3LEYH

2f5 epitope scaffold elicited anti-hiv-1 monoclonal antibody 6a7 in complex with hiv-1 gp41
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
217
Chain Sequence
DVQLQESGPGLVKPSQSLSLTCTVTGYLITTDYAWNWIRQFPGNKLEWMGYISYSGFTSYNPSLKSQISITRDTSKNQFFLQLNSVTTEDTATYYCAFGNYLPAYWGQGTLVTVSAAKTTAPSVYPLAPVCGGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 6a7 Antibody Heavy Chain
publication title Elicitation of structure-specific antibodies by epitope scaffolds.
pubmed doi rcsb
total genus 40
structure length 217
sequence length 220
ec nomenclature
pdb deposition date 2010-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3leyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3leyH01
3W2DH 1LILA 4PRPB 1QHPA 1XZ0B 1BQUA 4UT6H 1AO7B 5GGTL 4MMZC 3TWCL 3QEUB 1DQQB 4U6YB 3NPSC 1S9VA 4HWEL 3SJVE 1XR9B 4DN4L 3O6KL 4P49A 4MJ2A 5E8NA 4GAGH 5ALCL 4X0KA 3VXUA 4NKQB 4PJEA 5ICZA 4ODVH 1J86A 2MPAL 1YPZB 1RUML 3T2PA 4RGNE 4Z78A 2W0KA 4PGZA 3UYPA 1S78C 2YOCA 4YLQT 4M7LH 2CKBB 3O2DL 5FAAA 3JUYA 5TF1L 2XY2A 5DUPH 5ERWB 5C8JA 3FQNA 1I8IA 1N3NA 4LLVB 2VWEC 3ZT5A 5EIVA 1VEOA 4MD4A 4LEXH 1TZHA 4RWYL 3MOQA 4H25A 4U31A 2YD1A 2PF6A 1NLDL 1CXFA 2VIRB 1A3RL 2RFXA 2ICWA 3QJHA 4DKFL 4OGZA 2FIRT 4Y19A 1OTTD 3KPOA 1CWVA 3LCYA 2FJFA 1T6WA 3RKDC 4YIQB 4LCWA 3G5XA 4HBCH 3PV6A 5DMIH 3CH8A 3LKQB 4P4KD 5IROC 4PJFA 3VGGA 1M7XA 2A74B 3P9MA 2QHLA 1T1ZA 3DUHA 1PKQB 5E0QA 3VA6A 5E9DE 2Z4QA 4HUVB 1BX2A 4HKXB 5T5FH 2OSLB 5GJTL 3V79C 5F1NB 1HHGB 1XF1A 2DDQH 2R39A 3FO9A 1CD1B 3SDCA 4KMQA 4HIXH 3RGVA 3ZKXC 3CSYB 4WEUD 3AY4A 4NT6A 4XAWH 2FX9H 3MV7D 5HGHB 1CFTB 4JO3H 2Y1VA 4OM0L 2DKMA 3AS3A 4KJPD 2FLBT 1CGXA 2ICES 1UEYA 2VR9A 3EGSB 1F58H 3FFDA 2G9HA 1GOGA 1I9RL 1N0XH 2Y36L 1UZ8A 5EUOF 1G7QB 1I1AD 2DQHL 2PW1A 4LFHD 4H8WL 4TTDD 4KROB 3GSVA 2X4PB 2ESVE 3ULUL 1U36A 4K8RL 3IU4H 3KXFD 4OLWH 1A6UH 3FJTA 1SEQL 4M3JA 3RX5A 5KBNC 2YKLH 1N8ZA 4RGMC 3KPSB 4HBQA 1EA9C 5DJYA 1AD9A 2ZUUA 4WUUE 1PSKH 2JCCA 3B83A 2XKNA 3L3HB 4LPXA 5CJ8A 4W4OC 1LEGB 3BP5B 1A6TB 3J8F7 1TZIA 3MJ6A 4UI2A 1IL1A 3BGMA 4U3XA 4IIQB 4U1JB 1ORQA 3KYMA 5HDOA 3S5LB 1I7ZB 1C5BL 4FXKB 1QHOA 3BUYA 3QDJA 4NO3A 4YX2L 3ULVD 5EOCJ 4Z7VE 1E4WH 2W92A 1EBAA 1RURL 2ICCA 1T83C 2VZOA 4AQ1B 2V2XA 4UTBL 4WFFE 5C0DA 5SWZB 1IBGH 2VDNH 5IK3B 1XR8A 4KDWA 3GI9L 1ORSB 4LCIH 4F58H 4XI5D 3P11L 1KLUA 1JHKH 4JGJA 2CDGB 3IAGC 2OI9B 5GZND 3L7EB 1TQCB 3A6BL 5FA3A 4UB0L 1FYTA 3HE7A 3MMEB 4OM1H 2W0LA 3WHXB 4X6EA 5DJ6B 1LMKA 3VXRA 5DI8B 4ELME 3VXME 3BDXA 5L2KE 5CGMA 2GK0A 3MA9H 2R0LH 3ARFD 1MCBA 2F8VA 3BWAA 1NGQH 1X6NA 3S35X 4K3HA 1N4XH 1MF2L 3BEWB 3GUTA 5IMOA 3SE3A 1SYSA 1CFVH 4M1GH 4ZO6A 5D5ME 3B9KC 1WF5A 3OAYH 4TNVK 2NTFB 2VABA 1IGFL 2X1PA 4BYHA 4PJHB 3VFRB 3RIFF 1FGVH 5ADPL 2IADA 1S9KC 4HJJL 4NNYB 3U48A 4LRIC 3EOTH 5IGXH 5F8QC 3VXTB 1S78D 5C0FB 3H9SD 4XWOC 4LK4A 2OX5A 5CWSA 4M8QB 2I5YH 5SV3A 2EH7H 1GGIL 3L7FA 2IWGA 3KPMA 1AI1H 2E6QA 2MCPL 2FGWL 5DEGA 1MCFA 5IKCA 3UTTA 32C2B 3UJIL 4QHUB 3ETBF 5T3ZE 1A7RH 1U3JA 2G5BB 2RR3A 1D9KA 4Y88A 3VFNB 4QXUL 3OSKA 1GC1L 1Y18A 3RWJB 1JFQL 3RKDD 5EA0L 3WFDH 1BFVL 4MB5A 4J1UA 1ZLVK 2Z91A 1UYWL 3AFLA 4XPGH 2WWMC 1R5WB 4GXUM 2NY1B 4CVWA 2HVJB 5DJZA 5FUOH 5KSUB 2A6IA 5IOPB 4DCQB 4Z7VF 3BQUA 3NAAL 5DK0B 3OGOE 1NEZA 5IW6B 1JPST 4JDTL 1ED3A 1Z3GL 3GKWL 1BBDL 1FLRL 2VOTA 3KYOB 4NOFA 3QRGH 5T3XH 1U2CA 3BGAA 3CH1A 4LLWB 2X4RA 2X4NB 3CXDL 1AGBA 5CILH 5IB5B 1CDBA 4TOYH 5C0EB 1DEEB 5C9JA 3LRGA 2DMBA 2DQDL 3MRMB 1HILB 5FGCB 1LNUA 4J2XA 3NFSL 4G3YH 3WN5B 3MRDB 3MXWH 4ELMF 3C60A 1X5ZA 1QFWM 3QPXH 5LCVL 5BOPA 5IR1B 3VXNA 5BS0B 3QCTH 5DT1L 4P2QA 1L9MA 5CIPH 4MQ7B 1GGBL 2J5LC 2ADIA 4FQIL 5IHBA 1BVKB 4X9BA 1ETZA 4MJ6A 4P2OC 2CDFA 1H5BB 4XPFH 4M03A 4M02A 2X4OA 1U8IB 3FB8A 5D6CB 3SDYL 1FC1A 3QUXB 3CUPA 1NFIA 3RHWF 4EI5B 5DR5L 5J8OA 4HDIA 3UYRL 5E94A 2NY5H 5GS1B 2PTTB 1DBKH 3NPZB 2I60H 4KHTL 4EI6A 3S36L 3QDME 4UNTA 5KAQG 5C92A 4E5XA 4N0RA 3IDIA 5ICXB 4JY4A 5GSRA 3O45B 3QEQA 4YK4C 4U1HA 4R26L 3GK8H 4WO4B 1DZBA 3FO1B 1LO4H 1AQKL 5I15H 1T1XB 2A38A 4XCYA 5D1QC 3WV0A 2B0SL 1DN2A 5F72S 5E6IA 4ZPTA 2DTML 3NCBB 4MNHA 4BSVB 3BDBA 3FQRA 2JIXB 5HTSA 3RNKA 4CMMA 2BSTA 3GRWH 3S34L 3FFCE 3SCMC 4PLJC 1NANI 4XVJH 3Q6GH 5B8CB 4NQDB 3WS6C 1VPOL 2A9NL 2OLDA 5IBTL 2H3NA 2Z9TA 2FECL 3B9KD 1RZ7H 3TYGL 1Y6KR 4OKDA 1KIPB 4GG6B 1EJOL 3IXTB 5INCB 3WUZA 5B39B 1XIWB 2DI7A 1UQSB 3TVMA 3TIDB 5I16B 1Q72L 4IJ3B 4Z95L 3ZKQD 1UENA 4FFWC 2E9BA 4G9FA 4H1LA 2NZ9C 4XWOD 4YJZL 2Y9RT 3GMLA 5HYFA 3BT2L 1BGXL 3GIZH 3HE6B 4ISVA 1ZKAA 1FZMB 3UPCA 4JFHE 3S7GA 4K07A 2PR4H 4FQ1H 4KJWC 2G2RA 2X40A 5JIHA 4GW4B 3RWIB 1WTGT 5AUMA 5GSVB 5C1MB 4EQ2A 1W72L 1NBYB 2VDRL 4FQ2H 4K7PY 4G6JL 3ROOB 3QNYB 5J13B 2A0LC 5BV7L 2VH5H 3GBLA 3DX6A 3MLSL 5GGTA 5IUSA 5E08L 4ZODA 3R0MA 2XPGB 1BQHA 4X99A 2EIEA 2XRAL 2WWMD 1VHPA 5FGBA 4APQC 5FOBB 3HZKA 3C5JA 3P0GB 3U4EB 1JK8B 2IANB 1MRCH 4HUUA 1WIOA 1TVBB 4YDIH 1KTLB 5DQ9B 1R0AL 4MZ3A 1FO0L 1T7WA 3MRJA 1CFBA 3HS0B 1CXKA 1KPUB 3DXAD 5KTEH 1UACH 4OZ4A 1A21A 4U49A 3HPJB 4OF0A 2MHAB 4PGCA 3FQTB 5DRWA 2VZUA 2CR3A 1ZOXA 2ZSVB 2NY6C 2VLJE 4M4PA 4YXLH 1QYGH 2PYED 2FWOA 4MD5A 