2ZF9A

Crystal structure of a type iii cohesin module from the cellulosomal scae cell-surface anchoring scaffoldin of ruminococcus flavefaciens
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
184
structure length
184
Chain Sequence
b'AMGPAAGQAYDAGNLDVASSPVKPTLSITKKTLTAAEAPNAKVTMELSVEGAADKYAATGLHIQFDPKLKLIPDEDGALATAGRAARLLELKKAEADTDNSFFTATGSSTNNGKDGVLWSFVLQVPADAQPGDKYDVQVAYQSRTTNEDLFTNVKKDEEGLLMQAWTFTQGIEQGYIQVESTTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ScaE cell-surface anchored scaffoldin protein
publication title Cohesin diversity revealed by the crystal structure of the anchoring cohesin from Ruminococcus flavefaciens.
pubmed doi rcsb
source organism Ruminococcus flavefaciens
molecule tags Structural protein
total genus 40
structure length 184
sequence length 184
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zf9A00
2B59A 2BM3A 2OZNA 4FL4C 1ANUA 2VN6A 1ZV9A 3FNKA 4DH2A 3GHPA 2ZF9A 4IU3A 2W1NA 3L8QA 4UYPA 3KCPA 1G1KA 2VN5A 3KCPB 1QZNA 4N2OA 1AOHA 2CCLA 3BWZA 4UMSA 2VO8A 2JH2A 4U3SA 4WI0A 3F2LA 3UL4A 4WKZB 2XDHA 4IU2A 5G5DA 5AOZA 5K39A 2Y3NA 1OHZA 4FL4B 4UYQA 2O4EA 5LXVA 1TYJA
chains in the Genus database with same CATH superfamily
3MRMB 1D5MA 5D7HA 1N5YH 3EZJB 5IJKA 4V11A 3TO4C 3LPOA 4Y4HB 4KMQA 2G5BB 2GY7B 3EDEA 4G71B 2H9GA 3CDCA 1XB3A 1R17A 4JCWA 2YAFA 5KTEL 1JMZA 5J3HC 4M1DL 5HHME 4EMZA 3AS2A 3TV8A 1E8ZA 1MCOH 3ZDZB 3GSWA 3B9KA 4EZKA 5DMIH 5JYLA 1JNJA 3QEQE 3SPVA 3TNNA 5I15H 1X9UA 4N2EA 2PR4L 3MRHA 1CLYL 3B5GA 4KTEH 2XXMB 3S8WA 1YJDH 1Z1WA 3OKKB 1CGUA 2BIPA 5C9KA 3BQUC 4HLEA 4HKXA 2NXZD 5FM5O 3S4SB 2F15A 4PJIE 4PGDA 3KYNA 1HCYA 4OAWA 3WIHL 2E4FA 2FWSA 2VDLL 3ECQA 4R84A 4YDIL 4N85A 3HBGA 2P5WB 1ITCA 4DFIA 4DERA 5K59F 2ZUWA 2J1WA 4BFJA 5F6IB 5GZNC 2DKSA 1KUMA 4AW4A 3WEOA 2WXMA 1SPDA 3L1OH 4ZO9A 4JJOA 1PZ5B 2F19H 2Q86B 1R5VA 2WAQA 1KIUA 3UGXA 1G1KA 5ECGA 4L8CB 4K9EH 3EDFA 2KLTA 4Y1AB 4ENZA 3ZU8A 4KROB 4QRQA 1M3IA 3SO5A 5FWQA 4AG4L 4RH4A 2H32A 3GHBH 3QORB 1FLTX 3IDYC 1F3DJ 3BESR 4JE4B 4N0UE 2EYTA 4PJHF 4ZD3L 4ACPA 5D55A 1JXFA 1DBBH 1PZDA 1GAFL 4ATTA 2VR4A 3COOA 3F84A 3II2A 3JBG7 4PU2A 2W07A 4JO3L 5IMMB 3TT1H 2H8PB 2MTPA 1LHZA 2F5AH 1USZA 4PTUB 2ZXEB 4JFVA 3RURA 2VXTH 6PCYA 1EXUA 4B9IA 3JQOB 2VJ0A 1I8LC 4EEEA 3O8XD 1F8TH 3F6LA 1RU9L 4HCRL 5EIQA 3DETD 5IB2B 2QVIA 3QUXA 3NP4A 4WHDA 2Q1EA 3PREA 2V7HA 4QHNB 3CLEL 2FLRT 2ENJA 4K3HA 4N0YL 3DSNA 1GGIH 4IIQB 4LT7A 2EIDA 5GS1A 2D7NA 1UXSA 3MMEB 3MV8E 2YA1A 4PJ9C 4YDVB 4BZ1A 4ZFFB 5HPMB 3WD5L 4WGKA 3WKNA 3TN0A 1MIEL 3QWRD 3TX4A 4MXWH 1PW3A 1P1ZA 1I7ZB 2GG1A 1T7ZA 3AY2A 5E9DA 2G60H 1Q1PA 2CHZA 1UCBL 3H55A 3M8OH 3ROOB 5B8CA 1A02N 4RMRA 5EC1B 3BPOC 2VQ4A 3IDGA 1R0AH 3VSQA 3ARBD 3K71B 5IQNA 1ZTXL 4FQ1H 2XLLA 3GSRB 2Y36L 1B9KA 3RI5K 2Z8RA 1YUKB 2BIQA 3D39A 5DMKA 5TF1L 3HMXL 1AH1A 1HEJC 3MBXH 4BDVA 3AMKA 3DROA 2B1AH 4PSRA 4BEIA 2JTDA 2KC0A 3ZRCC 4XVJL 4GYBA 2B14A 2E8YA 8CGTA 3OGOE 3O4OB 1QHQA 5IVXE 3V7AE 2RMNA 1DSFL 2CRMA 3GBNH 1KFAH 1A5FL 4JPKH 1MRCL 1VACB 3UPCA 1KULA 4PCSA 5HYJE 4X6CB 1A7PH 4A2DA 5IFJB 1E27B 2VDRL 3CDFA 5C07E 3MRJB 3VFVB 3V5KB 1ZKAA 4RFOL 3LKRB 2R29L 4Z7OE 3H7BB 5KVDH 2EXSA 2B2XL 4N26A 5I9QB 2BVQB 1MFDL 3L3KA 1RJLB 4TM9A 1XF1A 4MSWB 4Y4HC 2GJ6A 1UG9A 4IQHA 5T1DL 2KI6A 2J4WH 1EO5A 5MEPB 4MA8H 3RGHA 4R90L 4LFHG 3L3IB 1LDSA 2JKWA 2YPKA 3W0WA 5GS0L 1NUGA 1BG1A 4WHYG 5F9OL 4PWIA 1RZFL 2C3HA 1L0YA 3FOLB 3G5XA 4PJGF 5KG9A 1WISA 3BIAX 4OLVH 1JPFA 1CXIA 2NXZC 1SEQH 4JGJA 4ZOEA 4Z95H 5I66A 3NDYE 1WFNA 1G7LB 3DUUA 4NZDA 5ID1B 3FB5B 4OF8A 2NR6D 2XCMC 3OHXA 4PJ6A 4UT9H 2FL5B 3WAKA 3DIDA 5JQHC 5KS9A 1LWJA 4FQXD 2WUBH 4XP1H 2V2XA 3RL1B 1W0YT 5CBEA 3V6OC 1WBXB 4KH9A 2WPGA 5F6IC 1L6PA 1TVHB 2HT2D 4EUPG 5GS3A 2AXGA 1ETZB 2QVFB 2VC2H 3HNVL 1IAIH 2XC8A 3AAZB 5DJ2A 4AQAA 1CE6A 3QIWD 2XVLA 4K3EL 3IPBA 1TTBA 2DL9A 5IEHA 1A8JH 4PJ8B 2OMVA 3F62A 3LAFA 1S9XA 2EC8A 3HBZA 4U7MA 5T5NF 4TUUA 2IJ0C 4YLBA 5INDA 1MREL 4I77L 4F8PA 3N42B 3J2PA 5DFVD 5A2IH 3CFJB 4X6FA 4L3FA 3KS0J 2WLMA 2OSLB 4E9YA 4YXKL 1W0VA 2MOVA 3OPUA 2XNAA 2ZCZA 3GZKA 2K9FB 4X7DC 1X5HA 3EYQD 1UEMA 5BZDB 4RQQB 4H8WH 1OB1B 3QEUB 2AEQH 5BVPH 3BWUC 1TO5A 1J8HE 3TBYB 3PIQB 1MRFL 3X11B 1J8RA 4X6DE 4O2CA 4FA6A 1DDHA 3L48A 5CBAA 5C0ND 2BHFA 2GC7C 5DHEA 3W37A 3CLWA 3DETC 1CFNB 4PJAA 5ADPH 1P9MA 5IHBA 3BLPX 4Y4KB 4NRZA 2CHWA 1NCGA 1L0QA 2AQQA 4XCFH 2ZYSA 5DHVA 3DVFA 1KN4H 3DPDA 3MRBB 3QZPA 2H1XA 5DR5H 3RY4A 3BX7C 3M1OA 1MAMH 3P3RA 5C09A 4HUXA 4IBZA 4HC1H 3L45A 4Z7WE 4L8DB 4ALAC 1S7RA 3MU3A 4V1DE 2P24A 3T4AA 3CFQA 4RGNE 2Q8AH 1GGUA 1WAPA 2F18A 3ULUE 2WSPA 2CGYA 1W72H 4M93C 3FSWA 4H44C 2ATPA 4LOEA 4PJCA 3D69B 5DEJA 3U7WH 3ARBC 4EBQH 2L7JA 3DDFA 5DYOB 5FIEA 2BERA 2OYLA 4MZIA 2QMKA 3SE8L 4QHLA 4XO8A 1CO1A 3KYOB 3KYAA 4PRPB 2G9HB 3MRKA 2ZPKH 5E5LA 2JJTA 1JHTA 2I60H 1RZ7L 3HZVB 1OPGH 1W6LA 1ZWIA 2VZ1A 3N1GC 3QFDB 4H1LA 5E2TH 1AD9B 1LNUB 2C1PB 1AGEB 4NT6B 1EUTA 2XFXB 3MOBL 1UWGL 3MKKA 1JUFA 1J5DA 3LZRA 3QVAA 4P2RE 3LIZH 4GP8B 3HBPA 4WWPA 5B3JE 5EF3A 2FQDA 3IXTB 3RVVD 3P4MB 2I7OA 1NOLA 2OXHA 1YC8A 3P3UA 1T7XA 4ZUVB 4AMWA 3G6AB 2WO4A 3JT0A 1NGWA 2BVPB 3FTWA 5HHMB 1FORL 2YS4A 