2IPTH

Pfa1 fab fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
223
structure length
223
Chain Sequence
QVTLKESGPGILKPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDDKSYNPSLKSQLTISKDAARNQVFLRITSVDTADTATYYCVRRAHTTVLGDWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSGLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IgG2a Fab fragment Heavy Chain
publication title Molecular basis for passive immunotherapy of Alzheimer's disease
pubmed doi rcsb
total genus 41
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iptH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iptH02
4HXAL 4MA7L 4U49A 1F97A 1XGTB 2IPKB 4S11A 5CEZE 1XIWA 3GSOA 5HYEA 1GRWA 2ED7A 1UCTA 2D2OA 2NX5E 3ZDYE 1QRNA 2J3SA 4HG4J 4OFYD 1UJ3B 2XIDA 2FJGA 3UEZA 3VXRD 4P23B 1ZGLP 4LHUB 1ZT1A 4KHTH 4C83A 3GI8H 2YD2A 2HFEA 2OK0H 4KDWA 5DMGD 1RURH 2AV1A 3VRJB 3LZFH 4JFXA 3M8OL 4JE4B 3W39B 2FJHB 4Y5YA 5GS2H 5C0JA 3CGTA 1MIML 1NC2A 2PW1B 1JWMA 3BISA 3MLYH 5CSZA 1TJHL 3HZVA 1LP9B 2ICEA 1MWAB 1NCWH 4KU1A 5EC1A 4GRWH 1EJOL 4PJDF 3CC5B 1U8NB 2EIBA 2BNRE 4PV8B 4WGWB 1BQHB 5ACLA 5F1KC 5I15L 1KTKE 1KEGH 4WY7H 1F00I 3HUJB 1T3FA 3QR2A 5IMMB 3OKDB 4PJ7B 1ADQL 4Z7OF 2J88H 5DUBA 5SWQB 1MCIA 4FQQA 2C7UA 5CGTA 4GAGL 4KAQH 3WFEL 1BECA 4OD3L 5GS0C 4H8WH 3L3GA 2Y9RT 3NCEB 4I0CC 5GGRY 4YHKH 5I73C 3H8NA 1IM9D 3CFJB 5GGVH 1V7ML 1W0YT 4YAQB 2H6PB 3DETC 2DJ4A 3KPSA 4PJGE 5HJ3A 1U8HB 2WQ8A 5JIIA 3BH8A 4P9HC 1K5NA 4KJQC 1B9ZA 1T4KA 1SMOA 4TRPL 5T3XE 1BJ8A 4NFDA 3FHAA 4GS7B 4KRNA 3BZFA 1WAAE 3QUZA 5IQ7L 5K33A 5DYOB 5EOCH 5ADOL 2XKUA 5F9WB 4UB0H 1U8IB 3DRQB 1VFAA 4YWGH 3L3OB 4ENEC 3SDXE 1DEEA 3DMMA 3PHOB 3UYPA 5I30H 5DJ0A 2L4OA 5H8DA 4ZUTB 4PJDE 1F58L 2MCPH 1LHZA 3W5NA 3DETD 4PJCF 1VFBB 2R15A 2WM0A 4MS8D 1FL3A 4JFZH 2WUCL 4XAKD 1BQSA 4KGJA 2YD3A 3V4PH 3C60D 5F6HI 5KBNC 4WNQA 5J1AB 4JFYB 4NO2A 3FFCE 2BNQE 3DUSA 2P24A 2G9HA 1FZJB 1KN4L 3TBSA 3D9AH 2V5TA 3OHXB 3GIZH 2Q7YB 3EJZD 2OXHA 4XWGL 1G0XA 3PWPD 1CBVL 3RX5A 4LNRB 4H88L 3Q6GH 2ZKHL 3IDNA 2MPAL 3ARGD 1P4IL 1UKQA 5IESH 4W6WB 1K3IA 1UJTA 3K8MA 3PWVB 3CFEA 3K2UL 2ARJA 2GFBB 2CIKB 2YHGA 3NZ8A 4X9BA 1YYMH 3ORJA 4H1LG 3O2VL 3IKCB 4FTVA 5GZNC 1RIHL 2N7BA 4KQ3L 4LPYA 3OAZH 1V3JA 4JFFD 4JO2H 4YHLL 3WD5H 5KJRH 4I77L 3QHTC 5C6PB 4P3CL 5GISL 2E9IA 3UBXA 2R0LL 4I13B 3BWAA 3H9SA 3PGCA 2QADD 4HJGB 4TSAL 4LLMB 4GG6F 4PJCE 4MA1B 2YPVL 3VWKA 2YOCA 4GRLB 1EXUB 1NGYA 3WXVL 2D4DA 3LEVL 2EDTA 3HI1A 1DBMH 5LGKA 2IGFL 3S34H 4P46C 2FLBT 2WWKT 1CFSA 4NJAL 4PLKC 3MRIA 3QHFL 5FF6A 1HQRB 4WU5B 3VGAC 1UENA 3N50A 2H26A 1VFUA 3QXVA 3RNQA 5ADPL 1UWXK 4EOWL 4F8QA 5D5MA 5I66A 1TVHA 4QGTA 2XQBL 1N0XL 1BIIB 4N0UB 1MSPA 2PCPB 1TXKA 3UYOD 4HDIB 4KTDH 4X4MA 2BVOA 3SJVD 5CKAA 4HJ0C 3VE0B 3FQNA 5GJSL 4I3RH 5F9JB 2H2PC 1FN4A 5FO9A 3MRBB 3FO1A 4GMSH 3VFMB 3MCG1 2APXA 4XPFL 4NZTH 1ERNA 3PQYA 2LAGB 5FAAA 2JJVA 3GSNB 3MREB 1B2WL 3PDOB 1YUHA 2R4RH 4XBGB 1MCWW 2DLGA 4PYHA 4QHKJ 5DQ9B 2CK0H 4IBLT 1AGFA 5DFTA 3WKNA 1X44A 3RZCB 1KT2A 4N0FA 4FMKA 5ERWA 3QO1B 1DQLL 1MEXH 4JFOB 4TQEL 5E6YA 5ETUB 4PJ5E 1QBLL 1KIUA 3NFPA 3VGBA 2ZUTA 1INEH 1U8MB 5D6DA 1P2CA 5AUMA 4WI8A 2GTZA 5JA8B 3SDAC 2ZOKA 5AYQA 2R0WL 1CGSH 4G80B 4GAJH 4NPYB 5E08H 1D6EA 5GGRA 3MNWA 5EC2B 1R0AL 2DD8L 1QVOB 4PTTA 4OZIF 4IDJH 4MZ2A 1WVZA 1FJ1B 2DKUA 3ULVD 3MSPA 3P9MA 4NKMA 3WIHL 4OZHB 2AI0L 4JFEA 1NDMA 4O2CB 4UBDC 1AIFB 4KRPC 2YZ1A 3HC3H 1OPGL 3FOLA 4NQED 4PRPB 4MQSB 3D2UA 1BD2D 4MD5B 1JNJA 5DRWB 1IKFL 2QL1A 4PIRF 2IADA 4OGXL 4PGBB 4X80L 5E94A 5MEQA 1V3KA 3EJYD 3OSKA 1NGXA 2ORBH 32C2A 3WUWA 5IB5A 3F65A 5FKAA 3RL2A 4K3DL 4GLRI 3VMOA 2Z4QB 5IEHB 2FATL 3WNPA 1U8OA 5CEZH 5DJZA 1RJZA 4PRDA 5J56B 3CZJA 3G6DL 1D9KB 3MV9E 5HYJA 1R3IL 4HPOL 3CLFL 3DX8B 2A6KA 5L2KE 2P5WA 5BW7A 2VLRA 5ILTH 4MD4A 3MRRB 4MCZA 1S5HB 3QB7C 4JY4A 3WS6A 5BRZE 5JTWA 4NRZA 2X9WA 4KK8C 3VCLB 1B4JH 2DWEA 3QNZB 5TFSL 1DBKH 1KUMA 2FH6A 3TIDB 4R7NA 1PG7H 4MLSA 4JFDD 2DL2A 2CR3A 2JK5B 3C5SA 4OZIE 2LU7A 1IE5A 2FZ3B 1E6JH 4MJ4A 4ZUSA 4X7EC 2NXZB 1EEYB 1KELL 1H8OA 3E6FB 4Y5VA 3TT1L 2FIRT 4XI5D 3DV4B 4OFKA 2NW3A 3KHOA 3ULVL 4J4PC 5TF1H 5IWLA 3X3GH 2EE9A 4LARH 5FEBA 2JB6B 4AG4L 5DMKA 4FG6D 1Z9MA 1NEUA 4PGEA 2A9MH 3NCYS 4PLNC 3TBVA 3E6HA 1I1RA 4MX7B 3S37L 5I1HH 4LSDA 1EO8L 1QSED 3QEGL 2QSCL 1X5FA 2Y07L 2C4FT 4NUJA 5I1IH 3FQUA 2NX5A 3PDDA 2ADGA 2ZNXA 1EK3A 2VDLL 3MV8E 3WSQL 1CQYA 3BRFA 3BGMA 1KPVB 2ZNWA 5DK3A 5DJXA 3KYNB 4N0CC 3CMOH 4HS3A 1T6WA 3QFJE 5T3XH 2OJZH 1LGVA 1QBML 3OR6B 3W0WE 5J6HB 1CTOA 2PYFA 4H5SB 1CDCA 2GTWB 5T3ZD 4ISVA 3EOTL 1MFBH 2QJDA 4U7SA 5C0RL 1CDJA 2X4RB 1UB5A 4KZEH 3PUCA 2AP2A 4B0MM 1IEBB 3S6CA 1GOGA 4X98A 1B0GA 3I50H 3TJHD 1OP3K 3BPNC 1YA5A 2BNRA 1GGBL 1UZ6F 3G08A 4HH8A 3BKYL 3VH8A 3FOMA 4W4OC 3LKSA 1OAUH 3ME0A 3V95A 4R96A 3QYCA 2HTKC 1LO0H 5I17A 4LLDB 3EFDH 3BQUC 3QCUH 1MCHA 3KJ4C 3PV6A 2R1XA 4P5MA 3OPZL 3QHZH 3U9PL 2CIIA 2VZ1A 1GGIL 1KJVA 5IUSA 4PY8I 2C3VB 3CVHH 2QQKH 5DQDH 5E7BA 4XCNB 3VXRE 2X70B 3VXTB 1IZKA 1JZ6A 3G5ZA 3MUGA 2CLRB 1ZHLA 5LJYH 1IC4H 3QXWA 3HTLX 4PJGA 3N85H 4Q6IB 3F62A 3K1KC 5EZJB 5HHPA 2JCCB 1E4WH 4PLOB 2B2XH 2OBGA 1CICD 1WAAA 