2ZF9A

Crystal structure of a type iii cohesin module from the cellulosomal scae cell-surface anchoring scaffoldin of ruminococcus flavefaciens
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
184
structure length
184
Chain Sequence
AMGPAAGQAYDAGNLDVASSPVKPTLSITKKTLTAAEAPNAKVTMELSVEGAADKYAATGLHIQFDPKLKLIPDEDGALATAGRAARLLELKKAEADTDNSFFTATGSSTNNGKDGVLWSFVLQVPADAQPGDKYDVQVAYQSRTTNEDLFTNVKKDEEGLLMQAWTFTQGIEQGYIQVESTTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cohesin diversity revealed by the crystal structure of the anchoring cohesin from Ruminococcus flavefaciens.
pubmed doi rcsb
source organism Ruminococcus flavefaciens
molecule tags Structural protein
molecule keywords ScaE cell-surface anchored scaffoldin protein
total genus 40
structure length 184
sequence length 184
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zf9A00
5AOZA 3GHPA 4IU3A 4FL4B 2VO8A 2Y3NA 1G1KA 2XDHA 2O4EA 4IU2A 3BWZA 2JH2A 2VN5A 4N2OA 2CCLA 4UMSA 1OHZA 4WKZB 4UYPA 1AOHA 1ZV9A 2ZF9A 3F2LA 5LXVA 1ANUA 4UYQA 3KCPA 1TYJA 2W1NA 3UL4A 2B59A 5G5DA 2BM3A 1QZNA 3FNKA 3L8QA 2VN6A 4WI0A 4FL4C 2OZNA 3KCPB 5K39A 4DH2A 4U3SA
chains in the Genus database with same CATH superfamily
1F11A 2CHNA 4JREB 4XPGH 5DEGA 2DWEB 2Y24A 3UG3A 3VXUA 4TM9A 5JIKA 2EEAA 3BP7A 4N2FA 2XYBA 1JUFA 3OX8B 4MRBA 3V0GA 3QFGA 3HHSB 1MCFA 1UKQA 4IGBB 3HZKA 1A4KB 4IOSA 2VYRE 5C71A 3ASWA 3C60D 4XMZA 2YA1A 1SHMA 5J6GA 3KYAA 3UPCA 4JFOA 3QDMA 4J2QA 2Z92B 43CAB 4N8CH 4HUCA 2WWOA 1E2ZA 4J3XA 1UURA 2XOTA 1MREL 5A2LH 1ZJAA 4FG0A 4L3EB 3KPRE 3WHXA 5HJ3B 2K3HA 4O02A 5D2NE 2NDGA 2W0KA 3WDIA 3KNBA 4FTVE 4J1UB 2QT6A 4Q6IB 4KKAC 3LS4L 1P69B 4ODUA 1YECL 3P4OB 2WUCH 3VXUB 1CYGA 4Z7VB 4PJAE 4XCNA 4A39A 2ZD0A 3T3MF 1KGIA 4U0QB 4JZJA 4H8WC 4I3RH 1UCTA 2V5SA 5JHAA 4HJ0D 3PABA 3WTYA 3K46A 4XN7A 3JWNE 1N18A 2G5BB 2DQEH 5ELIA 4FC3E 4DGVL 2P5EB 3CCHB 3WXVL 3WEXB 3HI5L 1IBGH 4UM9D 2WLYA 3MU3A 1CL7H 5DWUL 1MCDA 1RUPL 4P2QA 3WFHB 4AIZB 1S3KL 5FAAA 5HHNA 3AS0A 1OT1A 1NCOA 1OLZA 2C9UA 3OHXB 4ODTL 3U83A 5KYNA 3AROA 4MQXC 1ZT4B 3KZ8A 2WQAA 4AX3A 1X7QA 1JHLL 3FB6B 3FW6A 2VR5A 3OG6B 4KY1L 2Q6WA 3B1UA 3FZUD 1NGQL 32C2A 3SKNB 1FLRH 3IFNL 5C8JA 5L2KE 4X2UA 5JUEL 1TVDA 3GI9H 5CZVH 5DR5L 1TTUA 3K2UL 3MRKB 3PDOA 5F9JB 4X6CE 4ZXBC 2R4SL 3DMMB 3F8UB 3UBFA 5F93C 1J88A 1Q0EA 3AC0A 4PRAA 1N6QL 3TCXA 4FHKA 1BYNA 5FA3A 3QUYD 4G8GD 4L9LC 1EO5A 5KANG 5DC4B 1KTDB 2EQDA 3FCUB 4DGIH 3N40P 5DJXA 1PKQA 2YPLA 3KW7A 4L8SC 3QRFM 2YD8A 1TPXC 2A9MH 3GC3A 5AALA 1UD8A 1P84J 2D9QB 5D1XE 1U8IB 2WQSA 3QDGB 1MCJA 2X6BA 3IRCA 4C58B 3ULUE 5ILTH 5INDA 1FGVL 1QSFB 3SPGA 1VA9A 4ELMA 5AW2B 2NTFB 2WZ5A 4JN1H 4AVKA 2D7TH 1P2CA 4MBOA 1JBJA 1G9NL 3S4SA 5JIDA 1KC5L 3OGOE 4JPIB 4KXZH 2DN7A 4Y9GA 4P9HC 3THMH 5HXMA 4S0TD 5TE4H 2W0PA 4MMZC 1CYXA 3GS7A 4FFZH 1NFDB 3S34H 3SN6N 4TMPA 2WUBH 1E3XA 3SQRA 2FQDA 2P5WD 2DV6A 2WTRA 3NJNA 3NGBC 1FL5B 2AV1A 3S5LB 2DI8A 4GSUA 1F58H 3ZSTA 1OGTA 5DUBA 1MCPL 4OD2B 5D1QD 2J3SA 3BUYB 4XHJD 2SEBB 3HZMB 1JCKA 3L8QA 5FCUH 4CGUB 4WO4D 2ESVA 3ABLB 1TEFA 4P46D 3WCYA 4RMVA 1SOXA 1IFGA 1ZSDB 5ALCL 5I74C 3FAWA 4U3SA 3GHBH 5TF1L 1PYWA 3GHPA 5GJSH 4NQCE 2MNUA 3M8OL 4HCRL 1W6LA 3DVNB 3QJSB 3TVMB 5HPMB 5J13C 4KXZI 2LU5A 5T1MB 5J8OA 1XDTT 4LP4A 3SGEI 4QGYA 1Y7VA 3FUDA 4MYPA 1X44A 2IAMD 4PGCA 3RVWD 3P4MB 4XWOC 2J72A 3IJYB 5H37H 5ILTL 3EH5B 3AREA 4HJUA 4YHYB 3W0WE 2NSQA 3NSXA 5SV3A 4NKOB 4FP8L 4N0FB 4N0UB 5FEBA 4NCC1 1GYWA 1X5MA 3WE6A 1N2RB 4HFUH 2EEDA 3WXWL 3BWSA 4MJ4A 1VACA 4RMQA 2IWFA 5AW4B 3FFCA 1FE8L 3CIQA 1J8HE 4KPHH 2YWYA 4P4KA 1LO3H 4JFHD 4CVZB 5JHDE 2DLEA 3IN0A 2YXMA 1XAKA 5CJXC 1EHLL 4XHJC 3MROB 2C1OB 4K3DH 3APMA 1R5VB 2J8HA 4NLAA 2F53B 3VSVA 5HYJB 4MGXA 5FFGA 3S5LA 3MV01 3QFJA 5F1KC 1MHPH 2G9HB 3VQ2C 4JPVL 2DKUA 1DDHB 3JYBA 1HL4A 2CDGA 1M3JA 2RQEA 4ODSL 4P5RA 1WDAA 2IFFH 4KU1A 2J1YA 1UM6L 2FGWL 2P8PA 1GGBL 3TWCL 1CTOA 1BQLL 1TZGL 2EYTB 4POZC 5DT1L 1KB5B 3ZKXC 5D7KD 3FN9A 5BW7C 2W65B 4JDVA 1QRND 2IADA 3L5HA 2YAHA 4KUCF 2FECI 4LSUH 1J9RA 1L7TL 3AQYA 1JXFA 2AJSL 1CL7I 1WD9A 1U8OA 2Q7AA 2JQMA 3NAAH 1ZA3B 4Y5XB 4GG6F 4HKBB 3TZVC 1F4WH 1USZA 1KFAL 1T1WA 4GBXD 4GEJA 2PN5A 4BCXA 5G4MA 1U58A 2PP8A 2Q2EB 1TUPA 1NBCA 3N41B 1WBYB 4DWHA 1K4DB 2GIMA 1UQSA 4G8IA 4ABWA 4WO4A 3PHQA 2RBLA 3DUSA 4CA4A 3QZMA 1KV3A 5EEWA 4AYID 1L6XA 1WA2X 2H1PL 4WI2A 3WHE1 1X5XA 3DGGA 3K3QA 1FRGH 2EDRA 5A2CA 2R8SH 1G7PB 3EO0B 1LMIA 1XIWA 3GO1L 4IOIA 3NG5A 4GXUN 5I6PA 1NFAA 4JDTH 4GIOA 2DB8A 5IQ7L 1WE5A 1ZTXE 2A83A 3H54A 3LXAA 2G9HA 1CE6A 3GD1C 4M1DL 1Q9KB 3FZUC 3K1KC 4BBWA 1I4FB 2XVGA 5ICZB 5D7HA 3KXFA 4NN5C 4BFNA 1VGKB 5E6YA 4EZMA 3VE0B 5EZOH 3MJ7B 1PYWB 3IJEB 4YSEA 3UTSB 3L4VA 3PUUA 2OL3L 3FUJA 3MQIA 5DJYB 5EULV 4AEHL 2WLIA 1JZJA 3F7YA 3NJGA 4PV1C 1XCQA 2AQSA 3CDFA 2AJSH 1LVEA 4MB4A 3BAEH 5BW7A 3TONA 1D9KD 2JCCF 3K6SB 4OCWH 5F9DC 1EMTH 1OIOA 4I88A 2E9JA 3SPVA 5CN3A 1C08A 2HRPH 2VQ1B 3KCPA 4IDJL 4DVRL 4KK5D 3SE3C 3REWB 1J8KA 1PQZB 3PJNA 4G8GA 2ZOUA 3KPQB 3QYMA 3X2QB 3IDXH 4HEPA 2VLJD 3UMNA 1M2VB 2HJLB 3F5WB 4W9KC 2DDQH 5ITBL 4AITA 3TNMA 1NDGB 3NCYP 1BECA 4MCMA 5DQDH 4AI7A 1T0MA 3I50L 1J8HB 1FCCA 1QTYT 5DA4A 