4HIJA 3KPRA 1B0RA 4APXA 1I1AA 3DO4A 1ETJA 3EH2A 1MJ8L 3QEQB 4IBLT 5I9QC 4EVNB 5F6HJ 1RUQH 1JG9A 1CFVH 1T04A 3VGHA 1N26A 3CFEA 2EEDA 3WLBA 3CBKB 4M5YL 2W0FB 2Z8VC 2P47B 2ZUQB 5DZPA 5KBNC 4WZ9A 4OCNC 2GBVA 1O9ZA 2W65A 3FT0A 5BUPA 5D96B 2ESVD 4K5NA 4PJIB 3UAEA 1UB5A 1I9IH 1OLZA 1K5NA 4G7SB 1FF5A 1KOAA 1AFVL 1DZBA 3C8DA 1AMXA 2FJGA 2NR6C 4KDTC 4JFDD 3KL3A 4O02L 1XR9B 3GGWB 1CFTA 2PW1A 1LD9A 1VCAA 2HKHH 4FQXC 5ICZA 3BAEH 5C8JB 1LE9A 1MHEB 2Y72A 4HWBH 4RISH 1F1GA 5J89A 4DF9A 1OP5H 1WAAE 4B7IA 2HT2C 4ZNEA 4UV4H 3L9RA 4P59L 2VXQH 1IKFL 1A6UL 1UWFA 1WLHA 1ZHNB 2F1EA 2NX5A 2AMUA 3I9PA 1NA8A 2XG4A 3CU1A 2P45B 4E68A 1RUML 4J6IA 3U46A 2Y7LA 4YPGA 3BKCL 5EU7E 3WSQH 5DFVC 3HZKA 2DM3A 3QUMH 2GJPA 3MNZA 4OQ1A 1INQB 4N0UB 4WI5A 4ZYKB 3W9EA 2FR4A 4IKNA 4KPHH 2X4TB 3TBSB 4WHTB 2Z92B 1DVFB 4GKZB 4TNGA 1EFXA 2ENPA 3RZWA 3EYQC 1ZT7B 4F1ZA 2QKIA 1G9NL 2GT9A 1AHMA 3T3ME 2O30A 5FAAA 1ASOA 2BHUA 5DJ0A 3SE3A 4CC4C 3JTBA 3GLDA 1INEH 2BNUB 4FADA 2CO1A 5C0NC 2VQ1A 4YUEL 8FABA 5DC4B 5IHHA 1QYGL 3CX2A 4JRXE 4XH2A 2YKKA 2G5UA 2IDQA 3OJDA 4HCIA 4ILDA 3QQ4B 1MCEA 3LNHA 3STLA 4OM1H 2Q0ZX 5GGSA 2IANA 4XPAH 1PLGH 5L2KA 4QGYA 4QYAA 2HJLA 3OKLA 2X4PB 3Q1EA 5KVGE 1LMKA 3RWFB 5DA4A 1DDTA 5TH2A 1T5KA 4WDIA 2XETA 2ICWA 2YD1A 4YHKL 5JXAL 2ADFH 4DPAX 1B4LA 1XV8A 2OK0L 1GYUA 2HH0H 1A2YA 5FYKE 2DIEA 4WU7B 4TQPA 1EANA 1CLZL 4G3YH 3RTQD 5DVLA 1BQKA 2RB8A 2WHVA 2JKIS 3QJXA 2VDKB 3ARGD 4LRNH 5J9PA 3LZNA 2VDQL 2VERN 3SY0A 4N0FA 4ODSL 2WD0A 3H3PL 3PQYD 4JM2F 4NQXA 3QNYA 1UM5H 2BNRE 2CRZA 3L4YA 4WKZB 2C9VA 12E8L 3LRSB 5L9DL 2X6MA 3AS0A 5L2JB 5AD0B 3X3GL 1GVIA 4XCEB 2VUOA 3ZK0A 3JWNH 4LOFA 3MJ7B 5DJXA 3EHBD 5IVXB 3IEAA 3UC2A 1KN2L 1TJXA 2V9QA 3V9FA 1P5UC 1BYNA 4N87A 2J6EH 3O41B 5IMKA 1V7NH 2NZ1A 2GJZB 3RVVC 4JCLA 3I6KA 1RLWA 4ZFOA 4UOJA 3ZHNA 5C07B 2PYEE 1KELH 3MRFA 4OLEA 3CSBA 4OQTA 4BA0A 3TCLB 4P5MA 4Z7OB 4ZG1A 2X88A 4Q6IA 4G6FD 3VRIB 5EEUA 1P6AB 3BKJH 1F18A 2C7UB 3NSDA 4IRSA 3RGVB 3ILEA 3D0VA 4KTDH 3T09A 2GCYA 4B0MM 3AWGA 1P84J 1MIMH 1QP1A 1I8AA 3Q3GB 3DOHA 5A3ID 1JTOA 4LKXB 3B8SA 1A6VH 1GZHA 3LQAL 4F57H 4IGBD 4JFED 3PJSA 4S1RL 1IBYA 1CU4H 1J5HA 1UASA 2DQUH 1KG0A 5KYYA 3O6FB 3GQFA 4L9LC 1HIML 2DH2A 1BAGA 3MRPB 4KZDH 2WXFA 1YYMH 2L4OA 3MRDB 5GSVB 2IO5A 3D48R 2AJVL 1AGBB 2KYIA 3EFOA 4JQVA 3NFNB 2YAOA 1FNSH 1BVKA 2ZXDA 4M5TA 3B8YA 4KFZC 4PRBB 4MJ5B 3QEHB 2XVBA 3H53A 3MACH 3MUHL 4P4KD 4RAUB 2CLVB 4AUJA 1PYWB 5I16A 4CSZA 1VFAB 4MJJA 4WO4B 3IAQA 1O7DC 2VKXA 5TFSL 2VZOA 3ATEA 2CO7A 2WY3B 3W82A 1EH9A 2B15A 1CXEA 3QQNA 4JKWA 5D93B 1AJ7L 2E75C 5MENE 3WG7B 1IM3B 4PP2B 1LJMA 1PF3A 3HC0A 4PV8A 5FYLH 2VSDA 4Z7NB 4S1DD 3HNSH 4BH8B 2BINA 3C60B 3ZTNL 1LMIA 2FCBA 3SCMD 5HSFA 4MJID 1KCKA 3GMOB 1TEGA 3D4ZA 4N9GA 3SZKC 2ZX9A 1U91A 3QUZB 3AVEA 1SVBA 2R7EA 2QPSA 4ZDHA 4PJFA 2WIIB 3H9SA 5TGBA 3GLZA 3PP4H 2EVJA 3BPCB 2V0AA 4N24A 4G80A 2EIJB 1BD2E 1Q1JH 3MBEB 3AZUA 3SE4A 4NQDE 3VG0L 3BUTA 1X5YA 3ZO9A 4X6DB 2LW3A 5D4IA 1L0PA 2H1LM 4LL1A 5I8KL 1U8LA 2QGDA 5FFGA 1IKOP 1SY6H 3CFCL 3HJ0A 3EFDL 2V9RA 3OQ3B 4JKPL 5I0WA 5K9QG 5K39B 4PGBA 1NAKL 1F4XL 3KBHE 1XAKA 5E5RB 4TNWK 4H8QA 5C08D 2Z7ZA 1JNHB 3OF6A 5C2UB 3TBWA 1CL7L 3H56A 2I9TA 2P4AB 3VM5A 1E9OB 1UZ6F 3QG6A 4XN8A 1KTLB 2X6AA 1U8KB 2HT3D 4PP1D 5DQ9A 4Z7WB 2YMOA 1MG2C 2DYPA 4GO8A 2X7LA 4V1DB 1OLLA 1NC4B 2Y7OA 4XNUL 4AV0A 4GFXA 2EILB 4NSKB 2H0JA 2ZX6A 3RTQC 5AKTA 3PL6B 1MXDA 1E2WA 4N2IA 1N8ZB 4NI3A 3W57A 3MROB 3PWPA 5ESAB 5FW7A 4P23D 4NENA 4XVSL 4HH9B 4GMTH 5D70H 1U3ZA 3SJVE 1RFDL 4ONHA 3U0TA 1ZA6B 1FNAA 2L7EA 3DMMA 4HZ1A 5LGHL 1E6OL 1ASQA 1XXFC 3Q01A 2XFGB 1E50A 3EHBC 1E5ZA 5D2NC 2IXQB 3EOTL 2VLRE 1OSYA 4P2RB 1BXUA 1OP9A 5JW3L 1URIA 2IDUA 5JIKA 4JDEA 5HDBB 1N70A 1I1CA 4F7TA 2VDNL 3OLDA 3QHTC 5FO9A 3O0RH 2Y1AA 1KBVA 1P4IH 2UXVA 4K94H 5C1MB 4NZFA 1FL5B 2D2CC 5EZPA 3KAAA 1O5DT 2ITEA 4QRRA 2EXWD 3WXVH 3EOYG 4DP4X 1OZUA 1MJJA 2WCSA 4AYDC 2VL5A 3Q06A 5DWPA 4B96A 3N50A 1QUPA 3CU7A 3ZE2F 3GMRB 5H8DA 2J21A 2XV3A 2LAAA 3NACL 2YEZA 3QIUA 5KVDE 5A3IC 1OOAA 5FB8B 5K59E 5I6XB 1ONQA 4ZMXA 3PV6B 2Y07L 5G5DB 1DE4B 4BQ8A 5IK3A 1ZGLP 5IBUB 4A55A 5E6RB 2LGNA 4N2LA 1ZRUA 1NQBA 4LCWA 4M03A 3NCEB 4PRIE 1A4JB 1JVKA 3QPXH 4G59C 3RL2A 3WI9A 4XNQA 4QLWA 5IJVB 3UZQA 2CCVA 4R83A 3FO1B 5AW1B 4PGEA 3U1SH 5I18L 4MAYB 5DJ8A 2R4RL 4Z23A 3CC5B 1NFIA 4KKAD 1NLBH 3ORJA 1ZVHA 1DLFL 4YGAB 3V10A 4JHZA 1YMMA 4R8WL 4ANKA 1SJHA 4K2UL 2OMWB 2CBMA 3ZDWA 2CBOA 4P4KC 2BSED 3RWJA 2JXMA 4PJ9A 4LHUB 2OXGB 1IAOA 1JFQH 2WB1A 4PJHE 4NWUH 5CJ5A 2IH3A 4N2FA 2VLMD 3EF4A 2VLLA 4QRPE 1LO4H 5JTWA 5INCB 2XN9A 3GRBA 3OAYK 3UYPB 3NA9H 4LHUD 2EINB 1TPXB 4FFZA 3LN9A 5BNXD 2WINB 2QBWA 4OD1L 4RVBA 1LXMA 2N0MA 3DUHA 4XP6L 5L6YL 2AJUL 1GKEA 4S1DC 3VYPA 2Q2LA 4Z3IA 3UPRA 3SCMC 2DTML 3RP1A 5E94B 3CIAA 4HV8A 4I48B 5EZJB 1BMZA 1DBML 4TQIA 3D07A 3MNVA 1WEJH 1KZQA 1C5CH 4IYKA 4ODTH 1C16B 4WFFE 4MAUL 5ABZA 3PWVB 3BZFA 1G7PB 2FTAA 5ICUA 1NICA 5AB9A 5H2BB 1A3LL 1UOVA 5BVJB 4GY4A 1ODAA 4JRXB 1NPUA 5DTFB 4X0KB 4RRPM 2GTQA 3GINA 3QRGH 2FD6H 1U93B 4TRPH 3NRQA 1NDTA 4FQPA 2DRUA 1LO0L 3SE9L 4JO2H 3WDHA 3MRMA 2H41A 4HJGB 4IBTA 3WYRA 1T22B 1PZ3A 4JPVH 4XWGH 2CG9X 4JR9L 1MFAH 3OXSB 2J88L 