3LEYH

2f5 epitope scaffold elicited anti-hiv-1 monoclonal antibody 6a7 in complex with hiv-1 gp41
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
217
Chain Sequence
DVQLQESGPGLVKPSQSLSLTCTVTGYLITTDYAWNWIRQFPGNKLEWMGYISYSGFTSYNPSLKSQISITRDTSKNQFFLQLNSVTTEDTATYYCAFGNYLPAYWGQGTLVTVSAAKTTAPSVYPLAPVCGGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elicitation of structure-specific antibodies by epitope scaffolds.
pubmed doi rcsb
molecule tags Immune system
molecule keywords 6a7 Antibody Heavy Chain
total genus 40
structure length 217
sequence length 220
ec nomenclature
pdb deposition date 2010-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3leyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3leyH01
3S88L 2X4NB 1ROWA 3MUGA 3EDDA 4JFQA 1G6RH 3TPUA 1FV1A 1VENA 7FABL 2QHLA 2YPVH 4MB4A 4Z0BL 4YDJA 3TA3D 5JZ7C 3TFKD 4KH2A 2VQ1A 1M6OA 5IBLD 3WFEL 25C8L 1X4ZA 4FQCL 1CIDA 4FQ2L 2XG4A 1GVIA 4XVSL 2R0WH 4OI8A 1JN6A 1OAKL 2IG2H 2WBKA 4WHDA 1RPQA 2P5EB 4Q6IB 2DQCL 4X9BA 4X7CC 4LDOB 3LD8C 4NYLA 3FN3A 2VDQL 4QHNA 3C8HA 1M1SA 4K3DL 4RQQA 3QEUB 4PG2A 1YEJL 3EHBC 1XFPA 4M6MH 5BXFA 2HTKC 4A6YA 5JOPD 4U1MB 1LO5A 1DUZA 4PGZA 3CFBB 1HOCB 1WCQA 4IHOA 4WTZA 2YPVL 4Z7VF 4DW2L 3ZTJH 4D3CL 1EVUA 1OB1A 1EGJA 1ZHBB 1YEIL 2FGWL 2ZUVA 1B88A 5EIIB 4ZD3L 5GSRB 4DN3H 2UVFA 3MTRA 4ZPVB 4L3AA 1B0RA 4E5XA 4M6AA 3QDAA 5F7DB 3QNYB 5HHNA 4FMFA 5C0BA 1UC6A 4K71C 4KUCD 3VWJB 1NBZB 2QHRL 1CICA 2NXZC 2EDTA 2EDDA 4NSKB 4FHBD 5GGRY 5CZVH 4LAQH 4LSTL 4QF1A 3GJFH 2IADB 5JXAL 2ADFL 1ZVHA 4WI7A 3F7YB 4Z8FH 3SKOB 4Z6AT 3ZMRA 2CKBB 5EUOF 3K81A 4AM0A 2MHAB 1KLUA 2VDML 3MOBL 3GNMH 1OLLA 3WHE1 5B3JE 2QQLH 3AS2A 3KLAA 3QIUA 4RCAA 4L8SC 1INDL 3MBEB 2UWEA 3UTTE 4JN2B 2APFA 5C0JB 1FLRL 4Y16D 3B4NA 1RK1A 4LCUA 5FYKE 3EOYG 1FPTH 5EFIB 1WC7A 3LEXB 3SDDA 1IT9L 2NXZB 4TTDD 4O02L 1JL8A 1MRDL 5D2LB 4WHYG 2HH0H 3B6SA 3G9VA 4HH9B 2Z93B 4IOFD 4AEIH 5HHPA 1N0XH 3QB7C 2AJXH 1V5JA 1G84A 3NPSB 3MJ9A 4YDVA 2FSEA 1N26A 1QLRB 3DURA 3NA9L 1LO0L 1U8MB 4M7LT 2AVGA 3KWWA 5IUSA 1T03H 5DWUL 4WFGD 3FTGA 1ZHNA 3LRSA 2PYED 4H20L 4DVBA 2HJKA 2QSTA 4YPGB 5DVKA 4J3VA 5BZWB 1I9IH 1D6EA 3C8KB 1JYNA 1QSFA 5EA0H 3O6FB 4WNQA 5F1IA 4W81A 4MCZA 2FBOJ 4FQLL 1P1ZA 3GI9H 1CVSC 3IAPA 1ZGLA 2RFXA 4O4YH 3JUZA 2AS5M 2BNRE 1ZHKA 1UB6B 3INUH 3P73A 4PLJC 2NY3D 5GGVH 2Y1VA 1TITA 1U8OA 2N4IA 2E8ZA 3FO2B 5CEZH 3O3AB 4JN1L 5I1EH 5F70A 2CO6B 4CU8A 3QFDA 4XZUA 3OAUL 3NCBB 4YHIB 3VGFA 5JMOC 2JJTA 5L0QC 1U41A 2I9LB 3FQTA 5IR1A 4QNPE 2GYSA 3QA3A 4F9LA 2A6JA 3VXRA 2PTTA 1NGQH 2XWJA 3GEWB 5HHQA 1ZEAH 1TTUA 1C12B 1G6RB 4NZUH 4BK4A 1TIUA 2W07A 3HZYA 3FTGB 3GHEL 1SY6A 3BIKB 1ZTXL 2NPLX 1AO7A 3RY6A 1MFBL 1T2QH 4N5EC 1IKNA 4JO4H 1A5FH 3DX9A 4J4PA 1U8NB 1KJVB 3L6FB 4KXZH 5DLML 1J5OH 3ARDD 2QR0A 1KTDB 5HBBA 2DQCH 4PP1C 4N0YH 1UFUA 2F74B 1XF5A 2CLVB 1F4WH 2V9TA 3U1SL 1DQML 5EFIA 3ARGD 5A2IH 1WFOA 1YEDA 4PYHA 4XNUL 3CVHB 1AH1A 2EYTA 1UKQA 2BY3A 2P48B 3D25B 12E8L 2CRIA 5C9JB 3PP3K 1OTTC 1J0YA 5D7JC 1P9MA 3W0WB 5I1KH 1A4KA 4WWKA 3KPQB 1SYSA 4ODUA 4CDGC 1MCPL 2WINB 2HWZL 3MMEB 4UIMB 3TO2A 3LKNA 4PJEF 5DQDH 5DHYA 1FO0A 4RAHA 3DUSB 3TVMC 5J06A 1S7XA 4YLQT 5IV2A 4U1NB 3STZA 2AQ1A 4XWOC 4OF3A 5IB4B 1WBZA 1YN7A 3CLFH 4P5MA 2DKSA 3UBXB 4R90L 3QEQB 3RVWD 4PREB 5GQBA 4M5ZH 4PJGA 1EEZB 1B6UA 2COQA 1DBJH 1QLFB 2NY4C 4GRWB 4G3YL 1FVEA 2YKLH 5K93A 4OLWL 4PRDB 3VRJA 5J6HB 2H41A 3GJEB 1G6VK 5TE4H 4RFNB 3LKSB 3MREA 5K9OB 3MRNA 3OKDA 3U7WH 1YPZA 1JZ8A 1ZAGA 5DEGB 4YQXL 3CFCH 5DI8B 1RUQL 4NO0A 4UT7L 1NUNB 4LGRB 2UZYB 3O2WH 5DRNA 2Q20A 4KV5F 1CGYA 1RIUL 4CNIB 2DQTH 3PJSA 3S9DB 3SOBL 5DSCB 5I0ZA 1PBYA 2VLLA 3GRWL 4X4YA 5CKAA 3LEYH 1A21A 1F4YH 5E99H 5I1CL 3D85B 1MFBH 3M1BA 5DURD 3IKKA 3QDJE 5KSAC 4OZHE 3IDGB 3VFGH 4PRNA 5D93B 1IC4L 2BK8A 3DSFL 3QI9C 3VDAA 5IBLC 2CIKB 2G5BB 4LRNL 2HTLD 4Z77A 5LAXB 1LMKA 5HVWA 5KS9A 1PVHA 4JPKL 1PX4A 1LE9A 3MBEC 1HHIA 2NW3A 4YJZL 1OARL 4U6HA 4PGJA 2YOCA 2CXGA 3GSNA 5C0BB 2WBJC 1UM6H 3I02B 3CLEL 4HXBL 3BWAB 4Z7OE 4KHXL 4Z7OF 2E9BA 3KWWB 4KMQA 5SX5K 2PO6D 1QO3A 5E1AB 5E2TH 4UV7H 4ZFGL 4QCIB 4BQCA 3OKLB 4UBDD 1G9EA 4HF5H 4P9HL 1U8NA 3L6FA 3K8LA 1I1AD 2WK2A 3JVGA 4U1JA 2HJLA 3RDTD 4OZHF 3MLUH 5F7KC 1XF4B 4JFZH 2NY0B 2WMPA 2RHEA 3I6GB 2LV4A 1N7ML 4LCUB 3UZQA 4YHOL 2D0FA 1NUDA 3QIUD 1VFMA 3QUZD 4XNUH 1A6PA 2CLRA 2M1KA 2BDNL 3BPOB 1ADQA 4PJIB 4YXLH 3VD4A 1FL3A 4KV5E 5EWIL 4MAYB 4K2UH 3KR3L 1K8IA 2NZIA 4GG6A 1FH5L 1IGTB 1NLDL 2OJZH 4L9LC 3GMOB 1A9BB 2D7MA 2YA1A 4F7MB 1T1WB 4DGYL 1ZSDB 5C7XH 1PX3A 2WBJD 1P2CA 1LO2H 4G9FA 5E5MB 4YR6A 4OIBA 1TETL 4PUBH 3BSZL 4GW5B 4KKNA 1XF1A 3OJDB 3RVTC 5I76B 3ZE0E 5IMOB 4ZS6C 4JPWH 1TXKA 4HWUA 4GBXB 3VXRD 4NNYA 4YHYC 1UM4H 4ZPVA 1X6NA 3QUXD 3ARFB 1N4XL 3W9DB 1B3JA 3C6LA 3MLUL 4W4NA 5JW4R 3KPSA 2R1YB 3CH1B 2VZSA 4G8IA 1YY9D 3WXWH 3V6OE 2IGFH 3MLTA 4KGLA 2X89D 3WS3A 4OCLC 3G04A 1OTSD 3VXUE 2E7BA 3FO9B 4UI2A 4QRTA 1GHFH 4X4ME 5CGMA 4M1GH 1D5IL 1GGCH 5FHAH 3RUGE 3ARGA 5HI3D 2VTFA 4I8DA 4WHYH 3MRMB 4QGTA 4YHPB 4FQ1L 4NC1C 1HXYA 1A1OA 3M1BB 5I1CH 2VLKD 3D69B 2DQIH 4OZGF 4E0RA 1WFUA 1CL7L 2DIJA 4H0GA 1AGEB 5EU4B 1EJ6A 4UT6H 4ZSOE 