1DCEA 5T1DH 3H4FA 2F1AA 4RMSA 3FBQA 3BVUA 1UKTA 2EDEA 2L7UA 3DX8B 2Q87A 3GM0A 3M88A 5EZJA 2GTWA 3BH8A 3BX7C 2NXYB 3WY4A 2H26B 1KPRA 3KEDA 3W0WB 1PDKA 4M1GH 3WMSA 3INOA 1NCAH 1IAOB 3EJZD 4LCYB 2AJ3B 1J1XL 3QEQE 4IHBA 3QDJB 3KYNB 1GZQA 1S9YA 5C0JB 4YXHL 5KVDE 2IDSA 5I1GH 1B3IA 2KPNA 2M83A 2WZPD 4X8XA 1KPUA 5SWSB 2BVOB 2X1OA 4OIFA 5LXVA 1T83A 3P77B 1C08B 3DLQR 4QAWA 3QXWA 3ARDB 2QPDB 1YMMB 1LE9B 1F3DJ 1IUZA 1OM9A 2GK0B 3A67L 4LPTA 5ABAA 1U95B 2VR4A 2EABA 3V6ZB 2LABA 1IC7L 3RZCA 4H88H 5JW3L 4JRWA 3P54A 3ZE0E 3CFMA 4AZUA 1AHWC 2AC0A 4MS8C 1C5DA 1VB9A 4PRNA 4BCZA 2KLSA 1S7XB 1UCBL 1MCKA 4RSVA 3LD8C 2UX7A 3RWEA 4OLVL 3IM1A 3O6FD 4MAYA 4WKZB 1ZLSL 5SWSA 1VADB 2WJ7A 4RBPK 2CO7A 4I9WE 2IH8A 5CZXD 1T03L 4NPYA 2EO9A 2H0PA 1BJMA 1T7WA 1EGJA 1G9HA 3VA2C 2Y2WA 5D1ZA 1XD0A 1NBZA 2I25N 4OM0L 4PJBB 4I9XA 5F72S 1W0WB 1OO2A 4BKSC 5CEZE 1NAKH 2CDEA 4JHVA 3FUKA 3HS8A 5E9AA 1A7OH 1OTSD 5IY5B 2EACA 5A40E 1O7DE 5J6HB 4KHXL 2VL5A 1L7IL 3AT9A 2K7PA 4EN3B 3IMVA 1NJ9B 2OL3A 5HHVL 5CBEA 4G7RB 4MZRA 4LPCA 2BPBA 4K3HA 4TPRH 5ADOH 3OX8A 4JFPA 1AQKL 1FO0A 2ICWB 2R2HA 2X6UA 1KGWA 2Y36L 4F1SA 5HYSG 2WNKA 2ENJA 5GS0L 2UY6A 4PJHF 4NENA 3BQUC 5FWQA 1HJCA 4XO4A 2CPUA 3GB7A 2WHVA 3UTOA 3GZKA 3ES6A 4LLWA 2HKHL 3SQOL 1YPZA 3HC4L 2A77L 3SZ6A 5C08B 3WUZA 3MDJA 4P3CL 4WI0B 3HG1A 1KLFB 2Z7WA 3SDYH 4BA8A 1MHEA 4UNIA 3HFFA 5IF0B 1BQHA 3MOAL 1CLCA 4QRUB 2WLMA 4O58H 3CFKB 3HUJF 3J2PA 3HMXL 1YEHL 4HHAB 1JDAA 4BELD 2P80A 3V95A 4F37F 5J56B 3PREA 2VN3A 3MLRH 3IDIA 1OCOB 4P9ML 1PW3A 3CFNA 1S9VA 4CAGA 4AV5A 5TK2A 1YLBB 3PGFH 1G7HA 3MRMA 2V5MA 3P4LA 2GSIA 3SDAB 1YQVH 1N5AA 3OKNB 3SJVA 2C7UB 4ZTOH 5GJTH 3STLA 1A2YB 3NVQA 1Q9LA 3KPSA 5C0DA 4JM2B 4F91B 2C26A 4GFXA 5DU7A 4N5UA 3ZLQC 3I9IA 4XNQB 4GAGH 1UXWA 2NY6B 4OZ4B 2PTUA 4NNYB 2N4IA 1GGUA 4MA3B 4IOSD 1A9BA 5IEHB 4ZMOA 4PJXF 5HI3D 3T6XA 5HSFA 3V5KB 5BCAA 2Y2YA 4KDVA 3PQYE 2E4FA 3QUKA 2WWKO 4JKKA 3MV8D 2H6PA 3KR3L 1BYPA 2XHNA 2GITB 4NNXA 2X4NA 4HKBA 3RL1A 4KGJA 3RWFA 2W1NA 3B43A 2BOBA 3ZTNL 1GPOH 1ZXKA 4IW4C 5I1CL 2EIDA 3Q6GH 1QLFB 5GRJH 2X4TA 1QBMH 1XZWA 3CV5A 3HRZA 3SYCA 3WUWB 4Z3TA 4N8VG 5C2BH 2RAMA 1ONQA 3Q5YA 1FNEB 3N85H 4KFZC 3CVHB 1CURA 5FKAB 3GHBL 4G9FE 1MAML 4LPXA 1M9SA 4OB5H 4PLKD 3BVNB 1VCAA 2K0RA 3BZFA 5I73C 5GRZA 2X10A 3ZVVA 3PRZA 2EVJA 3QUKB 1JHLH 4KY1H 4BK8A 4BFBD 2OL3B 4ICXA 1ANUA 3ZDWA 4L4TE 4A7GF 4D7BA 3VGAB 1XGTA 2YUVA 5SX4H 2JB5H 2Q1EA 4G7QB 4PBWD 1JI2A 1KJMA 2VZ1A 3UFIA 3BLBA 1INDH 1JTPA 2QHRH 2R4RH 1F0LA 2VM4A 3UO1H 3R8QA 4S1RH 4YXKL 3V4UH 1ZTXH 4H1LB 5IQOA 4IBZA 4WTZA 4CKQA 4WEUD 4GKNA 5IM7A 3BRGC 2AJXH 4CJ1A 1UATA 3C6LA 1AZCA 4BK4A 4U1IA 4AUUA 2QQNH 2BNRA 5D4JA 3KBHE 3WMQA 3TZVB 5DD0L 5I71C 3V9EA 1PQZA 2VL4A 3FTGA 2P9RA 3N44F 3RJQB 4MNQD 1T2JA 4D94A 1MEXL 1CBVL 1RAMA 1Z1WA 3KJ6H 2QV4A 5E8EB 2WGNB 1K72A 1BIIA 5IBLC 1GHFH 5JQIB 1M6OB 2A77H 3P9MB 3QI9B 1JK9A 3TA3B 3GSNB 2OV0A 4AYDC 4E41E 5ID0B 2IO5A 3QUMA 1I75A 1A14H 1WFJA 2YAFA 4BHUI 2BIMA 3P40A 1JZ8A 4F7PB 1QFUL 3RWIA 1FVDB 2HG0A 4QXUH 1NTDA 1YN7A 2C34A 3X14B 4PWEA 3EO9H 3VG0H 3K2UH 4OZFH 4LK4A 4BFIB 1MZYA 3QXDB 4OZGF 2Z9TA 3DSFH 1Z9LA 4DO4A 2QQKH 3LKPB 3MJ9A 4TSBL 2YHGA 1A6VH 2BIHA 5KVDH 1TO4A 1XH3A 4LVOC 1SHWA 5C0BA 5D7KE 2EXSA 4X7FC 3AQXA 2P7TB 1HVXA 2DPKA 2KH2B 4PQXA 1QRNA 2Q9OA 2CCVA 5GJSL 3GM8A 3L2LA 3CHXA 1BVKB 4YDMA 5E5MA 2EZ0C 1IVTA 4I89A 4J4PD 5IVOA 1KGCD 5HGDA 4PJ5E 1ADQL 3D2TA 1FAIH 3B9KB 1QNZH 3ULVC 1KGJA 4GRLB 2JJTC 5K5YA 4AM0Q 1IILE 1K4CB 1ZHKA 3PAZA 4PVBA 1YMMA 1LE9A 1LDPL 1U8KB 2NNCA 3B3IB 1GGBH 3MJ6A 4JRLA 4P3CH 3OJVC 4OSUH 4L0YA 4DK3A 2AEPL 1EZVX 2QPSA 2ARJB 1XTMA 1KN4H 1S2EA 4TNVK 4YDKL 3S88H 2ATPA 1M7UA 3FO2B 4Z7NB 4JO8A 4HLJA 4LIQH 2NXZC 2RD0A 4I0PB 1I3RA 1NDMA 5KVFE 4TTDD 2DIAA 2NY2C 4LCWB 4LCYA 3QRGL 1V7NL 4ZPVA 2CIIA 1U42A 1FE8H 1D5BB 4MD0A 1ETJA 1V8HA 4IIZA 4MJ6A 1QBML 2Y7MA 3HC2A 4R7NB 3FCTB 2HLEB 1E2WA 4RMRA 3JVFC 4NZTH 3QCUH 5EU4A 1IQWH 2A9BA 4Y4HC 5GHWH 4X6FB 4MAYC 5EB9A 1T04B 1PTZA 1BVKA 4WO4C 5C7XH 5JZ7D 2CK0L 3P73A 3VFWA 3P4NA 5EC1B 2CCLA 1ZAGA 4P99A 4UQ9A 4FXKB 1NC2D 4POZD 1VACB 2EIBA 4A37A 4LFHD 3RWDB 1UYWH 2R7EA 4K9EL 1MQKL 1BQLH 4PG9B 4HU2A 4GW4A 4F3FA 1OAJA 3EFFB 1ZIAA 1O9VA 1QFWH 2DLIA 2LU3A 3POHA 2DQCL 3ZTDC 1E40A 5E1AB 1V55B 2IPKA 1CPUA 2P52A 1O7DC 3AG1B 1YG9A 3CXHK 4HLEA 1UUSA 4HFWA 4H8HA 3I6GB 4GP8B 4A63A 2HPTA 2R27A 4FG6C 5JOPE 1UG9A 1HKLL 3RUGB 5D4IA 5IWLC 4Y4HD 5HJGA 4E9WA 2H7WA 4K07A 1RURL 1K2DB 1NDGA 3P9LA 3RIKA 3EYQD 2NNXA 5C2BL 3U2SB 5HY9A 1B0GA 3L4UA 4Q9BA 2O5YL 5BMFH 3HG3A 4ZUSB 3RWCB 4EZLA 2DYRB 5JIHA 1Z5LA 3CC5B 4LHJB 1CXLA 4MFHA 3GGWB 5L7XH 2QTEA 3IJYA 3LNEA 3WAKA 3GZOA 4KX9A 3CPLA 4TSCH 1RZJH 1R3LA 3AT0A 4N90E 1EJ8A 2LTQC 4W4OA 1ACZA 4F8QA 3N50A 3T0EA 3UTSE 1Q9WA 3SEPA 4FX5A 4ZXBA 3MXVL 5FGCE 5FO8B 1BP3B 2JKSA 4P46C 2FD6L 4ZG1A 5TQ2L 1INEL 4XAKE 3JV6A 3QHFL 5DJCB 2NW2A 3MX0B 1CFTA 2X44D 5LN8A 3A24A 4P8QA 4UZUA 3WLBA 3TS8A 3OKMB 4FQXA 4PRBB 3NN8A 1NCBL 1KXTA 4OF8A 3T1FB 3EGDB 3QPKA 1DVTA 3GLAA 2EYTA 1HE8A 5LBSA 4QRQA 2XZCL 1T20A 1MCWM 2VDML 3U2SA 4ELDA 4KK9C 4HKZB 3T8XB 3MBWB 5F7LB 3ROLA 2X4PA 4OD1L 5F7MC 3ZK0A 4JFFD 1BLIA 1IBGL 3R4DA 4LBEA 4AEHH 3CX5J 