3WU1A

Crystal structure of the ets1-runx1-dna ternary complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
123
structure length
123
Chain Sequence
LADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
total genus 20
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wu1A00
2ADYA 3D09A 2VUKA 3WTUA 2XWRA 4L18A 2BIMA 5LGYA 3KMDA 3WTYA 3D06A 1H9DA 5AOLA 3EXLA 5BUAA 3VD2A 3WTVA 3D07A 3VD0A 4AGPA 1TUPA 2J1WA 5AOKA 2X0WA 4XR8C 1CMOA 3Q06A 3D0AA 5KBDA 4IJTA 3WTSA 2WGXA 3US0A 5AOMA 4LOEA 2BIOA 4AGNA 5AOJA 5ECGA 3VD1A 1IO4C 4LOFA 3QYNA 2FEJA 3D08A 5G4OA 1HJBC 4IBSA 4LO9A 3IGKA 4IBUA 5A7BA 1EANA 4G82A 4L0ZA 4IBQA 2RMNA 3Q01A 2BIQA 3WTWA 1T4WA 4KVPA 3ZMEA 5G4MA 1E50A 1TSRA 1LJMA 3QYMA 2H1LM 2YBGA 4IBWA 4A63A 1YCSA 4GUOA 1UOLA 5G4NA 3IGLA 2J1XA 3EXJA 2J1ZA 1GZHA 2PCXA 4AGOA 4G83A 4L0YA 1EAOA 3US1A 2BIPA 2X0VA 4IBYA 3TS8A 2P52A 1KZYA 4AGMA 1CO1A 4MZIA 1HU8A 3WTTA 5ABAA 2IOOA 4HJEA 1GZHC 2J6WA 3D05A 3WTXA 4AGLA 3Q05A 4IBVA 2AHIA 5LAPA 2AC0A 2X0UA 1HJCA 3KZ8A 4AGQA 2J20A 4IBZA 2XWCA 2OCJA 3WU1A 2J21A 2MEJB 2GEQA 2J1YA 2ATAA 4IBTA 2IOMA 5AOIA 4GUQA 4QO1B 4MZRA 5AB9A 2BINA 2IOIA 1EAQA
chains in the Genus database with same CATH superfamily
4YDVB 5F1IB 3ULUD 1ZXQA 4FS0A 4XXDA 1QP1A 3PDGA 1X44A 3HBZA 5HYQB 1J0IA 5C0DA 4FCHA 4WV1C 3AG2B 3I02B 5I1JH 4FJZA 3D2UA 2YGPA 3AQDA 1BXXA 1SNRA 4NUGL 4JJ5B 3MX0A 3ZBMA 5E1AB 5B39G 3D4GA 5DRXB 3BW9B 1JGEB 2EABA 2ZXAA 3GSXB 4JLRB 4XMKL 5C0BA 3UBXA 1CICB 2QFPA 3GRWH 3VGHA 4RZCB 2NXZD 5IJDC 3QR2A 4JMXA 4QF1B 2G2RA 2M2DA 1U93A 5DD6A 1PX8A 3E7JA 2EACA 3NH7L 4P3CH 4XI5D 5ACZB 2W9EH 3P3RA 5CBAA 1E43A 2ZX8A 3WS6C 3AXLA 5CFHA 4DOHE 4HZ1A 3TFKC 1M9SA 1UM6L 4J12A 1BMZA 1MHHB 4WJ5A 4D9LL 1HWWA 2EDYA 1PCSA 4G1EA 4UV4L 2CE6A 2BSTB 4P46B 4DPBX 2YUXA 5GRWA 4KRLB 2K70A 5CMAB 1JD9A 3MZTA 3O6FB 4OQTL 1JTOA 2DQMA 5EUKB 3WE6A 4ZPTA 2NY7L 2P7TA 3CZFB 1MIMH 5DTFA 4TQHA 5C3TA 1W0VB 4FXLA 2Y2WA 1DO5A 3GO1L 1ET8A 3LH2L 5DD3L 4JFFE 1PFCA 3D85A 1FI8C 5SWSE 2X4NA 1LVEA 2VR4A 5IESL 5H94B 3ZGHA 1JZJA 4NZ8A 1QZNA 2XV0A 5LXGL 3I75B 4YUEL 3H9HA 3GHBL 4L0YA 2AK4E 1FVEA 2ICEB 3FDWA 3X13A 4AM0A 5FO8B 1AGDB 5DZVA 1JTPA 3BKJH 4G7YL 5AL8A 3BXNB 1KTKE 4L8DB 3I2CH 3LXBA 3CPLA 1C1EL 1G87A 3CN1A 3QRGH 4IIQA 3H0TA 5I82A 3NA9H 1UA6L 2AQTA 2WKLA 5C09B 4XNYL 4XPBL 2YSSB 1JK9B 1HHJA 3ECVA 2QQKL 4LK4A 3QS3A 2HCZX 3SB3A 2XCMC 3RIAK 1DUYB 1NFIA 3VSVA 1G7JB 3FUEA 1X5HA 1IBGL 4PJAE 3UTPD 5CJ5A 1R24B 3J07A 4BFEA 1HWGB 1U2CA 2OX5B 2ED6A 1D9KC 3UMTA 3WHE0 5D5MB 3KPOB 3MCKB 3P9MA 1NCTA 4L37B 4CJ1A 3GSVA 3OZLA 4U3XA 3VDAA 2EDNA 4RGMC 3SYQA 1UFGA 5IY5B 4FFZL 4AIXA 4LLWA 4EI5C 1NC4B 1TOXA 4XP6L 5DZNA 3CXDL 2VDQB 1QFPA 2FBJH 3PXHA 4YH6A 1KEGH 1CBJA 3GIZH 2XOTA 4JFDB 3HE7B 4MMXB 1U92B 3CFUA 4L8BB 5D96B 1RU9H 3WKMH 1DBKH 3GMOB 3EOTH 4XXDB 4XN7A 3AITA 1IV8A 1NBYA 2CZNA 1IC4L 2WLLA 5D7IA 5D71L 3RWCA 5EDSA 5L6YH 5GS2D 1B2YA 2NW2B 1EV2E 4XWOC 3ZDYE 1L9MA 3HG1B 4YL9A 3UTZA 4KRPC 4LESA 3NRQA 4JLRA 3IDYC 1U3HD 2EH8L 4AG4L 1O7SA 5J3HD 1KBGL 3EFDL 3LRMA 1JS4A 4LBEB 1ADQL 1WA0X 3L54A 2K7QA 1BJ1J 1UCBH 2NLJA 1YMMB 4N2NA 1KENL 3B37A 1A7RH 1NJ9A 5AFAA 4JRXE 5AB0A 5L88H 4W4OA 2WO2B 5IP4A 4WY7H 1MAML 4BZ1L 2D03H 2IADB 3FKUS 3RP1A 4KJWC 1SLWA 1F8TH 1QYGL 2AAAA 2FJGB 2X87A 2JKIS 3PWVB 4Q6IA 5C0CE 4FMVA 2Q3XA 4U1HB 2VLJB 2YS4A 2BSED 4WEBL 1F0LA 5INCB 3RX5A 4BZ2H 4HVBA 3DHJA 4MFHA 3L1EA 4IU2B 4GAGH 3FCBA 5I8OL 5TQ0H 5I18L 1NOFA 1RZJH 3AFLA 2Z7ZA 1KCRH 3RVVD 4D3CH 1SLUA 4NQXB 2MOGA 4NNPH 4YZFE 2ZX5A 3HE7C 2EVIA 3Q1SL 3VFMB 1U8PA 1JPSH 5L6YL 5E2TL 3PV6A 3QWRD 3HZMA 1ZTXH 4XCFH 2WHVA 4D7PA 1JFQL 4TNGA 4DK3A 3TBSA 4WWKA 5A3ID 1GRWA 3QIUD 5EZIL 1L7IH 4HBCL 2X1OA 4HX1A 4JG1H 1GYWA 1PF3A 2ZXDA 3OPZH 2WXJA 1FVEB 1KGCD 3KGTA 1OAXL 1MLBB 4MAYC 4I3RH 3TBCA 3Q6FB 3Q2VA 4JG5A 1UB6B 2BNUA 2BRRL 1BYOA 4G6ML 2DLTA 3DX3A 1ONQB 4OB5H 1M71A 3O6KH 1P1ZA 3WOVA 1Y6KR 5FYKE 4PAZA 1DJZA 2NQ3A 4AMKH 3B4NA 1IL1B 1LXMA 2HVKB 3WUZA 4NRZA 5BQ7A 3OPUA 4KQ4L 1UA7A 3F01A 5FYKU 3VXMD 2A1WL 2X6MA 1DN0A 1EWHA 3QZBA 4CU8A 2PTUA 3GMLB 5LDUA 3TASA 3QUXB 2CKBL 5T1LD 2ZWSA 4RQQB 3UABA 1U30A 2IOMA 4M61A 4E9YA 1E7VA 1BWWA 3MCKA 1JNJA 4MAUL 3OKDB 4UAOB 2A74B 5IQ7L 3R4DA 1A1NB 1HS6A 4MJJA 5D7JC 5MENB 1HC1A 1XGTA 1YC7A 5IFAH 3D48R 3MDJA 5JA8B 3DHPA 1MFUA 4K0OA 5HHME 2AXFA 2WSPA 3Q6GH 3ISWA 5KVGH 2XN9B 4MMXA 4P48A 3CFMA 1RIUL 2X4TB 4PVLA 3GJFA 4YSTA 4JN1L 4U1KA 2QPUA 1GGCL 2BCKA 4LLQB 5C0FB 3OX8B 1MIEL 4HLEA 5B4MC 4P57A 3ARDC 5DVMA 4MQXD 1KCKA 2EYRA 3HHSB 4JGMA 4NT6A 1CF8H 4X9IA 5EIIG 5EN2A 3UTZB 2KDGA 1ZE3C 4GUCA 1XTMA 3G5ZB 3OGCB 4Z3TA 1KYUA 1K6QL 5CBEA 5JLZA 3RKDD 1NGWA 4HV8B 1WZLA 1RZQA 3HG3A 2FYYA 3S37L 2UV3A 4S0TD 3C6SA 4KHXL 1E8YA 2ZUQB 4M3HA 5KYXA 4OM0H 2W92A 1B4JL 3GDBA 3T4AB 4L0ZA 4L05A 3VWKC 4K7PY 1FH5L 4FNTA 4RDQF 1MWAA 5F71A 2AI0H 1ET7A 3ARTA 3C5ZA 3Q6GL 4FQHB 4QNPF 2RBLA 5DHYB 3UG4A 2DI8A 2FIKB 4MD4A 3HFMH 4OZFB 5D7LE 4GSDH 1X5FA 4NQXA 2E0PA 4GSUA 4YDLC 5C0EA 5CZXC 1DDTA 4A6YH 2V5YA 2OMBA 3HZMB 1NCBH 1XXDC 3QI9C 4GMTH 2YAEA 3NSJA 5ITFB 5C2BL 5A2AA 3VXUE 3ARRA 3LS5H 3GLAA 4LL4A 1XO8A 1BAFL 