2IPTH

Pfa1 fab fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
223
structure length
223
Chain Sequence
QVTLKESGPGILKPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDDKSYNPSLKSQLTISKDAARNQVFLRITSVDTADTATYYCVRRAHTTVLGDWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSGLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IgG2a Fab fragment Heavy Chain
publication title Molecular basis for passive immunotherapy of Alzheimer's disease
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iptH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iptH02
2B5IB 3FFDA 3MOBH 5B39A 1YDPB 1Z5LB 4GKZA 3IETA 4XVSH 1RV6X 4GQ9H 2UZIL 4DN4L 2OK0H 1EAJA 1FFRA 3HC3L 1DLHB 1S7WA 3C8KA 4PRNA 2QQQA 4G42A 1YEEH 3MODH 2APBA 2E9JA 4TRPH 1CL7L 4HC1H 4L8DA 4UTAH 1EA9C 1BFVL 3RRQA 4P46A 1M05B 5I15H 4PJEF 3JWNC 1WTGT 4H88L 2YMXL 2GJ6D 4TQEH 3B9EA 3RBSA 4WNQA 2AJXL 1MCIA 2QSCH 4M61B 2DMCA 3S37H 5I8KL 4HEME 5AD0A 4U1LA 5FYJE 1T5XB 4LVOB 1ZHNB 4TSAH 1MY7A 1U8IA 5KSBA 5GJSL 1IAIH 1V3KA 2FX7L 4YBHA 3TV3H 3ZL4H 4HUKB 2FO4A 3NMEA 4P49A 3MSPA 3NACL 5CIPB 5I18H 3QUXA 4PJ8D 3OKEB 4PRPA 1U91B 1M6OA 3IDNB 4CN1A 2LAGB 2ADJA 1UZ8A 2AQ3A 1IVLA 3D85A 5I9QB 1DEEA 2B4CH 2QADD 4RIRB 1DE4A 3MRRA 3CJJA 2GAZA 3SE8H 1FO0L 5FYJD 4S1SL 4M8QB 2YD2A 1V3MA 5DD5H 1X5HA 3LKSA 4F2MA 4U3CA 1KIQA 5JQ6H 4MCYA 3UAJD 2EEDA 5I16B 5KSAA 1FZMA 1JZ5A 1GVIA 2JJWA 4GG8B 4HGWA 4KRPB 3MLRL 4L4VB 3R8QA 4Y4KD 2OL3H 1U93A 3SGEH 1P5VA 3GMMB 1IAIM 3TJEH 3MYJB 4QRQA 4WI6A 3SDCD 2R9HD 3PL6D 3FO9B 1A7RL 1PGRB 3ARFD 1F42A 3G6DH 3ZT5A 4PGBB 1DUYA 5FHAL 4LEOA 3S4SB 4Q6IA 2HRLA 2CRZA 3KYAA 4OQ1A 2ADGA 3DVIA 3MNVA 5CEYB 4RBPK 4NCDA 4AY0A 1IGTB 1RZ7L 4KGJA 4S2SB 3HZVB 3V4UH 3RVVD 4UDTA 3E2HB 4QXUH 4WW1A 3BEWA 1RK0A 3O6FA 2KKQA 5BV7H 1KTDB 4I0KA 2B4CC 4OZGA 2Q7NA 3W9DA 3AS0A 1FYTA 4YO0B 4XNQA 1D5XA 4F33A 5D7JC 2VDML 4RCAA 4PY7B 2A6KA 2F5AL 1FSKC 5MHSE 1CFQB 3F7PC 1RURL 4YGVB 3EHBC 2VL4A 4N0UE 3BH9A 2IPUK 4X6FA 3SEPA 1OGAB 1QACA 5SWSE 5I1HH 4NWTL 5CHNB 3V79C 5DYOA 4LCYB 4W4OA 2V2XA 4K94L 4KROC 4F15B 2D0FA 5C0IA 3F8UB 5BRZE 5C92A 3CFEA 1S9XB 3TN0D 3MFFB 1TQCB 2H2PC 1UEYA 2DD8H 3GJFH 1ZHLB 1ZSDB 1IKFH 2B1HL 3PGCB 1ACZA 4Z0XB 4JCLA 1QHOA 2V9RA 1CGSL 4LSQH 3QJHA 4F7PB 5J1AA 3MRIA 1GGIH 1E0OB 4KJYA 1T1ZB 3KPMB 4NO3A 4XCCL 4ZUUA 4DGVH 1HCVA 4UIKL 3QFJE 4DOHB 4NQDB 1A47A 2BNUA 5DRZA 5MHSD 4R0LB 3ZT6A 1C08A 3W81A 2XN9A 2JIXD 3TFKD 3O9WA 4XNZC 5B21A 5FV1L 4HK3J 5F3BA 3B8YA 5SWSD 1FNAA 5BV7C 1EZVX 3WE6B 2V6HA 4X9GA 3V4VH 4W6YB 5BRZD 4ZPVB 3RGVA 4GMTL 1WQVT 2HKHL 2FH6A 5D1ZA 1CF8H 4XHJC 4JN1H 4F8TA 2XA8L 4XNYH 4ZFOB 5KAQF 1YY9C 4D0BB 2MOVA 4FXKA 5CSBA 1JGVH 4OZFH 3JWDH 4UAOC 3CFCL 3WL9A 4S10A 4BZ1H 4CU7A 4KVCH 3QFJD 3ROLB 1C5DB 3T2OA 1V8HA 3FB6A 4JPIB 1FVDA 4OGYL 4X4MA 1BECA 3VFSA 1G9NL 3SKUD 3L3HA 5ACZB 4JRXA 1RJYA 2AXFB 5DHYB 1CD1A 2BSSA 4U6TA 3KPRE 4MA1B 2AEWA 3MV7B 5CINH 5C0BB 1RIVL 1BQHA 1FGNH 2O5XH 2Q8AH 1N2RA 1EHLL 2CK0H 4XVUD 4PB9H 1UM4H 1P9MA 2VABA 2FATL 3GK8H 4KUCF 5C6WH 4ZO6A 3DRTA 1EEQA 4NFDA 4EQ3A 5A2FA 3CSYB 1ERNA 5HPOA 1NFDB 1BFOB 3P4NA 2GJ6A 1D6EA 1CT8B 4PV8B 3GKWH 3G5XB 3I75A 4XMPL 1QSFE 4LNRB 3RTQC 3L95A 4NUGH 5TGBA 1FJ1A 2NLJB 1S7XA 4KH2A 4OZIF 5MERA 1J1OH 1CLYL 4QY8A 3EOTL 4GBXD 3B9VA 3KG5A 4DGIH 5DSCA 5GGRY 1IARB 2NY5C 5CKGA 4JJ5B 4HAFA 3KPRD 5ANME 3ET9F 4KTYA 1KXTB 5IMKA 1CDCA 4WDIB 4WU5B 2J4WH 4NM8H 1I9RL 1S8DA 3C8HA 3BEVB 2R23B 3AUVA 4NQVA 5D71L 5GHWH 1WZMA 2FHFA 2DI9A 5FCUL 4UT9H 3WHE1 2YUZA 3MRLB 3TIDA 2ADFH 2AK1H 2AI0L 3MROA 1EDQA 4OGXH 1A21A 3ULUH 1KCSH 1QSFD 4EUPB 4PJXB 3UTOA 4JHZA 4XBPA 4CGTA 4JRYB 3LQAC 2MKWA 3BZ4B 3HS0B 5DJYB 3N1MC 1H3VA 5E70A 2BVPB 1LO5A 4FQXD 2NZ9C 5DRXA 1YECH 4ZOBA 3K2MC 4Y4KA 4DFHA 1YEGH 1N5YL 5JW5B 1J1XL 3PGDA 4M5ZL 3G6AA 2W65A 1ZWIA 2EC9T 1HYSD 3SDCA 5EU6E 1NKOA 3PL6A 3RGHA 4KQ4L 5DLMH 3ARFA 4H25B 1WLHA 3F58L 3TNMA 5E1AB 5CIPH 4HWEH 4XI5D 4OM0H 4YWGL 1DQJB 1K2DB 2HLAA 2A83B 4RAVB 1RZKC 2YPLB 5I8CA 1A0QH 4NM4L 5FA3A 4RFOH 1Q72L 4PREA 3IJHA 4JZNB 5BMFH 2KZWA 4M3JA 3CFDA 1FZKB 3OXSA 3HNSH 1IGJB 1ZTXL 5EU6D 4NQEE 4LDEB 1OPGL 1QRNE 1WFUA 1RUPH 5EWIH 2G5BB 3MTRA 1JHTB 3OGCB 1HHGA 4G8EA 4E9LA 5KVFH 1HQRA 4CVXA 3RA7H 4R2GB 2Z8VC 2AJYL 5I73B 3OJDA 3Q6FA 4JANA 1YN7A 2LABA 4Q97A 4BQCA 4WJ5B 4QOKE 2XPGA 2VDPH 4ERSL 3WLWD 3OV6A 2DJUA 3PWNA 3TN0A 4G7YH 3DO3A 3UTZA 4BM7A 4EJ1C 4XNXL 2BXZA 5BCAA 4ORZC 1UZ6E 1DQQB 2WIIB 1HINL 2YKLL 1I8KB 3VXTA 3UP1A 4NQED 3PDOB 1QRND 3B3IB 3QCTH 5C3LD 1TQBB 2BCKB 2BDNH 4NBYB 4DFIA 1CGTA 1MHHA 3QIWC 5C0AE 2XRAL 4DW2L 5J0BA 3S35H 3SDAC 3VD3A 3KPTA 5SWSA 4QOKD 4ZUWA 2HWZH 1NBVH 3VFRA 4P3DB 4LARH 1XCTA 3KYKH 5BRZA 1NCAH 3C6SB 3BIKB 2YRZA 1A7QH 1CU4L 4KRPC 4LEXL 3BQUD 3UC0L 4NQSA 2FBJH 1ORSA 4PJCB 2ZUUA 1D3CA 2VQUA 5JXAL 4M7JH 5C3TA 1UCBL 4PJHE 3QZWG 4U1GB 2LV4A 1MJ8L 3NIFE 5EFIA 4I2XE 3QFJA 2X41A 1I9IL 4HJGB 5GS1C 1S5HB 1OAKL 5C0AD 2WV3A 1BVLB 1JNLL 4KTDH 4XXCA 3TO4C 4M7KL 2H9GA 1T7ZA 3WS3A 1J87A 1WC7A 4OGZA 2H41A 3DWTA 4PGEA 3DOSA 2VR4A 5DFVD 1SJXA 4Y5YC 5IT2L 3WJJA 1TJIH 5SV4A 3ZE0E 4O58H 4U31A 3Q3GA 4D94A 1CFBA 1H8NA 1RHHA 2W9LA 3KVQA 