1MLCB 2Z91A 3FQNB 5CEYB 4G6MH 1MCCA 3FQWB 3GHBL 2ILLA 4QT5A 4OV5A 2CKBA 4OFKA 4Z7NF 4V1DA 5DD5H 4OTXH 2Z0BA 5IK3A 1KLGB 4LVOC 4NRYA 2W59A 2Z31A 4MJ6B 1JHTB 3BP5B 4HIIA 4PLOB 5D7SL 3T2NL 3IETA 5HHOB 1K4DB 2DQGL 3GKZA 2HMID 2XY1A 3M17B 1QFWI 1OAZL 2E7HA 4YH6A 1P7HL 5GGVY 3WFHA 4MWFA 3GDBA 2VDLL 1HYSD 4D9QD 3EOTH 4BFBD 1QVOB 3MJGX 1MQKL 4U1LB 3MRNB 2IANE 3L5WB 3OKDB 1X5ZA 2DWEA 5JORA 1QLRA 1MIMH 3L1OH 5DMKA 3WDHA 1X7QA 2NY6B 1CZ8H 1QZ1A 3U6RA 1N7MH 1YA5A 1XIWB 4HIEA 1FE8L 4NQUA 5DS8B 2VXSH 5JPMB 1TQBC 4Z7WA 2XY2A 1CXHA 1ERNA 1UJTA 1G7QA 1NDGB 3BKCL 1XGRB 4CMMA 5MP6L 2MKWA 5T5NF 4PJXB 3JV5A 4PLKD 3DI3B 5DJ0B 4HPOH 2BFVH 1EGJL 1RD6A 2W91A 3JTSB 4O58L 2F8VA 5A43C 4PD4J 4YHKH 2P5WB 5HI5D 1RZ8A 5E8PB 3WNPA 1C08B 1U93A 2DLIA 1UKSA 5FM8A 4LCIH 1T21B 3LMJL 2HMIC 4NCC2 3EYFA 2BNUB 2BVQB 3P77B 4OZFG 4ISVB 3SE3A 5IBTH 2A6DA 1JRHI 2E7CA 3LEVL 4IHOB 5DRWB 5JXEA 1MVFA 5SWSA 2GK0B 4HUXA 3QUYC 5JTWA 4NQED 5J6GB 1VGKB 2ZG2A 5HYSG 2GITA 5FYKD 1CDIA 2X4RB 5BV7L 3CVHA 3MXWL 3R0MA 4LQFH 4N0UA 4ZUWB 4XC3H 4EQ3A 2QQNH 5DYOA 3ULVF 4X6CF 5I17A 3QZWB 2R56H 2BSTB 3DV6A 3NCYS 5B3JF 1CBVL 3FN0L 3Q0HA 2GUOB 4ONFH 4X7SL 3C08L 2P24A 4PJ9C 4J3XA 2BVOA 2CH8A 2PF6A 4KI1A 1DBKL 5C6TL 4ZO6A 2CJUL 1RV6X 3JTSA 1N4XH 3LN4A 4I2XE 5FDWA 5F3BB 1RZIB 2VUOA 3S8WA 1E4WL 3BPOC 3RU8H 4PJHA 4S1RL 3MLPA 3HLAB 3U7YL 4U1IB 1WGOA 3KAAA 4PJDF 4P23B 4Z7VE 2HG5A 2J2ZA 1C12A 4DUXA 4ZPTA 3E1F1 1AKJA 1NGPL 1HH9B 3HI5L 4LQFL 1X7QB 5EBMA 3CFJB 4RMTA 2F9BT 1R3HA 3KLSA 1NLBL 4LHUG 3OAZK 2Q7YB 4KVCH 3V0WL 2DLHA 4DVBB 1QRNE 3PHOA 3STLA 4NJAL 1XGYL 3FCTB 1BWMA 4MD5B 2UVEA 3HC4H 5C08A 3TBYB 2SEBA 3JWDC 3VH8G 4XXDB 3IDIA 3MRDA 1FJ1A 1OVZA 5JA8B 1VDGA 2G2RA 5BVPL 5FKAA 3TWCL 2Q6WA 3D0LB 2RQ8A 3JWOC 3ZKXB 3CMGA 4MJIE 5D4QA 3L5XH 1I1AC 1F6FB 3RGVD 1ZT7A 2GFBB 5ACMA 4MNGB 3GB7A 4KZEH 5BZWA 4KI5E 1ZANL 5KS9B 4DKDC 3K80A 4HGKC 3KLAB 3FB5B 3TJEL 4X6FA 1PDKA 4U1IA 1VEPA 5FIEA 3BXNB 3BDXA 4R97B 3SCMB 4NKQB 5T1MA 4OT1H 1J0IA 6FABL 4V1DD 1U8KA 3KYOA 5E2UH 3V4VH 4JO2L 4YBHA 1EEZA 4OCRH 4D0DA 3SDCB 3BN3B 1IAKB 2I5YH 1S9XB 2QKIB 1E27A 3OB0K 1MUJB 1J5OL 4D9LH 1OTTD 5EU3B 3STBA 1NC2B 3GSVB 1YYLH 3KPSB 2JKXA 5FKPB 5CIPH 2EYRA 1JWMA 4NRXA 5F3BA 5KJRH 2WIIB 1UG9A 5DUPH 5HD8C 2XN9A 4LCCB 1CG9B 3QJHA 5F89A 5KN5B 1QBML 5HGAB 3ARTA 1PG7X 2Y72A 3P0YL 4ODXB 4U6YA 2X4SB 3LVEA 4F2MA 3BRDA 1I1YB 4UT9H 2DRUA 4P2QE 1G7PA 4G9FB 2QR0B 5C07D 2JJSC 3Q3GB 5C0FB 2R0ZL 2J8UB 3TC9A 2CDFA 1HXMA 4IS6B 5L88L 5I16A 1B2WL 3VE0A 1FHGA 3TBSB 2CSPA 5H2BB 4QY8B 2L4OA 2VL5B 2YXFA 4EDXB 3ELAT 3HG1E 1J1PL 3QFJA 4XPFH 3QXVA 3V0VB 3EYUH 1FNGB 3PWNB 5BOPA 5D7JB 5EOCH 1ZEAL 4G80A 3ZSSA 5ESVB 5GRVK 3W39A 2X42A 3O2VL 3CDYA 2DKUA 1Z5LA 4P57B 4MAYC 1SY6H 3GRWA 4M7LH 1YEFL 4ONHB 3ALWA 3BZ4A 4QCIA 1AC6A 1BJMA 4KQ3H 1L0XA 4OGAC 1T03L 2EDNA 5GZOD 4XGZB 4XAKE 3LOWA 1KJVA 1GAFH 4OFYA 2WIMA 1FV1B 4OLYL 3OKOB 4OLUL 5JOEA 3NFPB 1JGEB 3N85L 3OMZA 2GY7B 2R4RL 4JZOB 2AJXL 3SO5A 2B1AH 4JJ5B 4ORGB 5I1GL 1S3KH 3O6LH 4MS8C 1FL6A 3K4AA 4DGVL 2VQ1B 2NY5C 5KBNC 1JNHA 3WFBH 4ZUTB 2VXUL 1F4YL 1XCQB 3VD5A 5DJDA 4YHNB 4DGYH 3IDYC 1DTUA 3CD4A 3K74B 1XIWA 3VW3L 3S4SA 5ID1A 1UACH 5KS9E 3S37H 4K7PX 4MNGA 1J1OH 5SX5H 3T3ME 4CW1A 4LSDA 2YPLE 1GAFL 5FGCE 4GH7B 1RUPH 1HIMH 1R5IB 1E6JH 3IXTB 4AIOA 4Z78B 1VSCA 5D7LB 3HNSL 1MQ8A 3CX5J 3B9KA 1BD2E 1NANI 2ICWJ 4I18C 5ETUA 4W70A 4ZDHB 5EU7E 5GGVL 2OMNA 1HH6A 4R4ND 5CEZL 5E2TL 1JPGA 3IDGA 3WKMH 4JDVB 4Z7WF 4UV4H 4FNLH 4GOSA 1CLOL 1FVDA 1HSBA 4XNZC 5CEYA 4DGVH 5DMKB 2DWEB 3K8KA 2AXHA 2ESVA 1NCAH 4K7PY 3H8NA 1AHWB 4N0RA 5D6DC 4JJ5A 4WHCA 4JPKH 5IQ7L 1JYWA 3QHZH 4OB5L 2R0KH 5FGBC 1K4DA 4JFXB 32C2B 4N0FA 4QF1B 5DMIL 1E6OH 5IMMB 1RURL 3OR6B 4MQ7B 4Q9QL 2APWA 3TT1L 1ZA6A 4PJIE 4U7SA 4P23A 4AEHH 3EFDL 5IVNA 4EN3B 4UTBL 2ZCLL 3AFLA 5E0QA 2XZQH 4KRNA 2IWGA 4W6WB 2Q7YA 4HXAH 3U1SH 2HYMA 2GJJA 4B5EA 1PAMA 3BP6A 3DARA 5I1JH 3P4NB 4IRSA 3N06B 2V2TA 5FV1L 4PG9A 4PJ5B 5C8JB 3NCEB 4XHJD 4PJEA 4RA0C 5ILTL 5T3XL 3VXUA 5LGKA 1MHPL 2IPTL 4BSWB 5DO2D 3FN0H 5GSVA 1F3JB 4YDLB 3D39B 3RWCB 3MO1A 2IGFL 4P5TD 2ICWA 2IQAB 4WTZG 1DQDL 1QTYT 2ORBH 5EPMB 5INCA 2P5EA 4Q6IA 1MJJB 4RGNE 3G5YA 4NCC1 5L8JB 4HZAA 3LB6C 2A6KA 2AKRB 2APTA 1UH2A 3EOAA 3PABB 4CN6A 1UADC 4X9HA 5MEND 3LIZL 4F2MB 4H88L 4MHHI 5C0RH 1OAYH 3B5GA 4IOFC 1ADQH 5DJAB 3TO2B 3HR6A 3LPWA 4GG6B 5A2KH 5D6DA 1QRND 1RJZA 2VLJE 4KROC 3N1QC 3K4DA 4QXWA 2P8MB 1DE4B 3OL2A 4X99B 3HUJE 1S7RA 3WV0A 5F9JB 4ZUSA 3D3VB 4PJFF 1NC2A 3GSVA 2QQKL 4G5ZH 2GJ6E 3QA3B 5A40E 1DBML 2NW2A 5DRZB 4AEEA 3PP4H 1ZANH 2Q76B 5ICZA 4DKEL 4K3JH 4WFFE 4GW1B 3O6FA 4Y16C 5LWYH 2P44B 4KROD 4Y4HC 3M17A 1J1XH 3D2UB 3X14A 1JF6A 5HHOE 4PRHA 3I6LD 2X4QA 4JKMA 2XZQL 4BQ6A 5HGHB 3WEXA 1X5HA 2HH0L 1I9EA 5J56B 4JHWH 3P0GB 3V6FB 1UH3A 1ZS8A 4UNUA 2CDEB 1NBVH 4KK6C 5IM7A 4P2OA 3KYMA 5D71H 1IM9B 1WK0A 5TE6H 4YNYB 3LQAL 1DBKH 1T6VN 4B50A 3NPSC 5IMLA 3C5ZA 1ULVA 3VXNA 4WUUB 5JNYB 2DOCA 1P69B 3UTZB 1A0QH 4AY0A 3O4LA 4HC1A 4KTDL 3DWTA 4JFDB 4OSUL 5I8EB 1KEGH 1XIWD 1QEWB 5DQ9A 4Z77B 4Z7QF 3VFNA 4FNLL 5KSUA 4WTWA 1AQKH 4MSWA 4HIJB 4LSSH 4U33A 2MCPL 1EX0A 5E8OA 5DD0H 5K9OA 5TQ2L 1HEZB 