4AH2A 4Y5XA 4YDMA 3NFNB 3BWAA 2NMSA 3QEHB 4UBDC 4GY4A 1I3GL 1WEJH 5MHSD 1G0YR 2MCPL 1M1XA 4JKKA 1EGJH 2Y3NA 3IMWA 1ITBB 4GQQA 1NDGA 3RTQD 4AEIH 4JE4B 5HGDA 4JN2A 5BS0A 4GBXB 3LQZA 5BRZE 1IGML 4FFTA 4KQ3L 3I6KA 2KH2B 3OG6B 3US9A 5CEZH 1UT1A 3V6OA 1U8MB 3EBIA 4LAQL 2CA3A 3N40P 5AL0A 1CI3M 4X6DF 3D0VB 1K8IA 3B2XA 5AWNL 3UGXA 4JR9L 1X5XA 3VXPB 4YBQD 1H8SA 5HJ3A 1HXYB 4AZUA 3FZUC 3GJFH 4IGBC 3SDCD 2AJUL 5FM4A 1JBJA 3QJSB 1MI5E 3GNMH 3N0AA 1S7XA 4NAJA 3QJFA 5FHBH 3FRPB 1HE8A 4A7TA 1E6OH 3LZQA 5GISH 3D09A 3V9EA 3UG3A 1TJMA 5IVXE 2CQVA 2OI9C 4KMTL 1UM4L 2IDUA 4F8NA 3WTYA 3MRDA 3OGOE 1E4XI 1OT4A 3N9GH 2FYVA 4PJCE 5C0CD 5E4AA 1NPJA 3DROB 5FM8A 1F4XH 2XNAA 2AXFB 5E8NB 2ZZUT 4P3CL 4YHML 2DWEB 4GMSH 3FU9A 3MGOA 3IDXL 3S36L 1UGKA 4PP1C 1X4ZA 4K94L 3BGMB 3QIBB 2ZXGA 3BT0A 4U1GC 2Q6WB 5EORH 3W57A 5K9QG 2ZX9A 5JW4M 1SJEB 5F97E 4KAQL 3ASWA 4ODUA 5EO1B 5JHLA 4QNPE 4AQ8A 4LVHB 5J13B 5TDNA 1VLXA 3AG4B 3W11C 1E6JH 3VTAA 4JM0A 1Z9SB 2CJTA 3BN9D 4NM8L 3SPHA 4G7SB 1ILUA 1J12A 1MCOH 1DQJA 3FT2B 1BQHG 1HILB 3F7RA 3C5XA 1MDTA 5MEPA 4HUMB 2XA3A 4XBGA 5GISL 3WN5A 1A9BA 4U6VL 1AACA 4X8XA 1Z1WA 1HH6A 3LKOB 4ZFOL 3VD5A 4FXKA 1Q9OB 1UHVA 2R29H 2ZCLL 1EJFA 3GMQB 4PJHB 3MLYH 3WJLC 4LSSH 3ARSA 4R96B 4E5XG 5C0RH 1NAML 2YBGA 2D9CA 1TQCB 3Q8AA 4GBXC 4APQA 4Y2DD 3IAGC 4XVTH 2OL3A 1QACA 5SWSB 4NDMB 1CK0H 1RIHL 5C0EB 1A4JA 2D7OA 4LHQB 4CA4A 4KK5D 4F1SA 2BIHA 3HC2A 1QI3A 4UAHA 3KJ6L 3KLDA 1E9QA 1A0QH 3SQOH 5JO5A 1CZ8L 1YLBB 1W6LA 2XXGA 1DUZA 2GTZB 1MELA 1GXEA 3SYCA 4W9FC 1DFBH 2GITA 2HLFC 4OLZL 4ELKB 5C6PB 2XVLA 1UXMA 5LXVA 1OTSC 1F13A 1VFOA 2XLLA 3FO0L 3NEXA 1HESA 3BE1L 3FK3A 2IC2A 4R84A 2MWCA 1BFVH 5B38A 3P30L 5EU6B 3UYOD 6FABL 4PJAB 1T3FA 3CFTA 3LYRA 1UWGH 4DW2H 2R2CA 4S1RH 4JFOB 5DURB 1XGUA 1XCXA 2DB8A 2Z0UA 3NZ8A 4NHUA 4ANXA 2GJ6A 1ZGLM 3QAZB 2GHZA 3C5ZC 1AXSB 4PJIE 4ZMOA 2W0FB 1RIHH 2WWMC 1IT9H 4P8QA 1WTLA 2ZF8A 4AUYA 3P4OA 1A0QL 2BRQA 2NR6D 3FS9A 1XGZA 1VIWA 3BOVA 3CSTA 3ZGIA 5IJKA 3HN3A 4QRRB 4ZTPL 3FONA 1NINA 3TEYA 5DK2A 3SDYH 5K59E 1BXVA 2H8PB 4Y5XC 1K3ZA 1BZQK 1ASQA 1WITA 4IJTA 3FFCA 2P5WA 1VKXB 3M46A 2JI1A 1SF3A 4FQLH 1ACZA 1OE2A 1FE8H 3BE1H 2NXYC 2M1KA 1AD9A 1IO4C 5DRXA 3CZLA 4G7VH 3DO7A 2GVYA 1TZGL 3DSNB 4R5VA 5CINL 3ZKND 1ZVNA 2OW7A 5TDNB 2KLRA 4P4KD 1O7DC 3V5HA 5E2WH 5E56A 1RUMH 4L4TD 3IETB 3L4CA 1OAQL 3FQRA 1P6AB 2Q8BH 5FDWB 4MXQC 3BAIA 4QT5A 1CFTA 1PG7H 4OGAC 2Y0SA 3MRLA 3NJJA 4HULB 4Y16D 4R7LA 3JUYA 4OI9A 5E5LA 4XBGB 4W93A 5D2LB 2W1NA 3ULUE 2E46A 3B7RL 5I19L 3ARQA 3L08A 3KM1A 1RJLA 1ZK9A 2O6PA 1Q72H 3IN2A 1UWEH 4RISL 5EUKA 3WE6B 1L3NA 1YEDB 4QHUB 1XIWB 2P46B 1E27B 1ZANL 5ICZB 1R0AL 2FVNA 4WW1B 3N5AA 1MCKA 5F7MC 4HAKA 2A6JB 4YBHA 3QGVA 2ZUXA 2VE6B 1KBBA 43CAA 4G5AA 5IKCB 1CFQA 4C83B 4G8IB 1F4YL 4BK4A 5BZWA 1GIGL 3KPNB 4FD0A 2JJSC 2O5YL 5HGHA 4JFYA 4BGLA 1BX2A 2DKUA 1DQQB 4KXCA 1H3GA 2ZXEB 1NANI 3BXNA 3QC6X 5E6RB 8CGTA 2YD9A 1OP3H 5I1KH 1UM5L 3CPLB 5CJBA 4Z77A 4OCLC 2ZXQA 2OTUB 1G7MA 5C2UB 4HIQA 2GK2A 3S0PA 2JB5L 1Y07A 4YGVB 3EYOA 3SO5A 5BO1H 4EF3A 1U8IA 2BFVL 1V55B 2AK1L 5DA4A 3MFGB 3LMJL 1PQZA 5DFTA 1AIFA 3LQMA 3O9WC 3JBG7 2H3NA 5HDQL 4FXKC 3JV4B 3TN0B 2NY6B 2IG2H 3KBFA 3KYKL 1KB9J 3T09A 4I0PD 5KJ4A 3LKSA 3JUZA 3KHQA 1CFBA 2VZ3A 5EUOA 3BCDA 5C7ZA 3VXSA 2Z64C 3IRPX 5BXFA 3BI9X 4U3CA 2P5ED 4XVJH 3MXWH 4I0PB 4WI2A 2R1YA 3SD5A 2APWA 2R0WL 4OLYH 2YLKA 2J1WA 5F89B 1BBDH 3BVVA 3ARBC 1T7WA 1U95B 2IAND 1MFAH 1MG3C 3FONB 5DJYA 1K4CB 2OCCB 1RVFL 2QTEA 3FT0A 4U6HA 4EVNB 4XP1L 4MXQD 4QCIA 4FXTA 4KHXH 4B9KC 1AVAA 2CA4A 3MLZH 5D72H 4HMDA 5E5MB 3OLDA 3ULUF 3RI5F 2IQAA 1KGJA 3B3IB 3FRUB 2JB5H 4NKMB 5JOFA 2MHAA 3Q7JA 4DVBA 2HJLA 5CU5A 5I1LB 1FZKB 1F1GA 4U6YB 1AANA 4WWNA 5E4OA 3E6FB 2B1HH 4N5UA 4PY7A 1R3HA 3TWCH 1NBQA 3BH8A 3L81A 5IB5A 5DRNB 2CG9X 5KW9L 1IKFH 3SO3B 2G4EA 4Q6IC 2P4AB 1NCGA 5G2NA 5IJVB 3B1UA 3BYYA 4PV1C 2E8ZA 3CZGA 1T21A 2X2UA 1FORL 4ZTOH 1LP9E 4OLYL 4KKCC 1A3LH 2QQQA 5FS5A 3D18B 4L8CB 1J9CT 2AS5M 3V6FA 2NQCA 1CQKA 4WNJA 5IJKC 1RZ8A 4TLUA 4TN9A 4XVUD 3N2JA 4DN3H 4Z8FL 2X2IA 2I7OA 2MCPH 3GHEL 4FG6C 3LEYH 1VACA 1I1AA 4NQED 4DGYL 5E9DE 1U91B 2Y2YA 3SBQA 4YXHL 3KS0J 3C2AH 2B0SL 3LIZL 2X6BA 5HYQA 1AGEB 2CIKA 1S9YB 3T77A 4N2LA 2AV7A 5AUMA 3VXMB 1MVUB 4G8GA 5MEQA 5JTWA 2ZP0T 3PP3H 2ISDA 2QGCA 4AL8L 4I18B 5HP5A 5HDWA 2FD6H 4ZUVA 1TEGA 3GXMA 3L3DA 1TVDA 5EU5B 4FAAB 1VEOA 1DBBH 1XAKA 1A3ZA 4IRZH 3ARBB 4ZSOE 1CLYL 4X50A 5FHAH 4F93B 4M5ZL 1FFTB 3O3EB 3FT4B 3VFTA 4GIPD 2I32A 3RDTC 3GXTA 4FTDA 4Z78A 5AENA 1XB3A 4KMTH 4TNWK 5FM5O 1BVLA 4WI6A 4XNBA 4MD5B 3HAEB 3TA3C 5IHWA 3WIAA 4U2YA 1TVHA 2UWEF 2LVEA 3QO0B 4CW1B 1E40A 1YYCA 1CE6A 1YEWA 2OR7A 4WAFA 4AV5A 1FNGA 3LKSB 3QJHA 4Y7OC 4J8RA 4I2XB 3Q9PA 4NQDD 1AGBA 1NMBL 1U8LA 2CO6A 1J9QA 5KANI 1YN6B 3WS3B 4XCEA 4BBWA 4JPKL 3T71A 4ODWB 2ZQKA 1NGQL 3D85B 3PHOB 1U95A 4Z3IA 4JNXA 4L4VE 3BSZH 3AU1A 4QTFA 4LRIA 4A04A 4YDIL 3ZTNH 2J44A 3L13A 4OCXH 1C5CL 3MV9A 1R46A 1S7SA 1ZHKB 4PJBA 5E8DH 1CL7H 3VCLA 3TA3A 4L9LC 1A7RL 3RVUD 7CGTA 1DVFD 3TURA 1V8HA 5KG9A 3LXAA 5AOZA 1JZEA 5JOEA 4ETQB 4GXFA 2UWEA 1AKJA 5I1LA 