2IBGA 3GHBL 4F57H 4P57B 4MQXC 4J8RA 4RBPH 1K5NB 3S3JA 4NN5B 5I8EB 1NGWB 1S9KC 4P9HL 3MOAH 4EDXB 4EVNB 2PCPA 4QRPE 4ZFGL 1HOCB 2IFFH 5CBAB 4GBXA 3VRIA 4DZ8B 4NWUH 5TE6H 1G6RL 3EYOB 4R3SA 3O2WL 4YFLI 3KPRA 1KFAH 1A9EB 3JWOH 4LCUB 1BZQK 3HE7C 3PWVB 1T83C 3MXVH 4H8WC 3ES6A 3W5MA 4Z7OE 1ZANL 1FNSL 4U6HA 4O2CB 1JGDA 1CCZA 1PX3A 2ICEA 4PBWD 1IJ9A 5FA4B 1MELA 3SE4A 1J5OH 3KLSA 1VFAA 2CO7B 3L1OL 5L6YL 1QSFA 3QP3A 1F8TL 4S1DD 1E4XH 2RFXB 3RDTC 1NMBL 4M1GL 2EEBA 1XGTA 3U46B 3VI3E 4QRPD 5HHOB 5I8OH 1FFPA 4X6DB 4RAUB 1IGIH 4FQXA 1R3KB 4PGDA 2YRPA 5ANMA 2X4TA 1OW0A 1A6WH 1FL3B 3BHBA 4P3CH 3OHXB 5BQ7B 4Q9BA 5HDBE 3ZDYE 4XTRC 5BW7C 3C6LD 1MSPA 5I1AB 4LFHD 3PNWA 5FUZH 5TPWL 4Z6AT 3SKMB 1PY9A 3BPLB 3EO1B 5IB3A 4KC3B 1X5JA 4RFEB 2X4OA 1BZ9B 2WLZA 3SY0A 4I18B 5EU3B 4H26B 2JELL 4QXGL 1L6ZA 1D7FA 3WMSA 5L2KD 2P8PA 4O51A 4I0PD 4P48A 1T80A 1VFBA 3BW9A 4FQJL 4LQFH 4KHXH 2R4RH 4EUPH 5EBMA 3INUL 3T4AB 1F58H 1E4XI 1IGML 3DV4A 3O0RL 3DX9B 3B5HA 4UB0L 4G8GB 5EU6A 4K07A 4LPWA 3X13A 4KK5D 2ZUSA 5E8NA 4N8VB 4Y16C 1MCDA 1KTRL 2R29L 3RZCD 3O2VH 5I1CH 2IALA 2ZCKH 2VERN 2FX9H 3L3KA 2VISB 4G6JH 5CEZE 4FFYH 5L2KB 1U8JA 3UJJL 3WIFB 4JY6A 3FN0L 4KDTC 4S1QL 3UJTL 3W0WB 4KK9D 5HGAB 3T08A 4N0RA 3MXWH 4XP1H 1U8LB 4RGMB 1VERA 4B7IA 4OZFG 2EIEA 3PWUA 3P9LB 5ID0B 4JFDE 4X7DC 3QDGE 4LLUB 3Q5OA 1EGJH 1HWHB 1KJ2B 3DUHA 4NQEA 4XCEA 3ZKNC 4GRWE 1QRNA 4UV7L 5MP6H 1YYLH 5F70A 1RZJC 3BO8A 5J3HD 5CEZD 4A6YL 3C60C 3CXHK 1F11B 4BK4A 3U9PL 4G5ZL 3X3FL 4K2UL 4X5LA 4BFEA 4NBZB 2AJUL 3DXAE 4QOKA 4ESKA 1IC1A 4U1KB 3CLEL 4GT7A 5AWNH 4JFXB 1KEGL 2HN7B 3LRSB 3MBEB 1QFWH 2OSLB 1INDL 2BHUA 3Q6GL 3K8KA 4DKEH 5DJXB 3BQUA 4JFDD 3QDGD 1E4KC 3KPPA 5L9DL 3KYOB 1U8QA 3ILPB 5JTWA 1KUMA 5E5MB 1KJMA 3DSFH 3QWOA 4WTZG 1DBML 5JHDB 4OLXH 4X7TA 5C0DA 4EN3C 5JW4N 4MD5B 3A67L 3HPLA 4YBLC 4MA8L 3FJTA 1A6VL 2DJ4A 4UNVA 1AO7E 2NY0C 5IHZB 4DN3H 2DYPD 1YNLL 3NGBC 5DQDH 3BKJH 4WHTA 5J6HB 4O2EB 2ED9A 2P24A 1LVEA 4QHLB 3AAZB 2CQVA 3DXAD 4GAGL 1SYSA 2HT3C 4ODSL 2IC2A 1QUNA 1N5AB 1GCFA 1BLNB 4OF6A 2NQCA 4JQVA 2Y5TB 1QFWM 4PR5B 3QHZH 2VLJE 2X4QB 3WD5H 4U7SA 1N3NA 3WHXB 1FNFA 3FTGA 3OAZH 1U9KA 2C4XA 2PTVA 4PJHA 2PXYB 1QFWI 1CFSA 3HZKA 1I1FB 4PTTA 3QFDA 5AZ2L 2ENSA 3SQOH 3MV8B 5E2VL 1C5CH 5DURD 5IG7B 5GRYA 3MBXL 3OAUL 5HHXL 25C8H 1BJ1H 1AO7D 2DLFH 4FZ8L 5EIIA 3LKRA 4JAMB 1TVBA 2E9IA 4LLDA 4DTGH 4FOMA 4NKMB 4X7SH 4PJAF 2EKSB 3QUZD 4M5YH 1HKFA 5C7XL 4M43H 3CFJA 2YD4A 2J8UF 3MCLH 5IGXL 1DZBA 4NPYA 3HFMH 2VLJD 1CFTA 2FZ3A 2AAVA 3BRFA 2GHWB 5HI4C 1YEIH 3FO1B 3JV0A 3N9GH 5GSVA 1TCRB 2PTUA 3GSUB 5JW3L 4KPHH 5T1LB 2PKDA 3P4MA 4OZHB 5T3ZL 1B0RA 4BH7B 5DHXB 4HS6A 1H15A 5IBUB 2LE9A 2AXHA 4QRPA 2FJHB 2GSGB 1DBBL 2GI7A 2VDOH 3QIUB 3GBMH 2Y07L 4R4FH 1GOGA 5LQBL 1NSNH 2J8OA 1JI1A 1BIHA 4WHDA 1N59B 2DQUH 4JFQA 1GZPA 4J3SA 3C6LA 3LIZL 4Y8AA 3GSVA 4AEIH 4JFEE 1PSKL 2EH8H 2F15A 3SDYH 1T2QH 3VRLE 5GJTL 2OX5A 2FHCA 3T8XB 4IRSB 3S4SG 3RVTD 3CSBA 1BQUA 1JTTA 1FO0A 2K7QA 5LBSH 4OLVH 4HV8B 1G9ML 3DARA 1S7UB 2V7HB 5DJ8B 3BDXA 4I0PA 3G6JB 2HVKB 1CDUA 3WUWG 1X44A 3FT4B 4JO3L 2VAJA 3BN9D 5T5NF 4OFYD 4F7CA 2B0SH 3MRCB 4QHKI 1Z9MA 4TULL 1WIOA 4YEFA 4RAHA 2BY3A 3LZFL 4JFED 4KY1L 2XZCH 1TCMA 4GLRH 3RZCA 4XP4H 2F19H 4OFIA 1NFIA 5KG9B 1AR1C 4Y0GA 1OAXH 3F6IA 5TQ0H 3ZE1E 2L7JA 3I02A 1A3LL 3B2VL 3VGBA 3WFEH 3K8MA 1VENA 3IKCB 4CADB 3THMH 1FNGA 4WI9A 1OB1A 4L4TE 1UM5L 1J88A 3MR9B 4KJPC 1I1CA 4JFEB 2GUOB 2XICA 1H0DB 2IF7A 5F7DB 4ZYKA 3MRKA 1LO2L 1KELH 3T65B 3CFKB 4OUUA 1AXTL 2E6JA 4G80A 1JN6B 1INEH 2VO5A 5FUOL 1JWMA 2FD6L 4YFLF 1DUZA 4L5FL 4GLRI 1BVKB 4FP8L 1J7VR 3DURA 1QLFB 5AAWA 3QQ3A 3BP7B 4ZTPL 2A77L 2VH5H 1QLRA 3OKOA 4L4TD 2DWEB 4PGJA 1T1WB 4Y1AE 3WLBA 5C0NC 3T0DA 4E41B 1S9YA 3FT2B 1RJZB 3RZWA 3LEVL 4JFDA 5IW3A 2IWGA 4UNTA 2H3NA 4X6CA 2DM2A 3OGOE 3ZDXF 3G08B 1P7KA 1A6UH 3QDHA 3IF1A 1AGDB 2Z31B 3IGAA 4XX1G 4ZUSA 3KYMA 4XVTH 2H2SD 4XAWL 5B39B 2C1OB 1KJ2H 2YN5A 4JFFB 1T0NA 2DYPA 4MHHG 5JXEC 4I18C 5D2LE 2CLZB 1KCVL 1E28B 4GQ9L 1R5WB 1UM6L 3DXAA 4OCXH 1F2XK 3SPVB 3WNMA 2LTQB 2OK0L 5DUBB 3C8KB 3UTSE 4C4KT 1WGOA 3GGWB 3BT2H 4Y1AD 4YR6B 3WJLC 4OD2B 3MOQA 1CXLA 1MRCL 1T66C 2A9NH 2NW2B 3QPQD 4NDMB 4IOFC 2WWMD 4GFTB 4ZSOE 5JA8B 4UTAL 4YHNB 1WT5A 4Z78A 1SYVB 1EHNA 1HXMA 4JB9L 1SEQH 5I15L 4HS8L 1HHKA 4HAGA 5EZIH 5ELIA 1IKNA 5HVGB 3GBLA 5KVMC 5F8QC 1BJ8A 3MCG1 1AIFB 4WUUE 1AO7A 5IFHH 1NFDF 1MI5E 1Q0YH 1UYWL 2NY2C 4YE4H 2VMFA 3MO1A 4MMZC 3N06B 4U1HA 4WFFD 5D1XB 4RGMC 3UTSD 3Q48A 4X4XB 2WUBL 1A6TA 4JHAH 3ZL4L 1ZHBB 2FECL 4LAJH 1A1NA 2MNUA 3CSPA 5I18L 3U7WH 4D3CL 4PRPB 4ODUA 1KB9K 5IBLC 5INCA 2HYMA 2P47B 3QXAA 4X7FC 1G7QB 1D9KD 2ADJB 3V6OE 4U6VH 5BZDA 1TITA 5EA0H 2Q76A 4C54A 5IROC 4Y19E 5ADOH 5FEBA 3LV3B 3MGOB 1CBVL 3BGMA 3W2DH 2EXYD 4WUUD 5D2NC 2ED7A 4EUPG 1RSFA 4PRIE 4ZS6C 1CLZH 2JCCE 4RRPG 1MI5D 4HCRA 4JFZH 4HEPG 3FONA 5EDXA 2BRQA 2NXYD 3FCTB 1W72L 2R1YB 1ACYH 4PJXF 4BH8B 5DD5L 5TH2A 1KIQB 3MRGA 4WCYH 5F9OL 5KSAB 3IDGB 4NKIL 1K4CA 5FAAA 1JV5A 4TTDD 4FN0A 3T1WA 4KU1A 3GMQB 5KZCB 5D6CA 1C16B 2AK4E 3JTSA 3TT1L 1DFBL 4YDLC 2VZ1A 1SBSL 5J06A 3LKQB 3GIVA 4LF3A 1G9EA 3MJ7B 4Y19D 