2XBDA 4Y4HA 4NCC1 2HT3C 3GMNB 4HSQA 4L0PB 2G5BA 4PP1C 1JYNA 1JTTA 3UBXI 1RJYB 4C4UA 1AVAA 1HN1A 3G04B 4G8GE 5CJXA 2DBLH 2HYMA 3W11D 2XUWA 1NMAL 1NGPH 3LEYH 5CGBA 5CD5C 1I8KB 1AO7E 4UT7H 3INUH 2XA3A 2YJQA 3FO0H 1LYQA 2WZ5A 4P23C 3VG9B 1SN0A 4OKDA 3OKKA 1OIOA 2VM9A 1S3RA 1N6VA 3D5OF 4N2HA 1B4TA 3CJJA 3JSSA 3UTTD 3V0GA 4ELMF 1SXZA 2BNRB 5TDOB 1CBVH 1HXYB 3S4SA 1HXMB 3IXAB 3SBWA 1JE6A 4CSSA 4ELDA 2AKRB 1BYPA 1X5XA 2A74A 1IC5L 1AR1B 1L9QA 4AK1A 3CBRA 1K85A 3WY2A 2P5WA 1OD9A 2OSXA 2MKLC 1NCJA 2NUPB 4NC0B 5BMFH 5JXED 4EN2A 2DI9A 4WJKB 1VZGA 3P11H 5F8RC 3IMTA 1AC6A 3U6RB 4MQXD 1F0LA 1OALA 2NCMA 3RJDA 1TTGA 2HLFC 1PZ5A 4RA0C 5GZOA 4PJGE 2Q86A 2F7IA 4X2UA 1JYVA 1FDLH 4NP4H 4Y9FA 5F72S 4L8CA 4Y1AA 4GRLB 3TFBA 3QXVA 2BMKB 3BIBX 4LCUB 2C3GA 3EGSB 1KXQE 1TNNA 4HEMA 4XMZA 1KTRL 1S5IL 3UBFA 1NL0H 3QORA 5DLML 1S4IA 2YQBA 4NO0D 2LLGA 4Z7QB 1F2XK 2X1XR 3S5YA 1UADC 3VQ1C 2AV7B 2BS8A 3WS3A 5IMMA 1LEGB 4Z3EA 5I6XC 4GXVH 2H0FA 2QVKA 2H8PA 5IR1B 1EGJL 5AW9B 3M7OA 1YVLA 4NQEA 4PTUA 2NTFB 4KKAC 4DKFH 3AY4C 1TFPA 2B4CH 2RAMA 3SKMB 3OMAB 2P7TA 5IVNA 3UO1L 5IB2A 3DX0A 1GTFA 4WV1B 4GKSB 4IS6A 4QHNA 5CGYD 1IM9B 3QHFL 4IIQA 4WENB 3H0TA 5JMOC 3TV3H 4LCIL 5JHDD 2F53B 1WYJA 2PCXA 3MMEA 3NIDF 2R2BA 4YDVA 4YHML 3CXHJ 5E2WH 5HPMA 4AKOA 1FRGL 1U0QA 1TLKA 3UTSD 4C56E 5MENB 3P69A 3BT2H 3W56A 3F7LA 4YHLH 4H40A 4QXVA 4WIQA 4P9ML 5JHMA 5IGXL 1I7ZA 1KENH 3OLEA 4XTRD 3AXIA 4LVNB 5F9JB 4LP8A 4A04A 5E1QA 2VDPL 1DVSA 5EC1A 3FRUB 4K7PY 2DMHA 2RD0A 2V6HA 1HILB 1KCSH 4S0TD 2CGZA 3K71A 3ZL1A 3U4EA 1IAKB 3BISA 4OM0L 4WTXA 3K2IA 4JK0D 1QRNB 1TCMA 1SJMA 3GSRA 5GGTA 1Q8MA 1WP6A 4DT2A 4UOQA 3QP3A 5IVOA 2XZQL 5J56B 3BMVA 3DJRA 1VERA 2DZEA 4NUGL 3T2LA 4B5ZA 2BWQA 2I26N 1QRND 1X5AA 1LK3L 2E86A 3GIZH 4KNTA 2ZXAA 1KMGA 2NY5C 4L29B 4TSBL 2HLAB 3D4YA 4AVIA 4JGUA 4EOWL 5K69A 4NPJA 1HL5A 4MS8D 1VACA 4AQZA 2XJKA 1SDYA 4X6CA 4ERSL 1RZJH 4YSEA 1E27A 5IFJA 3MRJA 3VFVA 1QSZA 3V5KA 2EEAA 3LKRA 4DUVA 3H7BA 4YL4A 1ADQL 3VWJD 3MGAA 3LS5L 2Y0SA 2BVQA 3KLKA 1RJLA 4KC3B 4N0RA 5BPPA 2ATKB 4PLOB 4MSWA 3W11C 2XRAL 1HHGB 3JV5A 5MEPA 4LLMB 5I6KA 3L3IA 1AC0A 3ZTDC 1DUYB 3DDGA 1OQOA 2AQ1A 3D3VD 2H2PD 3OKDB 4O2FB 2MCG1 3FOLA 1JDDA 2CGRL 3DHJA 4YS4A 3GD1C 5FOJA 2NR6A 2YOCA 1EJOL 5F7MC 4C54A 5C0EB 1CD0A 5CGTA 3SOTA 3GSXB 2FYVA 1G7LA 3L17A 5AKRA 4PV9B 4PJBB 2H6OA 2YGNA 3FCTB 5ID1A 4JJ5B 2ED6A 4MASA 1EHLL 2XTJE 4GAFB 4N2OA 4WI8A 1DBKH 3TT3L 5JXEC 5ALBL 3B7YA 4OI7A 2FL5A 2GHWB 2ITFA 3WNNA 4YDKH 5LKNA 5BS0D 2EDLA 1I1YA 4MQXC 1GJWA 3RL1A 3E8VA 5BZWB 4X80H 1NCCL 1WBXA 5EA0L 3NSFA 3U1PA 1TVHA 1KLFB 1QEXA 5J4MA 1MFBL 2QV2A 1ETZA 4GRWF 1NOAA 3AAZA 1R46A 3NCFB 4YN3A 4KUZL 1Q9WB 3ARZA 4PJ8A 2C5DC 1Q0XH 5DEGB 1XF3B 4N8VB 3F7YB 5SWZD 1OP3K 3SPIA 3V4UL 1FJ1A 3QDGE 2FO1A 3DK0A 3SBPA 4C55A 3A6BH 4FYRA 3CFJA 4N22A 1F86A 2X87A 1O75A 2QLYA 1TYEB 3J8F7 2OSLA 4WEBH 1JWSB 2YLKA 3S3PA 3SDAA 4CC4A 2MQ0A 2O6FA 3RWIB 2N01B 1YEWA 4RQQA 4JRFA 2J12B 2OAAA 1OB1A 4ZSOB 1PVHA 3QEUA 5AUMB 3X17A 3T1WA 1XR8B 5T3XH 3RIFF 4LASH 3PIQA 5AW2B 2F8VA 3X11A 3HG4A 3NCJH 4KHXL 4A7UA 3P0VL 4M4PA 3QPQD 4N8CL 1U8JB 5E4IA 3VCLB 1CFNA 1F3RB 5D7JD 5LDSA 2GFBB 5E4EC 5DI8A 4P3CL 5EO0B 2XKNB 2ZKHH 4J3XA 2WANA 4PJHB 1DVYA 4MHHG 2OR9L 2Z1KA 4Y4KA 3THMH 3A4DA 5A2FA 4QRPB 2ODIA 3MOAH 1C9SA 3H2WA 3P02A 1EJ8A 2CK2A 5F7EH 4WV1C 3L4ZA 2BVTA 5MP6H 35C8H 3REWA 2H26B 4DKTA 5JHLL 3FUEA 2VXVH 3MRBA 2WN2A 3S37H 1WBZB 2KS0A 3MGTB 1MWAL 3LH8A 4L5FL 4BKTC 3CLFH 5IHUL 2X0VA 3E3QC 2Q8BL 4L8DA 2I27N 5AG9A 2WWOA 2CDGB 3BAWA 4XTRC 3ULVD 3UBXB 4NBZB 1RUKL 4NUQA 3M1BB 3ROOA 1LO3L 5KSBF 1HE7A 3U4KA 3D69A 1NMBH 5B39G 5DYOA 5FYLE 2DBJA 4LVNC 1YSOA 4ZS7H 1M7UA 1A9BB 4PRPA 3UDWA 2WOBA 4HQQL 4W9HC 5L4JA 1WBYB 3K74B 1KC5H 1T5XB 3HZVA 4OJYA 1P5VA 4MD5B 4FABH 5DS1A 5F3BB 3NFPB 3QFDA 5F1NB 4ALAL 1AD9A 1LNUA 2C1PA 3CV5A 3GTNA 4JQIH 4Y9GA 4NT6A 1I9EA 1IBZA 2XFXA 5DD6B 2J1XA 3F7PC 2X89A 5J1SC 3DV4B 4MS8C 4NYLB 1JL8A 2HB0A 4FQCH 1H9DA 1ROCA 2OP4H 1JPEA 1JPGB 5CEZD 3IXTA 3AITA 3O9WB 3L2LA 3O2VL 4I4WB 2QSCH 3P4MA 3LXAA 3VB9A 4CDHA 4ZUVA 1SXSA 3ARRA 3VFNB 1N18A 3G6AA 2IFGA 2NQCA 1JSYA 3QHZH 4JY6B 4LPCA 1KB5H 3VWJC 1YC7A 4MWFB 3T65B 2BVPA 5FV1L 3SEPA 2EDDA 3KR3H 4P48A 4KRPD 4G8GB 1PMYA 3LZLA 1OP4A 2FJHB 4X4ZA 1BLNB 1OOWA 5DK0B 3PWLB 3I9GH 3QEQA 4EVNA 3N2JA 5DVPA 5ENWB 1RZ8A 3ZMNA 1AO7B 1G1YA 5L88L 1R3JB 2H2PC 2HJKB 2W0FA 4OW6A 3MFFB 2ORBL 4XP5L 4TSAH 1IGFL 3UFIA 43CAB 4UQCA 3KL5A 2WLKA 3U7YH 3H8NA 1EZSA 4QXUL 1B6UA 3DUSB 2WSKA 1WJ3A 4PJIA 1ZLWK 4LOUD 3BHBB 4H0GA 5JPNC 3M1CA 2PCPB 1Z66A 2C9UA 2DLFL 4U0RC 5LAXB 1E65A 1HQ4B 1WZAA 4NZ8A 1XBRA 4YHOL 4PRAB 4XMPH 2E59A 1XR9A 3GGWA 3ECBA 1JHKL 4L4JA 4HUUB 2ADGB 3VGBA 5C8JA 1JNNH 1MHEA 1DQIA 4XB3A 2ITDB 1PZBA 1NCIA 3TTYA 4PBXA 3BE1L 4GUCA 4NKIH 3ZN6A 4C59B 3NFSL 2FIKB 1ZHNA 5EG6C 4AE1A 5I76B 2F6AA 3W2DH 3S97C 2AP2A 1M2VB 4WU5B 4WFGD 4FLHA 4OCXL 3DI3B 4BKSC 1OAXL 1GIGL 1OW0C 3HS8A 5KSAD 5E6ZA 4ZYKA 2QQNH 1INQA 3PPSA 4N0UA 3ZY7A 3ZKQD 4Y8DC 4HETA 2YSSB 1NBZB 1AXIB 1Q9LB 3APCA 2X4TA 3KZ8A 3TBSA 1I7RB 2Z92A 1DVFA 4GKZA 1N2RB 3BPLB 3U9UB 1GHFL 4P4RB 3S2AA 1E0OB 1XFPA 1LLAA 2EIKB 3JV4B 5FA3B 2EH7L 2MFNA 2F54E 4LAQL 