2VDOH 4X7SH 4Y4FB 4MMXC 3U4BH 1AKJB 4O51A 1K8IA 2VABA 4XHJC 3SDXA 5HPMA 2FX7L 4GW4B 3CH1B 4NO0D 3MNZA 4HK0B 4PJDA 3W11C 1H3TA 1BEYL 3KPRB 4E9LA 1AO7D 4ODVH 4OD2A 2DIJA 5IB4B 1MCOH 5AAWA 4N5ED 3ZE1E 3K4ZA 4AL8H 2CUIA 4OGAD 4RX4A 3UC0L 5CBAB 2DBJA 3OGCA 2I27N 2A74A 4LKCA 5D6CA 3CVHA 2DQEH 3FFCA 2BNQA 4X7TA 4OLVH 5IFAH 3QRGH 1KJ2B 2BCKA 3U9UA 3V7AG 3WN5B 4MJ6A 4J2XA 4ZFZB 3BVNA 1VESA 4H26B 4NQVB 4P5TD 5I1AB 2EC8A 2YBRA 4DKFH 4QRUB 2R9HC 2BSTA 1ND0B 2IALB 3GMRB 3MLXH 3O8XC 5DHYB 2ICWI 4AENA 4TTGA 4WVRA 1UACL 2APVA 1XIWB 1CXHA 3GSOB 2XA8H 3DSFL 1ORSB 1OTTD 1T2XA 4B53A 1QFWM 2LV4A 1QRNB 4M1CD 4LRIC 1F4HA 4GO6B 5I1LA 3IDIA 1HYSC 3QZWG 2FJGB 5IROC 5CINL 5E2UH 1ZT1B 1Z3GH 3DBXA 4Z5RA 3T0VA 4C83B 4BSWA 5TQ2H 2CDEA 3IDJA 1YMHA 2HFEB 4YFLI 3FN9A 4XAKE 2AV1B 1JGDA 3BE1H 1YEIH 1A9EA 3F6LA 4JFXB 4XMPL 4JB9H 3NA9H 2CXKA 4JM4H 3GSVA 4Y5YB 2ADJA 5C0JB 4PJCA 3OB0H 1E6OH 1NC2B 3AUVA 1JWMB 4M8VA 4WFHD 5ICZA 5CSZB 3HZVB 2ICEB 3H7LA 5HHMD 5EC1B 2BHYA 5KTEL 3ES6A 4DEPB 4I18A 4JG1L 5IJKA 3PWPE 5EU7E 4XPBL 2XI9A 1EHAA 4PB9L 1CGTA 5EU5A 4EI6A 5I1EH 1T3FB 5KSVA 1HK6A 1JV5A 3MYZA 4KKAC 4NQUA 5DUBB 4FQQB 2C7UB 1TJIL 1YYLL 5JORA 1JGVL 3SKOA 1IZJA 3G04B 3L3GB 5AAMA 3EUUA 4XXCA 4DVRL 1Y18A 5ANME 3ARDA 2V7HB 3GI9L 5C0FA 3CSPA 4NKQB 1N7MH 4S1SL 4KC3B 3QO0A 4O9HH 4JFFE 1JPSL 3KPSB 3QQ9D 4YFEA 2KL6A 4YGVA 2A9NH 3BH8B 1U3HD 1K5NB 4JVPA 1T4KB 1NMAH 4ZAKA 2CKNA 1QD0A 3C5ZC 2F8OA 1T1WA 3RGVC 2NMSA 1QFWI 3BZFB 4Y2DD 3QUZB 5HHNB 3QI9A 1MLCA 1MFEH 4HGKC 4PJ5A 1T6VN 2AEPL 4GQPH 2CMRH 1VFAB 5FHBH 3UJTH 2VWEC 1DEEB 3DMMB 4IRZH 4GRWB 3KPQA 5DJ0B 4FQIH 1IC5H 4YX2H 2AXJA 5IB3B 4JR9L 3SOBL 4HWEL 4H0IA 3ZKXB 1FL3B 3EDDA 3MV7D 1DVFC 2D0GA 4Y88A 5HD8D 5M94B 3SJVE 2F58L 1QSZA 3O3AA 4PJIF 5A43C 1MAMH 1Z9OA 2WIIA 1WCQA 3GBMH 4WNQB 4MA7H 3D3VD 1QKZL 4NO2B 1A6UH 4X99A 3DUSB 3RGVD 2P24B 2G9HB 4DWHA 3TBSB 5KSBF 5FV2A 2DQHL 3A6BL 2ZCLL 4YQXL 3GJEA 1VEMA 2CKBL 2YR3A 4L4TD 4CJ0A 3P0GB 1I9JL 2GK0A 4ZUVA 3WNOA 3IDNB 3V7MA 1RUQH 3BZEA 4OQTH 2NY1D 3M8OH 3BJLA 3EHBC 2Z92A 3CFEB 5BV7L 2A6JA 2ARJB 1NUDA 4GJTB 1TZGL 3I6LD 3NZ8B 3B6SA 2BX5A 3RJQB 1MJ7L 2RBLA 4FTVB 5CIPH 5DO2D 3BT2L 3QG7L 3LRHA 5DJ2A 3HE7A 3VA6A 5L2KA 2BSRA 3RVVC 3M45A 1L7IH 3KLHD 3UBXB 3ULVE 3BWAB 3H9SB 3PGCB 1ROWA 5AWNL 2IBZX 4GAGH 3HR5A 1A4JA 1TTGA 3VWKB 4C56D 4LRNL 4E0RA 5IQ9A 4NQEE 1NGYB 2G60L 3RDTD 1BX2B 4MMZC 1MHHB 3S35L 3HI1B 4M8QA 2B1HL 3QIBC 4ZG1A 1BD2E 4QRRD 4OZIA 3IETA 2ATKA 2FD6L 1ZK9A 4RGND 1A64A 1GIGL 4PJIE 2DLIA 2YD8A 4Y5XC 3ARBC 5C0EA 4CAGA 5B4MC 3MROB 3MRIB 3AREA 5FF6B 4NUGH 5KSBE 1XH3A 2E7LC 1NQBA 4GW1A 5E8DL 5E2JA 5EZIH 3RNQB 4Y7MA 3MGAA 5D5MB 5EDXA 2R0ZH 5I66B 1N2RA 1TVHB 4F7PA 3ZKQD 3MXVH 1UM5L 4NGHH 3OJMB 1XF2A 4OQTA 2B0SH 1HH6A 1EGJH 4FQ1H 4Z7VF 5IQ7H 2BVOB 2AAVA 2CUHA 3FQNB 4GRMA 2Q6WB 2GITA 1FN4B 1YC7A 3FO1B 1NANI 4NJ9L 5FOJA 1FZOA 3N1GC 5CIPA 3I2CL 1K4DA 4Z7UE 3PQYB 4WEMB 1D5XA 3QJFA 3MV8A 1I3GL 3S36X 4F7MA 1YUHB 4WO4B 3MFGB 4JFDE 4KKCD 1AGFB 1CVSC 4FS0A 4N8CL 4JM2D 1ADQA 2OSLA 3QFJA 5TDNA 1KT2B 4N0FB 4TSBH 5ERWB 1RIVH 4JPVL 3W0WA 4DUWA 5I8CA 4KRMB 3FN3A 3ZTNL 3ZTJH 3NFPB 4WI7A 3LRSA 2V9TA 3L3HA 2IPTL 4XCEA 1P2CB 3BWUC 5AUMB 2H2SC 3KPPA 3GGWA 4CU8A 4P3WA 2GTZB 1YN7A 3BN3B 2VLJD 2ZOKB 4JKLA 5HY9B 4LF3A 1JMXA 3JZ7A 3GDBA 1D6EB 4XWGH 5GGRB 3MNWB 5HGDA 5EBLA 4PTTB 5C07D 1QNZL 3BRDA 2ZKHH 1P4IH 3P9MB 4NKMB 2IPUG 4RAUA 4JFEB 1HN1A 4QCIA 1NDMB 1QSEE 1XF4A 4XC3L 3WCYA 2GCYA 1KCSL 1EGJA 3FOLB 2NY4D 2QKIA 4OIIL 4OFYA 4AM0A 3JWOC 3D2UB 5DRZA 5EULV 3TA3C 2AEWA 3BGAA 4JHAH 5FKPA 3BIKA 5E94B 5MEQB 4KQ3H 3P73A 4YXLL 1JIBA 1D7FA 1EERB 1NGXB 4NM8L 4ZUUA 3L95A 4YHLH 5DD3L 32C2B 2M2DA 4P3CH 3CDFA 3WUWB 2MOVA 4Y4HB 4U3HA 1FFOA 2NY6D 4JGMA 5CLWA 1BF8A 5FKAB 5T3ZE 4PB0H 5AZEL 1Q0XL 3LN5A 1YECH 3RL2B 3BYTA 2FX8H 1UFUA 2YPVH 3B2UD 2W0LA 5F9OL 1FIGH 1U8OB 5DJZB 1RJZB 4PRDB 3CFCH 3VXUD 5F6IB 5HYJB 4N1HB 4HXBH 4XB7A 3P11H 2CGRL 4R7DA 4F7CA 4QRSA 5T1KD 2A6KB 2PNDA 4LMQI 2P5WB 2F8VA 2VLRB 1DQTA 4NJAH 4MD4B 5DGRA 2UUDH 4JY4B 4M6OL 1LVEA 3TA3D 4RGOH 3I9GH 2DWEB 3SKNA 2E27H 1Q72L 3NABL 5ADPH 4R7NB 1CCZA 1UCBL 4OCWL 1XR9A 3H2WA 3C5SB 1IM9A 1SJHA 1DANU 4CL7A 2DQTL 1L9MA 2G2RA 1QLEL 2N4IA 3TBTA 3MX0A 1MHPL 1QFOA 4ZUSB 2LTQC 3I84A 5EIQA 4Y5VB 3BDYH 4PV9A 4HULB 4L9LC 1YEHH 2R2CA 2NW3B 3RGHA 2Z8RA 1R3HA 1NBVH 4RFOL 1QUNA 5DMKB 1N8ZB 3HI5L 1XMWA 4PGEB 4MB3A 1JNLL 3OQ3B 1VERA 1M1SA 3TBVB 1LK2B 3E6HB 2IH3A 2GSIA 2PO6C 5IW6A 4FA8A 3LKNA 4NUJB 2NX5B 2ADGB 1CYGA 4PRNA 3RWGA 1AO7E 5GQBA 5HHQA 4P48A 3LQAC 1W0VA 2R0WH 2X5PA 5DJXB 5B38A 1MPAL 5GS1A 1ODAA 1I1AC 4HS3B 3SDCD 4YFLF 3NZHH 3ZE2E 2DD8H 3TNMB 3LIZL 2PYFB 1HHJA 3C60A 1B6UA 1YEGL 3WIHH 2AI0H 4P59L 3NACL 3CDCA 2XTJD 1UB5B 2X6MA 3DXAD 5JR1L 4X98B 1T2QH 1B0GB 4HKXA 1OGTA 3BAEL 2BNRB 1I7TA 4LSSH 1S7WA 3BKCL 1IKFH 3VH8B 3FOMB 3PWPA 1GZQA 4YXHH 2DLFH 3LKSB 3MOAH 4R96B 3IDXH 1VA9A 3HE6C 3ARGA 5IVNA 4R26L 2XN9D 5I17B 3OJDA 3DUHA 1A7NL 2R1XB 4KUCD 2WUBH 2EDDA 4OGZA 4P5MB 4AYFA 1FL6B 25C8H 2CIIB 4LHQB 3A6CL 1ONQA 3KPNA 5FOBA 43CAA 1KJVB 4F9LC 4K3DH 1DJSA 4EI5C 4F33A 5ANMA 2D9QB 4OZGF 4P2YA 4DK3A 5CJQH 1SJXA 