2ZF9A

Crystal structure of a type iii cohesin module from the cellulosomal scae cell-surface anchoring scaffoldin of ruminococcus flavefaciens
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
184
structure length
184
Chain Sequence
AMGPAAGQAYDAGNLDVASSPVKPTLSITKKTLTAAEAPNAKVTMELSVEGAADKYAATGLHIQFDPKLKLIPDEDGALATAGRAARLLELKKAEADTDNSFFTATGSSTNNGKDGVLWSFVLQVPADAQPGDKYDVQVAYQSRTTNEDLFTNVKKDEEGLLMQAWTFTQGIEQGYIQVESTTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords ScaE cell-surface anchored scaffoldin protein
publication title Cohesin diversity revealed by the crystal structure of the anchoring cohesin from Ruminococcus flavefaciens.
pubmed doi rcsb
source organism Ruminococcus flavefaciens
total genus 40
structure length 184
sequence length 184
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zf9A00
4IU3A 2BM3A 2Y3NA 3BWZA 2VO8A 4U3SA 4IU2A 1OHZA 1TYJA 2OZNA 4FL4C 2ZF9A 3L8QA 3GHPA 5G5DA 1AOHA 3KCPA 2XDHA 4WI0A 4WKZB 1ANUA 4UMSA 5AOZA 5LXVA 1G1KA 4N2OA 4FL4B 5K39A 2O4EA 2W1NA 2VN5A 3F2LA 3FNKA 4DH2A 2CCLA 4UYQA 2VN6A 3KCPB 2JH2A 3UL4A 4UYPA 2B59A 1QZNA 1ZV9A
chains in the Genus database with same CATH superfamily
3L95A 4NNPH 1PG7L 3KYOA 3I9AA 1MREL 1XB8A 4XAKE 3UBXA 5KN5B 3AG3B 5HI5C 1PKQE 1RLWA 4XMTA 3Q1EA 4ECNA 4KVPA 5I0YA 1OCRB 4BKSC 1LP9F 3BQUB 1H15B 1S7RA 1AO7A 2GCYA 1KXTA 2A99A 3E9UA 3IMBA 3P0YH 1IM3A 4KO6A 1JGLL 1U8CA 4XN5A 4XPBL 1L7TL 2HKFH 1A4CA 2WTOA 4G8GA 2EXSA 3HN5A 3D1MC 1CQYA 1ZV9A 5SWSA 1M3IA 3RPKA 2J2ZA 1AD0B 3UGXA 4H5SA 2JIXA 1OM3H 2NY1C 2MOQA 4KMLB 4X6DE 3DV4B 1PVHA 2Z7ZA 1NANH 2GAZB 1MRDL 3C2AL 1HAWA 2ZQKA 4LDLB 2AJVL 1KJ2B 2DQEH 5JXEA 3ECQA 1A02N 1KN2H 2W9EH 4P2RE 2XZCL 2JLPA 3MFGB 5C0AD 1ZT1B 3S35H 5C0NC 5LG6A 1CB4A 1ZANH 4RAUA 3ATBA 2F7RA 5DC9B 1B6DA 5HYQA 1WBXB 2BLFA 2HCZX 1FN4B 3ENEA 2NXYB 3G5VB 3NK4A 2IDQA 4FQQA 1E4KC 2P44B 5EIQA 5BRQA 3EGDA 3FUIA 4CA4A 1D5BA 1XR9A 4WAFA 4Z3IA 4JM2A 3T0XA 3KD4A 3NIDE 1HXYA 5E1AB 3PL6A 1FZMA 1OTSC 4JO2L 4ETQB 1JP5A 1Z9PA 4EZJA 3QI9D 3B4NA 4R7DB 1R5IB 3LKQA 3IMUA 3WMPA 4F27A 1ROWA 2VLRD 5BOPA 1AHWA 2ICWJ 5KBPA 1MW3A 1JHLH 2XRAL 1PYWB 4KK6C 5LB1A 3HKZA 2YBRA 1IBHA 5F97E 2EO9A 3LH8A 4AM0Q 1OCOB 3D30A 1OP3K 2WBKA 2DLHA 1ZGLP 3QRGL 3KGSA 4L2YA 4N6RA 1KB5A 5LAPA 3IDJB 2GSIA 3VVWA 3GSNB 4QXGH 4FABH 3DK2A 4Y4HD 3QIWD 5CSZA 1QSEA 3NAAL 1YUHB 1G7MB 5EU3B 3TYGH 3K46A 3B9DA 1IKNA 3O6LH 4H44C 1E9OA 4ODXB 3RWGA 2ENYA 3CXHK 1KZYA 4S1SH 5ABDE 4UOZA 5FPIA 5KUKA 3FTXA 3CFKB 3KR3H 4WUKH 1I3GH 4MD4A 3EW3B 3BYYA 4NDMB 1D5ZA 5HDOA 1RSFA 3ZTCC 4DN3L 5GGTL 5EU4A 4HK0B 4CC0A 4Y4KA 2Y36H 1PLAA 3QO1B 2X6VA 1ETA1 1CIDA 3QIUA 4G80B 1P6AB 4AEFA 2B59B 4XCFH 5BXFB 1WC7B 3H6JA 1XF1A 3ZKMD 1EEZA 4L9LA 5GRXG 2A9ML 2EO7A 3S6CA 4N0FB 3T3MB 3VFPA 3FNKA 2WBXA 5D7JD 3OWRA 2JMRA 1LM8V 3GXNA 1ZTXH 1GGIH 4X5WB 3VXUA 4XNMA 4OLZH 1MWAA 3ARYA 3BH4A 4DNLA 3MOBL 3MO1B 4EMZA 3QEUA 4OZIB 1VDGA 3B9KA 5C3IA 4KX8A 1S7TB 2D0GA 1ED3B 4K7PX 4MNHA 3QUGA 1CC3A 3SQOL 5EG6C 2WGXA 1IC4H 4RRPM 1VPOL 4WV1C 1RK0B 2F0CA 3QUYB 5LLIC 4LRNL 4X4KA 1CR9L 1IUZA 3QZWA 3PP3K 1R5VA 3BLKA 3LKOB 1GZHC 1X6NA 1GGYA 5IWLC 4YJZL 4KZ0A 3HG1E 1IJ9A 4IOSA 2BW5A 1TG8A 4G2AA 1E2VA 2J7LA 3MTXA 2CDGA 4KQ4L 5TFSL 1S4IA 3HC0A 2DMGA 2EIDA 3D5OF 4Z3FA 3WY1A 3SCMD 4NYLB 3V7MA 4A2MA 4XVJH 5JHDB 1VFAA 2WBJB 1F4XH 2W07A 3LQMA 2VTFA 2Q76B 2R1WB 3G6JB 4NO3B 4PCKA 4QIRA 5D7LB 1XEUA 2HH0H 3QJUB 3BKMH 3L95B 4RA3A 4B9GA 4Y5YC 4HOZA 4N2OA 4ATTA 2ATKA 3K4DA 1D5XA 1JI1A 3PUCA 4G42A 2IPKA 2E7DA 4GW4A 2AZAA 2P3YA 4IRSA 2P9RA 1XF5A 2GCYB 2F5BL 2Q8AH 1KXTB 4BE6A 1G9NL 2QPUA 1IM3B 3GI8H 4YDIL 4K23H 3UO8B 1U8CB 1NCAH 4S2SA 4Q9QL 2W60A 4ZJ9A 1E5AA 5BW7C 3LIUA 1C9SA 4U1LA 1EQWA 5G4OA 3UACA 4ENED 1AOHA 1EDHA 3JUYA 5DHVA 3BH9A 5E24E 1FNHA 4RAVA 4QEGA 5SWSB 1CE1L 2J2ZB 3DMMA 1CTMA 4YSCA 4HJSA 2ROYA 4H5SB 1MCNA 5FHAH 4W68A 1W91A 4UTBA 2DH2A 3H8NA 2X0UA 1CFQA 5IUSA 5EC1B 1W8EA 4I4WA 4OKVB 4O00A 3HZKA 4XPTH 3SPGA 4YSSA 4LCCC 5CEXA 1S9YA 3DX7B 4I3SH 4LFHD 4RAUB 5HJ3A 5C6WH 4WHCA 3PUUA 5ICZA 5HYQB 3RU8H 5IB3A 2OJEA 5CFHA 4Y1TA 1G7HA 4GG6A 4GAAA 3TIDA 1E50A 4FL4B 3WTVA 4H88H 1D5BB 4OLYH 1AXTH 1EGJL 1XR9B 2IJ0C 5GRUL 5CJXA 2AC0A 4JM2B 3DIFA 1FH2A 1HXYB 2VQTA 2GTQA 3PL6B 4KY2A 3S96A 1FZMB 2BRQA 1S9KC 1HI6B 2I07A 1SDYA 3E6HA 5FGCE 3AITA 3VH8G 2BH0A 3GSWA 3LKQB 3QJZA 2AEQL 5EUOF 2IQ9H 1CWVA 3CN0A 1C8QA 3KDPB 2BNRD 4P49A 1AHWB 5G4MA 5IJVA 2OK0H 3MLYL 5A16A 2GUOA 4YX2H 1WQVT 2BP5M 4GKLA 5JHLL 2G60H 5FGSA 1ZGLA 3GMLA 3V4LA 1KB5B 4K3DH 5B22A 3E8UH 2GSIB 5A2LH 4OF7A 3U4AA 2BVYA 2BOCA 5CLXA 2VXTH 1VSCA 5CSZB 5BQDA 3PDOB 1QSEB 5DMGC 3ISWA 4S1QH 5F93C 1NPJA 3KH3A 4M7JL 3F62A 4XNXL 4JFHE 2VDQL 1E9OB 1Z5YD 1GKEA 4ZMVA 2CIIA 3RWGB 4EIUA 4JRWA 5JUEH 4FLQA 4IOFD 1KB9J 4KI5E 43CAB 2PLTA 4ZZFA 4CN6A 3FU5A 4FD0A 3JVGA 1KTRL 4MD4B 2HP4A 2FT8A 4M48H 1D5ZB 4JDZA 5DRWA 2Y22A 4Y8AA 2QSTA 3BXNA 3GRGA 2DQUH 4EZLA 3SODB 4PJIE 5EU4B 3NYKA 1UKSA 4Y4KB 4U0RC 5IF0A 1P2CA 3OAWA 4S1RH 4IGBC 5A3IC 2VR9A 4GSRA 2A4ZA 4F57H 1FORL 3GS0A 4QRPA 2Q5BA 5LJYH 3MLTB 1K8IA 3O6KH 3C5ZC 4ZFFA 1PX8A 1EEZB 1ZOXA 1BBDH 2WO3B 2XQ0A 3VFPB 4R7NB 4JN1L 2CPCA 1GRWA 