4UMGA 4W9GC 5E8PB 4I1RA 3IE9A 4DO5A 5CJOL 3QPQC 1R1CA 1ZLVK 4Z3FA 3AMLA 5ISZE 4K7FA 4HK3N 4BK5A 4NNPL 2WP3O 3QQ4A 3IFNL 4FI6A 1ES0B 1UT2A 3W38A 4G6ML 4G6KH 2E9IA 2M1KA 2X0WA 4KWUA 4FQHB 3V0AC 2X4PA 4C56B 3RWFA 4N25A 2DIAA 4RSYA 4TKWA 3MJGX 5DK3A 1DO6A 4GEIA 3CVHL 3V8OA 2YPLB 3ULVC 1BPVA 1GZQB 1IUZA 3A23A 4WU7A 2FB4H 4HXAH 4P57B 3R7RA 1OAZH 1H8OA 1G7MB 1G9HA 4M1CD 4F93B 3QQ3B 4KY1L 2ZOKB 5F8QC 3IAPA 3IS1X 4DPCX 4FNLH 4F2EA 4JHBA 1RIHL 5I0XA 4P9HH 3VXSB 4K9JA 3HB3B 2NT1A 4XBGB 1UZ6E 1VDGA 1VENA 3BSZH 3KVPA 2FBJH 2V17L 2BJMH 3LRSA 4MNQB 2VZUA 1W8OA 5L2JA 3WY4A 3HC3L 5AD0A 3MV11 1EZVY 1WVZA 4XCEA 3RWEB 4G9DB 1V55B 1LEKB 3MJ7A 4KK8C 4XNBA 5IVXA 4MB4A 3I6LD 1OD7A 3S35L 4UTBL 4JKKA 4EZLA 1UENA 3O41A 4GBXB 5GGQH 5KJ4A 1HINH 3VGFA 2GJZA 2BC4B 4PBWD 3SODB 5HYJA 1G6RB 1QSEB 4YSQA 5C07A 3V0VB 5KTEH 4M1DH 4PM1A 4MZ2A 2BNQE 2YUZA 5JUEL 2CBTA 3OX8B 5EN3A 3VRIA 1CBJA 5I71C 5E03A 2XJLA 3RGVA 4S0SD 2C7UA 1FL3B 2XZCL 4HLZH 1J9TA 3A4EA 4IJ3B 3AG3B 1CDUA 5E6ID 3RHWK 4HHWA 1ZLDA 1ZA3B 3CSYB 1CLYH 5AAMC 2F7RA 4U2ZA 4BZ2H 4IBSA 1G0DA 3PAYA 1WT5C 3DPBB 3Q3GA 3CCHB 4IBUA 1PBYA 3FMGH 4LKXA 2WO3B 3DLQR 1NCBL 1QR1B 3MUZ1 1YNTF 3WIHH 4N8PA 3LPFA 3RY5A 2OMZB 1WE5A 2PCFB 3VH8G 1AZRA 4DGIH 4G72B 1G9MC 3O6FA 1AAJA 2IAMB 3S98A 2ZOOA 4LOUC 2R39A 3MRPA 3U2IA 4MA1B 3MRDA 5GSVA 4YSCA 2VR6A 3GXDA 3ZOAA 4A63A 1AGBA 3FF8A 4HBCL 3WAJA 1AIZA 2CXKA 2XTJB 4DKAA 3NFNA 2DB8A 5L7XL 2N3JA 1E4XH 2IAMD 2PTVA 2SODB 3PUUA 3ZE2E 5I1AB 2OA9A 4HS6B 4PRBA 4MJ5A 3QEHA 5AAWC 3HS0A 1P6WA 4F80A 4RAUA 2CLVA 5EDXA 1OWWA 3RIKA 5EEZA 1WITA 4WO4A 5GJTH 3X1FA 1SDDB 2COQA 4A37A 1A7QH 2V5YA 5CZXC 2VWEE 4RX4D 5IHLB 5A7EA 4PVBA 5KJRH 3SDYL 1P84K 1XDTT 1TJHL 4HPHA 3HG5A 5IFAL 1IM3A 3SGDH 4AIXA 3RZCB 3A3YB 4PP2A 1R19A 3MUY1 3QDGB 4G7VL 5KSAC 1BWMA 1JBJA 2ARWA 3GXUB 1XGYL 4BH8A 4JO3H 3C60A 3HHSB 3L1FA 4BSVB 2Z9TA 3GMOA 4X9BA 4AIEA 5LXGL 3QUZA 1ZOXA 1QACA 2DYRB 3NIFF 4PVNA 3E38A 5TE4L 2WIIA 1H3PH 3SKNB 3QDME 5FCUH 1CR9L 3O2WH 3MBEA 2WVTA 4BFRA 4X6DA 5CMAB 4GPVA 4KGJA 4M1GL 3EYUL 1CE1H 1L9NA 1BIHA 2ZONA 3O2DA 1BG9A 4RZCB 3EO9L 1QBLL 3OLIA 3SO3C 2E6JA 5K39A 4AQEB 4ODHH 1MFCL 4PY8I 3EDKA 4K71C 3OB0H 2BIOA 3Q5TA 4X9YA 3ZUCA 4HAKA 5GS0H 2VIRB 4MA3B 1SEBB 2KDGA 1E9OA 1JYXA 1KTLA 5FUCE 3QCVL 1QBMH 2A1WL 2IVFC 1U8KA 5HJ3B 3RJOA 1FI8C 3MLVL 4Z7WA 1EZLA 3ARVA 3T2PA 4Z7VF 3I6GB 4V1DA 4EZJA 1D7CA 1NC4A 5HHXL 3FTGB 4RMWA 3JWOH 4NSKA 5BRPA 2FH8A 1ZTXH 3PL6A 5M7QA 4M1CC 5IB1B 4KZEL 5E2UH 2Y36H 2HKAA 3EJRA 2EIEA 1N8ZA 4NHUB 5DD1L 2YRLA 1J05B 4LDCA 3MROA 2IPUK 5ESAA 4KNSA 5HVHB 3C6SB 1B3JA 1EX0A 3WTWA 1JPTH 5CAYB 4HH9A 3T4YA 1BQHB 3TC9A 1SBSL 4V33A 4XVJH 3WNPA 3DXAD 2MOGA 5JORB 5KZCD 1ZA6A 5F97E 2VN3A 2FH6A 3D9AL 4UTAA 1NUNB 3MJ9L 4TQ8A 4JHWL 4O5LH 1R6VA 1A5FH 3BJLA 1E42A 4N20A 5D5MF 3VXUE 1TNMA 4KJPD 2IXQA 1CFSB 2ZF8A 2VDRH 5E99L 4P2RA 4UUJA 4KO9A 4WGWB 4EDWL 1BVNT 2R29H 1KNOB 3D30A 4LVOB 2DDQL 1AKJB 2KL6A 4U1SB 1T1XB 4F58H 3JYCA 2ERJC 2XN2A 2AK4E 4GAGH 2VZ3A 1FL5A 4KZCA 2UXFA 3ABGA 3RJQB 3A6OA 1BAFL 1M1XB 2AV1B 4Q14A 4ELME 5BV7H 3OB8A 1JGVL 3GBDA 4N3UA 4U05A 5E6IC 1I75A 5HY9B 1D7BA 3GMRA 4Y9CA 3Q05A 2QDVA 5LCVA 5K9JL 2BIHA 1PCXA 4FFYH 2A6KB 4EI5B 4H26A 4L3EE 3WLWD 2OZ4L 5FB8A 4IJ3C 2QADB 4Z7AA 1L0XA 3PV6A 1OM3L 4HEPG 1DE4A 2BOCA 4PJ7B 1BFVL 1E5CA 2B5IB 4Y19D 1JRHH 4O4YL 1BEYL 1AS7A 4ZW8A 4NCC2 1A4JA 1RXLA 3B9EA 2GIMA 4B9JA 5CO1A 2YQGA 1B0GB 4QOKE 2OSWA 5IJVA 2N0KA 3FO1A 2QFPA 5C0FB 4MAYA 3FO2B 4N90E 3CC5A 4M6AA 3GT6A 1RUAL 2BFGA 5DSCB 5HDRA 3VI3E 2IAMC 4IOFD 4DZBB 2OMWA 4OD3L 2C7FA 2UX7A 3CXDL 4MA1C 3UTQB 4JFXB 5ACMA 4YLCA 3T0ED 4L0ZA 2PXYA 1WAAA 2W95A 2OXGA 3Q2LA 4XAKD 3DIVA 2OULB 2WXHA 5I0VA 2R69L 5INCA 5BXFB 2B0SH 2QVTA 2YLHA 3UYPA 3A6CH 2ZCHL 5DJ6B 2WINA 4PW4A 2VMDA 2A9NH 3EH5B 5DO2D 1SHXA 1RUPH 3KG5A 5KYWB 1QSFD 3UERA 2CLRB 3WJLC 2ARJB 2PWFA 5E94A 1RSYA 4I48A 2L0DA 5EZJA 3EJQA 3OC5A 2AQNA 1NCDL 1MRFH 1OSZB 1EEYB 3ZSTA 1C16A 4HS8L 1CGSL 5EU4B 1H3VA 2Z3FA 5AVUB 3VXPA 1RP9A 3PWVA 1HZHL 3QQDB 1G7PA 3HR5B 4JDZB 3KWUA 2IH9A 3UIYA 3M07A 3NIDE 5H2BA 3R1GH 2DI8A 1T0PB 2E27L 1GGBH 3NP3A 3ZKSD 3GK8H 1MCWW 5BVJA 5D2LF 3JVFC 4JRXA 4K3GA 5DTFA 4X0KA 4D7BA 5ISZB 1NLDH 1HFUA 3B4NA 1HZKA 5D72H 2E7HA 5T3XE 4FG6D 2L7QA 5FF6B 1YYCA 4Y5XC 3R4RA 4KXCA 2WXIA 5HJBA 1KPRB 4HJGA 3V4PL 1T22A 2N7BA 5I5IA 4Z6AT 2XPYA 3OXSA 4R9HA 5GISH 1XTMA 4N4YB 5C0CE 3TZVB 4FD0A 4MXQD 3GMNA 5E08H 2EE0A 1YNKL 2K8QA 2PTUA 4JO1H 4QRTA 1RJYA 3HRZB 4B9ZA 4TNWF 3GFUA 3G04A 3SE8H 4FYTA 3K0YA 3TZVD 3S96B 4XXCC 2J71A 2D3NA 4F8QA 3EBHA 5K5YA 1I8KA 3F01A 3KXFE 7FABH 4AV4A 4DOHE 1OHZA 3FN3A 4WEMB 3MVSA 3FUDA 3IRPX 3VGAC 2BNRA 1T0NB 5TDOA 5EZOL 1EAPB 1EZUA 1U58B 1HXYA 2O6EA 4HALA 4PEEA 3T6VA 4DUWA 1HXMA 3IXAA 5BRZE 4NZUL 2AKRA 2CJ3A 5DDHB 5HVHC 3DX1A 2G3ZA 5HYIA 1HHHB 4MS6A 2UWEF 3VU1A 4QYOB 4KOCA 5HVFB 2X4SA 4KJPC 2P42B 3ZTJG 4FTVD 2APVA 3RPBA 2BCKB 5I23A 1BZ9B 1N0LB 1SFDA 3FU5A 4DP9X 2NUPA 1KJVB 3FCGA 3MAWA 1ZEAL 1Y6MR 3MA9L 3CX5K 3F7QA 5SWSE 3U6RA 5IQ7H 2PYEA 5ADOL 1NGZB 1FORH 1FVCB 2BNQB 1PLCA 1T2QH 4NIYE 5CKGA 3I2CL 3IBEA 4KH2A 4X5XA 1A7NH 3X14B 4I2XB 2RCSH 3TS8A 4PD4J 4GRLA 5HP5A 2BMKA 5L4FA 4F7PB 3EGSA 