4XCCL 3G6DH 2VXTL 4WCYL 3G5ZB 3MUHL 1XCQA 3LKRB 3MUGB 3BEVA 1ZHLB 4HPOH 5C0CD 1VHPA 1KTRL 2QR0A 4JFFA 1WIUA 3VG9C 3D69A 4PJGB 3V4UL 1JTPA 3ZKND 1RUKL 5C3LD 1E4XL 4EXKA 1F6LL 3PWJA 5E2TL 2JJSA 3QP3A 4WFHE 2XXCB 5CJBA 1SVZA 3JXAA 4K2UL 4QYOA 5HHME 2ESVD 3O6FC 1BHGA 1MUJA 1T1XA 2OR7A 3WIHA 4O51B 4NC2B 1K8IB 4MB5A 2PYED 2FB4L 2VABB 1KPRA 4CN1A 3SDXB 4GAFB 5HPMB 3EYFA 3MNZB 3H7BA 4LCCA 4NFCA 3TT1H 1CQKA 1RUAH 4PJDB 5LCVH 2GEEA 4OD2B 4YE4L 3ULVH 4RQQA 4M6MH 3F58H 1FFNA 3S3JA 2HLFC 1F02I 5I71C 1UKTA 2DN7A 4X6BA 2X4UA 4N90D 2WZPD 4C58B 1HSBA 5TPWH 2VQ1A 3LH2L 3SJVA 2ARWA 5DFVD 2X4NA 4DQOL 3NVQA 1BFVL 3IXAA 3NIDF 3OGCB 2A74B 4LKCB 2K9UA 3QG6A 5D6CB 4V2BA 3CVHB 3S37H 3FFCB 2BNQB 4BQBA 1RZJC 3HN3A 3OKNA 3QEGH 4X7TB 5DJ8A 1Q94A 3ZYJA 2QSCH 1Q8MA 3LEXA 3U9UB 1T89C 3TEUA 4MJ6B 3R1GL 3BVNB 3TH4T 4UUJA 5LVEA 3WSQH 3P4MA 1RZ8B 4KKBD 1HINL 2YBRB 1YEKL 2BSTB 5H94A 1WT5C 2XA3A 4J3TA 4M1DH 1H3PL 1FPTL 3ARFA 1QPPA 1J8HD 1QBMH 4AENB 1INDL 3DURA 5CCKL 4S2SA 5C0RH 2IAMD 4Z76A 4EDWH 4GLRH 4JKMA 4XBPA 3HI6L 3W9EA 3IDIB 3LEYL 5I1LB 3NFNA 3OKEA 4ALAH 3DBXB 4Z5RB 1GGBH 4M7KH 4BSWB 1A3RL 3MV7E 2CDEB 3IDJB 3T4YA 3ZKMD 1YMHB 5FGBC 3T0XA 1SHMA 1H8SA 1JGDB 5E1HB 4U2YA 1A9EB 4HBCL 3LV3B 5C08D 3U7YH 4A6YL 3GSVB 1LD9A 4BSVA 2ADJB 4PJCB 4V1DD 1FNLA 3D3VE 4ZTOH 1AI1L 3B8YA 5ICZB 2I9TA 5C9KA 3OPZH 3U9PH 4NQEA 2YPLD 4IOFC 4GSDL 1BD2A 1RZKC 5IMOA 3S3PA 3ES6B 1FBIL 4L4TE 5L8KB 4I18B 4PJIA 5HI3C 1N3NA 3RA7L 3TJEL 3I6GA 3RVTD 4FABL 2HLAA 3O9WD 4WWKC 5EU5B 4EI6B 1G7HA 5KSVB 3L6FA 2VSCA 4DK6A 4G42A 1JV5B 5KSBA 4HX1A 5CJXA 3D0VA 2Q8BH 3MC0A 5LG1A 4J3WA 5F96H 2ZUUA 5JORB 1AC6A 5TE4L 3SKOB 2MFNA 3I6LE 1SMAA 1N64L 3RZWA 1Y18B 3ARDB 3QJHA 5C0FB 3LPGA 2P5ED 2ZUXA 2NYYC 1U8LB 3I3EA 3QO0B 2QQNL 1JUFA 4I0PD 1VACA 2EDEA 4JM2F 4HD9A 2EDNA 2FX7H 4YGVB 2YA0A 3BKML 4DFIA 2NY3D 5I9QC 4Z7UA 3PE9A 5K59E 1F13A 4HCRL 5F7UA 1BEYH 5D2NC 4NNYA 4C56E 1IQDA 5T3ZH 4ZAKB 4R4FH 4JFDA 4OKDA 1T1WB 2EXYD 4QRRE 3QI9B 4M7ZB 4RGNE 3EDKA 1MLCB 5EORL 4PJ5B 4LVNB 1WBZA 1KENH 3RWIA 2A73A 3KPQB 5J0BA 3TCXA 5E6ID 3OKKA 5DXWA 2EE6A 2VJXA 4JQXC 1G0DA 1ORQA 4JRXD 3DARA 5IVZA 5IFHH 4ZFGL 3ZMRA 1MRDH 3OXRA 4S0SD 5C71A 4PYGA 1FO0H 4LQ1A 3O3AB 1F3DJ 3QAZB 2WIIB 1QSEA 4LL9A 1UWEL 3TZVC 3E1F1 4X99B 4OZFH 3K46A 3DSFH 1GC1L 4HUWA 4KI5D 1WF5A 4PG2A 3RBSA 4JPWH 3VRIA 5GS0L 5ISZA 1AHWA 4RZCA 2GK0B 4ZUVB 1TTUA 1ZLSL 3BZEB 1NCAH 3BDBA 2ZCHL 2Z92B 3U46A 2A6JB 4JFPA 5JMRA 4KY1H 2HKHH 1EVUA 1UJ3C 3V8OA 4TPRH 4P23C 2VLJE 5CP7A 3MV9B 4LLYA 1KXTB 5C0GA 3B9DA 5E8EA 4XP4H 5DJ2B 3HE7B 3TN0A 5HHXH 5C07E 5IHBA 3L9RA 5L2KB 2BSRB 4PB9H 3OWEA 2P44B 4I2XE 4AH2A 5BRZB 3X17A 2BOBA 4ZO6A 1TJIH 1YYLH 3HR5B 1A4JB 1TNNA 1A6VL 4E0RB 1HIML 5IQ9B 2AS5M 4RCAA 4M8QB 5IW1A 4OZIB 3IETB 5FYKU 2ATKB 4OBSA 4PGCA 3QEUB 4OZFA 4S1SH 5C0EB 1FORL 3AREB 4M1GH 4UINL 4DGYL 1XH3B 4LSTH 4GW1B 2D7OA 4Q97A 5KS9E 5IVXF 4RBPK 3FT4A 2ED9A 1I3RA 1N2RB 1SEBA 3LS4L 4F7PB 4PLJC 1CICA 5CHNA 1XF2B 1IGML 4KK5D 3EAKA 3RWEA 3VXUE 1HH6B 2F53D 4YC2B 1UGNA 2YD7A 2NXYB 2VXUH 5I2IA 4GRMB 2Z31D 4N8VB 4MXVF 2GITB 2AEPH 4NO0A 4S1DD 3DUUA 1FZOB 5FUZL 3BZ4A 3WIFA 5CIPB 3PWNA 2B8OT 2VMFA 1K4DB 2OYPA 1VFMA 2P45B 5D2LE 1D5XB 3QJFB 3MV8B 4NBZB 2NY2B 1B88A 4TOYL 3O6KL 4GS7C 3SOBH 3MLVH 1A1MA 1U42A 3IYLW 4UZGA 5FV1L 4XP5L 3T65A 2PUQT 2OSLB 3QFJB 1WQVT 5TDNB 4PRID 3W0WB 1TQBB 5IV2A 4OTXH 5F9WC 4UNUA 4UOW0 3RP1A 3VXSD 4IRJD 2HT3D 3LRSB 4TULL 2ED8A 1F5WA 5GPRA 4KKNA 3WHXA 3L3HB 3ZYZA 4OV6F 4WW2F 1ZHNA 4XCEB 1WFOA 3KPPB 3BP7A 4QWWC 3GGWB 1KJ3H 1YN7B 3DOSA 2DLTA 2VNCA 1AP2A 3A6BH 4KUCF 4L9DA 1DBBL 3WFDL 4P5TA 2ZCLH 4MA8L 4YQXH 5HGDB 5EBLB 4G6ML 5A3ID 2ICES 1BLNA 2AJXH 1NLDH 2ZJSL 4RAUB 5C86A 4QCIB 4U4BA 5IVXE 4HUKB 3ZDZE 1XF4B 2DM2A 4P2RD 5BV7H 4XWOD 2GCYB 3VWJA 4K94H 4S1RL 1EZVY 2QKIB 3OB8A 1TZGH 4AM0B 1NJ9A 5DRZB 3PP3K 2XYCA 2AQ2A 2DQIH 3VXRB 5KVGH 1MJ7H 2NNAA 3V9FA 4XNUL 1C8PA 5HGHA 3BIKB 4MXVE 5MP6L 3P73B 3QG7H 4ZUUB 3WNLA 4YHZL 3L95B 3EOAA 5GHWH 3MA7A 2YRLA 1FFOB 2CO6B 3GEWB 5EWIL 1JNNH 3LN5B 5H2BA 5LXGL 2XTJE 3X14A 3BO8A 2FECL 1OSZA 3DXAE 3RKPA 1BVKA 5C0NC 3UAJC 2ZUQB 4J6RH 2B1HH 1QFWH 4R7DB 4F7CB 2FD6H 1OP5K 1JGUL 4QRSB 1GIGH 4EEEA 1U95A 5BXFA 1SM3L 2DMCA 4FQHA 1P6AB 2X41A 2HT4C 4CUCA 5E99L 5TQ0L 2XN9E 2ITDA 3B8SA 3HZMA 4JVWA 5KAQG 4MA1C 4G8EA 4JEGB 4DAGH 4X9GA 3FRUA 3BN9D 3JWDL 4PJAF 2R69L 2HWZL 5E8DH 3CSGA 3SKNB 4GRLC 1YC8A 2DWDA 3QXDA 1T2JA 1XR9B 1NBYA 3C5JA 2RFXA 5F97E 1IM9B 1SJHB 1WEJH 5JOPD 2G2RB 2R23A 3MLWH 1J0ZA 3TBTB 3FB7A 4ONGL 5C0CE 5HSFA 1J0HA 4XTRC 3JTTA 1RPQA 4PV9B 4NO5A 3TWCL 4ZS7H 3UAJD 1ZHKA 2YA1A 4UT6L 4OB5L 3WO3B 1IGCH 4YBQC 4FNLL 3I2CH 2VKXA 3HNTL 1U3HA 3VFRA 2UY7A 4K23H 5F7YC 3BUYA 1SY6L 1R3HB 3EIFA 8CGTA 2ESVE 3LHPL 3ULUC 4Y2DA 3KYMA 4JG0L 3DJ9A 2NTFA 4JRWA 4JPVH 2DTML 2PYEE 1FNHA 3HC4L 4K7FA 3KLAA 2PR4L 2GSIB 4F7EA 1CF8L 4XVUD 3T0BA 4Z7QE 2IPTH 2PXYD 3LKNB 1CL7L 1H5BA 5ESVA 3SBWA 4PRNB 3H42L 3DNKA 1GOFA 3RWGB 1FNSL 5HHQB 1W0VB 5HVWA 3N1FC 4XTRD 2Y6SC 4N90E 5B38B 3MV7A 5GS1B 3RZCC 1A0QL 2MJWA 4XNZB 3S5LA 1L6XA 2COQA 2DL9A 3C60B 1HHJB 4HUUA 3DO3A 2RJMA 1CLOH 3FAWA 3AGVA 2I60H 