4XP5L 3HZYA 3WKML 2RB8A 3GIVA 5KJRH 3HBZA 3SE9L 2BVPA 4M03A 3VXUB 1NLBH 4TSBL 3VXTA 15C8H 1OZTG 3S3DB 1JV5A 2E6PA 3FOMA 3F7YA 3PFQA 4JN2A 1S3KH 1NUDA 3QEUB 2QVTA 2NY1D 4UINL 1A22B 2I5YH 3C5XA 1X5GA 3H2WA 5D2LF 3UABA 1ACZA 3MOAH 3UG3A 4LVNC 4MNHB 1IM9D 3LVEA 2APVA 4PG9A 2IDUA 1XT5A 2FVNA 4H26A 4R0LA 1RJLA 4FYQA 3QZWB 4PGBA 3TS8A 5JOFA 5C0ND 1R5VB 2H41A 2ZNXA 5JLZA 4XOEA 3CLEH 2D4FA 4QXWA 3U2SA 4IIZA 1JTOA 4PRPE 4HEPG 2WZAA 5LCVL 4I2XE 2CDGB 4M6OL 4KTEL 4MGXA 3HC0B 3UYPA 4QR7A 5KEZA 4Y1AA 1P4UA 4LL4A 1SUHA 4XXCC 4B41A 4JDVA 2CCLA 2B1HH 2W07B 4EN3C 1I1AA 4PB9H 1YEDB 2HKHH 2JJUA 3HG3A 3SE6A 5F0PB 1OTSD 2W9LA 3FT4A 1SYSA 4JFPA 4GI8A 1DFBH 5D6CA 2AQ3A 4PRHE 2ATKB 3U0WL 4NUJA 1D5XB 2R83A 4G42B 5BV7H 2IPKB 4N8UA 4GW4B 4KK6D 4EQ2A 5K93A 1CL7L 5F7AA 4W9JC 3C6LA 3DPBA 1XF5B 2F9BT 5CZVH 2YEZA 4IJ3C 2CA4A 5EU6A 1KLGA 4HCFA 4Z7OF 4S2SB 2W60B 4LMQE 2X05A 3WMSA 3RWIB 4U1LB 3THMH 3IPEA 4E5XG 5DHVB 3QHTC 4FQ2H 3P9LA 4RAVB 4QHLA 4M5YL 3IFNL 3DMMB 5JORA 3W9DB 1XDTT 1QFPA 3LKRB 5ELIA 3TCTA 1JF6A 4X6FA 3U9PH 4HWEH 1NFAA 3AWEA 1KIRA 2IXQA 1WAAF 5EZOH 5BRZE 1DZ0A 4I4WB 1DLFL 2YMXH 3HZKB 2OSYA 4OGXL 1MFDH 1X5JA 3B3BA 1JTTA 2V7NA 4DPAX 2J1XA 5CEXB 4F91B 1R3JA 1BD2E 2VXSL 1S9YB 2EABA 3FBKA 4HWBA 4NZ8A 1JNLH 3SPCA 3T6XA 5I0XA 2AVGA 2D7OA 4DAGH 4LASH 3MUHL 5ICZB 3UCQA 3CSBA 2OJEB 2EEDA 5IB3B 1E4XH 1G7HB 5I74B 1D5MA 5DVPA 3TIDB 1E9PA 1ONQA 1KTCA 4TXVB 1A3ZA 4HS3A 4U4BA 1SDAB 4N8CH 4WHYH 3FCSA 4R6UA 5I1EH 4R26L 4AEIL 5CILL 3S96B 4OZHB 2E9IA 1NFDE 4ONGH 4UILL 3E6HB 4XXWC 4HIXH 1MJJA 5LGHL 4LVOB 5ACMA 5IESL 5IJVB 3LYRA 4DPRA 3NCJL 3SZ6A 5A16B 2GUOB 5K1VA 1Q0YH 1DO5A 3L3OB 3NFNA 1JDCA 2HWZL 4KQ3H 1BPVA 1FJ1B 4JCMA 2IWEA 5LN8A 5B7FA 4LSUL 1TEYA 1ZGLB 3GMLB 2ZCHH 3CVHH 1T21A 2UVFA 5HHNA 3O0LA 2YC1A 4B9PA 4J3OF 2A0LC 2YRPA 2BOCB 3ARGA 4LOEA 1H9DA 1KCRH 3TF7C 3WAJA 4H0LC 3UMTA 3LZQA 1YNKL 4PS4H 3VXQA 5JW3L 1G6RH 4M9PA 1A1OA 4Q9RH 3MLZL 2VN6A 4CMHC 3AFLA 3IDGA 3WGVB 1MPAL 4JDZB 5DRWB 3HG4A 4Q7DA 2C4FT 4J8RB 1U30A 5I16A 3U83A 1NL0H 1T7WA 1TF4A 2ESVA 4N5UA 5IF0B 4Z7QB 3TN0C 1KT2A 3W9EA 1I9IL 1OVZA 3QNYA 4NGHH 4X7CC 3O3UN 2X28A 5CGYC 4QRPB 3WEXA 1FDLH 3G6AA 4N2HA 1ZK5A 3OG6B 2VDRL 4HLEA 5CF3A 4ZFFB 1X9RA 3D50A 3RUGB 2P5EE 2FX9L 4H8QA 4PV8A 3BJLA 3T1FA 2OI9C 5IJCC 3U0TA 2J1YA 3HZYB 2DL9A 5F9WB 3GIVB 2DTSA 3L5JA 2BVPB 4YSPA 3TWYA 3ZDZE 3VXTB 1F5WA 1B2WH 3SDYH 1JV5B 3T71A 3FOMB 3F7YB 3LZLA 1PZ2A 4JN2B 4PREB 5DSCA 5ANME 5CD5C 3C09C 4R9HA 4FQCL 5EEVA 2ZKWA 4U6YA 3CFCH 1MAJA 2WLHA 5J11B 4NN6C 4PG9B 3KL0A 1NBVH 5C0DA 3NA9L 4H26B 3DVIA 35C8L 4A2HA 1RJLB 4F15B 4LSQH 4PGBB 5JOFB 3MNWA 2R0LH 3GK8L 2UUDK 5JLZB 3S2CA 4TL4A 4HXAH 2HRPH 3U2SB 2C9UA 1Z32X 4P3DA 3UYPB 2QQLH 4O9HL 3UG4A 1FIEA 1YZZA 5AZEL 2ZYIA 3IMRA 2XUWA 3D2TA 4M1GH 3IB4A 4O51A 4WI6A 4XRCA 4DP4X 4JDVB 4OFIA 3FO2B 3BMWA 3L9BA 3RP1A 1I1AB 4G70B 3OQ3B 4A39A 1I8LC 1CZ8H 3FT4B 1SYSB 3IKCA 3NCWA 1BBJA 2BX5A 4JFPB 4XCCL 1DUZA 4OBSA 5D6CB 4XVTL 2BP0B 3NRFA 4RETB 3TO2B 3LNDA 2YEQA 2O4EA 3H54A 1QBLL 1D7DA 5ESQA 1HKLH 3V0DA 1ZLDA 3DPBB 5CZRA 2YEZB 4Z7IA 3L2MA 5EU6B 2YZ1A 1KLGB 4IKLA 3RTQA 4KI1A 1A66A 3NIGF 5IFAL 3JV5A 3MCLH 4TVPL 4B0MB 4A6YL 3WIHL 1THAA 1R0AH 2IBGA 3AWFA 4MJ4A 5DMGD 3VI3B 3IU4H 1N7MH 1G0YR 3P9LB 5EMYA 4QHLB 1UENA 5CBAA 4PWIA 1WH0A 3BWUC 5H35A 2CUHA 3BWUF 4R4FL 5HI3C 4DT2A 1UJ3C 4X6FB 4XWOD 3ALWA 3EBGA 3VNYA 1KIRB 1SM3L 3A21A 3OSKA 2BSSA 3VW3L 1CF8H 4O02H 3S7GA 5D4QA 3ZRSA 3LDBB 3H55A 5EU7C 4S10A 4ZOBA 1KZQA 3VX1A 5I1CH 5A3ID 4TNVK 3T6WA 3FB5B 1A3LH 3ERXA 2X09A 1JHKH 1YECL 5JPMC 5DFTA 5D55A 3RQ3A 5G2NA 3ML8A 1M05B 3C5ZD 2XFGB 3QQ3B 1DCEA 1NGXA 5K5YA 1E9PB 1LE9A 3FCTA 3OHXC 3S37X 2BP8A 1KIQA 1BQUA 3TCXA 1JPTL 3GMNB 4ISVB 1N26A 3SDXA 2HVKA 4RBPH 5D8JL 5AVZB 1HZLA 4PS7A 2WM0A 4G3YL 1QBMH 2AVFA 1MJJB 3T0BA 3UAJA 3SE3A 1CO1A 1HINL 4PCYA 1CU4L 2F54A 3NFNB 4UQ2A 2GG1A 3GXDA 4I18C 4X6EA 5B3NA 3FB7A 1ZIBA 4OLVH 5LGJA 3AGVA 2ILLA 1RUPH 2IQAA 4BJLA 3CFJB 3UPRB 2I60L 4IRZA 1T21B 4UNVA 5HHNB 2VLJA 2YC1B 3HFML 3VI4B 3I75A 1AMYA 1J0ZA 1IFHH 5ICXA 1FNLA 4XVSH 3WIIL 4NQCA 3U48A 3AC0A 4K7FA 2BVOA 4C55A 4LL9A 3WKPA 2XC8A 4QOKA 1DHKA 4LCWB 4WTXA 1A1OB 4EN3D 3UBFA 3ULSB 4WDIB 3CC5A 4NCC2 4OIIL 1TQSA 1SXCA 3IDGB 1L9SA 4Z95H 5E4OA 3RY6C 4YHNA 1DQVA 2NY2C 3D48R 43C9B 5I16B 3X2QB 3GXPA 2OYPA 2ESVB 3AS2A 4F8PA 3W9EB 4WWNA 1VACA 2B4CH 2H0FA 2X3AA 3OG4B 3QNYB 1ZEAH 1AQDA 1JXDA 3WEXB 3G6AB 3BAEH 2IPUG 4IBQA 4OIAA 3T3ME 4ZW5A 2M8XA 3MV01 1PLCA 2K9FB 5KW9H 4PV8B 5T1KA 2HLFC 3WKYA 2JF1A 4BE5A 1DVSA 1CDGA 3BVUA 5CHNB 5L4MA 5E4AA 4JQXC 1F42A 2E4TA 4OZIE 1H5BA 1KJ3L 4TLKA 4IIQB 5DSCB 8FABA 2DW5A 1OIOA 1NCBH 1V05A 4U6YB 3LS5H 4RGOH 3O4OB 3T2PA 3L5XL 1KDIA 3NSXA 3POCA 4LCVA 4GKZB 1AG0A 2ZKHH 1F8TH 5EUKB 5J06A 4XWGL 2VZUA 3CFDA 3MC0A 4NBZB 2GK2A 1EO8L 5IVZA 3MNWB 2VMCA 5CJBA 5DD1L 4TS6A 2EP6A 1SN5A 2YUXA 1GW0A 1IC5L 5CZKA 2HFFA 1OPOA 3RHWF 4PU2A 1SLWA 5F7EH 4R2GB 2Q8BL 4P3DB 2WAHA 3RVVC 1I8KA 4L3FA 3EOTH 3S3PA 2ZT9C 5JHDE 1AACA 2WINB 4O51B 1J1PL 4XRCB 1UKQA 3G6JE 1KJMA 3GMMB 4JJOA 4NHUB 5D7LE 2MCMA 1DN0A 1TTBA 3IKCB 3VD4A 2DBLH 3D0VA 2YN5A 1C5CH 1DUZB 1BWWA 3ZT6A 4GXVL 3MUY1 4HJJL 7CGTA 1YSOA 