3GSXB 1QSZA 4Q6IB 4OCNC 2P5EB 4HH9B 2ZSWA 2X4UA 5EU5B 4Y2DD 3ARDD 5IMLB 4FRWA 5HHQB 1R3HA 4GUPB 3DX7A 3EIFA 1T20A 4OI8A 4Y5VA 3BD5A 3HB3C 3AB0B 1CK0L 3PWJA 4OFYA 4WW1B 5EU7C 3BEWB 5F1SA 4JQIH 1QYGH 5BV7L 3SCMB 3BAEH 3EJJX 2AK4D 3VWJC 1FYTB 4YQXL 4XNQB 1D5XB 3GMLA 1A7PL 2MTPA 3K0WA 4TVSa 4XCNB 1J0KA 2BVOA 4OCRH 3GRWH 3I6KA 2F74B 1WWBX 1L4IA 3MRJA 2CUHA 4N8CL 1NL0L 4LHUD 3CIQA 3EKCA 3H8NA 4LSPL 4LLWB 1CZ8H 1KN4L 2FX8H 3RWDB 2V9TA 5DYOB 1UACL 2BNRB 3CFEB 2HTKC 4KZDH 4PJ5E 1NEUA 5EBWB 5DC9B 15C8H 2QR0A 1IKFL 3VGHA 3D87B 4OLZH 1U58A 1G7LA 5L88H 1HSAA 4HZAA 2FEEI 1U92B 1I7TA 4KJYB 3N50A 1FH5L 1VACA 3DVNB 1XZ0B 1MFAL 4LSTH 1MCRA 3MJ9L 3CK0H 4GRMA 5T1MB 5J57B 4JKWA 4ONGH 4LSUH 3CAFA 5DRZB 2J12B 4YK4B 5IW6A 3DHJA 1MH5B 2XN9B 4HIIB 3O9WB 1B4JL 3WXWL 2A1WL 2W0KA 4KI5E 1FPTH 4HUMB 1YN6B 1A7NL 4TUOA 1WBYA 4KK8D 4DCQA 4MXVE 4L4TA 1EO5A 2DLGA 3RGVB 2IJ0C 4PJ5D 4C56E 5D1ZB 3QT2A 3RHWK 4K3DL 1DBKL 2A9ML 3FO0L 5IBTL 3TVMA 4JN1L 4OD1H 4P9ML 2MHAA 1MNUL 5J6GA 4NO2A 2V5RA 2C1PA 5ENWB 1ETZB 2NY5L 1WBZB 3L7FA 4PJGF 4U6XB 1TXKA 1GZQA 4UBDD 5D5MA 2DS4A 3QWRA 1Y6NR 4FQ1L 2VXTH 4IJ3C 1U8NB 3ROOA 4QRSB 1HKLH 2DTML 4GOSA 5FM8A 3I6GB 1AGCB 4KI5D 1LO4H 3L5WA 2VQ1B 4JRXB 3C5ZA 4X0KA 2Z8RA 2CIIB 4KFZC 3IS0X 4Y1AA 5E6IC 2AJZA 5FYKE 5FM4A 1BQHB 4I1NB 4C56D 1CDYA 5CINL 5EZOH 4XPBH 5E8DL 3LQAL 2E27H 3NCEB 3RWCA 4XPHH 4LOUC 2PYFA 2VDNH 2P8MA 2Z4QA 3X14B 1X7QB 3QB7C 1ZGLA 3OQ3B 4R4ND 4OF3A 3MUGA 4HJJL 3PP3H 1P4LB 3VFVA 3TA3C 5D2LA 3L95B 3KPLA 5B8CB 3WDJA 4NUGL 2DWDB 3P3YA 4FA8A 1MCNA 3EYQC 3T2NL 4C56B 4KUZL 5EOCH 4ENEC 1C7TA 3QJFA 1YY8A 5MEOA 2CH8A 5DC4B 3TCLB 5FYKD 1RZKL 4QRRE 4NJ9H 2JE8A 1MFBH 3MPCA 4HUNB 4JHWL 4ZSOA 3RUGE 1D9KA 2VL5A 1OF2A 1BWWA 4OLWL 1RIUH 5F1IA 1XIWC 1B90A 1T89A 3ZYJA 5BVJB 1O7SA 4HF5H 1U8OB 4WUUA 4AL8H 1AD9B 4OF5A 1MI5A 2FGZA 3ARED 4WO4A 1BIIB 2VLRB 4EZMA 5KVEL 4JO4H 2OR7A 2VWEE 5CZVH 2RBLA 4Q2ZB 2VLKE 3GSNL 4KHTH 1NCWH 3PGDB 5C0CE 3RFZC 4QRRD 3G6AB 5IFJA 3FO2B 4X6DF 4CUCA 3E0GA 4N1CA 4H1LA 4RGNE 3C08L 2VITB 4ELKB 3L3DB 1GGTA 4M6ML 4FABL 3WXVH 5HVHB 2GSIA 3V6OA 2CXKA 5IVXB 3TNMB 2LVCA 5DJCB 5ESAA 2HVJB 4Y19A 3KHOA 3QXTA 5EO9A 3NAAH 4L3EE 4OM0L 4PJIB 4LSRH 4XB8A 4PRIA 4PJFA 2ATKB 2JCCA 2JLLA 4M02A 4Y2DA 4U05A 3ARDA 2G5RA 5IEHB 3IJHB 4U2ZA 1X5AA 4L9LA 5F44A 4WI3A 1RK1B 2OCFD 4KAQH 5KVDH 4F7MA 1XGRA 5JORA 3KPSB 2RR3A 2VLKD 4HMCA 5HYSB 4ETQB 2GCYB 5CAYB 4XT1C 1PZ5B 4HUVA 5C9KA 2NY1B 4N8VG 2PTTA 4P46C 4YHLL 1RUPL 1IGYB 4LGRB 1WAAE 1DQLL 1OTSC 1AP2B 2JK5A 1OLLA 2DKUA 4L3ED 2B2XL 1HI6A 3L5IA 4OFVA 3QSKB 4ZOEA 2JJSA 3Q6FB 4LHUA 2D3VA 3QHFH 1MWAL 3WIHL 3A6OA 2XPGB 3N85H 1FFNB 2CMRH 4XPGL 4ZG1A 3K2UL 4M7ZC 2Q3AA 2QJDA 4HKJA 1YYMH 4OCYH 4Q6YA 3IDUA 3QUXC 4ZAKD 4I9WD 5HJ3B 1GOFA 1U3HA 4L3EB 4RSVA 1A8JH 1CDGA 2Q8BH 1F3DJ 5DFTA 4F7TB 5C1MB 5JLZA 1P84K 3ORJA 4OTXH 4MJ6A 1VFOA 4OFDA 5I17A 1EEZB 4M62H 1AXIB 2NY6C 3H9HB 3QQ9C 1B3JA 1E4WH 1F45A 1SM3L 5DZOA 1QHPA 4MMXC 5SWQA 1XCQA 4KMTH 1UVQA 3VFRB 4G8FA 2XZAL 5CLTA 4HQQL 1SJHB 5FDWB 5KSAC 2FIKA 4PJ5A 5BZWA 3TYFA 1KXVC 3BPOC 1KPUA 2AS5M 3KS0H 3VXUD 3D3VE 3UTTE 4NQSB 5ID1A 3P9MA 1XGQB 3GIZL 1UB6B 4NZTH 3QEQE 4XPFL 1NLDH 4RFNB 4JM2B 4CVWA 1ORQA 4UU9B 1N0XL 1BEYH 3DV6A 4LCIL 5HHME 4Q6IC 4H8WL 1JFQH 4MS8C 5F7YC 3CU1A 2EDNA 2BOBA 1F02I 4Z18A 4ONFH 2PR4L 2DRUA 1A4KA 1S9VA 2FWOA 3WS3B 5AG8A 3O45A 4WI5A 1ZK9A 2HRPH 3GMNA 4WFGD 3U4BH 4AQ1B 3GMRA 2VN4A 3ALPA 3VXUB 4RGOL 1JPFA 3QI9A 4IRJD 4PPTA 1LP9E 5B38B 1N64H 3QYCA 4PGEB 4YHIA 5F8RC 1FGVL 4ZD3H 2YBRB 3DJ9A 1PG7W 5I30H 3O6FC 3D3VD 3FOMA 3UTTD 3ZE2E 1CD9B 1XT5A 1UJ3A 5GS0C 5F7MC 5HYIA 1F13A 3QEQD 4PIRF 1NMCB 1S7VA 1UENA 1BQLL 2IQAA 5HHMD 3IFOA 3FMGL 4ZFOL 5GGSA 6FABH 3DIFA 1NMAH 2PCPB 4P5TD 2LAAA 2ZNWA 4GMSH 4W4OC 3TP4A 4FFWC 4OFPA 1LNUB 4N0CD 3OR7B 5JW4R 3HNTH 1T2XA 2XTJE 5L2JA 35C8H 4M48L 3NFPB 4JLRA 4NQXA 3ES6B 2CDFB 4BZ2L 3M07A 4DVRH 3PXJA 4OCWH 1H5BB 3EDDA 1F3JA 3ULVD 4G8IA 1JGDB 5DQJA 43CAB 3U2SB 3PV6A 1LEIA 2OP4H 4QXTB 1QBLL 3RP1A 1FFQA 3ZYOA 1A1MB 3DPBA 1J5OL 2F58H 5ACMA 4GG6B 3MGTB 4YK4C 5IK3B 2EZ0D 5EZLA 2JJUA 3OKDB 4U3XA 5K33A 3AREA 4RA3A 5IBUG 3O9WC 3X11B 3TH2T 3PV7A 4OZHF 2HT4C 3A6BL 3BI9X 4AK1A 1CGVA 3VD4A 4HFUH 2X5PA 4RZCA 2IPTL 4JY5L 4BZYA 3BZEB 4PGDB 3RGVC 3R4DA 5D1ZC 4QRRA 2XTJD 5JOEA 1U95B 3QUMA 5ISZE 3FT3B 3CXDL 3L3OB 2RB8A 3BGFB 5KSVB 2BHYA 1MJUH 3F7VA 3RUGA 3HG1D 3OPZL 5CD5D 4OI9A 5ERWB 3RL1A 1J1PH 1IM9D 5IB3B 5E8OB 1UADC 4JPVL 3DO7A 1EPFA 1MRFL 1NH6A 3M1BB 3GSWA 1RFDL 4NZUL 4QT5A 3CX5K 1S5IL 1OWRM 2Y4SA 1RZJL 2XTJB 3QUYA 4DK3A 4F7EB 3WFBH 1S7RA 2DQDH 2I9TA 4Y4HD 3T4YB 5E7BA 3HG1B 4U1NA 1Q8MA 1TVHA 3HLAB 3JUYA 5C0CA 4LSVH 5ISZD 2X05A 2OTWA 1P9MC 1U42A 5E8NB 3TBTA 4MYWB 3DMMD 1GYAA 3PDGA 2F8OA 1VDGA 5EUOF 4OI7A 4XRCB 1QVOA 1MQKL 2ZCKL 3IDIA 5IHUH 3T0EE 2BSRB 1JPTL 3C5JA 3LEXA 3MRMB 4UDUB 3O4LE 4R90H 1QD0A 4UT6H 3BE1H 2ZUTA 5TF1L 3QXDB 4NO0D 1DEDA 5CJQH 5J9PA 4IHOB 2W92A 3BISA 4PRAA 2ZZUT 1SJEA 4YX2H 4TSBL 4NJAH 2BMKA 3BKYL 3O41A 3RIAK 5ICYA 5D9SB 3UDWA 5DRWA 3V52H 4OAWB 4MX7B 2XACC 2WINA 4FQQB 4Z0BL 4ZAKA 1EGJL 4XCEB 1AGEB 2DQTH 2YA0A 3LKPA 4U1SB 4ZODA 