5EOTA 3V5HB 3PWPD 3HI5H 3VWJB 3O3AB 3V0VA 4UDTA 2K7QA 1QRKA 4ODSH 4EQ3A 5LGJA 3RDTA 2VLRB 3JV4B 1G7MA 5I19L 3BPNB 4PJIB 4TNVF 3BXNA 1IQWL 2QTEA 4OCRL 4CBPA 4P2OD 2XN9E 4UTAH 4P46A 4N1CA 3NCCB 3ORJA 1B6DA 1FVDB 5D1ZA 4KKAC 5E2WL 1JHTB 4K94L 1S9WA 5BQ7A 2CMRH 5KSBB 1BOGB 3MRCA 3OHXA 3QQNA 3DOSA 3UTSE 5EU7E 1NMBL 2OR9H 4HH9A 4TTGA 5EU5B 3I2CH 2AJYH 1MFAH 3PJSB 5DVOA 3HI6L 3NCEB 4P2RA 2W65A 1E0OB 4F9PA 2XTLA 4LCUA 2EDEA 5C07B 5IIEB 1J0JA 4EZMA 1R6VA 2Y06L 4X80L 1LP9B 2XQYG 3L3DA 4N9OB 4BK4A 4LSSL 1ZEAH 2EZ0C 1J88A 4I0PB 2YXMA 5FA4A 1UA6H 3DURA 4IRJC 1U91A 1LWRA 1DLFL 1UH2A 5HHMD 4KI5E 1HQ4A 1OGAE 4OGXH 1EFQA 1CF8H 4Y5XC 2Z8VC 1FG2B 3IJYA 5K33A 5ID1A 4WGWB 3FONB 3IDNB 3G5ZB 5DJXB 1MCPH 2GJ6D 3QHZH 5D1QD 4JFOB 2X05A 3TA3C 4F8QA 2BNRE 4Z0XA 1P4BH 3HFML 5E03A 1ZTXH 5TQ0H 4AEHL 5MENA 3DJ9A 3NZ8A 4JM2C 3EJJX 3SCMD 4PLJD 2ZCKL 1G7PA 1XGUB 4P4RA 2W91A 3CAFA 3VFUB 1AC6A 3L95A 1U8PA 3Q6FA 4L9DA 3EJYC 3VFOB 3K46A 1XF2B 2H32A 2ZUXA 5DYOB 3QWRA 1F6AB 4QRSA 5GGSB 3VMPA 1H8NA 3QB7C 4H26B 5A1AA 3I9GL 3D3VD 2R56L 4FFWD 4Y89A 5D7SL 3MRRB 2NZ9D 3VDAA 1QFHA 7FABH 4NKMB 1DUZB 2P42B 5CJXA 5JXAH 3IFNL 1I3GL 4ESKA 3T09A 1DQTA 3V6ZA 4U1SB 5CIPB 2E7BA 2VE6A 3MROA 1XGPB 1K4DB 3KYNA 4FZEH 4GG8B 4WHTA 2R2BB 2VDQH 4KJWD 2WUBH 2X41A 3TIEA 3UROR 4YHOH 2A0LD 1RQ5A 3BP4B 4OCXL 4JN1H 1OARH 3BP6A 2Q76B 1RV6X 2Q6WB 3RY4A 5I8OL 5IVXA 1JF5A 1KV3A 5C0AB 1WT5C 5FDWA 5ETUA 1A6ZA 1DSFL 1MLCA 4P9MH 3LH2H 1A1NB 1IGYB 5LBSL 3SQBA 4APQD 2E7CA 3BDYH 3EYFA 2R4SH 4M93C 1CG9B 2A1WL 3TBTB 2CIKB 3MYZA 2LAGB 4H0GA 4LAQL 4QRQB 3QXDB 3I6KA 3TBVB 1ZLWK 3V6BR 1NH6A 3L3JA 1B0GA 1M7DA 4NWTH 1TJGL 3RWHB 4QTHA 1VADA 1F4XH 4Q0XL 4URTB 3E6HA 4JM4H 4HWNA 2R8SL 3BKJH 2NY6D 1RZJC 2PXYB 4CVZA 3HMWH 2BNQD 5E8DH 3KS0J 4LNVA 1EO5A 4Z9KB 3MODL 1J8KA 5JW4M 4MJ5B 2J1KA 1WAAE 3W0WD 4FQQA 1GGUA 2N1KA 5HPMB 4Q9QH 4XXCA 1J12A 2NNAB 5HGDB 5I66A 1J5OL 2ATKA 4JHZA 1B0RA 3GSWB 5BJTA 5B3JF 1SM3L 1SY6H 3MCG1 3IXAA 4PB9L 5MI0B 3R1GL 5AAMA 4GOSA 5D7JA 2E7HA 1QSFA 4JY6A 4D0CB 2I26N 4KKAD 4HPOL 1NCWH 2D7TL 4DGIH 4RMWA 1BFSA 2YD9A 4TVPH 2UY6A 3HZVB 2I27N 3E6FA 4XBGB 4I0CC 2A83B 4MNQA 3RZCB 1DVFC 5TDNB 3MBXL 4K55A 4QHKI 5ECJE 3ARDB 4Y5YA 4HFWA 4S2SB 4ZSOB 1T7YA 3IDYC 3GJFA 4O51A 4XPAL 2AJZA 3KPRB 1G7IA 2DWEB 3LVEA 4V1DE 2EZ0D 2L0DA 1MCHA 4OKVA 5IJVA 1KB5A 1QLFB 4IRJD 1NKRA 5EUOB 3QUYC 1QSEB 4G8GE 4PJXE 2D7QA 3LKPB 3MOBH 3JV6B 3M45A 2IAND 2H1PH 5JQHC 2H2SC 1YMMB 3R0NA 5F7UA 1EFXA 2R2HA 2AW2A 1ZVYA 3B6SA 3UC0L 3TA3D 5BO1H 2IAMB 5LKNA 4L4VD 5L9DL 4ENEC 4BZ1L 2VN7A 4JM2D 5I1AA 3CMOH 3VD9A 1G7JB 5JLZA 2UZYB 4KDVA 3SDXF 1CICA 1CLZL 5HHPA 1MAJA 3GSQB 3PWNB 4JHAH 2AXHA 2R9HC 5DUBA 1EO8H 4JR9H 3R8BB 4LNRB 3OXSA 3SJVB 3VXUE 4NJAH 3EJYD 2Y6SC 2X1QA 3D25A 4PJEE 3MJ8A 4D9QE 4LSTH 4QEGA 2VL4A 4NC1E 4CNIA 4XX1E 1DQMH 3DTXA 3MRKA 1BHGA 2EH8H 4ZUUA 5JHDE 3QG6A 4R9HA 4B41A 2AKRB 1E6JL 5SX5K 1B0WA 1K6QH 3MBEB 1JZ8A 2FATH 3QUKB 1IM9B 3GO1H 5F6IC 3PQYE 3NGBB 5I1LB 4KVNH 1TPXB 3KR3L 2AGJH 3VXSA 4CKVX 1C7TA 4JRYB 3UPAA 3V0WL 1FIGH 1AE6H 2YPLE 1T1WA 3F6LA 4H88L 5TFSL 3VG0H 3F5WA 4AIOA 1DBAH 2GCYA 4AM0A 5FO9A 1VFAA 5JOEA 4PJFE 4Z7WA 4O2EA 4QTIH 4PGJA 3T77B 2H8PA 1ES0B 1UM6L 2VITB 9CGTA 3H9HB 3FRPA 1EX0A 3ARYA 2VR4A 1EDQA 3H0TB 4NDMA 5A3IC 4PV8A 5E9DB 4Y16B 1KENL 3MRLB 2SEBB 3M8OH 3D48R 4MJIA 1WCQA 2DIBA 2ZJSL 1YJDH 1Q9KA 1EHAA 1E4XL 4HK0A 3MJ7B 5ACZA 4TSCH 2QQNH 2QLVB 4L5FL 1XAUA 2A6DA 2OYPA 5JW5A 3UBXB 4GMSL 1M05A 2F53D 4YPGA 4LEOA 1KPRA 3DX9B 1U8QB 5D93B 1K8IA 2XA8H 3O6LH 5FCUH 1T0NB 3RVWC 4PRAB 1UWEL 3NZHL 1I75A 1FAIL 3DVNA 1YECH 4WENB 2KUTA 2NQCA 3U83A 1RHHB 4HV8A 3OJDB 3V7AG 4P2CG 4FTVD 5I1EH 2VLLB 1I3VA 3EO1A 4OFYD 3KPNA 1I8LA 2ESVB 4AEEA 1I1RA 1W72A 2MSPA 4M62L 1S9YB 2FJGB 1GPOL 2XKSA 1HK6A 2EKSB 2JCCE 1DE4B 4FQLH 1ZV5A 1NCDL 2JJSC 1ZLVH 4Y2DB 1G84A 4RGNC 3LSOA 4WDIA 4WUUB 5D9SA 5EU3A 2VQ1A 5EOCH 4OF6A 2I24N 5C0BE 3O11B 4DEPC 3U82B 1ZT7A 1RK1B 4OZHA 2P8LA 2D2OA 5D96C 5M94B 1NCTA 4PJEF 2GW5A 3DRTA 3T0EB 4JFEE 2DL2A 1IGTA 1DVFD 2F5AL 1EXUB 2XTJB 3O9WC 4N90E 5C0NC 3DMMA 3LQAH 3ZTJG 3ZMRA 5FHBH 1NLBL 4FNLL 4HFUL 4WI3A 5K9JH 3MCLH 4FZ8L 5FYKD 1AKJA 3F8UB 1EHXA 2KQNA 2CKBL 3BI9X 3S5LG 5CEZD 4PY8J 3B8SA 1CDJA 4GRMB 3AB0B 4Y4FC 2YUZA 5IW1A 4H20H 2Z92B 3QUYD 1F4YL 3RU8H 5MP6L 2H2SD 4AH2A 2JJTC 4C59B 4XC3H 1J1OH 5C70A 4FFZH 5J9PA 3I50L 4NQED 4QYOB 4PJFF 5JORA 4GMTL 4ENED 4EIGB 4ZUVB 3UEZA 2QQLH 3MV01 4QWWC 2GQHA 1IGIL 1CVRA 2Q87A 1N5YH 4JFDA 2R9HD 2YEZB 3BH9A 1KB9J 4KDTC 5MHSE 2Y6SD 5IJKC 1N7ML 4ORGA 3WIFA 3I6LE 1F2QA 1FZJB 3X3FH 1TVDA 1IC4H 4L8SB 4U6HA 4EVNA 1HOCA 4I1NB 1PX4A 3VXPB 4OFKA 4F33A 4MNGB 4MDIB 4JRXE 3WUWB 1JZ5A 1ZGLA 4JB9L 4J7RA 1I85A 3W9EA 3V4VH 3TYFA 4BFIB 1EMTH 2ITDB 4OT1H 1KIQA 3LZFH 2R69H 3BKCH 2XZCH 3KPQB 3SOBL 2V17H 4JG1H 5F7LB 2XXMB 2YC1B 1CL7H 4X6DA 3D9AL 2FJHB 4QHNB 5ANMB 4P59L 1XH3B 4ZO8A 2JCCF 1A9EA 4GQPH 1KUMA 4KUCD 4I0KA 3T2QA 4I18B 3MCKA 4G7VL 1PY9A 3IF1B 2VXUH 3MV8E 4P5TA 1A3LH 3O3DA 2LTQC 2AV1B 1JBJA 5A3ID 2FX7L 3L5WB 3ARQA 5F3BA 4YR6B 1R5IA 1NUDA 4RA3A 4MD0A 4MX7A 2ICEA 1PG7X 5TDOB 3Q3GA 5F88B 3B3IB 3ZSTA 1LGVA 2OJEB 2Q86A 4HWBA 3RVWD 