2FWLB 1P2CA 1FRGH 5TDPB 4ZFQA 3QPQC 1NKOA 1MH5B 3HEIB 1DQML 2YARA 2HTKD 3IEAA 3QNYA 4FQXC 2FH6A 4JQIL 5LJYH 4P5RA 3MUUA 3MA9H 4Z0XA 3RGVB 5ANHA 1FFPA 2DMHA 5SWZE 2VDQH 3ARGC 3T4AA 1DJXA 1V10A 4R7NA 2LVCA 4LSQH 3HB3D 1PD1A 1HQRB 2JKRM 3KLQA 3IGLA 1BMGA 4QRSA 2EEFA 1BD2D 1XGRB 3APMA 4YSPA 3G04B 4O02A 3G3LA 1MHPH 5DHYA 1Q9KA 3T2NH 4GAJH 2Q2EB 4MD4B 4MS8C 3BKML 3NCCB 5E6IC 5T3ZH 4F24A 5CJ8A 2WLZA 4XMUA 3NIDB 3PDDA 1VAHA 2PKDA 4FJYA 3RWIA 2WIIB 1D5RA 3NACH 4G8FA 2VLKD 4M7JL 2DPKA 2RQ8A 5AVRB 2X70A 3GXIA 5MI0B 2E7LC 1CFVH 3JWOL 3QEQD 4BZ2A 1YYMH 2ZOKB 3EHBC 3GDCA 3SE4C 4EJ1C 1R33A 4ZI8A 3VXMA 3RIKA 5C0CA 3HNTH 4Y9EA 4FMKA 3EGXB 4K71B 3HUJE 4ORZC 3VTMA 5AD0B 1R9FA 3KPQB 1OAYH 1ZT1A 5AW0B 4ACPA 5SWQB 3L3DB 2EDMA 3GXPA 4BELD 3P77A 4FQXB 4X7SH 1QFWM 1FZMB 4WI0B 3VG9C 4PN6A 4DGIL 4M8RA 3DUSA 4QRQB 2J4WL 3N42B 3O3EA 4RFOL 1IC5H 1NJ9B 1O7DE 2KYIA 2YOCA 2EDHA 5DVPA 2DIBA 4GBXD 3CVIH 3U36A 5IQ7H 3B2UD 3EJUA 5BW7C 1I3RA 2E3VA 4GI6A 4R4FH 1WFJA 1SF5A 2LU5A 4TUKL 5CEYB 2OFQA 3TNNB 3WLBB 3NG5A 5IF0A 2C9XA 1KC5L 4ZG1A 2MMXA 4M6AA 2BMKB 4G71B 5E6IB 2WD0A 1ASPA 1MCEA 4APXA 3GSNL 4IRJD 3VVWA 3V10A 5IHUL 1NIAA 3WY1A 3FRPA 1L4IA 3E3QC 4UINH 4CMHC 3F85A 2CCLA 4FNUA 4NKDA 1YN6A 4AM0Q 3HOGA 3FAXA 2IALB 5F7YC 2QGBA 1RMFL 3MOBH 3P02A 2VR9A 3BAJA 2PP9A 5ILTL 4K71C 2H45A 3WENA 1IBHA 5F0MB 4ZUUA 2COQA 5ALCH 4BZ2L 1C7TA 1ZHBB 3CMGA 3QUMA 3QJQB 4S10A 3MV01 4X7SL 2ROXA 3W9EB 5JPMC 3UBXI 1HYSC 3MBEB 5D6CB 1M7UA 4G9FB 5LDSA 4N2CA 2ZWNA 3G6AB 1T22A 4G5ZH 4HJ0D 1UB6A 1XZWA 2BNUB 3UTTB 1Z32X 2F54B 2YD2A 4BV1A 5HHMD 2EXWC 3IRZA 3UBXG 3C5ZD 3GM0A 4HCFA 5L4JA 2PWFA 4GG8B 1P2CB 5TDPA 3IGAB 1BQSA 3VSQA 4MDIB 4N1CA 5I0VA 4WNQB 2HVKA 5HHPB 4L3ED 3IVKB 2QSCH 2F53D 5INDB 2OMXB 3GMRB 4X5LA 1D6VL 3UACA 4WENB 4XVSH 5KYUB 4GSDL 1WJ3A 4PV9B 1KULA 5AYUL 4J7RA 2G5UA 1XCQA 2HKFH 5E6ZA 1BVKA 3RA7H 1D6EB 4JZJA 1NCIA 1NUDA 1MJUL 1OGSA 1DJSA 1SXNA 5AW3B 1F4YH 3DOHA 5GS3A 2A74A 2FX9L 4AQ1A 4ISVB 2QVIA 3KH4A 2NNAB 3H9YA 4LSPL 3U4BL 4I7ZC 2WBXA 4I3GA 3QC5X 4DEPC 1IZJA 2R56H 4TL5A 3V4LA 1UM5H 5EEYA 1JN6A 2YUZA 1A4JB 1OL0A 2XN9A 3T0EC 5CJQH 2PO6C 1CDIA 2YPLE 4XP9H 4M43H 5GZOC 1S78C 4S1QH 4GT7A 2AVFA 3FYEB 2XKUA 2ZCHL 2XZCH 4KXZI 4L3EB 3TBTB 4D9LH 3JV6A 1AR1B 1NC2B 3NN8B 5AZUA 3HHSA 2D7PA 5JDSB 1D6VH 4CMHB 5AD0A 5CR8A 1EJ6A 4AQAB 5C6WH 5HJGA 3D12B 3HKZA 5JLZB 1FZMA 3SQBB 2UYLA 2LAGB 4WFGD 1F6FB 1OB1B 2R0WH 3KDMA 1YNKL 3WGUB 1UEMA 2DQHH 2JJWA 5MP6L 4ODTL 5GS0C 3ARVA 1QBAA 1KTRL 1S9WB 4HOXA 1R19A 4HIEA 1ZTXE 2EH7L 5C08B 2H1PL 3D3VB 3MC0A 1JVKA 2OXHB 5GZOA 2Y07H 2W94A 1FG9C 1J48A 3ARUA 4X7FC 4RFNC 5DQJA 3BKJL 2Z8WC 4IGBD 4KK9C 5DQ9A 3FO2B 2R7EB 2IPTL 3DARA 4DP5X 5JR1L 4JVPA 2BIOA 2NNRA 2K7PA 4C56B 3HVNA 2DJUA 5F9JA 4XNYH 5I74C 2UZPA 5HHOB 2DQTL 3FSWA 3VMNA 1IGIH 4GRLC 4P2QB 3PDOB 4TUJB 3BWAB 2F68X 5E94B 3FBKA 1AE6H 3U9UB 4OR1A 1JF5A 3MBEA 1MFDL 5TE6L 1KBPA 1M1XB 4PJ5D 3OHMB 4K3EH 1I8LA 1LO5A 1WZ1H 3CE1A 2F54A 2NYZA 3TBYB 4NB7A 3RY5A 2CO4A 4FABH 3Q1SH 4HXBH 2KLSA 1BP3B 2DM3A 3BD4A 2PO6B 4G43B 4XP6H 1WP6A 4Z7VF 4W9IC 4HPYH 1E0OB 3GIZL 5GS1A 2JK5A 1M05B 3KWTA 5D8JH 1F1AA 4YXHH 3UROR 1ZA3A 3G6JE 3O4OB 5HJ3B 4YHZH 4NKOA 4H26B 3CDYA 3DV6B 1QG3A 5JR1H 1WAEA 3CX2A 3NOIA 3T0WA 2HAZA 1INQA 1EEYA 3PPSA 4XWGH 4MB4A 2QVMA 1HT6A 2CBOA 2X3AA 4PWEA 1LLAA 4GFTB 5E1GA 1LK3H 1IGIL 3M7OA 4PJFB 5AZ2H 2JMRA 3WJMA 4N2HA 3SDXF 1I7RB 1RUQL 2DQDH 5K9KA 1FYHB 5DT1L 1UJTA 4AMKL 1YNTF 5IK3A 3VXME 4D2NA 2ZUUA 1SEBA 2NZ9C 1CCZA 2Z0BA 4LLMA 4JFPA 3UGUA 1OXYA 5IOKA 5LQBL 1CLZH 4NN6C 1IARB 4HHAB 1HZHL 1QFHA 3LRHA 2PPCA 1FZJA 2V7HB 2GABA 1Y7VA 5BZWB 1BF5A 5IM7B 1SJEA 3QXWA 3RNQA 5DSCB 3AWEA 1DQQA 1AHWB 3EDEA 3QZWA 2J8UE 1B0RB 4YHZL 2OTWB 4B9YA 4JG0H 4LMQE 2WPGA 3IPBA 2E75C 5F0JB 3K5SA 2CJUL 4L8SB 5C7XL 2GC7C 4UZUA 2YAFA 5AOLA 1QBML 1A6VL 3UTOA 2C7FA 3GSRB 1YMHB 2UX6A 2H7WA 1D7BA 3SKOB 2ZKMX 4D0BB 4FXKB 1DSFH 1W72L 5DYOB 3KWXA 2ZP8A 4HKJB 1RK1A 1KV3A 1U0QA 4XPGL 3N1GC 3UXFA 4XPAH 1G7QA 1JE6A 4ICWA 1HFUA 2Y5EA 5D7KD 1LEIA 1DBAH 1E4XH 3GF8A 1E4WL 1NCHA 2NR6C 4BQ9A 3ZK0A 5JOPD 1WPCA 1J8HA 2BXYA 4MJ6A 5EC2B 3TFKD 2VSCA 1T89A 2OR9H 1E8XA 1TT6A 1A9EB 1K4CA 2D7QA 5I6XB 4YO0B 4NJAL 4XXCA 3K6NA 4ORGA 2FJFA 3ZT6A 1ZLEA 4KRPB 2IAMD 1S9VA 2GUOB 1AHWC 1G6RH 2GTZA 3Q44A 3FPXA 1HL8A 4TUJA 5DS2A 3IDYB 4OD3H 4D9QE 2XG5A 3ZTJH 2ED7A 3VE0A 3ZZQA 2E4TA 3ULVF 3I9IA 4UF7C 1AY1H 4L8SC 1LO5B 2FWSA 5CD5D 1FZKA 1L5GB 4R7XA 3BPNC 3D39B 3CVDA 4FJ6A 1Z3GH 1I9JH 4PY7B 1PMYA 1BF2A 1JPFB 4LASH 2Y1YA 4N0YH 1M7DA 5L2JA 1P5UA 5CU9A 2NXYB 4TQIA 4UTBL 1KELH 4Z7IA 1Y18A 3O4LE 3GBML 2E59A 4QXTA 1GJUA 2X4UB 4R90L 1YO4A 2FNWA 2PTVA 3LPFA 1Q8MA 3ECWA 3GSVB 3P3UA 4HGMA 2CSPA 4YAQB 3ME0A 5BRPA 5FYLE 5I1IH 4F80A 3EZ8A 2XFXA 5EPMB 3BMVA 3ROLB 4LLWB 4JPWH 4FERA 1MJ7L 5I6XC 3I9AA 5I6MA 4IHOB 5DVLA 3SN6N 3AS2A 2FATL 1IGMH 3LXUX 5D7LB 2FX8L 2NTFB 1NEPA 3LZLA 3OAWA 3BPLB 1QFWI 2EE2A 1NICA 3VXUD 5EIIA 3NPZB 4NO0B 5KS9A 4MAYB 5DEGA 3U9WA 4HHAA 3UPRB 1IM3D 1U36A 4G6JH 3OKKB 3H1ZA 3O3DB 5HVWA 2IDCA 4XPFH 4IBTA 1OGAE 2LR4A 3CH8A 2HKHL 4HEME 1YEGH 5CWSA 1BCIA 1E6OL 