3E6HB 2FJGB 5AG9A 3U4AA 3VWKB 2BOCA 3T0ED 3VMNA 1WAAA 4WI2A 3B8SA 2HKFL 3BO8B 4NRYB 2PF6A 3O4LD 2QADC 2VIRA 4PB0H 1J18A 2GITB 3EYSL 3H9SE 1AQKL 4JFOB 3T0AA 1I9JH 4YC2B 5C0FB 1XF3A 5EUKA 1YEKH 3VXME 3R1GL 3U1SL 1MCLA 2JKXA 4OZ4A 5D8JH 2Z35A 1KCRL 1MEXH 4ETYA 4Y4KC 1FC1A 3MLXH 3SDCC 3KPPB 2P8LA 3DX6B 3PL6C 3UBXB 5INDB 1KJMB 1BD2B 2WAHA 1JZ2A 3BP5B 1LE5B 3ARFC 5C0DB 2YSSB 1RU9H 3ZKXC 2EDXA 3B9DA 5I1IL 4JKPL 3F12B 5JIIA 4Q0XH 12E8H 1BX2B 3IU3B 4DN3L 1V05A 2YN3A 3B2UD 3HUJF 5GGVY 1NCCL 2D0GA 5ESVA 5D1QD 3H9SD 1BOGA 2B1AL 1NANH 4QNPF 5KANI 3JV6A 3UYRL 1JWSA 3O3AA 3VXMD 4X5WB 2A74A 2E9BA 4DZBA 3P11H 3UZVB 4MA7L 1JVKA 1U6AH 4K3EL 2IAMA 4DQOH 3I3EA 3D3VA 3UTTA 2H26A 1KT2A 3QHZL 1GPOL 4WI4A 2IPKA 3BZFA 1KB5A 1JPSH 3QEQA 4KVNH 1IC5H 3HZKB 1I75A 4CN6A 1Q9KA 1I4FA 1QR1B 1IEHA 4K71C 1C5CL 2DQCL 2YD5A 4HG4J 3OKNB 4J1UB 1LDPL 3GB7B 5HYJB 4MAYB 3MLZH 1G7MB 4BFGA 2C3HA 25C8L 3LKRB 2DLFL 4PJ9B 3PQYB 3ZDZE 2UV3A 4E0RA 3GSOA 4P5TA 2HTLD 5F6HJ 1YPZE 5CMAA 2ZUQB 3S34H 4Y5XA 5JPNA 4M5YL 5ICZA 4QHMA 1LP9A 3TN0C 1RUAH 3I3BA 3MJGX 4AIXA 4YFDB 4P4KD 5KSBF 4K8RC 4XCYB 3U36B 1NANI 4GRLD 4HWNA 2P42B 4RMVA 3O2DA 1GIGH 4NKDA 3P0VL 3T3PF 3D0VA 1MOEA 3LS4H 4UQ3B 2EDFA 5LGKA 5ITFB 2Q87A 3P4MB 1E6OH 4D9LL 4FZEL 5IM7A 3TFKC 1CDIA 1MJJA 4NGHL 4R26H 4WY7L 3SBWA 3VD7A 4YBQD 5A3ID 3P30H 5LVEA 4W6XB 3H0TA 3MLTB 4GRLB 5SX4H 2MFNA 3ARUA 2VXVH 2X4RB 3VFTA 4G6KL 1VGEL 1T03L 1LE9A 1QNZH 5TDPA 3NFSH 4OF7A 2JJTA 1PG7H 1IM9A 3W11D 1NGPL 5GGUA 1A64A 2IG2L 3BWAB 4YXLL 5BXFA 1FO0B 2BVYA 3MRBA 2DDQH 5DR5L 4CVZA 1ZT1B 2ZCHH 2VB5A 1N0LA 3PP4H 2X70B 4XXCC 1FQ9C 4E5XB 4XC3H 4ZXBB 1PYWB 3SJVE 4JG0H 3KXFA 3TWCL 5B4MD 2XFXA 1RI8A 1WITA 4Y4HA 5J8OA 3KDMB 1I3GL 4ELME 1MUJB 1JUFA 3ARXA 4HK3N 3BH8B 4F7CB 3CDGB 4OSUL 1IEAA 5ISZA 3WJJC 4GW4A 4XVUC 1ZVSA 5JMRA 1ZT4B 2OYPA 3QH3B 1OGTB 4H5SA 4YPGA 2Q20A 3RJQB 1HHHB 5K9QG 4WWKD 3ULVH 4RQQA 4OFKA 4OZGF 2OXGA 5SX4I 4HIXH 1KTLB 2I25N 2ZG1A 3TBSA 3ELAT 3IDJA 4LSSH 3V0VB 4NO0A 4ZQKA 1KPRB 3SKNA 1DANU 2R69H 3SJVD 3WFEL 1XH3A 4GBXC 2A38A 1JMXA 3MV01 1NGYA 5C2UB 5DVKA 1JZ7A 1NDMB 2FSEA 5I76B 1JZ6A 5MEPA 3MLYL 1FIGL 1BM3L 3U7YH 2HJLB 5TJWK 3JV4A 4G6MH 1A5FH 2DAVA 4TVPL 1G0DA 1KELL 3RWEB 4XVJL 1DDHB 2AJ3A 5KS9A 1CLCA 5T3XH 4Q9QL 3CMOH 4G80B 1KLUA 1YMMB 5CLWA 2F54B 1JWMB 4K9EH 4R97C 4WVRA 3T0EA 1U2CA 1E6JH 1MAMH 2E6PA 1F6FB 4PV9A 3SO5A 1G7IA 3SE4C 4UT7H 4ODTL 3O4LA 3IDXH 4PY8I 3BMWA 3A6CH 3WKNA 5FYLH 3WIIL 4R4BA 1R3JA 3D69B 3NA9L 2AABH 2JB6B 3QUKA 4FQCL 5FM5O 3QRGH 3WKMH 2CPCA 3NCJH 1X5FA 2BJMH 2WP3O 5FOJA 4FQXC 1EMTH 3QDME 5CZKA 3QNXB 4M4PA 4Z7WB 3P0YL 1EAPB 3TZVD 1OW0C 4MJ5B 1AD0B 1HYSC 3EFDH 5DWUH 5I1DA 2VSDA 4X6CB 1FVEA 3AC0A 4P2OB 3MJ9A 1HH6A 2C4FU 1M71B 5E8EB 5GRJH 1NBQA 1P7KB 2BY2A 4AENB 1G84A 3IF1B 1T21A 4XI5C 3IJSA 2YUWA 2FLRT 4JN2A 1XGYH 2DQIH 3F65A 4D9RE 4M6OH 2G60H 2BFVL 3BN3B 3BP4A 2HJKB 3DUSB 3VRJA 1IQWH 2DIBA 4KI1A 3VXMA 1DVFD 4O9HH 1WK0A 4I3SH 4Z8FL 2DI7A 4NYLA 3QDMD 2P46B 1INQA 3L5XL 2D7TH 1XF5A 2IH3B 4UILH 3GM0A 4M7LT 1IL1A 1L7IL 1NC2D 3KR3H 4G3YH 4MCZB 1HXMB 1ADQA 5B3JE 1MREH 5GGTH 3GJEA 3C9NB 5FUCE 1NBZB 2C3VB 3FQWA 3T0WA 3QNYA 2HG5A 1MFCL 1MHEB 5EZIL 2R8SL 1CE6A 1TTGA 1H3WM 4D9RD 2ADIA 4YE4L 1MIEL 5IFAH 4IOSD 4NKOB 3B4NA 3WLWC 4AM0B 1A7OL 3WO4C 5C6TH 4X6EA 3ARGB 1T4KB 4HUXA 1FFOA 3V9FA 1NC2B 4P4KA 4YAQB 5E8PB 3QXAB 1FNEA 5IQ7L 3O4OB 1F6LL 1WWWX 5GRUL 5IEKA 2APFA 1KCKA 2Q76B 4K3GA 1XFPA 5LCVL 4PTUA 4I3RL 4KGLA 4MVBD 5I66A 5ALBH 3RHWF 2K3TA 2VLLB 1U8PB 5HHVH 1FAKT 3FONB 5JNYB 1FVCA 1YPZA 1QSEB 2D31A 5CJBA 2UZIH 4LP5A 3UBXI 4DN4H 3VMOA 2QKIB 3HC3H 3BQUC 2JTDA 1I1YB 1K85A 3WFHA 4PP1D 1Q94B 3IJYB 3GDBA 5IWLA 1CL7H 4MNQA 2Z91A 2VRAA 1YA5A 3WS6C 1BFVH 1FG9C 2A6JA 3HE6A 1AGBB 3I2CL 3PJSB 1KJVB 2FJFA 3EAKA 2C7UB 2YMXH 2ARJQ 2AJXH 2ZCLL 2C3GA 2ITCB 1G7JA 4UTBL 1MCSA 3I85A 4UQ2B 3ZTJH 4HPYL 5I8KH 2FEEL 5GS2H 1FORL 1XAUA 4Y5VB 2YS4A 1MCCA 1U2HA 3EO9L 2J6EL 1NFKA 5JHLL 1XF2B 4NKQB 4XXDB 2DIAA 5GJSH 4JQVC 4I13B 2FX7H 1AGFA 1JNNL 5HYSG 2IADB 3NABL 3R06A 3NACH 2X2YA 3CZFB 4P2RE 3TT3L 4WWKA 1I3VA 4UNUA 3RKDD 2YD1A 2BVOB 1RVFL 4O00A 4PGCB 3HAEB 1TMCB 2BC4A 3WNKA 5C09B 3MRJB 4QGTA 3CVHA 2H6PB 2IANE 1HHIB 2Z92A 3SJVA 1CZ8L 4NRZA 2GTZA 1I7UB 4L3CB 1J05A 3BIAX 2ZUQC 4IIQA 4MB3A 1FO0H 4APQB 2VTFA 4Z7UB 3MLSL 1GRWA 3CVIL 4ELMA 4NUJA 4HUUB 4KMQA 2EDEA 4LAQL 3MLRH 4U7MA 3DI3B 1NGQL 3P2TA 5F96L 4P2RD 4U0QB 3L3GA 5F6IB 1A7RH 1FRGL 4LSTL 4HWBL 1NAKL 3CCHB 4GRMB 4NQCB 4ORGB 2NX5B 4V1DD 4FTVB 5GQBA 5KJRL 4AMKL 4S1DC 5IW6B 3AMKA 5FHAH 2J7LA 4JDTL 3L7EA 2VAAB 3MLUL 3FB8A 3SKOB 2OQJA 3QIBD 3D18B 1CQKA 3I9GL 5TDOB 3HZMA 1MCHA 1RZ7H 4CBPA 5H94A 5CEXA 3ARVA 1RIHL 3TZVA 5DMGD 1RMFL 2ZNXA 5LWYL 2MPAL 2MHAB 4K7FB 3C6LC 3VXRE 4NOFA 1LDSA 4V1DB 4FNLL 2VE6B 3O3EB 4P2QA 1ZA6A 3T1FB 2EYSB 2VXSL 4GAFB 1CN4A 1XR9A 4M93B 2VDMH 5D5MB 5GIRB 5IJVA 5JOFA 5F9DC 4JM2F 3FRPA 2F5AH 1CD8A 4PJ7B 1RURH 1P7QD 4XBEL 4I0PC 5E94B 5HSFA 1DVFA 1EIBA 1LO4L 3FQTA 4NT6A 4NWTH 5B38G 1KV3A 3QDMA 4YDIL 4K94H 1IRAY 3T0XA 5FB8A 1AHWA 5BO1L 2PO6A 4NFCA 4KK5C 2B1HH 3MC0A 1N8ZB 4OKVB 1FZOA 1AY1L 3HI6H 3RZCC 