQTL 5GGRA 1JGUL 4OZHF 1CD0A 1F86A 2F5BH 3RWGA 2VR9A 2GK2A 3I85A 3TBWA 3FF7A 3EJZD 3LEVH 4WEBL 3TH4T 2ITFA 2OL3H 2UZIL 4X7EC 3OGCB 4FRWA 3ME0A 3V10A 4NWTH 5CJ5A 4R97B 4EQ3A 4Y4KC 2QT6A 1YEHH 2XDHA 1FIEA 1IGYA 1P84J 2M2DA 2F08A 2YPKB 4GUPA 1LGVA 4N6RB 1WLHA 3RIKA 3EJTA 4YGVB 2FQEA 4OCYH 2AJUH 2WN3A 3PWPA 2EDXA 3KPMA 3FQNA 1C5CH 1N26A 2Y3AA 1J8HE 4JDZB 4CVXB 2ICCA 2NXZB 2DWSA 1IAII 1IM9B 4MA7L 4X5WA 2PW1A 5IHUL 4P46C 3UCRA 5KSAA 4NQDD 2FWUA 2OFQA 3T4YA 2Q7NA 4L1TA 2ZAIA 2B5IC 3NSDA 2CIKA 2X41A 3FQUA 3NIFB 4LPXA 5MEQA 1NUGA 2PKDA 2X4UB 4AJ0A 5CO1A 4A68A 4HG4K 3ZJAA 1Z0NA 2VAAA 4LO9A 2QVFB 4Q6IB 2H3KA 4N0UA 1UH4A 3D39B 1DZ0A 3K6NA 1MCNA 5AEAA 5TH2B 4C4BA 3LQAL 4HOWA 1RJLB 5DHMC 4YK4B 1QPKA 3MLUL 2GBTA 1J1XL 3TZVA 3U0TB 5I0DA 3LS4L 1O6SB 3AUVA 3K5RA 5E4OA 2APXA 4TUOA 3DX6A 5CR1A 2JIXD 1KYFA 5AVVB 2W95A 4NCC2 3KYNB 4I0PA 3MKGA 4JVUA 5C9KA 1QKZL 1CCZA 5M7QA 3MXWL 1PY0A 1NCWL 2Y7OA 4D9QE 4KTEH 1M7IB 1LILA 2AXHA 2WWKO 1VFOA 4TNVK 2DIAA 1JSYA 4N6QA 2Q8AH 3C2SA 5ANHA 2CNZA 4ANKA 1NCAH 3V6FA 3HZKA 4O2EA 4Z1PA 4CADA 3H9YA 3P2BA 3BSZH 3D52A 4P2RD 5BZWB 5IJKA 2HRHA 4WV1C 2X9ZA 5IHZB 2WVUA 1Y6NR 5D1ZC 3U7YH 5IROD 4JRXA 1YPZB 3B7UX 1BZ9B 1IGIL 1MXDA 1BLNA 1S7SA 4MX7A 5JR1L 3CUPB 5EZLB 5ERWB 4PUBL 3AJ7A 3QEQE 3LPPA 1UZGA 2AK4A 1GY1A 4DAGL 2CH8A 1T6WA 4MXQD 3P0VL 4XMKL 3EOBB 4ZPVA 1HHHB 5LCVA 2MQ0A 4LLVB 1MLBB 3D06A 4Y2LA 3VXNB 2PCFA 5KYYA 5EZJB 1NA8A 4G6MH 1SBSH 4XB3A 1J8RA 1OXYA 2IADA 1DBKH 1RVFH 5GS0L 3ECVA 4YH6A 3VRIB 1W72H 4BFRA 1DANT 2R59A 2L8AA 4BFGA 2J6EL 4FFZL 3JWDL 4H0GA 2FIKB 4IBTA 3L4TA 3RY5A 5HXMA 3X1GA 1JFQL 2QQKL 4NERA 3ZUNC 2VC2B 3KLLA 4MS8D 4HJ0C 4P23A 4L48A 3VW3L 4KJWC 2YA1A 3P4MA 4JPVL 4ZNEA 4LKCA 1PQZB 2EDNA 4RH4A 4NM4L 3DUHA 4NN7B 2IQAB 3E6HA 1DCEA 3L17A 2O4EA 4PV9A 1HL8A 1OCRB 2RJMA 3BLKA 2XETA 1UM4L 4FYRA 3WIFA 2HJLB 4PJAB 4WUKH 3CSPA 1UB6A 5DRZA 3MMEA 4CW1B 3F3HA 4XBGA 3IM1A 2YHGA 2CBMA 4HUMB 3IRZA 3LNHA 3OMAB 3T04D 3WEAA 5JPNA 4ODUA 1CICD 1NDMB 1N64L 2LVEA 2H7WA 3BVDB 4MA1C 3QZNA 3O3DB 5D2LE 3B37A 5ADPH 1N18A 4OJYA 4HALA 1PIGA 2AKRB 3RTQD 5F8RC 2K9UA 4PWHA 3IDIA 3O6LL 1JDAA 2DMCA 3H3KA 2NXYC 1F3DJ 1MCLA 2VGLM 3TT3H 1S9XB 3MRKB 1P7QD 1WIOA 3VFVA 25C8L 5SX4H 5EOCH 5CKGA 4Q2ZB 4MQXC 3EYUH 4GAYB 4UMGA 4JZNB 1QZ1A 2EABA 1RZPA 4M5SA 1HSBB 3BPOB 2A77H 3DX7B 3MYZA 4KTGA 3W38A 2WTPA 3AREA 1NBVH 4TXVB 1BBDH 3VXRB 4OB5L 3EYOB 1DFBL 4B5EA 4RWYH 4YJZL 2C1PA 1A6VH 1T80A 3PDGA 3ZTJH 3KR3H 1JE6A 4ZNCD 3ZXAC 2VLLA 3ARUA 2Y0SA 1OSYA 3DSNA 4K94H 2DQGL 4OIAA 1IFHH 3PHOA 3X1EA 3NJGA 2WPGA 4NUPA 3DX9B 2ATKB 2A74C 2DWEB 4MNHA 4WNQB 4UB0L 1XGUA 4L3AA 4JRYA 3QCVL 5IT2H 3EBAA 4HCGA 3QI9B 4S1SL 5EU4A 5C7ZA 1BLIA 4TSBL 5FWQA 1KNOB 2X4QB 3KBHE 5IQMA 1G9NL 5ALCH 3WEBA 3Q13A 5DJ2A 2WXOA 2KLTA 4OCWL 1K6QL 3VO0A 4DJMA 3ZKSD 3RAJL 4IHOA 3SHSA 3VA2C 4XP1L 2EUVA 2ZUWA 4IBYA 3QA3B 4Y16D 2APTA 3ZDXF 2PYFA 3C2AL 3F7PC 5EUOF 3VH8B 4MMZC 3LRGA 3ZSSA 3KCWA 5CN1A 1TTRA 2BXYA 1E9PB 4IRJC 4ODTH 4U31A 5MENA 3VXSA 4FTVB 1EEZB 4FHBD 3ZZSA 2C9QA 3DNKA 4UINL 4KY1L 1A7PH 1FFPB 2VR6A 2X4SA 1PLBA 2HG5B 3CVBA 2YD4A 3P4NB 3ZN6A 1YMME 4BFIB 4D0BB 4NZTH 1UD8A 3B2VH 3GSWB 5CSBA 3SE3A 4F58L 3DDFA 4OM0H 1DSFL 1K3IA 4MMXB 3W2DH 4M61B 5C0IB 4CAGA 5CEXA 3ARDB 3CFCH 3L3IA 3BKCL 1W8EA 3LKQA 4LK4A 