5DJ8A 1KF9B 2OJZH 3OPZL 2KL6A 4OLZL 1I1FB 1LK3L 4PRDA 3P3YA 2X4QA 4P57B 3QNZB 1FNEB 4OCWL 5HGAA 3D6GA 4MXVE 4XZUB 5DJCA 3V6OE 3PIQA 4NO0D 4AENA 5CUSH 2YBRB 5AZ2L 3GBNL 4JJ5A 5JPNB 1SJEA 4MHHI 3UPRB 4DJMA 2E7LC 1CBVL 4ONGL 4JFFB 1GZQA 2OP4L 3HAEA 2X6MA 2OM5A 2YD3A 4RGND 4X6FB 1KLGB 4DGVL 4D9LH 2EDKA 3F12B 3NTCL 2DQCH 4UZGA 1NCBH 3MGAA 4G43A 2WNGA 1F3RB 3TBWA 3RI5K 2CR6A 2BDNH 4CADA 4LHUB 2YPKB 4KK5C 2H45A 4JKPH 1CK0L 4YDJA 1BP3B 3O4LE 4PJ9B 3CU7A 2VSDA 3O9WD 4O2FA 4WTZA 5C0ND 1MY7A 1U93B 4P5KA 1QBML 2IC2A 1B2WH 4LLMA 4UQ3B 1WFOA 4R8WL 1BBJB 1RULL 4Y4FD 2UYLB 5C08B 3MRFA 4TPRH 3OKOA 4N1EA 5F96L 4OJFL 2P8PA 2XV6B 2HFFA 5E9DD 3UO1H 4KKLC 4GSDL 2X9WA 3U4BH 4HSQA 4QCIB 2EXWC 1JWSA 5L6YH 5I8EB 3LIZL 4X8JA 4JFQB 1D7FA 4RAUA 3RWCB 3WHE1 1MCNA 3SDDB 3CJJA 4S1QL 5EORH 1D5BA 4WNQB 1Z5LB 4NNPH 1LO2L 4NQSB 5DHVB 4QWWD 4EBQL 1DBJH 4M61A 2VDLL 4ZXBB 3FQUB 4OFDA 2CDEA 2C3XA 3QUMA 2CGRH 3TBSA 2HJFB 3MLUH 1QZ1A 1OP5K 4NUJB 4RNRA 4HC1L 1E4KC 4QOKA 4C4KT 3V5DA 4NPYA 4IMKC 3M17B 4Z7QE 3VH8G 4KFZC 5E5MB 3JWNC 5EOQL 2F54A 1U58A 5E7BA 4YDLC 2DMKA 2L7JA 3PP4L 4I77L 3C5ZB 1MSPA 5D6DC 3SGJA 5CP7B 1DBMH 3AREC 4WUUD 4GBXC 3UBXI 2VISB 1T22B 5I1GH 4P3CL 3L3KB 4LDLB 1ZLSL 3W2DL 4E41B 2KQMA 4PRNA 5JHLH 5E5RB 3IETB 4K3EH 3CSBA 5D4QA 3RL2B 4UT6L 5E6YA 4M5ZH 4LLYB 2EDNA 2EEAA 4HPYH 2DQUH 3HNVH 3HUJA 3LDBB 3K8MA 5EZJA 1UJ3B 2M26A 4WFFD 4GAGL 3U9PH 2ADGB 2WIMA 1FRGH 3SY0A 3TNMA 1RMFH 1WBYA 3CFKB 4ODVL 5J7CC 3TPUA 3MNZB 2FO1A 1ZHNB 1V05A 43CAB 4M7LL 3MGOA 4NZRH 2V5RA 5DUPL 2GITB 5DMKB 2GJZA 4KTYA 4JVWA 4U33A 3S4SG 2QL1A 3G5VA 3G04A 4WWKC 1ONQB 3QI9A 3VXMD 5L2KD 1CS6A 3CXHK 1GCFA 1INQA 4LEXL 4DUXA 4Z8FH 3S96A 1Z9MA 1OCWH 5MEQA 5L88H 3BIKA 3LQZB 5K9KB 3N1GC 2JB5H 4HBCL 3EFDH 1KG0A 5DMIL 4AIZB 5CBEA 1R3KA 1S5IH 3CFJA 2GAZA 3QP3A 4Y1AE 1WWAX 5T5FL 1ZGLP 2WBJB 5F6HJ 4Z7NE 3QQ9C 5GQBA 4WY7H 3B9EA 2DDQL 2VUYA 1F3JA 5CZVH 3THMH 2ZUVA 5C71A 4IRSB 1KYOJ 1T66C 4HIXL 5A2LH 4XAWL 2FX9L 4E0RA 1ZE3C 2K9UA 3HLAB 1DTUA 4JO3L 5DFTA 1QD0A 3I75B 4KK5D 3V9FA 1S5HB 1G9NC 3QIUA 1F58L 3O41B 1N0XL 1F00I 2JK5B 1U92A 3VCLB 4Z7QF 2F9BT 3FOMB 4AY0A 4P2RE 3GIVB 4NKIH 3FMGL 4JVPA 2EKJA 5T3ZD 5EB9A 2D9QB 1A02N 3MUHL 4Q9BA 2BSRA 3WE6A 4ZUTB 3IU4L 1YN6B 2P7TB 1K9TA 1AIFA 4UIMA 5I1DA 4OLWL 4XP4H 3FOLA 1A6UL 3JTTA 3ULUE 3QISA 3MV9E 5CINH 3GJFK 3BD3A 2YKLL 3SO5A 1JPFA 2XZZA 2JJWA 4NUGH 4KKLD 5D1XB 3U7WL 1PSKL 3GKZA 2LABA 2EXWD 4JHWL 4LF3A 5E56A 1JI2A 2HFGH 2ZUQB 4WTWA 4PRPA 2J2ZA 1KTRL 2NY7H 1AO7A 2BNRB 5MENE 3PG2A 2C3VA 5IMLB 1LEIB 3LEYH 5B21A 4DVRH 1E4WL 5GISH 4QRTA 3TJHC 1IBGL 2AJ3B 1X4YA 1XF4A 2O5YH 2VDNL 3IFOA 2EYSB 3VI3F 3H3KA 4LCIL 2FZ3B 3TBYA 4F58L 4X4ME 1NBZB 2Y5TA 3VXQB 5F9JA 4C4KO 2WQRA 1JHKL 2CKBA 1QFWH 1U3HC 4XTRC 1VKXB 2YZ1A 3OKEA 4AJ0A 4PG2C 1C08B 1M7IB 3MUJA 4PJ8A 4PTTA 5EBMB 3AXLA 3CX5J 4OM1L 5JOFB 3BZEB 2DYPB 3ARED 5FM5M 3NACH 3MNWB 3NOIA 4GBXD 4LSVH 4X4ZA 1KTDB 4NQCB 3MA9L 4QKXB 1D5ZB 2R0LL 2ARJB 2P5WB 5DD3H 1NGQL 4CVXB 3CMGA 3P4OA 2LFGA 1KJVA 4U1IB 3ELAT 4XMPH 4R96B 4PRIA 5DQJB 4F7TA 3LKRB 5AG8A 4OQTA 5HVHC 2NTSP 5CHNA 3EYOA 4PJ5A 5C2UB 1FJ1A 1CFVL 2A74A 5EU7C 4ERSH 3L1OH 1U8HB 1JNHA 4M1GL 2P24B 4OZGA 5IVXE 5IQ9A 5I1HH 3O6FC 4HUVA 4HKXA 5F9WC 3QDMD 2C26A 2HTKC 2EO9A 2APBA 1FGVL 5TE6H 5F1NA 4XBEH 4K71B 3U7YH 1BF8A 3SDXB 3EOTL 5CJ5A 5IGXL 1RUAH 3B9DA 1JYXA 5HGHA 1KXTB 2HH0H 4J23A 4KI5C 3S6CA 3IDMB 4Y4HB 4KKBC 2I5YL 1WV7T 2EH7L 3DV4A 5IB2B 1IKNC 4WWKD 1UT9A 5MEPB 5HHVH 1GHFH 1AI1L 3TLRA 1GSMA 1P7QD 5SX5H 4J8RA 4CW1A 4ZDHA 3CC5B 4N0CC 5KSAA 1L9NA 3B2UC 1A7RL 5CBAB 3FFCD 3WNKA 3V6FB 1JZ2A 3WFDL 4FQCH 4HUNB 5IFHH 1MCOH 4XPGL 1OW0C 5EO0B 2XNAA 4GRLC 3IU3A 2WIIB 1H0DA 2UVFA 3QQ9D 5FUOL 5C0CB 3GMOB 4IIQA 4X5WA 2C1OB 1I7ZA 4J3OC 5J1SC 4X6CB 1T66D 3MRBA 3QCUH 3ZDYE 4KV5E 1T21B 5F7EH 5JTWA 2BFVH 2VJXA 3H7BB 2ZZUT 3DBXB 1K8DA 3QRGL 5A2FA 5T3XL 4U1MB 1A4JA 3FB5A 3QIBA 4PGBB 1KC5H 2V2WA 1UM4H 1X44A 4JFHD 5CILL 4TOYL 3W5MA 5IWLA 3I3BA 2VMFA 2DB8A 4W6WB 5AYQA 4QRRE 3SPVB 1KXVC 1AQDB 4XVSH 1OSZB 2GT9B 3D0LA 4ZYKB 3WJJA 2CDGA 4P23B 3IAPA 2CLVB 1FFOA 2P5EB 3P2TA 4G3YL 3MXWL 3P4LA 5GRVK 5BZWA 1IARB 2I9LB 3QPXL 1MLBA 1NCUA 5I1CH 3QCTL 2IFGA 3IGAA 4HK3N 5C09A 5T33H 4D0BA 3KGRA 1KEMH 2OR7A 4XPFL 1RK0B 2CLZA 1I7UA 4ZNCD 5IVXF 2Y7QA 4XVTH 4N0UB 4U1GB 1JGLH 1MNUH 4MHHG 5CJQH 1IJ9A 4F15B 2NY5L 1JRHI 1DBKL 2YK1H 3K8KA 4PJHA 2I60L 2VLJD 4XNZB 2MFNA 4LKXB 4NBZB 1FNSH 1WWCA 4FQXA 3TJHD 3S3PA 5E8NB 1MHCA 3VXUB 1BEYH 2DJUA 1F97A 4MQSB 4RA0C 5ICZB 1XGQB 3VXTA 5C0FA 1DP0A 3ULSA 1HSAA 4B50A 1U3HD 3GK8L 4XTRD 3O4OB 4LAJH 2Y07H 1VFBB 5HD8C 4HLZH 3DECA 3BIAX 1KIUA 1I8IB 3FQNB 4K9EH 5I15L 1GL4B 5DURD 2XN9D 3PWUA 4N8VG 1T80A 2QSVA 3VXSE 5C0RH 2RBLA 4MD4B 1TZHB 2B5IC 3WFBH 4H25B 4NOBA 2UZIH 5I9QB 5C9KA 1AXTH 1G1YA 3GRWL 1PY4A 2RFXB 4WFHE 1HCFX 4XVJL 3UTSD 3Q6GL 4Y19B 3KPOB 2FJFB 1YNLH 4LCWB 3G5XB 4Z7WE 4UNUA 3PV6B 1HI6A 5E70A 1RZ7L 3O6FD 1AHWB 1F45A 3P9MB 1T1ZB 4KV5F 1MCWM 3HR6A 3SDAC 1YY8A 2Z4QB 4DCQA 3REWB 1BX2B 2DKSA 1YEDA 5J56B 5DK0A 4MJIE 3M07A 4KK6C 1JF1A 1OAQH 1HXMA 2ZG2A 3GMMA 3FO9B 4KI5D 1OGAD 3KYOA 5FOJA 5GS2H 1MH5A 4KKBD 1KNOA 2LAAA 4QRPB 