3DK2A 4ZMQA 3V5HB 1NIBA 1B0RA 2F8IA 4YHIA 2QGEA 1JPGB 3CDZB 5B8CC 4OVUA 3L17A 2H6PB 4L5FL 4KNQA 5FC9A 1FCCA 1JRHL 5FWQA 3GSRA 1EHLL 1GSKA 4Q0XH 3NJXA 2WKGA 5BMFL 5FGSA 2Y69B 2XZAL 2O5XH 1K3IA 1UT2A 3O4LB 5IW1B 5J11B 4PS7A 3ELQA 3RWEB 4OZ4B 3WL9A 2ADJA 1N6QL 3CHPA 4ONFL 1NCJA 1G7QB 4KHTL 4OFIA 3VFMA 2K9FB 4LSVH 2WC7A 1E27A 3L2LA 4TQEL 1IAKB 4FQQA 5G4OA 4BKLB 1LEIB 3D39E 3QWQB 2A83B 4GS7C 2OP4H 4ILDA 5BJTA 5M7QA 1QEXA 2Y72A 4BCXA 1YEGL 3E1F1 2VN4A 3AREC 2Z92B 4TM9A 1INDL 2PPDA 3OAZK 4CMMA 2AABH 1MLBA 1BX2B 4YFEA 2JQZA 2EVGA 4MBOA 2R29L 2ZCLH 3MRRA 3II2A 4UNIA 5IT2H 3VSTA 4ONOA 5IVNA 3CUPA 2OTUA 1O9VA 1Q9LA 1AKPA 3UTSB 5LBSH 4YHPA 2NY0B 1J05A 4HH9B 3A4AA 2CO3A 2J1ZA 2PYEB 2XI9A 4GFXA 4MQSB 4P4RB 3R06A 5DMIH 1SHXA 3QEGH 4DN3L 4K2UL 1QD0A 3EF4A 1F4XL 1ZSDB 3ATEA 4H8PA 3SDXE 2HUHA 5DWUL 1ETJA 4CBPA 4JFDE 4AJ0A 5EUOB 1FYTE 4P2OB 1NFDF 2EO1A 4Q6YA 3VXSD 5F44A 2XX0A 5DI8B 2XFXB 1XGTB 2VXQL 5EPMA 5LAPA 3U0PA 3EAKA 1V7ML 5B8CB 4B9JA 2ITCB 1ZY9A 3PU7A 2WQAA 1UC6A 5C8JB 2DOCA 5TQ2H 3LQAH 3SCMD 4DGVH 2X70B 1GW6A 5GS2H 2YD5A 3GJFB 4G3YL 1MAJA 3UZQB 1G7LB 2DQFB 2ZOKA 1AG0A 4ZRGA 4LLQA 1PZ2A 5AW1B 3FQUA 5C0CB 2F2HA 4FNSA 3CQQA 1IJ9A 4NYLA 2YAPA 1UVQB 5DMJB 4N25A 4GRMA 1I7UA 1FL6A 2WN3A 2NY0C 5AVQB 5TFSL 2CCWA 3UAJD 4IEFB 3ZDXF 4X7EC 4WI0A 4ZPVB 7PCYA 5L2KE 4YXKH 4KO7A 3VG9B 4OV5B 4N2DA 2F8VA 2J2ZB 4J3OH 1LO4L 4PRHA 3FMGL 5AG8A 4G6FB 3VTTA 3VFWB 4OGYH 4MCMA 3TYFA 4PWGA 1PD6A 2ZYIA 3D3VD 2DLFH 3NSDA 4UMGA 4BQ8A 1XF5B 3AVEA 5PCYA 1JPST 1PAMA 3O8XB 4LEXL 3QG6B 2VJXA 2WMPA 3S37X 4FQHA 4CL7A 1R5IB 5IW1A 2H5UA 4OZFA 3DUUA 4KUCD 4AY0A 1UGNA 4OZFH 1T1ZB 2A77H 2AEIT 2BSBA 2ATKA 2DI7A 1NCWL 5CP3A 3RZCC 5TF1H 4QRFA 4A2GA 4PJ7A 1E8WA 2N1TE 4TVPE 3X17A 3FT9A 4J6RH 4PGCA 3DVIA 3CC5A 4P05A 5TH2B 4F57H 3UZEC 3RNKA 1BAWA 1GCFA 3ZO9A 4I18A 1TPXC 2VXTH 2A5UA 3PUUA 4AVHA 1J0ZA 3FFDA 2VDPB 1TQBB 3IJSB 5EF3A 4WTZA 4Y4KA 3X11B 3MJ9H 3ZZSA 5B38G 4TUOB 2CK0L 1VPOH 2Y7LA 5KSUB 4OF5A 5D1QA 3LVEA 1KG0B 4WI4A 4PGJA 3LQZB 1SDDB 3CUPB 5G4NA 1Y1DA 3UTSA 1FWXA 4HCGA 4Z3GA 1ND0B 4ELMF 5HPOA 1MQ8A 4WUUB 2C26A 2J73A 2XSKA 3HLKA 4KFZC 3A67L 2QSTA 1UG9A 3T2PA 2EVJA 3QQ3A 3SDDA 3WSQL 3L9RA 1G9NH 4Y1AD 4ZZFA 1GY2A 4W9ZA 5FKPA 1JGIA 5F7NC 4LF3A 4JZJB 2GC4C 4AEHH 2OJEA 1BFSA 1JGVL 1CGTA 4GKZA 1G1OA 5F96L 3KPTA 1ZVYA 1I8KB 2C1OB 4NZTL 5FW8A 3TO4B 2ZWLT 2WCSA 1DCEA 5FGRA 3U0PB 3VG0L 1BM7A 4M4PA 1OZUA 3VWKD 4D0CA 5FYJH 4ZMVA 5E95B 3TEXA 1RUML 2J6EH 3QXUA 2IFFH 5IQNA 1XB6A 3AU1B 2VN3A 3BUBA 3MJ9L 4KX7A 5DUPL 4UT7H 3CVCA 4HFUH 3NVQA 3DTXA 5EZLA 3ZJAA 4DEUA 4X6CE 4DGWC 1C9SA 3MV9B 5DC0A 1S7RB 5K33A 1PFOA 5F7LB 3W2DH 4H0HB 3L3IB 3IXTA 1IB5A 4OT1H 2R2EA 5FCSH 1EVTC 1BOYA 1FJ1A 4L1BA 4N2MA 5T3XE 5JW4R 2JCCB 4IDLA 4OTXL 4BQ6A 2D4FA 5LNGA 2NY1D 5K39A 1QTYT 5MI0C 3HZVB 5C09D 2BIIA 4V1DE 1FFNB 2PMZA 3LH2H 3VFVA 5LBVA 1JCVA 4PG9B 1LK2A 2X0WA 2W9DH 1U21A 1DCLA 4ZW7A 1SBSH 3L1FA 1SUHA 5A1AA 2UUDK 4ERSL 4H1LG 4AYEC 2NUTB 5IQMA 4X5WA 4UZSA 3TO2B 1NOAA 4GT0A 1NH6A 5C08A 5D72L 1EO7A 4QRSB 2OXHA 1C12A 3VH8G 5ILTH 4C59B 5D5MF 5CN3A 3QG6A 1HKLL 1BA9A 2F74B 4LPWA 2RCSH 2WMPB 4RMUA 4EO5A 1DQLL 5BV7B 2JJTC 3RL1B 4APQB 4NRXA 5CZXD 4UOJA 3GGWB 4BK8A 4HCRH 4WFEE 3BWSA 3FO2A 1A1OA 1F3DJ 4JG9A 3IGKA 3AQZA 4BK5A 4MCYA 1N2RB 3CLEL 4OD2B 3RURA 5F1NB 4Y19B 3RUGF 3LN9A 3B9KD 4ZOAA 5DJ2B 3QQNA 2JFCA 4JPVH 3V7AG 5KTEH 4YHKL 2C5DC 1XR8B 3FUNA 5T3ZD 5JDJA 1WWBX 5C07A 1OARL 1YJDC 3EJJX 3CC5B 3GS4A 3KPMB 4QXUL 1RUAH 3P11L 2NY3C 1OAUH 4IRSD 5ITBL 4JGNA 2ZTBA 2NY2C 2H2SC 2DQIH 3VWKA 3GSNA 1A22B 2XDHA 3KG5A 4K7FB 3VI3E 1RKRA 5JXEC 5D4HA 4L1SA 2AEPL 3H9SB 1QLRB 1OPGL 5D2LF 3K2KA 1ZA6B 1ND0A 5C0BE 5A40E 3NSXA 1MJ7H 1HKLH 1ZRUA 3EZJB 1RP8A 1GS6X 3SJVB 3IPEA 3CHRA 5LCVL 4KZ0A 3CHOA 3D0LB 4KJYA 4PJXF 4PLOB 2BSSB 1UWYA 4UILL 2FAUA 3AUVA 4JPIA 2HRPL 4M7LL 4ZXBB 1DZBA 4FLSA 3MV7A 4HLZG 3GMMB 1UXSA 2Z91A 3WIHA 4KUZL 2FD6L 2HTLD 3LHAA 1KDIA 4KY2A 1ZD6A 5EUOF 5BOJA 2P5WD 5AEAA 1CLYH 3WN6A 2YWYA 4QRTA 2YK1H 3CZEA 2W81C 3IJ7A 1N4XH 3AADB 4MMZA 5EV7A 5EZOH 3FFCB 1D9KA 1J1PH 1VKXA 4GXVL 4HIHA 1VFMA 4XC1L 2C7UB 5I6LA 2WTRB 1ZVHA 2P45B 1DN2A 1KPVA 4CC4C 5BV7L 4Q97A 2CDEA 2JIXB 2FRGP 1FGVH 2V7HA 3ABLB 1A3LL 1T22B 2NNFA 1JGDB 4ZW5A 3HG5A 1T1WA 4UOW0 2Y5TA 2GFBB 1NC4D 3DX8B 5DSCA 2CGYA 5A6IA 1P7HL 4U6XB 1NAMA 2BHZA 5IMLA 2LGNA 2XICA 2DL2A 2EO9A 2H0EA 3PQYB 4PWIA 3IGAA 4MXWH 2GQHA 5DMGD 3WFCL 5C07D 1RLBA 4JPKH 4KHTH 1TJIL 3IWUA 1W0YT 2YAHA 4RBPH 5GGSA 1R3KA 3NJVA 3S97C 3OAYH 1CQYA 2J57A 25C8L 3K0WA 2GIXA 1YMHA 1UD6A 3IBEA 1KFAL 2HJFA 4FA7B 4XO9A 1JP5A 2Q10A 2Q2LA 2YA1A 2V5RA 4LP8A 4NI3A 4WI8A 5DJZB 3U7YL 1A3QA 4BFOA 4IBSA 3U46B 4AQ1B 3NCFB 1ZEAH 5E0FA 1DVQA 4TPRH 4HS6B 1E4KA 2H2SD 4OLXH 4ZO7A 5DUML 1COBA 1IIKA 4IM8A 4W4OC 5I1AB 2OSLB 3FCSA 1V54B 3U2IA 2A9MH 32C2B 3MR9B 2ZX6A 4MYPA 3S5LA 5D70H 5JOPE 4OGAD 1PS3A 3G5WA 5EZPA 1OGPA 2PWGA 1S7UB 1ZWIA 2FJFB 5IBTL 5JHDE 5HGHB 5KBLA 1XSJA 3EH3B 2XWEA 5A6MA 4KU1A 2O93L 4R4NC 1E8ZA 5E7BA 1SOKA 4KX8A 4ECNA 5I15L 4AQAA 4QTHA 2IMMA 5I74B 1XL6A 1V7NH 4PY8I 1JNHA 4QI3A 4PWKA 3JV5A 2UYLB 3ZO0A 