3F12B 5EORH 3RVUC 1OCZB 1T04A 4HIPA 3LKSA 4WJ5A 2KBGA 2V2TB 2ICWI 2WCGA 5ERWB 4GAAA 4JGJA 5ABZA 2ITDB 2DYPA 3HZMA 5EUOE 4FKKA 4CC4C 1U8PB 4BWUA 4ZPTA 1OD7A 5ICYB 1A7RL 2VO5A 3SBWA 2H6OA 2CDEB 5GS2H 4GXFA 4LIQL 5T1JA 5E8DH 3FU7B 3O9WA 4IHOB 4Z76B 3I9AA 2ED7A 1E5YA 2D3NA 1P6AB 1JZEA 2DRUA 4NYLA 3MREA 2NNAB 2PCPB 1BCIA 2HAZA 3SB3A 4ZOEA 1KYUA 2BVPB 2WBKA 4NUPA 4KROB 1LO0H 3F01A 3QIUA 1I8AA 2QLVB 1G7LA 5IG7B 4GAYB 4IBUA 4XNYL 4DP9X 5I71B 1HKFA 5DJ2B 2BCKB 2BXZA 4HUXA 4TSAL 2JJVA 3MV9E 1O6TA 3L9RA 2XN0A 4PWJA 4JPKL 3WIIL 1AD0B 1SXNA 3ATEA 2FE0A 3MV7B 4TQIA 4XHQA 3B8YA 3P77A 1NKRA 3ZO9A 3S96B 3HC0B 4C55A 2Y5TB 3C2SA 3NABL 5TTRA 3BQUA 4H26A 2XDHA 5KSBF 2XSKA 2W9EL 3CXDL 3OXRA 4PV9B 1G7MA 2Q8AL 5C0EB 4LEBA 2YSTA 1KCWA 3SGKC 5GRXG 4LPWA 1IL1A 4POUB 4UILL 1DO6A 1FZKA 1XZ0B 3FQNA 4XBEH 1GGCL 3FNKA 4FNTA 4YGAB 1GTFA 2CLZA 2EDQA 2IGFL 4UAOC 3QRLA 1EAQA 1T0NB 2YK1H 4HXBH 2OSLA 4TQEH 4W1TA 2BHFA 3EDKA 4L29B 3X13B 4HIQA 5I8KL 1O0VA 5DK0B 3LPOA 2XY2A 5EBLA 5EN2B 2D7TL 2FUQA 1IFHH 4XPFL 5E5MB 1QVOB 4BRJA 2ZUWA 2UZXA 4XBPA 2WBJD 3KGSA 1E4XH 4PS8A 4FQLL 1X9RA 2VDPL 4OUOA 1SQ2N 4PJIE 2ZCLH 3AT8A 3Q9PA 1KPUB 2UVFA 1JPSH 2O72A 4FAAB 1SLVA 2PTTA 3K8KA 1YEDA 4ZW8A 5DD3L 5LGJB 3U79A 4BSVB 4FL4B 1Q1PA 2B59B 3EJYD 1EEYA 5I0VA 2Q10A 1X7QB 1BAFH 1FNFA 4LOUC 1YC8A 3GTNA 5AOKA 3KHQA 5KN5B 5LVEA 1KY7A 4AUJA 1MVFA 4PY8J 3HBQA 5E4EC 2EIZB 2CUIA 3AM8A 2R9HD 4OGQC 3PFQA 3VMNA 4XODA 5IVXA 4HCGA 4K3GA 5BO1H 1UJTA 4AGLA 1OL0A 3HPJA 4OD1H 2JV6A 5EG6C 2UWEB 1QQDA 1BAGA 3MTXA 2VLKE 2J8UA 3BGFC 5GGTL 1T80A 1MRCL 3LHPH 3CFCL 3C9NB 2BDNH 2XETA 1BM7A 1JV2B 3WL9A 3U0TA 4LSUL 5JIQA 3C08L 3KLDA 3GSOA 4RQQB 3RLSA 3ZE0F 4DPRA 2P5EE 3D0VB 1VRSA 2ITDA 3PAVA 5EO0A 5FR3A 3O2DL 4J12A 4JRXA 4QHUA 3JWOL 4HVBA 1SJXA 2OMXA 2BFVL 1LP9B 2PYEB 4KQ3L 3KW8A 1KIUB 4DH2A 3IDJB 2PP9A 4PJAB 2PLTA 1EWHA 2BNQA 1X5JA 3ARRA 3IB4A 4NAMA 3VXUE 2ZCHH 3E2HC 3V9CA 5ICZA 4XAWH 2IADB 1CLYH 4GRWB 5E1HB 1SDYA 3DXAE 1FCGA 1ZV9A 4IU3B 2OA9A 4WWKD 3V4PL 4RFOL 4GIAA 2WQVA 3QVAA 5MEQB 3ECBA 4MNGE 1ZT7B 5CGTA 1JNHB 3OZKA 4FLQA 4KRLB 4BFEA 3JTSA 1HQ4A 1OAUH 5E6RB 3RP1A 4ZFZB 3BUQA 4KTGA 4X50A 1WIUA 3HE7C 4AKOA 5CZXC 4EI5D 4DEWA 1RMFH 2DMCA 2N0MA 5IW6A 1P6WA 3GHEH 1M1XA 3LNHA 3WO4B 4AY0A 1S7QB 4V1DA 1NAMH 3ALPA 1OD9A 4RH4A 4UIKH 2B4CH 1WAPA 3RA7L 4YHIA 2ZQKA 3ZTCC 2XXFA 2OW6A 3EOTH 3UTTE 2VE6A 2JNZA 3BXNB 2IDFA 2R0LL 3GK8L 4ADIA 3SY6A 3C87A 2HVKA 2J57A 2V4LA 4PVLA 3RGHA 4X9FA 2O5XH 4F2EA 1AHWA 1H8OA 2NSMA 3X12B 1B4RA 3SJVB 3FOLB 2EDNA 3LKRB 4YSAA 4P4RB 1S9XA 4YO0B 3C75A 1JHTB 5C0DB 4O2CB 1ZVHA 1IZJA 1MLCB 2EILB 2IOIA 2XN9B 4Y2LA 5BRZB 5C7XL 2OR7A 5E23A 1TZHA 1SEQL 1NOLA 1OARH 2OR8A 4J3VA 2F8VA 2CO6A 4UDTB 4AQEA 4ODXB 2EIJB 4KZEL 2X0UA 4RZCB 2YQBA 5C0CD 2CMRH 2FJFB 5IQMA 1FNSH 3WJJA 1MCQA 4A68A 4APQB 4JLRA 3CZFA 4FF9A 4PEEA 3K5SA 5I5RA 2EVFA 2MQ0A 4X4ME 4YHKH 1TTCA 3ESUF 1QHOA 5DJAA 2JIXB 3FU9A 3IEAA 5D7IF 1S5HB 2NLJA 2XPZA 4KKNA 4H0IA 2X89A 4HF5H 1IM9D 1T7XA 2DBJA 1OSPL 2NNRA 2ZF9A 3MOQA 4OU3A 5D1XA 3IAGC 3CFEB 3SE4C 2EUVA 5LBVA 3EH3B 5IUCA 5HI5C 1SXZA 4R7XA 4JFYA 2IALB 1HIMH 2C9XA 3P4NB 1YPZB 3GLEA 5E1GA 5EC1A 2JCCB 3H7BB 5HHXL 3NSFA 2RALA 3OKKB 2PYEA 4JK0D 1BD2B 1VPOH 2GHWB 4JHBA 4LHUB 1QYGL 3PP4L 3A6BL 1E30A 4DZBB 2OTPA 1J05A 1JOIA 1TT6A 2ZUQC 3VSUA 4HX1B 3NTCL 5AWNH 5DWUH 1KSRA 1D6VH 1XGZA 1LEIB 1Y18B 1LDPH 4JFVA 2Y1ZA 3S37L 1JDCA 4DQOL 3AG2B 2ITEA 3CLWA 4RZKA 4Z7UE 5L8KB 1Y1DA 4EIZC 1LD9B 1AZZC 2CUAA 2IMMA 5EUOB 4UMGA 4N0UA 1I3GH 1A6VL 5KVDL 3F7PC 4PFEA 3LB6D 3VXMD 2JSFA 1A9VA 4OCYL 4WHTB 1AR1B 1XD1A 3QK0A 2DQFB 1XR9A 4IKJA 2OMTA 5IIEB 4LHUG 1CIDA 1P4IL 3ZDYF 4E9RA 2P5WE 4Z7OF 3DX0A 3LTVA 3O4LE 3S9DB 4Z7QE 4GQ9L 1T2QH 4JFDE 2X0VA 3VUAA 1A1MB 4CVXA 4Z7UB 1LP9F 4AKPA 3DO4A 5D71H 3SSGA 2OSYA 4LEEA 3UZVB 5ACZA 3UIZA 4WHYH 3FMGH 4AMKL 3VO0A 2FB4L 5C0AA 4M8QB 2SEBA 1MFNA 3JWNC 3RKPA 3UZQB 3RIAK 5I66A 1BQ5A 5I5IA 3PNWA 3CMOL 5ICXB 2YWZA 3BKJL 4OZFA 4MS6A 1J1PL 4KRPC 2OYPA 2C9QA 1QBBA 3UEQA 1YO4A 2Y72A 1M05B 4MNQE 1RHFA 4YXHH 4X7SH 2HKFL 2VH5L 3X3FH 4AIEA 4LEOA 4DSYA 2X40A 2AEQL 5F0JB 2WSKA 3D07A 1NGPH 5C0BB 3RTQA 2AK4E 5LXGL 4MDJA 4RCAA 2LLNA 3I6KB 3RWJB 3HNVL 3WKMH 3OB8A 1KCVH 3H9ZA 2DIEA 4ONGH 3VGBA 4U6HB 1MIEL 3QDHA 3GUFA 1AJ7L 2JTDA 1MUJA 3QZNA 2A9NL 4WW1A 1RJZB 4MX7B 3WHXB 1TJXA 2ICWJ 1Z7JA 1DUZB 4JO2L 4BSVA 5A16A 2FQEA 3PDGA 4ZX6A 4JFZL 4PJ7A 1CICD 4ILDA 1JUFB 4BIKA 4B95C 1IGMH 2E75C 1A1OB 1ZT1A 3QUXC 1KIPB 1TLMA 3HG1D 5BS0D 2KL6A 3H9HA 1SPDA 2FIKA 3A4EA 3AAZA 4MZ2A 1H3GA 3ZU8A 1YYLH 4NQUA 4A2LA 3MBXH 4GQQA 5TQ2H 1SM3L 4HC1L 4AYMC 2R15A 1VZHA 4XNXH 5KBMA 3FT3A 3RAJH 5EFIB 4Y19A 4B9FA 4QPEA 4L1SA 3BMWA 4KMTL 3BPNB 1QBLH 4FYSA 5DHMC 5BZWA 3UTPE 2VXTH 1QFOA 2A74C 1JV2A 3GLDA 3BUBA 4EDWL 3MNMA 1AGEB 1WS7A 3DMMC 5E8OA 3WEXA 2R83A 1PLBA 4H8PA 2MQCA 2Z1KA 4N68A 2WLNA 2K7QA 4D2NA 1V3KA 2PTVA 1CXHA 4LGRB 2IH1B 3SGDI 4HAFA 2Z4QB 5GS0H 2IPUK 1JGDA 5AOLA 3PJSB 2YZ8A 5GSVB 2ZG3A 4W9IC 4LVHC 1X3DA 2ODHA 1V7MH 3FDWA 4ODSH 1EANA 1D6VL 4WW2C 4QHMB 5DDHA 3IDMB 3B7YA 3V7AE 4AOFA 1R0AL 2G3MA 3ESNA 3B2DC 1EEZB 3VWKB 1J86A 1HOCA 3DK0A 2VLJA 3RVVD 4NQEE 2K6ZA 5A6IA 2UXGA 4L37A 4B9CA 