2X4NA 5L7XH 4LASH 3NN8A 2NR6C 3GIZL 2EDXA 4HXAH 3RY6C 1NUGA 5I1IH 3TO4C 3FFDB 2G9HB 2PR4L 1EEYB 1UZ8B 2JJVA 3HI1A 4FQ1L 5J11C 1BWMA 4N0CD 3B2UD 2PW1B 4JDVA 4KJYA 5T5NF 1TITA 4NCC2 3DVGA 4EUPG 3GSVB 1A6AB 4FQ2L 4LCYA 5EU6D 5HYJE 1OT2A 1PFCA 5IR1A 2VH5L 1L6XA 3UBXG 3MV11 4MQ7A 1U8NA 3AAZA 4E42A 2BMKA 3LN5A 4GRLD 5J1TC 1NC4B 1H3WM 4NC1C 1MRCL 5DJYB 4YDIL 1AD9B 1U8JA 3EDDA 3EBAA 4NZJA 5D6CA 5E99H 3G6JE 5EPMA 3QUXA 3SEPA 5KTEL 1TZIB 1UACL 4JANA 1IL1B 1QTYT 1ORQB 2BY1A 3KYMB 5GS1A 3BUYB 3QDJB 4NO3B 4P9HC 3BEVB 4K23H 2EE6A 2GY5A 4YXLL 5L2JA 1QYGL 1JZ7A 1OAUH 3T0VA 4F80A 2V2XB 4UV7H 3BMWA 5C0DB 3E2HC 3LD8B 4JLRB 2OCFD 3HI5L 3LHPH 1XR8B 1FORH 4ODSL 4WO4A 1KLUB 3WHE0 4GFTB 4AT6B 4PJAA 1MJJB 3HRPA 1FYTB 3HE7B 1BMGA 3EJZC 4X6EB 4UTAL 3VXRB 5GIRA 3SDCC 4BSVA 3RGVC 4IDLA 4YNYA 3AY4C 4Z7WF 2GK0B 4I2XA 3ZZ1A 1U95B 3CDGB 2CMRL 3BWAB 5B8CA 1W8OA 1CD8A 4NQDA 2GHWB 3GUTB 3HNSH 1MCKA 5IMOB 1A47A 2OR9L 1SYSB 4JFDE 4GG6A 2LV4A 3I2CL 2AJYL 1MFAL 2MQ3A 4AL8H 5B39A 4KQ3H 2VABB 1UZ6E 2VDMH 4LGSB 2IADB 3S9DB 2D7OA 1ZEAL 3OB8A 3PL6C 5C2BH 4Z7UE 1UA6L 1KN2H 4TRPH 4OGXL 1CF8L 4LP4A 2BHUA 5HD8D 5CD3A 2L4OA 5TE4H 4GXVH 3HE6A 3L7FB 2X1XR 1MCPL 5GS0H 1P1ZA 3GB7B 3QHZL 4UT9H 3NIGF 1P4BL 3KPMB 4GW4A 5EO1A 1ZTXL 2C1PA 4XH2A 5DEGB 5TQ0L 1E28B 3DX8A 4TUKH 5IKCB 3UTTB 3ROOA 1O5DT 4UNVA 1VENA 4X9GA 1S7VA 4NSKB 3F7VB 1D9KB 2XPGA 3D85D 1J8HA 2NY4B 4J1UB 2P46B 5IBUB 1IZJA 2YWYA 2Z91B 3AROA 4KXZI 3U4EA 2ED8A 1KTLA 4OZHF 1R3IH 3SDAD 1HWHB 2W38A 4OLVH 4V1DD 2W0PA 5I6XB 5DJZB 1KPUA 3WFEH 5FV2A 1AD0A 4KK6D 1OP5H 2A6IB 3GGWA 1A7QL 4CL7A 2MHAA 3BQUB 2X4SA 4G8GD 4WV1A 3SN6N 5BW7C 1NEZB 7FABL 3LV3A 3MRQB 4G80B 5JXAL 4I4WA 2NR6D 1I4FA 4JCMA 3BPOC 3TO4D 2RIKA 4FZEL 2X4RB 2DICA 3LY6A 4DOHB 3L5IA 3V5HA 2VDQL 2AK4A 4KRMB 1AGBB 2WUBL 2XA3A 3RVTC 4BQCA 3O3AA 5C9JB 3DUSA 5FM8A 1ERNA 4GUPA 1OVZA 1T3FA 3O3BA 1LNUB 2OS7A 4YHOL 5F1IB 4G8EA 4JN1L 1OARL 2PYFA 2VZSA 3WYRA 3BD4A 3IJHA 3C60B 4LP5A 4ZMAT 1ITCA 1T89A 3VXNB 4P9ML 3LH2L 1BJ1J 2D0HA 4D9QD 4P2QB 4PJBE 3BDYL 2R4SL 2A73A 4MJ6B 1JHTA 3KDMB 4H5SA 2CDFB 1FSKC 5JHDD 2E7MA 4DGYH 4J6RH 3HPLA 4OD2A 4NWTL 3FB8B 5E5UB 5EU4A 1A7OH 2FSEB 4WI9A 1F4XL 2Z31C 3CUPB 1NFIB 1U42A 2X9YA 3PQYD 3QG7H 4JM4L 4HDIB 1OHQA 3PJSA 3BKJL 3GI8H 4PBXA 5E1AA 3HMWL 1F6LL 3WDHA 12E8H 5E8DL 1E4JA 4YDKH 4FN0A 4PP2A 2YPLD 4F7MA 3V5KA 1Q0YH 1MJ7H 1Q0XH 3K7UA 3BE1H 4X4YB 4CGTA 5T1DH 3IDIB 4YUEH 4ODWA 4QNPE 4Q9QL 4JY4B 5GSRB 3QAZB 5HHOD 2EEDA 3QEQB 1WFTA 2CO7B 4U1HB 5D2LA 5KS9A 1CIUA 3FONA 4LSRH 5DHXB 3FN9A 1SY6L 4X6DF 2JB6A 3EJZD 2QSCH 1RI8A 4YXKH 1G7LA 3SDCD 3WMSA 4XCYB 3RGVD 1D6EA 3VG9C 4Q74A 2CK2A 1NCWL 5E6IB 1NBQA 4DGIL 4M3KB 4ZPTB 4HEME 4L4TE 4MA3A 4WI6A 4MNHB 4TVPL 3FQRB 4CMMB 3RNKB 2BSTB 3JV0A 2ICWI 4GW1A 2ITCA 4PIRF 5IG7A 1JWUB 3PGFH 2YD7A 4QXGH 5GGSA 5GGUA 2EDRA 1MHHA 2YR3A 3V6OC 2F54E 4NQUA 3PL6D 1J1XH 5T1KD 2NX5E 1IAIM 4MA1B 3HA0A 4GKSA 3MOBL 3BAEH 4G9FB 4HHAA 3ZE1E 2H1PL 2FBJH 3QH3A 4GS7B 4U1SA 1L4IA 2WWKT 4WU7A 3GMLB 5IVZA 1QLRA 3GJFH 5BO1L 4JZJA 5C0BD 4ISVB 2E9IA 5FM5O 1OT1A 5JUEH 3TCLA 5SWSA 4LDEB 3CMOL 3RKPA 3BKYH 3D39D 4NN5C 4KGJA 1S9XA 5AUMB 1UJTA 5BXFB 3HUJE 4JFED 3WLWC 3HC3H 4JHAL 1ZXQA 1EO8L 2MKLC 4JR9L 5DD5H 3K4AA 1A1NA 2FO4A 1MI5E 4NJAL 1BQHB 4X99B 2YS4A 4LSTL 4KMLB 2CIKA 3HZKB 3C5JB 1X5KA 3ZKSD 3RFZC 1VB9A 5K9QI 4HUUB 1DQML 4QRQA 3TBVA 2EH8L 3O8XA 3TPKA 5JR1H 3RWHA 4ZOBA 3HG1E 4N8PA 5D2NA 3SE4A 1K6QL 4OZ4B 1INEH 2FATL 4Y4KB 4CN4A 5DQDH 4PGCB 1BZQK 3GO1L 1IEBB 4KVNL 5TH2A 2A6JB 2AGJL 1KTKE 2B1AH 1P5VA 4QNPF 1JNNH 1FIGL 2HYMA 1AE6L 2NXYC 4HGWA 4MJ5A 4NN6B 3RJQB 5IT2H 3RVTD 3VG0L 2FWOB 1DBAL 4MD5B 4CRPA 5EOTB 3WNOA 2D03H 3G5YB 3V0VB 4QTIL 4UDTB 4Z5RA 4W6YB 4L4JA 3IRPX 3GSWA 5LGJB 5IB1A 1W2KT 3AC0A 3C6LC 4GW5B 3KYAA 3TVMC 3I6LD 3M8OL 1JYWA 3QQ4A 1J10A 1H9VA 1YJDL 4XBGA 2A83A 5BQ7B 4TSCL 1S9WB 5SX4I 2QQNL 3LMJH 2Z31D 4OIIH 1CR9H 4JRXD 3MRCB 3OHXB 35C8H 1KCKA 1D6VH 5FXCH 2XA8L 3O6LL 1J9CT 5FYLH 3FAXA 5FCUL 1EIBA 1J11A 4M7ZC 1YECL 1PZ5A 3SE9H 4P2RB 2W65B 2QKIA 1B88A 4LCUB 3ZE1F 5I1EL 3H9YA 1Q94B 3X3GL 3BPCA 4KWUA 5KZCD 3ALXA 3QULA 4G5ZH 5FA4B 2PTUA 3GSOA 5FCSH 5C0GA 1KSRA 1YNKH 3DURB 1BVZA 1U91B 3MV8D 2YHGA 5FGBC 1HQ4B 3MYJB 5DRXA 5CCKH 3UP1A 3FB7A 4FQLL 3ECBA 2BP3A 5ID1B 2D7MA 3OR6A 5KVEH 1UB6B 3FN3A 4PRPE 5F7YC 5EOCL 1D5MA 3HUJF 3QUZC 1AO7E 4Z0XB 2DQEH 4WHYG 3S37X 5CMAA 3UJJH 1G7PB 4YQXH 1QSZA 5D7LA 4F7EA 4P4RB 1FV1A 1HKFA 3LQAL 5FHBL 5K9JL 3MCLL 4NO5A 1L6ZA 1YPZE 1U8PB 1KIRA 1T04B 2CH8A 3DYPA 4HJGA 5I1KH 4QRSB 3OB0K 1QRND 4H20L 4HKZA 3CFDB 3RDTC 3RU8L 2Q7YA 1RZGA 3QDAA 2LU3A 5I1LA 2K7PA 4XC3L 1J1OL 2EYRA 4P46C 3DUUA 4FFZL 4JRYA 1NCAH 1XGYH 5D1ZC 3V6ZB 2WWKO 4JPKH 1NGXA 3MROB 5F9AC 4AMKH 2QQLL 5EBGA 3FT2A 1TZGH 2B8OT 1XMWA 4O02L 3TIEB 3O4LD 4KKNA 1PKQE 4R0LA 3WLWD 3CD4A 3T2OA 1N5YL 4OZGE 4WFED 1INDH 4LLUA 4PB0L 2ATPB 3BP6B 1F4WH 4PV9B 5IP4A 1U0QA 5JA9A 5ETUB 1A6ZB 1MLCB 2DJSA 4FP8H 4G6FD 3NVQA 4HW6A 4H8WC 3DGGA 3EYFB 1UWXK 3TM6A 3X3FL 1IC4L 3ULUC 4DK3A 3N0PB 4K8RC 1WISA 2Q8BH 2WANA 1YQVH 3MZTA 1JJUA 2DKUA 1RJLA 4N5UA 5HGGS 3I6KB 3DX9A 1F90H 5K9OA 1BZ7A 2V5TA 3L3JB 3RAJH 3EYUH 