3KYMB 3VFUA 5ESQB 1AO7E 2CRMA 1KN4L 5I66A 5LDSA 3QFGA 4OV6F 3OV6A 2H1PH 4JO1H 5AUMA 2C34A 3RTQB 1JK8A 4OFPA 4AZ8A 1J88A 1TCRA 2JCCA 3MCG1 1I53A 2A0LD 2Z8RA 5I6XB 3R0MA 4KAQL 5IOKA 1KELL 5SWSE 5DZJA 2FSDA 5LAXB 2GC4C 5DZOA 2MFNA 1L9OA 3HR5A 2HPTA 4BZ2L 4L3EB 5CBAB 3NCXA 2HRGA 1MXGA 5H35B 5I19H 5JW4R 1HOCA 5F9OL 4YE4L 5C0AA 1UG9A 3I84A 4WKXA 2ITCB 5DZPA 1JFQH 4MDRA 2XWTB 2BSSB 2EDKA 1P4LB 1IBYA 5D7KD 1B90A 3SYOA 3S8WA 3TEUA 3DOSA 1JVOA 1P6WA 3M17A 5I1KL 2OZ4L 3TN0D 2GJJA 4AYDC 4FA7B 1ADQA 2C3WA 4HCIA 5JQ6L 1KWKA 2P8PB 3GI9L 5CGYD 3MRRA 4UDTB 4XMWA 2LQRA 1NMCC 4PV1C 1N6QH 3BSZA 1OAKH 4Q0XH 4JFOA 2FL5A 4XP6L 3UL4A 1NGXB 1MCEA 3QEHA 3FCTB 1OEZW 2BO0A 4AW4A 4CW1A 2BP8B 1KIQB 3SDXF 5ALBH 4N0RA 5INCA 2QGBA 5C2BH 3QZMA 3VE0B 2HVKB 3HC4H 3IK2A 3O2WL 2DLTA 4OZGB 5AZ2L 4X9HA 5HI4C 3DTUB 5CD5D 2DM7A 3TBTB 1VZIA 3WXWH 3D09A 5HYIA 2HRLA 4GINA 2CXKA 3KPQA 2F54B 4UQ2B 3MJ7B 1FFOA 3QIWA 3BN3B 4NNPL 4X6EB 3FB7B 5AENA 5LGJB 2FUTA 2IQAB 5HGAA 3JWOC 4C83B 4MAUH 2FJFA 2XT1B 1HNYA 3S3CB 1QBAA 2AQRA 2JKRM 1MCDA 5MENB 2VLJB 1AZNA 4FG2A 5HGGS 1QSEE 3I75B 4J6IA 1NLDH 3JZYA 2RAMA 5ICXB 1INDH 2HJLA 2AAVA 2KPWA 3H4HA 4LKCA 2IEPA 3H7BA 4DP7X 3MPCA 3P0YL 4K7FB 2BVOB 1WS8A 4PY8J 1HHHB 4XO5A 4QOKB 5A2CA 2A7BA 1AANA 1RKRA 2HKFL 4OFQA 4FYTA 1GJIA 2X2UA 1DN2A 1NCOA 4UM8B 1SOSA 3CC5B 2RIKA 2V0AA 1UYWH 4WI2A 4YHNB 3CDGA 4G59C 1HIMH 2APSA 4HSAC 5FUZH 1OM3L 3EF7A 4EQ3A 2FLBT 4L5FE 1VACB 1AQDB 1ECYA 2AKRA 4YHIA 5ISZB 1DLHA 4ZTOH 3CD4A 2GTWA 2DQEL 3VO0A 1KN2L 2W9EL 5FUOH 4PJEA 1A7QH 2ZCZA 5T1KB 3S35L 3OB8A 4MB4A 1L0XA 1ETZA 1ZANL 1UM5H 3VXUE 4YDLB 1AIFA 3MLWH 1H5BB 5IVXA 4ZDHA 1QI5A 4M7LT 5AW7B 5HI3D 2P52A 1U8OA 4GMTH 4Y88A 8FABB 1W6WA 4OGQC 1XWVA 1V10A 1JNHA 8CGTA 1FYTA 4Z8FH 3IMWA 4NUMA 1L9TA 2BSDA 2GT9B 2XBZA 5CN2A 2X42A 4N2FA 2G4EA 1BMGA 3TZVA 4KK9C 4EI6A 3CFDB 3ECBA 3SOBH 4OU3A 5IVZB 4PW4A 4CILA 1JHLL 5JR1H 1DQJA 2L4OA 3K6SB 2HFFB 3W0WD 5F6HI 1I8KB 2BIOA 1E7UA 2OV0A 4QXGL 4ZO7A 1R19A 4FABL 4MMZC 1KJMB 1XCQA 1BXUA 4U05A 5E4EC 3JT2A 1DN0B 4JG5A 2JLLA 4HAGA 1N5YH 3RPBA 4HKBA 2C4XA 3D0VB 3TYGL 3WBDA 4QO1A 4UQEA 4U6VH 3O6LL 2ITFA 1CFTA 4X8JA 4OM0H 1AZZC 4S1SL 4N86A 1U58A 4Y5VA 1T89C 3VFUB 2J6EA 4F80A 5I66B 3BHBA 3D85D 1H9VA 1I3GL 3KR3L 4WUKL 1O9VA 3QXWA 1IBBA 5AUMB 3TTYA 1TVHB 4AZ8B 2JCCB 2F1BA 2Y36L 1CBJA 1FYHB 2OULB 1JN6A 4FE9A 1JZ7A 2WLNA 1QLRA 2NXZC 2Y72A 4KKZA 3EYVB 1QR1A 3ILDA 5LBGA 4XCFL 4P57A 5CO1A 4IBWA 5A2JH 4BEIA 2ZPKH 4UTAH 2O30A 4ELMA 1OKEA 5C0AB 3RWFA 1VFMA 4RGMB 2WZPD 2Y2WA 4J3UA 1I3UA 1WD8A 1ZTXL 1GGIL 3K6NA 3P73A 4OLZL 4BELD 2O26U 2NY2D 1ITCA 3DOSB 1WF5A 3M17B 5D7IB 4B60A 4C54A 4DF9A 5AVQB 2XV6B 2G5RA 3K6IA 3WEAA 1FNEA 5IW6A 1DVFC 1U33A 4ZSOA 4GAFB 2ZIDA 4RX4D 4JPWH 5JXAH 4GG6E 2YFNA 2WWKO 1IC4L 4UUJB 5FDWB 2EIJB 4L3CA 5AOLA 1DEEB 1BQSA 4JFOB 2FL5B 2OCJA 3RA7L 4FXGA 4HD9A 3QI9B 1EVUA 2HLFD 4JZNA 3RBSA 3EBAA 1AYOA 5LXVA 1MFVA 3KJ4B 2VLRB 1CXLA 4OZHE 1SDDA 5INCB 4WFFE 3IDUA 1A9BA 1GS7A 4TRPH 4H8WH 3F7LA 1MWAH 4NWUH 5TF0A 4BFJA 2I25N 3B2XA 4XVJL 3MX0A 3KCWA 5DHDA 3H42H 1F4XL 1PAMA 1H3WM 1A5FH 3KPQB 2QTVA 1CBVH 2N4IA 3EYOB 4Y4HB 4AK1A 1FFOB 3QIWB 2HH0L 3BKML 3IETA 5HGAB 3JT0A 1CD8A 2FJFB 4G6JH 4DK5A 3M6DA 3IMSA 4NKDB 5KYUA 2BY1A 1NUFA 3I9PA 4ABQA 4KRNA 4AIXA 3MOQA 1RZJH 2HJLB 3B7UX 2Q8AL 3RVVD 2A3TA 4E9VA 2J25A 3H7BB 1JIBA 3OLIA 4PPTA 2O5XL 3GI8L 4WNJA 2Z31A 4K23L 4P2QD 4R7XA 3M46A 3LNFA 4QRQA 2YD1A 3EHBB 2CPUA 5SX4I 5JW4Q 3V8OA 3S5LG 1UZ6E 3QULA 1QKZH 4NKMA 3U7WH 5IW6B 4XR8C 4G8IA 2LABA 4ZS7H 2OX5B 5FCSH 5JIHA 3BT0A 3DHUA 4FGMA 3ULUC 3ULUF 4L0YA 1J8HD 2N59A 8PAZA 3LKPA 1SFDA 2LTQB 4RIRA 5FHAL 4Z7QE 5HVHB 1WLHA 4N0CC 5L0QC 2WZ5A 3QUZC 4LIQL 5FS5A 2DD8H 4QRPE 5D7JB 1E3FA 1E8YA 2G30A 3E2HC 3NJMA 3PJSA 4IK6A 3UPCA 4YHIB 1DLHB 2H3NA 3RX9A 4U1KA 3RUGE 1CLVA 3BKYH 3GYRA 2GTWB 1CXFA 3OLGA 3PAYA 3ZDXB 5K59F 3AQYA 4XPTL 3TU6A 3S4SA 4UIMB 3PGDA 4PJEB 3N1QC 2VT0A 1P53A 4I3SL 3RFRA 4ZUTB 4KJWC 5AW5B 4MJIA 4EDXA 4POUB 1U41A 5JNYA 3MRLA 1IM9A 1HHKA 1YO4A 1AIFB 3DETC 1MIMH 4Z7NB 1ECZA 3VGDA 5IVXB 1WFUA 3GIZH 4H88L 4OLYL 1AXTL 2ARWA 1RJZA 1JNHB 1FYTB 3MV7A 2MHAA 4FCAA 3WAKA 5ITFA 1OGPA 2QEJA 3OLEA 4EZKA 1C1EH 2AGJH 3NIFB 4QY8A 2OTPA 2EINB 3QZPA 3TZVB 4B96A 3S34L 5FA3A 1E4KA 3UZEA 2IQ9L 2PW1B 4EI6B 3ECBB 2G9KA 3HZVB 2OK0L 2AMUA 2HFEA 3LHPH 5IHBA 1U6AH 1DQJB 2DM2A 4YX2L 2B08A 4AQAA 1RU9L 2G60L 1N3NB 4PJCB 4JY4B 4Y1AE 3PLYA 4D9RE 4K3EH 1N10A 2J72A 1JG9A 4K3DL 1CPUA 3R18A 3E8UL 4QTFA 5CD3A 5I6KA 3V95A 4RESB 4ZMAT 5GGVH 3CDYA 3LNIA 1ZKAA 3B7SA 2WAQA 4S1QL 2FWOA 3KLLA 5HI4D 5IM7A 4HKBB 4QO1B 4UV4H 1DBMH 1CFTB 2BSTA 2H45A 4JUTA 1IBZA 3P0VH 5JUEL 2J57A 2Y1AA 1U58B 2CBMA 4WFED 1FNSH 3N50A 5EU6E 3BHBB 3GSRB 1Z5LB 3TA4D 2E5EA 4M48L 1SGKA 2OMUA 2DQUL 2ZJSH 3VRLF 4QHKI 4H1LB 5DGRA 4S1RL 3VI3E 3RI5K 3U30B 4F57L 2ZAHA 1QLRB 1RQ5A 1GYAA 4J3OH 1QR1B 3BGFC 4LESA 4E9QA 2XPGA 3O6KL 2GBTA 2XJKA 2D3VA 4ELMF 1AXIB 4YXKL 1BBDL 2BIIA 3CSGA 5AAWA 3TOPA 3RWFB 1NWPA 3CX2A 2JI3A 5CJ8A 4BFBD 3QXUA 5KJRL 4KXCA 1N5AB 3P73B 1NLBL 3SIKA 5C9JA 1EEQA 15C8L 1NWOA 4GS7B 5I17A 3MRKA 1EAJA 3V8CA 2D7QA 3MBEC 1S3KL 4K2UH 2J73A 1MAMH 3NJVA 3ZSSA 2I5YL 