4YGVA 1C5DA 3D39A 5GSRB 1MZZA 4YX2L 5JW4N 3W5MA 1ADQA 2CU9A 5KVGL 4V33A 2NYKA 3GIVA 2FECL 2Q7YA 1FNSH 4R4BB 4AYID 4Z7QF 3ZE0E 3FULA 5IEHA 1QLEH 5LCVA 1XBDA 1Z2KA 2FE0A 2VDPL 4LPXA 3VXSB 4JPIB 4YAQA 2XQBL 4AOFA 3NEEA 2QFRA 4I89A 1WFIA 4RDBA 4GW5B 1URZA 4QKTA 2Y7NA 5GGVY 2R9HD 5BPPA 1FDLH 1YA5A 4C56A 3BP5A 5F9JB 3WIFB 3MNZB 4XMXA 2WBWB 2PXYB 1FZOA 4ATTA 1KXVC 4B6ZA 3QQDA 3NDZE 3O81A 4EI6B 1AXTH 4M6NH 3WNLA 3GSOB 3PRZA 2Y9RT 1OGAA 2DKMA 4PLKD 2QV4A 4QO1B 3ESNA 1JYNA 4AJYV 2CHDA 3NK4A 2JCCF 1U3NA 2C1PB 3UPRA 2OMZA 4OLUH 3OKKA 1CN4A 4HG4J 3QCTL 5E9DD 3L1OH 3S4SG 5GGQH 2CMRL 5F9WB 5ESVB 3IBOA 3MLRL 4NQQA 4YQXL 4O4YL 4ZODA 1KB9K 1DEEB 4GQZA 1CFMA 1UURA 2R1XB 3C5SB 3Q8CA 2IANB 4TL4A 4R7DB 2F53A 3KPSE 3BH4A 5JNYB 4PJ8C 2NYYC 1G84A 4XPAL 4Y1SA 1M05A 1JZ5A 5GZND 4HT1H 4N2AA 1T2JA 1YYML 4GKSB 5CKGA 4D0DB 2YHGA 2YKLL 2XTSA 1N3NA 5K9JH 3T0AA 1JDCA 2WQSA 3O3UN 4BA0A 3VD4A 3PHQB 4D8PB 4L8CA 3TA4D 1ZCRA 4WGVB 1JFHA 5ETUA 5DJZA 3GPSA 5BCAA 3WJMB 3LOWA 2HVBA 2R2BA 4WZ9A 1KUMA 5F2FA 5JUEL 3IMUA 5JPNC 2J88H 3P1VA 3RJOA 2V8LA 1QSEA 2WLHA 3AREA 3D1MC 4HAGA 4WK2B 3WTWA 4JO1H 4XP5H 2ZOLB 5I28A 2QSCL 32C2A 3L1OL 5J3HC 2QR0A 3EJPA 2P5EB 1MCNA 7TAAA 5BOZG 5T5NG 2OXGA 2XRAH 5FK9B 1KWGA 2XV6B 3UO8B 5JZ7D 4AEEA 3RA7L 5FOBB 4EMZA 3OJDB 1MJUH 2JELH 3L4VA 4PWHA 4WUKH 3OD3A 3ARBA 1IBFA 1QZ1A 2EADA 4PW4A 1OO2A 3BZFA 1JNHB 3FT4A 4YPJA 4NZUH 1YNTA 3SDAD 2IPKA 5C0AD 1IAIM 3QUZD 4MYWB 4YHPB 3S34L 4YXLH 2QDVA 3VG0H 2J8HA 3ULUL 5JQ6H 4FOMA 3GIVB 1N8ZA 3BIAX 5CJQL 3TJEH 1PDKB 1PIFA 3EDKA 4ZFZA 3O45B 4PLNC 1KCUH 2OMVA 3U7WL 5ANMA 3CFEA 1W16A 4N2BA 3BAEL 1MNNA 1H3XA 4MNHB 4J8RB 1EJ8A 5DFWH 2G60H 1AGBB 1U8LB 2VDKB 4UQ9A 5KEZA 4CUCA 4L4TB 2VR5A 3DVNB 5I1JL 1A4AA 5BZXA 3KDPB 2Q0ZX 4FGMA 3MRNA 4MSWA 3CVHA 2Q76A 1PKQB 4IOIB 2LQRA 3V0AC 1A6TB 1BJ1H 1EEZB 2YLHA 1WT5C 5IFHL 35C8L 4LDLB 1QSZA 4JW3A 2B2XL 2FO4B 1Z0NA 4JFFA 3EXLA 3FQUB 5I0DA 4LKXB 4ICXA 3GB7A 1KJ2A 3PJNA 2D31B 2KT6A 3GUTB 2CHWA 2PETA 3OQRA 4W6WB 5I8CA 4TRPL 4FFYH 3MLSL 4XPTH 2W9EL 1A5FH 1AQDB 4HKXB 1KCLA 1N6VA 1O5PA 1IC1A 2W8CA 1CK0L 1PGRB 2IANA 1VEMA 1S9XB 2R4RL 2BPBA 4XZ4A 5IHZA 1CFSA 1KACB 2G3NA 1EAJA 2J5LC 2X4UA 1PZSA 3X1BA 5AKSA 5KSVB 2OKMA 2KMWA 4KRMB 1QKZL 4FG6D 3H54A 3G6JA 4QXUH 4ANVA 3ZE1E 3BVTA 5LNEA 2QQNH 2RMNA 3ROLA 1R5IA 1Q90A 3M1CA 1TO5A 3RZCA 3WLWC 2OAAA 4JFEE 2Q86A 5KYWA 4OCYH 4IHOA 5E2UH 2YQ3A 3V0WL 5JXAL 3IFPA 1WSST 3CNKA 1BZ9A 2Z1PA 4DW2L 3K72B 4W6XB 3NJFA 4HPYL 3LKNA 2C9QA 2YMXL 3BEWA 1UKTA 4OFYD 3KLHD 1PL3A 3C60B 3OKEB 4PJIF 5F6HJ 5HHQB 4OGQC 2AJSH 4OZHB 1SYSB 1ZT1B 1PJWA 1TPXB 5EEVA 2PTTA 4FA6A 1A7QH 3TWYA 5LAXA 3BP4B 5DR5L 1FL3B 3WNIA 4JQVA 2HG5B 1WUNT 3LZFL 1CS6A 3DUSB 4QRQA 4ALAH 3SPJA 3CDZA 3O2WH 2V9UA 3R8QA 1FSKC 5FKAB 3ULUC 5KBMA 3TZVA 1A7PL 1IBZA 2DQTH 5CSZA 5B39B 2BWIA 4E5XA 3EBHA 1ETZA 2QL1A 3TJHC 4IOSD 4MA1C 2XQ0A 5FEBA 5DC9B 3IJHA 3I6GB 3FFOA 4IBZA 3OLGA 2BMKA 4UV4H 1U8JB 3OR6A 2CRMA 1AHKA 3N91A 1AS6A 2XX1A 3PQYE 2FBJL 4YOKA 1KCBA 1F2QA 1A4CA 8PAZA 5J6GA 1BVNP 1IAKA 1RFDL 4O02H 5HI3C 4GUQA 4JDEA 4XH2B 1NEZG 3MUGB 4LAJH 4X6DA 4TNVF 4DUXA 1PNDA 1SVZA 4NQDB 1GR7A 2A83A 4LLDA 3BIKB 2GHWB 5GGRA 1U8NA 2IDSA 4KKAC 1AFVH 4MLIA 3WFCH 2B7DT 3MRNB 1LD9B 4MDJB 4F2EA 3BZEB 3UPCA 3DTXB 4JY5L 3RTLA 4FHJA 4FYQA 1MCWW 3C12A 1EEZA 3R0MA 3UOAB 4FTVB 3MJ8A 1TSHA 3KXFB 4FYRA 5CZKA 1YN7B 5T3XL 4QLRA 4M5TA 1KLGB 3T0EE 4EDXB 5F3HA 1WQVT 1IE4A 4MD0B 5EBLB 3RIAF 3QPQD 4ZW3A 3GUTA 1T83C 1SDYA 3P9LB 2K6YA 1IIIA 3CSYA 4WO4D 4K4KA 1Q9LB 3FZUD 4BFRA 1QW8A 3HVDA 1AG6A 3G5XB 3ARGD 3N85H 4BXSV 4L4JA 5J89A 1C16A 4O2CA 1LWJA 3W0WA 2BP0B 3WI9A 5GGSY 4U1GB 1R5VB 4NPYB 5EEZA 4M3JA 3DPBA 1T6BX 5IROD 3RDJA 1L9NA 1FYTD 1QWUA 2NZIA 4P2OA 4M03A 3WYRA 3U2SA 1Y6MR 3QAQA 4FLHA 4CSTA 1Z3RA 1YPZF 1M53A 1W72B 4U1MB 2UUDH 1NIDA 2MIZA 3T3MF 3RKPA 3Q5TA 2C9PA 2AV1A 2F7QA 3ZUCA 1JDAA 1PZAA 4JG0L 2QLYA 3RHWK 4K7PH 1NOLA 4L29A 2L4OA 4BFBD 2H3XC 2CJUH 3H6AA 3V4VA 4MNQA 5T1DL 2R0LL 3AJ7A 4FLOA 4BCYA 2F7OA 2Z8SA 1IFHH 3JV6B 4J3OD 5F1KC 4WKZA 3I74A 3KPMA 1T0MB 4XPHH 1KGYE 2JJVA 2X0VA 3VGDA 3T4AC 4GRMB 2O6FA 3MXWL 2APBA 2MPAL 3VWKB 3BP4A 5I1DA 4LL9A 4ZMWA 3BSGA 3WY4A 4BSJA 3GD1C 4ADJA 2A1WH 1QLRA 1HHGB 4LGSB 4OFVA 5F96H 5GZOD 4M4RB 3TYFB 3FQWA 4EUPH 1S9WA 1FVCA 1X5MA 3GT6A 1EAPA 5B39A 3ILPA 1JCKA 3GMNB 2ARJQ 1AXTL 4M6NL 1U4EA 4TQPA 5HJBA 5FYJE 3I6GA 3F7YB 2L3BA 4XOEA 4HWBL 3ZLQC 3PXJA 1CXKA 2JKLA 1QSFA 3DUUB 1UXSB 3S96B 4ODSL 2QBWA 5F3FA 3UCRA 1AYOA 5AVVB 5CJOL 1VFBA 4IJ3B 3H4HA 3ARFD 4XCFL 3ZKXC 3G6JF 2MCMA 1I9JL 4NQDA 4BFIA 2XZQL 4PM1A 4RA0C 1L3WA 4JREC 1NFDE 4AL8C 3CN2A 2UZYB 3FAWA 1QW9A 1ZLDA 4F8TA 4DCQA 5H37G 3AS0A 2F19L 4UT6L 3MJ8B 1M1SA 2BWQA 1YRKA 4XE0A 3DX8A 4Z8FH 1J8HD 2VITB 2X3CA 3P4MA 5IMLB 2R1WB 4Q2ZB 2PO6A 4ZD3H 4LHUD 3ESPA 2BERA 4HWEH 5KSAB 1R17A 5TTRA 4XCYB 4GAYA 5F9AC 5GS1B 5GGSB 2CUMA 1QTPA 1H8LA 2OSXA 1DEDA 2FZ3A 1UACL 4NIKB 1G1YA 3TH2T 1MF2H 3HAEG 5LWYH 5IMKA 3FUMA 3OKOB 4P2RA 4WUUE 4A67A 1T7VA 4MAYD 1PZBA 3U2SB 3DOSB 4N5ED 5IT2L 1XIWD 4HS6A 5D2NC 3NZHL 4HDIA 3T0ED 2ED9A 3KYOB 2C3VA 4LIQE 5I1AA 