1CGSH 4YIQB 5DD0L 4MNHB 1TZHA 3AU1A 1J0HA 3MUGB 5CD3A 4PJEE 4XCCH 4UIKH 5C07E 3G9VA 1CVSC 1FN4B 5E2JA 2P43B 2AKRA 3B9KB 5J11B 1OCWL 4OQTA 1W0VB 2CDGB 1KLGA 5EOCL 5F3HA 1S7TB 2V5YA 2N4IA 1WZ1L 2AV7B 4W70A 1IILE 1EJOL 4XGZA 1B9ZA 4GMTH 5HD8D 4MZ2A 2HKHH 3S88L 4L8BA 2R0KL 1MFBL 2VNCA 5DJDA 1RQ5A 2XA8H 4NN6B 2DLIA 2PW2A 3ZHLA 2O61A 3CFCH 1ZA3B 3GSQB 2HFEB 4HIJB 1I7ZB 1R24B 3FFCE 2V2WB 5C07D 4PG2A 5FKAA 5LGJA 3P40A 5E6ZA 2YEZB 4XMLL 3OJVC 4TUJB 5EOTA 4NNXA 4PJBE 1VGKB 2UYLB 2H8PB 3KPQA 3IB4A 5IFJB 2VZUA 4GKNB 3TYGL 1RIVH 5DC0A 3HI1B 2QHRL 1VHPA 3OX8B 4NN7B 1EHLH 4MQSB 3AROA 4C83A 4CL7A 2FATH 4UMGA 5ESAB 4L9DA 1FP5A 1CXEA 4YHML 3V5KA 3S5LA 3CX2A 4MZ3A 1PKQE 2EYTA 3QHTC 2HMID 4PJFB 4KZEL 2C3WA 1KC5L 1MAJA 4I5BB 5FGCB 4PBXA 3RWIB 1RZ8A 1JJUA 4B50A 1MVUB 3N1QC 4R7DB 2ZWLT 2APTA 3EOTH 4FQHB 5JQHC 4LIQE 5DJZB 3VDAA 5ESQA 4P4RB 1SY6A 2IQ9L 1WT5C 4KQ3L 1KIRB 3UTPE 3VXSE 2YWYA 4LHQB 3HMXA 5IV2B 1I9RH 1KNOA 1A02N 5D71H 4HIHB 2J88L 3EOBA 1IKNC 5FCUH 5HTSA 3MRHB 4Z7QE 1EFXA 1P69B 2O5ZL 3BVNB 2AI0H 2DQGL 4MD0A 3EGSA 2X4NB 4HKXA 1LK3L 4D8PA 4I77L 4S11A 5IB2B 2AP2A 2D7NA 2YXMA 1P53A 4BSVA 3OKKB 2OR8A 5DI8A 1TETL 1NAMA 4NO5A 2QQNL 2RHEA 1X5ZA 1N5YH 1J1XH 3NCCB 1IM3A 4M5ZH 3VA6A 1U3HB 1AKJB 4P2RA 5F9WC 4LMQI 3UTPD 3QWQB 2BNQE 4ZUTB 3V5DA 1YNTA 3PWPE 5F93C 1T7XA 4KQ4H 3NZ8A 2A0LD 3F58H 5CJ8A 5KW9L 1GAFL 2IANA 4AH2A 5GS0L 3DROB 4N5ED 2DBLL 4YWGH 2MCPL 4AEHL 2AXGB 3J8F7 1UCTA 4P23D 5GGRB 1HH9A 3AS2A 4M8VA 5SWZE 3TIEA 1T0MA 1UVQB 3HAEH 1AXSA 4KMTL 4NM4H 2NR6D 3LQZB 4JGUA 3STLB 1PEZA 3S3SA 1XR8A 3F7YA 1C12A 3H9YA 2FIKB 3G5ZA 3L5HA 4UOW0 5BZWB 2ORBL 5AZEL 3VMPA 2NYYC 3AS1A 3UBXG 3WN5A 2P45B 3TGXA 4A6YB 1N4XL 1ZTXH 1NLDL 3D0LA 4GSDH 1UZ6F 2BNQD 4DUXA 3PWPD 3AXLA 3NZHL 3RVTC 5EN2A 3V0WL 4L1HA 3ULSA 5IVNA 3QO0A 4JGJA 2BOBB 5HVWA 3IT8D 1K6QL 4PJDB 1P7QA 2ZP0T 2NXZB 2AJYH 4JDVA 1E27A 4MA3B 2UUDK 4PP2B 2HRPL 5SWZD 5IQ9B 2A73B 3QI9B 4HHAA 4ZFZA 5D7SL 4Y5VC 4YHIB 3MNWA 4ERSH 1J86A 2NNAA 3OF6A 3S6CA 3CSGA 1SMOA 4ZPTB 2GK0A 3FOMB 4N9OB 3S7GA 3VXRA 4D0CB 4XNXH 2YXFA 4MDJB 1HINH 2YKLH 4QYOA 4CW1A 3P4OB 5E24E 3TPKA 2CRYA 4PJHF 3RIAF 3VW3L 5C0GB 5T3ZE 3ARQA 4L1DA 3NIFF 2EDKA 1HEZA 1I85A 2XRAH 1Y18B 4WTWA 3K4ZA 4DW2H 4YLQT 4WUKL 4KTEL 3QEHA 4BYHA 4OZIE 3D5OF 1B6DA 3IDMA 1D5ZA 3QEUB 3IFPA 4JVPA 1K8IA 3KWWB 1L6XA 2QEJA 4NSKA 1U8MB 1NDGA 4JLRB 4NQXB 4U6YA 3V6FB 1S3KL 1MQ8A 1CU4H 1A4JA 4LEXH 4OV6F 3GUTA 5BJTB 4ODWB 3U4EB 3UC0H 5DJ2B 1BHGA 1EXUA 5LXGL 5F6IC 3DTXB 3ZE0F 3ZTJG 1UCBH 1S9WB 4KUCD 1R0AL 1LK2B 2H45A 1PQZA 4PJEA 1MJ8H 3VFPB 2HAZA 4PLKD 4LLVA 5T3ZD 4F58L 2MQ0A 5C07A 1ZS8B 3BOVA 5IB1B 1I3RB 3IFLL 8FABB 1OAKH 4QRTB 2J5LC 4PG9A 3NTCL 1JNLH 4R7NB 4ZUVB 1V5JA 3PIQA 4KKLD 4M7KH 3F5WA 3EOAB 4IBLT 2Q7YB 5DD1L 2PYED 5DVNA 4B7LA 3O3DA 5A43C 3O8XA 3TVMC 2X7LA 4XZUB 3GKZA 2R2EA 5IT2H 2AV1B 5FO9B 3TO2A 3FN9A 4X99A 3MV9B 1F90L 3V8CA 5DQ9A 4YH6A 3OG4B 5LGHL 3GHBH 4H0HB 4I48B 2H2SC 5ICXA 5IOPA 2VZVA 3QAZC 4NQUA 3UZEA 5CJOL 2Y36L 3FFCA 5CSZA 5EIQA 2J3SA 4LDOB 3TF7C 3CC5A 4P9HH 2PYEB 4RX4A 4U1IA 5DEGA 3QUYB 4OV5B 1OSPL 4ZFGH 1EO8L 3C5ZC 1DN0A 4UUJA 4PJBA 2I9TB 4QHNB 1TVHB 3O2WH 3QPQC 1BFSA 1FL5A 5FYJL 2WWMC 2OTWB 5HDQL 4RMUA 4P2CG 2XT1B 1Q9WA 2EDBA 3PF2A 4R8WL 2UZXB 3IDYB 2FDBP 3MCKA 1I9EA 4JZJA 1G7HB 1ZANH 3ZDYF 1FNSH 4WW2A 5F88A 3LEXB 3TH3T 4UIMB 5HDLA 2ZOLA 1PKQA 3BE1L 3VJ6A 5AAMA 1I1AB 3L1OH 5L6YH 1F8TH 1SJEB 3RAJL 3S3PA 1NMBH 2ERJB 4M1GH 1TZIA 4ONHB 4E42A 5ICYB 5EO1A 5DXWA 5IW1A 4CRPA 2W9DL 1OAUL 1IQDB 2F53E 5IHBA 2NY4B 2NTSP 4Y4FB 5I74B 1BOYA 1D9KC 3VXOA 2GY7B 3ARBB 3VXSA 1V7ML 4HLJA 2BOCB 5TPWH 3O3BB 1T89C 1YUHA 5FXCH 3D2UB 1PJ9A 1ES0A 4EI5B 2HFFA 3BESR 5I1KL 2NTFB 1NEZB 2FRGP 3LEYL 2VIRB 3W9EA 1OP9A 4FMFA 5CUSH 4WO4C 2ZKHL 2AEPL 2NXYC 5ILTH 2JELH 4QXGH 4FQIL 3CFBA 2FB4H 4OZ4B 2Z35B 3JSSA 1OTTD 5AUMB 5CGYD 2X40A 1YEJL 4FQJH 5DS8A 1ITBB 4TTDC 1JF1B 1JTOA 3MLXL 3INUH 2F53D 1O5DT 3O0RH 2D03H 1D5IL 3I6LE 3QULA 4GW5B 4QRUB 1Z9SA 1CFNA 3V6OC 2A2QT 1I7RB 2BNQA 4ONOA 3LN4B 5EBGA 1PLGL 4U7KA 1KBGL 4X6CF 3PWPA 3VFOB 2R29H 4HXBL 4K8RL 4GRWF 2C9AA 4MJ4A 3TBYB 2JJVA 3UPAA 1YNKL 1TJHL 5MENB 4Y2DC 5ESVB 3UJJH 4JDZA 2W60B 3ARDC 3FN0H 4S1QH 4Z7NF 3UJTH 1HIML 2NZIA 1J0ZA 4L9LC 3STBA 5BS0D 5SWZA 2UVFA 1I3UA 3O11B 3MREB 4HZLB 2G75B 2R1WA 2VXUL 2DF3A 2EDYA 3QXVA 5ETUB 3P11L 3NPSC 2IAMB 3LPGA 2KL6A 2O5YL 2X10A 3NCYP 5HY9A 3X12A 2FL5B 3BZFB 1QR4A 2WZPD 3I6LD 3FRUB 2EIZA 4MXWL 3QDJA 4PRBB 4UV7H 2I26N 4GXUN 4LCWE 4MB5A 2R2BA 1PG7X 3OB8A 5BS0B 2CIKA 2JJSC 2WBJD 1IGCL 3VFNA 2YUXA 4A6YH 3T04D 5T1KA 3U9PH 3IRPX 4K2UH 4BSWB 4MJIB 2BSED 3S34L 4KKAC 4QHMB 2AJUH 3QRFM 3CLEH 4MQ7A 2KH2B 1KEGH 3DNKA 2HFGL 1INDH 3S9DB 3Q6GH 4Z7VA 3P77B 3WYRA 5DZNA 1U3HC 3ZKSD 5L9DH 4L8SA 1MLBA 3F6LA 1B2WL 1IFHL 1DBMH 1MHCA 5K9OB 4LCWD 1NGZA 5HGBA 3CDFA 2OMBA 5IM7B 2OZ4A 3U6RA 4MA8H 1A6VH 3DGGA 5FO8A 5CGMA 5D7JD 1YNLH 5ALCL 2OLDA 4KK8C 3U9UB 4OZIA 1UT9A 5E9DE 4GAGH 4ODSH 3DLQR 3PG2A 1QPPA 3LCYA 1J8HE 3VFTB 4JKLA 1A3QA 2CKBA 1JRHL 2NMSA 1QNZL 4G7VL 1WEJL 3SKJH 4KROD 4ZS7L 5IVOA 1PG7L 2Y5EA 4NBXB 2H2PD 3MRQA 4KMLB 5ABDE 4K3HA 5D7JB 