1ZVHA 4QTHB 1VADB 3WBDA 4C56A 4RFNC 3V4VL 1EMTL 4OT1L 4DZ8A 3E6HB 2R69L 3BKCL 3LZFL 4NRXA 3VRIA 2XZCL 4CVZB 2V17L 4ALAH 4JG1L 4PJGB 3LKNB 2NXYD 5FV1L 5GGQH 1CL7L 3V8OA 2WZPD 1X5XA 5FGRA 1BQLH 2YWZA 2BVPA 4FQQB 4BJLA 5M95B 3KPSE 4GO6B 2EKSA 2VXUL 3C6LD 5I66B 3AU1A 4Y2DA 1A3LL 2ATKB 4M6OH 4M7LT 4KTEH 3DO7B 1B0RB 3TVMD 5ILTH 2DIAA 4P4KA 3PABB 3IXAB 2JKXA 3F7RA 3ALPA 3GMQA 4XPTH 2YA1A 1A7NH 1QSFB 1OTUC 1RUQH 4HAGA 3T0EA 2QR0A 3KPLA 1BFOB 3E6FB 4XNYH 1ZMYA 2CUMA 1PVHA 4MNQB 4UQ2B 3TN0C 4XP9H 2OJZL 5HYSA 4HFWB 2AEQL 4WHCA 1PEWA 1VESA 1SVZA 1LE9B 3SO3C 4GRMA 3GJFB 4O51B 5IMMA 2AJZB 5F7HA 1G7IB 4NKDB 3KJ4C 5CUSL 1I1AA 4OKVB 4KTDH 1CGUA 1KB5B 4WI8A 2IALA 5JIIA 1T2QH 4HWBH 4YHZH 4RGOH 1T7ZA 2QSTA 2R2HB 4X7EC 1WK0A 4D9LL 2DQIH 4K7PX 1NGWB 2DQCL 5J89A 2E6JA 1NCBL 3DHMA 3QUZD 4OZGF 3WS3A 4LOUC 1X6LA 2IBZY 1ACZA 1U8LA 2BDNL 4WW1B 1JTOA 5FECA 4NZTH 4JKPL 5I1AB 3WEXA 1HNFA 1CICB 5HHPB 3OKLA 4PJHE 5GGRA 3HAEH 2ZUSA 4H0HB 5I71B 2VKWA 3NIFF 2WQ8A 3GM8A 3OG4B 3T8XA 5FF6A 1B2WL 3OXSB 1FL5A 2CD0A 3MJ8B 3PHSA 4LARH 1HE7A 5LJYH 1OP9A 4CNIB 1GC1C 4G6AC 1WITA 4XXCC 3DTXB 2IPUG 4KI1A 4TPRL 1M71A 3MRKB 4ZUUB 3RDTD 5D70H 1GOHA 4Y1AD 3QG6B 3UO1L 5F1KC 4FHBD 3U4BL 2ITDA 2DI9A 4NFCA 2YD6A 1EEZB 4F57H 5L6YL 4P46D 5D7JC 3SGEI 1NCCH 4WW2A 4LCCA 4L9LC 5D1ZD 4M1DH 2NW2A 4RISH 4PD4J 2FJHA 3CFIC 5LG1A 5E8EA 5EORL 1IT9H 4XX1G 1T1WB 4NNPL 1NDGA 4ZUWB 3F5WB 1DBJL 2GCYB 4AM0B 5FO9B 3OJVC 2CGRL 3ARFA 1VFAB 4ZFOA 4Y5YC 4X5XB 3MLUL 4P2RD 1Y6NR 4IM8A 3DGCR 4HMCA 4P3WA 1TJIH 4MAYC 4NDMB 4PV8B 2DIJA 4NP4H 4ZTPH 4DN3H 5DSCA 2ZCLH 4TSAH 3ULUD 4K8RD 3IVKB 2X4UA 3MV9D 3SGDH 4PRHB 4F9LC 1OAKH 4IMLB 2NXZC 3O2WH 3QUMH 1DBML 4HK0B 4RFOH 5BVPH 5ACZB 2MMXA 3QDHA 3B3IA 5JW5B 4P0DA 1M05B 4YPGB 5L0QC 3QIWC 2B1HH 1KPRB 4LEOB 1K8IB 3QYCA 5I1GL 5FGCE 4LPYA 3QNZA 5MEND 5JHLL 3DVNB 4M5ZL 1YEJH 1IILE 3GJEA 1RVFH 4HPYL 3LPWA 2DQUL 3HNVL 5JPNA 3TGXA 3VFWA 3UPRA 3EO1B 15C8H 2A6KB 3KPNB 4JFFA 4JQXA 4J3SA 1EHLH 1W72B 3U9PL 2I25N 1D5IH 1FRGL 2EIBA 1RMFL 3BIBX 4X6FA 2OTUB 4X83A 3GSNH 1P9MC 2FEEL 3WDIA 2B2XH 3DO3A 4WDIB 5D9SB 4GXUN 3MLVH 4PJHF 2VQ1B 3RL1B 1OTUD 4LHUA 4NZRL 2YPKA 5H94B 1LD9A 1NBVH 2XWTA 2EDLA 3T3PE 4OZHB 2P8LB 5LAXA 1BD2D 4CN6A 1IGTB 3TN0D 3VD5A 5K9QG 4R4FH 4Z8FL 3VU2A 1OCWL 3DMMB 4BQ8A 5L88L 1NUFA 1NL0H 2YD2A 1AKJB 1ZA6B 1N6UA 2JB5L 3AM8A 3EFDL 2F58H 4ZAKB 3AMKA 3FCTA 1FL6B 4PD4K 4XMLH 3JWDH 3ZE0F 1S5IL 1DQLH 3VJ6A 5IW1B 2R0KH 1P4LA 3TCXA 3OKMA 4LPVA 4WY7L 4AH2B 5CZVL 5TGBB 2CUIA 3THML 3DWTA 5KVGH 5J9PB 4M6MH 1UWGH 1T2XA 4LOUD 4BKLA 4OLYH 4DWHA 2J8HA 4R90H 4NQDE 4Y5VC 3P4MB 1C12A 4W4OA 5DC4B 4FFYH 2X70B 2C3GA 4R3SA 3OKYA 4GG6E 1FE8H 5TJWK 4K3JH 1UEMA 2XXCB 3RVXC 4TUOA 4NKIL 5TQ2H 3ME0A 1JVKA 2H6PB 2QQKH 4PJDB 3QXTA 5I76A 3RNQA 2W0FA 4ORGB 4KH2A 3MACH 1T83A 4XP4L 3REVA 1CFQA 4G6AD 2DF3A 5CINL 3T0XA 4UINH 4FXLA 2Z0BA 4U6HB 5BV7C 4HK3J 1PLGH 1HOCB 3PWJB 3FT4A 4NUGL 3S97C 4XRCA 4F33B 2MQ0A 5GRZA 4KRPB 3HB3C 1ZLUK 4TULH 3BGFC 5FGSA 1ZGLB 3L3KA 2HFGL 5D7JD 5GS3A 4E41A 3W9EB 2HA1A 3TYFB 4DW2L 3IETA 2NY7L 3IS1X 3RL2A 5JW4R 4LLYA 5IHUH 5DJ0A 1CLOH 3ARBB 4X6DB 2WLZA 3LEYL 3MO1A 3T3ME 4UMGA 4DVRL 1UJ3A 2RB8A 2XZAH 2W9LA 1L0XA 1A9EB 3EOAA 3QNXA 5HVWA 2IG2L 3ZE2F 3OKNB 4QRRD 2O5YL 3TZVC 4O2CB 4OCSH 3VGDA 1WWWX 3RWFA 4P5TB 3MREA 4MAYD 3T3PF 1N64H 4MA7H 4OCLC 5DVNA 2PKDA 1SJXA 4PFEA 3VFGH 1QFWL 5DMKA 3SGKC 1FCGA 2NXZD 5F3BB 4RQQB 4GLRH 3GHEH 1R5IB 4YHYC 1EFXD 3SKOA 3NACL 2VLKB 4MD0B 4MX7B 4LRIA 4LSVL 2NY2C 1ZT4A 2ICEB 1MHPH 5CAYB 3Q3GB 2JELH 5DD3L 5HGBA 3TH3T 4LVHB 5T1LB 2AK4E 2Q86B 4XMPL 3R06A 4PJAF 5DJ8B 1HIMH 4K94C 4U0RC 4AIZA 1NEZG 4ERSL 5HGAB 3L1OL 2FEDC 1QEWA 4MJ4A 2VLRE 2HN7A 2HWZH 3PIQB 3EYVB 1VERA 4KY1H 4PJIE 4AENB 4OZIB 5I1HL 3VRJA 5F71A 3BO8A 4JJ5B 1AY1H 2X7LA 5EO9A 1SJEB 4U3HA 5TE6L 3O2VH 4XBEL 1GZQB 3U7YL 4Q6YA 1IC7H 3HAEB 4N9GA 4Z76B 5KSBE 2PNDA 1RUAL 3MLPA 3FZUC 3NMEA 4OQTH 2R4RH 4GG6F 2HH0L 1N6QH 1DL7H 3I75A 4U2YA 3GDBA 4G43B 3TBWB 1YEEH 2C7UA 4CADB 5HHVL 3I02A 1GHFL 4BH7A 4DVBA 3VXSD 3DXAA 1DUYA 1F13A 3EO9H 5C3TA 4O2FB 4CU7A 1LP9E 1OAYH 4P5KB 1YN6A 2P7TA 4WFHD 5FK9A 3OKDA 4LLMB 5ISZB 4GT7A 4FQCL 4JO2H 5IFHL 1CFSA 2PYEA 3L5JA 4L3CA 1BOYA 1MEXH 2VO5A 4KHXH 1MCOL 3MRFB 3NFNA 3OKOB 4WWID 1BM3H 2P8PB 3PWPA 4RCAA 1IRAY 4IBLT 1WZLA 3T3MF 4MJID 3SE8H 4HIHA 1ACYL 1JWSB 4YH6A 1NSNH 4X8JB 1RUKH 2O26U 3QCUL 4YDVB 5IMLA 1LEIA 5F7EL 4RAUB 1QNZH 1A1OB 2BFVL 4FG6C 4P2OA 1D5BB 1NAKH 1MIMH 1S7UA 3MJ9A 1NC2D 2DJ4A 2ZP0T 4XP6H 1KC5L 2CDEB 3QUMB 5T3XE 3TBSB 3RVXD 4XXDA 4XVSL 4X6BA 4RNRB 4XCNA 5HYJD 4QOKB 2FECI 1BFTA 1RFDH 3HHRB 3NFPA 3V5DB 3ESUF 1CN4A 3HN3A 2CUHA 1PEZA 2CPCA 5I1CL 5JOFA 1I8KA 1U6AH 1U58B 3KLDA 1JZ4A 2D9CA 5DD1H 1CXEA 4JKMA 2HT3D 3U0PA 5T33L 1TJHH 2P5WA 3HB3D 1KEML 2ED7A 1P84J 4CVXA 4YAQA 4U1IA 3WNMA 4F8TA 2OMNA 2MCG1 1W0WA 2I07A 4NFBA 1OF2A 4PR5A 3PXJA 4XVTL 1CFNA 1JGLL 1MNUL 4PRNB 5CJQL 3D1MC 3H2WA 2P24A 2GJ6A 5F9OH 5D1QA 3BPLB 4H1LG 5C0AE 3P4NA 5I30H 2YK1L 2WLYA 3IAQA 5EZJB 3MGTB 1FNSL 3PGCA 3TZVD 1H3XA 2VRAA 1A6WH 1BEYL 1SBSH 3TNMB 1WBYB 5L8KB 5I18H 2ENYA 3CDCA 2DMCA 4JZNB 3TPUB 4Y4HA 3PF2A 2ZUYA 1IQDA 