1SVZA 4R3SB 5DZOA 4V2CB 1B3IA 3WLWC 3OM3B 2XQBH 2ICCA 4LL4A 5B21A 3E9TA 3IF1B 3BOVA 4PS4L 1JXKA 4TQEL 2AV7A 1JGUH 3EGDB 3QWNA 1BHGA 1LEGA 4IU2B 3UJTH 2YA2A 2I5YH 3CHSA 3KDMB 4YHZL 2BIMA 4LSUL 2QSTA 4XCCL 1U3YA 1CURA 4GRWE 2B5IC 3AC0A 2NTFA 3CQPA 5DRWB 2QDWA 4KXBA 3BC9A 4IOFC 5DJYB 3H4HA 4MMZB 4FXGB 3SKMA 4HAFA 4DO6A 1KGCE 3K5RA 4P59H 4AZUA 4JHAH 1Q0EA 3T0EC 1DQQA 4N68A 3TBVB 3NTCH 1JWUB 3Q48A 3VUAA 5IP4A 4GKSA 1JNLH 1J10A 4IBVA 1UWEH 1IM9A 2JV6A 3NJXA 4JB9H 1LM8V 4NZRL 5GS2D 1BJ1J 2IPUG 1FVEB 1BM3L 2F53A 1DVXA 5E51A 5TQ2L 5MENA 3MV8D 1R4XA 3MN8A 5DO2C 4LDLB 1P4BH 5TDPB 1V7ML 3UO8B 5F7HA 3HS9A 15C8L 1GGYA 2R56H 2MQGA 4PGZA 5F9JA 3D1MC 3B9AA 3FRUA 4ANXA 3BFQG 1HILA 1RSFA 4HJ1A 3D8MA 1IT9L 3NZHL 1IAKA 4FJ6A 2YEQA 3F7RA 3NDZE 3QDMB 4JRYE 2WJ5A 4QNPF 2NSXA 4NQDA 1J11A 4RIRB 2VLKD 2B9AA 3F64A 3UMNA 3ZT5A 3AADB 2RGSA 1UB6B 3PHSA 4A7SA 4KXDA 4PG2C 4DTGL 2X4UB 5IB3B 5CSZB 5DWUH 3GSUB 4U1IB 3HAEB 4FG6C 3WBDA 4ZMQA 4L29A 4M6NL 2HLAA 5ID0A 2BW4A 1B2YA 1XF4B 4B3EA 2JSFA 2V2TB 4XPGL 1P53A 1L7TL 1MN4A 3WJJC 3KPSB 4GFTB 4KJWD 5H94A 5KSBE 1FE8H 2D3VA 5JXAH 2HFEB 1U3JA 4KNUA 4PUBH 1S78D 1PY9A 2H3XC 4HUWB 3DYMA 3MXVL 4MXQC 1OAQH 1CLZH 2ZWYA 4DNLA 4HCGA 4FULA 4G7YL 1IZKA 3EYSH 1ZLSL 4B27A 4WW1B 5FYJU 4E5XG 3V7MA 3U36B 2ATKA 1KCBA 4YR6B 3QJFB 4A7TA 3TZVC 1QFOA 3LHPL 1UJTA 1HHGA 4W6YB 2NY5L 4LLMA 4ODSH 1LL1A 1CWVA 3ZGHA 1DUYA 4WQOA 3P73B 3ARTA 2E6PA 2VQTA 2GSGB 5L9DH 3OKDA 4O2FA 5IESL 5DHVH 5I73B 2VZVA 3O4LE 3OPZL 4W9FC 5FPIA 3IJHB 1EVTC 4OI8A 3ZDXF 4FQIH 5C0EA 2PO6D 1JGIA 3MLUL 4MYPA 3GSXA 3P3SA 1NC2D 2ISDA 4PV9A 5DXWA 1E4WH 3FCTA 4JAMB 3V9CA 2W94A 4WO0A 3VMPA 4JJ5A 3C8HA 2GTZA 2ED8A 2FEEL 3LRHA 4XNAA 1GPOL 2BOLA 3ML9A 1MY7A 2YUXA 3O3UN 5GJSH 4KDVA 4LLUB 2ZP0T 5FGSA 3ZO0A 2DS4A 5BZWA 4N3TA 3NJMA 2AK4B 3F7KA 2ZSWB 1KLFA 4RFNC 3OD3A 2DMBA 1EIBA 2YAQA 3S3JA 4RZKA 4N5UA 2LVCA 4ELMB 3RNQB 2WNWA 4WNSA 4LB8A 3L3OA 5TDNB 1Q9WA 4ZX3A 3MUUA 4H1LH 4PWHA 5DEGA 3RDTB 3LQAH 1XF3A 4N8VA 3F7YA 4S1RH 3MTXA 3FDWA 4NKMB 4XP9H 2YC1B 1CJYA 4CMHB 2F8IA 4P46B 2HX9A 4R5XA 3VFGL 3L54A 4H5SA 1JWSA 1MCSA 2EDNA 3GC3A 4DHLA 1X5MA 5GRYA 4N2NA 4R5VA 3RWIA 3EOAB 3B56A 4QOKB 3W1ZA 4ZSOA 2DJMA 5AUMA 1ZSDA 1XR8A 2DIBA 1GA2A 2Z8SA 4M00A 1VGEL 3GJEB 4JZJB 1J8HD 3VI3B 3C6EA 5IROC 4HK0B 1U8JA 3LEVH 5KUKA 3TXAA 2MJWA 5A16B 2V2WB 3JZYA 1F2QA 3UJJL 4B9KC 3K2MC 1AJ7H 2XKNA 5EO0A 4PJHA 2A9BA 4MMZC 7PCYA 1RY7B 5ALCL 4QRPA 4IRJD 3II3A 3UTZB 2A99A 3BAIA 4JN1L 2BXYA 5CUSH 2VDOH 2W9DH 4ODXA 2H26A 2UXGA 3HEIB 3ZTNH 1DJIA 1WBZA 3MGTA 3JWDC 4UM9D 3L5JA 1N6UA 4O9HL 5HHOE 2CDGA 1JPSL 3B37A 3QA3B 4UQIM 3UBXA 1K8IB 1OGAD 2QHRL 3QI9D 3GI9L 2HKFH 4X4MA 5HHVL 2Z0UA 4A7GF 3WS6A 3EXLA 4OCWL 3VG0H 4J8QA 3B2UD 2GSIB 3I50L 5LHDA 1W16A 1KJ3L 3L9YA 3QXAB 1A9BA 3LJ3A 5AVVB 1D3CA 3HVDA 3NIDB 2IWKA 4QJ3B 4A7QA 1WBYA 4GEJA 5F71A 1NAMB 1T5XA 4GI9A 4MD5A 1X9QA 4X8CA 2DJUA 2W8CA 3NFPA 5F3BA 2YWZA 5F1NA 4JNXA 2CMRL 4QCIB 1QKZH 1AS6A 2BSSB 5F88B 4OVUA 4HKBB 5DD6A 5E1AB 3DV4A 3ZYOA 2RJMA 3GI8L 3A67H 1YDPB 4KJWC 4OSUL 1JPGA 5FHBL 3R18A 3O9WA 4LFHD 1A9VA 1Z5YD 4I4WA 1D9KB 3LNEA 1XZWA 3QXWA 2ICEB 1S78C 4DQAA 6PAZA 5JIQA 5C0CB 1EEZA 3SOBH 1J1XL 3VXMA 3VFNA 4AT6B 1CLOL 1GYVA 1OF0A 4MWFA 4U2YA 3T65A 5A40E 2NY7L 3P30H 4IOSA 3RX5A 2CJUH 4G8GA 3ZW3A 2A9ML 1IGTB 3CFKB 5ICXB 5KWYC 2FJHA 4JN2B 5DK0A 5D1XB 3PWLA 4EUPB 5ENWA 4NN5B 5E0QA 4DGVL 1RFDH 4HC1A 5IV2B 1B0WA 1AO7A 1WS7A 2AGJH 4TUKL 1R3JA 2ZUSA 4FQLH 2HJKA 5GSRB 4DOHB 3HZYB 4AL8C 3MFFA 4GI6A 1D5XB 1KZYA 2VAJA 3N43F 43CAA 3C08L 5G4MA 1HL9A 4X4YB 1ZTXE 3IWVA 4KVCL 2WVUA 3IK2A 5BRZB 2PO6C 4U49A 3DUSA 3BHBA 5AAWA 3ML8A 1OAYH 4Z76B 1ZDSA 3HI6L 5LAXA 3VXMB 4LSVL 1HQ4A 3U1QA 1RCYA 1U9KA 4YJZL 4PRAA 1E8XA 2CDEB 3WFCH 1DJSA 4HUUA 4MJ4A 4Y4FB 5SWSB 1CF1A 2ADGA 4DPRA 2ITDA 4PREB 2O6PA 1UJ3B 3WO4B 2G0LA 2DKUA 2P5PA 3AB0B 1DEDA 4XNYL 4XMWA 2FIKA 3LIZA 3NACH 4PR5A 2VO8A 4P07A 1LO2H 1J86A 3WV0A 5I76A 4AJ0A 4JPQA 1M2VA 1T83C 3JZ7A 4WU5A 1KXQA 4LCCB 2GI7A 4QHKI 1NBQA 1QOKA 2CKNA 3HUJF 1B88A 1AHWB 2WQWA 5FK9B 2N7AA 3KE0A 4WI3A 1SYVB 1JIBA 4AQOA 4Z77B 1JZ8A 3BSHA 5JPMB 1NEZB 3C5JB 5T8IA 1TZGH 1NBZA 1Q9LA 5D1QE 4BBWA 4NOBA 3K5SA 1JZ5A 1I7RA 4L1LA 1N2RA 2FE0A 3U9UA 4P4RA 1URLA 2EYRB 4OQTH 2DQIL 2C4XA 3IU4H 3L6FB 4KQ4L 4DP0X 1Y1DA 2A7BA 2HG0A 4GRWB 4R8WH 4E9VA 1KWKA 1CDBA 1ITBB 5DZ9A 5FA3A 3IJ7A 1IC4L 1Z2KA 3RWHB 2XU9A 3NJGA 3ROLB 4YVNA 5DVNA 5E8PA 3S5LA 4MD4B 1CYXA 4WCYH 3B83A 1HNYA 1T6WA 2DQFB 1QPPA 2VN7A 3QUYB 2EACA 1R3IH 5TK4A 3EBAA 3WTYA 2P5ED 3CZEA 2JIXD 3C8KA 5ICYB 1NKOA 1ZS8B 1ES0A 1JXDA 3VD5A 1DSYA 3QUYD 1IEBB 3EG9B 3NIFE 4XP6H 5K9QI 4FQHA 1KEML 3IDIB 4C56A 4WEUD 2JH2A 5CILL 5FO7B 4XPTL 5EUOF 3QRFM 3PP3H 1OCZB 4RDQG 2YPLA 3ATAA 1GZQA 3BJ91 4HPYH 5AVTB 5C0JB 1OE2A 4K73A 1INDH 3QI9C 3CMOL 4A6YB 4XNZB 4P57A 3ZQWA 4KRMB 3PY9A 3N1FC 2F61A 3DX4A 3MTRA 3NEOA 4XC3H 4GSXA 2IGFL 3QQ3A 3VYNA 2ZOKA 3BD4A 3R0NA 3B2UC 1UACL 2RA1A 2Z93B 3DVNB 4OGYL 4Z0XB 1NFAA 3LKNB 3F00A 3RWCB 1JRHI 3WXWL 2AK1H 4JRYB 4XN2A 3VXSA 4X8XA 2Y7QB 5C6TH 4D94A 4XBGA 3M6DA 5E1GA 1P7QB 4MNQA 4XX1E 2ILLA 2NZIA 4AJYV 5DS2A 4NQSA 3I3BA 2XBZA 3RWEA 2D4DA 3ULVL 4G9DA 4Z7VE 1D6VH 