3MCLH 2CLRA 1U8HB 1SOSA 1GOGA 2DM7A 3THMH 3NGBB 3VFNA 2NUPB 4NRYA 3IFLH 4LSUH 3BQUC 4PJIB 1LHZA 2LU7A 4KK8D 3AROA 2CDFA 4F7EA 2Y1AA 3BGFC 4GRWF 3R0NA 3HBGA 1GGCH 4GUPB 1CGSH 1UYWL 5EDXA 3X14A 1H6EA 4Z3JA 3TESA 5HDOA 2KZKA 2VGLM 3QEQA 4LNVA 2NY3D 1AZBA 1MRCH 1NMAH 1SFDA 5DVKA 5F7KC 5K39B 5K1VA 3T0VA 5LUMA 2NY2D 3NCBB 3G7TA 1MPAH 1XSKA 5FECB 1SBBA 2VNCA 5IUSA 1V7MH 3CGTA 3PCYA 3IE9A 2NY6C 1FFRA 3FHAA 1VGKB 5LWYL 5GS0D 3HRZA 1JWMB 3LV3B 3VXQA 4FQ1L 2WUCL 4BWTA 4X9HA 2E9GA 3GC3A 4K3JH 4N0UA 1H5BA 2AAVA 4YDJA 2EUVA 3E2HB 1X5KA 3KH3A 4QHKI 4D0BA 5B3NA 2EZ0D 2IIJA 2BHUA 5FA3A 1RK1B 2A9AA 1CICD 2N0MA 3KYNB 3RL1A 1OW0C 1LL1A 4KI5C 1LO3H 4F37K 3ZMRA 1U3ZA 3IAPA 5JIMA 4Y4FD 4NP4L 2DBLL 2BLFA 1KPUB 5GS1C 2D0GA 1KZQA 1TMCB 2F5AH 4GMSL 5IW6A 2I9TA 1T04A 3O9WB 2IAMA 3TN0C 2AEQH 1I9IL 2YBRA 3N0PB 3D07A 3T8MA 4MB1A 2VDQL 2VLRE 4HUUA 2FCBA 1T1YA 4G1MA 4JPSA 3SKJL 4FMFA 1PYWB 3KM2A 3JZYA 4HIIB 1Q1PA 2RACA 4LCWB 4X6FB 4U1LA 1X6NA 5LBGA 2H0PA 3H85A 1S46A 5JIQA 4N0FB 3R7QA 4YIQA 4IMLA 4EDWH 3MGTA 3GXFA 5ENWB 2SEBB 1RUPH 3ATFA 4WW2F 3OZ9H 5EIVA 3G08A 3G5VB 4R7DA 5FFGA 3QIWD 3MJ9A 5DMGC 2E86A 3GKWH 4PJEB 4BH7B 1V27A 2WW8A 1GGIL 3NP4A 2RB8A 4P3DA 3H42H 4PJ8B 1F02I 2X7LB 4J6RL 4MJ4A 1DVZA 4ZW8A 2X4RA 3BISA 3JT0A 1EDQA 1NAMH 1PTZA 3MAWA 3QB7C 4BM7A 3FH8A 4DP8X 3ME0B 8FABA 4P2RB 1OK8A 1UEYA 1SLXA 3UDWC 3MRQB 5L8KB 3KWUA 4GEIA 1HNYA 2WXNA 1GJWA 3P3TA 3ZE1F 3ARGA 2CLRB 4MQTB 3TL5A 4BJLA 5ACZA 5JHLH 4KDTA 2NUPA 4O2EB 3AXLB 3KBHE 4QYOA 2C3GA 3GWJA 3LKQB 2YXWA 3DLQR 4WU7A 1KENH 4G8GD 3PNRB 4DTGH 4GUPA 3X14B 1HXMB 3G9VA 1DQTA 7FABL 1ML0A 4GSRA 2Y1ZA 3X1FA 5AVSB 3H7LA 1G0XA 4JO5A 4ZAKD 3SGDH 4OM1L 1GGIH 3VRJA 4B0MM 4QXWA 4GG6A 3WFEL 4TULL 2LTQB 4ZPTB 1AQKH 3EOBB 4IRJA 3BPCA 4GKNB 4AV0A 3JTSB 4W81A 4CVXB 4M7LT 2VRAA 1MCCA 1NCWH 2OCJA 3QA3A 1K9TA 2F08A 1E9PB 1JZDC 5H2BA 2BP8B 3ABMB 4OAWB 1A14H 2ZPKL 1FDLL 2IDQA 1IAIH 2GTQA 1SXAA 3H7BB 2A4EA 3H9HB 3NAAL 4F57L 2OMUB 1TYEB 3KR3H 3VXUB 3O4LA 1PLCA 5FYKH 1H0DB 2G3ZA 2ADJB 2Y23A 5C0RL 4H88L 5EU4A 1MCQA 4ES9A 4KJQD 4AYFB 2XQYA 5I71C 3H0TB 1BQHB 3AT9A 3NIDF 4PRHD 3BDXA 1MJ8H 1KPUA 4LLUA 3V0HA 3MR9A 2ADFL 7PAZA 2JCWA 5D1ZD 1Z5YD 4GO8A 3SSGA 1PX3A 3Q9QA 2Z34A 5T1KB 1HCZA 2ZOWA 1IZKA 1UZ6F 3CVHB 4DPAX 2B08A 4OJFL 1MHEA 5IG7A 3VQLA 1WHPA 1IGJB 3V0FA 4FI8A 3GM8A 2HRGA 2HKFL 1A6TA 4FTVD 1RZJC 4RRPA 1BYPA 1MEXL 1ORQB 3OC8A 3ZZLA 5C86A 1M56B 1XB8A 5E4IA 5ICXB 3TH3T 4XOBA 4MZ2A 4U1LB 4V2BA 2R69L 5LGHH 3ZPDA 5AVUB 4ZMZA 3RTQB 2DICA 3FO0H 4Z3EA 1C5DB 5IQ9A 2V5TA 1A7OL 3WNNA 3MGTB 3MV9D 5I0WA 2FSDA 1HINH 4I1RA 4R9HA 5F7DA 3RWGB 3L3OC 3NCYP 3T4YB 4MNQE 3KPSB 4F7PA 2Z1KA 1UOVA 4PJ8D 2EAEA 3R8BB 3GMOA 1T66D 4PUBH 5K1NA 1HHHA 1J0YA 2EXYD 2EE0A 2DQCL 1B4LA 1TLMA 2DM2A 3DI2B 1KYDA 3CZUB 4H1LA 2EP6A 4A7GF 4WO0A 5BVJA 4N1HB 4I48B 2DMCA 3ZKMD 5KS9E 1FP5A 2DZEA 2WKOA 3FTXA 4O58L 1RHHA 3RVUC 3S9DB 1M4KA 4JUSA 3BP5B 2ITCA 3ZDZB 4UYQA 3QDGA 2R69A 3C9NA 2AEPH 1Q4NX 3QUXC 3HS8A 2X05A 3K72A 5DS8B 1DE4A 3W0WE 1FO0B 2Y5QA 2P9RA 1PLBA 4UM9A 1ZK5A 3VRLE 2EH7H 2DJ4A 1VCAA 3NRFA 2EIMB 3N42F 4K73A 3MJ7B 2Y07L 1UQSB 3F2LA 4ELMB 2OJZH 3C60C 1I7UB 1EZUA 4QOKD 4IU2A 4XBPA 1P5VB 4PGBA 4N9GB 1A2YA 3IFOB 1X5JA 1J9TA 5FV2A 5J9PA 1KCUL 1FL3A 1EH9A 2ZKXA 5DF0A 2VAJA 2G60L 4WO4A 1JPTH 3MLTB 1JHLH 3KCWA 5CP3H 3KBPA 1EUTA 2QKIA 4JHWL 1A6AA 1UT9A 3KJ4C 4AYGA 3B2VH 3BPOC 4FNQA 5HVGB 4EN3A 3CQFA 2WCPA 3OKMA 5EBWA 1ZV5A 3L4ZA 4XC1H 2VZUA 2FEEL 5BV7H 1S8DB 3QK0A 1JI2A 2Q87A 1XGQA 3LD8C 2DQJL 2CPCA 4YK4C 4P23D 1QUNB 3UAJC 2C9VA 4Z7QE 2R2BB 1Q72L 3S35L 5CILL 1M71B 4X6BA 4POYA 4HGWA 4EPSA 5IQOA 3ULVL 1C8QA 4UDUB 1EEQA 4E9TA 4MXVF 3FQNA 3MYZA 1ZTMA 4XPTL 5TF0A 4TMPA 3T9WA 5KBDA 3QH3A 5EU3B 4ODHH 2DL9A 3RPBA 3QIUB 3RGHA 4YSSA 3EF7A 3BZEA 3TIEB 4E42B 1N59B 1JV5B 3QQXA 4OFDA 5FUZH 1T83A 3FFDB 4FYSA 4MMXC 4XX1E 4LAQH 4DSYA 4Z7UA 2BNQA 1KLGA 4GI8A 5DZJA 4M61B 4N26A 3EJZD 4RGNC 1JHLL 1W8EA 3U7YH 3W9DA 4YN3A 1RURL 3ILEA 4H44C 2LLNA 3P9LA 5DEZA 2X9ZA 3GJEB 3R19A 1MCFA 4GOSA 3LCYA 1HKFA 4MVBD 2MJWA 2ZYHA 2OMWA 4JDZA 3FQ1A 2H4EA 4Y8DC 3G5XA 3JWDC 4MAZA 4MASA 5F7DB 3O6MH 5FO7A 1KGUA 4IRSA 5HDQH 4CU7A 3PWLA 1BFOA 4U1KB 2FL5A 4NNXA 3VFRA 3V0WH 2FLMA 5LN4A 5F7HA 3Q2CA 3WDHA 1NFKA 3GBEA 1OSZA 4MNHA 1NGYB 4Z7WA 1F3JA 3BFWA 4U1SA 3JVGC 5EN2B 1JVOA 5JHAA 1DJYA 2C1OA 3TO4A 4ZAKB 4DESA 1W72A 4U1MA 4LPCA 4TTGA 4FZEL 1UWXK 2FWUA 4AE1A 2R23A 4LP5A 3MBXH 3Q2LA 2V33A 4WSKA 5IMOA 5IESH 3FO1A 4JM4H 4YR6B 3BPOB 5M95B 1I8MB 3C6LD 4NQCD 2WP3T 5DS8A 3GHBH 5SV3A 1D5BB 3KPPB 3QI9A 2VLRB 3W39B 5IVXB 4KRPD 3EUDA 5KSBF 2NNXA 3L3IA 1PLGL 3QCVL 3UZVB 1WO2A 1FJ1B 4IRZL 2D31A 5H4ZA 1L0YA 1G0DA 2X0UA 3HS0B 3IKCA 2VDPH 4B27A 4F27A 1X3DA 1OT2A 2VQ4A 1MNUL 2FIKA 3FF7A 4HKXA 3RGVD 1FG2A 3W81A 3WFZA 1A2YB 3IFOA 2QPFA 1FV1A 1BGXL 1INEH 3UPAA 4S0SD 2B3RA 4MKTA 3NRPA 3N41B 5GZNA 2OR9L 1OVZA 1ET5A 2FB4H 1IBGH 4KROB 1IJNA 2FT8A 1TQTA 2VERN 3MLTA 5DZ9A 5C08E 4CADA 4PJEF 2G0LA 1WWAX 4OJDH 4Z7QB 1QRKA 2Z31D 4G42A 3DX7B 5KSVA 1L7TH 3FNKA 1CYGA 3RPIA 5E2TH 3G6JB 2NW3B 1X5GA 4YLBA 2DI9A 2HKAA 5LB1A 3KJ6H 5KVMC 