1KV7A 1UA3A 3HG2A 1YEKH 1AP2A 4KJYA 4N4YB 1RK0A 2FO4A 2OSWA 3RHWK 1CF8L 4G8GE 5CSZB 4U1NB 4XCCL 1TVHA 5E9DA 5E70A 1LEGA 2Y69B 4I85A 2ZUUA 2JB6A 2XBDA 3UH8A 1N8ZB 2CH8A 1ECYA 3X1GA 1UENA 1BFOB 3ILPB 3LJ3A 2E8YA 2ZT9C 4YSDA 4GLRI 3L54A 3ULUD 2W0LA 1UA6H 5GGQH 2UZPA 2X4UA 1I1FA 4I2XE 3VCLA 5DC9B 5I2IB 2ZYSA 2VISB 3IE9A 3DX9B 4W93A 5KSBB 3BP6A 1HHJA 1IC4H 2CBPA 1MH5A 2EECA 5HHOA 3U36A 3QIWA 2VXUH 3T4AC 4MCYA 1RJZA 4MX7A 1DDHA 4UQ2B 2D4FA 3AUWB 3AXHA 1RULH 3QI9C 4JKMA 1EEUA 3JWDC 2WVUA 2QTVA 1ZGLA 3MRCA 2N01B 4HH8A 4L5FE 1A6AB 5F7AA 4PMFA 3NZUA 4MJIE 2ENYA 2IXQB 1DO5A 3H3BC 2VITA 3IBOA 3IKKA 1CFTB 2W80C 4GMTH 3JV6B 1C16A 3L48A 2R2EA 3L1EA 3MXWL 2BWQA 3NIDB 1SVCP 4TNFA 1M05A 3WMPA 5IGXL 1E5CA 5GRUL 3TA4D 4H2AA 1UXWB 2EKJA 5CP7B 1W72A 3QZPA 1IBBA 3O2WH 4P5SA 3MFFB 1ZHLB 3GNML 2X4RA 3CZSA 4G80B 3DVNA 3EGSA 5CHNA 3FUFA 2CQVA 5H94A 3CSYA 3TL5A 1LO2H 3GYRA 1T5XB 1MAKA 1R33A 2YXWA 2Y06H 4MWFB 5PCYA 4E41D 2PR4H 4H0HB 2CIKA 4UQ3A 2K9FB 1CT8A 3ARWA 2RTTA 1MAJA 2RFXA 4XI5D 5CJBA 5I0DA 4U05A 4U3HA 2F5AL 3US0A 1KOAA 4YSTA 4PM1A 4PJ7B 1OW0C 1W80A 2DM4A 2LW3A 3N6YA 3M46A 4XPTL 4X8CA 5B7EA 3HBGA 2HFFA 5F7DB 5ISZA 1EIBA 4BK5A 2AAAA 2IDCA 3MFFA 3IF1B 4XPBH 2RB8A 4OZGE 5FUZH 3D39A 3PF2A 5F7NC 3THML 3TURA 5BOJA 5TH2B 3WEAA 4BXSV 4AXWB 5CBAA 3QEGH 1LEIA 4ECNA 1KULA 3EOAA 1JL8A 2X6MA 5FUOL 5T3XL 3VXMB 3HG4A 3MOBL 2ZYHA 1PX3A 1U8NB 5IR1B 3BZ5A 3E8VA 1PJWA 3TF4A 3GXUB 4FXKA 1G84A 3LRHA 4MJID 4A2GA 2X28A 4OFIA 3D5OF 3IBEA 1C7TA 5GGSY 3JUZA 5EZIH 2Y06L 1S46A 4KDTA 5TFSH 3VFGH 2XKUA 2ZAIA 3IU4L 4CNIB 3NZHH 1YEDB 1BBDH 4PB9H 4EI6A 4HIIB 2EC8A 4KWUA 3GRWL 1ZWIB 2PYFB 3ARBC 4ZPVB 2Z64C 3C09B 4N20A 4WFFD 4F8PA 4MXVE 1U8HA 1TFPA 5CD3B 3ZT7A 4F7EB 5TDNB 2FZ3B 1BFTA 2ARJA 3LRKA 2Y07L 3HE7A 2E6PA 3C8DA 2XZQH 4F1ZA 1J8SA 1KCLA 3PWPB 2EE3A 4P5MA 4TVPH 1TVHB 4H2CA 4AJWA 3U1QA 4R2GB 4APQD 1KTCA 3BSHA 4ZS7L 3BC9A 3X13A 2J44A 3L3GB 4KXCA 1JHTA 4HV8B 4FEMA 2QGBA 3CPLB 4WWID 4RAVB 3VVVA 3V0DA 1BZ7B 4MD5B 5LB1A 1R47A 3OHXA 4ANXA 1BMWA 5AW0B 2BS9A 3WKPA 1XH3B 2VKXA 4PGCB 3ULVE 4XP1L 1DQQA 4FDWA 5KSBA 4MXWL 3NJJA 2HJLA 1TVBB 5HDLA 3KG5A 1T1YA 3POCA 3IMSA 2O6CA 3V5HB 2DQDL 1ZCRA 1UJ3B 1JGEA 1T0OA 4MJIB 4XVUD 3EH4B 3L5XH 3HE6D 4L3EA 2X2UA 2OMBA 1D5XB 2OYKA 2VQ1A 3MLXH 3E38A 5I8CA 2JIXA 4PGZA 1HKLH 2R0WL 1AHKA 2OJEA 3Q05A 1DJXA 3MN8A 15C8H 2OYLA 2LOEA 4X99B 3TO4A 2JJUA 3RVUD 1F56A 4PH8A 4KX8A 3CK0L 2BVEA 3NZSA 2YUWA 4QT5A 1ZT7A 2AFNA 1KXQE 2ZAGA 4YHZL 5HYJE 5MEPA 3DV6B 5L9DH 1SHSA 1N0XH 1N68A 1ZPLA 5LGKA 1A65A 4DW2L 2JE8A 3MJ9H 4N2KA 3WGUB 2JCCE 2A0LD 2OTUB 3D52A 4Y1AE 4B9JA 1JN6B 2KLRA 3WKYA 2D7QA 5AUMA 3MRBA 5J12B 3HRZC 2XZCH 1A3ZA 1IC1A 2X2HA 3O3EB 5DK2B 2XN9E 2X41A 5GXBB 3L9BA 1JWUB 4CBPA 1A0QH 5E5UB 3HAEG 1X9QA 2YPKA 1WWAX 4NQXA 5ICYA 3OJDA 5F1SA 1P5UA 4RQQA 3APNA 2EUZA 4DHLA 5C0NC 3Q2WA 1XGYH 3HPLA 4ZYKA 1G6RH 3WHE0 4OJEH 4YVUA 4UMSA 4M29A 5ACLA 4IBWA 2ZXAA 3LQAH 4PRAB 5J12C 1WA0X 2Y22A 2GK2A 3ARXA 3TYGL 1WCQA 5FYKH 3ARFD 3PPSA 1HOEA 4IIQA 4N2HA 5EF3A 1VESA 1MFCH 1ID2A 3KPOA 4X8JB 3VQ1C 5AZUA 2GSGB 2FZ3A 1AY1L 4PRHA 2KMWA 3FRPG 3UTZB 2PXYC 3D69B 5BVPL 3PWNB 3TX4A 3SY0A 3KLHD 5L7XL 4YH6A 3EFDL 4ACPA 3BPCB 1BLNA 3QYCA 3PNWB 3V6OC 3F04A 4FXGC 1ZVYA 2KZWA 4O02H 3C5ZB 4FFVD 5F89A 3U46A 1CE1L 2DYPD 1CDJA 5IMMB 3VNZA 1YAIA 4YL9A 3L3HB 5T3XD 4PJCB 5HYQA 4TUJB 5C9JB 4HOXA 4LCIL 1J9TA 1NUGA 4XNQA 3LIZH 1AD9B 2ZNXA 1UWYA 2V6HA 2ADIA 4NNPL 2WXPA 2HFTA 1NANH 1QRNE 2QMKA 4NYLB 1EZVY 3VG9B 3CHPA 4MZIA 1E27A 3H7LA 5BQDA 4JS7A 4C83B 1XCTA 4RGOL 4ZFFA 4P46A 1E4JA 2QZQA 4WW2B 3BHBB 4AVJA 4M7KL 3SDDA 5IFHL 3T0AA 5GGUA 5GPRA 3X12A 2ZYRA 3S7GA 3HAEA 4NNXB 3VH8B 3K80A 3G3LA 1CK0H 4TYUA 4LLYA 4LRNH 4P23B 4XMPH 5FM8A 2OMYA 1S78C 1ZA6A 5HGAA 2CM6A 1RIUL 4HKXA 1JWSA 2H2SC 5TD4A 1NEZA 3CVDA 1DSYA 2XTJD 3GJFH 3VFGL 1FYTA 5DHVA 3Q44A 2MOVA 3GRBA 4OLUL 3W82A 4QRBA 3ABKB 1U8QB 3LHAA 4XN9A 4FZ8H 5D2LB 2Z1PA 4DGVH 1RUKH 1S9VB 2NY3D 3M1CA 1FG2B 2BFGA 2YMXH 4LP5A 3T6WA 3VWJB 4NKIL 4CW1B 4JFSA 1YPZF 2ZXQA 4HIHB 2FECL 4MMXA 2RFXB 4QRUA 4JO1L 3RWGB 3Q6FA 2JK5B 5DEJA 3B2MA 1EJOL 4BK5C 1X5HA 3F83A 2NXZD 3HAEB 4PJ5B 3MBEB 4HMDA 1RZKL 1YJDH 2ENPA 4S1RL 4X4XA 3V4UL 3ARDC 1AGCA 2ZWYA 1ZS8B 3FTWA 4U3CA 3QB7C 1PZUB 4JM2C 2FO8A 3OM3B 4XMKH 4KI5E 5DR5H 4XE0A 1UTDA 4CC4A 4ZS7H 5CBEB 2LAAA 2K70A 1LHZA 1TNMA 4NT6A 4Z7VE 1FG2A 1OB0A 2Y0SA 4JM4L 4FXTA 2AZAA 4IEFB 3UP6A 3I50H 1A7OL 3U6RB 1QVOA 5T5NG 5DVNA 1BW8A 1JNLH 1M6UA 2AJZB 3EDFA 4YE4H 4N2LA 2X3BA 4DOHE 1JFQL 2VZUA 3U0PA 1CDBA 5D2NB 1OT2A 4E0RA 3SKUD 4PS4H 5IW6B 4QRPB 3HG1B 2NXYC 3T2NL 2XI9A 5JHDD 4TUUA 1HEZB 5GRVK 3L5XL 2YN3A 4RISH 4B5ZA 5LBSH 4IBYA 3WENA 5KSVA 4CDGC 4WCYL 2H1LM 1AGBB 1Z5HA 4JANA 4KROD 1JYXA 4W9ZA 5D9SB 3SO3C 4ZMZA 2IAMA 4UBDD 1NGYB 3FPXA 5EO1B 5DLML 1DHKA 5D1ZD 2XJKA 4ALAC 4JE4B 5IEKB 2OZ4L 5D1ZI 1K8DB 2APXA 3ETTA 3RG1C 4R6UA 2WXFA 3FUIA 2IPUG 4F7CB 5ANMB 5FKPA 1HAUA 2EC9T 2PYFA 2W60B 3FK3A 3WY3A 4OCRL 2AQ2A 3FB6A 2Q6WB 2EXWD 4AVHA 3VD3A 5HYIA 1WF5A 1N4XL 2BVTA 1KIQB 4FQIH 3A67H 4OZHE 4W4NA 1V7NH 4FLOA 4KDTC 4P49A 4PJXE 1RJYA 4XTRD 1A2YA 4Y1TA 2VWEE 2X38A 5KVFL 1NANI 2DMHA 4RESB 4Y5XC 2FCBA 4IBTA 