5T3ZH 4J4PC 1T83C 4OV5B 4BUGA 1UXSA 5BW7A 2AJYL 1NBQA 4QRUB 3SGKC 4Q6YA 3MLWH 4L1DA 3Q6FA 2A83B 2WW8A 1PKQA 3MNVB 1J0JA 1YC8A 2KQMA 3DHJA 5CIPB 4J7RA 3BAEH 3WFCH 1RIVL 1Q8MA 3GMQA 2R56L 4NZUL 5F89B 5KN5A 3KR3H 5FUCE 2IADA 4EBQL 5MENE 1DE4A 3IRZA 1Q9KA 4H25A 3S5LG 3RA7H 1P4BH 2F19L 4EIGB 3T65A 5I74C 1OAQH 1X6LA 3PDGA 5T1LA 5LQBL 1QRKA 3QHFH 4JRXE 4OLXH 5A2LH 1NGZB 2H2SC 5DHXB 3ARDC 3O3DB 3CNKA 3BWUC 3AS3A 3DMMB 4Q9RH 2DQFA 3QDGA 5E4EB 4KHTH 1G7MA 1FG9C 2DYPD 1ZGLP 1I8KB 5EO9A 3QQ4B 1QA9A 3EYSL 2XRAL 5ESVA 3DHMA 12E8H 2DTSA 2IAMD 2IMNA 1CTNA 4NO2A 3LDBB 2AEWA 1O0VA 2VDOL 3JV4B 4LFHD 4NQCA 3G6JB 3ES6B 3T0EB 3BKMH 4Y5YC 2IH3A 5C08E 3L3JA 2O5ZH 2YD5A 3GKWL 4UDTA 4J2XA 3IDXH 3D48R 2JJUA 4PV9B 3LEVH 3TBSA 1YNLH 1KCUL 3X3FL 3GBNL 4OCYL 1BHGA 5CJQH 4YZFE 1IRAY 3TBTA 5KG9B 4DAGH 1DANU 3VXQB 4XWGL 4JHWL 4H0IA 1MWAA 2FX9L 5BMFL 3TWCH 1OL0A 2VDLH 2GY5A 4P23D 3MFGB 5T33H 5KANI 1RFDL 2NX5E 5D1QC 5JLZB 5MEOA 4H1LB 1MIEL 1J8HE 5I1LA 4YHIA 2GSGA 4ZXBC 4EVNA 2VZVA 4JQVC 3DV4B 1CR9H 4LVHC 2PTTB 5DD5L 4TUKL 1I8KA 4JO1H 4UQ2A 5EO9B 1SVCP 4R4BB 3EJJX 3ZKMD 4M7ZB 5C6PB 5KOVC 4XPGH 2HT2C 3N9GH 3VD7A 4L5FL 3IFLH 4UBDC 3U48A 3U7YH 5EPMA 1GZQA 4LP4A 5GGUB 4MGXA 5I2IA 1HSBB 4ZPTB 1FIGH 4R7NA 4JPVL 4NO0B 1B9ZA 1NCNA 3LZFL 3BEWA 1HE7A 2ZWLT 3DX6B 2OP4L 4OF5A 1I3GH 4CMHC 5IFAL 1AY1L 5EZOL 5F7FA 1SJEA 4LKCB 3WEXB 1CT8B 5FGCB 3MRLA 2RCSL 4WJ5A 2JB6A 4ELMB 4D0BA 1PG7H 2OM5A 4NT6A 3JXAA 4BQ8A 2FD6L 4XBEH 4K23L 1N64H 3P0VH 2EO9A 4XRCA 2LAAA 4FQXB 3MXVH 4TUKH 2WV3A 4N5UA 5I19H 2QQNL 1YPZB 4MMXC 1TQCB 4G8EB 1Q1JH 1ZMYA 3FO0H 3OBAA 3B5TA 4HX1A 5FA4A 1Q38A 1OAUH 2WINA 3MMEA 1QR1A 1A6AA 1UM4L 4C83B 5HYJB 1S9WA 1EEUA 4Q2ZA 2Z8VC 3SE8L 1F3RB 5BS0D 3CXDH 3ULVD 2OBGA 2LFGA 3B2UC 3VXPB 5HGDA 4JFFD 4HV8B 2WBJA 4KAQH 4G9FD 4LAJH 2X5PA 3HNVH 4MB3A 5T1KD 5ANMA 3I6KA 2ORBL 3D39D 3MRBA 5DGQA 3HZVB 4R2GB 4BUHA 4Y19D 4YUEL 3GMRA 2UZIH 1KB9J 2I26N 3QIWB 2D31B 1J0HA 3WN5A 5LGHH 1GIGH 1SJEB 1AO7B 1ZE3C 2NTFA 2ZUXA 4E42B 3RU8L 5J9PA 2CKBH 2VITB 1MFDH 5K9QI 3QHFL 1BJ1H 4UZGA 3QULA 4JPWL 2XNAA 2Z92A 1P4IL 1C7TA 4WW2F 4JZJB 3TA3A 4OZHA 2Z8SA 1DBJL 2EDYA 1YY8A 1DJSA 3P9LA 2VSCA 1EEYA 4QRPD 3SCMD 1BP3B 4Z7VA 5DVOA 1DLFH 3IJYA 1INEL 2V9QA 3O9WD 5HYSB 5DMYA 3H9SB 1UM5L 2YD3A 1LDPH 1UWGH 4X99A 2WP3T 3M8OL 5D7SH 1U9KA 3BGMB 3KPPA 4LEXH 5I8EA 1MCSA 4NDMB 4OBSA 1HKLH 1EDQA 2JELH 4GMSL 4LSPH 4KDVA 2A9NL 5E9DD 5FOBB 4JRXB 1A7RH 1NCTA 1W0VA 3C5SA 3KPRD 3UTQB 2VXVL 1QD0A 2XWBB 1NMCB 3OAZH 1T7ZA 4MB5A 1S7VB 3DPBA 4M5YH 1C5BH 4JDVA 5INDA 4OD1L 4QOKD 2AJVL 4C58B 2CDEA 3ARFD 5L2KE 4JFOA 3LZFH 2VB5A 4HMCA 5BRZD 3K2UL 2HKFL 3AXLB 3MRGA 2ESVB 4IMKC 1LE9B 5A3ID 2OYPA 3O2DH 4Z7QE 3B9KB 3H3PH 4MMZC 1YPZF 2BVEA 1IJ9A 1JJUA 4XNXH 5B38A 3RI5F 1YECL 1A3LH 3MCG1 2BRQA 2DM2A 2XWTA 5D72H 3WSQL 2Z8RA 4G8GB 3H9SA 2N1KA 3F6IA 2ED9A 1T22A 4FXLA 4MXQC 1IEHA 4NJ9L 1CQYA 2HA1A 2Y07H 1MJ7L 3MJ8A 3VH8B 3O3DA 4KDTA 2AABL 2J8UE 4E42A 5J9PB 2ZOKA 3T08A 4Y2DD 1G1CA 5D6CA 4WEBH 5EU6B 1BFSA 3WL9A 1R3KA 4PRBA 4YHLL 3TM6A 1EHAA 2QADD 4RIRB 4PJBB 3KHQA 2BSRA 3O2DA 1JHLH 4PLJD 2EECA 4PJGB 1YMME 4JVWA 3UC0L 3KG5A 1EJOH 3O8XC 4ODUB 3H3KA 3F58H 2BRRL 4JRYB 1Y18B 5ALBH 2AK4B 4GW5A 3TIDB 3ZT5A 1CGVA 3X11B 2CDGA 1JZ7A 5F7LB 4UU9A 3PWLA 4GAYB 5C0DA 1I9JH 4HUKB 4OUUA 2FH8A 2YS4A 4HSQA 1GOFA 5ITFB 5DEGA 4H20H 4XCCL 1FAIH 4DK6A 4X7TB 3K0WA 4XNMB 1DR9A 2DM3A 4U0QB 4DW2H 4QRRE 4XVUD 2AJZA 3SDAD 3MODH 1QSED 1D7FA 1FNSL 4Y5XB 3FQXA 3BP7B 2D7QA 2DYPB 4D9RD 1L7IH 4JVUA 5C0CD 2V17H 1JGDA 2H8PA 5H35A 1QLEH 2ITDB 1FYTA 3GMLA 3I9GH 1A2YB 1D6VH 2Z9TA 2E6JA 4JPIB 3LKRA 3VXPA 2KDGA 1U8PA 1ACZA 2YR3A 1R24A 3H3PL 4GRWF 1DN0A 3NMEA 5FKPA 5ALBL 4NPYA 3QIBB 4Q6IC 4ZUWA 3UTQA 3NCYP 4GBXA 4X98B 5KSAD 3OJVC 2H32H 3WYRA 4KTYA 5C09B 3MGAA 3QJHB 1XF3A 4HKBA 4U4BA 4UU9B 4Y19A 4UNVA 5DRWA 2CO7B 4JFFB 1S3KL 3HPLA 1J10A 4RA3A 2EH7L 3HE7D 4MXWL 4FG6D 3ULVL 1WF5A 1WV7T 1BFVL 5EO1B 5T1KB 3ZDXE 1HHGB 4HD9A 4KGJA 3TYGH 4HT1H 2C3VB 3ARXA 3ALPA 4TVSa 3MREB 1G7JB 3OPZH 2UZXB 3FB5A 3U7WL 4PJHB 4YXHH 3QIWD 1NAMA 3QG6A 1IFHL 3AREB 1XR9B 3S4SB 5ID1B 4K3GA 2GQHA 2VAAA 1OT2A 2W0FB 4ZUUB 3SCMA 3GBMH 3P9MA 3VRIA 1FO0H 4JM4H 3RDTC 1N64L 2OXHA 3W0WD 4FQLH 4R2GC 2Y36H 4ZFFB 2CDFB 5MHSD 1RK0A 2EXWD 1BQHG 3NIFE 3BKCH 5J11C 5EULV 2IALA 3PDOA 4UMGA 4GKNB 1AGCB 2YHGA 3OKKA 3TN0D 4MD5A 4HBCL 4RWHA 1MIML 3CXHK 1HQRA 1JWUB 1OARH 4OZHB 1K6QH 4WW2C 2P5WD 3V95A 4YDVB 1EMTH 3RL1A 1IAOB 5EU6D 1ACYH 5F44A 5F7YC 4P3DA 3NOIA 4UB0H 3TO4C 5E70A 2PXYD 4LHQB 3TBTB 4MZ2A 2W60B 1CQKA 1F00I 2OS7A 5E7BA 5ISZD 2BCKA 4DZ8B 3MLXH 1OTUC 1J9CT 4LLYB 4X0KB 4JFEB 3QDGE 4GKOA 3CXDL 3MBEA 5IT2H 3BPNB 2NY2D 3F5WB 1OWRM 1CD9B 3Q5TA 2CKBL 2J12B 3ZE2E 1F58H 4ZNEA 3WLBA 3CFCL 3BP7A 4P59L 5FYJE 4E41D 3V2AR 4NWUL 4MJ2A 4QY8A 1P7QD 1U3HA 4GRMB 3WE6A 2FYYA 3F6LA 2NX5B 2PTVA 4G6FD 4ODSL 1T2XA 4JAMA 4RFOL 2FX7H 5EN2A 4QXUH 3B8SA 4OM0H 4KKLD 2DAVA 4H5SB 2E9JA 2NY3B 3V6OA 4PJ8C 3DX9B 4HW6A 3P30H 5F6IB 4FA8A 1WUNT 3DJ9A 4NM8H 1MCBA 3SKMA 2CK0L 5IR1B 1OD9A 7CGTA 1GRWA 3MLYH 1NCBL 3MRRA 3VWKD 1S7SA 2O5ZL 4EUPH 1MFEL 5C0JA 1U8QA 3TO4D 3UBXG 4J3SA 1YUHA 3PGDA 5C0IB 