3D3VA 4GMTL 2HH0H 5F7HA 1X5LA 5E56A 5JIPA 4LDLB 4Q0XL 5JQ6L 2AW2A 4HKXB 5MEPA 1OGTB 1I7TB 3V79C 1WV7T 1S7WB 5TGBA 1PDKA 1YZZA 3PWPB 1GZQB 3SHSA 3DV6A 3UJIL 3BPOB 2HJKA 3ARGB 4NM8H 1J8HE 1HNFA 3OJDB 5DD3H 1FDLL 4RMQA 5SX5H 2DQDL 4LASL 4PR5B 1YEJL 1ONQB 1Q0XH 3KPNB 43CAB 5FOBB 5DJ6B 4D0CA 4F33B 1MCWM 5F9OH 1PEWA 1Q38A 5ANMB 3EYVA 3JVGC 4ZXBD 4PJ9D 2O61B 3O4LD 1QFHA 1S9WA 5DUPL 1MFCH 1XCQB 3BEVB 1G7QA 2CGRH 1XGYH 4YO0A 5E8NA 5GRUH 4JFFB 2X7LA 3C87A 3D69B 1KTDA 1KLFA 5C08E 5C92A 1TMCB 4ONFL 2IWGA 1ZVYA 1J0JA 2QADB 2BY0A 2HVJA 3HB3D 3PWJB 4LU5H 4V1DE 2BC4A 4C56A 2OX5A 4D2NA 1H0DA 2F8XC 2YPLE 3QUML 4QYOB 3RDTA 1D9KC 3BMVA 4PJXF 4ZOAA 3ALXA 5A40E 4MJ5A 4QRRA 1MUJB 3TBYA 1T1XB 1J5OL 4I48A 4MB4A 3LDBB 3WFHA 4RWYL 3QXUA 3DPBA 4MAUL 5I8KH 1KPRB 1GYAA 3ZO0A 3U7WH 1A6ZA 4P2QD 4LQFH 3EYFB 3H7BB 4LCCB 1T7YA 3BP4A 3OJVC 3QIUD 3IDUA 3FAXA 1JGLL 1MQKL 4RQQB 4KHXL 2QHLA 1FFNB 1AGBA 4OF3A 1JF1A 4X6BB 2X4UB 4EXPX 3WS3A 3S4SG 1WWAX 1HSBB 4RFOH 5TDPA 2IQAA 5K9QI 1LO4H 2VQ1B 3SJVB 2P5EE 3HI5H 2X4NB 1PSKL 2NXZC 1JNLH 3IXAB 1REIA 3QG6B 1EEZA 3L7EA 1OW0A 3GSWA 4KMTL 3OKNB 5DJ8B 1Q94B 3LEXB 2IC2A 1KYOJ 2NZ9C 5C8JA 2P8PA 4UUJB 4BYHA 1JPTH 3TP4A 1FP5A 3P4MB 4IMKA 4JM2A 5H94B 3ARYA 5H37G 3ARQA 3BP5A 3LQMA 5KOMC 1UH2A 1JE6A 3PL6D 1TPXC 3RAJL 3DURB 4S2SB 3HAEG 4P59H 1EHLL 4Z76B 4IHOA 3QPQC 2FGZA 2VLJA 3QT2A 5HI4C 4XBPB 1NH6A 3W9EB 1EDQA 3AY4C 3NFNB 3VFVA 3BAEH 4JRXE 1U91A 2D7TL 1IQWL 3BKCH 2VC2L 3CFDA 3T4YB 4IMLA 5C07A 1A7PH 2HT2D 5E8PA 3MMEA 4ZFOA 4TUOA 2R4SH 4LEOA 2XZZA 4I2XA 5IT2L 5D2NE 1PYWA 1LD9B 4BSVB 5DD1L 1N4XL 3VFGL 1A7NH 2I9TB 4NQEB 4F80A 4HF5L 3A6CH 5F1NA 4KI5E 2VERN 1BD2B 3UJJL 1AR1D 5IMOB 2WMPA 1U92A 3VMNA 2IFGA 4PJIB 4XCCH 1N3NB 3JSSA 4AY0A 2VXTH 4WCYH 1T66C 3I6GB 1KLGA 2HLAB 2JF1A 2WINA 1G7HB 3QPQD 3L6FB 3ZHDA 3HC0A 4G42B 4IRSD 5KSBB 1A6PA 2EDQA 4HX1B 5EZOL 3V4UH 3D0VB 1DN2A 1LP9F 5KS9A 1RUKH 3BKJL 4NP4L 2BVTA 4KJWD 4FOMA 5E2TH 1F42A 2BDNH 3VXNB 5I1DA 1ZANH 4LAQH 1P4BL 2W91A 4K2UH 3VXUA 3QJHB 2R8SL 2R29L 3HUJF 1NGQL 2D7NA 1HE7A 2BVPA 5T1KA 4Q6IC 5I6XB 1VACB 1LEKB 3WIIL 1NMBH 2EE3A 3JBG7 5KZCD 3B9AA 1NKOA 4Z7UB 3TA3A 5D2LA 4D9RD 1VDGA 2EEDA 4NNYB 1IQDB 4YE4H 4O02L 3AU1A 2HMID 3BIAX 4JFDB 5E9DD 4Y4FC 3MLSL 3HRPA 3HFML 4IIQC 3X11A 1MCFA 3LH2H 5EU6D 3PHSA 1X6NA 1BFVH 5DHVH 3L5XH 1WBZB 2EDWA 3VDAA 1ZGLM 3RWIB 4FRWA 3GSXA 4KWUA 5LQBL 1FYTD 4HMEA 1Z9SA 1CZ8H 3OKKB 3MRGA 3GMNA 3VFNA 1BOGA 3R1GH 5J11B 1ORQB 1KFAH 5IVZB 1X6LA 3QFDA 4HFUL 1HINH 2RR3A 3OXRB 3LRGA 5D1ZD 2O5XL 1YEKH 2F53E 3T0DA 1T7XA 2VITA 4AEFA 5J3HC 1R24A 1FPTH 5IVXA 1QSEB 3L1OH 3NIFF 3MBXL 3MPCA 1INDH 4ODHL 1KB9K 3WN5C 3ALPA 4R97B 1QFUL 3LKPB 1A1NA 4PRBB 3RVUC 3D6GA 1WISA 5K9KA 4HUWB 3EJJX 2B1AL 1SYVA 3VRIB 3HI6H 4YUEH 3LEYH 1CXFA 3H9HA 3BRGC 1MFDL 1AHWB 3SDCA 4RZCB 3SPVA 1A3RH 3GMLB 4PRIE 3D1MC 1HCVA 4YPJA 5EOTA 3VXSE 3GZKA 3MRMA 1RVFL 4JZJA 1XIWC 3SO5A 3U46B 3NTCL 4JFPB 1D5IL 3DXAA 1AI1H 5CJ5A 3WNMA 3VXPB 5CP7B 3MJGX 4GSDH 4LLYB 5DHVA 3FT2A 1OM3H 5C0GB 1MJUL 3AS3A 4X6FA 3RIFK 4BH7A 4DZBA 3TJEH 4WW2A 3L9RB 1AFVL 4FABH 2XN9A 5DJYA 1TITA 5MEOB 3EO9L 4Y5YC 4WDIA 4WENB 4AH2B 4CNIA 1UA6L 5DK0A 4P2RE 5TE4H 5HYSG 5LGJA 1FO0B 5IW1B 4DEPC 2ZZUT 2F5BH 3NA4A 1JP5A 4PGCB 1S3KH 5D9SA 4XCFH 5C0CA 4OZFB 3NIFE 1L0QA 1RD6A 2JJTA 2C4XA 3FMGH 1FLTX 4LOUD 3I3BA 4OSUH 3BKMH 5HI5D 3DHJA 4CRPA 1I3RB 3FT4B 2CRZA 3INUL 1SEBB 2P42B 2DKMA 2VLKD 4LCIH 2D31A 3F8UB 3P77A 1CICB 2ESVA 5CHNB 4YNYA 3RKDC 2DI8A 5C0IB 3RWEB 1W2KT 5F89A 2E7CA 4WW1A 4RDQF 4L8CA 2PYEA 5I2IB 4MHHI 5EORH 1Z5LA 3SGJA 3KPOB 1QSFD 4NO0B 1LQSR 3DUUB 3LQZA 1IEHA 4LEXH 1RJLA 4U6VL 5C0DA 3BZ4B 3PWNB 3K4DA 3T2NL 1AXIB 3RY6A 1AO7B 1HYRC 1JTTA 3EW3B 4H0HB 4Y16D 4ZNEE 1HH9A 3OAZK 1YPZE 3QIWD 4NNXA 5GZOC 3ULUF 1LO3L 3HNVH 2O5ZL 3QUZC 2R39A 3IDGA 4HAFA 2DMBA 3T65B 4ZFGH 2YPKA 3PGFL 3X3FH 5JOPE 1P69B 5IV2B 1I8KA 3U36A 3SE8H 3DMMC 2UYLA 3DVNA 3WHXB 5KVFL 1ZHNB 1PG7W 1UWEH 3BP7B 2AJUH 4NZDA 1WGOA 1WZ1H 1AP2B 1GC1H 1C1EL 5D1QD 4PJFF 4L1DA 4P5TB 4O4YH 1NL0L 4RA0C 1UEYA 4Z8FL 2A77L 4OLYL 1BJ1H 5E6ZA 4CADB 1BLNB 1J8HA 4H8WC 4CVXA 1YJDL 3IT8D 2BHUA 2OR9H 3N0PB 5HGBA 2ZCHH 4UTAL 1Y6KR 3S36L 4DTGL 2IAMA 3DLQR 2IQ9L 3FQRA 1NJ9B 3ECBA 4BQCA 3MLRL 3VI4E 4KTYA 1TENA 2NNAB 5HGHB 4OZHF 5B3JE 1ZLWH 3L3JA 4PG9A 1NCDL 3EOAB 5C08A 2Y06L 3MA7B 35C8H 4DCQA 1LO2L 3V4VH 1T1ZB 5DJCA 4V1DA 4TNWK 3X14B 1OSZB 3EO1A 1BVKB 1C7TA 2YPLA 5HHMB 4QKXB 1HIMH 4NZRL 5JXAH 2X1OA 4C4KO 4Z9KB 2AABH 1OSPH 2J8HA 4FZ8H 1XF3A 1U95B 5BXFB 4FQHB 1H3GA 3O9WA 2EDOA 5DUMH 4G8FA 4NC1C 1FORH 2ITDB 2L7UA 4UINH 5DA4A 4G8EB 3VWKC 3FRUB 3V0AC 1BWWA 4PJFE 5B3NA 4NQSA 5J12B 2DWDB 3QXDB 5CEYA 4ETQA 4IJ3B 1JHTA 1G6RL 3C5JB 2RFXB 1IGMH 3O4LE 5HVGB 2R23B 2P5EA 1X5KA 3FB7B 4OLXH 2ZCKH 5BV7B 2NPLX 4K71B 4I0PA 1P84J 3JTTB 5J1SC 4UT9L 4NO5B 3CFBA 7FABL 1ZHKB 5ALCL 2G75A 3MA9L 1BAFL 1U3HB 4U1SA 5FXCH 3VFRB 4ZTPL 3BUYB 2MMXA 3TVMD 4AZ8A 4AIZA 4MQXC 3O6KH 2OQJA 4YDKH 4Y2DB 3KYMB 1YMMA 5E5RB 4XP5H 2NTFB 2J8UA 1WITA 1DZBA 4BUGA 1MAKA 2YXFA 3N1QC 5DD6A 3KLAB 4PRPE 1J1PL 4WEBL 3G6JE 4F7EB 4P2QE 1RFDH 2DIAA 1H5BB 5ESVB 2AKRA 1FAKT 5E6IA 