4OCXH 3DO7A 2CDFA 3NCYS 2FEDD 4XPHH 5CEZL 3T2LA 4ELMB 1J5IA 2OTUA 3KJ6L 3KL0A 1H3PL 2G3XA 5F7HA 1D5ZB 1TVHA 3W9DA 3NEXA 5FKAB 4HX1B 1NICA 5CIPA 2YD6A 2NNXA 2OYPA 4AE1A 2VDLB 3O6FD 2MHAA 3CN1A 3HRZC 4WDIA 3TBBA 1T1ZB 1QLFB 4RISH 3FT0A 3P4LA 4OCSL 1AY1H 2BY2A 1QFOA 4LASH 5ESAB 1Z3GH 2Z31A 2Q1EA 5JDJA 2VIRB 2D8KA 3IJ7A 3MCLL 4LE8A 3H9SE 3NESA 3G08A 2QBWA 3SN6N 2QADD 1BXUA 4NJAH 3QORA 2Q2EB 4HV8A 1PU0A 2VZ1A 4OZIE 4K71B 5DURB 3S4SG 2CJUL 1SUHA 2XQYA 4UYPA 1OAYL 1GGCH 2VDLL 4JM2D 3VQ2C 3DECA 3WJMA 2DV6A 3MV8B 4WWNA 4ZK8A 3M07A 3WNLA 3R8QA 1KGIA 4YXHL 3MCG1 5GS2H 3V0AC 5IOPB 1B2WL 4C4KT 5SWZD 5IEKA 1BAFL 1MVUA 1DVXA 4NT6A 4KDTA 5DD0H 2X1PA 3PWUB 1MFCH 4RAVB 2YBGA 2Y2WA 2YUVA 1BQRA 4PJGA 5EN3A 3QJTB 4Z7QB 3MFFB 5ID1A 4FZ8H 2PR4H 4WCYL 8CGTA 4CU8A 2EACA 5E8NA 4GP4B 1AQ8A 1GC1C 3N50A 3WNJA 3TNMB 2L04A 4R4ND 4RFNB 3HLAA 3L9YA 4XXWC 1QFWM 3EZ8A 3IDXL 5T3ZL 5JW4Q 4F37F 4FMVA 1KBVA 4IBZA 3ZDZE 4L1DA 5AD0B 4KJPC 4J3OF 1ZLSH 4V2CB 4HGWA 3V4UH 3QHZH 2DB8A 4FJ6A 1SJEB 3VNYA 2FUQA 3G04A 3DK0A 5TE7L 2HFFA 3P1VA 5HHVH 5A16A 1NM4A 4JQIA 3VFUA 5JNYA 2IALA 4RSVA 1BX2A 3H7BA 3NRPA 4JG0H 3PJLA 3ARGD 2VMJA 3RL2A 4ADJA 1UVQB 3C09C 4MXVF 3D0AA 3WUZA 3WAKA 4PJXE 4GS7C 3WFHA 2R56H 1LO3H 1KYUA 4LGPB 4RFOH 4GRLD 4KHXL 3U7WL 2Z7WA 3BT0A 4F7TB 3HFMH 2X2IA 5MP6H 1KFAL 2XPGB 1XGPA 4MA3A 4NO0B 3HCVB 4WI8A 1ZHNA 2QLVB 5DJ0A 1AOHA 2CUMA 4AGPA 4P5KA 4I3RH 4JKLA 4NKDB 5HDBF 4Y89A 1SLVA 4UUJA 2EC9T 5HI5D 4F91B 3KMDA 4P5MA 3UCQA 5C2BH 1E0OB 4POYA 2NNAA 1NCNA 4N25A 2WSDA 1G7LA 5AOMA 1U8KB 1YVLA 3BJ91 2ZYSA 3EH5B 5D4IA 1NFIA 4XBEH 1WS7A 3V4PH 4RCAA 4WJG3 3ZHKA 1NCDL 1A6UH 3CCHB 4KTDH 1XTLA 2SEBA 3SDCC 3ZTJG 3RZCA 2Z91A 2WHVA 2H32B 1Y0LB 5HDLA 4XO4A 4PEEA 3UBXB 4ONOA 4MJID 1B3IA 5LNDA 4R7DB 3OJ2C 4AQ8C 1F13A 3FNKA 4YBQD 2PW2B 4HIPA 1FLTX 5AVSB 3FZUC 3BIKB 4Y9FA 2R0ZL 3VB9A 2OX5A 1BV8A 4GYBA 4PJDE 2KPNA 5J3HD 5LBSA 1CFNB 1PVHA 3BEVB 2EIZA 2CHWA 1VZGA 3CIQA 2XA8H 5EORL 4PRHD 1FC2D 3MRIA 1R24A 4AYFA 3D2UA 4A6YB 2A83B 4KITB 4G70B 4YE4H 5L2KB 2BRQA 1IEBA 1T1XB 2X1WL 1F3JA 2LOEA 4L8DA 1IU1A 4NQCB 3TEXA 4P2QA 2MNWA 4R4BA 3E1ZA 3RA7L 3OVUB 2NW2B 3LKOB 3OLDA 4G5AA 2R0WH 3KPLB 1NIFA 2UXVA 1YO4A 4NQVB 5KANG 3CLEL 3FO9A 3GMLB 3MUGB 1ZT1B 5SWZE 4L8SA 4HCRH 4UBDD 2OSYA 3RX9A 1L0QA 5BUGA 4CSTA 1UJTA 3G6DH 4CMHC 2D0HA 2WKOA 2D3VA 1EZSA 4JLRA 3EO9L 5D5MA 3VRJB 1HQ4B 1U4EA 4JN2B 4AQOA 1XIWC 2Y7QB 3MLYH 1NBQA 1HOCB 5KG9B 5D96B 3QIUD 5FO7A 4KMQA 4XNBA 2BCKB 4JHVA 2WWKT 4FQHA 4PJBA 4APQC 4EN3A 3GF8A 2W92A 1QLRB 1F58L 1F4AA 2W9DH 3K2MC 3MLSH 3DGDA 1T2QL 3T3PF 4ZT1A 1KV3A 1OANA 1CDCA 1WFMA 3HC4H 3N41F 2AV1A 2P8PB 1CFVH 3AQXA 4P57B 4ZSOA 1T5KA 3KJ4C 1I7RB 4JBSA 3KPTA 1PJWA 3BPLB 1MVYA 4J1UB 4PJ9C 4IOSA 4F2MB 1U8PA 3R19A 3M1BA 2D2CC 2NY5C 1VDGA 3UAJA 3EDJA 4J27A 1BMZA 1C1EL 1M4KA 3EYVA 2VDNL 1AIFB 3HAEB 3L4YA 4JFSA 4UILL 4MQTB 4HPOL 2H2SD 1SY6A 5DMGC 2VLJA 4HQQL 4HGKC 4GRWE 3H55A 1IB5A 1KCVL 4LLWB 5LXGL 4FKHA 3C60B 3QS3A 1RMFL 2BWIA 4AQZA 5KYXB 1KCWA 2WCSA 1D6VL 2E7HA 3TV3H 4X7TA 4Y4FD 3UADA 1U93A 1IGML 3I9GH 3LZNA 3P73B 4YHOL 3T3MB 5C6TL 5D7JC 2Q8BL 2ZKYA 2BWDA 4IEFA 5BJTB 3QZLA 1U33A 3F58L 3GHEH 4XOBA 3O4LD 2Z8VC 2EDKA 5HVHB 2CPCA 5BZZA 5BO1L 3O6ML 2YOCA 5IHBA 1E3ZA 2OR9L 3HI5H 2H6UA 4HLEA 5KSVA 2O61B 1UWGL 