3BFOA 1RVFH 4Y88A 1DDHB 1RULL 2VZTA 3IDIB 3VGAC 2VDKL 1D5MB 1F4XL 3PDDA 2SEBB 2VWEE 3F7YA 3BZEB 1KBGH 2NY2C 3CSPA 2NY7L 4LHJB 3B5HA 2FGZA 2DQEL 1KXQE 1T2JA 3BN9C 3HZVA 4DFIA 4RGND 2BXZA 1F6LL 2XPGB 4M48H 3QUZA 1BEYH 5HYQB 2RAMA 1ITCA 5B38G 1UZ6F 5HJ3A 5C0AB 4OZIB 2VH5L 1XGQA 1SYVB 1AGFB 4PJAE 4X6FB 4C83A 4GAGL 1Q72H 5DURB 1IAOA 2O26U 4WTXA 3BPLB 4OJFH 4M7KH 4Y5VA 1JF5A 5I71C 4YWGL 1J7VR 2ZZUT 3S88H 5TFSH 4ZYKB 3T0WA 2C5DC 1DL7L 1CGTA 5LXGL 1WC7B 1WZLA 3BVNB 1B4JL 1CK0L 4N90E 1U2HA 4FFWC 1PYWB 3GJFB 1JI1A 3O9WC 4HBCH 5HTSA 4XP1H 3V0AC 4POZC 4O5LL 3D18A 2BOCB 3RZCD 5TQ2H 4NP4H 1VGEH 2R23B 4PGCB 1VFBB 3EO9H 3VFRA 1KJMB 1AP2B 4TPRL 5E9DE 1HKFA 3WJJC 3EGSB 5C07E 4O9HH 2BY2A 5I8KH 4PGBA 1X5KA 2DMKA 1UT9A 3FO2A 4FFWD 1DVFA 1I85A 1QYGL 4I0CC 4APQD 4AG4H 1KPVB 1FZOB 4KI5F 5A1AA 4HCRH 2EIDA 2YD1A 3FMGL 3NIDE 4LLWA 5T1DL 3RZCC 1DLHB 3SGJA 5T5NG 4JFOB 5L2KD 4OCXH 1NMBH 3VU2A 1JTTA 4YIQB 3ARFC 3G9AB 3DUUB 2XXMB 3NGBC 2LABA 5CGYD 4XC1H 3QIBA 4NQTA 5DSCA 2HFEB 3MC0A 2MQ0A 3S96B 2Y7QB 5D1XD 2XQBH 1JUFA 3B9KC 3U4EA 3B9AA 4MNGE 4ZYKA 1IEBB 2YK1H 3RDTB 1HHKA 2VXTH 3O6MH 2WQRA 2BHYA 3EBAA 4KXZI 3KPLA 2AI0L 4OLXL 3EW3B 4JZNB 5FUOH 1LO5B 3LV3B 4PJBF 1MI5D 4S10A 4U1HB 3PGDB 5EO0A 1IT9H 5C6TH 2AKRA 4PJDE 3S6CA 5IB1B 1BVZA 1QBBA 3EYOA 3FQUB 5BS0B 4G7VL 2OZ4L 2GITB 3RTQB 3C6SB 4DUWA 1ZXQA 4OFPA 4NKDB 4LLWB 4R90H 2BSSA 4IDJL 2IPKB 2PW1A 4KHTL 4HZLB 3W81A 5KSVA 4QOKE 1I7RB 2JB5L 4PPTA 2R0ZH 3SGDI 4J8RB 3HB3C 4PJDB 3JTTB 4X7EC 4DJMA 2VZUA 3HTLX 4JDZA 1G7MB 1C5CH 5IMMA 2O5XH 3E6FB 2BOCA 1T7WA 2VIRA 4JM2D 4DOHE 1UCBH 3TPUB 3GK8L 4ZNCD 4M6NH 3S35H 4NQDD 4MD4B 4O9HL 1A8JH 4HKJA 2QBWA 3RL2B 3PV7A 1AE6H 5IKCA 1BVLB 1QHPA 3T4YB 1MFCL 1AFVH 4QTIH 1ETZB 2F53A 2HKHL 2X10A 5I8CA 3ZDXF 4HJJL 3UC0H 4F15B 5J3HD 4EI5D 3PV6A 5I6XC 4KJWC 5IHUL 1U8LB 1HCFX 4Y1AA 2HAZA 1K9TA 3GB7B 4P46D 4P2OB 3FB8B 1MY7A 2H6PA 5IROA 2PNDA 4Z78A 4JKLA 3DGCR 3P4MA 3BGAA 3N50A 4MXVF 4GG6E 1RY7B 5DTFA 2FNBA 4F8TA 1WFTA 4WUUA 3VMPA 4LLUA 4XGZA 4MX7B 4GW4A 4XMKH 4GRWE 2V2XB 4TNWF 1H5BC 4CBPA 2OJEA 2VC2H 5FO8A 2P8PA 1WCBB 2KUTA 5D72L 4KKAC 1BMGA 4PJFA 1K3IA 1EA9C 2EE6A 1BECA 1YJDH 3C5ZD 4WENB 4NHUB 3QDMA 3UYRH 4ELKA 4V2CB 3S4SG 5B39B 4LEOA 4HG4K 1J18A 4YEEA 1A1OB 4YHZH 3WS6C 3K7UA 3QH3A 1IBGH 1UYWH 4KKAD 4Y89A 1OGAD 1DN0B 3UZVB 2JJWA 3D5OF 3GUTA 4KHXH 1ZHLB 3GSOB 3HFML 1P4LB 3RGVC 4NZRH 1R5WB 3MV7A 2LVEA 2LTQB 1MOEA 1JWSB 1DFBL 2ZUUA 4Z7NE 3EUUA 4LPXA 1XH3A 1CGXA 2W9DH 3L7EB 1Q9WA 3A6BL 5IQ9A 1NLBH 3O9WB 4NN5C 3IF1A 2H2SD 3QCVL 3CFEA 1U91B 4XC1L 1S5HA 1BVKA 4FQHB 4ZAKB 1FNLA 3WHXA 1JGLL 3RX5A 4PBXA 3C6LB 4PJEB 4Z0XB 5F9OL 3WFBL 2ZPKH 3C2AH 1U3HB 3WE6B 2J8UF 1M7IA 4X6DA 4XCEB 2AV1A 4WO4D 4G6FB 5E8DH 3IAQA 5GHWH 3QO1A 3WIIH 2VDKH 1C08A 1N0XL 1U93B 4KK9D 2PUQT 4XPBL 3VFMA 3MOAL 5ANME 1GC1C 2VZ3A 2A77L 1CLCA 3OX8A 1IAMA 4N1EA 4U6YB 2OK0H 1KCKA 2FJGB 1UXSB 2BCKB 4DZ8A 2ICCA 2OL3A 2AEQL 3RWIA 3MNZB 5HYIA 1A6TA 5TDNA 3CAFA 1NJ9B 1YDPA 4QRPE 3ARPA 1U8HA 1HXMB 1YPZE 1DQDH 4KK9C 2O5YL 5BZDA 1DDHA 4Y19E 3W2DH 3AS1A 4OI9A 2YN3A 4WI4A 4A2LA 4ORZC 1GJIA 4CVUA 2F5AL 4KI5D 2IPTH 1K5NA 4CU6A 2WQ8A 1HQRB 1JWUA 2OI9B 3L3DB 2D7PA 1XH3B 1JGLH 4BKLA 3RKDC 1H0DB 1JVKA 1DEDA 1WWBX 2V7HA 4HUVB 4LLDB 5EORH 2FWOA 1FSKB 5JXEC 1VFAA 2E27L 1S5HB 4FXGA 5CBEA 2GJ6B 5MHSE 2NXYC 5FGRA 4JFHD 3TVMB 1CT8A 1ED3B 2A6JB 4OTXL 4MJ6A 1NGWB 3FFCD 2Q1EA 3U4BL 2FB4L 4KRPC 1MI5B 4FZEL 3O4LB 4OUOA 4DN4L 3QIBD 4PRPE 3ZKMC 2QEJA 1JZ6A 2YXMA 1GGTA 4B7LA 1JGEA 1IAIH 2DJSA 4G43A 1MF2L 4P2RE 5FYKH 5DQ9B 1ZT4A 2E3VA 2VXUH 4UDUA 3VGAB 3MRQA 2A73A 4BZ1L 1B0WA 4G8FA 3E8UH 5I1JL 4R7NB 1FE8H 1RJLB 4LCCC 1T1YB 1MCIA 1H5BA 1U3HC 4JFXA 1OAKH 2N56A 3TBYA 4NKIL 4YHMH 4JFQB 3KDMA 1I3UA 2QSVA 3IKCA 2PW2A 4PR5B 3TCLA 3HG1B 3TH2T 3FQRA 4WW1B 2AJ3B 3LQMA 5AEAA 5DEFB 1BJ1J 1TQCC 5INDB 4FMKA 1T04A 4EI5A 2EEBA 1WAAE 2IF7A 3DBXA 3TT1H 3WS3B 5FYJL 2BERA 3MZTA 3D2UA 3DSFH 1X5AA 1WTLA 4NWTL 4U1HA 5LVEA 5IB3A 3BDBA 4XMPL 4LHUA 4J3TA 5E6ID 1DQLH 4CU7A 4WWKC 5TQ0H 4N9OB 4G6AC 2YN5A 3KPSD 3L3OA 3BPLC 4XX1E 4PJAB 3UTSB 3BGMA 3MRMA 1BFVH 5CEXA 3I75B 5SWQA 4KZDL 4QLRA 4WW2A 4BZ1H 5I73B 1BD2B 1CGSL 2J8OA 4K71B 3DRTA 3W5NA 5GHWL 1U92A 2P8LA 3CH1A 1G7JA 1CF8H 1KELL 1F3JA 4R0LB 4U05A 3LCYA 4DEPB 1IGFH 3KPSE 3ARRA 5I1HL 1RZ7H 1MCDA 1RUKH 4K23H 5CP3A 4AEHL 5JDSA 2GUOA 5SV3A 4LLVB 5BQ7B 3WFCL 3RWHA 1N59B 1Q0YH 4MA8H 1NGYB 4XNYH 5J12C 3PWUA 4O2CA 4P0DA 1R3KB 3EOAB 2P5EE 1Q1JL 3FO0L 1MRCL 3BIBX 1RUAL 2ZSVB 5F97E 3MLWL 1YYLL 4HIHA 1G9NL 3F7PC 4GSDL 1NFIB 4XBGB 3DIFA 4M6OH 3GSUB 3J8F7 2V17L 4K07A 1KB5L 3CSGA 4MS8D 5I1HH 5AZEH 1EHXA 3IDYB 1NCWH 2W65A 4LSQL 4QHLB 4JGJA 5JHLH 3P0YH 2XTJE 1CDUA 5IBUB 4Z0BH 3IF1B 4L3EE 2X4OB 3O0RH 4NFBA 3QUZC 2I07A 1C5DB 5D7LE 1NMBL 5ACLA 1G9NH 3EO1B 1EHLL 4WI8A 3PE9A 1U92B 2EDBA 4HS3A 4Y4HD 2MMXA 5DUBB 1K8DB 3K2MC 4NFCA 4G6KH 4Z95H 4CMMB 2E9WA 3JV6A 3B2UD 2HJFA 4ZS7L 2Z93A 3C6LC 3VGDA 5ID0A 1AGFA 4I5BA 3RX7A 2F53B 3WO4C 4RMWA 3EYUL 1ZLVH 1QRNB 5GS1A 1RZ8B 1I8LA 1RZKH 1M6OB 4HLZG 4OV6F 3QRGL 1GZQB 5F96H 1HNGA 5E4EC 4HWZB 3TJHD 3BQUD 1B4JH 4KZDH 4J8RA 2HVKB 4YZFF 1K2DA 4TRPL 5JQ6L 1OAXH 