3WFEL 1U95B 4DN4L 3T71A 25C8L 4JR9H 3EYFB 3LS4H 2OCFD 5T1MB 1I3GL 2BLFA 4Y16B 2VLJE 1B4JH 4GBXA 3CFNA 5KSBB 2BC4A 4OIIL 2EIBA 4DP1X 1G6RA 1N5AB 1QSEA 2WLJA 5GGSY 3V0VA 4EKJA 5H37G 4GIOA 1E3FA 4LARL 4LSRH 3OX8A 4AK2A 5D7LE 4E41B 2Y69B 1EQWA 1FL3A 2A3TA 3R7QA 3KH4A 1THAA 1ZA3A 3CSYA 5DMGD 1EMTL 3DPBA 1OF2B 5D5ME 1KPVB 3CCHA 3KLQA 4E41D 4D9QD 3G5WA 3QEGL 5KSUB 1LP9F 4M7KH 5D4QA 2PPAA 5CEZL 1QR1A 4X9IA 5D1XC 5KOMC 3SPGA 4ADGA 2OMZA 1CK0H 2PCFA 3O4LB 1QNZH 1X4XA 4LBEA 2B08A 4NN5C 2UZYB 4WUKH 4YE4H 2IAMA 3KW8A 1WTGT 3BWZA 3CGTA 1I9RL 2ZCKH 2CQVA 2AJSL 3JTTB 1NCNA 1XMEB 1QHOA 2BVEA 5EN2B 3GDCA 4XNXL 3T1FB 2D2OA 2FX7L 3I84A 5I1AA 5I1KH 4HS6A 3TCXA 4MA7L 4NI6A 3RUGB 5F3HB 1MJ7H 1RULL 1SDDA 3BP7B 2X3BA 3ABMB 3P0YL 5DRZB 5IJBC 3GSOB 2J6EA 1G9ML 2GVYA 2OMXB 5DLMH 5F1KC 2C9SA 4WFHD 5E5MB 3WO4C 1UJ3C 4BFEA 1AYOA 3DJZA 4PYGA 3RIAF 4CN1A 2DJSA 5EPMB 3RZCA 4GT0A 4CU8A 3QDGA 4FFWC 5B3NA 2R0LL 5TPWH 3DECA 3HKZA 2E0PA 4GQ9H 3HHSA 3KGTA 2V7NB 4LCCC 1NCWL 1ML0A 4BSVA 4B9PA 3PS6A 1RZGB 2EDTA 3GTTA 3ZDZF 2Q2EB 4JPWH 1AHWC 5AVWB 1AYRA 2WUCH 3CFUA 4UV7H 5DGRA 1S6NA 4XR8C 1MNUL 2BDNL 5JPMC 3SKNA 1ZE3H 3CPUA 4FEMA 1FYTD 3KJ4B 2EDYA 3V5DB 5F70A 4NKDB 4CBZA 5AVRB 2VDLB 5CMAA 5KEZA 3T0WA 2YA0A 1CIDA 5DQDL 4F1SA 2YK1H 5EOQH 2R83A 1Y0LB 2HT4D 4AQEA 1FFNB 4LCIH 4OBRA 3MREB 4U1GB 1P6FA 4ES8A 5AOLA 1BXAA 4YHIB 3BO8B 1E28B 3QZOA 3KS0H 3QUYC 4LSPH 5F93C 5B1JC 2VIRA 4MA3A 2LU4A 4OJFH 4DH2A 3UYRL 1SEBA 3UG3A 3KYKL 3IPEA 1LK2B 3QFJE 1RLBA 2YOAA 1IGJB 5E95B 1S46A 4BE6A 5HJ3A 3US1A 3LNGA 5LGKA 4JG1H 3VFPB 3ARYA 4FDWA 5E6YA 1AQHA 5IT2H 2WQSA 3I6GA 3FTVA 1IBGL 5AEAA 3FTGA 3OKOB 4HPOH 5D2LE 4L4TD 5IB1A 4NHUA 1C5DB 2EDOA 1CLVA 3GUTB 1J05A 4GG6B 5BW7A 3QSKB 1TJMA 3WUWG 1U30A 3MRLB 3E7JA 4NUGH 3C6SA 1EO8L 3HLKA 3ME0B 3DIFB 3BWUF 3KPOB 5JORA 1BQHA 1PZSA 2DPKA 1A1MB 3GSNH 5ERWB 2XY1A 4FFZH 4A2GA 4PLJD 1USQA 2IBZX 4GI8A 2V5SA 2DQTH 3T5WA 3SJVD 1YEGH 3VFMB 4XCYB 1Y07A 5EU6D 4JCMA 3FT3B 4P2QE 1WIOA 3TVMD 3V5HB 4OLZH 1NMCC 2HSIA 1UQSB 3ASNB 1KNOA 2VLRD 3BSGA 1SY6A 3PJNA 1A21A 3EO1A 1AKJA 4U1SA 5CN2A 1T1XA 1KIQB 3Q0HA 2JLPA 9PCYA 5MI0C 1MHHB 1BMGA 4PRDB 3ILPA 4NZTL 4K3DL 1M1XA 1CI5A 2AV1A 1IZJA 2VR9A 1R3KB 3D52A 3G6JF 3WNKA 5LAPA 3TGXA 3AROA 1TG8A 5HY9A 5DMGC 1YAZA 3A5VA 4MBOA 3RVXC 3FTXA 1A6PA 3NJHA 3B2VH 5KYUB 2P80D 2UWEE 4L4VD 5E70A 2A6KA 4EI5A 5JDJA 2DEXX 5IY5B 1BIIB 3HC4H 1B2WL 3LKQB 4PJ7A 2VW6A 4RLDA 4ZFGL 3FB6B 2J73A 5ANME 3NN8B 2APFA 2H5UA 4JFHD 1B0GA 1VJSA 1RD6A 4PRID 5EEYA 3U48A 4WWKD 3TBBA 5ALBH 5C0FA 1YEFL 5CZVL 5T33L 1J0HA 3FO2A 3A4FA 4JLRB 1PSKL 1YEEL 5EA0H 4X5LA 3MLRL 1A3ZA 2DICA 4HMEA 4G9FE 3JYBA 4JFZL 4L8SB 3HZMB 3CDZB 3UTQA 4JFXA 4M4RB 1V8HA 3RB5A 2EDFA 3F58L 3DWTA 3UYOD 3BLKA 4HOMA 5IQMA 4KUZH 1BCIA 5EZLB 3WL9B 2AXJA 2GITB 2VDRB 1YNTB 5KVEH 4YDNA 3V4UH 1HAUA 5BXFA 3ARED 4XP4L 3IGFA 2QQLH 1MUJB 5DJ6A 4H0IA 1JV2B 5K1JA 5TE6H 4YSUA 2JCCF 3EJZD 5AB1A 4I5BB 1QWHA 3GJFK 3IT8D 3DJSA 5KYWA 1BZ8A 4NPKA 1DL7H 3OZ9L 2CLRA 2ARJA 3ARFB 5HI3D 1CDGA 3BD3A 4LSTH 4WY7H 4DAGL 5J1AB 2ENSA 3HMWH 3QIBA 3RAJH 1OSZA 1EEYA 2PPEA 4YSPA 1ZLVH 5EU4A 1J0KA 4UB0H 5EUKB 4JDZA 3QQDA 3HR5A 3EGXB 2F54A 2OJEB 3MODH 1DFBL 4XMKL 1AG6A 2CK0L 3PG2A 4JREC 1J5OL 1FAIH 1OGSA 2D0FA 2PETA 4OU3A 1AOHA 2HT4C 4KAQH 4WK2B 3Q6GH 3T8XA 5ISZA 3KJ4C 4ZX4A 4QWWD 1NM9A 2F5BL 3EO0B 4Z18A 5FF6A 3KMDA 4QRUB 2AMGA 4L2YA 3I02B 3KPRE 1F6LL 3AJ7A 1KPRA 3O6LH 4R4ND 3CHOA 1QTPA 4ONFH 4HIXL 3QG7L 5E8EB 3VQLA 5LUMA 4FEIA 4Z8FH 2R0KH 1F56A 3TZVA 3VSTA 1RZIB 2K7QA 4QNPE 4LPYA 1VSCA 4JVPA 4AITA 4OCSL 3HRZA 3VWKD 1X5IA 1P1VA 4PQXA 4UQ9A 1FYHB 3SYCA 1GC1C 3IGUA 4MNHB 1BA9A 3GZPA 4OV5A 3FOMB 4FF9A 3S96A 4D7PA 4WWID 4HQQH 3PHAA 3R06B 1D7FA 3SHSA 1Q9KB 2VH5H 1GY1A 3BN3B 3OG4B 4MJHA 2EVIA 4LLVB 4ALAH 3T04D 3RB7A 4Z7UF 4XO5A 1AXTH 1T0NA 3BDYL 4FZ8L 4J28A 1EAPA 4K5LA 1U58A 1C08B 4PLJC 1F58L 1QTSA 4RMUA 2B59B 1HYSD 5D71H 5DDHA 3D18B 2ZG3A 1HHHA 4KQ3H 2WXLA 4Z7VB 4QYOA 3TJEH 3U0WL 1W2KT 5BZZA 3O2VH 3STBA 2R0ZH 2V5TA 5E6SB 2BCKA 4M6ML 3TVMC 1BZ9A 1KLUB 1N0LA 3NABL 5C0AB 3UPAA 3WTXA 1KJVA 2VLJB 2WBKA 3FYIB 1ACCA 3H42L 4PCKA 4OFYD 1N64L 3B34A 4M61B 2V37A 5I1CL 4QRSB 2BNQA 2IFFL 5FM8A 1A0QH 4WUUE 4H8VA 4FL4B 4JPSA 5D7LB 3X14A 4I2XA 4AWJC 4KBPA 1KTBA 3EJCA 1TENA 1PD1A 4LQFL 4YGVB 3ZDXE 4F7PA 4I3SL 3VACA 1KEGL 2VR7A 4R3SA 4PI2A 5DJAA 3EBGA 3TONA 1ZXQA 5D5MB 4XP5H 5E1IA 3QDAA 2HN7B 2Q7AA 3IF1A 4QXUH 5EFIA 4B6ZA 5JLZB 4UZUA 1SFHA 4AQ1B 1ECYA 4MCYB 3VNYA 4BQ6A 1JF5A 2DLFH 4JDTH 4IU2A 3EF7A 3KDMA 2P3YA 1IBFA 1PIGA 3GXIA 1H5BC 1WFIA 4OJAA 4WWKC 3TM6A 5LN8A 5IROA 2ZOTA 3ZKMC 1BAWA 3HE6D 2IANE 2MQ3A 4O00A 2P43B 5DRWA 5GGRY 3ZYJA 1EXHA 5DJYA 2X28A 5A1AA 4FXGA 3BE1H 1EJFA 3NFSH 2YD3A 4UNTA 4BFFA 1CL7I 2ZCLH 1XGQA 1GMIA 2XICA 3TBVA 1C1EH 1JWUA 4ODVL 1A9EB 4Z78B 4WTQA 1KV7A 3WEAA 2HMIC 3U4BH 4OCXH 5FV2A 2K4AA 1J8SA 1FVEA 3CVBA 2OCCB 4M6OL 3FN0L 3AREC 5BO1H 2A6JB 2J8UF 5FUZL 1CQYA 3UAAA 2PPCA 5IBTL 4MHHI 2J7LA 2YXFA 5CXPA 5TDPA 3NESA 4Q0XL 3NJIA 4NWTL 4Z3HA 3GS4A 5JNYB 1M53A 5HI3C 2NY2D 3LRLA 5LBSA 3WY3A 4U1LB 1HH6B 2Q9OA 5E9AA 1MQ8A 4UQ3B 3PWJB 1K4CB 4HF5L 4U4IA 3TF4A 3QDMA 2DQEL 2V5MA 1Z9LA 5IQ9B 