3OHXC 1M71B 4JFFB 1R34A 4PTUB 3TIEB 4J3WA 3UABA 2HT3D 1QACA 3RFZC 3WS6A 5C3IA 2GIYA 5KSUA 4HIXL 4PI2A 5CMAB 5I1EL 2AXWA 3ZR6A 1QI3A 1AC6A 5C07A 4DGYL 4K0OA 4YL4A 5D1XD 4XPAL 5F96H 2ADJA 4WWPA 4BWWA 4W4OC 5GS1B 1PSKL 4JRXD 3JWNG 4KZEH 2GTQA 7PAZA 2MCPL 5ITFA 1ZHBA 2Z7YA 2ZKMX 1NC4D 1UD3A 3M1BB 1TOXA 1A3LH 3MRPA 3QUMB 2BXYA 3MUHL 4JR9L 4M7JH 4RETB 4YSSA 5HI4D 2N56A 4K71C 1U8PA 4YSUA 2F19H 4R4NC 4JO4L 1ORSB 4U4BA 3D18B 2EDKA 2HN7A 4WFEE 3GSUA 1CK0L 4XMPL 1F86A 2KZ1B 3HB3D 1WWBX 1NEZG 3T4YB 2F58L 3G5ZA 2ZP0T 1ETZB 5FW7A 3QUYA 1T0MB 4CMHC 3NUKA 4PLKC 2CXKA 5D7IE 4B60A 2KLTA 2YAPA 5EDXA 1A1OA 3UG5A 4RFOH 5BV7H 1BMGA 4AE1A 1J5DA 3H56A 4WW2F 5IOKA 5C0GA 5E6SB 3UJIL 3T2PA 4OZIF 1JCVA 4TS6A 1CLOH 3HTLX 1ZE3H 4LSPL 4Y9CA 1PDKB 1OTUC 1W72L 1L6PA 5DHDA 4XXWA 2OCCB 4NQCD 3OAYH 4JRYD 2QVMA 1X5IA 1CCZA 1ORSA 2NY4C 4UV7H 5DRNB 2YEZB 1WFNA 4FZEL 4WHCA 2NCMA 2P45B 2ZCZA 4PJ9A 4PN6A 1NIEA 1JD7A 2DQJH 2X2YA 5EPMB 2QR0A 4QKTA 4DKDC 5IP4A 4M9OA 1JPGB 4PREB 5BZZA 3WNJA 2EP6A 2JIXD 1CS6A 4Z7UF 3QCTL 3AGWA 3VRIB 4BQ8A 1PLAA 2VDOH 1HAWA 5CJOL 1MWAH 2KUTA 1ZTXL 1TXKA 1OSZA 2O5YH 3MHZA 4GKOA 5D7LD 4BZ1A 5A2JH 5E8DL 4W9EC 1VGKA 3DECA 4MXQC 5K1JA 5A7EA 2P1YA 1PX8A 5HP5A 2H1PH 1HCZA 3EBGA 4U1JA 2RHEA 4Q4EA 5GSRB 5C0CB 5JOFB 2A74B 2E7HA 4M8RA 4BUQA 2EYRB 3MRDA 4WGWB 4E5XA 4PRNB 3DIFA 5TDOB 4JPVH 3CBKB 1KIQA 4UTBL 3QQ9D 4GO6B 5EU3A 1YZZA 2WPGA 1YNTF 1NC2B 1OGAE 2BS71 1TLKA 3O3AB 4P2OD 4N0YH 3KLQA 1FV1A 4K7PH 4FOMA 4FXKC 4K3EL 3I02B 3F65A 2TRYA 2A6DA 4MDIA 3BAWA 3WLWC 5TDNA 5DUJA 2VLRB 3CX5K 3LN9A 3P0YL 4HW6A 3SDDD 3F2LA 2VMDA 3ZKMC 5L2KB 2KDYA 5JDSB 1BX2A 5IT2H 3BE1L 4MXQD 1VKXB 3OZ9H 1SBBA 4Q56A 5D72L 2MTPA 1NGPL 4GKNB 3U25A 1F8TH 1LE5B 3NA9L 5BS0E 1P53A 4DP2X 1MJ7L 1TEGA 2KQMA 3OKNA 4I1RA 5D6CB 2AK1H 1XCWA 3NEEA 4PVMA 4WWKC 4WFHE 3F6IA 2J4WH 3SKJH 4BGDA 4GG6B 1VEMA 4UOW0 3U1PA 1A3RL 4CDHA 3DVGA 1A64A 3D09A 1AXIB 1F6LL 1WUZA 2H26A 3KBEA 5E6IB 3MROA 3B7RL 3UG4A 3ZBMA 4HSCX 2D4DA 2FEDD 4AK2A 2HB0A 1IGCL 2X4OB 1PPIA 3MBEC 2DTSA 3B2UD 2XKNB 2W95A 3KL3A 3HG5A 4HGWA 4JFYB 3HB3B 3NIFE 2Z31C 3AVEA 1JNJA 2EICA 3ULVL 4H8QA 2FHCA 1NGWB 4P59H 3ZHFA 3UC0H 1WZ1H 2DICA 1IJ9A 1NC4B 2D3LA 4KO6A 1ZLWK 2BW5A 1OB1A 2E7CA 3MZTA 2AEPH 5KAQF 3WTTA 4KVCH 2HZHA 2WO2B 3O6ML 2Z3FA 3D2UB 2I9TA 3DA0A 5FV2A 3RTQD 3CFQA 1AHMA 2PYED 3V6BR 3DUUA 3QZWA 1KPVA 1Y0LA 4ZAKD 1L0QA 3Q6FB 4YBHA 1DVFC 4NQDA 3WELA 3H55A 3ENEA 3L4CA 2B7DT 2XV3A 1CR9L 1QG3A 2CA3A 5DA0B 4ONGL 4JLRB 3D48R 3S3SA 3VXRE 1CT8B 1ZT1B 5DZLA 4OF0A 3D1MC 5B1JA 4GLRH 3U4BL 5DQJB 3T1WA 4NJAL 5ID1A 1IEBB 5BQ7B 2FWOA 5E08L 2J6EA 2CGRH 4YXLL 2FX9L 3BKMH 2VR7A 3C2AH 4O2FB 4WGVB 5GZNA 3KYOB 5HGHA 1WV7T 2FYVA 4GKSB 4UQBA 5GSRA 5C0CA 3H0TB 3OMNB 6PAZA 2HWZL 1C9SA 1X9LA 1E4HA 1CQKA 1MCSA 4NLHA 1B3JA 3Q2NA 1HNGA 3BIKB 4S11A 1ILUA 2NTFA 4Z7NE 1G9MH 2X4UB 1P1ZA 1MZZA 1NC4A 2DQ6A 1VGEH 1PZSA 3MA7B 1BD2E 5FYJH 4DEUA 5ACMA 4F7KA 3HUJE 1M1XB 2FJHA 3FO0H 4QF1B 5C0IB 1J5OL 2B14A 3US9A 3BZEB 5HDWA 1W9XA 1CLZL 1J1OH 5KOVC 4X5WB 3L4TA 2AJUL 2EDYA 3LXCA 4NO0D 3HS0C 4OM0H 4WUKH 3GF8A 4NQDB 1BLNB 4TNVF 1SXBA 7PCYA 1NWOA 3AG4B 4UBDC 5GS1C 4FABL 4LEXH 1NIDA 5J89A 4BUGA 1CLOL 3EBIA 2DQGH 4OIAA 4R4BB 2V7HA 1P1VA 3EGXA 1PZDA 5ETUA 1HL9A 2G2RB 5SWZA 1AS8A 5DMKA 5FUCC 2Q86B 2WBWB 3H42H 1L9PA 4MKMA 3EO9L 3AXIA 4B9ZA 1ZLWH 2ICEB 2X5PA 2XKNA 4HGWB 3MYJA 4PJIB 2WN2A 3V4VH 4JKWA 2OMNA 1NMAL 4JGMA 4TLKA 1JV5A 4KUZH 5AVWB 4BH8A 2VLLB 2VN6A 3TBTA 3QJFA 1UUNA 1O6VA 5E9DD 1N3NB 1OCRB 3GSRB 1EVUA 1OPGL 2CGYA 4WHYG 1N26A 2CAKA 1M2OA 3FONB 1KLGA 3K74B 5GGTA 4JN2A 4F7TA 1RUAH 5HDRA 1L3WA 2X6CA 4BUHA 5CEZL 3ZL4H 4R8WL 2YPKB 1JZ7A 1TJIH 1OP9A 4FJYA 5F9WB 4P23D 3D4CA 1NPUA 1WJ3A 3FQ2A 4I77L 1T66D 2IALA 4DPCX 1NCWH 1A66A 2DTMH 1DL7H 3OWRA 4PAZA 2VSDA 1XH2A 5C09A 1UXLA 2WKOF 2ZJSL 1S9KC 3SDAD 1QHPA 1YN7B 4X4MA 3GBEA 5CINH 1JNNL 5I8CB 2OULB 2AQTA 1VFAA 4LVEA 5T3ZL 1G4MA 4GUPB 3TJHC 1URZA 2OMVB 2CO1A 1OALA 2OJEB 4GKLA 2XNAB 5AKTA 5ESVA 3P3UA 3TO4B 3SGDH 1XQ4A 2P4AB 4X99A 3V4VL 3LZFL 4UTAA 3SOBL 2IDQA 3IJEA 3PABB 1UJ3C 4BHUA 2CO3A 5C08A 5IFHH 2PPAA 1KXVA 2AK1L 5TE6H 4UDTA 2MPAL 3S3CB 3OVUB 2P8LB 1F90L 1I8IA 2AXHA 2AXJA 4NC1C 3RNQB 1QI5A 3GIZH 1HH6A 1IGTB 1Z6JT 5EN2A 3MLRL 1MCCA 4GI8A 2B4CC 1PG7L 5C08D 1Q94B 1A6AA 1F6AB 1LNUA 1U8KA 1Z3RA 4RRPG 4XBPB 4BINA 4GW5A 5E4IA 4EZKA 5JPMB 4L5FL 3WFCL 2HLAB 4Q6IC 3VWJC 5KG9A 2NMSA 4BRVA 5J6GB 4Z7UA 2B77A 1ET8A 1KJMB 3ZTJH 5CR1A 1G7HB 2CMRL 3MRMB 3UJJL 3GMLA 5AVVB 1QKZH 1C5BL 3Q1SH 1GJUA 1MCBA 4JCMA 4LVNB 3T0WA 3SDXF 4OLZH 1CFSB 1INQB 1YEIH 1VGEL 3U82B 1AKJA 4ZNEE 5LNGA 1HK6A 4GQPH 1D6EA 2IQ9H 3HC4H 3WGVB 1HNFA 2PXYD 2XQBH 5I6XB 1DBBL 3H2QA 5IJKA 1F00I 1XF4B 5JPMC 1IZKA 1MG3C 3LEXB 2BVQB 4M3HA 3MACL 3E3QC 4F2ME 4NAQA 1IV8A 3VJ6A 3SPVB 4PRDB 4UQCA 1MY5A 4LDOB 3WKQA 3EXJA 1LD9A 1UOWA 2X0WA 4JDZA 2E59A 3GXIA 4CW1A 3LRSB 2VUKA 2UYLA 3QJXA 1NFDE 4O4YH 5HD8C 5E6ID 3RL1B 1LGVA 4NIYE 3O3UN 4DO5A 4IRZH 4TL5A 4MNQA 3P0VL 2R69L 4P48A 2NY6C 5I8KH 4IJ3C 1Z9PA 1RZ8A 3HMXA 4KMQA 4W68A 5E03A 5KBDA 5E2UL 2A73A 3BUIA 5DZJA 5K33A 5HHMD 2Z91B 1RMFL 1WBZB 5TH2A 5CBAB 1ZE3C 3U2IA 1CC3A 3PAYA 2A83B 2COVD 3DARA 