4V1DA 1OE3A 1T0NA 4A7VA 1QUNA 3NQIA 2H6OA 2BM3A 2FX7H 2HT3C 3LEYL 4Y19A 1FNHA 2VC2B 3MRBA 1XWVA 3Q3GB 4RWYH 5DCCA 4X6BB 5GRZA 2DLGA 1BZ9B 4PGEB 1DBKL 1I8IA 2EIEA 4RGNE 4WI7A 5J12B 4BFIB 1ZHLA 4E0RB 1MW1A 3ARWA 3PIQA 4NPKA 4YWGH 1D3CA 4JREB 3UJIL 4AGNA 2UZYA 5HHQA 1TQCC 5AVWB 1BBJA 3IGUA 4NLAA 4RMBA 1CG9A 1A4KA 3V4PA 5MEND 1INEL 3O3AA 5IROA 3QG7H 5CF3A 4KH9A 4JB9H 4H20H 5LAXB 1HH9B 2QGDA 5K5YA 1BG1A 1DBBL 3NIGF 1T89C 4OF7A 4WU5A 4PGDB 4AT6B 2E8YA 5EOTB 4PS4H 3BZ5A 5EZJB 4AQ8C 1AMXA 3W5NA 3H9SD 2VQUA 1C8PA 2FWOB 1VADB 1H8OA 2EKSA 3QR0A 4PJ6A 4NHCL 4X99B 3ZDZE 5J06A 1KJMA 4Y4FC 1ETZB 43C9B 4WHYH 2YD3A 3T6WA 5DLLA 4AQ1C 2YEZA 3KWVA 1S5HB 2Q6WA 4GAGL 4P59L 1RZJL 1MN4A 2X4PB 1URLA 2J1XA 1GZHA 3ORJA 4JY6A 4Q58C 4PHZA 5KBPA 5JXED 1PZ3A 1CFVL 4PEEA 4QRTB 3POCA 1KB5A 4HKBA 2NPLX 3B9KB 1NGQH 1V3LA 4G7VL 4N8CL 5JIKA 4P4KB 4XGZA 3DDGA 1LD9A 4M93B 4MDJA 4PRPD 5CUSL 4XT1C 1TETH 4ZW6A 1OSYA 2HT4C 1M3IA 1PCXA 4BHUI 2TRHA 5FV1L 3QI9B 2BXZA 4PJXA 4ATWA 1HH6B 1YN7A 4NBYB 2VSMB 3NAAH 2IGLA 4PB9L 1B0WA 4N8VB 4OB5L 3SDAB 4KX9A 1JOIA 2EDWA 4JM2A 2XY1A 2ZKHH 5F8QC 1HIMH 1IFGA 2WNKA 3VM5A 2ZAIA 3ECQA 4NDMA 4PWFA 1XVSA 1YY9D 1G9HA 2WXOA 5HGBB 4U05A 1LP9F 2RJMA 1UWEL 3APNA 3CXHK 1WLHA 1XXFC 1ROCA 3ZDWA 5CJOH 3J27A 4QJ4B 1H5BB 2QMJA 4YDJB 4MKMA 2D4DA 3ISYA 3ATDA 5HI5C 3FTGB 4PD4J 5EOCH 5SWZA 1CL7I 1DVFC 2NZ9D 2CHZA 4JFQB 4M6OL 2E6JA 1FLRL 3PE9A 5C9JA 3WTVA 1TG8A 1D7CA 2GY5A 4M62H 1OCWL 3B9KC 1DJIA 5F70A 1UXLA 3ESVF 1I53A 3DPDA 3H3PL 1F86A 2D7NA 4P2CG 3S5LB 4GG6F 5JORA 4OUUB 1EIBA 5KANG 1ZS8A 5GSVA 4HUNB 4EN2A 4G9FE 4G70B 1YDPA 3MUJA 4XCCH 2YJLA 4HZLB 2HLEB 3W82A 1THCA 3VFUB 5IOPB 4PCTA 1CG9B 1Z7JA 3U7WH 4I1PA 4IKKA 4XAWL 2MQCA 3UTQA 2VB5A 4P2RD 2DQEL 4I1NB 1O6SB 1VGEL 1OHQA 1J9RA 2NOYA 3E1ZA 5AZEH 3ALPA 5I1DB 3U1QA 4N0FA 3RVTC 3I84A 2RQEA 3HZYB 4X0NA 1IAOA 1NCDL 3DETD 1CXHA 2XN9D 3FH7A 4KZCA 2ROYA 1WIOA 4PVNA 5T3ZE 1FLRH 4GQPH 2H8PA 4NS0A 1FVCB 4M62L 1NUNB 2WLIA 3MCLL 3PABB 1XF4B 5DFVC 3H3PH 4NUPA 3W11D 4F7MA 2OJ1A 2NSMA 4PRIA 4IIQC 4E9SA 3QUHA 4CAGA 3E8UH 5ID0B 1JGLH 2V2XB 3RB7A 3UJTL 4JHZA 3MRQA 1O9ZA 1A6UH 1DZ0A 4JFZH 5DFAA 1VFBB 1PD0A 4ALAL 4LCYB 2NY4B 5AVXB 4NFBA 3D69B 3D34A 2O72A 4HKBB 3MOBL 4YSRA 4ELDA 3AGVA 1LO4H 4IKNA 1JK8A 4J27A 5J7CC 3CBJB 4XRCA 3J2PA 1B90A 3WS6A 1U8CA 1BDYA 3VUAA 3KE0A 5AAPA 4HF5L 3TEUA 5D2NB 1EGJL 4EI5A 4LCWE 4BA8A 1LYQA 4BUHA 1EQWA 1TIUA 2E5EA 2HWZL 2JE8A 2MNJB 1Y0LB 1NEZA 2ZUVA 4KK5C 1XDTT 1FH2A 2VITA 4N8VA 4NBZB 2VLLA 2DQHL 3MRGA 4RNRB 3WNJA 3QUML 2V9RA 3F6JA 4YDVA 4WW1A 3FOLA 2WXFA 1TENA 1MRDH 3NIFB 4LHJB 3HZKA 4PLKC 4M7ZC 3T1FB 1SHMA 1NGZA 4G8EB 1UZ8B 5J1AA 4L18A 3QS2A 2L7JA 3RE0A 3SGKA 1KEGL 3BKYL 4KITB 4JY5H 2OMNA 1TYJA 4FQJL 1ZLWH 1J1OH 1V5JA 1GC1C 5I16A 2NXZB 1N64H 3MCG1 5SWZB 3CDGB 3UH8A 1QSED 1AS7A 4N3UA 2GW5A 4QF1A 1PVHA 2CAKA 2FJHA 5GRXG 3SO3C 4RESB 5T33L 2OM5A 3HBPA 5DD6B 1J0JA 1YUHB 2K3HA 3DOIA 1ZT7B 5C08D 4PJ5B 1A47A 3AREB 4J3XA 4UTAL 1U8IB 2K3TA 2YO3A 3DX9B 4LLUB 2WQUA 1AOHA 3SQRA 1NGPH 4OUUA 5T1KA 3L9YA 5HDBF 4PRDA 5BZDA 1XH0A 2EECA 2Y7QB 4PS3A 3ECUA 4F7CB 3DDFA 1G94A 4Z0BH 5CMAA 1WT5A 2VRKA 5A2FA 1BLNA 1I8AA 4OD1H 2ADGB 2BY2A 1IBBA 4A2FA 4R8WH 5GIRB 3L5WA 5FECA 5ICYA 1OE1A 1DANT 4PV8B 2HVJB 4AIZA 2PR4L 2EE3A 4TNWF 5D5ME 3H53A 5CIPA 3QWRA 3VRIA 4M56A 1TNMA 3RQ3A 3TCTA 3X2QB 3ZY7A 2X4NB 1RK0B 5C07E 3DX6A 3IDGB 4N68A 3RWGA 5I73B 1E7UA 4F2FA 1KLFA 4XWGL 1AFVL 2X89D 2XN2A 2IBZX 3O45A 4NN5B 4EVNA 3D9AL 4O2FB 3AXIA 1BPLB 1EFXD 4QRPB 3RX9A 4L1DA 3GK8H 3A6CL 3TNMB 4M8UA 2OZ4H 4LOVA 1IGFL 5I8KL 4ZX6A 4P07A 4EBQL 1H3PL 1RSFA 4H1LB 2RR3A 4PRIB 4B9FA 4HQQL 1MCPL 3BWUF 4J1UB 4U1IB 3LXCA 4ONGL 4UQ3B 4U1NA 5ID0A 4A55A 3ARPA 2DIEA 2DTSA 1E5UI 2UY6A 1JK9A 4I3RL 4KMQA 1CDUA 3I9PA 4PJDA 4RMVA 2I9TB 1R3HB 1T04B 1MNUH 3D2TA 3EGDB 3PGCB 3P0YL 2MQ3A 1JF6A 4IOIA 3DIDA 3BPNB 1EMTL 2DIJA 4M7KL 3GBLA 3FW6A 1HJCA 1EXHA 4DPCX 1YPZB 2YXMA 4M5YL 5FB8B 1XF2B 1T1YB 3DRQB 4G1MB 3UIZA 5HVHB 1IAII 3EYSH 3GB7B 4Q9QL 2CBMA 1JMXA 1BLIA 5I8CB 3UC0L 1SVBA 3D5OF 1JGUL 3O4LD 2DQUL 1A14L 3V6FB 4K9JA 1QQDA 4NQVA 5EULV 3UTTD 4P5TD 1VERA 2SEBA 4YVNA 3BJ91 2VLLB 1NFDB 4JEGB 1O9WA 3FOMA 1S3KH 4BH7A 3ZYOA 2FX7L 3FOLB 1B2WL 4LPYA 1WRFA 4F8PA 3ZW3A 1NQBA 1VZIA 3GBNL 4LNRB 1I75A 3BP7A 3K2IA 3LNEA 1FAIH 4JMNA 1LP9B 1TTFA 3KVPA 3UAJA 4ZMXA 4ZMPA 2YFOA 1ZANH 3WMSA 2V4LA 1RZPA 4PG2C 4NERA 1JXDA 1S8DA 1ZDSA 4ZUVB 3QUZC 4XPHL 4BWUA 2ICES 1U8KA 3HNTL 3OMZA 1BIIA 4WVRA 3BAXA 2ENQA 3SYOA 3ZKQD 5LGKA 5I73C 4XN4A 4RZKA 1BFTA 4UDUA 4I0PC 3ZMNA 4MX7B 4OZIB 1Q94B 2FEJA 1JGUH 3DX9A 5TK4A 1RZFH 1TQBC 4HK3J 1GOHA 1FE8L 5GJTL 2FJGA 4Q6IB 3VXOB 3HI1A 3ATBA 4NHCH 2YXVA 4KKZA 2VLJA 3B8YA 2YMTA 2A2QT 1CE6B 1SYSA 2ZSVA 2P42B 4F7CA 4WSGA 2WK2A 4FCAA 3IN0A 4DP4X 5ADPH 3QJHB 2WXLA 4LASL 4X6EB 2ADGA 2HG5A 1U8PB 2Y7OA 4XX1G 2XQYK 3SE3A 4IRJB 2HVJA 2VN6A 4AIZB 5E8OB 3KPLB 4PJDE 2PW2B 5CGTA 3FO9B 4P9HL 4EUPA 1NWOA 3WEMA 4WWKB 1S7QB 3BGAA 1JXGA 5IREA 1SHWA 1JD7A 5FO7B 1SXZA 3D39D 5CCKL 5AAWC 1S7SB 3JVGA 4LDCA 1OD7A 3PWJB 4HLZH 3MOAH 2JXMA 4CDHA 4MCNA 3GLDA 4DKFL 4LOUD 