4IBSA 3ULVL 1CE6B 2OXHA 4MZ2A 4U49A 2D3LA 1T22B 4D7BA 4NLAA 3UYRH 4PRHE 4DO5A 3VXMB 5KYNA 3LVTA 3WHE0 4YSCA 3ATFA 5IVXF 5IJCC 3I2CH 4HBCL 1MFEL 4UT9A 3GSRA 4GAGL 4OU3A 4J3OC 2HPTA 2V8MA 3HG0A 2NUTA 3NVQA 4PG2A 1EFXD 1X3DA 3RWEA 1JCKA 3VFWB 2FQDA 4KRLB 5CJBA 3FUMA 1WEJH 4FA6A 3O41B 2Z4QA 1CLYL 1W72B 1ZS2A 3ZGIA 3N1GC 1ZANL 3H2PA 3BH8B 1XR8A 2W60A 4Q89A 4UTBH 4QHMA 1BQ5A 3BT2H 4FKEA 5E6SB 1NL0L 1L9SA 1OT2A 4PJFA 4X4ME 3RDTB 3FQRB 3RVUC 5CZXC 5BPPA 1UACH 2QR0B 5CD3A 3Q05A 4RMVA 1HILB 1IQDA 1KXTB 1YEIL 2X4RB 3IFNH 4ZOAA 1XB3A 5KJ4A 5LVEA 1KBWA 1ZLUK 5F9JB 3U4EB 4PJCB 4KPHH 1AKPA 3BAJA 2PO6D 2FSDA 4WUUA 1TCRB 2E47A 3S7GA 2FB4H 3MV7D 4OI9A 2BJMH 4XMLH 2NX5B 1XCQB 1OK0A 5G5DB 2FVNA 2BNRA 1FORH 2Q76B 1BG1A 2J88H 3HHMA 3SE8H 1T0MA 1R5WB 2EH8L 3ZR5A 3D87B 3WEXA 3U6RB 2R83A 3LKSB 1W2KT 5LJYH 4N68A 1NLBH 4UOJA 5F6HJ 5C0BE 1RJZA 2Q2LA 2PYEA 4YBLB 2XNAA 4J4PA 4PVBA 5DD3H 2A0LC 4Y1AD 2AEWA 4M5ZL 1IGJB 1RK1A 3K1KC 1S7XA 5L8KB 3GMRB 4KDWA 1H3TA 5IOKA 2O6EA 4G5ZL 1MREH 4HIEA 4TVPH 3UBHA 5BZDB 1CU4H 5LBGA 3TFBA 5J6SA 3BGFB 5BRQA 3SEPA 4UIKL 5L8JB 3GSNH 2BP0A 4PS7A 1XH3A 3A22A 3IXAA 3MTRA 1UJ3B 3EUDA 1CB4A 1PEWA 1MPAL 1NOLA 3PQYA 4MZ3A 5F1SA 3AWEA 5AVYB 1T5XB 4HXBH 3CN0A 1H8LA 3VSTA 2V5TA 1YQVL 2CDGA 5B1KA 2QLYA 3FUHA 5IUSA 3WELA 3ZIMA 1PCSA 2IQ9H 3B3IB 5JHDB 4R2GB 3VVWA 4YVNA 1KPVA 2H26A 2OR7A 5LCVL 1EXHA 4ZO6A 4IKLA 2GG1A 4DGVH 2EDTA 2NQDA 4DO4A 2ZOLB 5E70A 2XTJC 2QKIA 5D72L 2R29L 4FQ2L 1TZHB 3QUZB 4NM8H 4XMUA 4ALAH 4B7IA 3FO0L 1GPOH 1Z3RA 3NSXA 1ACCA 2DW5A 4HKBB 2P28B 3TZVC 1JZDC 3QNYA 3KHQA 3V0HA 3HE7C 5HJGA 3CZUB 4WWKC 4YHLH 3BAXA 3K6SB 2LW3A 3NFNB 1U58A 3A6BL 1ZXQA 1OE3A 1ZMYA 4I0PC 3QNZB 3IJHB 1YA5A 5HHNA 1JK8A 4KK8C 2JCCE 2AJSH 4PWJA 4ZW6A 4W1TA 3OWRA 4H88L 4TQEH 5AOIA 4CVXA 1NFDA 2HFEB 1RZQA 3VU2A 5DJZA 3FBKA 3TNNA 1A4JB 3O81A 3QCUL 4B0MM 1NLDH 1UT1A 2DKUA 1EDYA 2P3YA 2BRRL 3WFDL 5KJRH 2Q10A 1BZEA 2WVSA 1NMBL 2MMXA 2DQFB 2FJFA 35C8H 4OV6F 5GS1B 1LO4L 1BPLB 1JZHA 5ESQA 4LAQL 4IIQA 2ICES 4GUCA 3FK3A 3ESMA 3MV7E 2Y7NA 3IYLW 5C2UB 4P5TA 1ND0A 2HKFH 1Q9LA 4I2XE 1URIA 4OLXL 3B1TA 4G7RB 1CLZH 2X4TA 4M5YH 1J0JA 2BK8A 2Y5QA 4X0NA 3U0TA 2W0FA 4BK5A 5H37A 1PG7L 1KLGB 1NAML 2D73A 1XCTA 3V0IA 2PF6A 5DMIH 1UYWH 1DJYA 4GXVL 3V6OC 3Q6FA 5F1IA 1S7WB 3E9TA 1PG7X 4UT7H 2B9BA 3LZLA 4AC4A 4KKBC 1AKJB 5D8JL 4Z95H 4Q0XL 4YHNA 1HHJB 4E42B 1VCAA 3MRLB 2OMUB 5EO9B 3DPBB 1D5BA 3FU5A 4ODWB 2XA3A 4OY9A 3GHPA 4XNMB 1Q0EA 5I1LA 1R47A 2KQNA 3HEIB 1IVTA 5CCKH 4TULH 4K2UH 4A38A 1DBAL 3KWWB 4XAKD 5DJ8B 1CI3M 3MREB 1JHKL 3DA0A 1QUNA 3EZJB 4MKMA 3ZRCC 3VFTB 1NFAA 1GYWA 4G9FE 4YZFF 4ZJ9A 1TIUA 2B1OA 3OKOB 4M6OL 2VXVH 4HZLA 1L0XA 3QQDB 4X9HA 2UXFA 5DK0A 5IB4A 4KZDL 3ZE2E 1G9MC 3GUFA 1E4XH 4YO0A 3ZKMD 3J2PA 5C8JA 3CLFL 4YIQB 2DMHA 1K4CB 3O8XD 3G6JA 3CUPA 5EZLA 3ASNB 3IMWA 5ERWA 5HSFA 4D9LH 4QOKA 4TUJA 4ZFOB 1Z1WA 4A2EA 2KPWA 3JV0A 1A0QH 2HWZH 1QW9A 4EZMA 4AJWA 3INUH 3EOBA 5EU6E 3UZQB 1U8OB 5CLXA 3Q2WA 1WSST 5IZ7A 4Q9BA 3WXWL 4FF9A 1JNLL 4BSVB 3KPRA 5E9DB 1T0OA 1ADQH 1U36A 1OARL 2D3JA 3E8VA 3QG7H 4H44C 4DIXA 2E9GA 4G9DB 3LIUA 1D5RA 4YSEA 3VRIA 3VGBA 4ZFOL 4GBXD 2WGNB 2YSSB 3F04A 3UTZB 1NEUA 3K8LA 4AM0B 1S3RA 4BKLB 2DQCH 1MG2C 2FIKA 1AGFA 2R2HA 1TEGA 1T6VN 1GJUA 3TGXA 3W0WD 5BNXD 1U9KA 3CZLA 1I8LA 