5AZ2H 1BF8A 2X4UB 2XQYG 2O61A 3QXWA 5T33L 3U46B 4MHHG 4EUPA 1KUMA 1EV2E 3ILQC 1H15A 4P4KB 3CXHJ 4GW4B 1FRGL 5C3LD 4JG0L 3ROLA 2RJMA 4GAGH 1VFAB 2XA8H 4FXGB 4QNPF 4OBRA 4PJCA 1ZVSB 2XV6B 3CUPB 1MCQA 4O4YL 5FA3B 3TNMB 4XCFL 4LSUL 4I3RL 2J3SA 3AU1B 2R1XA 1TNMA 3I2CH 1EGJH 3KYOB 4S1RH 4CW1B 3EYQD 1N5YH 4R96B 2NR6C 3IXAB 3IVKA 4CVXB 3OAUH 2NXYB 4QHKI 3MJ9L 1CICD 1HWHB 2ARJB 4HGMA 3KYMB 2ATKB 2XN9D 5MEQB 2Y9RT 3QUKA 4TQEH 3WLWD 4KVCL 1JPTL 3DIFB 2QADC 5C0AA 4BQ9A 3GI8L 1BPVA 4MA3B 3FFCB 3RWEB 2LVCA 3LKQA 3TBWB 4W6XB 1ZT7B 2GFBA 3IGAB 2XTJC 4ALAH 1QPPA 4JRYA 2XICA 4LVHB 1C5DA 1SQ2N 2D31A 1GXEA 4L8SA 4I0PD 4NUGL 1MCJA 3BOVA 5EO0B 2I5YL 3K8MA 4P48A 1BVKB 4FQHA 4UILH 2B4CL 3MFFB 1Q0XL 3D25A 5KAQF 2ZUQC 1AKJD 5TE7L 5I15L 3WNMA 4DAGL 2DICA 1IMHC 3UPAA 3DNKA 4QOKB 4GAFB 3DECA 3KPQA 3RDTA 2HT3C 1CL7H 5EIIA 3BEVB 3L3OB 5GS1C 1EVTC 5FB8B 3CFJA 1TJIL 5CZVL 3Q5OA 2ADFH 2Y5TA 1G6RL 3LV3A 4Z7VB 5F7UA 5EUOE 1E4XH 3DRTB 4F3FB 3JWOL 3L7EA 1HQ4A 2VABB 3SDAA 4D0CB 5C9KA 3GNML 1I9RH 4N5ED 4TVPE 5HGBB 4HUWB 4AZ8A 3QZWG 3V0VA 2AJ3A 1AGBA 1EFXD 1IC5H 4POUB 3FHAA 2AJUL 3FB6B 4P5TB 3HRZA 3EDFA 3WIHH 4OSUH 3AY4C 5J1TC 1YMMD 1S7UB 5FCUH 1E4XL 3R8QA 3QPQC 5EUOB 1DUYB 5C0DB 4H1LH 3CC5B 4JR9H 4K94C 4NRZB 3IXAA 3VCLB 2XZAL 5JQ6H 2YMXH 1CVRA 2VXSL 3KDMB 4M62H 4NN7C 5FECB 1KENL 2DD8H 2WUBH 1T04B 3T77A 4EI5B 5DTFB 4K7FB 1S7WB 4XXCC 5ERWA 4U0RC 1H8NA 2D9QB 4ZOAA 3X3GH 3MA9H 4ZDHA 2F58L 4LSVL 2KQNA 3AMKA 4XMLL 3SE3C 3OAYK 1I8IA 3TZVA 3WIFB 5AWNL 1PLGL 2HP4A 3F8UB 4RSVA 5L9DH 2EC8A 3IXTA 1RFDH 1I7UB 1S7SB 2PCPB 5GRYA 1MCFA 1AHWA 1JGVH 1UVQA 1FVCB 5EU5B 3MV01 2DYPA 3ZKNC 3H7BA 3BHBB 4N68A 1XGRA 2BMKA 1IVLA 2BVPB 1EHNA 4AG4L 1U8JA 2OCFD 1W72L 3QYCA 4NHCL 1DZBA 3GM8A 5F7MC 1OT1A 3DURB 5KZCD 2DKMA 3OXRB 5JW4N 5F88B 3S3PA 1NFDE 4TPRH 1PD6A 5B4MC 3AREC 4J1UA 4FFZH 2R2EB 3PWLB 2A1WH 2VDOH 5C0IA 3SKNA 5CD5D 1TJGH 4X0KA 1NMCC 4LVNB 2Q8AL 5GSRA 4XI5C 3IFPB 4DWHA 1IM3A 1ONQA 1T0PB 4YBLC 2Y5EA 4X5WA 1KPRB 4MCYA 4RIRA 1UA6L 3PWNA 5ENWA 5H8DA 1OSPH 3TBVA 2HG5B 2IBGA 1ZT1B 3P4OA 3WUWG 2C1OB 2MNUA 4F58L 2E8YA 1QFUL 4HFUL 4IMKA 1NANH 2BNRA 3D87B 3QXUA 5DJCA 1JWSA 5DEZA 5FYLE 2ITDA 5DXWA 1F11A 1AGCA 1I8LC 1BQLH 3WNKA 1NCBH 1A6ZA 5DQJB 2EDWA 2Y7QA 1IKFL 4PYGA 1AR1C 3MRKA 3VFVA 2HN7B 2EDRA 2BRRH 3TN0C 4I5BB 5IP4A 4W4OA 5ICXA 5HDBF 5IB2B 4UIMA 15C8L 1OQXA 2B1HL 4IRJA 3PWPB 2VL4A 1PZUB 2VWEC 1D5ZA 1IBGL 2WWKT 1DVFC 1ADQL 4FQIL 1P53A 4HGWB 5FAAA 4NQEA 3IFNL 1NEZG 1MJUH 2D03L 4WI6A 3QXTA 4X6BB 3V5KB 2Z4QB 3SO3B 3KPTA 2X4OA 4GBXC 1R5WA 4Y4KD 2W9EL 3GMRB 4OLZL 1P4BL 2F19H 5L88H 2JJVA 5ECJE 4HHAA 3C5ZB 3DYPA 5TE4L 4P2RA 1L9NA 4WHTA 2BNQD 3HR5A 3MLZL 3IDJB 1WVZA 3R4DA 1T5WB 1UH4A 1JZ3A 3MUGB 3HPJB 2EIZA 4JY4A 3HAEH 1S8DB 2Q86B 3T3MF 2F53E 1FH5H 4KJPC 3QG7H 1Z9SA 2OXGA 5D5ME 3LEYL 5E8DL 3MR9B 5HY9B 1VADA 1ZHKB 3P73B 4ZUVB 1RK0B 3QCUL 2YD4A 4XB7A 3TCXA 1IZKA 2H1PL 4RRPA 1NAKL 2PO6C 3D85D 1JZ2A 2GJ6D 3RP1A 2OLDA 4MJIB 1BZQK 4Z7WB 2FEDD 4KRPB 1NL0L 3ULVH 2DTML 4H8WC 3MNVA 3CDCA 2JIXD 2J1KA 2VAAB 3WMSA 5M94B 2B4CC 2ZSWB 1A3LL 4BZ2H 2ERJC 1T0NA 1A7RL 1MCEA 5E1HB 4MNQA 3U36B 3T0EA 2R0KL 4NZTH 4HMDA 1QFOA 1ZVSA 4RNRB 2ATPA 4AIZB 2ICWI 2RIKA 4U6XB 1T80A 5C0GA 4OD3H 3HAEA 3RZCA 3FRUA 4MX7A 1R5VA 1JGVL 3E6FA 1T0MA 3C5JB 1XGQB 2JJSA 5L8KB 4KZEL 3CSYA 3PABA 1QVOA 2QSCL 1YJDL 1J8HD 5HDBE 1DQTA 1KT2B 3MV8E 3VWJC 3BH9A 1J1PH 3VJ6A 1BZ7B 3GHEH 5F1NA 4FQPA 2AGJL 3BKYL 4GXVL 2ZPKL 3C2AL 2HVJA 2P7TA 3VG9C 5T1LD 1MREL 1KB5A 2X1PA 1NCCL 1K6QL 2VSDA 3AB0B 4G8GE 4C4KO 2Z4QA 4JB9L 3O3BB 3MRQB 5FGBA 2YPLA 3O41B 3MRRB 1FGNH 5I30H 1LD9B 5D7KD 1P7QA 1OPGL 3WFDH 5GGTH 4JM2F 1MPAH 4P2RB 4TOYH 3QDHA 3OF6A 4JM2C 4MA7H 4R26L 4PV8A 1A5FL 2CXKA 3JZ7A 1PG7L 1YC7A 5C8JA 1IARB 5JDJA 1M71A 1I7ZA 1MSPA 4S1QL 2F5AH 4XCFH 2KL6A 4KTDH 1OGTA 4U6TA 4HZLA 1DQMH 1S7RB 5F9JA 4APQC 1VADB 5JR1H 1FVEB 3BPCB 3W9DA 2CUHA 5DMGC 4FP8H 3UDWA 1HI6B 1CDBA 3O6FD 1NFDF 5DDHB 2OI9C 3K4ZA 3QNYA 5HHNB 4EI6B 1C5CL 1TVBB 2VABA 4LARH 1LEGA 1N8ZA 3EFDH 2C1OA 1U95A 3NN8B 5HGDB 2OTUB 4HJGA 3LQAC 5JIKA 5IEKB 2EDJA 4BZ2L 3F5WA 4W4OC 5FFLA 1PY4A 1YZZA 5HHMD 1MHPH 3I6KB 3FOMA 4MDIA 5L7XL 4OM0L 5I74B 4MQXC 1RZKL 3MNZA 5E95B 3QQ9C 1IGFL 5LWYL 2J5LC 3S34L 4M00A 4P9MH 4FQXC 5HXMA 1SJHA 3ZKSD 4Y2DA 1C1EL 2X2YA 1Z0NA 2GK0A 5CP3H 3S96A 5FF6A 4OGYH 3TPKA 1N6QH 3ULUC 5KSBF 3DVIA 2EZ0C 1J12A 1RZKC 2VDMH 3MOBH 4IMLA 5GISH 1SYVA 5IEHA 4Z0XA 4I4WB 2FHBA 4WWID 1ZA3A 1MHHB 3PGCB 4PBWD 2V2XA 4X7DC 1H3XA 2PYEA 3U6RB 1KCUH 2FB4H 1VESA 3QUML 4GG8B 5T1MB 4FZEH 3L3JB 2DQIL 4Y19B 5CSBA 3IFOA 4LSQH 4OF6A 3AU1A 4XP6H 5DRXB 3VD9A 3HZKA 1LDPL 3JUYA 1QHOA 4OCRL 1FJ1B 4A6YH 5B39G 4U2ZA 3FOMB 4EUPB 5DD1L 1X4YA 1UVQB 2R4SL 5I9QC 3VJ6B 3ARQA 3HC3L 5EU6E 4E0RB 2R29H 1TNNA 1A6WL 5C86A 2VDPH 3LHPH 2AEIT 4Y4HB 4WDIA 4S2SB 4JG0H 2DLEA 3GMPA 2XA8L 5JHDA 3HC0B 5IFJA 2NCMA 3GBML 3CIQA 4JFFE 2VLJA 1WT5A 3EO9L 4QHMB 5CJXC 1KLUB 1MWAH 1KJ3H 2YD8A 1SBSL 4KJQD 4BQBA 3V6ZB 4WU5A 2A38A 2DM4A 3H0TB 5JW4M 3P11H 4OGZA 5IB2A 1UB5A 4NO3A 4JN1H 5I1EL 4Z7UA 5F7WC 4U7MA 3TNNA 4PG9B 4F33B 2RGSA 5C0ND 4P2RD 3QEGH 4PJ9D 2X4TB 5CGTA 5E8EA 1D5BB 5T3XE 