2R29A 5KG9B 4HOWA 3FQTA 3Q0HA 2ESVE 1BD2B 2B4CC 1AAJA 3UYPA 1RZFL 2D7MA 1SJHB 2JJSA 5B7MA 1BMWA 4AYFA 4UQ3A 4XN8A 2CKNA 4XP1H 3SDDD 3ULAB 3WUWA 4ZFFB 1CWVA 3V95A 3Q05A 3CFNA 3QPXL 4MA7L 3ERXA 4NRZB 3WDJA 3QXTA 1MH5A 4W1TA 2AZUA 3QNYB 4LPVA 1QHOA 3HS9A 4Y1AE 2JB6A 3AUWB 4WHCA 2BS71 3CXHJ 3M6DA 1TEFA 3GMLA 3MRHB 4GIAA 2WKOF 3CD4A 3FTWA 3W39A 2YAOA 5L4IA 1ORQA 2GEQA 2J1KA 2F8XC 4P9HH 5ICXA 2JWYA 4LCUB 2XJLA 3RFZB 1IKFL 4N28A 4PBXA 4PMFA 5I1KL 5FYJU 5MENA 4M6OH 3EH2A 1NTDA 1N0LB 1YEEH 1KSRA 3GNML 5FO9A 2BZ7A 1OCWH 3MHZA 4GO9A 3ATAA 3P73B 4Q0XL 4WW2B 4CC4A 1M42A 5DQDL 2IWEA 3IFLL 1F97A 1IC7H 4QGYA 5F1OB 4CADB 3IB4A 3SODB 3DPBB 4UZGA 3LIUA 3OX8A 4RAHA 5F88B 4ZFOB 1XGPA 3ZT7A 4XMZA 4YSQA 3DTDA 4YBLC 1E2ZA 5I17A 4XVUC 1SVCP 1S7WB 3EJYD 3DJ9A 1UATA 2G30A 3PAYA 4K3DH 2MCAA 3A6BL 4KI1A 5SWQA 1CDJA 3NCJH 3O2DH 1RHHB 3PAUA 4LOEA 5B3JF 5KVEL 1F6LL 1RP9A 2V7NA 3IK2A 4RSYA 4YX2H 1IVTA 4B41A 5K9QI 2J72A 3U4KA 2X9YA 2YAMA 3W1ZA 3U6RA 3NIGB 3CN4A 4FQ1H 1QLEL 3QZLA 4TQ8A 3GZKA 3AW5A 2V5MA 5HGAA 3U6XS 2BOBA 1OLLA 3HI1B 2NCEA 4TNFA 3UP1A 3K6IA 4ELMA 4S0HA 3BAYA 2BVOB 2I85A 1NDTA 1GL4B 1H6TA 1T4WA 5C0BD 2GJ6E 4N9GA 2B1HL 4QAMB 4IGBA 3RDTD 4APQD 4UNVA 3HPJA 4L9LB 2EDQA 5A16B 4YGAB 4Y2OB 1LO3L 4WU5B 1N7MH 3SDDC 1A6UL 3KPLA 1RSYA 1ZAGA 1I7ZA 4JDVB 1A6AB 1TFPA 3VH8B 2IH3A 5E4EC 5KVFL 4ZS6D 1TTBA 3MRMB 4WFHE 4YSOA 4D94A 4ZUUB 1WA1X 4PBWD 5EBWB 2BSRA 3QUZA 5GHWH 3EDFA 3F5WA 1NWPA 4IBYA 2VXSH 5DS1A 5D7JA 5D6CA 4DTGL 1S5HA 5I9QB 1QSFB 2ICWJ 4OQTA 1S2EA 4LIQL 4YLCA 2E9JA 4MZ3A 1E42A 3FSAA 4ONFH 3OB8A 1AO7A 1QBBA 4AIOA 3N04A 5KYNA 4TULH 2K8MA 1TZHA 2EDEA 2GBTA 3WUWB 4ZFFA 1KIQA 5IB2B 1A65A 4XBEL 5E8EB 3D0VA 1ZGLA 4ANWA 4WK0B 1HOCB 4JKPL 4PBDA 5T5NF 3RGBA 2YKLH 4M93C 5E2VL 1YHPA 2B1AL 3B7SA 2X1QA 5ISZE 4E9RA 2E6PA 1WH0A 3CFDA 3WN5C 4ABVA 5F6IC 2BNQB 3VFOA 3BKYH 5L0QC 2R59A 2NX5E 3W9DB 1LEKA 3KNBB 3EJYC 3RFZA 5AB1A 4MJ2A 4H40A 4ISVA 3S36X 3LHPH 4DJMA 4OZHE 3VRLF 2R1WA 2CRZA 5FUOL 3FMGH 5LGJB 4B9PA 3B9AA 4JCMA 1NCCH 4PCYA 4JE0A 1JV2B 2B5IC 1DVTA 4JKNA 2AJ3B 4WW2A 3B8SA 3PWLB 3A22A 1DBJL 3NFSL 4DAGL 4CVUA 3VB9A 5CNHA 3OXRB 1FA4A 3QORB 3OKOA 1Z9NA 1N9PA 3EDDA 3UTTE 2UVFA 2VDLH 3UERA 2CH8A 3R4RA 4NEHB 3QJTB 2MKLC 3DBXB 1HEZB 1GOFA 1KGWA 2G9HB 5JDSA 5HYJE 5J56B 1KCWA 4WI3A 5HYJA 2QMKA 5TQ2L 1BPVA 1I8MA 3WN5B 4JJHA 3MJWA 1QOKA 1IEAB 2H32B 3IT8D 3LKOA 4DZBB 3BO8B 4K8RL 4HIEB 2H41A 3CVHL 3MBED 2J25A 1JZ6A 1OIOA 5DEFB 3VQ1C 4HXAH 2Y36H 4ES8A 1FG2B 1YECH 1DQMH 4J2QA 3QHTC 4WDIB 2VL5B 3V7MA 3EJSA 5FGBA 4N24A 4AYMC 1IAOB 4J23A 3PWUB 4RISH 5HHOA 2D3LA 3QORC 3US1A 4YDNA 3WIHH 4AK1A 2WVVB 3IXAA 3SHSA 1J0HA 4AZ8B 4NUJB 1BXUA 5JMOC 5F6IB 4ESKA 3TVMC 2FJUB 4NO5A 2XTLA 4BSVB 2OCFD 4RAVB 1HCFX 2NDFA 1I9EA 5IHBA 5D7LD 5IV2B 4DUWA 3FCUB 3MUHL 5CEXB 2QQLL 1WFUA 1A7NL 3L8QA 2FQFA 4FQCH 3EYSL 3MFFB 4V1DB 5E7FA 4J3SA 4HJIA 4Q9QH 4KPHL 5ERWB 3SCMA 1K8DA 3NACL 3QUYC 4JM2D 1P6WA 2WBJA 2WQWA 3GSQB 1HHIB 3CC1A 1CU4L 3QR1A 4PGEA 3UEQA 4JFOA 5B21A 4HP5A 1AXIB 4E9QA 3UO1L 4WTWA 4BKSC 3WKYA 1H19A 4DEPB 1N70A 3M17B 2R0ZH 1BEYL 3D30A 4PUBL 4H26A 4ZK8A 4EOWH 4RAUB 4K07A 3O3AB 5HD8C 1AZUA 5T1KD 1O75A 1JDDA 2ID5A 5AB9A 3ETBJ 2OW6A 2Y2TA 1GGBL 2N1KA 2CK0H 2V8MA 4LB8A 1NLBL 2VUKA 3VXTA 1GC1L 3EUUA 4XVSL 4KI5F 4J2XA 3FN0H 1KGCE 3S35H 4Y19E 1CR9H 2NY4D 4FL4C 2UX7A 2XYCA 2Q7AA 2X4QA 1JV2A 5DJ0A 3N50A 3LZOA 2DYRB 4ELME 3WSQH 5DGQA 5DUBA 1OGTB 1T1XA 2X6UA 2QHRL 1CGVA 4TSBH 5AVYB 3DNKA 2YEZB 3QFJB 2HN7B 5HI4C 1QVOA 4OIIL 3M88A 5DWPA 3DO7B 1G9MH 3RNQB 3CLEH 4WF7A 1EFXA 1ERNA 4JY6B 2X88A 4Z9KB 3GMPB 3DGCR 2A7BA 4NGHH 3MCYA 1GTFA 3RJQB 2DEXX 2C8NA 3BVUA 4Y5VC 4PJ5A 2Y6SC 4F7KA 2X9XA 4GI9A 4NO2B 4C4BA 3HPLA 1OSPL 3O11B 4H8WL 1M2VA 5ESQA 4ZNEA 2L7UA 2N3JA 4UIMA 4Y4HB 3Q01A 5TDOA 1AQ8A 2RALA 4X9FA 3AMKA 3PG2A 3C08H 4W9GC 4M5SA 2Z9TA 5BZDB 1A02N 3PNWB 4GRLB 4UQ2A 1F00I 2Y3AA 4YEEA 3AM8A 1JZ3A 3ZDXE 1NMCB 3VRJB 3MRFB 1X5IA 1XIWA 5BUPA 5ICYB 4OF3A 2DWTA 2E9WA 1E5CA 5D7HA 5IVZA 2O5XL 3KCPB 1AGCA 1YPZE 2XBTA 1I4FB 2WQ8A 4AUUA 3IDGA 5AYUH 2C9AA 1A9EA 3UBFA 1FL5A 5IKCA 3MJ6A 1IVLA 2AEOA 1UD3A 2Z31A 1ZHNA 2VQ1B 2GPZA 4QOKA 5D96C 2W07B 3QJRB 1B9ZA 3WTXA 2QADD 1JZIA 3MLUL 4Y1AA 3O4OC 3E80A 4JFDD 3MV7E 4ZXBD 4MB5A 5CEXA 3D7PA 4J1UA 1AJ7H 5I1HL 2HTLC 4U1NB 3GHPA 1TLKA 5F1SA 3H4FA 4KZDH 3C6LB 4OKVA 1BGXH 4Y7MA 1ZGLP 1NCNA 2MEJB 3KLAA 1AP2A 5IMMA 1MUJB 2XPGB 3EGDA 3NJKA 4R83A 3HFFA 1FGVL 2ATAA 2CDGB 1OAKH 4YSDA 1Y18B 4EXPX 1YDPB 3GTVA 1YSOA 4YHOL 4F20A 3RWHA 3CH1A 4FADA 1YPZA 1J86A 3VFUA 2M26A 5D93B 2MOQA 3PJSA 3ZTJG 4PJXE 1EHAA 2F5BL 5DUJA 1EBAA 4J4PC 4L5FE 3WFHA 1KIUB 4JFVA 3REWB 1UUNA 1E28A 3RTQA 4MMYB 5I76A 5KAQF 3VWJD 4EAEA 4N2IA 4I3SH 1KGIA 3QCUH 3GINA 1SHSA 4LOUC 4F2MA 1ANUA 2VL4A 3A6BH 4WGWB 5KSBB 2LOEA 1A1MB 4IKJA 3MBXL 4LDOB 1OF2B 4F7PB 1TTRA 3STLB 2HSIA 3C6EA 1U58A 1W0WA 2VXQH 2YD7A 4JM4L 3WFDL 3TT1H 1HHHB 1WFNA 2K4WA 4I85A 4S1SH 3D2UB 5LCVH 5KZCB 4JDTL 4XCNB 1ETB1 4PJ5E 4TPRL 5AOJA 3CAFA 1PLGH 1SMDA 2QQKH 3QCVH 5ECGA 4DGVL 5E1AA 2HN7A 4QRUA 4MDRA 5M94B 3LB6C 3L4TA 5B1BB 1ORSA 4YSUA 2EDJA <