1JZ2A 1JYXA 2H3NA 3L7FA 3SQBA 4H20H 3E3QE 5I1JH 4U1KA 4JRXA 3OZ9H 3TPKA 1VGEH 3MV7B 3IS1X 1CVRA 3S5LB 4MJID 4CVZA 2L7JA 5GRWA 2X1QA 1ITBB 1IFHL 4G6MH 3OKYA 5HHVL 3U6RA 1EPFA 5D6DC 5IKCA 2BOCA 2FEEI 4GQ9L 3D3VB 1JNHA 3QXAA 4HWBL 3RGVB 4MQXD 1QG3A 4JRYD 3EYQD 1YEFL 1ZEAL 5MEPB 4S1RH 1I9IL 4L4TB 5TGBB 1BBDL 4MWFA 4NIKB 2NY0D 3OKLA 2J4WH 3DV6B 5DK2A 5EBMA 2HJKB 4ZPVA 1EH9A 2V2XB 3EYSH 4HS6A 4RMTA 2NY1B 1F2QA 4DGVL 5DRXA 4PUBH 3F7RA 4JQIL 5LXGH 4D0CB 4HK3J 3EYVB 3PWLA 4O58H 1D5MA 1NDGA 1S9WB 1DBAL 1CDBA 4WIQA 4NN7B 1YNKH 1C08A 1JFQH 4U1IA 2Q76A 1G7QB 4YO0B 5E8NB 2W9LA 2VLMD 4HZAA 1JGUH 1S5IH 1MLBB 2X7LB 1KTDB 4EIZC 2AJSH 4XH2A 2EH7L 2NLJA 1HHKA 2HVJB 4QRQA 5A2LH 4PGJA 1VB9A 2BC4B 5AZ2H 4C56B 3JWDH 3HS0A 2R69H 2HWZH 2WK2A 1FH5H 4R90L 1H0DB 1S9YA 4GKZA 3RDTB 4OF8A 5F6IC 3B2VH 2E6PA 4MJ5B 4QRRB 3TBYB 1B0RA 4UU9A 1CD8A 2MTPA 4I48B 4RGNB 3SKMA 3LQAL 3WFHB 2JCCF 1Z9LA 5BW7C 1A6ZB 5EO1A 2A6IA 3BP4B 3WS6C 2VR5A 4X8XA 4UT6H 1NC4D 4LCYA 5F1IA 5GRZA 4L1HA 1WFUA 4PS4H 5FUOH 1AGBB 3AROA 3IFOA 4WI3A 4X5WA 1JF1B 1FZMA 5JHLL 3CD4A 3WS3B 2VIRA 5TDPB 2IQAB 1OTSD 2ADFH 2F53A 4P4KD 1K6QL 4NCC2 4A2LA 4KROC 2Z31A 1QA9A 5TE7L 1RZ7L 2DTMH 4Y5VC 4EQ3A 3HC4H 4UIKL 1EEZB 1K9TA 3L7EB 3GSWB 1R5WA 4DKEL 4LGPB 4PD4K 2VDRL 1CL7H 2Y36L 5C8JB 4D9RE 3H42H 3X13A 1FNSH 2P8PB 3BOVA 2OCFD 2VXSL 3UZVB 1PKQE 1P7HL 5E9DE 4GG8A 2D9CA 4V2CB 2VDPL 4JM2B 3BSZL 1A0QH 4PRIA 1OQXA 1MNUL 5EBWA 2DM4A 5EOQH 3BP5B 3R8BB 2P1YA 1JZ3A 3VXSA 5EU6E 2GAZA 4IRJA 5FYJL 1FC2D 2AJVL 3BP6A 15C8L 1FFRA 4MD0A 4D8PA 5DMYA 2AXGA 1FYTE 3RI5K 1A47A 3BDXA 4IHOB 1XZ0A 1R3LA 3BUTA 2VLJB 1DDHB 4Q0XH 4KROD 3SO3B 5C9JB 1P7QB 3VFVB 1U91B 3CFDB 1FFQA 4IMLB 5C07B 3SQOH 4JDTL 5E8PB 1J12A 5EN2A 3MMEB 4ZFOB 4TUOB 1CE1L 2XPGA 4LEOB 4I2XB 4WFED 4FQ2H 5GJTL 4RFNB 3O2WH 4HH9A 4GKSA 3KWWA 4HUVA 1SY6A 4P2RA 2AXFA 2DQDH 3KNBB 3HG1D 4PJHE 4ZMAT 2VZSA 1JTOA 3U0TA 5F1NB 2NY4B 3QH3A 1OWRM 2C3GA 1DQQA 5D7JD 2BXZA 1U92B 2YD6A 1QLRA 4S1QL 3EYUH 4YR6A 4UNTA 2RIKA 4UDTB 3UZQA 1KLGB 3C2AL 2WINB 1Q0YL 1A4KA 3NPSB 1CWVA 3HC0B 5CUSL 4F58H 1VPOL 1I9EA 2NY6B 5HVHB 5KS9B 4ONFH 3HKFA 3UROR 3UP1A 1UC6A 2P48B 5I1DB 2KZ1B 3C8DA 3O6MH 1FGVL 4QTIL 3ARWA 4NRXA 3VXUB 4JPIA 1C5DA 1IAKA 3PABA 5CBEA 4J12A 2AJYH 2ITCA 1J5OH 2BVPB 4AMKL 1I7RA 3QDJD 4ERSH 4RWYH 5T1KB 1KIPA 5IMKA 3KR3L 1JZ7A 3ARSA 1S78D 3TA3B 5D2LB 2VDNH 4ZNEA 5I19L 2FDBP 3FCTB 1YPZA 5EOCJ 3H0TB 5E00A 3AU1B 3BFOA 4KTEL 4D94A 1S7SA 2YUXA 4HJJL 2X4OA 1UM6L 4IDLA 3MYJA 3OB0K 4JZNA 4QF1A 3X11B 3HRZA 1X5GA 3GK8L 3LB6C 3GSXB 4PJ8D 2E8YA 1DBJH 3GBLA 4JN2A 5DLML 3MRGB 3GMNB 3VFNB 1BOGB 3THML 1A7BA 2WV3A 2VLKE 4XPTL 3QFDB 3O3BA 2B4CH 3JWNC 1RZKL 5E5MA 2VITB 1IAIM 1G0YR 1R24B 4WHYG 5IVXB 3KPLA 5AYUL 5C7XL 3C09B 1QSFE 3FZUD 3RAJH 2PXYA 3HNSH 1A1NB 5K9KB 2ZWLT 4TVPD 1EHLH 4OJFL 3CPLA 1SYVB 2HRPL 3N1MC 3GRWL 4QRTA 4Y4KD 3O6LL 4FP8L 3H3PL 5L7XL 4B41A 3EBAA 5D71L 2D7TH 1IQWH 1FE8H 3SDCB 2VC2H 3SPVB 1NMCC 1P5VA 1LDPH 1M7DA 1CU4L 3VW3H 5CZVL 5EOTB 4JZJB 1LO5A 5C6WH 2E6JA 3RU8H 2XTJB 2BERA 1GGCL 3DXAB 3MQIA 1A5FL 4WFGD 2EO9A 4N0YL 4DKAA 1HSAA 3QEHA 2GT9A 5DHVB 3FT2B 2UWEF 1C12A 2YXMA 4OCMC 4X6FB 3KYAA 4RFEA 4WWID 4BH7B 4DZBB 1RIUL 1NFDF 4WW2B 2JLLA 1FZKA 2XN9B 5DJYB 1YY9C 4WDIB 5JW3H 5H35A 1K8DA 1F4XH 4CNIB 5DK0B 3QUYD 4PJFA 4BQ9A 3BJ91 1D5BA 3U4EA 4Z95L 1ZA3A 4QHLB 3IU3B 5LGJB 2CK2A 3ETBF 3MV01 4ZSOE 4ZXBA 4PJ9A 3IFNH 3O4LA 4M43H 4I18C 2ZPKH 5IJKC 3P4NA 1NLBL 2R8SH 4HQQL 1OOAA 1OARL 5D9SB 3T2PA 5C0CB 1NGQH 4XMKL 2A6DA 3UYRL 1R5VA 3WIIH 4OGYH 2UY6A 1X5ZA 3CUPA 3OGOE 5INDA 3K2MC 2VDKH 4G6KH 3S7GA 1A1OA 4YEEA 4XXCC 4F37F 1MI5D 4F9PA 2B7DT 2D31B 3ARDC 3P77B 4O02H 2ESVB 4YNYB 3VFWA 5F89B 1CFBA 3RPKA 5FECA 4AEHL 4WW1B 4L8CB 3VXMD 2PYEB 3MLSH 1VFOA 5E03A 3G6JA 4P2QA 4WTZA 3LQZB 5C0DB 1RJLB 5D5MF 3QIUA 4PTUA 4R2GD 3WKML 1CS6A 1C5BH 4DN3H 3T2QA 3GSRA 2UWEE 1JPST 4NNXB 4ZAKC 2QQLL 3MXWL 1AXTH 3CCHA 3SDDD 1NFDE 3QI9C 4M7ZC 3N9GL 3IDGB 2YPKB 4HFUH 1A22B 1GZPA 4NN6B 1KXVC 4WI9A 2O5XH 2VLLA 1I8KB 2FHBA 3OL2A 4LVNC 3U36B 4NN5B 4QOKD 1G9EA 2UYLB 3DVNB 3OMZA 1KIRA 4Z78A 1J86A 4D3CL 3CX5J 2E8ZA 4ODHH 4XNQA 2W9EL 1QFUH 2VN7A 2CSPA 3CIQA 2B1AH 1JHKL 1RUPL 4ZOBA 1MWAL 4FFYL 4K8RD 1NCCL 4JO4L 1MFDH 2PTTA 2FBOJ 1J8HB 3QAZC 4X9HA 4CVXB 5T1DH 3PL6A 5HGBB 1W72L 4NOFA 1L7TH 3DGCR 5FDWA 1NAMH 5CD3A 5FO8B 3O3DA 4M6NL 3NTCH 2IAMB 3RHWK 1D5IH 3ROOA 1PX4A 4PJEE 3ECBB 1AH1A 4ODXB 5IF0A 1G7MA 1YQVL 2R56H 5DVMA 3F7PC 1MJUH 3LS5L 4NKIL 4UV4H 5D93B 3QWOA 4MJIE 3L3JB 1AXSA 3TYGH 3V5KA 1G9NL 4PG9B 5T33L 2GQHA 4TUKH 4XNYL 1AFVH 5C08B 3GM8A 2CJUL 3HCVB 3EO9H 5DSCA 5AEAA 4DCQB 5CZXC 1IL1A 1IAIL 1ZVSA 5DJCB 4V1DB 1OQOA 1FV1A 1UA6H 4ELMA 2ZUWA 4KPHL 2EZ0D 4JRYE 3RWDA 1OAKL 3EO1B 2YPLB 1JF5A 3FQTA 1N5AA 3MLUL 1OD7A 3HE7C 4K9EH 1JRHL 3VFPA 1XF3B 4UTBL 3OR7A 3O9WB 1S7TA 1CDIA 5J4MA 4G8FB 1DFBL 4IRSA 4QHUA 5T1LD 2X42A 4U6XA 1N6QH 4L4VD 2AGJL 5JZ7D 4J8RA 2YUZA 2YD4A 1MF2H 3SGDH 4NQSB 1A6WH 1NEZA 3CLEL 3INUH 5CEYB 4ETQB 4W6YB 2NR6C 1CXEA 1JHTB 2FH8A 4WEUD 2K7PA 3W82A 2P5EB 1NAMA 1ZTXH 5ACZA 4M5ZH 3CU1A 2Q8AL 4Z77A 3AREC 4I0PB 2VLME 2WBJD 4Z7WE 1I8MA 