1MWAB 4XCNA 4DCQB 2WAHA 3S35X 4EOWL 5TDPA 4Z76B 1LO2L 4AM0B 4LBEB 2ESVE 2BVOB 3LN9A 4P3CH 2H6PB 4PTTA 5ESQA 5CEZE 5DJ6B 5ICYB 1U8MA 5FDYA 1RZFL 1NKRA 2R0LH 2AP2A 3TVMA 3EFFB 3GKWH 4JQXA 5EUKA 3ULSA 3LN4B 4UDTB 2NY2B 4PB0H 5I30L 1DLHA 1PZ5A 4HDIB 4X4XA 2G9HA 1F3DH 3V8OA 5CFHA 3RGVB 2K7PA 1GHFL 4D94A 3QBTB 1FNEA 4U6VH 3VGGA 1BJ8A 1L9MA 4OQTH 1IC5L 2AK1H 4G8EA 1LILA 5IW6A 3W0WA 2DQHL 3MCLH 5MI0B 1LQSR 3JVGC 2J6EA 1RHHA 4NN5B 3LS4L 1KBGL 1G1YA 3HE6C 4M6OL 3PG2A 2VLME 3P77A 2BJMH 4NQVB 4L9DA 1JN6B 1AQDA 1F90H 1KEML 3QDJD 1E27B 3T8XA 4X6BA 4XP5L 1VCAA 4RISH 3BVNA 3T0DA 1KN4H 3Q5YA 4ZTOL 5CLWA 3QXAA 2HT3D 1VPOH 2AXGB 2R2EA 4OFIA 1R3IL 1ZHLA 3V0WH 5BRZE 1PKQE 2OZ4H 5IWLA 4CJ0A 2RFXB 1PJ9A 2IPUK 3LQZA 1JF1B 4D0BB 3QP3A 1T1XA 5AUMA 5ICYA 4K8RD 2FEEL 2P8PB 3H6JA 4RMRA 1AGDA 1QFUH 4X4MA 5E99L 1EXUB 1MCRA 1TZGH 4IRZH 3KPRE 2VLRB 2CLZA 4K55A 4N90D 5MENA 1RZJH 3IT8D 1T4KA 1FAKT 1CIUA 1FZMB 1AHWC 4OZGE 4QRUA 1GOGA 4NN7B 5ISZB 3MROA 1BQHA 1UXWA 4GS7C 3P4MB 2WBWB 1U3HD 4UT6L 1S7WA 4N1HB 4UQ3A 1A14L 5IBUG 3BZFB 3OKMB 4XWOD 3RUGF 3VWJD 4NQVA 4WCYH 2JK5B 3HE7B 3MV7E 3MGOB 3QWRA 4XWGH 5GS2D 3U0TA 5J13B 5C07A 3Q1SH 2H3NA 4KKCD 1U8PB 2OZ4A 2Z35B 2BFVL 1DQJB 1LEKB 3BESR 1XCTA 5HVFB 1ZHNB 4KWUA 4XMKL 3PQYD 2ZCKL 5T1DH 4G6AD 4EI6A 2UWEB 4L3CA 1WBYA 1D6EB 2W9EH 3FRUB 2X1WL 4L3ED 4X4XB 5TGBB 3NFSL 1VB9A 3QG6B 3SE9L 4HKZB 2IG2L 4MJ5A 3BE1L 2ZKHL 2NTSP 3OG4B 1JPGB 2HRPL 1JPST 3Q2CA 4S1SL 1JNJA 1ZVYA 2AJZB 5F1KC 2FZ3A 1U8JB 4RMUA 2R29L 5TF1H 3IFOB 4JVPA 2F54D 3ALXA 4HWEH 4I1NB 3D39E 2BSSB 1MVUA 5E6IA 5CBEB 1J0ZA 2OSLA 3KS0H 35C8H 1A14H 1QSZA 5F7DA 2F58H 1TVDA 2IH3B 3TIDA 1KLFA 2Y06L 4HPYL 3VXSA 5F72S 4HFWA 5CINH 1J8HA 5A2JH 3JV6B 4N0YL 4JANB 1W8OA 3KNBA 1A7QH 2EC9T 4XVSH 3RX8A 4ONGL 3L9RA 2R8SL 1S9WB 2AABH 4JFZL 4LGSB 3MLSH 3ORJA 5FXCH 5JIHA 1EIBA 1RHHB 1A4JB 5TH2A 2DB8A 4NQSB 1AIFB 4L8SB 2XQBL 1FGVH 2DJUA 1I85C 5DJXA 4N8VG 4HWBL 3U4EB 3T0AA 2K3TA 1E4WH 4OF8A 4I3SH 2DQJL 4GKNA 2NLJB 4JFPA 2CRZA 5HYEA 3JV0A 1TMCB 3JTTA 1CGWA 5AAMA 4DEPC 3MNWB 3MV8B 4NOFA 2A0LC 4G80B 4OCSH 3TLRA 4ONFL 3OAYH 4NSKA 4Y16B 3BKJL 2YPKB 5D5MA 2ICWB 2IQAA 4PV8B 2FJHA 1H3TA 3Q1SL 3SKJL 4OZFA 5IHLB 5AYUH 1ZLSH 2UY7A 3FO9A 3THMH 4P99A 2G75B 2CRMA 2J88L 4U1LA 4X9FA 4X6DB 4LQ1A 2PXYB 5TDOB 4YFLI 1F97A 3VFSA 3HMXL 3ARUA 3P30L 1H3GA 3M45A 4JPVH 1FIEA 1KN4L 3UPCA 4P4KC 2NR6D 3FKUS 2H1PH 2B8OT 1B6DA 2IQ9L 3KGRA 4G6JL 2YUWA 4QWWC 2YPLB 1RU9H 4S0SD 4XMLH 5DEFA 4C56E 5DK0A 3QEUA 4NDMA 2HLFD 3QFDB 2J88H 3HG1A 3G5ZB 2VQUA 3SPVB 2IC2A 1NPUA 4HS8H 5JUEH 1F5WA 5E5MA 4M8VA 1J05B 3QNZB 4ZG1A 5MERB 1PEZA 3I85A 2JIXB 5C2BH 5ICZB 3LRHA 4JFYA 1WWWX 3E3QC 2YA0A 3ROOB 1MIEH 2EDHA 5GS0D 5AUMB 4TQEL 4BA8A 2X40A 3ZO0A 4PJ7F 5L9DL 4MAUL 2X4QB 4KKBC 4F9PC 1CK0H 5JW4Q 3MACL 3NZ8A 3FZUC 1MLBA 5I1DA 4HWBH 4Y5XA 2HJLB 3D1MC 4C59B 4PJEE 1CFNB 1OAYL 3VMOA 4QXTA 2HTKD 3C60D 3RPKA 5I75B 3CCHB 1H3WM 3CMOL 3L5IA 5EU5A 5I8KL 4GKZA 3D3VA 4HXBH 1KC5H 1W0WA 3P11L 4H8WH 5JO5B 3VFTA 1CN4A 3QCTH 4OD3L 1YEGL 4PJGF 5LGHL 1FFNB 2ZJSH 2LQRA 2M2DA 2IFGA 3JWNC 3P9MB 2FEEI 1DBBL 4JZJC 5SV4A 4P2CG 1NFIA 1HNFA 4XBGA 5FHBH 3DMMC 2XFXA 3VFWB 3CK0L 4NQXA 4NQSA 3UX9B 4RFEB 1T1YA 5I0DA 1CL7I 3JSSA 5KSAB 1NEZA 2WLYA 5D93C 3PXJA 3B6SB 4ZSOB 2EKSA 3RRQA 2A74A 4ODWB 5L2KB 5ILTH 1W0YT 2HKHH 2EXYD 5ANMB 4OZ4B 4PJ5D 5HHXL 1A3RH 2FL5A 3FQWA 4QT5B 2OL3B 4MA1C 2DQUH 3QQ3A 2YRLA 4NM4H 4XNQB 3SKMB 2DDQL 1ZOXA 1S7TA 4PG2C 3GO1L 5DDHA 2CDGB 4PTUA 1XR8B 1F6AB 4W68A 4PJ9A 4JY6B 3ZL4H 2H26B 3GM0A 3QULB 4YE4H 2DS4A 2H45A 4WV1B 1IAIL 3RKDD 1TZIB 3V8CA 2YSSA 4ODVH 3HE7C 1KIRA 5D1XC 1A4KB 2Z8WC 4WWKB 4EN3A 4JE4B 1X5JA 3O0RL 4PRID 1FGVL 1BF2A 1RI8A 3GI9L 1IGCL 1CYGA 4ZTOH 1FYHB 5JHDB 1LK2A 1MAKA 2C1PB 4Y7MA 3MYJB 2CKNA 5IB4A 2IALB 4D8PA 3KXFB 1OGAA 1WQVT 1GIGL 2ADGB 4D3CH 1IQWL 4WFFD 2EKSB 3U0TB 2EDLA 4FG6C 3MODL 4UQ2B 2IH1A 5T3ZE 5J1AA 2PO6B 4NO3B 4OCMC 4GG6F 4MXVE 1NDMA 5IM7B 4QRQA 4R26H 2AW2A 3GSNB 1SVZA 4MSWB 3NZHH 1GCFA 3D0VB 4M5ZL 1A7PH 1W0WB 1E6JL 2VLRA 5C0CE 5EORL 3ARVA 3L5XL 3SDXA 3DV4A 4PD4K 1ZWIB 1IL1B 4FP8L 4K3HA 3H2WA 4MCZB 1XF5B 3QRGH 3ULUF 3NA9H 2NZ9D 2EE9A 1GSMA 3UTSE 3RIAF 3MLYL 2PXYA 5TDOA 2VKXA 2BVPA 2P8LB 3RAJH 3RVVC 1JF1A 1AR2A 2ITCB 5AAWA 2DL2A 4GG8A 4F8QA 3WSQH 1RJYA 5D1QB 3G5XB 3BO8B 4EI5C 5F6HI 1XCTB 3V4PL 5BV7C 4JFDD 1SBSH 3LKPA 4PY7B 1KJ3L 2VN4A 2Z31C 4FN0A 3VXRB 5D1XA 4JB9H 3C09B 3UTTB 4GW1A 3UMTA 5B21A 4DOHB 4NC1E 1V05A 5TE6L 5I8CB 1LHZA 4HXAL 5IW1B 4P2QD 2VXQH 3CFDB 1PSKH 3WFHB 2R4SH 1FNSH 2VZ1A 3A67L 1NCWL 4NC2B 2PW2B 2UWEF 4PR5A 4QOKA 3RBGA 3TCLB 4NO5A 2AQ3A 3MRCB 2ZUTA 1NLDH 3BRGC 1Y0LA 1CD1B 2VISA 1HH9A 2F5BH 2VLMD 4NQCB 1R24B 4JDTL 4J6RH 4LPVA 4M3JA 1XGUB 3AM8C 3EFFA 4K7FA 4EKXA 1CWVA 3QIWA 5T5FL 1JFQL 2H26A 3RZWA 4MAYD 1CGUA 4IRSC 4R3SA 1U58A 3OHXA 2YUVA 3O6KH 3MRKB 4PV9A 3H9SD 1D3CA 1R0AL 2X09A 2AJSL 1KGCE 4JZJA 2YD9A 1IC7L 3QUMB 2EDFA 4YO0A 3BUYB 4NKMB 1EPFA 4TULH 5DFWH 3HMWH 4QRRD 5TH2B 1W8NA 3QISA 1A6WH 3ZYOA 2A9ML 3IS0X 5I75C 2J8UA 4IJ3B 3T2QA 4IRSD 3KPRB 1M4KA 1BIHA 5D2NA 3JWDL 1KEGL 4HIXH 5HYSA 4Y4FA 1KFAL 4GRLC 1G7IB 3VG0H 2NLJA 3LKRB 1FFQA 