4DWHA 5HGDA 5E2VH 4KDWA 5KTEL 3GMPB 1XEDA 1W72B 3FB7A 1LQSR 3T77B 3OAUH 5HHXH 1FSKB 3PP4L 1HQ4A 4FZ8H 3KXFB 3NCFB 1NJ9A 4KI5C 3PABA 5DVLA 3LMJL 2YA1A 3QI9C 1T1XA 3H42L 5E9DD 1MLCB 1Z9LA 2VUOA 3FQRB 4QTHA 3ALWA 4IDLA 2HFTA 4YPJA 1D6VL 3BP6B 4QWWD 1J8HD 5CP3A 4X6BA 5IGXH 1UJ3C 3IVKA 3MJ8A 1KTKE 3L6FA 1ZHKB 2V2TA 3WSQL 4R4NC 2P7TA 2PN5A 4LLAA 3HAEG 4LCCA 5I19H 4XHJD 3EW3B 3NOIA 5JO5A 5JW3H 4HWZB 3REVB 2VDLL 1YY9D 1FHGA 4TYUA 1IBGL 4YDJB 3RVWC 1NUNB 3IRZA 3SE9L 3LH2L 5E9DB 1KIUA 5E2UL 4NC1E 2J6EA 2OS7A 4JQXA 4XNZB 3BDYL 3MRDA 5EBLB 1IE5A 1DBBH 5C9JA 3T0BA 2NY3D 3OKLB 2D0HA 5LQBH 1IZJA 1JI2A 3MRNA 5EPMB 5H2BA 1B0GA 1UKQA 3OR6B 2MQ3A 5DTFA 3FQXB 4HS3B 5KS9B 3LIZH 5T3XL 2V9QA 4ODVH 1T5WA 2D7OA 1UA6L 3HKFA 4BJLA 4ODHL 3UPRA 4UAOB 4JZOA 5GJTH 1ZLWH 1S7SB 2ARJA 2R15A 3RL2B 3WUZA 4WTXA 4L8CA 2CLVB 3AREC 2M2DA 3ZE1F 2V5MA 4LSDA 3IXAA 3EOYG 1QBML 3QUKB 1A1OB 4GS7C 1G9MH 4OLYL 5EC1B 3JV5A 3NCJL 3UTQA 3AM8A 2P5WB 1PW3A 3RTQD 5FKPA 5AYUL 1JZ8A 4JO3H 2H32A 2F53A 4W6WB 3GSRB 2XKUA 2OTUB 3OAYK 4R6UA 3LHPL 4HBCL 4TULH 5SV3A 4EQ2A 3MNZA 1UGNA 1T21B 2DLEA 3LZFH 3OTTA 4JREB 4EI6B 5E00B 3IJSB 3ILQD 4PLJC 4JN2B 3TNNA 1HXYB 2YZ1A 3WNNA 2AJVL 1B6UA 5JIPA 5D5MF 4HIEA 4XP6L 5DJ6B 4L29A 3RTQB 1A3LH 4HUWA 3QUYC 2ZG3A 3B2VH 2VWEC 3HC0B 2EYRA 2YPKA 4NYLB 2A6IA 5D7IA 1OAYH 1UM5H 4U1JB 1BMGA 2X4SA 4EIGB 2FO1A 4RGNC 4HC1A 5E56A 1ONQB 1M7IA 5DT1L 4G6AC 3KR3L 2D7QA 1LO2H 3QQNA 3NPZB 5D7LB 1AXTH 5JIHA 2NZ9D 3QNYB 2HG5B 5F7WC 5FUOH 2XKNA 5JDSB 2FD6H 1F4YL 3ULUE 2WBJA 1KJ3L 4GAYB 4FG6D 3EZJB 3QZWA 4QXWA 1VEOA 4FFVC 4K55A 4L5FH 5D2LF 1G7PA 4FP8H 1JZ3A 1GC1L 4ZTPH 5L8LB 4P5KA 2A77H 3FQNB 4MD4A 3UDWC 4TOYL 5KOVC 1GGUA 2OI9B 4ZAKC 1QZ1A 3AMLA 5EULV 4QCIA 3LEVH 1R5IB 4HULB 5I1LA 4X8JB 1K8DA 1P7HL 1MJ7L 4P99A 1URLA 3KLAA 1AC6A 4LDLB 3WEXA 5HXMA 2DQFA 1CICA 4PUBL 2IMNA 4XAWH 3NFNB 3ULUD 3ARTA 5EZJA 5EO0B 2D31B 2EE6A 1HK6A 1KCVH 4NZRL 4RDQF 4LKCA 1UM6H 4QF1B 1VKXA 3HI5L 4G6FB 1F6AB 1JF6A 4OIBA 3O6LL 1CTNA 1FBIL 4RNRB 4P0DA 1NC4B 2HJFA 2Y25A 1HDMB 4GXUM 2IBBA 4NNPH 4KK6C 3VA2C 3WFHB 1WIUA 1X6LA 1MRCH 4MNQB 4D0DA 2W0FA 5FOBA 1ZVYA 1T3FB 2DM3A 4IEFB 4L4VE 1YEDA 4JB9H 4MGXA 5DD6A 4HS8H 3K8LA 2AEQL 3D25A 5LAXA 2R4SL 1XGPB 2ITDA 3VXQA 2VDKL 4Z76B 3SDDA 3T09A 3GSNB 3QQ4B 4PJAB 1UYWH 4PJFF 1CG9A 1KEML 2JCCF 3VCLA 4KKCC 1SEBB 2FR4B 4IOIA 2J8UB 5JPMB 3U0PB 2XOTA 2IAMC 2XQYK 4LPYA 3OMZA 1P1ZA 2WUBH 1J8HA 1JPGA 5D93C 3QNZB 3L3IA 4D3CH 1JGEA 1JNHA 2JB5L 3H9ZA 2EDOA 4KRPD 4L4VD 4NC2B 5I2IB 4MDIA 4UZGA 3QIWB 3T0VA 1CBVH 4P5TC 4N1EA 3CX5J 2DQJL 1YZZA 1AFVH 4X7EC 1A6AA 4Y5XC 2GJZA 3SDAB 2CDEB 1W72H 3PWLB 4NUJB 1WBXB 1A2YA 2FGWL 3UMTA 5F9OH 3V95A 1OGAE 1GGBL 4NKIH 1UWXH 3LDBB 3QISA 4LVNB 1PKOA 5F7KC 3M17A 4YHYC 5A16B 3TT1H 1DFBH 4YNYA 3EYFA 1T1YB 4JO1H 1SBSH 4KWUA 1MWAB 5M95B 1G1CA 2EZ0C 2FECI 5DMKB 3CPLA 4LLQA 3REWB 5GS1B 5IB4A 4MQXD 1OP3K 3SBWC 4O02L 2XNAB 3TO4B 3WNLA 4DOHE 4NQDE 4C4KO 4JY4B 4XPTL 1Z6JT 5CEXB 1JHLL 3T2QA 3E8UL 4CKVX 2E3VA 3S96B 1UXWA 1ED3A 1OGAD 2ZPKL 1UB5A 2D9QB 1CK0H 4YHPA 4Y5YB 5CD5C 2NCMA 2A6DB 4P2QB 2JJTC 3DVGA 4OZFA 2VJXA 2EE2A 4EOWL 4XNMA 5CP7A 4ZO7A 1FZJA 4YQXH 4C57C 3E3QE 1A7PH 3ZDXE 4FXGA 1KPVA 4N0FA 2Z8SA 1EEYB 4N8CH 1NL0H 3D39D 1XF4A 4X5XB 4XX1E 4TN9A 4LSPH 5CEZL 3FQTB 1KN4H 3KYNB 3IFNL 3OXRA 4NT6B 4PJDF 4LRIA 4Y4HC 2NW3A 4NQDD 4KI5F 3WFDL 3UYPA 3TH4T 1AHWB 1UACH 4NNYB 2PO6B 1Q9OB 3NIDF 5IHLB 2EDTA 3HE7B 3RVXD 5IR1B 3HI6L 1OTUC 3NN8A 2E7LA 5CWSB 4I4WB 4G43A 1M1SA 3MV7E 5C0BE 3BUYB 4MNGA 5F9AC 4PRHB 1FH5H 1WSST 3D39B 5HYQB 1MFAH 2X4PB 5KVGL 3MJ9H 3BZDA 2COQA 3BPCB 5A2LH 2PW1A 1D5MB 4WTZA 1JWUB 4PGZA 4YDVB 3U0TA 1NFDE 3DUUA 4YJZL 5FECA 1EHXA 1B4JH 3RDTB 3LSOA 3FN3A 2YPVL 2A1WH 3U82B 3WXWH 2DLHA 1YDPA 1Z5LA 1A7NH 4LPXA 4U0RC 5KAQG 3LD8C 4K3DH 1DBKH 4U33A 2A9MH 3FO0H 5IBTH 1DLHA 4P9MH 2BZDA 1MNUH 2UWEB 3T0EC 3MV7D 2NY5H 5C0BD 2ATPB 2XWBB 5GGQL 4HG4K 2C3XA 4AG4H 4FQ1H 2V7NA 2L4OA 2DTMH 4HJ0C 4P2YA 3RWJB 1I8IB 5I1JL 2X1XR 1FE8L 4JR9H 4PJXE 3SGDI 3CH1B 4DUWA 1Z0MA 4YUEL 2CSPA 3NCMA 1DN2A 2F8VA 4JRYE 1T5XA 3SO3C 5E8DH 1RZGA 3LQAH 5I0DA 1A9BB 4Y16B 4JREC 3RUGF 3G5VB 5ADPH 2PETA 4N90E 3OKEA 3HMWH 1U91A 2M1KA 3B2UC 4HJJH 2BHZA 2DQHL 4KRLB 3OAYH 3T2NH 1T6VN 4KUZH 2UY7A 2H1PL 4RIRA 4AT6B 2XZQL 4HCRL 2YPLE 4X4YB 1F3DH 4WIQA 1UFUA 2QQKL 3KLHD 1RZKH 3MX0A 4M8QA 4JRYD 1JYXA 5KBNC 4PJ8A 1GOHA 4JHWH 4GG8A 2YC1A 2L7UA 1XF1A 4S1RL 4L4VA 4OLWH 3GMMA 3VFMB 3MYJA 1EFXB 4N90D 3FO9A 3O81A 3C60B 3V4PL 1JYWA 2HTLC 3EGSB 2Y23A 5TF0A 4PGBA 1Q9LB 3S4SA 2BX5A 5KVEH 1EERB 5T5FL 4NHCL 4P4KC 2YPLD 4LLYB 2OI9C 3GSNH 5E4IA 2EDQA 1IGTA 3HZVA 3WUWA 3C08H 5SX5K 3BYTA 3V5DB 1YNTB 4M6MH 4FABH 3KJ6L 3ETBF 3RY4A 4EN3B 1OL0A 1K4DB 1NEZG 1KTDA 4YBLB 1WAAF 4U2YA 4OCSL 4HW6A 2NY0B 1ZVHA 1F5WA 4YBQC 3NGBB 4PY7A 5A3IC 3H7BB 3D6GA 1UXSB 1OLZA 5GGSY 4R2GD 3SE3A 5I0ZA 3MLWL 2CLRB 3JTTB 1OGAA 2ZG2A 4YXHL 4TNWK 1HHJB 2WM0A 5CHNA 5C08B 4DAGL 4JPKL 4LCYA 3C2AL 3HPJB 5DJ0B 5EC2A 5IWLC 1ZLUK 1Z0NA 4IMLB 3D0LB 1S9XA 5DK2A 3MFFA 3W11C 4GSDL 3HE6C 3TLRA 1AQDB 1ZHLA 4C58B 5C0EB 1F97A 2EECA 3PGCA 4YHLH 2APVA 1UJTA 2IEPA 4PJCE 