3MNMA 4LESA 3OR7B 4LQ1A 3X17A 3HNSH 2XWDA 5F93C 1FZOA 2P49B 4OF0A 2DPKA 2V7HB 4RVBA 1AO7D 1PQZA 4YQXH 3U1QA 1IAOB 1RHFA 1K8DA 4XZUB 2VZTA 3V52H 4WTZG 3UC0L 4JPWL 3V4PB 5CU9A 3RHWF 3EHBD 3WHXB 1U8LB 4ZUSA 1AGBB 1SDDA 2HKAA 3NIDB 1FF5A 4NP9A 5DFTA 4NPKA 3RGHA 4KZEH 4EVNA 4S1QH 1TVBA 4ORZC 5TDOB 2QTVA 4NQUA 3WJJC 5L4JA 4HHAB 3O3DA 5ADOL 3VRLF 1L3WA 1JPEA 4FG2A 4NAQA 3FJTA 1W8OA 1KYOJ 3CFDA 1K9TA 1YDPA 2XJLA 3FUEA 2QPUA 4KRPB 3WY4A 2J12B 3DUSA 1P2CA 1RZ8A 2UX6A 3OR6A 2C9XA 2R7EB 2LFGA 4AK2A 1PAZA 3D25A 1MAJA 4ODBD 4NN6C 3WN6A 5CSZB 1YNKL 3DX7A 4JW3A 3EJJX 4DOHB 1CF8H 5D5MF 4QRRA 3SB3A 3ABKB 2QVTA 4PU2A 4APXA 4LSPH 2E86A 2F53A 4JFFD 4OCRL 5HI3D 5KVEE 3FFCD 1M9WA 4UT6A 2BSCA 3QXAB 4KVNL 4NQSB 1JGVH 4P07A 4YC2B 2VWEC 3H85A 4MJJA 2R1WB 3IGAA 1I82A 4PYHA 4XC3H 3RBGA 5FW8A 2DICA 4Z7WA 2K3TA 1QSEB 4UQEA 2YUZA 1JZ7A 2OW7A 3SE3C 2D7MA 4GLRH 4XAKE 2YD3A 3I75A 3GSVA 4LRNL 2BM3A 4LMQE 5DS2A 3SDAA 1IO4C 2DWEA 1M71B 2ZUXA 2QGDA 3NIGF 1KBPA 3VAEA 2HRPH 1S7RA 1JNNH 4Z3GA 4GAAA 1BREA 1MI5D 2F58H 1ZDSA 2ZAGA 2XOTA 4BKSC 2BX5A 5FWRA 2J73A 2FYYA 2K4AA 1W8NA 4X2UA 3EGDA 2GCYB 4FFYH 3D0LB 1F4HA 2EH7L 3TIDB 2ENSA 2WWNA 5GISL 5D1QD 3OPZL 2QSQA 1M3IA 3F7YA 5IF0A 1RIHL 2FLMA 2AI0L 3JWOH 5F6IC 4MBOA 2F8IA 1LE5B 3O2VH 2MWCA 2ESVD 3WFCL 4F57L 4EZJA 5SV4A 4P4KB 1KXHA 4EOWL 1A5FH 2HG5A 2QSCH 5IVNA 3P4NA 3KYAA 2Z35B 4PRIE 3UO8B 3UDWA 3PL6B 4JR9L 3VFSB 5I1CH 3W0WE 4F7CA 2EKSB 1H5BC 3GIZL 5C0IA 1HI6A 2PETA 3BAWA 2QFRA 3MJWA 2IGFH 3CZFB 2ZXEB 4PJIF 3STZA 1EX0A 4GMSH 3QQ9C 43C9A 4UNTA 3RI5F 4OZGA 4L5FH 2FDBP 2Q3AA 1SM3H 2COQA 2VLKE 2YD8A 3RWJB 4PBVC 2PPAA 2F54D 5JHAA 3DGCR 5SX5K 4KK9D 4YSTA 3KVPA 4XCFL 2B3RA 5FKAA 3V6ZA 5JLZA 3JTBA 5TK2A 1OGTA 4AYEC 2W88A 3O2WH 3OKLA 2IOIA 4NNXA 5SX5H 3CFEA 4XVJL 3U9UB 2V2TB 1E7VA 4HJIA 3QFJD 1TF4A 3RQ3A 2VIRA 5E0FA 1K8IA 5CZVH 3LKRB 4R26L 4PI2A 4JANB 1JUFA 3IFPB 1PX4A 2WXJA 2OZ4L 3MNDA 1OM9A 4JHAL 3VWJA 2V8LA 3D0VB 4GO6B 4FFWD 4GW5A 1RZKH 3UP6A 3MV8A 3B6SA 2WYIA 4U1NB 5DZLA 1XDTT 3EDFA 4G80B 4X6BB 1SDYA 4JO4H 4Z8FL 2Z7YA 4L5FE 2BVPB 5I6LA 1YYMH 1OAUH 3QNFA 2MQGA 4NKIL 2OMXB 5DFVD 4YDVB 4JFFE 5A40E 2O5NA 4NX0A 1LJMA 5CF3A 1IC5L 3LNIA 4XMXA 3ZX1A 4XB7A 4BZ2H 1FV1B 3IN2A 3SE9H 3B2MA 3TNMA 1ORSB 4PRPD 3IE9A 3H53A 2R23B 1HESA 2RCSH 2BDNL 1NKGA 3L9RB 1URZA 4K8RL 3L5WA 1U3HA 1N12A 3MI6A 3Q01A 1TETL 4JFQB 4M6ML 2JCWA 1GL4B 5FYJD 1K72A 2V33A 4HT1H 3ZDYE 2AVGA 4N2LA 2UX7A 1PZCA 2DMGA 5CXPA 3V4LA 1G4MA 2W8CA 4MNGB 3N40P 5E6ZA 5HVWA 1OF2A 2UZYA 2BNQD 3QDGD 1YYLH 1EHKB 1YN6B 5ITFB 4B6ZA 2FH8A 2WXFA 4HS6A 4MJ6B 4WI6A 1PPIA 4CVZA 5J6GB 1MI5E 3F65A 3BESR 3QIWA 4E41D 5GGSB 1EEQA 1YEEL 3BVNB 4U1HA 4AY0A 3PWLA 5KSBA 4RAUA 1DBBL 1SXZA 4N24A 3DI3B 4UDUA 1TDQA 2FE0A 3HS0B 5D1QE 1IAKB 2AXWA 5C71A 2HH0H 3DVGB 2J8UE 4K9EC 5B7EA 4JAMA 3HCVA 4GRMA 5JHBA 2UUDK 5HYJB 2ZP0T 2EDHA 1SY6L 3ML9A 3SPGA 4NKDA 5A3ID 2D0FA 4XXCA 4GEIA 3VI4F 5T8IA 1MHHA 4PR5B 2V2WA 5BXFB 1BM3H 2AEQH 2EYSB 4F7MA 4EDWH 3GLZA 3QJQB 4ZPTB 1T03L 2I9TB 8FABB 4PWKA 4WIQA 4O2CB 1MCPH 4IGBB 3P02A 4TOYH 2XPZA 3OF6D 4AQ1B 3SY0A 3CCHA 3TFKD 1FDLH 4JFEB 1T7VA 4LOUC 4EUPG 1MCHA 5C08A 1Y0LA 3PRZA 4RX4D 3HB3C 3UBXA 5JXAL 1N19A 4ZXBC 1S9VB 2QTEA 1NIDA 1TT6A 1OP3K 3KPNA 3L3DB 4LSUL 3VYOA 2F54E 4JN1L 5DA0B 4BELD 1ONQB 