1L9RA 5DJXB 1URIA 2BSED 1M56B 2ZKMX 1FNEB 3PREA 1F58H 3MOAL 4FLOA 1U3YA 3OMNB 4ZSOB 5T5NG 3T3PB 1G4MA 2D31B 3W56A 3TBYB 2VLKD 2YSTA 3BGAA 4M3KB 1RIVH 5GRJH 4ZW7A 4L3CB 2APBA 5DT1H 3S8FB 3ULVE 4FXGB 1MFCH 2YUVA 2EDNA 2OYLA 4JZNB 2J8HA 2LE9A 4ZNEA 3PP4H 3WN5C 3AG2B 3G7TA 3PV6B 1G1OA 4HHAA 1AMXA 3D33A 3QDMA 4NKOB 1A9BB 1QHQA 2WXOA 4M7ZB 3TT1H 5G5DA 3TBWA 2YPVH 1BV8A 1DE4A 2CKBA 2CM6A 1RP8A 4PJFA 3MX0B 2H47C 2B1HL 4P46A 1GZHA 4NS0A 1OD7A 2HKHL 4PB9L 4NC1E 5TDPA 3JWDL 3EGSA 5D7EA 5GRVL 4DP5X 3IETB 3CCHA 1DFBL 1IQWH 3MUUA 1WVZA 4KK9D 4WW2A 4ZW8A 3D25A 3TURA 5BV7L 2R56H 5F44A 5LGYA 3DPDA 3IBEA 4BCXA 1FVCA 2SEBB 5KYUB 1SHSA 4R5XA 3IPBA 4YOKA 3HPJB 2X44D 1BJ1J 3K6DA 4ZTEA 2Z31B 2AS5M 4YGVA 4PHXA 3FYEB 4QRQB 1TXKA 5J8OA 1DP0A 4OCXH 32C2B 3AQXA 3THML 4CVZB 4NKMB 4R4BA 2EKSA 4G8IB 1JWMA 4FQ2L 1WZAA 1PFOA 4TQHA 1L9NA 1ZLWK 4ONHA 2ESVE 3LKPB 3OQRA 3P40A 2FHCA 4XB3A 3U9PL 4A2FA 4APQA 4HWEL 3PJSB 5EZOL 2XN9D 5GS2D 1FZKA 4BINA 1VESA 2YMXL 2NQ3A 4U1KB 1CD0A 3S4SB 4HJEA 3PGDB 2EVIA 3SGKA 1RZQA 1JNLL 2NY1B 1JZEA 4U2YA 4HH8A 4WI9A 3NK3A 4DAGL 1NGWA 3MZGB 3WLBA 4MJIB 2NXZD 1RV6X 4EDXB 4LASL 3MRLB 1IM9B 2Z3FA 3O2DA 4NXKA 1E4XL 1JE6A 3BDXA 3NJLA 5FOBA 3WCYA 1J0JA 1ND0B 3F85A 2YAEA 3LVTA 4DW2H 3R06A 5KVFH 4N8CL 3EDJA 1XGZA 3MV7B 5ITFB 2MHAB 5I1EL 1CL7I 5JMRA 3IDNA 4ONGL 2I26N 4RZKA 3IU3A 3OGCA 2J21A 4HIXL 1MSPA 5FA3B 2IALA 3BZFA 1DVFD 3VGGA 2F58H 2HFEB 3PDDA 3SKMA 1Q0YL 1WRFA 3F3HA 1I8UA 4BHUI 4KQ3L 5EHFA 5DVOA 2N56A 4QKXB 2UVEA 4JFUA 4MVBC 5FV2A 5IP4A 3CVHL 3KYKH 2EIBA 2EYRA 2D7PA 5GZNA 4M6NH 3FW6A 4I9WD 3DOIA 1F1AA 2ZYHA 4ODBD 4X9GA 5CD3B 3L54A 3PHAA 1KCRL 2RR3A 4LLVA 4XPHH 4GAJH 2FWOB 1CICC 2IVFC 5IM7B 4GSDH 3DC0A 1SEBA 1BFSA 4PS4L 1G6RL 2BSTB 2VERN 2WK2A 5IREA 2EE3A 1E43A 2LU3A 1EO7A 4Q9RL 1LLAA 3L4YA 4I88A 3HHMA 1WFMA 3HB3C 4DH2A 2OMUB 2OP4H 3ZIYA 4ZXBA 1FPTH 1IT9H 1NL0L 3RZCC 4NGHL 3U6XS 1NSNH 2QV4A 1UTDA 4HU2A 1KG0B 1FDLL 3C75A 5TQ2H 1P7QD 2XPGB 5DS8A 5CP7A 5EBWA 2X89A 2WVUA 5IBUG 3EJJX 2E6JA 1CK0H 2FHBA 4PRID 4UOJA 1OSEA 5E99H 1T80A 3E7JA 3OC8A 2VDPH 3T04D 3ULUD 5EEUA 3BPLB 1QWHA 1B2WL 3MRKB 3SDYL 5I17B 2WN2A 2HTKC 4N0CD 3QUZD 4HOWA 5E2WH 1BJ1H 1LO2L 2B1OA 3CFCL 3OKLA 3QXAA 5DU7A 3TYFB 2AW2A 1AQMA 2QKIC 2QQQA 3OHMB 1NBVL 2AI0H 4OCMC 3FN0L 4HWNA 3F00A 1XCTA 4PLJC 4YQXH 4I9XA 4GRLC 2J8UA 4LSQL 2DI9A 3ZJAA 2F7PA 5FYKH 2R0LL 2WTRA 4P9ML 1KEGH 1FAKT 4KJWD 2P48B 4KXBA 5L2KA 4HXAL 4J3XA 4OZGE 4HHAB 3B7TA 5IMMA 3EJCA 3DV6B 3QDMB 1CURA 3L17A 6PCYA 2QQLL 3DETD 4WFGE 4XN2A 5G5DB 3TBWB 4GYBA 4N90D 1HJCA 1DE4B 2QVIA 4M1GL 2CKBB 4CDGC 5JDJA 2F54E 4ZMNA 4DEUA 5D1XA 4J3BA 4P46B 1RUKH 5EU5A 3ZL4H 1QD0A 5C07D 6PAZA 4PIRF 1V8HA 3RKPA 1CZ8L 3EGSB 5HPOA 2NPLX 1X44A 3CCHB 2ID5A 4DETA 4WW2B 5MENE 2VLJE 2LLLA 3D25B 3ZE2B 3HMWH 4WWKA 1PX3A 2WD0A 1A4AA 3DXAD 7PAZA 4NQCE 1HKLL 2VDLH 3LEXB 1GZPA 1FBIH 3QR0A 2GIYA 4QOKE 1ZDQA 3VQLA 2CUMA 4ERSH 5HHOD 4BQ9A 2H7WA 3W3BA 1XGTB 3MCLL 4YGVB 3V9CA 2LT9A 2YD2A 4AEHH 3MLRH 1R0AL 5AKRA 3ARUA 3IU4L 1N7ML 2EKSB 4KKRA 4R4BB 5DJ6A 5KSAA 1JWMB 3OMZA 4L29A 4MNGA 1FE8H 4I89A 1NZRA 5B1KA 1EH9A 2ENPA 3B5GA 5DI8A 2J5WA 1QLEH 5EOQH 5ISZE 1IGCH 3K4ZA 4OF6A 4RMVA 1ZHNA 2I9LA 1CF8L 3SDAA 1VB9A 5C8JA 1U8PB 4LHUA 4O02L 3CXHJ 3D3VD 2WQRA 3Q2NA 2Y5TB 5I1CL 3U79A 5C7XL 1A3LL 5HPMB 1JGVH 4Z7VA 1JHKL 3WLBB 3DX8B 1MI5D 3GGWB 1MIEH 2X2IA 1N8OE 2X1QA 5J6HA 3QW9A 3NT0A 2ARJB 5FOBB 1ZV2A 1K5WA 3R06B 4NRXA 1Z9LA 2AEOA 3MRFA 5TK4A 1W72H 2HPOA 2DQJH 3NCMA 4MQSB 3PXHA 3NN8A 3IDNB 4WEEA 5TE7H 4IKJA 2ZUWA 3IU3B 3KLAA 3OGCB 5E8NA 2R59A 4AJVA 1YEGH 2BOLA 3MBED 3MRBA 1QBML 4KJQC 4XN8A 2DF3A 3RFZC 1CDYA 3BZFB 4N0YH 3A23A 4E9SA 3KGTA 3CQQA 3MA7A 4OVVA 3SKMB 4WK4B 1V54B 5E2TH 3QUHA 4OLVL 4Z0BH 2Y1ZA 1RUPL 3TPUA 1I1FA 1VEMA 2NCMA 2X10A 1TPXC 4GAYA 4XODA 1SXZA 4L8CA 2VDKH 3FAWA 1PTZA 3TA3C 2HX7A 4NM4H 3WY4A 5B3JF 1IFHL 1MDAA 2K8MA 4RAHA 4LLVB 4XVSL 2FBJL 3TBSB 2CDEA 3AT8A 2NCEA 1SEBB 2ED9A 2WSKA 5AL8A 2AK4A 4LVEA 1GYCA 5EO9A 3T65B 3BMVA 5EA0H 2JCCE 3WJJC 5JIMA 5KYXA 4UQ9A 3KDMA 1CFSA 2JJSA 3OXSA 4LEEA 5D1ZA 4IRZH 2UX7A 2YD8A 3CSTA 1SVZA 5MP6H 2B4CL 4HFWA 5SV3A 1T6VN 1E3ZA 1QPPA 1ZEAL 4HK3J 3ETTA 3PV7A 5D70H 2YHGA 1ES0A 4H0IA 5PCYA 1OE2A 3BAEL 2X9XA 3BEVA 3LAFA 4HFUH 5DS8B 1BM3H 3IJ9A 4AKPA 5EBWB 2D9QB 5C0AE 3V2AR 4XVUC 2X6MA 3ZRCC 5GGVY 5GSVA 1SMOA 1TQWA 5GHWH 5JTWA 4IU2A 1WFTA 4PJ7A 1DL7H 1KEMH 3C5ZB 4JREC 3CU7A 1HKFA 4GUCA 1NCBL 4HULB 1TYRA 3LS5L 3OKLB 3QXAB 4RGOL 4GLRI 1J87A 2X4SA 1NCUA 1U0QA 3LD8C 3IN0A 4FULA 1DBKH 4MTMA 3UTZA 3CNKA 2ZKHL 2F53D 1XCTB 3HA0A 1F8TL 2CQVA 2J8UB 1T1YA 1WCQA 4L37A 2WTRB 1WUZA 3ZE0F 4MXWH 2FTAA 5L2KB 4KJYA 4XBPA 2IV8A 4LVNB 5F7EL 2QBWA 3KPMA 3JV0A 5IMMB 3X1EA 1SBSH 3M1OA 3EOTL 2XBTA 3TGXA 3GS7A 4QWWC 4I0KA 2OLDA 5J1TC 3ESNA 5D1XB 2V2WA 5FYLD 4XAWH 4QF1A 2ZXBA 3HRZA 2DBLL 5JIKA 1C5CL 3WIFA 1H8NA 1GTFA 4J3VA 1ZAGA 5E8EA 5JIIA 4WWKB 1JV2A 4OJAA 4EN3B 3GRWA 3ZKSD 5FF6A 2WHVA 3SDCC 2UXFA 3BRFA 4ZW6A 2H1PL 2R69A 4JO1L 3UDWA 5HYEA 1B0RA 2XI9A 1BOGA 1ZHLA 3ZHLA 4X6BA 4G5ZL 1XMEB 4JRYA 1ACYH 1C8PA 3F6LA 1HL8A 3LQAC 1XQ4A 1O7DC 5AVTB 4R97C 4PJXA 4CU8A 3V5KA 2YXWA 3OBAA 5KSAB 2PCYA 4XCYA 