4GIPD 4RMVA 1OAKL 3HE7B 3PXHA 4ETQB 3ISWA 2W5PA 3DBXB 2X42A 3MGOB 5BCAA 2X4UA 5IB3A 4QWWC 4O02B 5CSZA 5F3FA 1FVDB 3GSUA 4U1IA 3HAEA 4DQOH 3IMWA 1F4YH 5B7FA 1XF4A 3HE7D 5D7KE 3L13A 2V2TA 4AYFA 1AGCB 3KYMB 4R4NC 2OKMA 3KPSA 4LEXL 1MKFA 3CVHH 2HFEA 4UT6A 2G75B 3G3LA 5M95B 3QFJB 3ARSA 4PCTA 1FO0L 5JR1L 1K2DB 4X4XB 4UOW0 1JMXA 1H9VA 3Q5OA 2BRRH 4WW1A 5IW3A 1T6VN 3VWKC 1BQSA 1MCRA 4KY1H 3U36A 1WFMA 3QCUH 4YR6A 3CN1A 3QJFA 5EC2B 4AM0B 5D2LB 4I9WE 3OMNB 3REVB 1RIHH 1HU8A 4LPUA 2ADJB 1U8IB 5D7IB 3T0XA 5IUCA 4M7LL 2MCPH 3QAZB 4M7ZC 4ZX5A 3P73A 4GW1B 5AZ2H 3RFRA 4QTIH 2DTSA 1RK1A 1HHJB 3MV9E 1BXVA 2GKIA 1TUPA 4OZHB 1AZUA 3QDJE 4JG5A 3L16A 3IJHA 4WFEE 5FXCH 2CALA 3VQ2C 1N7ML 1HYSC 4LLQB 3QNZB 5BOZG 3NCCB 3TJPA 2DW5A 4JAMA 1BWWA 4P2QB 3I85A 1OSPL 4QEGA 4WTZG 3LXBA 4TNVK 3B3IB 1A4BA 4LLUA 4HCFA 2E9WA 4JO4L 4J3OG 3H9HB 3FCBA 4Y5VA 2AK4A 4XPBL 2ZSWA 4FI7A 4OLXH 5CLWA 1EHNA 1PX3A 5IZ7A 2XYCA 5FWRA 4ELMA 3RNQA 5E2VL 5TDNA 1KF9B 2XV2A 3Q2NA 4EDXB 5D6DA 1XGPB 3RDTA 1NCBH 1P2CA 4FL4C 2UWEB 3KGRA 4KVNH 2QSVA 4NKMA 2YC1A 4JKNA 2FVNA 5HPOA 3OVUB 1S7WB 4P46A 4YXHL 3L8QA 2F74B 3VXNB 1U8MA 2JKSA 1XB6A 2MEJB 5CIPB 3ZKND 3UAJD 3VX1A 4Z7IA 2QJDA 5CGMA 2VDQB 1U3HB 2CBPA 2DMKA 4JMNA 3EOAA 4QOKA 4LL9A 5L7XH 4HAGA 2PMZA 1WCQA 4HWZB 4G6AD 4QAMB 4RMQA 2DWXA 4P49A 3P9WB 4XVOA 4JZJA 3VFTB 4BGLA 3VI3A 3ZPDA 2C3XA 2I9LB 3UC0L 3RY6C 2FT6A 4G9FB 3QXDA 4HK0A 5DO8A 4BA8A 3HUJE 3SYOA 3KWTA 2CO2A 3SKJL 3S37X 5A16A 2V2WA 3C6LB 3MJ6A 3VRLE 2IQ9H 3CSTA 2F7OA 5IFAH 2X9XA 1BF8A 3UTZA 4J2QA 1EVUA 5EO1B 2JB5L 1U8NB 3FW6A 3FQNA 3U30C 2YAEA 1L9MA 3CN4A 1U8OA 3L4UA 3VGEA 3C2AL 3JV6A 3I74A 1IMHC 4W9ZA 3K46A 2MWCA 3GB7B 3QA3A 3UG4A 3PWUB 4EZMA 1AE6H 1K8IA 3AG1B 4AEEA 2NY2C 1YECH 4JO5A 4NQCE 1T1WB 1LEIB 4LRIA 5LBGA 4KX7A 1TKWA 2AJYL 3MXWL 1PX4A 4FNQA 2GSIA 3PXJA 5SX5K 1SOKA 5JW4M 3POCA 2FT8A 1JP5A 3LRMA 3QXAA 2ZWSA 4O51A 1ID5I 1OKEA 1XXDC 3ENEA 4M62L 2A5UA 1QBLH 1PIFA 5HGAB 5DHDA 1ODUA 2K70A 1A1OB 1MFCH 1F1AA 1OGPA 2AANA 1NAMA 2FATL 2ZD0A 3CH8A 3JWDL 4JQXA 4MQSB 1T89A 1YPZB 2XDHA 2YIHA 5HGBB 4CADB 1MLBB 3U0PB 4QCIA 4IRZA 5EUOE 1X7SA 1D5IL 3DKHA 4XMTA 2BSSA 5F88A 3RILA 3ZIMA 1FV1B 4HKBA 4MMXB 1TTCA 5C0RL 1NIEA 2L7UA 2XN0A 3HE7C 5E1AA 3S4SG 3IGKA 4I0PD 2A1WH 1YDPA 1J1PL 3D2UB 4Y5YB 4HA1A 2A73B 3WNMA 4Z3TA 1D9KA 2ICEA 3T6WA 1QASA 1RQ5A 4KTYA 1AI1H 5C0CA 3S3BB 4AT6A 4YO0B 1JS4A 2BFVL 2VUYA 4KZEH 3K0WA 2AS5M 3LNFA 4A66A 2J3SA 4PWFA 5E56A 5ICXA 1IGTA 3CFKA 4JM2D 4JN2A 2CKBH 2GK0B 3HOGA 4RBPH 3VXRB 3ZYZA 5JOPD 3S88L 4UYQA 5D1XA 2QGCA 1CQKA 1XF5B 2Y24A 1KJMB 4EUPA 4Z7NF 3L4CA 4P5SA 5IV2A 3K6FA 3KXFA 1KPUB 2W9EH 3NSJA 4JZOB 5GSRA 3HZYA 3N55A 2NYYD 4BUQA 3DTDA 1D5XA 5CCKL 4JHWH 2HWZL 4X4YA 5JZ7D 4HVBA 3QQ9D 3APFA 4ETYA 4F7CB 2QFRA 3QAZC 5BRZA 5I1IL 1PX8A 5E99H 3HTLX 2ZTBA 3TH4T 1AP2B 3NA4A 4Y2DD 4Z76A 2DDQH 1DJYA 2NY6D 4EPSA 1AQKH 1FNGB 4R5TA 4PJ5D 2CDEA 1F11B 1UXWB 4Y4FA 5SWSA 2VDKH 3FCSB 3JVGC 4HWEL 4RWYH 3ARDB 1JGVH 4PREA 1LP9E 4AL8L 3GMMB 4EAEA 2WQ8A 3JWNC 2K6YA 4WUUB 2OM5A 3FQRB 3CQFA 1KJ2L 3ALPA 1JERA 1HCFX 4DKDC 4RGOH 1OM3H 3ZDXB 3UMTA 4LCCA 4BHUI 2FLBT 5BUAA 1BFVH 3ZL4L 4E9QA 5C7XL 2COVD 1YG9A 2X9YA 4TSCH 5AOZA 1BEYH 5FK9A 3BP6B 4GOSA 4Z7WF 2E7LA 3KNBA 1KBBA 1IU1A 1SYVA 1M6OB 4Z77A 2OL3L 3ZKNC 5I0YA 5JPMA 1NEZA 3C5JA 3UAJC 5AAPA 3LV3B 3MV7D 1UM6L 2F7QA 3V4VL 1TVBB 2EYRA 1PJWA 3L6FA 2CNYA 4G6AC 1I85C 2DQCH 3CPLB 5E8OB 3FB8B 4DN3L 2YWYA 2YBRB 5F9DC 3RWHA 4OLWL 1BVNP 2H0PA 1GGCL 4MD4A 4BFIB 2AABH 1YEIH 3KHQA 2DQFA 2IBBA 2UUDK 1L7IH 3MYZA 5FCSH 4CN6A 3MBWB 4I8DA 2Z31B 3PF2A 2IADB 4OLUH 5I1LB 5FYJH 1A4AA 2ZCHH 4F37F 2VDNB 4NKOB 5FA4B 5ICYA 1ZS8A 4KX8A 4L8BA 2OR7A 3ZDZE 1IEBA 3EG9A 5HDBF 3UABA 1Q0YH 3C6LC 1FNHA 1WZLA 3IDIA 4XB7A 4P5TB 3NK4A 4Q8BA 4TVUA 2QMJA 2WBJB 5FO7A 3U2JA 5I1GH 1A4KB 2KQMA 3CWGA 4PS8A 1QRKA 4TLSA 5KVEE 5C0JA 4OV6F 2OX5A 1V5JA 1NCHA 1CGSH 2ZJSL 3Q1SH 4HS8H 4A6YA 2KZBA 1R34A 1FH5H 2NT0A 5CR8A 2ENQA 4JANB 2MCMA 4CGTA 4M8VA 3VYOA 5IJCC 3IE4A 4LU5L 2CSPA 2E27H 2P5WE 2Z93A 3DVNA 3V6OE 4EI6B 4Q58C 4Z0XA 4J4PA 3LKNA 1ZHBB 4JRYA 4APQD 1U8QB 1MWOA 4J3BA 4QXTB 4AVJA 2Y7QA 4P8QA 1HI6B 1DQVA 4U1KB 3PYCA 2R8SH 4JS7A 1P7QA 1VF5C 3BVNB 1NSNL 5JA8B 1OCCB 2WC7A 1TZ8A 1N10A 1U95A 4HHGA 1OQXA 5AW4B 3EYFA 3NJVA 4FKKA 1C5BL 5T1MA 5GQBA 3SDCD 4Y16A 4HEME 5KSBA 5KVMC 5J5EA 3ULUL 1WK0A 1N5AA 1JGEB 3IU3B 3L08A 2FSEB 5TK2A 4CILA 2PP9A 1GS8A 3S3DB 4NOFA 4IKLA 1II4E 2GAZB 5GHWL 5DD0L 4BQ9A 1NBVH 1S3KL 4Y88A 3H7LA 1CICD 4P3DB 3FTZA 2WQXA 2CIIB 3MLWL 3O2DH 3FB7B 1SZNA 4S1SH 4UTAL 3UADA 3RDJA 1OF2A 5DUPL 3K4DA 3B2MA 1KPVA 4E9TA 3FO9B 4GUPB 5KSUA 3KCWA 3SDXF 2NYYC 4NZUH 1DBJH 4UQ2B 2I69A 3O4LA 5JZ7C 3G5YB 3QDJB 2DM4A 2UZYA 4NN7C 1HEZA 4PRHB 2ROXA 3QB7C 4FP8H 4PS7A 3TYFB 4Y2DC 2CR6A 2CD0A 3JTTA 3G6JE 4FLOA 4GW5A 2NY6C 1AGDB 3GXFA 5DHYB 1NCTA 5ADOH 4PRHD 4CNIB 5EN2A 4OZFH 3WNOA 3T1FA 4NUMA 5ES4B 3QR2A 4BE5A 3BSZA 1TCRA 2X05A 1ZVYA 3JTSB 1CD1A 1SXAA 4J27A 3KVDD 5C97A 2IG2L 1J8KA 3RUGA 2KPWA 5F3HA 5KBPA 5B1AB 1DJZA 3BP7A 5HHNB 5DRZA 4LPTA 3GSOA 3DOSB 1SF3A 5IB4B 4KMTL 2OMXA 4AJVA 1JXJA 5E5MA 4BSJA 3F85A 5EPMA 3HCVB 2I7SA 2FX8L 4TQEH 1J18A 3ARQA 3LIUA 