1BQHB 2XWCA 5TQ2L 4N2AA 5CD5C 5ITBH 1ROCA 4CSSA 3VSVA 3ZKXC 4H8WH 3CBRA 1OP3H 1IKFL 5EG6C 3WIIL 2WLYA 4F9LA 4NQXB 2G2RB 1YRKA 4BA8A 3QFJE 1OWWA 4KVCH 4YHIB 1LO2H 5FLUA 5DJXB 4OKVB 4A6YA 4Q4EA 4GSXA 4CGTA 3O3EA 4P0DA 5EZPA 3GDCA 2P5ED 1RUKH 1ZJAA 5I1IH 5F7LB 3RGVA 3E80A 1F3RB 2NW2A 5IB2A 1E4KA 3KPLA 1TENA 4R84A 2CRZA 2BZDA 4UANA 3VFPB 1UM5H 4L1SA 1FIGL 3CE1A 3UAJC 3RGBA 3DOSB 5AZEL 2IGTA 1X5YA 1A14H 2VT0A 1OKEA 3D3VD 1OGAE 2YXWA 5E94A 1P7KB 5KYWB 2OL3A 5EZIL 3HOGA 5D7KD 4HKJA 3KNBB 2VUKA 3KBPA 4JN2A 3RVVC 3DRTB 2ZUQB 1CFQA 1S7TB 4PRPE 3NIFF 3QUYD 1FI8C 4EE2A 3ILQD 1JNHB 3DIDA 1RK7A 1VAHA 4QUOA 4HIXL 3WNPA 1QLRA 2IPTH 4ONGH 1RZJH 5FYJE 1E4HA 1UZ8B 4NRXB 4YZWA 3BUPA 2VZVA 5F0PB 3RFRA 2HT4D 4PGDB 4AZ8A 5F70A 1FVEB 2ZKHL 2WVVA 2BNQE 3QDGE 4OI7A 4XX5A 2XWJA 2AGJH 3T8XB 2OJZH 1E27A 2E6QA 3HPLB 3HE6D 4LL4A 4YHYC 2EEXA 5HVGB 2OKMA 1S9WA 2X09A 4JFDD 1PIFA 5GIRB 2JKRM 5GGUA 5EIIG 5FPIA 1DQVA 3HHRB 1GCYA 3F7KA 3QRGL 3Q6GH 4J3UA 1C08A 3ISRA 3HKFA 3SKOA 2BSSA 3ULUF 4GAJH 5ACLA 1P6AB 2X1OA 1YUKB 4TUUA 2NRDA 5C7XH 1PKQE 4LF3B 4U6TA 1RUMH 3D50A 1KGJA 1IC7H 4P5SA 2R1XB 5E2WL 1II4E 3MRJA 4XVTH 3QEQA 3P3YA 2MOGA 1QSFA 3K8MA 3DTXB 2AXGB 2FBJH 4Z7IA 2CALA 4WFED 2JLLA 5GSVA 2EEDA 5DWUH 4NS0A 4QEGA 3D6GA 3BVTA 1BOYA 3QWNA 1SXSA 5FGBA 4LLUA 5A2CA 4K7FB 2HJKB 4FQQB 5J6HB 4AH2A 2FBRA 1YPZF 1IZJA 2H4EA 2WZAA 5C0RL 4JQVA 2G4EA 5JXED 3TBYB 4DPRA 4E9WA 4E36A 5I8KL 5HHOD 3QW9A 5T1KD 4HOMA 1MWAH 3CH8A 4L3CA 1E28B 1CT8A 5JOPE 3BSZA 5JQ6L 2PWHA 3BP6A 4FABL 1XQ4A 4MQ7B 1NANH 2XVLA 1P5VB 3P9LB 5F0JB 3UZEA 4N2NA 1A1OA 1NEZG 4QWWD 5T1LD 2AW2A 5DRWB 3HMXL 4N8PA 4KJYA 3WTUA 3SQBB 1L9PA 5IGXH 2GJZA 2ADFL 5C09A 1VADA 1MNUH 1D5MB 3S4SA 4KBPA 4MDRA 4Q56A 1Y18A 1HXMA 2WYTA 2CDEA 2P5EE 2V5SA 2CRYA 4MB3A 2JQZA 1AYRA 3VUAA 4AUYA 4XP6H 1FO0H 2BP8A 4HK3N 1GW6A 1NCBH 5FUOH 2L7EA 2YD2A 4DEPB 3MLZL 4OGYH 5SWSD 4PJAF 1W72A 1OM3H 1F42A 4U1SA 2X6VA 5ISZA 1H3UA 3VXUB 4BRVA 1MLCA 4HIJB 4I8DA 5D7KE 5FECB 5HYSB 3FT3A 4IK6A 2C5DC 1N0LA 3RDTA 1TTCA 2QR0A 1P4UA 4UQAA 2X4RA 5DK2A 4XVUC 2IDTA 3L5XL 2LE9A 5F71A 3PPSA 4RMTA 3OZ9H 1NCIA 2XPYA 3KCPB 4URKA 5BVPH 2LTQB 3WXVH 3FB7B 2DWDB 3U4EA 3C8DA 4Z5RB 3GPEA 4LVHB 1CGSH 4FP8L 2TSBA 4OT1L 1AZRA 3UEQA 2KYIA 1D6EA 4XPBH 2O72A 3GSOA 1DL7L 3V4VH 1PD0A 1OL0A 2Q86B 2ZCLH 4ONHA 4JFDE 5HP5A 3QIBC 1NSNL 4TNGA 4M7JL 3LKSA 3TBVB 3LZFL 3R06B 4P9HH 3MNZB 1Z6JT 3TESA 5F9DC 1NBZA 2W5PA 2WBJD 5J89A 5E5UB 4TV3A 1B88A 3EGXA 4HWEH 3NG5A 6TAAA 1OTSC 3C08H 3DI2B 4JFXA 4XC1L 4EIZC 4G7QB 1W0WB 1UB5A 3GMRA 3NSJA 4L3EB 4LLQA 3ZK0A 3RWFA 5IQNA 3PGFL 3F8UB 4JQXA 3WIHH 1ZSDA 3IBOA 4RSYA 4WU5A 5BZDA 4WFEE 1NFKA 4DGYL 2F18A 3SZ6A 2IAND 1LYQA 2Q7AA 2YMXH 4G1MB 4ORGA 3S5LB 1QFWI 3ARWA 2VJXA 4QF1B 3ATEA 3BLBA 4R97C 1CD1B 3IKCA 4TQIA 5KVFL 4YSSA 4KROB 5T3XL 5J7CC 5JA9A 3WTXA 2R8SL 5GGVY 4MDJA 5K59E 4FQXA 1ADWA 5GJTL 4KMLB 2YMOA 1T5XA 3W5NA 5HHOE 1YMMA 3GZKA 3MRGB 2NY4B 3I9AA 2BZ7A 2VSKB 3SGDH 4DP8X 3LRSB 3BVWA 2KH2B 1RPUA 2NXZC 3WFZA 2BHYA 3NACL 4JGJA 4JDTL 4WWID 5LN4A 4H0IA 4R3SA 1BEYH 1Q9WB 3W11C 3N1PC 3WTTA 3UP1A 3BSGA 5GRWA 4Q4IA 5F3HB 5IFHH 3X1FA 3C5ZD 3N44B 4MYPA 5JIPA 1EK3A 1PLGL 2F15A 5AAMC 4BDVB 2R2EB 1MCIA 5ESVB 1AANA 3FOLA 2WUBH 5HGAB 4Q6IC 2ZOLA 1DFXA 2K7QA 4L4VD 3PXJA 4ODHH 5BS0B 