4K8RL 3TV3H 4R0LA 5LKNA 1FVDA 3CFBB 4GOSA 2BJML 2G75B 2W0FB 2NY3B 4U6VH 5C6TL 4NKOA 4U1SB 1MVUA 3T2NH 4CW1A 2CD0A 3IJSA 1CR9H 4IOSD 1PKQA 4K3JL 1UYWL 5E9DA 4AIZB 3LSOA 2OQJB 2NXYC 5I18H 3P30L 1EFXD 1EIBA 4OCYH 1BQHG 2J8UB 5JDJA 4MVBC 4EN3D 5EU6A 3MCKA 1F6FB 5E2VL 3T4AA 1QBAA 1FYTA 5KVFH 2J5LC 2AKRB 5F8RC 5E6IB 2H3NB 2NY2C 3L7FB 1VGKA 4FZEL 5GSVA 4GXUM 1XEDA 1ZKAA 4U1KB 4JRXB 4WV1A 2BMKA 3MCLL 4G7VL 4KK9D 1NL0H 1TQBC 5D1ZA 4YLQT 3V52H 2GJZA 2OL3H 1T03L 4CVZB 3MRNA 5D2NB 3U6RB 3ZDYF 1YJDH 5IKCB 2BOCB 1JNHB 3QXAB 1U2CA 5I1KL 1IGTA 3GJFH 4PJHA 3CNKA 3UTTD 2DF3A 1CT8A 3LD8B 3NGBB 5DDHA 3SCMD 4I8DA 1Z0NA 4XP6H 4MWFB 4EBQL 3OKLB 4YJZL 5DK2B 5EBMB 1G9MH 4ZPVB 1E28A 4LPUA 1N59A 4HS6B 2FEDD 1JPGA 1N6UA 4HS8L 4JLRA 5DRXB 1LO2H 5CZKA 1BIHA 2WWMD 1IAOA 1IC7L 2EO1A 4M48H 3PWLB 4BH8A 4WUKL 1D5MB 1NDGB 2XZCH 1C08B 4RISL 5D72L 4U1IB 2Q76B 1BVZA 5DMGC 4JPKL 3MRJA 1DSFL 1MRCL 2IBGA 4NZUL 2VKWA 4WFEE 1BBJA 4YHOL 5TH2A 2NLJB 1HHKB 4QRQB 4F8TA 3HS0B 3HG1E 5I1CH 2CH8A 2OL3A 2ZUQC 1S9YB 4DUVA 4GKZB 2FO4A 3GSNL 1B0RB 4YXKL 2FWOA 4UU9B 3SKMB 1S7VA 4PJGF 3U0WL 2H9GA 5CEXA 1A7OH 4W70A 1WWBX 3GJFA 5SX4I 4XBEL 2HG5A 1ZGLA 5EO1B 1BGXL 4JY5L 2A6IB 2DKSA 4ELKA 4N5UA 4LCYB 5ALCH 5F1IB 3RX8A 3T2OA 2Q3AA 3CSYA 1WAAF 1XGUA 3IFOB 4X5WB 2VLKA 4ZTPH 1FZMB 5F9AC 1EUUA 1FAIH 3FONA 2VIRB 3I6KA 4XAWH 2F53B 3SDXF 3BGFC 1AQKL 4M4RA 1AE6L 1CGWA 2XZAH 2Z9TA 2Z31B 3HA0A 3V6OE 1QA9B 4UAOB 3PGDA 1QSFA 1HKLL 3MLZH 4OCXH 1R5WB 3D39A 4LPVA 4OFVA 1S7XA 1MRFL 4OLZH 3T04D 3IDMA 2VXQL 4Y16A 3X13B 3QIWA 1XGRA 4MDIB 4PP1D 4Y8DC 3P40A 5HBBA 3JUYA 2DYPD 4GG8B 5SV4A 1J0KA 4PRIB 5TDOA 1FCGA 1A7QH 3VXSB 2HRLA 2GAZB 4IRJB 4K7PY 3BP6B 1IFHH 2NTSP 4MD0B 3NIGE 4D8PB 1IGFL 4GQ9H 4PY7A 2AXGB 4D0BA 1TJGL 3AXLA 1R3LB 1IT9L 4XPGH 5D1QA 4ZUWA 3RWJA 1IEAA 4MS8C 1I9IH 5GS1C 4K3GA 4XNZC 3CU7A 1V3MA 5BMFL 3C60C 4NCC1 5EN2B 3T0ED 2XPGB 1CE6A 5DEFA 1NCNA 1HOCA 3RI5F 2QHRL 4HH9B 4NWUL 4GKSB 1X5JA 3KWWB 4HUVB 3X12A 4TTDD 4P2RB 1ES0A 4ODSL 2AXFB 3NCYP 1VKXA 4Q9RL 4MXQD 3U0TB 1DANT 1HDMA 1F3DH 4TVPE 1HI6A 4ZSOA 2A1WH 1DQQB 3EJZC 3RVWD 3GSQA 4GBXD 5EU7C 1QLRB 4QLRA 4YR6B 3STZA 3BPOC 1XFPA 2QLVB 3ARGC 1EMTH 3F7YA 5MHSD 1A4KB 3T8XA 4CMMA 5HDBF 4PBXA 2IH1A 3ZZ1A 1MREH 4MQ7A 3CXDL 4QHMA 2Y4SA 3V8CA 2EH7H 3DSNA 4XCYA 5D70L 3NH7L 2VUOA 5JW5A 1UEMA 2F5AL 2FX9H 4WFGE 2W59A 4NRXB 3OAUL 4JPIB 2VUYA 2Y5TA 2Z91A 3VRLE 1IAKB 3PABB 4G3YH 4RA3A 5CBEB 3K1DA 4MNHB 2ITCB 1I7RB 3STBA 5FIEA 5D7IE 1T20A 1KIPB 2AK1H 3RUGF 3BEWA 2XZQL 5GGQL 5IMKB 4URTB 2QADC 1RMFL 4P2OD 1T0MA 2JJSC 3WLWD 1ZA6A 1KN2L 3JV6A 1JCKA 2UWEA 1YPZB 4OM0L 1NBQA 4NOBA 4LIQE 5E00B 1U6AH 1B3JA 2HKFL 1NFDA 2FHFA 5JHLH 1KB5L 2W07A 2IG2H 1S7SB 3LDBC 2X4OB 3QCTL 2DDQL 3MYJB 2WNGA 1QHOA 1K6QH 4XZUA 2I26N 4QF1B 4JFQA 3HRZB 4LCCC 4EUPH 3S8WA 4G8IA 3GHEL 1DLHB 4BZ2L 4U7MA 5ACMA 1BZ9B 4JN2B 3MBED 1KC5L 2I5YH 1GCFA 5HYIA 2CLVA 4M7JL 4XP9H 3TVMA 1MI5E 3Q3GA 4M5YH 3BZDA 1OAYL 3PG2A 1RU9H 3O3BB 1ZLVH 3QSKB 5KVMC 2DQJH 4XMLH 5HDBE 2XKSA 4LSRL 5E5MB 2V17L 4KUZL 3VXME 5IBUB 1D5ZA 5I0DA 3KPLB 1WCBA 2JKXA 3PP4L 1T5WA 2DI7A 2AJVH 4RAVA 4HPYH 15C8H 2PXYB 3Q5TA 5CSBA 3JTSA 3OJ2C 4LLVA 1IKNA 4PJEA 3CPLB 5DR5L 5C70A 4QRTB 1QBBA 4G6JH 4OLUL 1JWUA 1A3LL 4K7PH 5KW9L 1QPXA 3RUGE 3PXJA 3ARFC 1RV6X 1M7DB 4MJIA 1BREA 4L5FL 4JDTH 5HTSA 4QOKE 1CE1H 1RULL 2YUVA 2SEBA 1LO5B 5GJTH 1WWCA 1OAXL 4JRYA 1TCMA 2B20A 4XVTL 3ZSTA 5BZWA 1HSAB 3QEHB 2GT9B 2R0KL 1C12B 4EUPA 1RK0A 2ERJB 1QO3A 1RY7B 1FGNL 4RFEB 4S1QH 1JMZA 2AJZA 3ZDXF 4L8DA 1RAMA 4ODBD 1FZKB 3ULVC 3V0WL 4KQ4L 4RMWA 2YKLL 2WBKA 3SGEH 3DGGA 5H35B 5CUSH 4E42A 1FNAA 3HLAA 4PJFB 3SGKA 1TZHA 1XGQA 1D5BB 3U4EB 3J8F7 5IHZA 1ZA3B 4U7KA 3ARFD 2JELH 1U8JA 4O00A 4ZXBB 4AEIH 4OD1L 4PJ9B 3O4LB 4HIEA 3P4NB 1A14L 3KJ6L 5IGXH 3EJYC 4UOW1 4ZDHA 3VFSA 2BRRL 2NY5H 3K81A 4NWTH 4Z7WA 4NNPL 2A6DB 2IFFH 5CGYD 5CJXC 1R5VB 4HK3N 3KR3H 1HEZA 3CUPB 4P9ML 5LWYL 1B6DA 5INDB 2A83A 3TO4D 1H3VA 4FQCH 1A1OB 2Q20A 2FLRT 5KANG 1Q9LA 1KJ2L 3KS0J 4HIXL 1KJMA 3FFDA 4FQXD 5K9JH 2BY2A 5C2BH 3V5DB 3DX9A 3HMWL 1HHGA 3DYMA 5CILL 1J1XL 3P4OA 1UM6H 2Z8VC 1ZAGA 2EDKA 5I6XC 4BM7A 3G6JB 3UPRA 3CFIC 4P2QB 1JPFA 1AD0A 4XT1C 5E24E 3GK8H 3QIUB 1H8NA 4PTUB 4L4VE 1NC4A 4MGXA 4XRCA 4HGMA 2HN7A 3GSRB 4X9IA 5DLMH 4XVSH 1MCPL 3CCHB 3ZDXE 5I1GL 2YWYA 3KDMA 1FG2B 2KKQA 5DTFA 1S7RA 4P4KA 1GZPB 4M93B 4X8JA 2VQTA 2VLLB 2ZP0T 4U1JA 1KIRB 4XI5C 3WNKA 1ZHBA 3GKWL 3KYKH 3ARPA 1II4E 2EE2A 1V7NL 5J11C 4G8GD 1MHEA 4JREC 2HRPH 4P0DA 3EKCA 2DMKA 4FP8H 4AIXA 6FABL 2UZYB 3EO0A 4FG6C 3ZL4H 5IFJA 4Q7DA 5F1SA 5LGHL 2OJEA 4YK4B 5D71H 1FFPA 3SE4A 5B39A 2PTTB 2PW2A 1T80A 4OT1H 5D8JH 1JBJA 5JO5A 1CU4H 3U4AA 2BZDA 3PL6B 5FDWB 1VEPA 4R97C 5CD3B 3O3DB 2G5BA 4XNXL 4JJ5B 4PG2C 1F8TL 4X6CF 3ROOB 2QQQA 4LCUA 4L8BA 4N0YH 2EYSA 5IF0B 2C1OA 1G7MB 4WUUD 1AHWC 1U58A 4YDIH 4UT7L 3QWOB 5F7MC 5JMOC 1AXSB 1PBYA 4Q2ZA 3UO1L 3L5WA 4X4XA 3MLPA 4HEPG 3RHWF 5DSCB 4QT5A 1IL1B 1ZVSB 4S0TD 1FV1B 2BVUA 3T08A 3RWDB 3HG1A 4PBWD 3TJHC 2HJLA 3FQTB 5HDLA 3VXQA 3UTTE 1FIEA 1A7RH 5D7JA 1N5AB 3GI8L 2LAAA 2OK0L 1QYGL 5DC9B 3T77A 4Q58C 1TPXB 3TN0C 1RURL 3VFPB 