3D0VA 1YMMD 3ZUNC 1U41A 4A7TA 2Q3AA 1S7VB 3CU7A 3PUCA 4BE6A 4ZFFB 3ISYA 4HDIB 2R1XA 3GEWB 1T83C 1RUQH 1JWMB 4HSAC 3L5WA 4Y4HB 4NUGH 1FH5H 2F7PA 3DSNB 5J3HD 4HZLB 4B0MM 3U0PB 2F5BH 4IKNA 5E99L 15C8L 4NFCA 1BAFL 4WTXA 1QQDB 1NBYB 4XGZB 1BXUA 3VFVB 4NWTH 4OTXH 1CG9B 1KJ3H 2Z91A 2CBQA 2PO6A 2W5PA 5LG1A 1T1ZB 1HCFX 2ZNWA 4OLWL 5HDQL 4Y9FA 3LKSB 4LGSB 3MLYH 1ZMYA 2UZYB 3HFML 3NESA 3QAZB 3RUGE 5EOTA 1UFUA 1AXSB 3S5LG 1TMCB 1U36A 3BEWA 3MNWA 3PWPD 4EUPH 1JZ2A 3AQZA 4RAUB 2BOLA 3IJSB 3KPRA 3FB8B 3TP4A 4YLBA 5EBWA 4X4XB 4DO6A 1CU4H 2I27N 1JXKA 4FTVA 4EKJA 1OAXL 1U3HB 4J3OG 3TEZA 2MNWA 5HGGS 1KN4L 1RFDL 2BSED 4KMLB 2ETWA 4AYFB 4EQ3A 5K9QG 4AKQA 2C4XA 4OR1A 3VU2A 2CO6B 1YYCA 3VI4A 4YDIL 1JZ4A 2XV2A 4JRYB 1N64L 3DX7B 4B50A 3SOBH 1S7UA 3V0VA 2HCZX 1IAIH 4U0RC 3ZPDA 3O8XA 1IAOA 5J7CC 2VZVA 1D9KB 4JO2H 3VDBA 3DYPA 1N19A 3BVWA 1CFNB 2BP0B 3ULVD 1HHGA 2NQCA 3LD8B 4WU5B 5CILL 1TTRA 3JTTA 2PCXA 5CMAA 5EUKB 4LGPB 3MKKA 1VLXA 1NLBL 5IREA 1GY2A 3ABMB 4XCYA 2F61A 1WFUA 2VLJE 3ZE1B 1DEEA 2VAAA 3DGDA 3OQ3B 3WTVA 4G9DA 1WVZA 3EO0A 1FVCA 2HVJB 2GY7B 2O6FA 3NZHL 1BEYL 4NUQA 4JY4B 4QRPE 4X8GA 1Q94A 4GS7C 3FH8A 4NN6B 4JFPB 3ARBB 4IRSD 5EIQA 5TF0A 1AXSA 1UCBH 4NQCA 1BX2B 4XC1H 3SPIA 4ZI8A 5IB1A 1IEHA 4ODBD 5KYWA 2X4SA 1JPFB 5C3LD 4RWHA 2W60A 3N06B 5E51A 3HN5A 3QEUA 5E9NA 3D08A 4KVNH 2XZZA 1ACCA 4JRXB 3H85A 4TUKL 1QWUA 2NUTB 1ASQA 3ZDZB 4ZFGL 1ZA6B 4UTBA 4N8CL 5IFAH 3WFBL 4LB8A 4PLOB 2WIIA 2MHAA 5IW3A 3VRLF 3S5ZA 3NEXA 4U6VL 4LCCC 5IF0A 5DD3H 1C5CL 1J5IA 4XBGA 2OBGA 4KKZA 4F8NA 2P8PB 2I32A 5F6IB 4YUEL 1GL4B 3U6XA 3BMVA 4PPTA 5DJ0A 3EJRA 3MV8A 3EKCA 4K23L 3RBSA 2YR3A 5EHFA 4HX1A 1OAYH 2YQ2A 4MXWH 3LRLA 3NZ8A 4FFWD 1X5GA 4L1HA 3OR6B 5I75C 1NSNL 3EO1B 2NRDA 2AQQA 3FH7A 3FC8A 4RNRB 4WTWA 5GRVL 2J56A 3S0PA 1ZV2A 4V2CB 1NAMB 5B8CC 1GSMA 1UACL 5IQLA 5M7QA 3STZA 4FGMA 1RZPA 4X6BB 2E6QA 3OGCA 3ARSA 1E4XI 4FJ6A 1MPAL 2WKGA 1RK1A 1UQSB 4IBSA 3FB5A 3Q43A 4OM1H 1GA2A 2VCOA 3IU3A 1BWMA 2ICEA 1EUTA 3S3JA 3UTZA 1QATA 4UT9H 5GGRY 5ES4B 1GJWA 4BJLA 3NQIA 1JGEB 2F08A 4ZRGA 2HTKD 4HGKC 3VD2A 1RUQL 5JYLA 1UB5A 3IDXL 3QH3B 5GRUH 4QJ5B 1NIFA 5D2NC 4RIRA 3MGTB 3T8XA 2FX8L 2ADGA 4QRPD 3PGCA 4NSKB 2FT8A 5AVXB 3MUJA 4HH9A 1Q72L 4JDVB 1YNKL 2XWJB 4PMEA 5KAQG 2V5YA 4NKMB 4PLJC 3W0WA 2AI0L 4L05A 4Z3EA 4LZKA 1E6JH 1TZHB 2PF6A 1XT5A 3DHPA 1GH7A 3JWNH 5E2UH 3MRQB 1FYTD 1IGFL 1AVAA 1EK3A 4WDIA 2DM3A 1FNGB 1I85C 1S7RA 2WB1A 3DX6B 3QUGA 4G8FB 4JPQA 3TVMD 5BOZG 1KTJA 3GMOB 3MUZ1 4U6XB 3VXTA 3IDGB 4FQJH 3WEBA 3KMDA 3QO1B 2VIRB 1Z32X 3RAJL 3MLWL 1PZ5A 4OF6A 3Q2LA 4J3OD 4HS3B 4HJTA 1F8TL 4EF3A 2GT9B 3KPQA 4PB0H 3QHZH 5KUKA 2OP4L 5IBUB 5JTWA 5GISL 1QEXA 4PTUA 1UKSA 3NCWA 3WTXA 1RJLB 2ORBH 2R59A 3S37X 5F1IB 2IBZX 1G0YR 1I8LA 3HNSL 2WXHA 3F62A 3ESOA 1AD0A 2DBLH 4P9MH 4HIHA 1HFUA 3APFA 2GTWB 3BH8B 4P0DA 4RGNC 4UINL 3DROA 1G4RA 1YSOA 5LCVH 1CGYA 5I30H 3DNKA 1S3KH 4MMYB 2WLIB 5GGVY 1KLUB 4GRWF 3QDGD 4WENB 1NUNB 4JY5L 3L4ZA 4OB5L 3ZKXB 2V3DA 3QCVL 4G3YH 3BUDA 4MCZA 4OVVA 3NSJA 3ECQA 3PQYB 1BQRA 3LVEA 4OQTH 4POYA 4UU9B 2VDKL 4G8GB 5B3JF 3QUYB 3TU6A 4KJQC 4LVHB 1UOKA 1JF6A 1RUMH 2CJ3A 2QQLL 4R9HA 1U3NA 3MRNB 3DMMD 4Z7WA 2BNRD 3OGCB 3CFTA 5D7JC 5BS0B 2DYPB 1RK1B 3L6FB 4KAQH 4AVIA 5F8QC 1AGDB 3PPEA 2XX1A 2ZCHL 4FMFA 4LLQA 3FOMB 2XFXA 2NT1A 1D5ZA 5ANHA 1XF5B 4XN5A 5B1KA 3VFMA 4FNLL 5I15L 5GZOD 5JW4Q 1OTUD 3BZFB 1DVQA 4MB5A 3ZSSA 4DFHA 1N70A 3LS5L 3TCLA 3UAJC 1JD9A 1U8OB 3IWUA 1OVZA 1A5FH 4XPGL 2B08A 2B3IA 3QUXD 4GW1A 4Q9CA 5I5MA 1SMDA 1SJVA 2FL5A 4OZIE 1S5HA 4N26A 2FATH 4NXKA 5DMGC 4GI9A 5DYFA 1RVFL 4GAJL 5KTEL 1BBDL 4PB9L 4ZJ9A 5JW5A 1BFOA 2J20A 3ILPA 4ZFQA 4X98A 3VXUD 1AQDB 1R5VA 1XB3A 3S37H 1URIA 4MKTA 5A3ID 3WEMA 2V2TA 1EO8L 2BY3A 5SWSE 5FOBB 1NMBL 4R83A 1X5AA 4DNLA 1Z9NA 4YHNB 3PXLA 3ABZA 3R7QA 2VXTL 3CZLA 4UUJA 3FUEA 5CF3A 3FJTA 3O3AA 1WD8A 1KWGA 5JDJA 1KELH 3NJXA 4XNMA 5D7IB 2DH3A 1M7DB 3D85B 5F7HA 1MLCA 1IGFH 5HGHB 2HLAA 5IBTH 1E0OB 5KG9B 2Y2TA 2J55A 4OGAC 4F2FA 4IK7A 3Q8FA 3O6FB 1I9IL 3LRGA 1JPST 4A6YB 3GMMB 1I1CA 3H0TA 5TGBB 3V0HA 4S0HA 4PGDB 4OCNC 4M4RA 1YDPB 5DD5L 1ERNA 4Z0XB 4DIXA 2PP7A 1H15A 2VXQL 3MV9B 5J9PB 1Q38A 1D3CA 1ACXA 2VSKB 3KBFA 3BAEL 4YK4C 1OAQL 1E28B 4TNWK 1QFWI 5IVNA 4UAHA 1WT5A 3TVMA 1C5BH 2VAJA 3Q1SL 4Y1AB 1I1AA 4DN3L 4MQ7B 2GJJA 2R56H 3GBNL 4RMTA 5JORB 1KB3A 3SE8L 3V10A 4JO4H 4NO3A 1CIUA 2VT0A 3AGVA 1AJ7H 3EOBB 4X98B 1HZKA 1OE3A 1I31A 1HZHL 1MHHB 3QDMB 1HXMA 2IH9A 3AS2A 3AW5A 1J0IA 1GIGL 1N2RA 3N1PC 1NWPA 1YNKH 1A1NB 4NENB 3TCTA 4PP1D 1WP6A 3TWCH 5KJRH 1BQHG 5J4MA 4JKPH 2NXYD 5I19L 1ZS2A 1Z5YD 5B3JE 3O3BA 1B2YA 1D5ZB 5ANME 4QXVA 1J1PH 2D7PA 4GEIA 5DZOA 4BSWB 5T1KB 4KH9A 4L1LA 1SYVA 1A7QH 4IJTA 5KVMC 4JCLA 4LAQH 1U8QA 2JKIS 2J6EH 1HHIA 4IRJA 1XR8B 2HT4C 1F4WL 4P3DA 1VENA 4XNUL 1B0RB 4FFYL 4PYGA 1GW0A 5IB4A 4JFWA 4JR9H 1N12A 4Y4HA 3SJVE 4FHBD 3N44B 1JGUL 5TDPB 5TQ0L 1FFRA 5J11C 1AQ8A 1IFRA 1NKOA 3AABA 1KGUA 3HVDA 5LDSA 1D5BA 4KQ4H 3S97C 2JELH 4FLSA 5AVYB 2B0SL 2Q20A 3VCLB 5E4EB 2EYRA 2YC1A 1JZGA 2DEXX 3MRDB 4A67A 4PRHD 4DTGH 2NY4B 4E5XB 2C4FT 5C0FA 4CU8A 5J1AA 3L95A 4AJ0A 3FRUA 2VLMD 2OTWA 1OGAD 2ZWSA 4QHLB 2GFBA 4GO8A 5FYLH 