5I0ZA 1MH5A 1T89C 1C9SA 2MCAA 5AOLA 4QRPB 1RIVL 3R4RA 3RTLA 4YK4C 1JNJA 3OKKA 2ITEA 2G2NA 3CIAA 4BK5C 3ZL4H 2FSEB 3FU7A 3K5SA 1E3FA 2EILB 4ELMF 1WIPA 3OGOE 4KXDA 1BHGA 3S37L 2EXYC 5JDSB 1ET8A 4WENB 2VDKH 3BW9A 1ZS8A 1NPJA 3H6AA 2YAOA 1HYSC 3S37X 1GOHA 5K9JL 4H5SB 4MRBA 2ITDA 3KWVA 1YMHB 3QUKB 3ULUC 4B3EA 3CD4A 2R4RH 3AUWB 5I8EB 2YMTA 4Y8AA 4Z6AT 2BIHA 2LV4A 2OM5A 1CL7H 1YUHB 5GS1A 2RD0A 3CGTA 3L7EB 5EBMA 2WXRA 3QPKA 2MQCA 4AEHH 1KC5L 1FNGA 3BDYH 2HP4A 2DQ6A 3VTAA 1CVRA 1OCZB 4Z7UA 2FO8A 2TRYA 2VERA 4AUJA 3L4XA 2P24A 3WL9A 4WO4B 2R9HD 3S34L 1G7JB 2BOBB 2Y07H 1HWGB 5ALBL 4MAUL 3BO8B 5CN2A 4G6AC 1KIRA 4ES8A 4DZBA 4ANUA 4Z7QF 4FNQA 5DCCA 2HVBA 1KLGA 3DV4B 3JWDC 3C5JB 3I9IA 5FA3A 3KEHA 4OTXH 4FD0A 1QRKA 2DI7A 4D0DB 2XWZA 4XCCL 3FRUA 1ED3B 2PCYA 3IJEA 4FCHA 4A1RA 1AKJA 4G71B 3TA3A 1R5IA 2B16A 2OMUA 3GNML 5SV3A 4HEMA 2BPBA 4IS6A 4L4TD 1C8PA 3QUXB 5E6UB 4AOFA 4TLSA 5E8OB 4NCDA 4U6XB 4PS4H 3BZEA 4BWUA 5IVZA 2Q6WB 3ZZLA 4BK4A 4Z78A 1U3ZA 4LDOB 5DJ8A 4QTFA 2DI8A 4O02H 1JCVA 4GSQA 1CJYA 2IANE 5HVFB 1PYWB 3U2SA 1DVFB 2N4IA 3MJGX 2GYSA 3MAWA 5I73B 3B2DC 5IY5B 4NN7C 4X6CA 1NMCB 1A2YA 2OMTB 4ZD3L 3LVEA 4YIQA 2J8OA 4H25A 4IYKA 4B53A 5L7XH 4F1ZA 2MNUA 1LP9E 2WNKA 4IQHA 1NGYA 1HXKA 1UM6L 4DKDC 4UCFA 3S88H 3MXVL 3MUZ1 5H94B 3ZVVA 1UWEL 3SO3B 4Q6YA 5ABAA 2X42A 5FHAH 2R4SH 3A24A 1FJ1B 5IMMA 5E24E 4Z0XA 1TFHA 2VLMD 3QDMB 2OJEB 3B1UA 5FO9B 2RFXB 1INQB 4L4VE 1JDDA 3BKML 2NDFA 5FM8A 3TEWA 4ZAKB 5G4MA 1E90A 1ZLEA 4YDLB 4NNYA 2BH0A 5TQ0H 4N2MA 2YAEA 4LBEB 3CLWA 3BP7B 2MTPA 5CBEA 2WUCL 2VDMB 5SX4I 4OUUB 1TU2B 3IF1A 3B2UD 1KGXA 2R2BB 4N8CL 1L9QA 1Q1JH 1WP6A 3D4GA 1ETZB 3RUGA 1IE4A 4JFOB 4O2FB 1HWHB 4A04A 4F3FB 3DIVA 2V2XA 5LGJB 3V4PA 4ZUWB 3BUQA 1A6ZB 1G7IB 4WKXA 4GY4A 4UV7H 1AGBA 1SYVB 4RGND 5MERA 3MFGB 5B7FA 5DUPL 3UTOA 3V9EA 4ONFH 1G9NC 2ROXA 4N2BA 1DJHA 1WG3A 2G3NA 3AITA 2IH1B 3L3HB 4U0QB 4AEIH 3O9WA 2ZF9A 5AOZA 5EBWB 7FABL 3X13A 1ZGLA 3UJIL 4JMXA 1M05B 2Z1PA 1R75A 1J05B 1C5BH 1CK0H 2IV8A 3BVUA 3REVA 3DETD 1C16B 3FU0A 4IK7A 5I66B 1Q8MA 4GI8A 3QI9C 4H13C 1EZVY 5BOJA 3K6DA 4KV5E 1NC2B 1T04B 1JK9A 3NCJH 3FMGH 1UA6H 2FX9L 4N0YH 1F90L 4N2EA 3VMPA 1DQDH 5B7MA 3TWCL 2WJ7A 1NDGA 4BFEA 4QTHA 3RFZB 4PP1C 2X89A 1J87A 2UY6A 3WLBA 4DCQB 2EIMB 1KENL 1R0AH 1OT1A 1XGQA 1AQDA 4PJ7E 1UEYA 1DBJH 1U8MB 3PP4L 2EXWC 3EFFB 4BCZA 2WTRA 1XB6A 4YFDB 4QYOB 2OMVB 4JKPH 3MBED 4HCRA 1WK0A 2R1WA 4URTB 1CG9B 3PWVB 2JQAA 3RWIA 5KANI 1VESA 4NFDA 4HAGA 3FUDA 3IVKA 3NN8B 1RUQH 3QZWG 4MMXC 1QI3A 2AP2A 4DVRL 4GXFA 1ZK5A 3BCFA 3ARDC 3UYPB 2O5YH 3MUHL 1QR1A 5IHWA 4XI5C 4N1CA 5LB1A 1EV2E 3THML 5PAZA 2E75C 2V0AA 2WXQA 2QELA 2NR6D 3DJSA 4KUZL 3SDXE 4F7EA 5I75B 4QXTB 4J6RL 3RKDC 2GC4C 1AGEB 4GQPH 3TPUA 2WXNA 1L9OA 4OZHE 1HWWA 4YEEA 3AGVA 2JKJA 2PP8A 1QOKA 2QHRL 4MASA 1IUZA 3QJRB 3OKMA 5K1NA 1INDH 1VZHA 4NKMA 4GSDL 2QFPA 4LCCB 2WZ6A 1SHXA 4X9BA 5CMAB 1K85A 2WLLB 3L13A 2X3CA 1JZEA 3T3MF 4K71C 3WLWC 1USQA 3ULVF 5GRUH 2IH9A 2ZWNA 4NKOA 4BA0A 1KTLB 4XP4H 2QDWA 2JXMA 1T7XA 3PL6A 2COVD 3UG4A 4DP4X 4PGZA 1CIUA 3CVDA 3CN2A 4YNYA 1AHKA 1SQ2N 5HHME 4UV4H 2NY6B 1BEXA 1IGTB 4NOBA 4QHUB 4BH8A 5FYKL 5GGQH 2VRAA 3ZDWA 1XR9B 2DYPB 2I60L 3N1MC 1XSIA 4MNQD 2CR6A 1EO8L 3U1PA 5A7BA 1WH0A 1OSPH 1IT9L 4JHWH 4RGNE 4EBQL 4RFNC 1FAKT 