4OD2B 4P9ML 3UBXI 5EOTB 1T7YA 3BKML 1I9JL 1V3JA 4TUJB 4RQQB 1O5DT 1BIIA 1YMMA 5GPRA 3U9UB 3BT2H 3RY5A 4PIRF 4QXUL 2VE6B 4J1UB 4XC3L 5KSUB 5FV2A 3G6JE 4YBQD 1Q9LA 2X1QA 3T3PE 3GSXA 5D9SB 4OZIF 3BP5A 3PL6D 1NCUA 5MEPA 4XX1G 4HK0B 1L7IL 5AG8A 2KPNA 3FCTA 2YEZA 3KYKL 1CFTB 1S9XA 2EH8H 2BNQA 4ELKB 1U0QA 1T66C 1BQHB 1UXWB 3X17A 3UPRB 3FAWA 3UTTA 2VNCA 4XPHH 1P84J 1YEEL 4U3HA 1SY6L 1UCTA 4KRMB 2BOBB 4OLWH 4WJ5B 3EGSA 1A1MB 2GHWB 1T5XB 3W5MA 1CLZH 5SX4I 2A74B 5C1MB 4O58H 3V7MA 3S35L 4JKPH 2E9IA 5CJQL 1RMFL 3SPVA 1MHCA 2J6EH 3LKPB 4PY7A 4HJ0D 2GJ6A 1WICA 1OM3H 4U6XA 2YD2A 4NUGH 2V5TA 1MCOL 3HRPA 4GBXD 2B39A 4YBQC 3T4YA 5D70H 5ETUB 4G6ML 3I3DA 2J4WL 3HG1D 4NC0B 3UAJD 5FO7A 2PTUA 3FT4B 3DRQB 3NACH 4OFDA 1CFQA 5KSBA 3PV6B 2ICEB 2Y23A 4WI3A 4AENA 1EZVX 4XH2A 1T20A 3MV7D 2EDKA 5EZOH 2XKUA 4WEUD 2ADJA 2X4PB 1MF2H 3QEQE 2V2WB 4MVBC 4XHJC 2DQGH 4L3EB 2VR5A 4M43L 1RQ5A 5GRUH 5I1IH 5F9AC 1HSAA 3ZHLA 1YEGH 8FABA 3UPRA 4FQJH 4DGIL 1YEJH 3F65A 3QI9D 4QRPB 4I9WE 2W0LA 2YWZA 1X5XA 3AMLA 1RAMA 2V7NA 2DI7A 2NY1D 4I4WA 4ELMF 3UYPA 1MI5E 1ZLWK 4KPHH 3HI6L 1ORSB 5E8PA 3ZE2F 4CDHA 4F58H 3MRBB 3MPCA 3IU4L 4XVUC 4K7PH 4I3GA 2NQCA 3EYQC 3VMNA 4Y2DB 1LE5B 4WGWB 1JHKH 1NGQL 2DDQH 2VITA 3OWEA 4NQEB 1HQ4B 5E6IC 1HI6A 4R8WH 4X8JB 4LRIC 4S1DD 3UJIL 3VI4F 4PRPA 2GK2A 1F6AA 3GUTB 4N8VA 3HMXA 4NBYB 5TF0A 5GZND 1QUNA 2CMRL 1BZ7A 1GPOH 3BKJH 4PGEB 4P4KD 3TA3C 5JZ7D 4R4FL 4LSVH 3T4AA 4RX4D 2H8PB 4FQXA 3RWFB 5JW5A 4MWFB 4OIIH 3MXWH 4M6NL 1ZT1A 4HDIA 5AZEL 1F2XK 1NGYA 4HG4J 1ITBB 3AY4A 2DQJH 4M48L 3OR7A 3BQUC 4LSRH 4G8FB 1A7PL 3LN5B 3LY6A 1K4CA 5B8CC 2V5MA 3N1GC 4NRXB 1L4IA 2WUCL 1KCRH 5EIVA 4ZS6D 3M8OH 3BGFC 4Y5XC 5F9WB 3BHBA 5JQHC 2ICEA 1OP5K 2B1HH 3BP4A 5FYKU 2AERT 4GS7B 5BJTA 2WANA 4F7MA 1INQA 4CAGA 3X3GL 1N5AB 5JUEL 1R5IA 1RIHL 1X5IA 5CCKL 2V6HA 5GS0L 1BX2A 4I0PA 4HPOL 1JHLL 3ZTJG 5ADPL 3X12A 4TNVK 1HYRC 3H0TA 3SDCD 5DRZA 1P5VA 3B43A 1ED3A 3HA0A 1LO4L 4KK6D 5B8CB 1QSVA 3HAEB 5B3NA 2JCCB 5I2IB 5DUBA 2XZAH 5IJVA 32C2A 2A77H 4N0FB 5C08B 3REWA 1HH6B 4G3YH 4L8BA 1T89C 2E27H 3AC0A 1FLRH 5LCVH 4MNQD 1UA6H 1WITA 5CIPA 2PYFA 1EO8H 3OKLA 3FQRB 4WW1A 2HRPH 5J3HC 4AIXA 3AXLA 3MRGB 1YECH 4CVWA 1X5LA 2XTJD 2WLZA 2ENYA 1IE5A 3ISWA 1IM9A 3BMVA 4KMTH 4EXPX 1UYWL 3O11B 4BFIB 5C0GB 4M1DH 1JGUL 1N3NA 5JOPE 3WIFA 4MZ3A 4KJQC 4UOW0 2HVKA 5IESH 4ZO7A 4DTGH 2A1WL 5TPWL 1QG3A 4NZRL 4F9PA 4LDLB 5ADPH 5FOBA 5HD8D 4DN3L 4ZD3H 2VOTA 4HWEL 1CZ8L 1KTRL 5EZIL 5GS1B 5CJBA 1B0GB 3RNQA 4WI5A 3GMMA 3QEHA 2CRYA 5BO1L 5CWSB 5D7JD 3DYOA 3GSXB 4FQIH 5EB9A 2VLKA 4P46A 5LCVL 3S36X 3WIHA 5FF6B 3T0VA 2B2XL 2FIKB 2P8MA 4R8WL 5DT1L 2ZUYA 2AEPL 4PS4H 3OF6D 3EYVA 3SDYH 3BGFB 3KPPB 1P7QB 3RWJA 4I13B 2X4RA 1P9MC 4ZODA 3GIVA 2YMXL 1S7QA 3HI1A 4QRSB 1XF2A 2G9HB 1AJ7H 5FYJU 1U2CA 3HR5B 2XNAB 1EK3A 2Z92B 2R9HD 3DX7A 5CS7A 5HDLA 4EXKA 3HI6H 4I0KA 1QFWL 4M61B 1I1YA 2BC4A 3CVIL 4L8DB 3WN5C 1A2YA 5JDSB 1N5AA 1X44A 3RY6C 1MCLA 3ARED 3P9LB 5E56A 1GZPA 4PS4L 5ITFA 3DXAA 4RGOL 3Q3GA 2EDEA 2FCBA 4YXLL 1Y6NR 4JKWA 1F90L 5DZLA 5F1OB 4G9DB 2VYRE 1DBAL 2YA2A 5IVXF 1SJHB 1G9MH 1JPFB 4NZJA 5FUOL 2VL5A 4F37F 5IJKC 1WSST 1EFXB 4TVPH 4XP4L 1A6TB 4Y5YA 3L3GB 4P9HH 3QUXB 3THML 3WFZA 2IAMA 2QSQA 4EN3C 4PY8I 4M7ZC 1F4XH 1EFQA 1RSFA 4JFPB 4NZDA 4QHMA 3V6OC 3VWKB 3WUWA 4XPBH 2C7UB 2V9RA 3EDEA 4JKKA 3GMNA 4R9HA 1T21A 1QQDA 5C09E 4YPGA 1MJJA 2HFGH 2R2BB 3MJ8B 4LRNH 3JBG7 5D8JL 4PRPD 2LAGB 4Z7UE 5EU6A 2BP3A 2P4AB 1FVDB 4OLVL 3U46A 2XT1B 1ND0A 2D7TL 1XCQA 1QFHA 3CVHH 1IGIH 2FYYB 5JHDE 4PTTB 5DJZB 1IEAA 2JLLA 3VWKC 3RVWC 5BVJA 3WS6A 3GMMB 3QEHB 4FABL 4XP9H 4MNQB 1F02I 3KJ6L 3U36A 4CUCA 5K59F 3AGVA 2ZUQB 3U79A 1WWAX 1KNOA 1MFCH 4NCDA 3O6LL 1QACA 2B1AL 4FOMA 1X5FA 5IMLB 2HRLA 3RGHA 5IFJB 2EC9U 5GGRB 1P6FA 3VCLA 2KBGA 1FL5A 5EBWB 3O3BA 2OTPA 2QTEA 4JQIH 5IHZB 3VXTB 2X4UA 1A7NL 2Q7NA 3QUMH 4ZO8A 4L9LA 4NWTH 4PJHF 3OZ9H 4OCXL 5TGBA 4LIQL 1AI1L 1ZLUK 2ZCHL 4PLNC 3R06B 3RIFK 5HHOD 4D2NA 1NBVL 4MJ4A 1L6ZA 2I25N 1I1FA 4YGAB 4LPUA 3QDJB 4Y8DC 1F3DJ 3V6FA 1YMMB 3PGCA 3QAZC 2ADJB 2XIDA 4JO1L 2VC2L 3FQNA 4Y4KA 2I07B 1YYMH 3TO4A 3REWB 5FECA 1YN6A 4M4PA 1MJ7H 3QIUC 2X70B 1KXTB 4YNYA 5I6XB 1FBIL 3QIWC 3E8UL 4N8VB 1A0QL 3O4OB 4HJ0C 3HCVB 4XP4H 4BSVB 4UV4L 1SMOA 5TPWH 5T5FH 1KJ2A 1I3VA 3DYMA 5IJKA 5DRXA 3E2HC 3MQIA 4HUWA 3GSUA 3HN3A 3FOLA 4XNMA 2W0FA 4ZUUA 4JREC 3ARBB 2ZNXA 3OJ2C 4K7PL 3VFGL 4YE4L 3TIEB 3NH7L 2JF1A 4K3DH 5D2NE 1OGTB 3TZVC 1Q72L 4UUJB 5IVZA 3PUCA 3VFMB 2D9CA 4XPAH 5K59E 5KJRL 1JTPA 4NKIH 2C4FU 4X80L 4JO3H 3UXFA 4NNYB 4JDTH 4R97C 3SCMC 2DMBA 1EFXA 5GIRA 1KN2H 2CK0H 3B9EA 2Y06H 2E5EA 3QFJB 1RJZB 3NH7H 1CD8A 1IGML 3HB3D 4Z7UF 4NKOB 1MAMH 2ICES 3BRFA 1NFDB 3QEGL 1JMXA 3SQOL 1TFHA 1G9MC 3PQYB 2HLFC 3EYVB 5DFTA 3QXDB 2P43B 4PRAA 4L8CB 4R6UA 5FM5O 3EZJB 1FDLH 3KHOA 2V5YA 4GKZB 4OGXH 5L6YL 2NNAA 1IM9D 5EBLB 1YJDC 1RUAH 3RA7L 4LCYB 4A6YL 3DROA 1T7VA 4MQSB 3ARDA 2GT9B 1UKTA 4WO4A 1OAQL 4NM8L 4TSBL 43C9B 5FKAB 2WIIA 1KB5H 4YFLF 4KTEL 4M1CD 2DQHH 3FT2A 3MCLL 3AREA 5IF0A 4XAKD 5GS0H 3TJHC 1KPUB 4ZQKB 3V52L 4KU1A 3VXSB 3GMPB 1IFHH 4Y4KB 4YO0B 4Q9QH 3CFKA 3PHSA 1G7PB 4CVXA 4Q97A 3RVUC 4NQCE 