3O3BA 5DJ6B 1CICD 1TCMA 4P23C 4IJ3B 3QXDA 1HSBA 1KCVH 2BDNH 4Z7OB 1NAMB 5I19L 5DI8B 2YD3A 2WZ0A 4G72B 1AY1L 3CFTA 3TONA 3ZDXE 1JFQL 1QRND 1ZHNB 1XBRA 3HB3D 3LNEA 5AW8B 4EBQH 4FADA 5C8JB 1IGFH 4PJEE 1CQKA 4LHUB 3ZZLA 1HE8A 3RIFK 5C0CA 5B1JA 3RZCD 3RYMA 3UC0H 4JRLA 3JV6A 2DQIL 3QH3B 3R8BB 4Z7VB 4B9CA 2E9BA 3PGFL 2FLRT 4IKIA 4Z7NE 5IVXE 2AV7A 4PMFA 5J6HB 4Q0XL 1OCCB 3I6LD 1FCCA 2V2TA 4JZJC 4Z76A 3EIFA 1FYTE 3EFFB 3MRFB 4PRDA 3F05A 5ALBL 4C4KO 4AUYA 1BGXH 4NFBA 3NIFE 4M43H 5C2BL 3HC4L 3RNQA 4PD4K 3ZO9A 2EE6A 3BE1H 25C8H 3KLAB 4I87A 5E8NB 2DEWX 2HTKD 1MCLA 3MRBB 4YSDA 3PWPD 4HWZA 3WXWL 2FUQA 1JGIA 5C0JA 3MA7B 3IN2A 5C70A 4OB5H 1ADQH 1F6LL 1PEWA 1OV8A 4PLJD 1LHZA 1I1FB 1S7QA 4GRLD 3C60A 5CJ5A 4GAYB 3Q48A 4MAUL 4DEPC 4J39A 3AAZA 4B7LA 1MLBA 4LCIH 3K72A 3X1FA 1UA6H 1NLDL 1A9VA 1INDL 4GUPA 2PWFA 3FU6A 4XC1H 4B95C 4YAQA 3E38A 5KVDE 2CDEB 1TSHA 2XX1A 4JFED 5CS7A 4YHYB 4K5PA 1QA9A 4JAMA 5FYJD 3Q2LA 3ZPDA 3UTSD 1CDJA 3KL3A 4EVNA 1UYWL 2H8PA 4GRWF 2WQAA 2FD6H 4QRUA 2MSPA 1BEYH 1HIML 3KDMB 1CFSB 4WTQA 3OXSB 5D1ZB 5FUZL 4KMTH 1R24A 3HI5L 2YKKA 2WLMA 5C1MB 4OW6A 4U1IA 3MBXH 2UXGA 3QORC 3L6FA 1GOGA 4HFWB 4YPJA 2HA1A 3B6SA 2Y4SA 2WZPA 1C08A 3TF4A 1ES0B 2BM3A 4QJ4B 2E8YA 4CMHB 2FSEA 1D2OA 1JPGA 4TM9A 5FUOL 2NW2A 3MRDB 2XWCA 5AVUB 2WXNA 1BIIA 5A1AA 1OAUH 1TZGH 4JJ5A 4KO5A 4PAZA 1UM5L 3TN0B 4I3RH 4PJBA 3Q8FA 5E2UH 4M5TA 4PJ7F 3HG2A 3MLWL 2XY1A 2K7PA 4IU2B 1AVAA 3A24A 1IE4A 1IFRA 1KBKA 1L6PA 4GMTL 4YDVA 4ZUWA 3WFEH 4ZSOE 3SO3C 4TLUA 2GY7B 2OI9B 4Z8FL 1ZLUK 4B9KC 2X4SB 1M2VA 1NOFA 3UTZB 3D34A 2VO8A 5IQ7H 4L18A 4ZBJA 3DX3A 5DUPH 4WIQA 3SOBL 2GJRA 5I8EA 3CN2A 4L37B 2JV6A 4PVNA 1II4E 5JR1L 2NY7H 4FLRA 4R5TA 5AB2A 4R7LA 4KJYB 4XBPB 4NN6B 4YFLF 2P5WD 4GP4B 4DKAA 2IOIA 2R0ZH 4DHLA 2R7EA 1PCXA 1PW3A 1AGFA 1A7NH 3G9AB 5FGBC 1RZFH 2V2WB 5CEYA 1NANI 2KZBA 4QF1B 3VXMA 3HRZB 2E9JA 1N5YL 4KJQD 5EZIH 2JJWA 4U6VL 3WIFB 3IMTA 4RFEB 4MCZA 4OM0L 5E8EB 2DTMH 5DJZA 3P77A 1BREA 3VD7A 4Q2ZB 1JV2B 1ZSDA 3PS6A 2W65A 3UZVA 5C2UB 5FF6B 1CDIA 4K3HA 1XH0A 1AHKA 1SQ2N 2VR3A 1B9KA 1BOGB 1ZHLB 4OD1H 1BIHA 4X6BB 4JRYB 4X4XA 3TA3D 1JXKA 1Q1PA 4QCIA 1J9CT 2IOOA 2XWEA 2P28B 4PJXB 3V5KB 5FECB 3K2UH 4X83A 4CC4C 4XCYB 3O3BB 3HN8A 4AGOA 3MXVH 3QXDB 1HSBB 1L9MA 4AM0A 5FKPA 2ZPKL 2NY3B 4NI6A 4UTAL 4M6AA 2O5NA 2N0MA 3QAQA 4HPHA 5KVDH 2PPCA 1JWUA 3AY4C 3F04A 2MCPH 2KDYA 5K9QG 5KSBF 2JB6A 3TEYA 2GI7A 3NRPA 1L7IH 1GY2A 2VL4A 1XGRB 2FZ3A 2J6EH 3FQNA 4N0UA 3PXLA 5IBTL 2HJFA 3ABGA 1V3JA 5C0CB 1H19A 1KGYE 1A6ZA 4MJIE 3JV6B 3SQRA 5I6NA 4BUHA 4JPWL 1RZ7H 5J13C 3L4TA 3MKKA 3ZHKA 1HFUA 4CBZA 2V2TB 3LV3A 4Z76B 3H1ZA 4XVUD 3MV7E 3VYPA 3NJGA 3U2IA 5F7BA 3QWNA 4PRDB 4G71B 1S7VA 1KC5H 3ROLA 4AYEC 2Q7AA 3RNQB 4OM1H 4TQIA 1IARB 1MJUH 3O3AA 2AXHA 1MWAL 3IMVA 4H8WL 5T5FH 1E8XA 2ZSVA 3GMPB 2BXZA 4HWZB 4U4IA 4OZ4A 5C0JB 3H42L 1A5FL 2Y23A 1CBVL 1WFIA 2HMIC 1NTDA 4FTVA 4DTGH 1SUJA 1AXSA 1ZXKA 3HE7A 3FUMA 1S7QB 4HC1H 4XPGH 5T5NF 3C60B 3SPIA 2YUZA 1MLBB 4G6JL 3K72B 4ZFOL 4BIKA 1I75A 1ASOA 4WI4A 1RZJL 4GUPB 2XWJB 4YAQB 2HZHA 4NO0D 2VQUA 1YEFH 4QWWD 3EADA 1QA9B 4JAMB 3GHEL 3FT2A 3S5YA 1E5ZA 1KJVB 1YPZF 4NB7A 1QKZL 3U7WL 3EJRA 4ZS7L 1OGTA 1JCKA 3K5SA 4XO9A 3GNMH 4DVBA 1UOLA 4QRUB 2NX5D 4TN9A 1FL5A 3MAWA 4GFXA 2APTA 5J0BA 3AQZA 1QAWA 2EZ0C 2DD8L 2P5PA 3N1MC 3P3YA 4ODUA 3GZOA 4U1IB 3UTPD 4AI7A 4MD0A 3MROA 5AOZA 4UQAA 3SDCD 4B9ZA 3U1SH 3B6SB 3B9VA 1JFHA 3BKYL 5E8PA 2FSEB 1JPGB 3KJ6H 3U7AA 1DR9A 1BXVA 1WT5A 1RUAH 1CYXA 2NW2B 1OCWH 2NY2B 4IHOB 1BIIB 5DHXB 5F70A 4PJBF 4KKNA 5I9QC 4F7CB 2X4QA 2BSEA 4K55A 3DO7A 2R4SH 1TVBA 2Z91A 1UB6A 5E6YA 2AAAA 4HCRA 4P23D 4YSOA 3ESUF 1MIML 3CXDL 5IBLC 3GIZL 4ZUWB 4YDVB 3APFA 2O6FA 2PO6C 5I6PA 1OT4A 3DURB 5EIIA 4MKMA 4CKVX 1M2VB 2IAND 3ESMA 5KSUA 3CAFA 1C1EL 5FM5M 1LXMA 1HAUA 2AGJL 5FW8A 7FABH 4BZ1A 4IK7A 1NOLA 5C0RH 3WXVH 4ZNEE 1TQTA 2LU4A 5TDOA 5I8EB 5JO5A 1WBZA 5TDNA 1QI4A 3LHPL 1U6AL 3QDME 4Z3HA 1PZBA 2OFQA 3I3BA 3P2TA 5A6MA 2ZWNA 2DKUA 1KPVA 3SEPA 4K3EL 4XCNA 4PJFE 3MJ8A 4QTHA 2R7EB 1CS6A 3OLDA 2QT6A 4MCYB 1XX9C 4Y2DC 3RX7A 2DI7A 3S98A 5GGVL 2GC7C 5J57B 4N1HB 3MV9D 3UXFA 3VXMB 1S5IH 3IDIA 3S2AA 1GKOA 3ZE2E 2HG5A 4UV4L 1DBML 2CBOA 5FYLH 5I1LA 4P2QB 4MCZB 1LVEA 3P0VL 2WP3O 1A65A 2Q86A 3DTXA 3F6JA 3P77B 3N42F 1I7UB 3B5HA 3UZVB 1FNSL 2W65B 5D1QC 5DS1A 1C12A 1E8ZA 4IBYA 3W1ZA 2E7CA 3WTWA 1J8HB 1YC8A 2ZJSL 5L7XH 4W81A 4X4XB 1X5KA 1XIWD 2X41A 3BW9A 4QCIB 1MNUH 1IEAA 5E00B 4JFDD 3FRUA 1T89A 4FERA 4XH2B 3U46B 5ILTH 5IR1A 4ANXA 2VDMH 2XN9A 3KLDA 4ZO6A 3N43F 2PW2A 4MS6A 2VGLM 2CRIA 5GXBB 5FKPB 2F61A 2AQTA 4X2UA 1W0VA 1V3MA 3EJQA 1JWUB 5D5MA 1KBWA 4RISH 3ARBC 2DM4A 2WANA 2JB6B 3T0WA 4PP1C 4CN1A 4PJGA 2FZ3B 1EK3A 4AUJA 3BWZA 4XBMA 1JGEA 4ADIA 4N0UB 4Y9FA 3PHOA 1NBZA 1MAML 4R3SA 2W0FA 5BNXD 1GHFH 1A6ZB 3RGVA 3KCPA 3QORD 1F58L 1PGRB 1FHNA 1RIVL 2ZOUA 1YQ2A 3NPZB 4HPOH 5IMOA 2B5IC 5GS1A 5GRJL 5DT1L 1ASQA 1MFCL 3HAEA 3I02A 1DQTA 3LV3B 3WY2A 5B1CA 4N1CA 3PP4L 4EXPX 2XU9A 4XN9A 1PKOA 1S7VB 1R75A 3PY9A 4Q9CA 1KV3A 1DVTA 2ZOKB 3TT1L 3FO1A 2MQ0A 2YQ2A 3O3AB 2YPVL 2ZSVB 3ZO0A 4HAFA 4YL4A 2HVJB 2A6KA 4OZ4B 2VDOB 2ZD0A 2IGLA 1BVLA 1BFTA 1M1XA 4FTVB 4AGPA 