4RNRA 2XT1B 3LZFL 2D03L 3OR7B 4MA3A 4LP5A 5IBTL 3QUXD 3P2TA 1S7TB 4YHMH 4U1NA 4LSUL 1RJCA 4AK1A 4IRSB 4QHUB 3TPUB 2BXYA 4U6XB 2ZOLA 2JE8A 2OTPA 3BPLB 3P0VH 4MQTB 4G7YL 5ISZD 1NCWL 2C9AA 4J8RB 5E2WL 5LAXA 1HZHH 1NEZB 2QBWA 4ZO9A 5F6HJ 3F7VA 3LY6A 4WY7L 4TVPH 5CWSA 2UZXB 1NAMB 5KSAD 4AEHH 3QDJA 5ACZB 3V6OA 2J88L 4Z77B 3JV5A 1I8MB 4U0RB 3SEPA 4R0LB 4KAQL 3QULA 5KZCB 4X6CE 1R3JA 4H8WL 3ZYIA 3TYFA 4WGVB 5JPMA 4NKOB 3TN0D 2VYRE 2GJ6D 3IAQA 1OTUD 1MVUB 1IRAY 2F74A 3Q0HA 3ZE1F 4YHKL 4CW1B 3IJSB 1CICC 5GGVL 1PKQB 4U2ZA 3GUTA 5E9DB 3LSOB 3EFFA 3VMPA 1UH4A 3N9GH 2IPUK 2OI9B 5EU6B 3MCKB 4HKZA 4BFIA 1KBGH 3L5IA 1FNEA 3T4AB 1C5CL 2X1PA 2XACC 1FYTB 4PJ8A 4YHPA 4XNMA 2DB8A 2HFGH 5L88L 5DVKA 1AGEA 4KJPD 1HXMA 2W9EH 4WO4D 4XVJL 3U1SL 4N5EC 3HZKA 5DVOA 5KG9A 1JHKH 3NCCB 4WV1B 2BMKB 2AEQH 5EOCL 1F4WL 3QEQA 4LIQH 5FA4A 5D1ZB 2KQNA 4OGAC 3BX7C 4UB0L 2GJZB 2X1WL 3CVIL 3GB7A 3R06A 2GY7B 3MRNB 2I24N 1RSFA 4FMFA 5DWUH 1W72H 2MCPL 1IGTB 2J7LA 4PJHB 3V6ZA 1KCKA 4HUNB 2C3XA 1MVFA 1SJEA 5JOEA 1CT8B 4JFZL 4P5TC 5DDHB 4IIQB 4Y4KA 3RTQD 5ID0A 4Y1AD 5HYQA 2HTLD 1S9XA 2UVEA 3V4PL 1OL0A 1X5HA 3LS5H 1E28B 4NKIH 1F4YL 1N59B 1G9NH 5T33H 1JPGB 4XNYH 2EIEA 4OKVA 3D9AL 2CJUH 1J7VR 4JLRB 1TFHA 3GIZL 1OTTC 1IAIH 3OX8A 1TVDA 4X6DE 3VWJC 1ZS8A 5F7EH 4M1CC 1IAOB 4TSCL 2Z8WC 1OAKH 4LLQA 4CDHA 1XT5A 1U3JA 4K3EL 4BH8B 4EJ1C 3DHMA 4IEFB 3MLUH 5FO7A 3K4AA 5IESL 5D7IA 4R4ND 3MRJB 1ACYH 4Y4HD 2F9BT 3T0EE 1BBJB 5TH2B 3QUYA 4J1UA 4UV7H 2FIKA 1YYML 1U8NA 2OL3B 1EJ6A 3T1WA 3WLBA 1PW3A 2FO4B 5E0QA 3IFLH 8FABA 1YNLH 3H3BC 5ID1A 2FL5A 2FWOB 2VZVA 5EFIA 1S7VB 3WD5L 5KJRL 5GGTL 4UILH 1ZLUH 1YDPA 5CEXB 2H9GB 4EDXA 3WHE0 1W72A 3VWJD 1D6VH 3GJFB 3U83A 2HG5B 5BVPH 4Q9QH 5D96B 2Q8AH 5MHSE 1ZGLB 4K8RH 4ELKB 4B7IA 4Y19D 2MKLC 3VDBA 1OAQL 3CSYB 5J12C 3QUKA 1XGUB 1BQLL 3G5YA 1FVCA 1MI5A 4IJ3C 2VLKB 4RGMB 1SEQH 3S34L 4E5XA 3FONB 3I6KB 2H6PA 5CMAA 3MLTA 5DMIL 5BV7C 3VXMA 4K71C 5SX5K 4K94C 4OF6A 3QQ9C 1U8HA 3PGDB 1QSFB 2N7AA 4IS6A 3WXWH 3PJSA 5E2VH 3UBXG 2V7NA 1S7XB 3S97C 1U3HC 3DI2B 2FGWH 3WUZA 3IDMB 4Y16B 4HC1H 4P2CG 4HG4K 3QIWB 1XGRB 4JO1H 3Q6FA 1J0YA 4KTDL 4Y2DC 3SDDA 3U48A 3RUGA 1T7WA 5A2KH 2P47B 5TDOB 3M17A 2XTLA 1T03H 4GMSL 2DQFA 4QOKA 2J12B 1MH5A 12E8L 5F21B 1H5BC 3SBWC 4PY7B 4D0BB 4JHWL 3AXLB 5I1KH 5E8OA 2R4RL 2WW8A 5T5FL 1NGZA 2CK0L 1QR4A 5D1QB 2NW2A 4ZUWB 3RWJB 1IEAB 5HJ3B 5I16A 1MEXL 5BQ7A 5HD8C 4KVNH 1BFTA 1CE6B 3IB4A 5DEFB 1HOCB 1KCUL 2V2TA 2I25N 4JANA 4X9FA 4HS8H 1ES0B 1VKXB 2EDJA 1CGSL 4GAJL 1HDMB 5E08L 2LFGA 1HI6B 5BCAA 4ZSOB 2AVGA 2YA2A 2EDXA 5FCUL 3STZB 3ULVF 4XP1H 3O0RL 3S98A 1MQ8A 2FR4A 3VFUA 1Y6NR 3BXNA 3DWTA 4YZFE 3F7YB 3MJ9H 3T8XB 4JPKH 4CMMB 5BO1H 3HC3L 5IW3A 2IH1B 1DSFH 2NY1C 1I7UA 4HC1A 4MQ7B 4NZUH 4QHMB 1HWGB 3RBGA 2GY5A 1GJIA 2GFBA 4UIMA 4W81A 5I74B 4XCYB 4N0RA 5JW5B 2EXWD 3M1BA 1PQZA 3H6JA 4OI9A 5DO2C 4NN7C 2Y5TB 1Y0LA 2Z91B 5IBLD 3LPFA 3WJLA 4HXAH 1NUNB 1S7UA 2ORBL 1DUZA 4XPHL 3U0WH 1T20B 3KLHC 3BEWB 4EZMA 4XXDA 4P5KA 4R3SA 5T1LA 1BGXH 4JY5H 1T0MB 4L4VA 1ZA6B 4E41D 3MRHA 2UWEB 4U1GB 2ZUYA 3RDTC 2R1WA 5DD5L 1NFDB 4RGNC 6CGTA 3LVEA 2CPCA 1MIMH 1OP9A 4XZUB 1AQKH 5ILTL 4NM4L 4JFQB 1TJHH 1AGCA 1AE6H 3F12A 3KVQA 2WBJA 4Z7UF 1FSKB 4G8IB 1EJOH 1WLHA 1DBKL 3O3UN 4KK6D 2V9RA 3H9YA 5I15H 2CLVB 3TVMB 3B9KD 3CSBA 3Q3GB 3MJ9A 3G6AA 1ADQH 3OG4B 1E6JL 2EIDA 1EFXA 4LSQL 3WFEH 4OD3H 4PY8J 4EN3A 1D5ZB 4KKLD 3SE3A 1WCBB 1OW0C 1T5WB 3KPMA 4RAVB 5E70A 1ZE3C 3X3GL 1IGFH 4H1LH 1PY9A 1V7MH 3JTSB 4LLVB 5TE6L 4M02A 3WFCL 1RI8A 4PJEB 4LARL 5JW4R 1IT9H 1CFSB 3F6IA 5F71A 4IMKC 2XWJA 4KKCC 1JWUB 4I4WA 4B7LA 3UDWA 4JM2C 2H26B 4POZD 3EZ8A 4MJIB 1NFKA 5I1HL 4Z0BL 2DM3A 3UTOA 3O2DL 3V0VA 1NCTA 2SEBB 2XICA 1EZVX 5L6YL 1EAPA 3P4LA 4TRPH 1TZIA 43C9A 3A0OA 4JRYB 4ODSH 3UTTA 3SO3C 4JFHD 4Q9RH 5BZWB 5ADOH 4G8GE 3CMOL 3SCMA 3VFTA 5FO9B 4EUPB 3V7AE 1QVOA 4HUMB 1RK0B 5T3XL 1QO3B 4MAYD 3TFKD 2NY0B 3VJ6A 9CGTA 4R9HA 2AJZB 4L8DB 5JHDD 1F58H 1X4XA 5SX4H 1MFBL 4RFNC 3DGGB 4KZEL 1QQDA 4E42B 4XX1G 1UZ8A 3HLAB 3KPTA 1CK0L 1TZHB 1XGQB 2NY4C 2WUCH 3CDYA 4MDJA 5IHZB 4XHQA 3NH7H 3MJ8A 1HHIA 1U8JB 2DJUA 3PIQA 1PZUB 4HIEB 5JXED 1LO0L 4WUUE 1E4KA 4ZDHB 3VFSB 4EIGB 2XY2A 5J89A 1KN4H 3IDYB 3NPSC 4H1LA 3QCUL 4OFDA 4Z7WB 4ODTL 2AXHA 1KLUA 2NY6C 2XZQH 5HVHC 3QHZL 5GGQH 2C1PA 4X6CA 1HEZB 1I4FA 2A83B 3QCVL 2QQKL 2VTFA 1CBVH 1TLKA 3B2UC 5DQDL 1F90L 4H88H 4PGZA 1Q9LB 2MPAH 4KZDL 1NKRA 3NOIA 3F5WA 2ICWJ 3F7QA 1KJMB 3FFDB 3NPZB 4FFVC 1IC4L 1KB5H 3DX9B 1G1YA 3VH8G 1HHGB 3K2UH 3QCTH 3P4OB 3UPRB 2A2QT 3K7UA 3O2VH 1E4WL 2IADB 1RIHH 1NC4B 2B2XL 3FRPG 3LMJL 4XRCB 5ISZE 2HN7B 3LKQA 1KC5H 3NMEA 3MR9A 1QRKA 2VDOL 4I77H 4X7SL 5GISH 3U4BL 3C6LD 5IB5B 1LEGA 3KDMB 1OAYH 5CS7A 5DTFB 1S7RB 2R0LH 4KDVA 4P4KB 3TH2T 4TSAH 3UZEA 4X8JB 1T7VA 4LSRH 2V17H 4U1JB 4GAYA 1JI2A 4K55A 3WXVH 4ODVL 3LEVH 5IM7A 1ZHBB 4FFVD 3TO2A 2IGFH 4LPWA 2GJ6E 3LN9A 1R6VA 5KVEL 2MQ0A 1MHEB 2DM7A 3MRFA 5DR5H 2ENSA 3ZE2F 1IBGL 3QHFH 4PRHD 4MCZB 5IFJB 2DYPA 1A3LH 2OJEB 5KW9H 4NRZB 4HLJA 1FFPB 3QDGD 5B39B 2PW2B 4G9FD 3RVXD 2Z0BA 2DQEL 4EOWH 3C09C 5JO5B 2E7BA 2GJJA 1Q9OA 3QRGL 1KNOA 1RULH 5IB1A 