1DQLH 4F7PA 1FCCA 4BSJA 5HI4D 2B2XH 5DEFB 1T1ZA 3KPMA 5B4MC 1X6NA 3FQUA 1MWAH 4WGVB 3WIHH 4J3XA 4HHAB 4ZFZB 1A14L 4NQDA 5A2IH 2CRIA 2BSTA 4R0LA 4OT1L 4HMEA 4XPGH 3ARYA 1FL6A 3K2UH 3VGEA 1KACB 2Z8WC 4G9FD 2CUMA 3MZTA 4WWKC 2VXQL 3BXNB 4ZPVA 4OBSA 4LRNL 5JUEL 3HR5B 1CS6A 2DKMA 5HGHB 1OAQL 3MRFB 4XB7A 3RNKB 1HEZB 5IMOB 4OM1L 1JNJA 1N6VA 3DYPA 1SM3H 2XTLA 1UQSA 3R8BB 4N0UA 3L3JA 5GZOD 2JIXA 32C2B 4IIQC 3MA7A 5I6XC 1D5ZB 4G9FB 3IFPB 1WFNA 1C5DA 3UJIL 1CWVA 1K8IB 4JPIA 4I0CC 2XZAH 4HQQH 1NDGB 4JFHD 1LP9F 3JUZA 5GXBB 3VXPB 3LDBC 4LVNC 5ACZA 1DBAL 4PJGB 2AXFA 5DHYA 3GIZH 1Y0LB 3LKNB 2APXA 2VLME 4XPFH 1ZT7B 5J12C 1IC4L 3V7AG 4G9DB 3L9RB 1N0XH 1MF2L 4LCIH 4FMKA 4H8WH 4LK4A 1BJMA 3CSYA 1NFDA 5DUML 1BFOA 1AR1D 1CT8A 2PR4H 2XWTB 3PIQB 4PV8A 1JK8B 4MAUL 4LNRA 4XBGB 4RGOH 2MWCA 3TZVC 2EC8A 5F7HA 4OB5H 3MUHL 2X7LB 5HHOE 4LP4A 1ND0B 1FGVH 3EJZC 4X6DE 4JJ5A 5DQ9B 2VLMD 1YQVL 1OP3H 4Q58C 4IM8A 4WDIA 4WU5A 5IF0B 3BEVA 2R23A 1FNHA 1BQLH 4PFEA 3FMGH 4B5EA 3MRLA 4XPAL 1DVFC 5E2TL 1S7QA 4EUPA 2W9EL 1DCLA 4RRPA 4YHZL 1AHWC 4O2FB 3VFUB 4DKFH 2PO6C 3MGAA 5HHOD 5KSUB 4JRYA 3BZ4A 1FDLL 3HS0A 4M48H 5DJYA 3VH8B 4BZ2H 2BVPA 4Y8DC 4U3HA 3SQBA 2LVEA 1N7ML 5JR1L 5F88B 3S36X 5JW5A 3VU2A 2OJEB 1MIML 4G8GE 4NIKB 1QBLH 2FNBA 4XP5H 3UXFA 4O4YL 5GSRB 3NBNA 3GO1L 3EJYD 1N6UA 3C09C 5HDOA 1M7DB 3EFFB 2VC2L 5FHBL 4H25A 9CGTA 1OP5K 5E1AA 2IH1B 1YC7A 5L2KE 3LRHA 3A6BH 1CGYA 2P49B 4GKSB 1DQJA 1K2DA 4BQBA 2A83A 4RAVA 2CK2A 2IPTH 1UH2A 2YPLA 4JY5H 4JO2L 3W0WE 5MEQA 3FB5B 3IYLW 4JZNA 3OJMB 3VXOB 2XQBL 3CXDH 1W2KT 1NBYB 2BERA 5FUCC 3OPZH 3ARSA 5DUPL 1MVFA 1FZKA 3GMOB 5HPMB 4POZD 5HI5D 5KS9F 2WSKA 2FEDC 1WV7T 1IGJA 5DGRA 4G8GD 3TCXA 2Q1EA 4JPVH 4XMKL 5C0RL 4PG2C 5CUSL 1MRFH 1RFDH 2G5BA 1JHTA 4NZUH 5ILTL 1S5IH 3CFBB 1VESA 3NH7L 2FB4L 3QO1A 1RZJH 4X83A 1F3RB 4JEGB 5FM5M 2WWKT 3LKOB 3W0WD 4PP1C 4AQOA 2D03L 3H2WA 2K7PA 1OM3L 3MMEB 4F3FA 2L0DA 3UEZA 4CNIA 4YHOH 1A3RL 2IGFL 2AW2A 5EU4B 1MQKH 1DQQA 4M00A 1JPTH 5IBLD 1G0XA 4ALAL 3X17A 3PDOA 4JDZB 5JHDE 3B3IA 5TF1H 4C55A 5CCKL 5J4MA 4HMDA 1TNNA 3VDBA 2NY2B 2BCKA 3N1PC 1WZLA 4TSBH 1KYOJ 2I5YL 4JFPB 4ZS6D 3BKYH 1KCUL 4LKXB 3KAAA 1TPXC 2F5BL 5HY9B 2EO1A 5DMJB 4Z0BH 3IKKA 1NUFA 3MBED 3QDJB 3RKDC 4NFBA 5FGBA 3C6SA 3BIKA 5JA9A 1MFEL 3EYVA 4IRZL 2YD7A 4PJCA 2HKFH 1HZHL 1QFHA 4GKOA 2ESVB 5T1KB 1P5UA 1HWGB 5D2NB 5JHDD 5IMMB 3MV8E 3EYSH 1AQKH 4HKBB 1VADB 3UX9B 2X89D 3V6ZB 4HJGA 5F6HI 1S5HA 4MQ7B 1PY4A 3R1GH 1BVLA 3U1SH 3TESA 1KCRH 4Z7VB 1DBJL 2Q3ZA 3HB3D 2DQEL 4YDLB 2EICA 1MHCB 1VB9A 3NCYS 1WCBB 1AR2A 4PLOB 3F7QA 2MMXA 3BUTA 5I1IH 4JKPH 3UPCA 4F9PA 4M6NH 3KS0J 4UINL 5C0AA 3VWJD 2PXYD 4P57A 3MV8D 4OGAD 1NCCH 1DQDL 3ZDZF 5I8EA 2B1AH 1NGWA 4OZHE 2CJUL 3UYRH 1YPZF 5DMGC 5SX5H 1RY7B 1OOAA 4EDXA 4EVNA 4M7LL 4FQ2L 1HOCA 4MQTB 5CBAA 1E4JA 3WN5C 4MA7H 4DZ8A 4K3EH 1CE1L 3EYOA 3KJ4C 2EH7H 3KNBB 1M7XA 2ZOKB 3SKJL 5H35B 1GPOH 5FYKL 5CSGA 1A9EA 3K7UA 4LCUA 3VWJB 3PWVA 3S8WA 3EO0A 2DQCH 3ZT7A 1JE6A 1LDPH 4I2XA 4Z5RB 4YFEA 4XWGL 3FOLB 1R3LB 1X5YA 2BVUA 2P48B 5E2WL 1A6ZB 4CMMB 5FA4A 4BFIB 3HNVL 3B9AA 1KENL 1MCQA 5T1LD 3AY4A 3CUPB 1NLBL 3OZ9L 3U46A 2XA3A 3G6JE 2M26A 3QIUD 3RNQB 4CU6A 4X6DA 3BRDA 1R5VB 5F89B 2V2TB 4P5MA 3WNPA 2ED8A 1IAKB 5TE4H 3TJHC 1LHZA 1FL3A 1MRDH 3P0VH 3QUML 4ZTOL 3FAXA 3OHXA 5I19L 2XV6B 5BQ7A 1IC7H 5KN5B 3LN5B 3SKMA 1I8MB 2X42A 3HCVB 1I85C 3EO1A 4D9LH 7CGTA 3ZKMD 4FZEH 3ZTNL 4JFYA 2P4AB 5D96C 4RFEA 1EVUA 4NGHH 5IIEB 1BZ9A 4IRSD 4WY7H 2Q86B 3PHQB 3MRPB 4I18A 3N1FC 5EU3A 3M45A 3DHMA 4OCLC 4H26A 4JG1L 4LNVA 2XXCB 1B0GB 4WU7B 1AE6L 5DTFB 1J8KA 4G6KH 1VGEH 1T03H 5HHPB 3TBWB 1KF9B 4ODVL 4MXQC 1XGUB 2FYYB 3ESVF 4JZOB 1NGPH 2GY5A 3IXTB 2BVQB 1ZLVK 2IG2H 1RJLB 2EDHA 4N8VA 1QEWB 4YXLH 5DR5H 1MHPL 3IXAB 4LOUD 3ECBA 1OHQA 4IJ3B 2VISA 5L2KA 4Q9CA 3TWCH 2DBJA 3UROR 3RWHA 5T5NG 1L9NA 1IAOB 5FKPB 2SEBB 3O8XC 5E6IB 3RWFB 1I3GH 5C8JB 3EYQD 4OSUH 3SGKA 5E08L 4ISVB 1OARL 4Z77A 5EUOB 4U1MB 4HDIB 4HXAL 4E41E 3RU8L 3P9LA 3JVGA 5ID0A 1CFVL 2OR9L 3K1KC 4LLUA 2HMIC 1KJ2A 1QFPA 3K81A 3JBG7 5CKAA 3T3ME 2ICWJ 2YOCA 5FO7B 1HILB 1OSZB 4ZDHB 3ME0A 3Q5TA 3TA3B 4WEBL 2DI8A 2G2RB 2EXWD 3MLPA 1F11A 3OKMA 4JFFE 5D7IB 1YMHA 1OAYL 1HSBB 5F7UA 3MLYH 1FIGH 1BM3H 3VE0A 3UZQA 2WMPA 4U1KA 4GW1B 4JFXA 3W39B 2HN7A 3LRSA 3MBEA 4TVPH 2I07B 2OSLA 4BELD 3GM8A 4JZJC 1GHFL 4OIIL 4XVJH 4WW2C 5DJXA 4E41D 4Q9QH 2DIJA 1XIWB 2FCBA 5IB5A 3ILPA 5J13C 1U8KB 4ODTH 5E5MA 3SDXB 5B3NA 1A6PA 5JHDA 3QZWB 4MD5A 1LO0L 2ENYA 3M8OL 2Z31D 3EDEA 3WIIH 2AQ1A 2X89A 4LVEA 3NA9H 1FV1B 4FQCH 4JFFD 5IHZA 1QO3B 2R2HA 4MD4B 3QEGL 5J6HA 4O2EA 1BAFH 4QHLA 2G9HA 4HH8A 3AAZA 3P0YH 3LPFA 4NRXA 2I9LB 4NHUB 5KSBE 2BVEA 3QDGA 3UO1L 2NY7H 1N5AA 1CGUA 1AC0A 2LQRA 3KLAB 3T3PE 1OP5H 4BKLB 2A0LC 2DTSA 3DBXB 5B3JF 5D6DA 2UWEF 2X4QA 4PRPE 2RCSL 3HUJB 4IDJL 1CICB 2X44D 4N5EC 3WHXA 1KB5L 2PXYA 3FFDB 1PD6A 1I1FA 4GKZB 3MV8A 3IETB 2BFVH 2NR6C 3RJDA 3Q5YA 4WFFE 3JXAA 4JAMA 1S7WB 2GTWA 4PRNB 5I75B 4Z8FH 3D1MC 4G42B 4NKMA 2IPUG 4NNPL 1FCGA 5D1XD 2EKSA 3L5XH 3LS5L 4L8DB 1L7IH 4BUGA 4P46B 5DD6B 2MKLC 3QUXD 2WUCL 3R0NA 4PRPD 1MFCH 4M4RA 2R8SH 