3FHQA 1IQWL 2AJUH 1T4WA 1UD8A 1DQMH 3CDFA 1UJTA 2L04A 2AJ3B 2R56L 3NZSA 4JM4H 3LXCA 4PJHA 1MCBA 5KZCB 5ABZA 4KTDH 4KNQA 2HYMA 1FH5H 3BIAX 1AIZA 2OQJA 5FIEA 1WFNA 2G5BA 3FT2B 1DVYA 2JFCA 1GSKA 4OCXL 4QXUH 5DC0A 3WJMA 1AQHA 4MMXC 3MSPA 1U4FA 5FEBA 4DVBB 1WG3A 2VXQA 1TETH 4TNEA 5ETUA 4B97A 2PR4H 1FL5B 2HLEB 2YR3A 3HPLA 3OM3B 4N2IA 2D8KA 1LL1A 4WEUD 2ZG2A 3ARVA 2R29H 4I13B 2OJ1A 4ODUB 3SYCA 1DBJH 1ZLVH 4MD0B 3MROB 4PRIA 1T7XA 5GISH 1RZGA 4YHMH 1A7OH 5E8PB 2DWTA 1MJ7H 1Y18A 2EDJA 4OCWH 1YY9C 1ZVSA 4C47A 2YBGA 2X4QB 3IWVA 2K9UA 4ZAKC 3DO7B 2WXMA 1TLKA 2Z91B 1MELA 2VWEC 1UB6B 4O2CA 2GJZA 4RFOH 2XVLA 1O7SA 2VRQA 4DW2L 3KPPA 1KGCD 3CG8A 5KVFL 5CCGE 4MB3A 3V5DA 1NA8A 3KM1A 3KGRA 4CBPA 5EIIB 5DTFA 5KSUB 5C92A 3UTQB 1OXYA 3KPSA 1EA9C 2J8UE 3WGUB 4WI8A 2G75A 3O81A 4NQUA 5TE4H 1EERB 3ECWA 3LHAA 1OT1A 3QDGD 5JO5B 5L2KE 1WBZB 2F58L 5ID1A 3MCKA 5BS0A 1CGTA 1VAHA 1QSFD 1IIKA 4PR5B 1KPVB 2Q20A 2OSWA 3KYKL 4QTHB 3MJ8B 5E9DD 1AHMA 4M6NL 5MHSD 5D1XE 2ZKYA 4TQPA 2VDNB 3QEQD 5J4MA 3V4VH 3HEIB 4XPHL 4GAJL 4K7PH 3IDIB 2C1OA 2HG5B 3O41B 4Y7OC 4GSDL 4P04A 5I1LB 5IW1A 1DYZA 1A4JA 3FF7A 1S78C 3DTXB 4XO3A 3F5WA 1T04B 3AZUA 2HMID 3CHQA 2UY7A 1C12B 3GC3A 4E9RA 1E4XI 3QE5A 3ZE1B 2OP4L 3MYJA 3HUJA 4QRBA 1FPTL 1IT9L 1IB5A 4HA1A 1CIUA 1UWXK 1I8MA 2HFGH 2Q7YA 3BW9B 3STZA 3MODH 5D93C 1IEAB 1NSNL 4MNGE 4JFZH 3KS0J 5IR1B 2XN9B 5TQ2L 2P42B 3ZDYB 1AKJD 1DJWA 4UTCA 5FB8B 2XTJC 2PW2B 3FULA 4AJYV 1FC1A 3OKMA 4XZ4A 1W0VB 1CK0L 2D73A 5EF0A 4JY6A 4EKJA 4F2MA 5D5MB 5E99L 2Z4QA 2VDPL 3S3BB 2NXZB 4PJGB 2F74A 5E95B 3SSGA 3LRLA 3PHOB 1NBZB 2CUIA 3V0GA 3P54A 1LMKA 2W0FB 1TTAA 2EZ0D 1UC6A 2W59A 4Z7VE 3KCPB 1TFHA 2PTVA 4XBEH 1FVDA 1VFOA 2AI0L 2X6CA 4LRIC 5IMOB 1RULH 1TJIH 1ETB1 3AREA 1MW2A 2YPKA 4YQXL 3HAEB 1KBGH 3I02B 3H0TA 3V52H 2B15A 2EDDA 2G2RB 5FYKL 3OZLA 1X9LA 2KC0A 3NZ8A 4FNPA 2VQ4A 4NUGH 3OKKB 2YWYA 3DGDA 4HHGA 3WTSA 3ZU8A 3LZOA 3FO1B 2ISDA 4N8VA 5JQIB 2XZQH 5GGSA 2BERA 5IBLD 2X4TA 4TULH 4MFHA 4HUCA 4WI7A 2NW3B 2BZ7A 2EQDA 2MQGA 4YHOH 1RUKL 3ZL4L 2AEIT 4HAKA 1BVLB 5F0LB 1M1XB 4FQXC 4MYWB 2PETA 4NZUH 5ICUA 4MCNA 1V3LA 3HKFA 2HG0A 3HMWL 1JYNA 2QJDA 4JHVA 3GUTA 5C09D 2VDLL 4WI0A 4PJHB 4JKLA 1R3KA 4ZZKA 3MNMA 3DLQR 3HS8A 1LE5B 1FBIL 2HVBA 2VAAA 4MDIA 3L5IA 4P2CG 1L3WA 4ERSL 1YDPA 1QW8A 1AC0A 4Y2DD 4AEHL 3MLRL 2AK4E 2GEEA 3REWA 4ATWA 1EWHA 3CZKA 2CZNA 1R4XA 1FE8L 4LLWA 5ETUB 2VJ8A 2FGWH 2CM5A 3CHOA 3IEAA 5HYJA 2W0LA 2QHRH 5BQ7B 1TYJA 3FT3A 1QLEL 3QEGH 1NEZG 2V5RA 2Q10A 5EOQL 1IGCL 2D7TH 5D1QD 1T0NA 4PRIB 3FQRA 1HCZA 2VSKB 2EDYA 4QHNA 4AE0A 1HILA 1CI5A 2DL2A 4JGUA 5GQBA 3MREA 5AWNH 2L7JA 3S48A 4YH6A 1ZVSB 2IDCA 3QUZB 4HUVA 2IAAC 2W88A 4P99A 3ZMRA 3STBA 2CGZA 1MIEL 4O2CB 3X17A 2XICA 5JZ7C 2GJZB 3LQAH 4MDJA 4PJAA 1WV7T 2EECA 2Z8VC 3KPPB 1BMWA 1O6TA 2OTWA 3V5DB 1W72L 5KS9F 2DQJL 3ARBD 3OKEA 4GI9A 4PP1D 5DTFB 4WFHD 4V33A 2ADJA 5TE7L 1CGXA 5DURD 4QD2E 2J3SA 3MNDA 4YMPA 1YEGL 4GXUN 3KS0H 4E5XB 4PGDA 3WEBA 4N0YL 1NDMA 4G6AC 2CE6A 5EIVA 5DMIH 3MCKB 3RGHA 2IBZY 5E2TL 5EDXA 5KBDA 2IH9A 1X9UA 4RMRA 4Z0BL 2F8XC 4JFFA 4X9YA 4FFZH 2P1YA 2VDKL 4QRTB 1QHOA 5JA9A 1UOKA 3D39D 3DHPA 7TAAA 4WNQA 1YG9A 4WHTA 4NM4L 5C71A 1B0WA 2A2QT 3B43A 4P4KA 2I85A 3DI2B 3LSOB 4HZLA 1IRAY 3Q3GA 2B20A 2C1OB 4U1GB 5IY5B 3B2DC 5A2BA 3GLEA 3AB0B 3UBGA 2EKJA 4GP5B 1A4JB 3BFWA 5HHOB 2DICA 1SRDA 2VH5H 1E2ZA 4JKPH 4MB1A 3L3DB 3F5WB 3T4AA 3DX6A 2CG9X 3P3TA 3OAUH 2UY7B 1F86A 3H6AA 3ZW3A 3HUJF 4X4YA 1FCGA 5EA0L 1SJMA 3ETBF 4G7YH 4JFYA 3MYJB 4JRYE 2KQMA 5F3HA 2WWNA 2YLKA 2X4PB 4IBLT 4PJXE 5H37A 4IRZL 1I8MB 1TU2A 4GW1A 2Q7YB 4LAQH 3B8SA 3STZB 5MP6L 4GFTB 4O2FA 2A9DA 3JWOL 3NPSB 3AG4B 5MERA 2FECL 1SEQH 4V11A 2FIKA 5D70L 3SPJA 2PP9A 5GS0H 3ZIMA 2P4AB 3QUKA 1F3RB 1S9WA 3ARQA 4HFUL 1BM3L 2E4FA 4NOFA 1YMMA 3A47A 3J27A 1WYJA 3OKMB 2IOMA 5DDHA 3N2JA 1HK6A 3O8XC 3P30H 2RJMA 1NGYA 1ET5A 1LO0H 2Z4QB 4UANA 5CJOH 1FL6A 2IH3A 3RDTA 5GHWL 3V0HA 3WUWA 4JNXA 1A4BA 3BGFB 5C0CE 3J2PA 1DL7L 1KEML 5MEQA 2F74B 3O6MH 3IGLA 4NKIH 1RMFH 5AYUH 1HXKA 1Q4NX 1SJEA 5DJ0A 3VD5A 1DBKL 1FVDB 1HQRA 4O58H 4LLMA 4B9IA 2YPKB 3NJKA 4X50A 1UXSA 1YY9D 2YMOA 3H0TB 5IT2H 4AMWA 1XCWA 3QUMH 1CGWA 3NZ8B 2G5UA 4MXWL 5DA0B 4ZAKD 3VX0A 4XB8A 5D2NA 2OS7A 1SBSL 2A74A 5L9DH 4N8VB 3VGBA 1T4KA 2EC9U 2BC4A 4GRLA 2X4TB 5E1QA 1MCWW 3V6OC 4YXHH 3CLFH 3WN5B 4P2OC 3MRJA 4OD3H 2YPLA 4NAMA 1EFXD 3RIFF 5SX4H 4WRLA 1KTLA 5K33A 4HLZG 1SPDA 3GMRA 3JTTA 4PH8A 4OF5A 2Q1EA 5CINH 4NENA 3T4YA 4DO4A 2ZOWA 4MXVE 3FUKA 4JGJA 3EYUH 4WI0B 1J5HA 1R3KB 2PXYA 4X5QA 1S9XA 2CHZA 2G0LA 2Y5QA 2ZWLT 3L7FA 2KQNA 4PGJA 5EO0A 3UC2A 2PWDA 1YDPB 3JUZA 1MCCA 3QARA 1U8KB 3P9MB 1FLTX 1ACYL 4AXWA 4AW7A 1VJSA 4YBLB 3RAJH 4L48A 3IFOA 3REWB 1O9WA 1MH5B 4P5MA 3KPRA 4F9PA 3SBPA 1RY7B 4HKJA 1KCVL 4LLWB 2BDNL 5HYJB 4PJ5A 1Z2KA 3QGVA 1S78D 3FT3B 4WO0A 2ZXDA 1U8JA 3DSFH 5EWIH 1DJIA 5I73C 1S5HB 1T0NB 1ZJAA 3FQRB 2YRZA 5EZLB 4RH4A 4DOHB 2XIBA 2O5ZH 1IGFL 4TVPD 2ZWKA 3K2KA 2VW4A 1TJHH 3VQ2C 3PPEA 2JTDA 4ODHH 3WS3A 3OD3A 4OFYD 4WGWB 1TJXA 4ZX6A 3ZX1A 1XZ0A 4HUVB 3P4OA 4L3AA 1DVXA 1HXMA 1UZ8A 4L05A 2HRHA 4PJAB 2XTJD 4S11A 5EPMB 4D0CA 2F53B 1QQDA 4NBXB 5FLUA 4OZFB 5I5RA 