4L3ED 5D2NE 2Y07L 1EUUA 4K9EL 2GJZB 5DZNA 2W60B 1BQHG 3OB0H 2NY2D 3G5VB 3G04B 2XWBA 5DRZA 3D3VA 3QI9B 1OP3K 3D2UB 4CDHA 3CC5A 4MMXC 5C0RL 2C5DC 1INQB 3WFBL 4Q6IB 5GGSY 2UZIL 4LSPH 3V6FA 1C8PA 1AXTL 5D2LF 3S96B 5KS9F 3QXWA 5MEQB 3ARWA 4HXBH 5DLML 4NC0B 3F6IA 3VW3H 1YNLL 3NCYP 2FEDD 3Q5TA 1KG0B 3RVUC 4JFDD 5CBEB 5BZDA 1RZIA 5GRJH 1JTPA 4R97C 2WIIA 1HYRC 1NGPH 3CFJB 2GAZB 1HH9B 5E8OA 2C1OA 4X6CA 1RZFH 1XEDA 3PUCA 3RTQC 3P77A 1OAQL 1UXSB 3FZUD 3CVHA 1UH4A 3KNBB 2AJUH 3BUTA 4APQA 4E0RB 4Z7OE 3C2SA 1UWXH 1U8MB 5L7XL 4LASL 2CJUH 3BZ4A 4HXAL 5JZ7C 4ZSOE 5I1IL 3IDGA 3QIUB 1WC7A 4UU9B 4MCYA 1II4E 3IRZA 3U30B 2X42A 1AQDA 1WSST 2PO6C 2ERJC 1OSZA 1P84K 4NM8L 2BSRB 3WE6B 5EUOE 5E24E 4LMQI 3M1BA 3MUGA 5IBLC 1HEZA 2BNQA 1AIFB 4MSWA 5I1DB 3FOLB 3JTTB 1YMME 3BD5A 2HRLA 3NA4A 3ILPA 3W0WA 3QFJB 4I3RH 1BZ9B 2MQCA 4MB4A 3ARTA 5E99L 2OZ4H 1IVLA 4N0UA 4LU5H 3BZFB 2DOCA 1A14H 4FG6D 3BX7C 2C3VB 5FHAH 2IPTH 2N7BA 4LKXA 3BESR 4K23L 1REIA 3WNNA 2GK2A 1KN4H 5EUKB 1QOKA 4NN7C 1OAUL 2LU4A 4UV7L 4QRTB 4TNWF 4W6XB 1MVFA 1TETH 3QZWG 1XGQA 3VFSA 1XF4B 3LHPL 3IFOB 4O9HH 2HKHH 1FORL 4PUBH 4RX4D 1XCQA 3TBYB 2Y5TB 5F9JB 1X5AA 1MJUH 1VFBA 1KT2B 4Z18A 3PE9A 4ORZC 2YN5A 4BM7A 3OKEB 4YWGH 1DQJA 1Q9OA 4PJ8B 4PTTB 5H8DA 3AXLB 2BVTA 1J0IA 2CIIB 1TVHA 1KCRH 1S7QA 4JRYE 43C9A 3OF6D 2AQ1A 4IRJA 4LHQB 1QQDB 4X8XA 2X1OA 3P4OB 1KJVB 2BY3A 1JMZA 4PRIB 4L1HA 4F7TB 1A5FH 2GUOA 3HNSL 5CHNB 3EYOB 4PJ5B 3TA3A 1G9MH 4X7TB 1FJ1B 3L3IA 1AHWA 4NQXA 1JNHB 2YD4A 3INUH 4AL8L 4OZGB 5IQ9B 4KQ3L 4JQVC 3REWA 3VI4E 4M7JH 2VDML 2XI9A 1JTTA 4Z7OF 5TPWH 1S7WA 1SYVA 5C2BL 1RSFA 2GTWB 5K59E 5ABDE 1KN2L 4EXPX 5L8JB 2VKXA 4TRPL 3K3QA 4KK9C 5B4MC 4LDOB 2F8OA 4QRPA 4UV4H 5FUCE 5TE4L 4GXVL 4C56E 4LGPB 2J8UA 3L6FB 4D94A 3DV4B 2YUVA 5GS0L 3V7MA 1X5GA 1QR1A 1EEYA 4UT9L 5CGYC 4NRZA 5F3HA 4F37K 4QY8B 4TUKL 1A6AA 4J8RB 2AAVA 4CW1B 3QEHA 4L4TD 3ALWA 4ZDHB 5DDHA 5KSAB 3MOAH 4U1KA 3X12A 3RVUD 1KCSH 3QDGB 2NY3B 4UDUA 1NC4A 4CMHB 1KEGH 4LQFH 1R3IL 4OLVL 2XNAB 3FQXA 3IU3B 4XBPA 3ZSSA 5DJ2A 3JWOH 3OTTA 3I85A 1H0DB 3EDEA 3RTQD 2RCSH 3WFEL 1WEJH 2F54D 3MLWH 1N5AA 1QSVA 4X5WB 2NX5D 2DLTA 1IAIH 5D7IB 1WT5A 2Y5EA 2Q7NA 3MRBB 5ADPH 5E4EB 3T0EE 2XTJE 3EYSH 3BEVA 4Q7DA 3TH2T 2KZ1B 1K8DB 1A9BB 2DS4A 2AVGA 5JZ7D 2IGFH 5IW3A 1FFNA 5DVLA 1A4JB 3KLAB 4WI4A 3FB5B 3QIBB 3RUGA 4JLRA 3W11C 2KBGA 2PO6D 2AJSH 1F8TH 2V2WB 1Z9LA 2D7PA 2F53A 2VXQH 3D0LB 1VFUA 5J57B 2X89A 4AT6A 5IBLD 1FFOB 4LPTA 1MJJA 5BZWB 2X1WL 4FOMA 3U4AA 1MLBB 2AQ3A 2G5RA 1MI5D 4PGDA 5B22A 1MFDH 3IGAB 1GC1H 2AABH 4FTVA 5C09B 1R24A 5KSVB 2ZSWB 4OFYA 2EDQA 5HI4C 1U95A 3CDGA 4D0BB 3EZ8A 3PGDB 2CLZB 4DGYL 4J6RL 2V2TA 1I8MA 3HG1D 5GGVY 3VFTA 1I7UB 1TMCB 1A7OL 1K3ZA 2Y7QB 3VI4F 3CLEH 3QG7L 3UMTA 4LLQA 5T5NG 2BVUA 3GI8L 4KROC 12E8L 5K59F 4YDKL 1PQZA 2XG5A 4L8DA 4N0FA 4UOJA 4FQXB 4IS6A 4NQVA 1Q0YL 1MJ7L 1Q0XL 3BE1L 3N1QC 3VFVA 5ESVA 1X9QA 1MHCB 5T1DL 4XC1H 3GMRA 1DVFA 4YUEL 1FVCA 4OI7A 3MX0A 4M9OA 4MNGE 2B39A 3FO2A 3ULSB 1HSAB 3VGBA 4XNQB 1CDIA 4LSRL 4P2YA 1D3CA 2WAHA 3GB7A 3ARGA 1DQDH 4IIQC 2QSCL 4YXKL 1CDHA 3MA7A 1E28A 3PWUB 2EECA 1ULVA 5ANME 2R15A 4NSKA 3F7VA 1VEMA 1JNLH 2OL3A 2ID5A 1Y6MR 2FX8H 3LKSA 4CUCA 3E1F1 4TVPE 3TT3H 4NQEA 3C5SA 3MLTA 2FNBA 1TNMA 1HI6B 3PGFL 5FUZH 4PPTA 4QXGL 3R4DA 4AZ8A 4OGYH 4QHLB 4X4XA 2OI9C 1TQCC 1YY8B 1Z2KA 1YEDB 1X5HA 1J1XL 2OXHA 2GY7B 1TQBB 4G80A 3MRQA 1JF1B 4KK9D 1HXMB 5B4MD 4JREB 1JGVH 3GMMB 1CU4H 2EXYC 3BAEL 3OBAA 5CEYB 2FBJL 3U46A 4XP5H 1GOFA 1MH5B 1NFDA 5GGRY 3GSXA 1KNOB 1V7MH 2FD6H 1E4XI 1BIIA 2VNCA 3FHAA 3NN8B 4IOIB 4PRPD 2RAMA 5CGYD 2XZQL 4AIXA 3VWKB 1AO7D 4HEPG 4O00A 5KW9H 1B9ZA 1QVOB 5JUEL 5F7DA 1MCEA 3HI1B 1ZLUH 3MSPA 1KB5L 3BKYL 5F1IA 3ZYJA 4JDVB 4KJYB 3DVGB 3DV6A 4LCYB 5HY9A 3HC3L 3MPCA 4CAGA 4JFFE 5DD5L 3N1FC 1XCTA 1BLNA 4JPWH 5EDXA 1U8NB 3AAZB 4E42B 2VL5A 2BMKB 2J8OA 3KDMA 3LN5B 4ODUA 3UYOD 4PGEA 1U8JB 1IEAA 5LGHH 5JR1L 1JE6A 2GIYA 5C0JA 1TLKA 2FSEA 2W9DH 5EPMB 4YHIB 3U79A 5CSZA 4JANB 1A22B 1INEL 1ZK9A 4PYGA 5DQDL 4NZDA 4DFIA 5C86A 2COQA 1N26A 2B1AL 1OOAA 1WWBX 4XP1H 4KZDH 1PX3A 1JNNL 5DJAA 3W11D 4X4YA 5L2JB 4OV5A 5IT2L 2FYYB 3OX8A 1KJ2H 1G6VK 2DQJH 4NQTA 3NCJH 5C08E 2D03L 3V52H 5FYJD 1CGYA 2NY1C 4XNUH 4WW2F 4DFHA 4PJAB 2BOCA 1JUFA 2YA0A 2R23A 4Y7MA 1V7NH 4NO0A 1EERB 1EGJH 5HI4D 2BVOA 2EYTA 2W07A 3CCHA 4OZFA 4N8VA 5GIRB 1WFNA 4NJ9H 3F7PC 4YNYB 4I2XB 3WJLC 3EW3B 5EBWA 4GRWF 1KCLA 2JJSA 4OIIL 1CR9L 4XCCH 1FN4A 35C8L 2YD8A 4P48A 3A67H 1D6VL 1JWUA 1XGTA 5FYLL 5I8CA 2LVCA 1K5NA 4KROD 1I9IH 2BK8A 5HHQA 2PETA 3SE9L 2CXKA 4Q9RH 3WN5C 3X14B 4F37F 1WBXA 5E6ZA 5EBLA 1IFHH 3O9WA 5KOMC 2NY3D 3KPSD 4G5ZL 5CSBA 4OV6F 1YNKL 1MJ8H 1FNAA 3C6SA 1H5BC 1MVUA 5CCKL 5CD3B 4HKJA 5KVEL 4E41E 4WJ5B 4UIKH 1AP2A 3ES6A 3QUXC 1P1ZB 2P47B 4JFXA 3WO4B 1A7PH 4EI5C 3KJ6H 5E2TH 1H3PH 2DQEL 5EO1B 5JQ6H 4XH2B 2C1PB 5GS1C 5BXFA 2JJTA 3DX8B 4G8IA 4BA8A 1NFKA 3ZT6A 3UJJL 5GXBB 1S7VB 4U3CA 4XCEA 5ACMA 4OD3H 4YQXL 5A2IH 4M43H 5DO2C 5SWZD 5IM7A 3KPPA 2GSIA 1J8HB 1A1MA 5JOPE 1K2DA 4YEFA 3WNLA 3GMNA 1WBZA 5C6TH 4WI5A 3VDBA 4ZD3H 2V5MA 5I73B 2IF7A 2WBWB 5I1KL 4QHKJ 4WO4C 1NDMA 3ZDXF 2ENSA 2HAZA 