4HBCH 3SJVD 1E9OA 6PCYA 1YPZE 1CFBA 3UZQA 3V0AC 4AMXA 2ATAA 5EZPA 3N0AA 1M53A 4N8VA 2VLRA 2ALWA 3CN2A 3PXHA 4LDCA 4P2RB 2RGSA 3B9KA 3QIUD 1IGCH 2G5UA 2MOQA 4A2HA 2FX9H 4Z77B 4WEMB 4KNTA 4MTMA 4LSSL 1XFPA 5FFLA 3DIFB 3GSNH 5TDOA 3BSZH 3TV3L 4S1SL 3ZX1A 1I9EA 2H6PB 4Z0BL 1ZSHA 3ULUH 2DM7A 3VNYA 5D5MF 4W6YB 1G7IB 2OMUB 2F0CA 4FP8H 4KTEH 1RUML 2OTWB 1A4CA 2YD3A 4I3GA 4KITB 1HU8A 4WFHD 4XXDB 4M7LH 1PD6A 4L4TA 3QO1A 4QCIA 5D2LE 1MNUL 1UXSA 3K4AA 4LLUA 1HNYA 4PUBH 1PZ5B 1QUPA 5A16B 5FO8A 1FL3A 4K2UL 4H20L 1TQUA 1IAKA 2NY7L 4Y1SA 1J11A 2J71A 4O2FA 3HFMH 4OJAA 5CILH 4UOQA 4XVTH 2VDQH 1FFOA 1MF2L 4YQXL 1JXJA 3IXTB 1FZKB 3TO4C 5CEXA 5LQBL 2CLZB 2V5TA 3AAZB 5I1AA 3AS3A 4NHCH 2OSLB 4HUNB 4XXDA 2IJ0C 4GAFB 4Y7MA 1NGXB 2A6IB 4X0KA 2NW3A 2FRGP 5SX4I 4KO5A 1TYJA 2CJSA 4AQ1A 5D1QA 3CFKA 2DWEA 4F7MA 2HWZH 1E9PB 1G9NH 4F8OA 3KDPB 5IM7B 3R06A 3RL2B 3FYIB 1NOFA 3B8SA 1MJ7H 4E41A 5DS8A 3DTXA 1AO7D 4YS4A 4PD4K 1JRHL 1BF2A 1E4KA 3ZO0A 5C0AB 1T21A 3IE4A 5C0ND 4PUBL 5EOTB 4IRZA 3ZJAA 3G08A 3TN0B 4H4NA 4OGXH 1ICTA 1W6WA 1BVNT 5AKSA 3RDJA 3FQ4A 5C07E 4GB9A 3N1QC 3OXSA 2ARJQ 2Q86A 1P4BH 3ECWA 2VSMB 3V5DB 2OMYB 4ZS6C 5IJVA 3QPQD 1OXYA 4ZMQA 5KS9A 2WWNA 1XIWC 5K1NA 3MREB 3LKRA 1N8OE 5B39G 1DR9A 3CFBA 4AEEA 1FFPA 3OKLA 2VXSH 4BFJA 3FB7B 1NBQA 1TENA 4I1PA 3ROOA 4JFFA 4N5ED 1KCRL 3C6SA 1BHGA 2YLHA 1CVRA 3KPMA 4WI8A 4BFKA 4B9GA 3C8KB 1V3JA 1IO4C 1FA4A 1OSYA 3GJFA 4W70A 1B0RA 4N24A 3I6LD 3I85A 4NCDA 4WSGA 5IJBC 4OJYA 3ETBF 3IMUA 3MA7A 4X6EB 5CCJA 2FWSA 2NUPB 3GRWA 1UEMA 3CVHA 3RQ3A 1ML0A 3WD5L 3WTWA 2WJ5A 3MNZB 5T1LD 5BRPA 4NZDA 1NSNH 1X5KA 5F89B 4HZAA 3U46B 4HXAL 3T1FA 1CFVH 5A7BA 2AKRB 1FBIH 4ANVA 4HIXH 3CDZA 2WZ6A 4XZUB 2HG5B 1UD6A 1QSFD 2J5WA 3WAJA 2AJZA 4DFIA 4NFDA 2FEEL 2IV8A 1C12B 1L6ZA 3FF8A 3WEOA 3MRHA 5DZVA 5FIEA 1MFAH 1IBHA 1A6ZA 4YX2L 3ELQA 3OAUL 5IVXF 2X05A 4DKEL 4JO3L 2VXSL 3OF6D 3OKMA 4FQXB 4HU8A 1WHPA 5I1KL 1P4UA 4UT9L 2PWFA 2XZQL 3SKMB 4HIEB 2XICA 1D9KA 1XGYL 3CNKA 4YWGL 3TPUB 4XOAA 1SXAA 3WE6B 4PJDB 4ZUWB 2JQZA 3WJJC 3ULSB 3B4NA 1T6VN 3BRDA 3AB0C 3N43F 3QUZC 5MI0B 4HKXB 4PWFA 2VN4A 5E8PB 3GSXA 1U93B 1OGAA 2OP4H 4GW5B 1YMME 3U0WH 3MRBB 1OZUA 1FN4B 4YDLB 3O4LB 3HZYA 3TEUA 3VQMA 2WVVA 3OC8A 2E8ZA 4G2AA 4NRYA 5AOMA 3LKNA 1YC7A 1CFVL 2NY1B 4QD2E 1U2HA 1ZJBA 3KGRA 3MFGB 3QUZD 2XU9A 4XX1G 1I7TB 3GI8L 2BSSA 4AV4A 5CEZD 2XN2A 4M7ZB 1I3VA 1I8UA 5HPOA 4PJDA 1ZVSA 4HWEL 5G5DA 3ECVA 3GBLA 1QA9A 3M17B 2CJUL 1NCIA 4L2LA 2V0AA 3LKQA 1USQA 3MRNA 3QQDA 3C60C 4ZFZA 3UYRH 2NQDA 3V8CA 1Z3GH 4O5LL 3KGTA 4PJDF 1AZVA 2VC2H 4L8SB 1TCRB 2O4EA 4LLYB 4P23A 4JCWA 3KWWA 1JPSL 3T0EE 2BIPA 1P4IH 3MCKB 2A6KA 3PWPE 2MKLC 4NUGL 5F1NA 2ITCA 5IQ9B 2QQLH 2XYCA 5I1CH 3D69A 4MLIA 4RGOH 4I48B 4O51A 4XP5L 3RKDC 1Q8MA 1TVBA 1DBJH 3X1BA 5F9AC 1NH6A 4L23A 1ZPUA 4R3SA 3V5HA 4ODWA 3I2CH 3PP3K 4ORGA 4U1SA 5EBMA 3IDGA 3NYKA 2LQRA 1DEDA 4LARL 2VNCA 3RZWA 5I5JA 1FYHB 3CVIH 5EN3A 3IDJA 1U4EA 3FT0A 3L3HA 2ID5A 4K71B 4LLDB 1GAFH 2NY2B 3L08A 4J3BA 4RDQF 3HRZB 2DOCA 3T65B 1PSKH 2GW5A 4Y2DA 1JWMA 3UBGA 3V6ZA 2GG1A 4NQDE 4S1QL 4X5LA 2WGXA 3UBXB 5F9JA 4JFDB 3GIVB 2FIKB 2PWHA 2K8MA 3FB7A 5TPWL 3BO8A 4CSZA 1INQA 1CFSA 5BRQA 4KK8C 4MAYB 4WKZA 5GISH 1GS7A 3BDBA 3P3SA 1NKGA 3MLTA 4UT7L 2FLRT 1G7IA 2OMUA 3O4OC 4L3AA 1MVYA 1FZOB 1FRGL 2IDTA 4GRLA 5EUOA 3RY6A 1EHKB 4L9LB 5KVGE 2P46B 4IOFC 4J3SA 1P7BA 2VZOA 4N2OA 1FBIL 5DEFA 1BD2D 3ZDXB 3MNVA 1S7RB 4G8FA 1PX4A 2R29L 4NQXB 3RVXD 4AYBA 5DVKA 5CN1A 1ILSA 3QS2A 4U1JB 1NM4A 2ZUSA 3BW9A 1IAKB 1IC5H 1YEFL 4FD0A 4WV1B 5EZOL 1IM9B 3UEZA 3WIHH 4JG0L 3N1MC 4EEEA 1BD2A 4HZ1A 3RI5F 5LGJA 2CR0A 3PJSA 3QFDB 4NWUH 3DJTA 4GAGL 7TAAA 4WCYH 3FU7A 4IHOA 1J10A 3Q8CA 5FDYA 1XVSA 1AR2A 2FATL 4D0CB 2ZOLA 1AOHA 4J2XA 1YY8B 3BH4A 3WNPA 3N42F 3D50A 1PBYA 1PGRB 3GJEA 4XCCH 5F2FA 2FX7L 3LIUA 5H37A 2WQXA 2AEOA 4PWIA 3VW3H 4OCXH 2XTLA 1OLLA 2Y6SC 4M8VA 1D5IH 5CSBA 1FVDA 3D4YA 5DYOB 2OXGA 3E6HB 4NPKA 2M8XA 1PU0A 3O81A 5ICUA 4W6WB 3HBPA 4FE9A 4L9LA 1GKEA 2QZ5A 1V7ML 1CDGA 4IJ3B 5K9KA 3CN0A 2G9KA 4K9EH 2X88A 4U31A 3UTPD 3L2NA 3IN2A 3AU0A 1FN4A 1GGIL 2AXGA 3E8UL 1IQDA 5C6TH 1THCA 3EJPA 2ZX5A 4U2YA 2GAZB 2E5EA 4GI6A 1VERA 3BEVB 2MCAA 4HIJB 2Q7YB 4YMPA 2OMXB 2X9XA 4WW2A 1Z0MA 3GSUB 4G42B 5CLTA 2P80D 3OZ9L 2F74A 4OZGB 4WFFE 3ULUL 4J6RL 1AKPA 3D85A 4LT7A 4KKLD 4N8UA 2C8NA 4PJ7F 5CU5A 3ZYZA 4KJWD 4N86A 1G7QB 3MYJB 3NP3A 4PJIA 2OR9H 4AYFA 2AHIA 1P7QB 4HS8L 1CE6B 5CS7A 4N2BA 4ESKA 4ZSOE 2NYYD 5CEYA 3H8NA 1H15B 3MV9A 3F7RA 3DPDA 4WU7A 2VZ3A 4NM4H 5IB2B 4GJTB 4D0BA 1KB5A 1UB6B 3MCLH 4JFQA 3T3MB 1BOYA 2APVA 4YHLL 2OI9C 2H41A 5KJRL 3VRJB 4MA1B 4C4BA 2OX5A 1CICC 1SN2A 4JFHE 4NQSB 2EYSB 1GGIH 4HCFA 3PGDB 5AW1B 4FQ1H 3F3HA 5C08E 4CSPA 1X4ZA 2NW2B 3CLFH 3MX0A 1WWWX 3TBBA 3LVTA 4ZTPL 4G7YL 2UZIL 4KRNA 2VM9A 4XCFL 4XNZB 1UEYA 3HMXH 4ENED 1N67A 3DX3A 4ZQKA 1P5VA 4YFLI 5JOPD 2X4SB 5I0ZA 3S3PA 3C6SB 3KPMB 2EDXA 1GZHA 3TA3D 3ELAT 1WFMA 3C8KA 3O3BB 3QAQA 3U7AA 2WINB 1HIML 3G9AB 4P4KC 4A6YL 4K23H 3UP1A 3N85L 2J1WA 3HCVB 2YFNA 3TYFA 5FO9B 4FLHA 1HEZA 2EH8L 2DQGL 2DTML 5T3XE 5HHPA 3SCMA 2XCMC 3UGUA 3AM8C 3W39B 2R51A 3Q6GL 4GFTB 2YBGA 4QRAA 4ZO7A 2JJSC 1ZANH 3RB7A 