3FO1A 4WNQB 3O2DL 3VXQB 3TEUA 2VDRL 1TCRA 3D85D 3GSUA 4LASL 1MIEH 4O5LL 1C8PA 5AD0B 4U1LB 5T1LA 4OZHA 2P5EE 1A7OH 3QUZA 1TDQA 1U8IB 4M7ZB 5KSBB 3BWUC 2FJHA 2FO4B 2GSGA 3L3IB 3QIUA 5CZXC 5JW4M 3QUXB 1JGEB 2VLJA 5KSAD 5IQ7H 1M6OB 1N59A 5GRUH 1UZ8B 4MDIB 1MCFA 3D85B 3WFCL 5LCVH 1YJDL 5KZCD 4I3RH 2NY6B 1FYTE 1DEEB 4PBVC 1PBYA 1P4IL 2AVGA 1RULL 2UY6A 2YWZA 1DE4B 3MRRB 3T8XA 1AFVL 2ZUWA 4IRSA 2GAZB 2GJZB 5DO2C 4MS8D 3D9AL 3PUCA 4X9HA 1OD9A 2P5ED 4NCC1 1OAZL 3LKSB 4F2MB 5C71A 4CJ1A 4MCYB 4HV8A 4M9OA 1FZMB 1S7UA 2V7HA 5DJ8A 3BPOB 4HGWB 3G6JA 1U93B 2HVKA 4QRQB 2BNRE 1OQXA 2Y06L 3CFIC 4L8SC 3FT4A 5JIKA 1NCTA 4YNYB 3QG6A 4JO1L 3MRCA 3I2CH 3G04A 1SVZA 3SCMD 1DUYB 2CR3A 4LEOB 1FYTD 3L5JA 5KG9A 2ZCLH 2ADGB 4KKLC 3CD4A 3MNVB 5GGVH 4UTBH 2FLBT 4HPYH 1EZVY 2EDDA 3QCUL 1QA9A 3H3PH 2XN9E 1FORH 1DLFL 4JHBA 4UDTB 3K1DA 1CLOL 2J6EH 3EO9H 5JHLH 1UB5B 5HBBA 3IKCA 4CADA 4GQPH 1JNNH 1RK0B 3NABH 3O6FB 4FFWD 2BNRD 4OZGB 2R0LH 1ZEAL 4JFEA 3W9DB 3TT3H 3HTLX 4F33B 1H0DA 5F7DA 1RVFH 5K9KA 2A6KB 3T65A 3CFKA 4RA0C 4XH2A 3BRGC 3HRZA 3BH9B 4X6FB 4M1DL 5FYJU 4XNUL 2V2XB 4KJWD 5C0IB 2XN9D 3MLSH 4DVBA 5ECJE 3O9WD 1BVKA 5E4EC 3CVIH 2J2ZA 3MQIA 1QLFA 5FCSH 3BP7A 4JRXE 4LAQH 5MI0B 3QJHB 1T1WA 4PRDA 3RGVD 4E41A 5J1AB 3MRIB 1NGQH 3FT2A 5F96H 4MNGB 5D1ZD 3G5YA 4Q74A 4LCCC 3P9WB 4NO3B 4ZUUB 1FRGH 4HWBH 1NAKH 5KJRH 2BNUB 4AMKH 1K3ZA 2K9UA 2OMNA 4JDTH 2Z31A 1C08B 4WEMB 3MLUH 4JQXC 1EBAA 5F3BB 2C1OA 4JFFA 3I9GH 3ARWA 5K9JH 4YHKL 4RISL 2CLZA 2I24N 1E28A 1R5WA 1VEPA 1DSFL 1RIHH 1RMFH 3SPVA 5LWYH 1RZFL 3I50H 4JRXD 5DUBA 2MPAH 2E6QA 3GGWA 4XP9L 1FLRL 1KOAA 4FXKB 4FNLH 1A7BA 4YR6A 4OD2A 2NW2A 4NDMA 5DD3L 3WL9B 4JPWH 2VXSH 4KXZH 3CZJA 4YHNA 1SYVA 4TNWF 1ADQL 4X98A 4AG4L 2V7NB 5FDYA 3RIFK 3FB6B 1FVDB 1ULVA 4XBEH 3VFSB 1OTTC 1AIFA 3AM8C 3L3HB 5CGYC 1QFOA 1RJYB 4JR9L 1RUML 4YDIH 1CD1B 2BSSB 4ZNEE 4OLEA 2VLRE 3VG9C 5D1XA 5BO1H 4UOW1 1ZLVH 1N2RB 1RZGB 5HI3C 2VABB 4X4XA 2X1QA 1AY1H 1ZHBA 3DRTB 5DD0H 5ADPL 3P4NB 2GJ6B 1D6EB 3HMWL 1G7QA 3I75B 4UI2A 1DQML 3EDKA 4QEGA 5FV2A 2PNDA 5IVXE 5E7FA 5C70A 2VZTA 5TGBB 1FJ1B 1S7XB 1L7TL 1X5LA 5MERB 1OCWH 3LV3A 3MGOA 4QY8B 4PJIE 4KXZI 1P4BL 5DSCB 3LB6C 3UTSA 1F4XL 4PJBF 1WZ1H 1Z3GL 4M9PA 2VLRD 3FCTA 1EJOH 4BQ6A 2R1YA 2RIKA 4BH8A 4PJ8B 5IMKB 3VH8G 3S88H 1WWAX 3KPSE 4NQVB 1S8DB 1VEMA 2R0KH 3IDGA 2YC1B 1V7NL 2R56L 4J7RA 3TIDB 3GMQA 1C16A 2WBJC 4WW2F 4DEPC 1JZ4A 4CJ0A 3MROB 2QADB 1IAII 2LU3A 3LKQA 1DQTA 2B39A 4JKKA 1BF2A 3MJ7A 4KRMB 1BQSA 3GSXA 2BRRH 7FABL 4XBPB 1MCJA 1Z9OA 2P5EA 4XMLH 4HH9A 5EU5A 2I27N 1CVRA 1ZLSL 1BBDL 1LO5B 5IMLA 5HHQA 5DRXB 1X5IA 4GUPA 4Y4KB 4XCFL 1L9MA 2W65B 1ZWIB 3TYGH 3WUWB 3SDCB 3PL6B 3KPSD 2QHRH 3MUZ1 3EYUL 1EO7A 1MCOL 3LVEA 3H3KA 3ARFB 1CR9H 1B4RA 4J3WA 3SCMA 4V2CB 4YHMH 5M7QA 4RMRA 1CICC 3ZKXB 2NY1D 3ZLQC 3CLFL 4LU5L 4X9FA 4Z7QF 2W0LA 3V2AR 4KZEH 3PHOA 2HLAB 4XCNA 1H3PH 1KC5H 5I8CB 5FA3B 3SGEI 2F74A 1O0VA 4GJTB 4PREB 3CVHL 3RX7A 2MJWA 4LLWA 3LRGA 5IKCA 5I75C 4UV4L 4UOJA 1U41A 4LLMA 1UH3A 3RWDA 3CFDB 3OXSB 5EC2B 3V8OA 2BNRA 5DK2B 3CH8A 4I9WE 1N6QH 2IQ9H 4KQ3H 2AK4A 5EBWA 4FQPA 4K8RD 2J88H 1HHGB 1S78C 4G8EB 4K71B 4TPRH 4ODXA 1HQRB 2VOTA 4KV5E 1U92A 4CVXB 5JDJA 3SDDC 2O5ZH 3DVNA 1XZ0A 3OJDB 4JANB 3D48R 1YN7B 2DQGH 3FQUB 5T1MA 3VFGL 1YEHL 2BSTB 2X1PA 1LK3H 1BPVA 1FL6B 3MLVL 4I77H 1MH5A 4HIIA 3PWNB 3TN0B 4QWWC 1QLEL 3UTZB 1YN6A 2K1MA 1TETH 2QQNH 1MPAL 3VXUE 1RUKL 1VA9A 3BJ91 3VXTB 3QXWA 3SOBL 2B7DT 2R0WL 1H8OA 2WQRA 1NUDA 5GS3A 1NCUA 5IESL 1C5BL 2V17L 4TNVK 5ENWA 1MHHB 1ETZA 3RKPA 4OBRA 5KW9H 5D7KE 1WBZA 4JM2D 1GAFH 4U6XA 1UQSB 5GS0H 4AEHH 4N0UB 2DBLH 2MCPH 2JIXB 3L3JB 4MWFA 5B22A 4RWYL 1NGXA 3MA7B 4XWOC 5SWSB 4DGYL 4WFGE 4ZUWB 2NY3C 4V2BA 1L0QA 1XCTB 1U8NA 1Q1JL 5BRZB 4QRSA 3I6GA 2ORBH 3OG6B 1AGCA 5AZEH 1QG3A 4W4NA 2XYCA 2VQ1A 4D9QE 1ORSB 2CIIA 4Z7VF 3C5SA 3PXHA 1N4XH 3GHEL 1WCQA 2D2OA 5EFIB 2YUVA 3NZHH 3V0WH 3QFJB 5D7KD 3X14A 1X7QA 4NC1C 4OLUH 5EB9A 1K6QH 4ACPA 5L8KB 3SGJA 3BIBX 2H9GB 3VG0L 4GG6E 3QPXL 1P4LA 1WC7B 4J4PD 3QDAA 5B8CA 5D7SH 1T2JA 4HD9A 2DWDA 4OB5L 2AJSL 2CO6B 4OQTL 1QKZL 4C56A 1WIPA 4D9QD 3JWDC 3ULVE 3TCLA 3Q3GB 3ILQC 4LBEA 1RHHB 1YC8A 1JGUH 4J8RB 5DMIL 1MFDL 3QG7L 3VW3H 4Y7MA 5BVJA 4B53A 1U8OA 4LRIC 1AD9A 4GBXB 1S7QB 3O6ML 2OTPA 5DHVA 3VRIB 4WUKH 5EG6C 4KTEH 2DB8A 4QHUA 4R3SB 2ICWA 4CAGA 4DKFL 4ZNEA 1BIIA 3KPRB 2VLRA 1S3KH 1SHMA 4Q2ZA 5T3XE 5MI0C 2E7LC 5I1GL 5J7CC 3HG1E 4KJQC 4U6HB 5LXGH 2ICEB 2W38A 3FO2A 4R97B 4XP5L 2VITA 1R0AH 4ELKA 3L3DA 1VFAB 4FG6C 1EHAA 5FYLE 4F58H 1QSFB 5IVXA 5DJCA 2HVJA 2E7MA 3IFLH 1Q38A 4BQ8A 1XGTB 3NTCH 2B5IC 1FFPB 3OAZK 4PJIA 5A1AA 4HK0A 2ATKA 2AGJH 5MEQB 4FQXB 5CS7A 4ZNCD 5IEHA 2YZ8A 5DD1H 5HYFA 5ANMB 3U79A 1RK1A 2X4TB 3BHBB 1EEUA 1TENA 4KRNA 4J3OC 3KPSA 4TSCL 5T3XD 3PNWB 1GGYA 5EOQL 1F90H 1FC2D 4ETQA 3P4LA 5HYSA 1BWMA 2GCYA 1NCBL 5LGHH 3E1F1 1PZ5A 1WWCA 3IAPA 1SY6L 1NKRA 2VDQL 1X5XA 5I1EL 3ULUC 2X4OB 4J6RL 3HMXL 5CJOH 2Y36H 1IGYA 3SY0B 5FYLD 3QCVL 3BSZL 1AP2A 3QO1B 1GGCL 2P8PB 4O51B 1OSPH 1EO8H 3RX5A 1VFBB 3BW9B 4BK5A 5EBMB 2VLKA 2KQNA 1FFNA 4LVOC 3DV4B 5HVFB 4K7PY 4POUB 4F3FB 5FYJH 3ABZA