1J8HB 4E9LA 3IMRA 4KKLC 4R7VA 2FIRT 3TVMB 2XZQH 4N5UA 4A2MA 3CZNA 4PWEA 3BWUF 3RX5A 2CO2A 2YQBA 4PGEB 2VQ1B 5E0QA 4YSUA 3PNWA 4YSQA 5T3ZD 3FZUD 1JMZA 3IFPA 2V9TA 2VXQH 1FZKB 3MRBB 2VQTA 4OF6A 4WW2A 4P2OA 4A7VA 5IMKB 1GC1H 2ERJB 3PU7A 2IDQA 3LXCA 4IMLB 4GNKB 5DTFA 3BIBX 4X6BA 4ENZA 4OLYL 3L3KB 3T0ED 1MRCH 1E4WL 1MJUL 2I07A 1BM7A 1KPRB 1A7QL 2H45A 4HUCA 1QFWL 3DUUB 2KT6A 4FQ1H 1HN1A 4DP7X 2D31B 1WUZA 5LNEA 1JPFB 4S1RH 1G1CA 2VO8A 5L9DH 2DWXA 4PJCF 4UTBA 2Y3NA 1RPQA 2DJ4A 4NIYE 1FYTD 1YCSA 1SEBB 3BUBA 4JFQA 4ZYKB 4PMEA 5KWYC 1EERB 1YG9A 1QEWB 3VXPB 4F27A 2AANA 1QFPA 3GS0A 3HBGA 1T21B 4HMEA 1S4IA 3GKWL 3EF7A 5LLIC 4KWUA 1C5CL 1T0NA 2PTVA 4B9GA 5EZOH 4OZ4B 4PS8A 1M1XB 4LPWA 1KXVC 5J6GA 3NBNA 3DXAA 2ZSWA 5IEHA 3ZE0E 4KXBA 1U2CA 1OAKL 3PNRB 4J3BA 3GBNH 2VO5A 4ZOBA 1YECL 3WFEL 1OPGH 3V95A 1DLFH 4AV0A 4BZ1L 5F7FA 1KSRA 5IHLB 4I1PA 1TQUA 4GT7A 5EO0A 4Y5XB 5CCHE 1NGWB 3K6IA 2OBGA 2HFTA 3K2KA 1FC1A 1G94A 2X12A 1HXYA 2CKNA 2A1WL 2XACC 2YPVL 3MX0A 3GM0A 3PHAA 5ICXB 1C7TA 1IL1B 1X5MA 1ZEAH 3FQTB 4HEPG 1RULH 2P47B 5AG8A 2NLJA 1IM3A 1HIMH 3MOAH 3T1FB 5D7LD 4WI9A 3UO1H 5IM7A 3A4DA 4LVEA 3C9NB 3BIAX 4ABVA 4I3SH 1QFUL 2HTLC 3BUYB 3KM1A 2FZ3B 1I1CA 8FABA 2YAMA 3DTUB 4O2CA 5DMGD 4GUOA 1WGOA 2X53A 3K1DA 4PGCB 1LEKB 4Y5YB 4KTEL 1VRSA 4FTDA 4LCVA 4EI0A 3SQOL 4X5XA 4O4YH 3U0PA 4JFEA 3MYJB 2EO7A 2OZNA 1ITBB 4JREB 4MD5A 3ZBMA 4WGVB 2A9MH 2EYTB 4WTZA 4CDHA 2P5WE 1EMTL 1KJVA 3JTSA 1NGXB 1QR4A 4HXAL 4NZFA 4R8WL 4ABWA 3KXFD 1NCAL 1XWVA 4MNQE 5MEPB 2BY1A 3CXHJ 4YHZH 3GSNA 3DMMA 1TPXB 5E6IA 1ONQA 3GYRA 4EDXB 4ETYA 5D96C 5FUZH 4NQXA 1JIBA 1FGVL 4O9HH 2YD5A 1DYZA 1KBGH 3S9DB 1RPKA 4MJ4A 4NQDB 5L4MA 1QPXA 1G87A 4KQ4H 5D2LB 1ODUA 3MRMA 5DJXA 5F89B 1VKXA 5KOMC 4DN4H 4HP5A 4WI0B 1TEYA 3AS3A 1RU9L 4GIPD 1LEIA 3DIFB 4FNLL 1G0DA 4JY5H 1HKLH 4FMKA 4DVBB 2G9HB 3BPLC 3O11B 4X4ZA 5E4EB 5DS1A 2WKLA 1KEGH 2YXFA 4C59B 4MAYD 4YUEL 4PTTB 3X12B 1A02N 4FE9A 4YX2H 3VFPA 5KN5B 1ZV2A 2EO1A 1E50A 1XSJA 1ZVYA 4GFTB 5DC0A 2ARJQ 2CG9X 1DBKL 3ATBA 3ZUCA 3T0EE 1Z9MA 2EVHA 2UVFA 4MMYA 4RFEB 2JIXB 2OR8A 3FSVA 4WLCA 2CIIB 1M6OB 2RH0A 4N2OA 1WAAA 3KNBA 2AEPL 2JTYA 2CO4A 3BP5A 4IBUA 4J5VA 2EEAA 4HH9B 3C60C 3RJQB 5JHLH 1K2DB 1CBVL 4B27A 1U8CA 3HUJE 5SWQB 4LL1A 1FYTE 4RIRB 3EJCA 4LBAA 4X4XA 3FW6A 4AYID 5LWYH 2YR3A 5FGBC 4D3CH 2XKNB 1RHHB 4UTAL 3QXDB 4CVWA 3G5VA 4JKNA 3WFBH 3ULVC 3ZDXE 3VD2A 4WSKA 2Y06H 1FVEA 5EUOE 5HHXL 5T33L 2YGQA 3IKKA 2PXYD 4IMKA 2Y23A 1EAOA 2H8PA 4P2RB 1ANUA 2HZHA 2CWRA 3MLTA 5HVHC 1X5JA 3ARYA 4GI9A 3EJSA 2VE6B 4J3SA 4NHCL 5ADPL 4L9LA 2EVIA 4AYGA 3MUJA 4L4JA 2VXTH 3E3QC 3A4FA 1MELA 3FB6B 3T2PA 4AKQA 3US1A 4G9FA 2VNCA 3S3PA 2EE3A 1RIUL 2R1YA 4FXKB 1E6OH 2AV7A 5EC1A 1SOSA 3TT3L 2LGNA 5EWIH 2WIMA 1F11A 3UZEC 3VI3A 2DY2A 4YDMA 3MKKA 5E1AA 4TSCH 3FTUA 4OJCA 1QACA 1OE2A 5J11C 3EXLA 1MHPH 4WK0B 1ZTXE 3BMVA 3BWUC 1WF5A 2VDQB 1BZ8A 4P06A 3LD8C 5BOZG 2AXGA 4IOIB 3UERA 5L6YL 1JYNA 2QV4A 1UATA 5J8OA 1TXKA 1G1YA 4MB1A 5EU6A 2YBRB 5I1GH 4F37K 1A6VL 5CSGA 1S2EA 2UYLB 5DMKB 1HQRA 1CVSC 2GIYA 4PB9H 3GI9H 1Q72L 3KYMB 3BN9D 3N06B 4IU2A 4PJ8A 4E0RB 2P8MB 4MRCA 3ENEA 5FO8B 1IKNC 2GTZB 2VDQL 4R7XA 4QJ5B 3BEWA 3MA9H 4J3OH 1AAJA 3RDTC 2H2PD 5IFAL 9PCYA 5E2TH 2E56A 1HDMB 1Z5HA 2DQUH 2YPLE 1ZIAA 3GTVA 5I1DB 5AUMB 