2O61A 1AD0B 4KDTA 1EHNA 5IJKA 3GGWB 3L3OA 4Y4KA 2EXYD 1I7RA 2Y06H 4JO4H 2X4SB 4WV1B 5EIQA 1IEBA 5GRVL 1LO0H 3LV3B 1TCMA 2AJXH 5BOZG 2P44B 1FYHB 3P0YH 2A6JA 2YRZA 4I4WB 1NCAL 2HTLC 2HKFL 1V5JA 1XGYL 1I4FB 4JPKL 1I1CA 4AMKL 5B8CC 4FQJH 2AK4B 3G5YA 4R7NA 1FZOA 4ZFZA 2ZCHH 1TZGL 3I6GA 4PS4H 1AGFA 1L7TH 3DUSB 4GAYA 4XB7A 4GUPB 1T3FB 2B4CH 2XY1A 3O3BB 1INDL 4G8EB 2PYFB 4GW5A 4YHLH 1XIWC 1F4WL 3IJHB 1DN0A 1BREA 4DUVA 4FP8L 4IJ3C 4Z7VA 4NHUA 1XT5A 4JG0H 3RJDA 4I3GA 1ZT1A 2A73B 1HHIB 5E95B 2Q8BL 1YQVL 4H5SB 3IFPA 3QA3B 2YA2A 1DFBH 2LE9A 4J12A 3HPLB 5D71H 1F90L 4OD2B 3RAJL 3HE6C 5EU4B 2IBGA 3EYUL 1WFUA 3OG6B 2OTWA 2R56H 3DXAE 4LSUH 1MUJB 4ELKA 4R2GB 4ALAL 3C2AH 5E1AB 1Q94A 2H9GA 5J13C 5GGQL 1AFVH 4PP2B 4WEBH 2Q8AH 4F7MB 3V5KB 1BQLL 1OP3H 3RBSA 3VXMA 2VSCA 4FQHB 2KDGA 4B5EA 2DLIA 4NKOA 4ODWB 2NY1D 3MYJA 4NRYA 3S8WA 4ZG1A 4UAOB 2W1NA 3PWPE 2BVYA 5D2LB 5KS9B 4M6OL 4KTEL 2MOVA 1UB6A 1S7SA 3CK0H 4QT5A 5ILTL 5BRZB 3WXWH 8CGTA 5D5MA 2JB6B 4ZFGH 5CKGA 1X3DA 5GGVH 4IRZH 4XPTL 1A7NL 1G7LB 2WINA 5DVKA 5B3JE 1D6EB 2BHYA 1CDGA 5J12B 1CQKA 1KXQE 4Z77A 4MA3B 2N7AA 2H26A 4XNYL 1RHFA 4GW1B 4E9LA 4XP9L 2ITCB 1T04A 4JCLA 1A4KA 3VWJC 3PNWA 5IG7B 1YN7A 4JKLA 3K2MC 5GGUB 4CN1A 5BS0D 3CFDA 3P73A 3TC9A 1MHHB 3BPNC 4LVNB 4MQTB 4P5MB 4KTDL 1EV2E 4K3DH 3K4ZA 1WVZA 4GKSB 2ZOKA 2VYRE 1T2QL 4NQCE 4HWBL 4HHAB 1TTGA 1OQOA 3F7YA 4RGOL 4YHZL 3QH3B 2P5WE 3S36X 1SJHA 1AXSA 1FVEA 1CI5A 5HHME 2DQIL 4WU7B 3QUXD 3RX7A 5IVZB 1QLRB 4EI5D 2DTSA 2O5XH 4JZJB 2XFXA 4OBRA 4NZTL 3C8HA 5SWSB 3TCLB 4HLJA 4K3GA 1S3KH 1C5DA 4V2CB 5DD6A 1S9XB 2ATPA 4J4PC 1JZ3A 4PV9A 1YEHH 4F7PA 4RAVB 5DO2D 5CFHA 4LBEA 1QO3A 3SDXE 2FO4B 4LGRB 4I0PC 1M4KA 4JEGB 2N4IA 4LARL 2WK2A 4WO4D 2EC9T 1KJ2B 3O8XB 2APTA 1E4KA 5D70L 2BXZA 2DBJA 4IMKA 5D2NB 4F57L 1NCCL 4BQBA 1CIDA 2HTLD 3WNPA 2JIXD 3LKNA 4PJGA 3ULVH 3DI3B 4M1DL 1T0MA 1B3JA 5TH2B 4RISL 5D6DA 3AREA 4NQDD 1OY3B 1IGJA 4I5BA 4HGWB 5DRNB 5ACLA 3RRQA 1MREH 5B38A 4HZLB 4Q9CA 1BVLA 2BCKA 1GGCH 4MLSA 4YHPA 2HJLA 5I75B 2BVQB 4Z5RB 1XIWD 3DO7A 4LRNH 5C0CE 1TJIL 5IB1B 4K2UH 5LVEA 3PABA 2YZ8A 5EN2B 1LO3H 4X6CE 4RDQG 4XNMB 1NMCB 1CTOA 2OBGA 4NP4L 4ZTPL 1PG7H 4DN3L 2ZCLL 4PRBB 4TSAL 1HYSC 3QQ4B 3BN9C 1F02I 5DGQA 3QDMA 5H2BA 3UZVB 1BFOA 1OAKL 5BVJB 1K3IA 3CFEA 3IJSA 2OXGA 3O2WL 2H41A 3B8YA 3QUML 4RFOL 5BVPL 1P2CB 3HE6D 2FB4H 4OCYH 2IH3A 1IAMA 2CO6B 4UQ2A 1ND0A 4GRWH 1X5IA 2B1HL 5J0BA 4RRPA 1H3GA 4S1SH 3NA9H 1LE9A 2VDPH 4NBXB 2P5EE 5ITFA 1PZ5B 2X09A 4WWKA 1YEJL 4NKDA 1ZA3A 2R1XA 2QKIB 4RAHA 1RVFL 3VGAB 3BPCB 15C8L 1EHLL 2NY5C 4ZOAA 5E2VH 5GRYA 4EN3B 3QULB 5C0GB 3GSOB 1D5IL 3CSGA 5DRXB 2QADB 4CJ0A 3RWGA 3FB7B 1NGWA 4Z0BH 3Q5OA 4WU5A 3ECBB 2B2XL 3OR6B 3MLVL 4N0UE 2GSGA 3UJTH 4WW1A 1H3VA 3FL7A 1D5MB 3SE4C 3O0RH 1NBVL 5DUMH 2X2YA 2Z8WC 3BHBB 2PXYC 5IQ7H 1XF3A 5CMAB 3IDJA 3C08H 5D7LB 3IYLW 3JTSB 4R4FL 4F7EB 4JAMA 1FV1B 1T0PB 3VWJD 1NL0L 4NO5B 2DLHA 1I1YA 4GQ9H 1KIRB 2F58L 2P1YA 3P40A 4HJGB 3JWDL 2VLRD 2APXA 1VGEH 2KZWA 1DQLL 5JO5A 2R0KL 4HKZB 4O58H 4AQOA 5MI0C 5IFJA 1EEZA 1JGEA 2Q7YB 2Z93A 1RZGB 4P3DB 3TFKC 1TIUA 5FKPA 1NCNA 2EYRB 5KVGL 3DUUB 3QEGH 2P8MB 4M6ML 4ETQA 1IAOB 1UWGL 4LVOB 3U9UA 4ZUWA 4OLYL 5CP3H 4YBLB 4R90L 4Y19E 4WUKH 5H37G 1MRFH 1ZHLB 1NGXB 3RZCC 1HKLH 4LCWE 4FFYL 4MLIA 3ARDC 3FT2B 4GKOA 4X6CF 4X5XA 5A16A 4J4PD 1FE8L 4UT7H 4K3JL 4R0LB 3IKKA 5DEFA 5C07D 5EG6C 4LLUB 5TQ2L 2DRUA 2QQKL 4R4BA 5J3HD 3D69A 2ADJA 4I0PD 3CFBB 4AEIH 1ITBB 3QHFH 3IVKA 3MACL 4HIIA 1YMHA 4PRHA 3DGGB 4ZFFA 4IMLA 1DCLA 4UINL 5FDYA 4OFVA 4QRPE 5DWUH 1PLGL 1N59A 2B7DT 4ODHH 1RJLB 2J8UE 2IAMC 3DSNA 2EDOA 1BZ7B 5K9OB 1WZ1H 4TULL 4C56B 1U3HA 1F4YH 3GMPA 3WFHB 3W81A 4DZ8B 4PG2A 4NRXB 3VRIB 1MFCH 3CFCH 5IHUL 1CLOL 4ODTH 3I3EA 1NANH 1ZHBA 2A6KA 2GEEA 1OAZH 2XZAL 1EBPA 2IQ9H 2YMXH 2BVPB 5T3XD 2V5YA 1M6OB 3QHTC 4PJ7B 3EKCA 5EWIH 2OTUA 5FYJH 2X9XA 4PBWD 3GHBH 4OCSL 2FR4B 3AU1B 1N64L 4RSVA 1WZKA 4MA7L 1SMOA 4FMKA 3RL1A 3VFGL 3FRUB 4P4KB 3O6FA 5H94A 1HYSD 3BN9D 1P6FA 4OCNC 3MBEC 3GMQB 3Q5YA 4JKKA 4AEFA 1CE1H 1MAMH 3QDJE 3NGBC 3GHEL 2YPVH 1TPXC 4GKZA 1HINH 2QR0B 3KPLB 1CCZA 1MHPL 2JELL 2XACC 4HWZA 4QO1A 4RZCB 1OGAA 1ZA6A 4MXWH 3MV7B 3LEXA 1HIML 4KQ4H 4X9HA 4ZAKA 5HYSB 1IKNA 3T65B 1DBBH 1FL6A 5CJBA 3PV7A 5IMMB 2R1YB 2FIKA 5C0AD 2HWZL 5SV4A 3ZKMC 4KY1L 2D4FA 4M4RA 1FYTE 3GSUA 1I1AB 1AY1L 4XCFH 4Y16C 4FTVE 3VXRE 3O2VL 1H15A 1FNFA 5EU6A 4YC2B 5TGBA 1SEBA 2EDHA 2IALB 1IC7L 1GZPA 3KXFB 3CLFH 1RZKL 3AUVA 1D5XA 4OQTL 3KAAA 2R4RL 3N06B 1S7XA 3NCFB 1OW0A 3P4MA 3ZDZF 1N6QL 1DL7L 1BWWA 2VZ3A 2X70A 5D93C 5FUCC 3WS3B 2G60H 5EC1A 3LN4A 4M7KH 1URLA 1LK2A 2FHBA 4Y2OA 1YEEL 1U8LB 5FECB 3U0TB 1CYGA 2PXYD 1RPQA 3C9NA 3C8KA 4WHDA 5JXEC 3ESVF 3JZ7A 3WEXB 4HS3A 3EO9L 2H6PA 3OKLB 5GGRB 4PJDA 1OAYL 1CLYH 3T8XB 5FF6B 2AV7A 1FL5B 2HJKB 3HC0A 4JO2L 2J8UF 3ZTNL 4HJ0C 1OL0A 2J6EH 1ZWIA 3O3EA 2EDFA 3PWJA 1MEXL 4KHXL 1M71B 4Y2DC 1J18A 1BM3L 1TNNA 2V7HA 2PTVA 1H3TA 1IM3B 4YHMH 3FTGA 2RQ8A 5E1HB 1I9EA 4D8PA 3TFKD 4ODXA 4XAKD 3SE8L 3QBTB 3UTTE 3MQIA 4JRWA 5GRWA 1RUKL 4WW2B 4LCCB 4M6NH 3ARBA 2EDTA 2NW2B 4U2ZA 1HWGB 3T0EC 4UBDC 1QNZL 3RZCD 4W81A 2XTJC 5E8EB 1NAKL 