3MHZA 2YFOA 4NOBA 4Y9GA 3KVPA 1MXDA 1BGXL 3OKEB 4M43L 2ZXAA 2WIIA 4Q4IA 1OB1A 2ADJB 4ALAC 3VU2A 1B4JH 25C8L 3BE1L 3MR9A 5DZVA 2ROXA 4B5ZA 5KOMC 3MCYA 4PGDB 1NDMB 3X14A 1CT8A 4XN4A 1WK0A 4F7MA 4OB5L 1ZJBA 1ADQL 3ATFA 4KUZH 5FAAA 3FC8A 2I7SA 4FXKC 5IJKC 4KV5F 4A7GA 4JFFB 1T22A 5M95B 3UYRH 4HVBA 1M7DA 1MLCA 2DEXX 1JYXA 3LKSA 4LCIL 5DQDH 1UA6L 5DYFA 4WHTB 3VXME 2IAMC 1X4YA 1F11A 2F8VA 1E5UI 4P4KB 4XC1L 4P5TC 3UFIA 4AQ1A 3BPCA 4PVBA 1RZ8A 3Q3GB 4ZFZA 5SWZA 4YHZL 2ZP9A 4P2QE 1AZRA 2PF6A 3B1TA 2XXMB 1I7RA 3FTSA 4TSAH 2UXTA 4PJ9C 4QHMB 3T4AB 1JZ8A 3DX6B 4PRNA 5GZOC 2D7NA 4FQXD 2XWDA 1J8HE 4RCAA 4W70A 2FD6L 4NZJA 4GQ9H 4JFYB 2E7LA 5IHZB 2OR8A 3ZYIA 5F3HB 1BEYL 3M45A 5CGMA 1RVFH 2WXQA 5KW9L 5K1JA 4XPAH 4KMTL 4L4TD 1TU2B 1NC2A 1IVLA 3II2A 3MBXL 4K07A 3VXRA 2WXHA 5MERB 2OAAA 2FIKB 3HE6C 1TZIA 2VISA 3QUKB 3RX5A 2R27A 1S9WB 3HB3B 3OF6D 3IAGC 2ENSA 1MVUA 2EDWA 1AP2A 1X7QB 2ZP8A 2WC7A 3PHQA 1YMMB 2GJPA 4UT6A 4N22A 3AY2A 2WQVA 5KJ7E 5DDHB 5EF1A 1OAUL 1TZGL 3RZCB 2H0PA 1NGYB 2P8LA 2YA1A 4I3RL 1NUGA 5E2UL 2H5UA 3QAZB 4K7PY 1FL6B 4W4OC 2UYLA 3OPZH 4N0UE 1AFVH 4G9FD 4Z3JA 3WFEL 2FWUA 3ULUL 5AAMA 1UM4L 3KWWA 4UCFA 3MRQA 1M7UA 1MUJA 4X6DF 5DJ0B 1HQRB 4XHJC 1Q0XH 1ID2A 3SB3A 1R3LA 2CA3A 1USZA 3F58H 4LLMB 1P7BA 3Q6GH 5IQ7L 4MRCA 3Q43A 2Y69B 3ABZA 1UXSB 3Q8EA 4WY7H 5DUPL 4RGNB 1FGNH 1MCJA 2VZ1A 4FYRA 3PWPB 4NN5C 5ADOH 2NY7L 4MJ2A 3VQMA 5LHDA 4AYFA 2C9RA 4DCQA 1ANUA 2LLNA 5D2NB 2B9AA 1NBCA 2A74B 4P06A 1T4KB 1YEJH 2BC4B 3ORJA 4GRLB 4YK4C 3VNZA 3WFCH 3ZMEA 1A7NL 2W1NA 3UBXI 1RZFL 5ESAA 4FTVE 1Q9LB 3EO0A 3MRJB 2YPLB 4KKLC 5E6SB 5B4MC 4OJEH 3NIDF 1NIFA 1KB3A 1KTLB 5EZIL 4N2LA 3GMRB 4WGKA 3JTTB 2Y7OA 2EAEA 3A6OA 4NENB 3T4YB 4G6AD 4C4UA 2DTML 1HH9A 4LF3A 4LSVH 2K8QA 3OWEA 2DDQH 2QGDA 4HLJA 4Z3GA 4WFEE 3ARTA 5I23A 4BV1A 3S37H 2PXYB 2A6DA 1S9XB 3DUSA 2IGFH 3L7FB 4U1JB 1VERA 3VMOA 3IJEB 2GHZA 2NX5A 4OD1L 3D0LA 4XCEA 4AH2A 4Z7AA 3QG7H 1RIUH 2AXFA 1P9MC 1SHXA 2LU7A 3VA6A 2OR7A 4OV5A 4XI5C 1FI8C 3K2UL 3IFOB 3KPRB 2OR9H 3SE4C 2EC8A 3MXVL 3EUDA 2XXFA 3CHRA 4HKJB 2Q7NA 2CKNA 3NGBB 4PJ5B 2V8LA 1YY8A 5L4FA 1U8JB 2X1WL 2MCPL 3IJSB 4YR6A 1OP9A 2ARJQ 1L7IL 1L9QA 1WBYA 4E9WA 2J6EL 1UQSA 3H9SA 2V2XA 4YSTA 4OH2A 3W11C 1GYVA 4KRMB 4RFNC 2A77H 2FK9A 3CFUA 3QCUH 1FG2A 1PDKA 5DK2A 5SWQA 4NRYB 4EI5A 2LLGA 1XZ0B 1PD1A 2V9TA 1RZ7L 2YD9A 2DRUA 2DIJA 3OAZH 1HXMB 1UZ8B 4F9LC 4D0CB 1JF1A 3IFPA 2Z8SA 2P46B 4F37F 2NSQA 3TJHC 4ZMTA 3O8XD 1WA0X 1QUNA 3LEVH 3R1GH 4J4PA 5I1DB 4F5CA 4QRFA 1KC5L 2BOBA 2WIIB 2EIKB 4OM1L 4ZMXA 1OB1B 3FRPA 3VMPA 1MJUL 1EX0A 2JKLA 3MR9B 5T5FL 3ULAB 2P5WB 3T0EA 1JOIA 4JBSA 4U3HA 1UGNA 5KSVB 2X88A 5HGHA 2IFFH 4F7MB 5F72S 3HS0C 1FO0B 4GBXC 3O4LD 1WA2X 4DTGL 4WO4C 2UY6A 2J4WH 5I24A 4HC1L 4XPGL 3STLA 1HL5A 3PJNA 3FB8B 4G7VH 1T22B 2HAZA 4KVCH 5CIPB 3RFZB 1MLCB 3OKDA 1HDMB 3LKSB 4FHJA 1K85A 2BINA 1WPCA 2DJUA 5F1IA 3SYAA 1F11B 4G8FA 4GG8A 5FO7B 1JZ3A 3FK3A 4AQ1B 3BPCB 1RZ8B 4NIKB 4ZFZB 5SWZB 3U25A 2JK5A 3QFJA 2TSAA 3H3KA 1U36A 1TPXB 1WAEA 1YEFL 4FC3E 1Z7JA 1I7RB 1L3NA 2VKWA 1KBBA 4KDWA 4PY8I 2E9WA 5FCUH 4JK0D 1XIWA 4P2OD 3QP3A 1BCIA 2EXTA 5T3ZD 4KKBC 4M9OA 3ZE1E 1FV1A 1F45A 1XEDA 3GNML 3GSXB 2KLTA 4XOCA 2W0PA 5EN2A 4B53A 1YRKA 2MCG1 2O1AA 3PAZA 5I2IA 1NC4A 1E27B 3VXRB 4BDVA 2N3JA 3GSUA 2XN9E 3ZDYE 3CK0H 5HJGA 2H32H 3ESOA 2Y6TE 5GGTA 1TZIB 4D9LL 4QHPA 5KVGE 1E8WA 5C0BA 1MVUB 1OW0C 3KJ6L 1AP2B 3GZPA 4KH2A 3FQXA 3ZHFA 1RUAL 1OCWL 2MMXA 1KPUA 1XMWA 5D5ME 3EFOB 1CYGA 2P8LB 4PJGE 2R4SL 2XPZA 5IB1A 2V17H 4G8EA 1A6TA 2XG4A 1E28B 2UYLB 2EXWC 1OO2A 2B0SH 2D3JA 1G0DA 3QPXH 1G9HA 2EILB 5DS2A 4HV8A 2PWEA 6TAAA 5C08D 1AGBA 3KWWB 4K5OA 2E6QA 1UVQA 1MUJB 4MQ7B 3VXPA 5BUGA 2XKUA 3QHFH 3QZWG 1N64H 1RUQH 1EAPA 1R3LB 1HX0A 7FABL 1ZY9A 3B1UA 3JZ7A 5C0RL 3WXVL 5EH1A 3UTTA 3BO8A 3VM7A 4YNYA 3GJEB 3GXFA 1XTMA 4NNYA 1GCYA 1IAMA 1CYWA 3CN3A 3GJFK 3LD8B 4AYFB 2BNQD 2F7IA 4W4NA 3P69A 4TNWF 3FHAA 3G9VA 4LU5L 2M1KA 4I9WE 2O72A 3TBVA 1IAII 1A1MA 1HOEA 4N87A 4JW3A 1BFOA 1JYVA 4KKQA 4FYSA 3EO0B 5AVWB 3D4CA 3GBEA 1S5IL 1U2CA 1XVSA 3NSYA 2HXAA 4MNQD 4APXA 5BV7C 1KDJA 4BZ1H 1NCTA 5FYLL 2XIDA 4K3GA 1RJCA 3GWJA 1HH9B 1CMOA 4PJHE 3FFCD 2FQEA 2MKWA 1G0XA 2A6DB 1ZHKB 3DUSB 1HNFA 3CZJA 2WLLB 4X7DC 2NX5B 4XCEB 1TO4A 3D0LB 4AH2B 5L7XL 1XF4A 2AXFB 1WE5A 2KLRA 4QAMB 4OV5B 3L5WA 3EJUA 3GTVA 1YUKB 2IAMD 1KCUH 4IBSA 5ILTL 2A6IB 4P5TD 2VDML 3K91A 1ZHBB 3PWLA 4WQOA 3DUUA 2ATPA 4DERA 3OGOE 5B3SB 3PWNA 4F20A 1JZ2A 1AS7A 4PJ9D 4PRIE 5FM4A 3VA2C 5HDWA 3GBDA 5A2FA 4YR6B 4RISL 3BFQG 3BIKA 3CZGA 5GZOD 5JHAA 3NJXA 1MQ8A 4KI5F 4CSZA 4CC4A 1UQSB 3H9SB 2V2XB 3N0AA 1XXFC 1YLBB 2QFRA 2UX6A 4NQED 4EIGB 5I18H 4XAKD 1OD9A 3EJYC 1KNOA 1IAOA 1GHFL 1FG2B 1PDKB 5SWQB 4PJIF 4EO5A 4EI5B 5T3XE 2E9GA 1WTLA 4MA3A 3N9GH 4X7SH 1MCPH 1R33A 1JXGA 3HE6D 2IANB 1UATA 3NDZE 1JF1B 3IFPB 4PLNC 1PNDA 4EUPA 5F9DC 3L3KA 3TH4T 4M1CC 3U2JA 3QDGA 3VCLA 1QUNB 3VB8A 4Q74A 3KPSE 2JTYA 1HU8A 2BOBB 4AV4A 4B50A 1QBBA 2QPDB 3C6SA 1EGJA 3T0EB 4LVHC 1LEKA 3FH8A 3RWEA 4JZJB 4JO5A 1KYOK 5HGHB 4P59H 4Z7UA 1HWGB 1E40A 2ERJC 5C3LD 4XHJD 1KYAA 1UOVA 3DO3A 1SY6H 5IV2B 3STLB 2AJUL 4U1HA 3GEFA 4P2RD 3OKDB 1DQML 1K4DA 