4M61B 3O8XB 3IMTA 3W3BA 5E5LA 2BNQE 1BOGB 1IGML 2WLLB 1BZ9B 3GZQA 5CCKH 4DAGL 4MQ7A 5AW9B 2XQYG 5LQBH 4OCSL 4P4KB 1JZ6A 3HZYB 1NCCL 1IFHL 3F84A 4G70B 1FNSL 1QMUA 1U8CB 1AO7E 2DQTH 4XPFH 3EYUL 1ZS8A 2W0FB 4Y5VA 1QABA 1JVOA 4Z7IA 2J2ZB 3RY4A 3EW3B 3GUTB 3NAAL 4ZTPH 1ZGLB 4ICWA 1ZLVK 3UZEA 4A7SA 1KGXA 1AYOA 3MOBH 1JZHA 3L3OB 4TVPL 5DXWA 5FGBC 3CGTA 1NFDF 1T7YA 1JGVH 2PUQT 4ZFOL 2Y5EA 3TC9A 5KYUB 4M7LL 4XRCB 1JK8A 1XGUA 4H8WH 2GJZB 4V1DE 3EHBB 3B5TA 5IHWA 4OI8A 4HG4J 3ARED 4MJ2A 3BT0A 2DKSA 4UQIM 4X5RA 1T4KB 3RBGA 4DKAA 2FAUA 1GZHC 3LIZA 1BFVH 4EN2A 3DDGA 4JPWL 3QNXB 5I26A 1WPCA 2P44B 4Y16B 3CX2A 3ULAB 2VIRA 4H1LH 2DIJA 5HTSA 1TETH 4AEIH 3IKCB 4LSSH 4OLYH 4EZJA 1S8DA 3SCMB 5KZCD 5FW6A 1TTFA 3NSYA 3CPUA 1NJ9A 5DTFA 5AQ0A 1HXYA 4XP6L 1CL7L 3HRPA 3V0JA 3QIWB 4ZUUB 1GHFL 4XP4L 3FSVA 1XCTB 3LZQA 4TF4A 1MFAL 1M7IB 2IH3A 2DQTL 4M6OL 3DHUA 3E7JA 2DQDH 3EYUH 1EFQA 4CADA 1UWFA 5CUSL 4WUUD 4OJFH 4QHMA 4OFKA 5EU6B 2HVKB 3H9SA 5FYKE 3O6MH 4PHXA 5F7BA 2GEEA 4AH2A 2WMPB 2HLFD 1S5IL 3ATAA 1REIA 3JV5A 4BQBA 1MWAB 5JHLA 1RUAL 4PBDA 5DRWB 3UAJD 5KVEL 3ETBJ 2MQGA 4ZUVA 4GPVA 3IYLW 3ZRSA 5I66B 1KLUA 5KVFH 3CN3A 3IU3B 4JUSA 2OR9L 5DRXA 1GR7A 4UDUB 1DVUA 4AIZA 3KXFD 3NIGE 4WIQA 2CIIB 3PXJA 4AK1A 1B6DA 5IROD 3ZE1E 2WCSA 1R3HA 3MMEA 4LCUB 3JWDH 3KAAA 4QTIL 2OJ1A 1TJMA 1JPTL 2YQGA 1DQKA 5C3TA 5D7JD 5JQ6L 2YPVL 2HFGH 1LLAA 1MI5D 3ZHDA 2NY0D 4JHUA 5F7EH 4TSCL 1E8WA 2YO3A 1MRDH 4EI0A 4XCFH 3QG6B 4ZW5A 4OV5B 2VJ8A 5I1LB 3V52H 3HS0A 1ZOXA 3UTTA 3DMMA 3B3BA 1PLGH 2V2WA 3CFCH 4FQ1L 4L3FA 5D72H 1KC5H 1TYRA 1AYRA 1RLWA 3CTTA 2Z6FA 3FONA 3ML9A 5BV7C 4FHJA 4P5KB 5K9JH 1XF3B 3OKEB 2FJUB 4F24A 3FT3B 1FIGL 6TAAA 4GUPA 4WY7H 1UZ8B 4YHZH 4L18A 1F42A 4M48L 2G3XA 1BEXA 1QBAA 4OLWH 4WEBH 4F20A 3P02A 4KJPC 3H9HB 1K85A 1KG0B 1UWXH 2RCSL 2VDLB 4Z8FH 2Y6SD 5CZKA 2W8CA 2K6WA 3C9NA 4I7ZC 4XCNB 3KVPA 4C59B 4MMZA 4B9IA 1HH6B 4KK6D 3QZBA 2XBZA 5MP6L 2CHZA 1QKZL 5H94B 1UGNA 2WBJA 5EUOF 2F54A 4WAFA 2BX5A 2IQ9L 4UM8B 4G9DB 1EUUA 1BZQK 4B96A 4ZW7A 3RWFB 4PJFE 1KJ2H 3CE1A 3JT2A 1L5GA 3LQMA 3GSNA 2K4AA 4RGMB 3O2DH 1MHHA 3EOTL 4PCTA 2CHWA 1S4IA 2EKSA 3HZKB 4X4ZA 3T0DA 5HDBB 3PHAA 5I9QC 3EF7A 5IKCA 1F1GA 2LFEA 1NL0H 2XLLA 4BFOA 4Y0GA 3A0OA 1NMCC 3C60A 1SEBB 1JP5A 1PJ9A 3ATDA 1PD0A 4LASH 2DQEL 1UHVA 3ISWA 5LAXB 3GTTA 1DE4A 3G5XB 4P2OA 5C0RH 3PGCB 2KPWA 5FYLE 3PLYA 5BUGA 2OXHB 3TM6A 1IKFL 1KG0A 2WVSA 1FHGA 2H5UA 2EEFA 3O6FC 1MH5B 3ISRA 2HKHH 1SGKA 2H3XC 2A3TA 4MVBD 3UBXA 3OKDB 4GMTL 1Q4NX 4HT1H 1K4DA 5BNXD 4IMLB 4JDEA 3MSPA 4DCQB 1DP0A 1RZFL 3DUSB 4NWUL 2YLKA 1N10A 4QLWA 3PV6B 5IFJA 3W81A 4FADA 2XVBA 1E7VA 2DKMA 2E9BA 5FF6B 4HS6B 2K9UA 2P5WA 1QSVA 5BPPA 1XB8A 1CMOA 4PJEA 3LMJH 1FF5A 3BIBX 1G6VK 2J4WL 3SKJL 3FO0L 3Q5OA 4KKPA 2X4TB 3R19A 3MKGA 4S0SD 1S3RA 2EDWA 5JW5B 5C0AE 3IJ9A 5L8LB 2VM3A 3L5WB 2KERA 1J8HD 2DYSB 3S8FB 1OTTC 3CDZB 3KYOA 1FIEA 3WFDL 4U1LB 1ZLUK 1HHIB 2YD4A 4IRJB 1RPUA 1Q72H 3D7PA 2I5YL 4A2EA 4JZOB 1LO5B 2A2QT 4WU7B 1F2QA 4PJAA 1MKFA 2Y4SA 2PO6B 5GZNC 2YARA 4ZO6A 2Z93B 1F4XL 3ZKQD 4LCWD 1NMAH 3FFOA 3UJJH 5AFAA 2WY3B 4M6NL 4XMWA 2NCEA 3KE0A 2E7DA 2MQ3A 2OMZB 3DRQB 3KWUA 3ML8A 1DDTA 3QEQB 5K59E 1QTSA 4WY7L 1JZIA 2JWYA 5JMRA 2EAEA 4M3JA 1P5UB 4X4KA 3DX4A 3FU6A 2APBA 3FFDA 5AD0A 3HNVH 4QYOB 3PAUA 4DVRH 3HB3C 1L9TA 1UADC 3ULUF 3I2CL 5FS5A 2Q5BA 5ID1B 1DJYA 5IOPB 1IB5A 1X6NA 2UZYA 5FK9A 2CBMA 2IFFL 1OAYL 5EU7C 3IMWA 5E8EA 2B8OT 4ZD3L 1TJHH 3CAFA 3BH9A 1IGIL 4P2QD 5IHHA 4TULH 5I75B 1YVLA 3VH8A 3WNIA 1X9UA 3GSNL 3D39D 3JZYA 3VYOA 4I2XA 4M03A 2ESVB 1OOWA 3E1F1 5HGAB 2JH2A 4UNTA 2OMWB 3BLPX 5G4NA 4PJEF 5GGRA 3HLAA 5KYXA 35C8L 3T8VA 3DURA 2ZJSH 1DQTA 2WWMC 4GSXA 2AQ1A 3WXWH 1VSCA 5I1DB 1QLRA 5EEUA 4Q0XH 5EA0L 2A38A 2JI1A 4MQTB 3LX9A 3ZE2E 1A21A 2WWKT 1Z9MA 1WC7B 4ZMVA 5DFTA 1AD9A 1OE1A 4B41A 1CB4A 3L1OH 3MNDA 2GQHA 5DSCB 3GMNB 1T89A 5CFHA 2VRQA 4AYGA 1EFXD 1C5DB 3QEQD 2F6AA 3WJLC 3G5YA 1BXAA 4M7ZC 4TQPA 4MNQB 4IMKA 3NSCA 1A7NH 1NLDL 4QRFA 2A1WH 4FQPA 5F6IC 4OTXL 3TZVD 1R3JA 4JY5H 4IRSC 1UT2A 2OX5B 4NQSA 3TBWB 3UJTH 4E9LA 4Z78A 1KTDA 4I3SL 4U1GC 3CFJA 3TBYA 4BWTA 1I7ZA 1XB6A 4FYQA 3IAQA 1EAOA 2KC0A 4BH7A 4Y4KC 3NDYE 2YEVB 2G2PA 3GGWA 4PIRF 1G1KA 2F8IA 4IRJD 3VWKC 3NIDF 1P4LA 1DJSA 4UWQB 4PW9A 4ELKB 1B9ZA 2QV2A 1SDDA 1P5VB 2Q8AH 1GRWA 2HA1A 3F7KA 2MCG1 1PCXA 2J8UB 3IK2A 3RJOA 5AG9A 3AADB 1WK0A 3MRGA 1KGYE 1HJBC 1X5FA 4N90D 4KAQL 3CN1A 5AW3B 3QG6A 4KHTH 4JN2B 2ATKB 1EDYA 3BQUB 1WH0A 1DFXA 2BSEA 4H26B 2YRPA 5ISZE 5IFJB 4JG9A 4FFZA 5KYYA 1AOZA 3J7HA 3DK2A 1U95A 4G6JL 4AGNA 2H0FA 4QHNB 3OMZA 2FNBA 4LL9A 1KJVB 3VXSA 1DQIA 1IBFA 4XVTL 4KI5C 4KZ0A 3IDUA 2HX9A 3BEVA 4L5FH 1YA5A 1T89C 2ZF8A 3BYTA 4QDGA 1J12A 2N0KA 1M2VA 4ALAH 2NNAA 2PCPA 4K7PX 2ED6A 4HUMB 2DWTA 3HNTL 5ENWA 4ERSL 2NOYA 2WXMA 3EJCA 4OLYL 3PL6B 4S1DC 2KZKA 1F4HA 3EOAB 4IIQC 1NBVL 4G72B 4K9JA 5F1NB 5JHMA 1VZIA 1EXUA 2DWXA 1PIFA 2P48B 3FU3A 4EOWL 1FJ1A 4ZBJA 3FPYA 4PV8A 3ME0A 2BSTA 4MB3A 4Y4KA 3CQPA 3P69A 4MNGB 2Z92A 43CAA 3MRRA 3BSZA 4PJ9C 4A2DA 2YD7A 1AI1H 1K5WA 2ZOKA 3I9PA 1NEPA 2FT7A 4F7MB 2ORBL 5IEKA 2WZAA 1NMBH 4HEMA 3GPEA 4JKLA 4OGXL 4YPJA 2DLFH 2AVGA 2J73A 3BWUF 5DMKB 1UD4A