1MIML 1NDGB 1J0ZA 3ARDD 5I74B 4CU8A 4XP6L 3OKNA 4M5YH 3ARFB 2EDDA 2R1WB 4ZFOB 4NNXB 4O2CA 1QBLH 3KPRD 3OV6A 5EIIA 3AVEA 4GRWB 2E6PA 3AB0C 3LKOA 1UG9A 5HI5C 1RFDL 3NPSB 1QSED 2MJWA 5DSCB 8FABB 4RQQA 1YMMD 1U6AL 3RUGF 3MJ9H 2X4UB 4P99A 2VLKA 4FFVD 4MA8H 5DD1L 2DAVA 4JFZH 2DLFH 1WAAA 4ZS6C 4YFDB 1TJHL 2IAMD 5J1AA 2YRPA 5EZLA 3HZYB 3RA7H 4DOHE 5C7XH 3Q1SH 5T1LA 1RIUH 1TDQA 4LLAA 1Q9WB 1J05A 3SKMA 1ZS8B 4O4YH 5F9OL 4G6KH 3EYVA 1WCBA 4OZIA 5I30L 3SJVD 3GJEB 2DQFA 1PKOA 1SVCP 1Q38A 1QFOA 4P2QE 3VFWB 1UVQB 4ZNEA 3HZMA 3P9LA 1A6WL 2IQAA 3MFGB 4Z76A 1DDHB 1SBSL 4L8SC 2BOBA 1MCJA 1KB9K 2DI8A 3OAZK 2GTZB 4XHQA 1KGCE 3RWEA 5I18L 5EFIA 3ARSA 3OJ2C 1JF6A 2ZPKH 3MBED 5GRXG 1IM9D 1PDKA 5CEXA 2P45B 3TO2A 2HLAB 3U2SA 1LD9B 2XWTB 4V1DA 1YY9C 1GXEA 3L9RA 4JQIH 5LAXB 4JRYD 2NZIA 3RIAK 1T1YB 4PJXA 3ZKXB 5C6WH 3SBWA 3UDWC 4OBSA 4LSPL 5ISZA 1BECA 3H8NA 4HXBL 4ETYA 1I3RA 3AS2A 2VXVH 1W0YT 4I18C 3VW3L 2ZNXA 3QEQE 3RY6A 2UWEB 3TO4A 3IFLH 1NUNB 3ZKMD 3FCTB 2M1KA 4LPWA 5GRJL 4X7FC 2J3SA 2QHRH 2IBBA 2M2DA 4Y16D 3VJ6B 1NGPL 1BPVA 1P4LB 3VA2C 5ADOH 3RQ3A 1RZFL 1Y0LA 2G75B 3OKMB 5A40E 1MQKH 5EH1A 3ZKNC 4YDVA 3HCVA 1OQXA 1CT8B 5FM4A 2AJUL 4XWGH 1A1OA 3T4AA 1X5FA 3MLXH 2B20A 4RGMB 4BKLB 4C56D 1CDCA 3W9DA 1RZ8B 1C12B 1TCRA 2CJUL 5JXED 5JHDA 1YNTA 4HCRA 4R3SB 4JPVH 3RHWK 5DEZA 4TUOB 2F19H 2ESVD 3WKMH 3CVHH 4YE4H 3PQYA 1P53A 1NFDF 1PD6A 1X4ZA 3SQOH 5F89A 5I76B 4HJ0D 4JPIA 4JQXC 3RNQB 4PG9A 2ZG1A 2W0FB 4G9FE 1IGCH 3ROLB 3QRFM 2EC9U 3REVB 1CFQB 3VMOA 2YPLA 1PYWA 4Y2DD 5J06A 1S7TA 3FT4B 2XWJA 4LHJB 4I3RL 4XRCB 1AR1C 5B39G 2AXGA 5HHOA 2OZ4L 4XMKH 3GSNA 3S98A 3HC4H 1JYNA 5KJRH 4LU5L 1MOEA 4U6XB 2VAJA 4HUKB 4U4BA 4DKEH 5ALBH 1A14L 3U1SH 4G8FB 4PJ9C 3T0ED 2K3TA 4UBDD 4MQXC 4GJTB 2XTJD 5FHAL 3QR2A 5DJ0B 2IPTL 2WV3A 4LSQH 3MO1B 3MGTA 3T1FA 4KUCF 2DQGH 3CDFA 1KN4L 4WTXA 5I17A 1HH6A 1FP5A 3AGVA 3EOAB 3QNXB 1TETL 2BRRH 4UOW1 4JZNA 3AM8C 4O9HL 2HKHL 4PUBL 5HI5D 5JW3H 1MCIA 5FKAA 3RWFB 7CGTA 3MREB 3LOWA 1MQ8A 1MJUL 3B9KB 3FMGH 1EVUA 3VI3E 5ID0B 1EEQA 2W60A 2RGSA 4YWGL 4S11A 4ZS6D 2MWCA 3D2UA 1AGCA 1KCRL 3PL6A 3SKOB 4BQ6A 4BSJA 1EZVY 5T1KA 2J4WH 4Q6IA 1ZT4B 3SDDC 3DRQA 2J88H 1X5LA 3IKCA 4BFEA 1YEFH 3E8UH 5HGBB 3U7WH 1YJDC 4ZXBC 4JHWH 3R06B 1A5FL 3K8LA 2E5EA 3WCYA 1G9ML 3QWQB 4NCDA 5C0BA 2GI7A 5HVGB 2BRQA 3MR9A 1QEWB 5I8KH 2HN7B 1JGUH 4C58B 25C8H 2XG4A 1HH9A 2Q20A 3INUL 3QXAB 1NAMA 1HDMA 4FXGA 3A6OA 3VRJB 3BO8B 3D39A 3HKFA 2X7LB 3U36A 5EO9B 4M7JL 1UXSA 4WRLA 2IBZX 4JFEA 2E27H 2BXYA 5TPWL 3KNBA 4DKDC 4N9GB 3C5ZC 3TEUA 2HLFC 4JGMA 1NGZB 2AXFA 4UV4L 1U8MA 2EIDA 1QA9A 1Q1JH 2FH6A 3ILQC 1YY9D 4IHOB 4TSBH 4UU9A 5DFVC 4DAGH 2C7UB 3I02B 4Q2ZA 4BH7B 5BW7A 5DF0A 4DVBB 5AZEH 3DXAB 1DUYB 5HJ3A 3VXOA 5FYKU 2CQVA 3LDBC 4X98B 1UJ3C 5FK9B 2C4XA 3MOAL 3OKDB 3CZJA 4TVPD 1NJ9B 4KVCH 1KCSL 4YHNA 1CFSB 2PYEB 4L3CB 1J0YA 3QFJA 3LQAC 1KEGL 1BZ9A 4LQFL 3NFNB 1CTNA 2CRMA 6CGTA 3PWPB 5I0DA 3JWOL 2RCSL 1OM3H 1WEJL 3MLWL 3ZKND 5IEKB 3BZFA 1IAIL 4HIHB 3DYMA 3LPFA 1MWAH 2JE8A 1IC1A 1VGKA 2J5LB 2OQJA 3EYSL 1EUTA 3H9ZA 5B3NA 5DTFB 4P2OB 5EUKA 3T0WA 2IGFL 1S7UB 4MS8C 3STLA 1FHGA 1OGTB 1FNGB 2AJSL 1SBBA 1F8TL 3ARVA 4JHBA 2Z31A 2WSKA 4JRXA 5JDSA 2VXQL 4XXDB 2V9RA 4X6BB 2EE3A 4XCNB 4HUXA 3FO0H 1KT2A 3NFPB 4ODBD 1JI1A 1OWWA 4JFFD 1OSPH 4D3CH 4JDZA 2WBJC 3MRNA 3OQ3B 1MFDL 1SQ2N 1I8KB 2CIIA 2AABL 4IRSC 4FABH 3H42H 1AR1D 3U0PB 3V4PH 1QQDA 1CGSH 3L3GA 5DMGC 4YK4B 4YAQB 4LHUD 3MV8A 5HHMB 1N4XL 1RZJH 1W0WB 2I07B 4PJ9D 1KYOK 1OF2B 4MQXD 4PR5B 4X7TA 1CFNB 4ZTOH 2C4FU 3CLEL 3RI5F 5LQBH 2GJ6B 5D1QB 3P4NB 2ED9A 3RIAF 5HDQH 3PGCB 5DS8A 1ZANH 2LVEA 3SCMB 3BFOA 2GTWA 4XC1L 5C08D 2R0ZH 5KG9B 1KPVA 4XVUC 4QGTA 5HHXH 5D1XC 5DA0B 1NEUA 4YXHH 2DWDB 3K1DA 3GSRA 1IQDB 3L6FA 4IDJH 3KS0H 5FB8B 1ZHKA 2ZUQC 1FPTH 1DQDL 3L5HA 4HF5H 4U7KA 4UUJA 5E8PB 3V6OA 4QY8A 1QRNA 4PJGE 2XWBB 3SDDD 1MHEA 5DRZB 4EIZC 3D3VB 3U0WH 1LE5A 3PHQA 4ZUSB 4ZS7H 1JNLL 1QUNA 4ZXBD 3BJLA 1X4XA 2FX8L 5FYKH 4KPHH 1YZZA 3QDGA 3MRHA 1FFPB 3TT3L 2XT1B 5D5MF 5CEZH 4WFGE 1A3QA 3EFFA 3B2VH 5FUZL 3GBMH 4YGVA 5BZDB 1RZIB 2A2QT 5D7KE 4OGYL 5T1MA 3SKJH 3G6AA 3O4LA 5E8OB 4RMTA 2WBKA 5D7IA 1QSFE 3UTPE 4ONFH 1QBBA 2OL3H 3C5ZD 4K7FB 2DM4A 1B4RA 3P77B 2NY0B 3W82A 1JGVL 2HLFD 3CVHB 1CU4L 1TTFA 4XP5L 3RGHA 5DJDA 4APQB 3ARRA 1A9BA 4MNQE 4NIKB 2JJUA 3ILQD 3EO0A 3KLAA 1V7ML 2FD6L 2D31A 5F1OB 5DFVD 4E41D 5MERA 2BJMH 3CX5K 3BZ4B 3PWLA 5KANI 1IEHA 3IDXH 4HIJA 3JVGA 3IDGB 1WC7B 1PJ9A 4MCYB 5KW9L 1EAPB 1YA5A 4G7YH 4KGLA 1QPXA 4C55A 1T5WB 5KVDH 2NY6B 3M1BB 3MUGB 2Z8SA 5JOPD 1HEZB 2BNQB 4MSWB 4K71C 3VH8B 3LRSA 4JPWL 5KSVA 2ZSWA 1Z6JT 5IESH 1G7HA 3MRGA 2J7LA 3FT3B 1FDLH 1T6VN 5FIEA 1KELH 3ILPB 3W0WB 4PY7A 3PGDA 4LIQH 2AI0H 3X11A 4U1LA 3HMXA 4Y4HC 3MLYH 3V8CA 1WLHA 5LGHL 4OB5H 4KRLB 4OUUA 2IH1B 2W9DL 3C6LA 2BNUA 4TYUA 3QT2A 4F7CA 2Q3AA 1R3LA 1B6UA 4L29A 1U8OA 1ADQA 1Q9LA 4MS8D 4XP1L 4KZDL 2D0GA 1T03H 1XGRA 4HWUA 1KJ2L 3DSFH 2UY7A 2DQJL 3NCJL 4U6VH 4POUB 3VFSB 3V52L 4L8BA 4EDXA 4XNQA 1XCQB 5C0IA 4XNUL 3OZ9H 4PJGF 3IDUA 4NYLB 5DZLA 2WBJD 1LO4L 1L0QA 1U3YA 1V7NL 4IRSD 1DQJB 1LVEA 1EGJL 1Q9OB 1KCVH 2NY0C 3S4SB 1TVHB 1S7QB