1S7TB 4KUZL 4L3CB 2A2QT 4L4TD 3IETB 3OSKA 4L4VB 3H7LA 5KANG 3ROOA 3VW3H 4UTAH 3SGKA 1UB5B 4PJ7A 4PGBB 5LG1A 5GGTA 4L8BB 5CJOH 5IFHH 1UWEL 3HE6A 2R39A 5FO8B 3AVEA 5KVMC 2JK5A 3HE7A 4FABH 3CDGA 4XH2B 2R4RH 3N85H 5HDQH 3I3BA 3B3IB 2APBA 1S9YB 1VKXB 4L3EA 4YXHL 5CD3A 1A6UH 3HKFA 1A22B 2GT9A 1MCKA 1CFBA 3G6AA 4H8WL 4WO4B 4XMPH 1VFBA 3T77B 1HWGB 4MJIA 3RWDB 3SDAB 4NZTL 1MRCH 1OLZA 5MENB 1XGPB 3OKNB 1DFBH 5C0EB 1A02N 3DV6B 1VA9A 2Q3ZA 4JO4L 4F9LC 1MNUH 5DR5H 3QJFB 5F96L 1NCAL 3ECBA 1CFVH 2LU3A 5CP7A 3W9EB 3HC3H 4AMKL 1A1MA 2QSCH 5CEZD 3CZJA 5F9OH 3RJQB 4O02H 5EZJA 2X41A 4OFVA 5CJOL 2NY1B 1AGEA 5EU4A 5FUCC 3QR2A 4M7JH 3OX8B 3EO1A 3RJDA 2VERN 5H2BA 1RURH 3CC5A 3T2NH 3ZYIA 3RWHB 4WUKH 4U1GB 3A6BH 4OZIA 3UBXA 4HS6B 5BVPH 5IIEB 1YNTA 2BHZA 3UJIH 2ZNWA 5LKNA 3LS5H 1IGJB 3MLRL 3N1PC 4HIHB 2NY3C 3NPZB 1KIPB 2IPKA 1YEHL 3HRZB 3IDMA 4JZNA 4GO6B 3DMMD 4LHUD 2P5ED 1KTLB 5DJCB 5DJXB 2IPUG 2NY5L 3DO3A 5INCB 4HULB 1GZPB 5CHNB 4ETQA 4XPFL 5E2JA 2AXJA 5JOFA 1XGTB 3IFNH 3WHXB 1NCDH 4J4PD 2JCCE 3WJLA 2EYSB 2X7LB 2EDQA 3B2VL 1D5IH 1J8HB 4Q0XH 4N0UB 2V7NB 5B38B 1PG7W 1CG9A 1FRGH 5FA3A 1WZ1L 2C3XA 4UIKH 3B3IA 3G6JA 1EAJA 5F88A 4YR6B 3O41A 2EXYC 4PJFB 4FQQB 2R69L 3GSRA 3WN5B 4JRYE 1T6WA 3WCYA 4LVOB 1A6VL 2H32B 4LCWE 2JIXA 1U6AL 2XRAH 4LEOB 1I75A 3S34H 2I9TB 2Y25A 1P7KB 2IMMA 3NTCH 3BZFA 3OKMA 5DLMH 4D9QE 2V5SA 2MFNA 2WBJB 1EO8L 1JPSH 4IOIB 3D0LA 3SO3C 4ZS7H 3F12A 1JNLL 3TVMD 1ZV5A 3WD5H 4GRWH 5DS8A 2NY6C 3Q6GL 4DQOL 3DGGB 1CLZL 1A6VH 1D5XB 5CINL 1LEIB 1JZ5A 1FN4A 4DZBB 4HFWB 3S36H 4ELME 1LO4H 4S0TD 1UM5H 1I1RA 3VI3E 5GGQL 3UYRL 2AEQH 4Q74A 1J11A 1MHEA 3O3EA 3RL2A 2I24N 3NIGE 2JB5H 4K9EC 4GT7A 1RK1B 4CNIA 1HK6A 3NFNB 4BFGA 4FQCH 1EAPB 3C60A 4ODBD 1GL4B 5K9KB 4R0LC 2PYEB 4HAGA 4QHUA 2JTDA 5GXBB 5H94A 2VXVH 4L8CA 5F1SA 2OTWA 43CAA 3WJLC 4X6DE 2FJFA 3DUSA 2IAMB 4PJ5E 5GRZA 3B8YA 4HUVA 1NBYA 2DBLH 3TN0A 3QIBC 3N1MC 1I7TB 5CSZA 2K7QA 3F7VB 3SDXB 4CJ1A 4LPYA 1R3HB 1JFQH 1O7VA 2W9DL 2FLBT 4A2MA 2Z31D 4R3SB 1OWWA 2VR9A 1DVFD 1AJ7L 4P57A 3FQUA 2ERJB 3IDJA 2B0SL 5D2NC 4O2FB 2X9YA 3GJEA 4XXDA 3T1WA 4GLRH 2F8OA 2OJZL 3MBED 5TF1L 4OQ1A 1DUYA 3A67H 4M02A 2DQUL 3WIIL 2EDOA 5E00A 2DQTL 1OCWH 4G7YH 3GSRB 5DZNA 1HZHL 3WDIA 3ARDB 3I6GA 4H1LA 2ZG1A 3K3QA 2ZJSL 4P3CL 5HYJE 1T3FA 4PJIF 5F7NC 1KJ2B 2VZOA 3UO1H 1LGVA 4X5LA 4IDLA 3VFTB 4EDXA 1HINL 1V3LA 4KDWA 4NYLB 3CK0H 2B5IB 1SJVA 4Z5RA 3OG6B 5L8LB 5ICXB 3WNLA 4QGYA 4LPTA 1QPXA 3SKJH 4OAWB 5KTEH 1Z6JT 3MCKB 4RWYH 1JNNH 1KXVC 3RWIB 5A16A 4ZUSB 3MGTB 1XZ0A 2DF3A 3G6JF 4HIJA 2FBJL 5ESAA 1SHMA 1MRFL 4HKXB 1MFAL 4JR9L 1KIPA 2A6DB 4PP1D 3QO0A 2VDRH 4HC1L 1NCDL 2VJXA 3UTSA 1EHLH 3RHWK 1INEH 4X7TA 4RDQG 3IU3B 5GRXG 3MNWA 4QHNB 4IJ3C 5LQBH 4PTUB 3S7GA 5EZLB 1ZT4B 3RKPA 4R4NC 1JCKA 5JORB 2P42B 3MV9E 4ZFFA 4KKCC 4IBLT 1I1AB 1U8IA 1WAAA 3VXSD 2VLRD 3GJFK 3LRSB 4MNQE 3I3EA 1KB5B 1BAFH 1FYTE 1Q9KB 3H9YA 3PWUB 4O2CB 4PB9L 5KS9F 4KMTL 4NQDA 5LGJB 5CCKH 4I3RH 2DQDL 4PJXA 1QSFB 4HPYH 4L4TB 5D1XB 1OP5H 1YNKH 3NFNA 3BN9D 3ECBB 1KT2A 4QRRB 5H37G 4I0PB 5DMIH 4N9GA 4LF3A 3LEXA 3NA4A 3DTXB 4BH8A 2FLRT 3SDXF 2MTPA 4X4YB 1O7SA 4R0LA 1U8KB 3CVHL 3KJ4C 5E8EB 2CQVA 5FM4A 4I77H 4P5MB 5JXED 1J86A 5B8CA 5JIIA 3OQ3B 4P5KB 4L29A 3PL6C 1AXIB 1A7OL 4G8GD 2MHAA 2AXGA 3BEWB 3FMGH 2C3VA 3WO3B 5F8QC 3LN5A 1BFTA 3O45B 2C3GA 2V5RA 4NPYB 1XGPA 4HUNB 5GRJL 4JY6A 1MNUL 5DR5L 3K2UH 3NAAL 3C8KA 3FHQA 4KMLB 5C9JA 2B0SH 1QSEB 1AO7E 4FTVA 3GI8H 1Z0MA 2OR7A 3CU1A 1S9KC 3ZDZF 1CXFA 1ACYL 5E94B 5C0CB 3G08B 2AV1B 2YZ8A 3SJVE 5E24E 1RUPL 4JLRA 4YXKH 5F71A 1TDQA 4U31A 2RB8A 4AYFA 5IV2B 3VRLE 4Y4FB 4M43H 5GRUL 5I1IL 3LB6D 2R0LL 4OI7A 4FFZL 4S1QH 4PUBL 3MYJA 5F9DC 3KVQA 1MWAL 3HFMH 3TEUA 5DC0A 1FNGA 3CVIH 1GYAA 5TDPB 5EZLA 3ARYA 3MRPB 4TULL 1F2QA 5KTEL 1N59A 5DA4A 3CPLB 5DC4B 2OSLB 4B0MM 5C6WH 4XPTL 2BY0A 4TN9A 5GJTL 3T0EE 2NYYD 3LKSA 2I60L 1AXSA 5CILH 2X1OA 4HGWA 4OZ4A 4FFYH 5I18L 1G7IA 4U7KA 2ADIA 1Y0LB 4Y2OA 4KJWD 2OMBA 1JRHL 1D6VL 4WW2B 1RZFH 3KS0J 3VFPB 1WBXA 3NCJL 3C6SA 3DROB 3EAKA 1UWXH 1OSZA 3MJ9H 2R1WB 1RHFA 3QEQA 1I1CA 2E6QA 3G08A 2UZIL 4LCWD 4M1GL 2XN9B 2ZG3A 4F7TB 4DKFH 2Y5TB 4H26A 3OR6A 1YNLL 5L2JA 3B83A 3KYKH 4LNRA 1FZOA 2Y4SA 1QKZH 5CHNA 2O5YH 2I9LA 1FNFA 4BJLA 4Y8AA 3RWJB 5FCSH 5T1LB 3ESUF 1DN2A 4Q2ZB 5E5RB 5IJVB 4XXCA 2CUMA 2WM0A 2LU4A 1GGUA 5IBTL 2ITCA 2W1NA 5IFHL 3PF2A 1FC2D 2VLKB 4HS6A 1GGIL 2F54E 3MA9L 4ZTPL 3BISA 3SDCA 1OP9A 3PDOB 4OLYH 3OB0H 4Y4FC 3D6GA 2YD6A 1UCBL 4Z76A 5FYLH 5T1KA 1OF2B 3D18B 5D7IF 1HHHB 2VKWA 1S9YA 1VKXA 1JK8B 1KV3A 3AUVA 4BH7B 4GUPA 1BFOB 3L7FA 4BYHA 2C4FT 2FO4A 5B22A 8FABB 2E7LC 3NZHL 5EC2A 3V4UH 3I02A 1IEAB 4RMVA 1TJHL 4O5LH 4LCCA 1FN4B 4DZBA 5CZKA 1ZA6B 4F7CB 1ZWIA 1MELA 4W6YB 1D5MA 1MJ8H 4FS0A 3PJSB 4ZUTA 1J1XL 1C16A 1WJ3A 1I7UA 4WVRA 3VXTA 1X5GA 1NGXA 3SGEI 4M7KL 7FABH 3D85A 1PQZA 3G5VB 4U49A 1N6QL 2W0KA 1OAZH 4YAQA 3MRIB 5TQ0L 1IQDB 3W82A 5BW7C 1TPXB 5GS3A 5D70L 4M1DL 4BSJA 1FGNL 4X6CE 3ULVE 3ZE1F 4H5SA 1YDPB 1W2KT 1WISA 3UJJL 5ID0B 2J8HA 5ALCH 3MCKA 1OP3H 5HSFA 1L7TH 3GHBH 4OLEA 1NSNL 1BVLA 2VN7A 1JPSL 1LVEA 2RR3A 1TJHH 1RJCA 4GUPB 2VUYA 1JPTH 5C0RL 5TE7H 3IJSB