3BVDB 1SVCP 4N6QA 4P9HH 1DANU 4JM4L 1GOHA 1O0VA 4KTDL 4KX7A 1FH5L 1OSZB 3F8UB 3G5WA 2CGYA 1U95A 1UA7A 1BF8A 5GRZA 2JK5B 1K9TA 2YLHA 3QFJB 3UTOA 4NM8L 3WIAA 1IL1A 1RZPA 5I30H 2NR6C 4OJCA 4Y2OB 5DC2A 3FO9A 4QXUL 4M93C 1XIWB 4KKLD 5B4MD 1Z0MA 4K5MA 4U6XA 3T2LA 4KPHH 1FV1B 4JFDB 2NZ1A 1TETL 2F08A 2GBVA 3OX8A 2PR4L 2VE6A 1ODAA 1NPNA 2CNZA 2E46A 5EN2B 3CGTA 1GGUA 2FB4H 3D2UD 5K39A 1AR1B 3HR6A 2R29L 3FSVA 1RK7A 4D8OA 5LNGA 3K6FA 3V0AC 5KN5A 1CE6A 1DBJL 3GSUB 5T1DH 4BDVB 1JTPA 1QFWH 1KWGA 1T0OA 1W8NA 2VR8A 5AVVB 1QABA 2CALA 4XBGA 4GRWB 5GISL 4YHML 1H15A 1A7OL 1MJ7L 4QAWA 4TQ8A 5C0BB 2UWEB 3FQXB 4OCWL 3VXOA 3VM5A 2A4CA 4ICWA 1KPUB 4XI5D 1UD5A 3I6KB 3RPIA 4F2ME 4DFIA 2CLVA 2W91A 1XAUA 5IB1B 1NQBA 3FL7A 3E3QC 1A6TB 2XG4B 4G8EB 4FKKA 4A66A 4DUVA 4RFOL 1JZIA 4A04A 4GSQA 1UASA 2EACA 1P5UC 1TZ8A 3VXPB 2L7EA 4UB0H 3LXBA 4KNUA 1EAPB 1YEKH 1BAFH 3W11D 1SXSA 5TE4L 3UTTB 1KJ2A 3BO8B 4XMVA 3KWTA 4AQ8C 1F97A 4YNYB 2YGNA 4POYA 3Q44A 4KZEH 2DV6A 3MDJA 2K70A 1F6FB 3GM0A 2EJ1A 3BD3A 3ABMB 2NY4C 4UU9A 3U1PA 4PI2A 1BAGA 3G5VA 1EDQA 1SF5A 4N8PA 2DKMA 2EDFA 1VA9A 4JCLA 3TBVB 3TJHD 1A1MB 4LDEB 1BFOB 1JRHH 5LCVA 4BWUA 2BJMH 2MPAH 3D87B 3V4VL 2X6AA 4L8SC 5CMAA 5I15H 3QK0A 5EN3A 3QA3B 1RAMA 4APXB 1NFDF 2G3MA 2QZQA 4U3XA 2E0PA 3FUNA 2J6WA 4PD4J 3Q9QA 3HMXH 4OGYH 1QSVA 1LD9A 2BSBA 3QQNA 4GQRA 4GBXD 2R1YA 5JPNC 4WO4D 3SYQA 4PQXA 2KMWA 1FG9C 1XBDA 1CXEA 1XF4B 2DS4A 1Q0EA 5LBSH 5C6PB 3L5WB 3MODL 3ZTEA 3GSNA 2VXVH 4ANVA 4JFZL 4LPYA 3PWLB 5HYJE 4W6YB 3NABL 2ATPB 2EEXA 1MZZA 3BVNA 3PWNB 3NCCB 1UACH 1NMBH 2DB8A 1JWSA 2EEBA 2ZG1A 4DOHE 4KKBD 2ICEC 1TENA 3TPKA 4L9DA 4X8CA 1CLYH 3U4KA 4F7KA 2NY6C 4F33A 4PJDA 4NDMA 4U1SA 2WKOF 2GBUA 1KNOB 1IAOB 5E5RB 4LPCA 1O6SA 1WSST 2COQA 2LAAA 3ME0B 2Y7SA 1G7QA 4L1BA 4FFWC 4XBEL 3SY0A 5HGBB 1HEJC 4ANKA 3WNPA 1WGOA 5EULV 4PJAE 1JK9B 1E6OH 2F53E 2AERT 5TPWH 1RULL 1TJIL 4AKOA 1JHTB 2B59A 5IQNA 4LEBA 3BUTA 5BXFA 1KBGL 1ZT7A 1J18A 3V52L 1HSAB 3KH4A 4NWTH 3CSFA 1GY1A 3I50H 3GXMA 4JLRA 3QDGB 3R8QA 4NUGL 3VCLB 4A7SA 4Q8BA 2F7OA 3Q0HA 4GO9A 2EXWD 4X5WA 3C6SB 3ZDZF 5DO8A 2XZQL 1I85C 1O6VA 4PJ8D 3RWEB 2ZX8A 3KG5A 1WCBA 3MO1A 2PPEA 4HS8H 4HEME 5BCAA 4Z7UB 1MRCH 4YHOL 2X9WA 4HU8A 3LIZH 1KY7A 3GT6A 4HX1B 1T7ZA 3FSZA 4PGCB 4JFFE 2KERA 1XB6A 1DQDH 4NZUL 2DH3A 4DZBB 3BKCH 4U1HB 4LOUC 1ODUA 4KX9A 1K4DB 1XF3A 4JPVH 4F7PA 1QX1A 2EUWA 4QDGA 4KXZI 5GPRA 3LKOA 5GS3A 1IZJA 1OPGH 4LBAA 4OKDA 5EDSA 1Q9WA 1U95B 4G7SB 2HT4C 3ZT7A 2FRGP 1U2YA 4Z77A 1U42A 1XH1A 3FO9B 1I7TA 3I6SA 4V1DA 1I9RL 1LO5A 2WXLA 2NYKA 4JMNA 4TOYL 4F7EB 2VDQB 4NO3A 4OCSH 5DUJA 3T09A 1QLFA 3QUXC 4C56D 5F7MC 2VE6B 4IM8A 2FGWL 3TFKC 3CIAA 2B4CC 6CGTA 1H8SA 1T1ZB 5T3ZH 2QHRL 5K39B 3QEGL 3WJJA 1ZCRA 3CJJA 3K2IA 2PYEA 2D7TL 3MNVA 3NQKA 1CE6B 3ZOAA 3VFMA 2QLYA 4XBGB 1UFUA 1YMME 5KVEH 2DI8A 2XYBA 4ODWA 1ZD6A 1QZ1A 1JAEA 3VGHA 3VXOB 5AWNL 1EAQA 4Y9EA 1HZKA 4X7TA 3RPIB 3VGEA 2CLVB 1ZIAA 3IDYB 3P3SA 1EAOA 4J8QA 2EDMA 4CVXA 1RJYA 4XMLH 3LQAL 3I6LE 5GSRB 3ZRFC 4N24A 3KYAA 3ARXA 2H9GB 5F88A 3QHZH 3HFFA 3MBWB 2RQEA 5I9QB 3MRGA 4M8VA 1CGYA 4F8QA 2DPKA 5EC1A 1CN4A 5KAQG 2BY0A 4OKVA 2EEFA 2PNDA 4RGNE 4CNIA 4E36A 3EJYD 4ADJA 3BESR 1FNGB 5DK0A 4HUUA 3LRHA 5DMIL 4DPBX 3DX7A 5E9NA 1U8QA 5D2NE 3WFBH 3L81A 5F9JA 2NXYC 2A9AA 1T83A 1WWWX 3KXFA 4UU9B 4JE4B 4GNKB 4JKKA 5AOMA 4FFZL 2B3RA 3UYOD 2YPLE 4M1CD 5SX5K 1MF2H 3WOVA 2GJ6A 1NJ9A 3QS2A 4DP1X 1RHHA 3HZ3A 4IJTA 1T7VA 4XE0A 5CMAB 5C09B 2R0KH 4OFDA 5HHVL 1HI6A 4BM7A 2CAKA 6FABH 3DKHA 2IIJA 3LPPA 5FYJE 3OC5A 2VH5L 3EO9H 4ALAH 4XVOA 1LD9B 4JKPL 4Y2DB 1DBAH 4JHBA 4JX0A 2R1YB 4DP9X 3OAUL 4N68A 1RHFA 1V3KA 4G7YL 4YIQA 2X4RA 4NERA 2ADYA 4BK5A 4JUSA 3LRMA 3US1A 4LAQL 4LGPB 4W1TA 2EVHA 3KPRE 1SEQL 4PRPD 5GS0L 5ABAA 1M42A 3PDOA 1UXWA 1XO8A 4PJ5E 2FEDC 3HZMA 4A6YA 3WIHA 2FJSA 3BVNB 4UQBA 1RZKC 2NR6D 3O3EA 4X7FC 3ARFC 4YHLH 1IQDA 2N7AA 4X5XA 1JWSB 1GMIA 3N40P 3P30L 1UOWA 2ITDA 5CJOL 1D7FA 43CAA 4AIZB 4F33B 3F7QA 3MRMA 4PJDB 4U1SB 4ZYKA 3O6ML 4HH9A 4PRHD 4NKIL 1CCZA 1RMFL 5AYUL 1O6SB 4PYHA 1MW0A 1G7QB 4UM9D 3SY0B 3F64A 1OARH 3K8MA 5ESVA 3ARBB 3RNKB 3M88A 1QOKA 2XDHA 3MLTA 3BOVA 1ZT7B 3T3MF 1AGEA 5IT2L 1BF5A 1EO5A 3QUML 4R7NA 4JLRB 3KHQA 1RLBA 2WQXA 3FQUB 5J6SA 2OW6A 1HCVA 1M7IB 4OSUH 3B2UC 3FBQA 2P5WE 1L6ZA 4FG0A 4M00A 2B5IB 4HIIA 5DGQA 5L9DL 4N26A 1ASPA 4OZIF 4UT7H 3UJTH 4N85A 1WCBB 4OIBA 4L23A 4IYKA 4DQOH 1OM9A 4YXHL 3D39B 3CLFL 5I6OA 4OD3L 2FECI 5BRZD 3ZGIA 3BZDA 1J1XH 1B4RA 3QUYC 3HTLX 1QVOB 4FX5A 4GXUM 1ZE3C 4L4VA 4B27A 5CINL 1A0QH 1E30A 4U1MA 1XF3B 2Y25A 4F7PB 2GQHA 1D9KC 3Q5OA 5I8CB 2JKIS 1XH2A 4QLRA 3EYUL 5SWZE 2ZWZA 4KXDA 2NY4D 3V0WH 5CEZE 2LR4A 1Q9WB 1OY3B 5AG9A 3FU7A 2E74C 4U49A 2WBJC 4EIZC 2D4DA 4Z77B 3RAJL 2C9XA 5AKSA 4L4TA 1I7TB 3Q06A 4V1DB 2QHLA 1LO5B 3DX9A 3G6JF 1H6UA 1BZ9A 1YEDA 2IG2H 4CGTA 1QLFB 2X9YA 1JS4A 3WHE1 2CMRH 2OMWB 2QDWA 5EWIL 3VXRE 5JA8B 1MJ8H 3DSFL 2GIXA 5I1JH 1D5IH 3V6ZB 2PYEB 1AGDA 3FU0A 3MNVB 2DOCA 3LRGA 1JJUA 4ANUA 5HHXH 1RIHH 1WWAX 4G6MH 1F4AA 3MRPA 4MMXB 3VFMB 4ZMOA 2O5ZL 2R2HB 2XNAA 4W9DC 2ZXGA 5GJTH 1P1VA 2CU9A 1TJHL 1SJHB 3IBOA 4ODWB 4WJ5A 3SJVA 2WN3A 4ODHL 3ZBMA 4E2OA 4NP4H 4HIJA 4X7TB