1X7SA 1KXQE 2B08A 5LG6A 1R3KA 12E8H 1XGRA 5F9WB 2DQTH 1CICB 3PWPD 5ID0B 2AQ3A 1K5NA 3MRCB 5I26A 3RTQB 1JGLH 2DL9A 2IJ0C 4G42B 3RNKB 4OZIB 1QBBA 2JJSC 5KSAD 1JAEA 4S1DC 3D05A 2IAMA 2LQRA 3OKNB 4QHKI 4HCIA 3S2CA 1P7QB 2A38A 3ET9F 1ADQA 3UIZA 3KWXA 3FTGB 4AYSA 4JZJB 1PZ2A 2J44A 1PL3A 4L1HA 4WVRA 3K46A 4ACPA 4GW1A 1OTTC 2XTJD 3NIDF 1M7DB 5CINL 4YBLC 3C6LA 5DYOB 5EOCJ 3RL1A 2HJFB 3VXUA 2DQIH 1Q0XH 5EA0L 2C7UA 3PABA 5DJ6B 4KGJA 4ZG1A 4GW4A 4MCMA 3TZVD 4MLIA 2CRIA 5T1MB 4ANXA 1NWOA 2H0PA 2VN5A 5IJVB 1F41A 4JQXC 4LDLB 1L4IA 1L0YA 3O45B 1XF2B 3T6VA 2N56A 3OXRA 4KNQA 4MXVE 3NMEA 1WZ1H 1CN4A 4HOZA 4I0PD 2V7NA 1QSVA 2IWEA 3BGFC 3NA9L 4Z5RA 2XWEA 4K3JH 1UJ3C 4ZRGA 2DLFH 2X2HA 5D7IE 5F7DB 5FM5M 4YWGL 2X70B 4P4RB 3FFOA 1UWYA 2HG0A 2XI9A 5HDBE 2VZOA 2W65B 2JLPA 4JO3L 4L2YA 4AQAA 3MNZA 4PJXB 1L6XA 4UQ3A 4PLJC 5HGBB 4NJAL 1YAZA 3VX0A 3G5YA 3P4OA 4Y16B 3T6XA 5CFHA 2GSIA 4R2GC 3QWOB 3U4BL 4X7DC 2QQLL 3DARA 2WXPA 4K3DH 4QI3A 2YWYA 3G6AB 3BWSA 1RURH 3BXNB 2D3NA 3IAPA 5KYUB 1KY7A 2FBOJ 1WJ3A 3OPUA 5KVDE 1W0WA 3DHPA 2WWMC 3KLQA 4ZMWA 2AK4D 4IDJL 3PAVA 1F6AA 3ELAT 1HEZA 2ED7A 4YR6A 4ZS6D 3S35L 2VLRA 3AACA 3W57A 3QUZC 1BFVH 1FFOA 4LAJH 4QYAA 3Q8FA 4XHQA 3OMIB 4KKCD 2J2ZB 3JV6B 2HB0A 4EUPA 1SDAB 5J12B 4P3CL 4QF1A 3S35X 5CAYB 1CD1A 5HGHA 4LRIC 1CGXA 3I84A 5I5MA 1ECYA 3V0GA 2ENJA 3ARZA 3IDNB 1CDYA 5J13B 5G2NA 1H3VA 3FCTA 5C86A 4K7PH 3MRGA 3RVXC 1ZLSL 2AABH 4PRIA 4P23D 3QHZL 2CKBH 2FATH 4ZUUB 2KDGA 1WCQA 5DD5L 3UPCA 3E0GA 4PJHA 2JJVA 5HHVL 15C8L 1GGBL 2A6JA 3O6FB 3K91A 4PJDB 4PHZA 4JG0L 1I1AA 1B0IA 4Y8DC 1E9OA 1FL3B 2GK0B 2M1KA 2WINB 3QULB 1A25A 5GS1C 3VFOB 2R0KH 5KVGH 2NY7H 5FV2A 4FFYA 1MW0A 3BQUA 3PWPE 3ESNA 5ESVA 5TF1L 4HIIB 1LO3L 2K6WA 3GJFB 4JFVA 2QADB 4KJQD 1A64A 2DS4A 5ELIA 3CFKA 5DJCA 2IDCA 2JNZA 4XNZB 5TE4H 3LS5L 3SJVA 3LN5B 3KBEA 4B5ZA 3MR9A 1A3ZA 5C0DB 4S0SD 3RWCB 2NW3A 4FNSA 4LZKA 5AZUA 4M9OA 2YK1H 5GZNC 3S0PA 4G6JH 1AZUA 5GJSH 5B39G 2IH3A 3L9BA 5SWZB 4LARH 4N0UE 2XTJE 5IBTH 4ATTA 5JW5B 5HDQL 3PS6A 1B9KA 4GQQA 1QWHA 3REWB 4N0FA 4LIQE 2BNUA 1Y1DA 4H5SA 5DVLA 4Z77A 2FHBA 3FXIC 3FOMA 4TTGA 1DBMH 3NP4A 3IRPX 3QQNA 5HGDB 3ARED 2IF7A 1JWMA 4TPRL 5FB8B 2YN3A 1T6BX 2PN5A 1OHZA 2P8LB 3TO4A 4DPCX 4YPGB 4X80H 4JM0A 3QG6A 4J3OG 1QRNE 2ZOOA 3MNWB 3AS0A 2NUPB 4W6XB 2A6IA 3EAKA 2RGSA 1PGRB 1WFNA 5EIIA 1A9BB 3PV6A 1NEPA 3ARGB 5A2IH 1OAZH 1H0DA 3ROLA 3FT2B 4L0PB 4ZFFA 3PGCA 2MQ3A 3LTVA 2N1KA 1E4XI 1YEFH 3AMKA 5JOEA 1TYJA 4JRYD 5I1EL 1OF0A 4GRLB 2HKHL 3ECQA 2WKGA 2WSPA 1DQJA 2A4CA 3R0MA 1IGCL 5DO2D 4PV8A 3MODH 3EBHA 4JRXE 2JQMA 1EVTC 1U8NA 4OW6A 1G9MH 1NAKH 4GRWB 3BSHA 2AK4E 4G82A 3KPSE 3DBXA 3QEGL 3KLAA 4IJ3B 2B4CL 5DQDL 3GXPA 4I9WD 3V6OE 1IAIM 4TVUA 2J6WA 3AQYA 4JDEB 4BZ2A 3KGTA 3KGUA 5MEND 1MFBH 3VXSD 3U0WL 1DVFA 4HIHB 4LVNB 3IU3A 3CFMA 2ARJA 5EIQA 5FDWA 3ZKNC 1XV8A 1GKOA 2ICEA 3ZMRA 5MHSD 1CO1A 4XP9H 3X3GH 4PMFA 2DEYX 4XN8A 5DT1H 5AW1B 4MJIB 3MLSL 3CV5A 2CLZB 4U1MA 5IWLA 1D5XB 3O3BB 3ATDA 4LPUA 5I23A 4BGLA 4ZNEE 2DBJA 1XD0A 2JMRA 1HNGA 1NEZA 3O9WC 1MJ8L 4AGMA 1ZA3B 1L0PA 4PVNA 4PRHB 1O7DC 2OJEA 4KRPC 1XEDA 4JL2A 3NZHL 4NO3B 2ZOKB 3EYFB 4OJFL 1D5IL 5C0CD 1TSHA 4IRSA 2ZCKL 5E2VL 2BIPA 5BQ7B 5DHVH 2JELL 3D07A 2Z31D 4M8UA 1AXTH 1EJOL 1U21A 3MACL 3HN8A 4TRPL 3G5XA 3SPHA 5D70H