1LK3L 2XQBH 2D7QA 1N0XH 4X6DA 2G5BB 5EUOE 1KB5A 1OAXH 4BZ1L 2Z35A 3NCJL 4KROB 4LCUB 4DKFL 4XVTH 3IFPA 5GJSH 1BZ7A 4LVHB 2EYSB 2NZIA 3U0PA 2C1OB 2R0KH 3MLXL 4M7LT 1U58B 3SDCC 1E4XI 1A6TA 1EHXA 2H32H 4XPFH 1FGNH 1N6VA 1CXIA 1T22A 3T0EA 4LPXA 5DC4B 4Q2ZB 5I8OL 4JZJC 3U30B 3L5WB 4X4XB 3WJJA 2XA8L 1B2WH 3OG6B 2XTJC 4QT5B 5DQJA 3U7AA 4AQ1B 2VAAA 3HG1B 2HJLB 4FQJL 1Z3GL 3VXQB 2Z8SA 1DQLH 1QFPA 1LNUA 4TQEH 5D7JB 1QBLH 3IRZA 4Y1AE 4GBXA 3DX6A 1EBAA 3T77B 1WFNA 1O5DT 4RNRB 1OB1A 3KJ6H 4WW2C 3FQUB 4HHAA 4MA3B 1L9NA 4JM4L 3UCRA 3I02A 2PF6A 4U1NB 3AB0B 5BRZD 3BGMB 2ZOLB 1DLFL 3NBNA 1MCJA 2CLZA 4I0KA 1R0AH 2BRQA 5LAXB 1TETL 5CGMA 1IJ9A 4ZS6D 1DEDA 3F7VB 4HIXH 4ISVB 5I1EL 5CWSB 1F3JA 2C26A 3HMWH 3QDJB 1OPGH 4N8PA 1J1XH 2JJTC 5GGVY 4FFZL 3ZKNC 1B4RA 3QULB 1H15A 3G08B 2PN5A 4P2OA 5A16A 1R3JB 5DI8A 3T0WA 3TYFB 5JPMB 1HILA 3HPLA 5EA0L 2F74B 4OGXH 2ZSVA 4X80H 2H32A 5FHAL 1ZLWK 1N7ML 3GUTB 3ARVA 5F7LB 1T5XA 1MCPH 3EFFB 1IARB 3PV6B 3GMOA 5I1GH 4O9HL 3SGJC 3WYRA 4HKZB 3S88L 2FATH 4BFIB 1CGYA 1FNEB 2A9NL 2DBLL 3WDJA 4K3HA 4PJ8B 4YHPB 4EVNA 4XNMB 3RY6C 1R3IH 4LP4A 4Y19E 1NMAL 3CLFH 3MBEA 1AGEB 4Y0GA 1HXMB 4QHKI 4JCLA 1V7NH 3HZKB 4U1HA 5KG9B 2W60A 5KOVC 5HHPB 4OV5A 1MFEL 3E2HB 2NQCA 4NN6C 5ALBL 5FA4B 3B3IA 4DJMA 5DFVC 5IMLA 2CMRL 3DRTA 5FHBL 3GB7B 3R06B 4NN5C 5TFSH 5AG8A 5HXMA 3TC9A 2YD9A 4LFHG 1J9CT 1IC5L 1BZQK 4L3CA 3D85D 3KXFD 4YX2L 4DKDC 3BW9A 3V6ZB 3PF2A 4ZFZA 3R0MA 4XNXH 4APQD 1SJEB 3B43A 1FLRL 5ID0B 4Y4KB 4KKBC 3D48R 1KELH 2X4TA 1S9XB 1O7SA 2OMNA 1JHLL 3CAFA 1J18A 4P99A 1MAML 1OD9A 3GBML 4UT7H 4XX1E 1A6UL 3UO1H 5HHOD 4OKVB 1ORSA 2IAMC 3OX8B 5F7KC 4AG4H 5I8EA 3RJDA 1ZS8B 4HWUA 1F6AA 4BUHA 4UNVA 4DOHE 4LLQB 1AD9A 5B21A 4WU7A 2YN5A 1EO8H 2MKWA 5FO7B 5M7QA 3ZKMC 1X5XA 1RUQL 1QYGH 3RL1A 2Z93A 4KH2A 5D93C 2BCKB 4NKDA 5ITFA 1JYVA 4OQTL 2Y07H 5D7IB 3AVEA 2D03H 1CXKA 5IBTH 1L0YA 4LSUH 3NAAL 2VDLH 4GW5A 2EKJA 3QUYB 4J1UB 1O0VA 4G7YH 2FIKB 1NMCB 5E2WH 1X7QA 3WLBB 3OBAA 1KIQA 8FABB 5ID1B 2FL5B 5EFIB 1J10A 3U79A 3RVTC 1WTLA 3EOTH 1L7IL 1YDPB 4EDXB 3O9WC 3IRPX 1W72B 3GO1L 4LK4A 4Z7NE 5K59F 4D0DA 1GC1C 2FSEA 2ID5A 1PY4A 3BKYH 3G04A 3TO4A 4JN1L 1YN6A 3MRKA 3QUKB 3G5YB 1FVCB 1MI5B 2V7HA 5DFWH 4E5XB 2Y25A 4KVCL 4FQXA 4YBLC 3LKOA 5CMAB 3MLTB 2D7MA 2PETA 2VZOA 3VXMB 3GMPA 4I0PC 4NUGL 3VDCA 1GGIH 3LN4A 4LVOB 4IS6B 1P1ZA 5EZIL 5EIVA 3PJSB 2NY3C 2R0ZL 1C5CH 2V7NB 4R2GB 3MXVL 4NGHL 4E41E 5L88H 1M7XA 1KTLA 2B0SL 3Q6FB 1EGJL 4FQ1L 4XVJH 3U1SH 2EXYC 5HHNA 3SDDB 3KG5A 5IG7A 4G43A 3RUGB 4AEEA 4L8SA 1F4WH 3M17B 2Q7NA 4RMSA 5GS0D 2FCBA 4W6XB 3CVIH 4XPAL 2DQFB 4YHIA 4QOKB 1MH5B 5IIEA 1WWWX 4M3KB 5E6IC 5IB3A 5L8JB 3RPIA 5E8OB 1NGZB 3D87B 1K2DA 2NW2B 4G8GA 3OAYH 3QNXA 4NZJA 4F2MA 4TSBL 1RIVL 1MCEA 1U93A 3TM6A 4BELD 4BQ8A 5I16B 5BQ7B 1J05A 4N9GA 4Z7OE 2VR4A 2ZG3A 4QHNA 4KJQD 3IAPA 4R6UA 1F4YH 4N8VG 4XB8A 4MJ2A 2V2TB 5FGCE 4OZ4A 4JANB 4U0QB 1YMMD 4KI5C 4JQVA 5ENWA 3LD8C 1C16A 3NGBC 4QXTA 1CGUA 2XNAA 4TSCH 4ENED 3UC0H 4K3EH 4G5ZL 4WUUA 5IR1A 1CFNA 3QZWA 2FR4B 3VFUB 3BXNB 3AM8A 4I3SL 1X4YA 4LDOB 1I7UB 4JY6A 4UIMB 5FYLD 2VXVL 1I9RL 4N9OB 3M1BB 1PQZB 4JFHE 4JHAL 1AGDA 3FO0L 1RUML 3VI3F 1Y0LB 2H41A 2ICCA 3OV6A 4OF5A 2I9LA 1UACH 1S7UB 5GGTH 1X9QA 2EYTA 1DUZB 4WTWA 3QUXA 2W65A 1U8QA 5KS9F 5JHDE 1MFAL 4XXDB 2YK1L 4PB0L 3D5OF 3GJEB 4P5KB 1YECL 4R3SB 5T1LB 2FX8L 1AQDA 4L4VB 5CINH 1FIGL 2E5EA 3MRHB 2VZTA 3CFCL 2OTUA 1A9BA 1BX2A 1OAQH 1MHHA 4HXBL 3KLDA 3P11L 1BQLH 1AJ7L 2R1WB 4KDTA 1KACB 4XMPH 2XY1A 2X4QA 5KSAA 1EVTC 2EH8L 3BH9A 5DMIH 1CFQA 3MROA 1AGCB 3F12B 2WBJB 3B6SB 1X5IA 5D2LF 4FQLL 4RGOL 3I9GL 2K7QA 4P9HL 5FYKD 5GZND 2E27L 5KTEH 4O2EA 1QLFA 2GJ6A 3BD4A 4JG1H 4WI6A 4ODWA 4XPBH 3V5HA 4KK5C 3G6AB 4P57A 3ZTJG 1EFXB 4DW2L 1NGWA 2Z31C 3MZGB 5GGUA 2Q6WA 1JGVH 3BDYL 4UAOC 4EN3B 1OGAD 1YEHL 4K07A 1VCAA 1TQCB 4S1DC 3KPMB 5DT1L 4HMCA 4DVRH 1XF1A 5EUOA 12E8H 3GI9H 3G5VA 3D18A 3ILQC 4JHWH 4P46D 1NBVL 3VI3E 5GGTA 3MFFA 4PLKD 2XG5A 4WO4A 5T5FH 2XWJB 3C9NA 4I4WB 1JPSH 2IJ0C 5FYLL 4OLEA 4YPGA 1ETZA 1I3UA 3K3QA 3G9AB 3HHRB 3IAGC 4BK5A 2FECI 3JWDC 4IRJC 1PFCA 2HT3C 5F7WC 3ZDZF 4GG6E 4UQ3A 3V0VB 1NPUA 1HKFA 3RWHA 4OF0A 1EAPB 1VADA 5CLTA 1KCUH 1WUNT 4HIJA 5L8LB 1TZIB 2KPNA 43C9B 4HJ0D 3QDMD 1GHFL 1GL4B 5HY9A 3UTTB 4CN4A 5MERA 4KXZI 3RTQA 4Y1AA 2H2PD 4ZPTA 3SCMB 4YDVA 3VFTB 3NZHL 3ZHLA 3ZE0F 4PRHE 2LVEA 3VJ6B 5FCUH 5F88A 4OFPA 2J5LB 2W38A 3O81A 5HGAA 3O0RH 3ZHKA 5A3IC 3QDGE 3ILQD 4G9FE 4F7MB 5J8OA 4JR9H 1QQDB 2BNUA 4HWEH 2OTWA 4JHBA 1UZ8B 4XWOC 3TNNA 1T2QL 1T04A 4MDJB 1OLLA 5I8CB 4LSSL 5E95B 3MJ8B 1HHIB 5FYKL 2F58H 4YXHL 2DLFL 3PIQB 3MOAL 3T09A 3IDXL 3WO4B 5L2JA 2YUWA 1QKZH 5B38G 1MCLA 4H1LB 3SDAD 1KLUB 1JJUA 2DQHH 4XPHH 2WUBL 4Y4HA 1G7IA 4LF3B 25C8L 5F3BA 2C1PB 4X6CB 2CKBH 5DJAA 1I4FB 1U8KA 4BKLA 2BFVL 3RQ3A 5J13C 1I9JH 2I07A 2VAJA 5CJQL 2W0KA 5BVJA 3F5WB 4UBDD 5JA9A 4KRPD 5JW4M 5DD5H 3RRQA 1CL7I 3WEXA 3ESVF 4XGZA 3KYOA 4NM4H 1CGXA 3UTSD 4QY8A 4Y19A 3BN9C 2DICA 5L9DL 5FKPB 3BT2H 2A0LC 2KBGA 3LKQB 5JNYA 5FDYA 1N5YL 3MR9B 3ZE0E 1T83A 2LQRA 1LEGB 5E5UB 4R8WL 4HLZG 4YHYB 5AWNH 4LSQH 4Z7QF 5J7CC 4LRNH 2V2WA 3V6BR