1PNCA 3AQZA 5AVSB 4XPHL 2V7NA 4TMPA 4LSUH 3S36H 2F68X 2B77A 1GJUA 1RZGA 4JKLA 5GRVL 5GGVY 3UTPE 4G5ZL 4BZ2A 4C58B 2DWEB 5I1HL 2UZIL 4NHCL 1MHCB 1SOXA 1SXBA 3KPQB 1KGJA 4I9XA 3TO4B 3BVDB 2ETWA 1EBPA 3X3FL 3NQIA 1ZAGA 5C3LD 5KN5B 2XWDA 2GW5A 3V5DA 3WIHA 2C26A 4NKDA 3ZQXA 4DKEH 5AG8A 3RBGA 3LQZB 2VMEA 3MLXL 4A68A 1DQKA 5ESQB 3FJTA 3VD1A 3RX9A 1FFRA 2RQ8A 3Q8EA 5LCVH 1PG7H 4UOZA 1N0XL 2MPAH 1Y0LA 2H3NB 2IPKB 2JCCE 1FFNA 3EJYD 3ZGIA 4DVBA 3MREA 3D6GA 2WLLB 4HP5A 4X7TB 4YHIA 3BO8A 1E28A 1H8SA 2QPFA 1CTMA 1HWGB 2A4EA 2NNRA 4R97B 3BQUB 1BQLH 1LK2A 3AM8C 4FXLA 4JFQB 4UU9B 2Z64C 1IGJA 3GO1H 1JZDC 5EF1A 4YNYB 1F02I 1O6SB 3TYGL 4E2OA 1PKOA 3VFPA 5KYXB 3CN0A 1PCSA 4OCYL 4MZ3A 5EBWB 4M3KB 1NFDF 2WNXA 3OKOA 4EIZC 1L4IA 5L4MA 4KJQD 3X1EA 3RGBA 1C5DA 3GUTA 1TOXA 1HJBC 3MRLA 5CU5A 4PG9B 5FGRA 4DP7X 4Z7QF 3ME0A 1TYJA 3US9A 4BUGA 3KPOA 3NSCA 4JFYB 5ERWA 1A1MA 5ACZB 5IUSA 1FLRL 3GXMA 1OZTG 3A22A 5KVGL 2R4SH 3DURB 3VFMA 1QI3A 2B7DT 2WYIA 3GRWH 3KJ6H 4XCYA 4XPGH 4C4KT 5D1ZB 3NPSB 3FT3A 1GXEA 4HCRA 3V0WL 3IDYB 3VXUD 3SDCC 3V5HA 5JO5B 5FYKL 4W9DC 1UQSA 3WIIH 1RH8A 3FU3A 1QTYT 1OCRB 1UD2A 3AQDA 1ZLSH 2YARA 1P7BA 5D1ZD 3BT0A 1GR7A 1AZNA 1S7QB 1DVUA 1KIQA 4TULL 5EWIL 1MHHA 2EKJA 1YN7B 4PRDA 2JKNA 1I7UB 1R5IB 2ADYA 2V5RA 1EHAA 1KB9J 2D31B 1PQZB 1UKTA 4ODBD 1R3KA 1YO4A 2DQGL 2NY5H 1VGKB 4Z7UE 3V52L 1CICC 2JE8A 4ICWA 3T6XA 2OTPA 1CCZA 2QQKH 5KYUA 1A7BA 3IETB 2VDPB 3OPZH 3HHMA 1JVLA 3U9PL 4X42A 3FPYA 1BIIA 3LKQA 1UD3A 3MLUH 2XIIA 5B7MA 1U3NA 1ETA1 1UYWL 1SRDA 2RACA 3NN8A 3TPKA 1S9YB 1QG3A 3CD4A 4L1HA 4KY2A 3QAQA 2W80C 1JZ4A 4J23A 1MCQA 1WQVT 1XH1A 1SM3L 3L7FB 4JLRA 5AB0A 2EIMB 1U6AH 4PJXF 4A67A 2K6WA 3D12B 3D09A 4N90D 1MI5D 1N5YL 4L8SA 3V0IA 3HZMA 1JI1A 4LNRB 1KXVC 3BPOB 4M4RA 2NY4D 3BAKA 2EUXA 3O11B 1L6ZA 1LP9B 5DHMC 5IOPB 5EZLA 3WL9A 2GITA 2WLYA 2FECL 1YNTA 4XBPB 1DZ0A 1HKLH 4P2OB 4X7EC 4YHYC 3G7TA 1WC7B 2R29A 4I3RL 1MUJA 5DMIL 3LTVA 1K5WA 5I15L 2D4FA 3VFGH 1TETH 4KTEL 4AGLA 4I5BA 4PMFA 4F24A 2DAVA 4GINA 4PVMA 3TL5A 2K9UA 3DHPA 1LO5B 3ARFA 4OTXH 3IFPB 4B53A 1T1YB 5F7DB 5J1AA 2AVGA 2GB2A 4UILH 4FFYA 3OLGA 5GRVK 5H4ZA 5J6HB 2VXUH 3OGCB 1UM4H 3BYTA 4YX2H 2N59A 2OMUB 3VTAA 1ORQB 3LNDA 4GP5B 1CTNA 2EZ0C 2OJEA 2J8UE 4CKVX 4ZI8A 3OC8A 4W6WB 5HYSA 3MLZH 1RIUH 3QRBA 3L1OL 3PGFH 5ALCH 4ZMAT 3EJYC 1F4AA 1AQDB 4JN1H 4PJBF 5CKAA 2F19L 3EO0A 2DQHL 2ZNXA 4M9PA 4QRUA 3I02A 5T3XD 1NGYB 1VEPA 1X9RA 1CGWA 3OJ2C 4O9HH 1RZQA 3FFCD 4NJAH 4W9LC 5E8EA 3V7AG 3RYMA 1JPSH 4N9OB 2NXZB 3NQKA 2ESVE 3GHBL 2JNZA 4CN4A 2W60B 3GI9H 1CT8B 1PZ2A 4NCDA 4K5PA 5T1KB 2F8OA 2ZXWB 2FEJA 5KUMA 1RVFH 1DBBL 5FUOH 4R97C 4YEFA 2E6QA 4MNHA 3I50H 4JFDE 4H0HB 3EADA 3FOMA 4KJQC 4HIIB 1U92B 1CGVA 3GPSA 4IBYA 4MCZB 4XBEH 5T1KD 3TT1L 2F5AL 3R06A 1Z9NA 4I13B 1Q9KA 3GKWH 1QBBA 5C0BD 3MDJA 5AYUH 4WVRA 1O7DE 2KLRA 1RERA 1WZMA 2BZCA 2CMRH 2XX0A 4LLVA 4U6YB 1F8TL 3PJLA 4LHJB 2DLTA 1C08A 5HHPB 3TLRA 2B59A 4E42B 4WNJA 3D18A 3KGUA 4UNVA 3U83A 5I1DB 4OSUH 4FNRA 2F0CA 5T1LD 4Z7VA 5JOFA 5KAQF 1GGIL 1GC1L 2AJZB 1E30A 1F90H 1WA0X 5LB1A 1KLUA 2G9KA 5C0AA 4MYWB 4PSPA 2JELH 2VLJA 1J1XH 1EEQA 2EDRA 4GKNB 1DQLL 1HSBA 3R4DA 5D1ZC 4EN3D 3NPSC 4M61A 1HL8A 2XQ0A 4OZGF 3ALXA 3B5HA 4QRSA 4MXWL 2GHZA 4NAJA 2B20A 2MHAB 4ZO8A 4ZMZA 5D7LA 4TXVB 1MWAB 4QLRA 2WTOA 3M8OL 3CAFA 4IMKC 4N1CA 4YGVA 4NAQA 4AYEC 4TLUA 2RR3A 3O6ML 3O8XB 5TE7H 1E5BA 2IDSA 3OKNB 4OT1H 5D5MA 1BZOA 3C08H 4Z1PA 1IILE 4KVCH 1GSMA 3MRGB 2EO1A 2HN7A 1VAHA 1J88A 1L6XA 1PY0A 2VRAA 5DEFB 5JLZA 2H6UA 3MBXL 1IKNA 4ZJ9A 4AQ1A 4MCYA 2BOBB 4Q74A 4AGNA 1Q72H 2O61B 1GYCA 2O26U 3RWDB 3KHOA 3TNMB 1XF2B 4LP5A 4NZJA 3VB8A 3KLAB 3G6JB 2R0WH 4ZW5A 2J5LC 3T2QA 4RSVA 5DURD 3GBNL 1KFAL 4JPKL 3VMOA 1A7PL 2VUKA 1XIWD 2NY4C 4M93B 1Z9MA 4Z78A 1A9EA 4J3SA 1ACXA 3ARBB 5IB5A 4GSDH 3LKOB 5FDWB 3T3PF 3IDUA 1AIFB 2UYLB 1M71B 2GBTA 1WWBX 1CVSC 2ZWKA 2A6JA 3PQYE 4AXWB 2J4WL 3G08B 5I17B 5AVZB 5HHQB 1VFMA 2XOTA 1KGIA 4GLRI 2A6IB 1XEUA 2Y7SA 3QYCA 4I3GA 4MMYB 2EJ1A 4P2OC 4AVHA 1OL0A 2ZUYA 1AANA 5D2NE 5JNYA 4HZLB 4DK3A 1SLXA 3QJHA 1HH9B 2CHDA 1SEQL 2JJSC 3AW5A 1E67A 2VN5A 3QXTA 4U1LA 1HH6A 4W81A 5SV4A 4KHTH 2IOIA 3FHQA 1HX0A 2XXCB 3PWJA 4UQ3A 1K4CA 3T2OA 5AQ0A 3C5ZD 3M86A 3HHRB 4UT9L 5IQ9A 2DQDL 4OCLC 1KGWA 1NUDA 3DX8B 3HE7A 2QVMA 4ETQA 2HVKB 2WUBL 3D08A 4XP1L 1T2XA 2JCCB 3M46A 4O02A 1FVDA 1ZK9A 4ZAKD 2VC2L 1BM7A 4ZQKB 1IAIL 2E47A 4G42A 3WFBH 3KYMA 2UZXB 3K3QA 4JFEE 5CILH 2ZUUA 2NQ3A 4XPTH 2NZ9D 5C6WH 4KKCD 4ZXBB 1Z3GH 1G7HB 3IFLH 3QFJA 4C4BA 1TZHB 1WRFA 2XV0A 5F1SA 5IOKA 3HRPA 5FYJE 1K2DA 3AT0A 1PL3A 4DETA 3TA3D 4X4XA 4JBSA 1GZPB 4AEIH 4BQCA 2LTQC 4DGUA 2IGFH 1V54B 4J6RL 4ZXBD 2VW4A 1UACH 5EEWA 5EC2A 4WRLA 4AM0A 5D2LA 2H3KA 1KBPA 3CDGB 1PEZA 3VU2A 4HT1H 1EUUA 3REVA 4UBDD 2K3HA 4ONGH 3HPJB 4H8WL 4FQXB 2ADJA 2XWBB 1U8IA 2AEQL 2DQJL 5D7IA 5GRZA 5BVPL 2IMNA 4UDUB 1HHJA 3GZOA 4AM0Q 2VABB 1IC1A 1OCWL 3QIWB 1X3DA 5A6IA 2LR4A 2H47C 3MNDA 5EV7A 5GRWA 4LLQA 5IBUG 5ADPL 3QNZA 5E8NB 1HYRC 3GXPA 5HDLA 4LSSH 4PLNC 4P2QA 5I30H 4XCFL 3TEZA 3K7UA 1YCSA 4MJIE 2LVEA 3FU0A 3B3IA 3QARA 5DR5L 4EN3C 5I19H 1HTYA 1MAML 3APNA 3H9HA 5CLZA 3WGVB 3NCYS 4Z7NE 4HC1L 4QTHB 1MPAH