3EO9H

Crystal structure the fab fragment of efalizumab
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
214
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGYSFTGHWMNWVRQAPGKGLEWVGMIHPSDSETRYNQKFKDRFTISVDKSKNTLYLQMNSLRAEDTAVYYCARGIYFYGTTYFDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Efalizumab binding to the LFA-1 alphaL I domain blocks ICAM-1 binding via steric hindrance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Efalizumab Fab fragment, light chain
total genus 41
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2008-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eo9H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eo9H01
1VERA 1TVBA 4KAQH 1N5AA 3IXAB 2P8PA 3IGAA 4Z9KB 1GZPB 2FLRT 1RURH 4YIQA 4PJ9B 5ESQA 3TO2A 4NSKA 4HG4K 1CQKA 1XFPA 4X4XB 2OYPA 2Y4SA 5CGYC 4WTZA 3RU8L 4D9LH 2J5LB 1OTTC 1KXTB 5HHOE 4MAUH 5F93C 2VIRB 4J4PD 3D9AH 4NHUB 3HC0A 4P46A 2HT4D 3UJIH 1LP9E 4ODHL 5DJDB 4N0CC 3FB8A 4LCWA 2BSED 2GTZB 3MO1B 3GJFH 1S7UA 4YDKL 1V8HA 4JB9H 4ZXBD 3X14B 1DQQB 2XACC 1GGIL 1OAZL 4MD5B 3V5DB 1PZ5A 5JORA 4UIMA 4ODVL 4Z7OE 4LLWB 4Y4HA 1SY6H 4P2OB 2R2BB 2E9BA 3NACH 2WBJC 5IV2B 2WUBL 5JZ7C 4HXBH 4H8WC 3CFBA 4KV5E 5IB5B 4QOKB 4HS6B 4ZQKB 3X13A 3CCHA 2DM4A 1VEMA 2O5YL 2XZAL 2FJGA 3TIDB 3IVKB 2ATPB 5IB4B 4K7PH 2XKNA 4N0FA 4CVZB 3QFJB 1N7ML 4N1EA 1EVUA 4HPOL 4Z76A 2QEJA 2DOCA 5FB8B 4JFFA 4X4ME 5F9OH 4NM8H 4LQ1A 3GIVB 3U6RB 2CKBB 4P2YA 3PWVB 2F8OA 4WWID 3CFCH 4LKXB 2B5IC 2IPKB 1P1ZA 3E2HB 4OF6A 3NPSC 1KC5L 4DN3L 1RK0A 2DM7A 4KUCF 2PYED 2ESVA 1A21A 5BJTB 4X4XA 2APXA 2VR9A 4V1DA 4JFPA 5J12B 1NEZB 1R5WA 3FMGL 1I3RB 1JNNH 5IK3A 5F72S 2QADC 3HNVL 2NNAA 5C0GB 4L4TD 1MCCA 4WUKL 2OSLA 1MIML 4GBXC 4R90H 3P4OB 4M43L 1A6VH 4ZO6A 4JZOA 2KH2B 5TGBA 2ZUXA 1IT9H 2ZOLA 3R1GH 3VXUA 5I17B 4BFGA 5TDPA 4KU1A 4WIQA 2JB6B 2WINB 5ECJE 4XNMA 4BK4A 3DRQA 5BVPH 4LLWA 5DK3A 3WIIL 1U36A 4NQCE 4OD2A 4FQIH 4Y4KC 4JJ5B 2ZSVA 2VAAA 3IFNH 4KQ4H 4JFFD 1UWXH 4PYHA 2W9DL 4LSUH 1LMKA 3WNNA 1UJ3A 3DOSA 2NTFA 4P9ML 4Q2ZB 5T1KB 1PFCA 1QPPA 4JPKH 2X9YA 3FB6B 3TJHD 3TCXA 4YDKH 5DGQA 3THML 1V3LA 4CVXA 1RUQH 1S7SA 2AW2A 2D7NA 3QUML 3UJIL 4L8SA 4ZUVA 4G9FE 3GB7B 3ZKMD 1T3FB 1MFBH 5CJXC 1OAXH 4Y2DA 3NFPB 2P46B 3KPLB 3SKOB 2VDLL 3RU8H 2CIKB 1RUMH 5CUSL 5GRZA 5DTFB 3OKDB 3IJHB 5DJYA 5B4MC 3BZFB 2OJEB 4GS7C 3MNWB 4AMKL 1T1ZA 4HV8A 3E8UL 1CU4H 4X0KA 4Y4HD 3DHMA 3REWB 1C5DA 2GT9A 2ICWA 5I1IL 5GGRA 4XH2A 3QXDB 1MCQA 3FN0H 3KPNB 1MRFH 2VUOA 2C3WA 1T1XB 5T33H 1W0VB 3GSVA 3AB0B 1NCNA 4K3GA 1AGFB 4PREA 1EGJA 5HI4D 3HUJE 5E94B 1VPOH 1GYAA 2QADD 2FX8L 2EXWD 3BD3A 2ORBH 3QUXC 4WO4A 1CXHA 3D2UA 3TBWB 3EO1B 1H3VA 1QSEB 2F9BT 1JYVA 1MAJA 3CH1A 3FQTB 2J8UF 5BV7L 1FLRH 1DEEA 1F4WL 3SGEH 4APQD 3GSNH 4MJ4A 4Z77B 3NBNA 5JHDB 3VD7A 1ZHBB 4NPYB 4AT6A 4YHZH 4OM0H 1QTYT 2VDPL 4JRXA 2RAMA 3B2UD 1FZOA 5D71H 1A0QL 2G75B 2EIEA 3BIBX 4F9LA 4KY1L 2V5RA 4Z7NF 1DL7H 1QLEH 1JWUA 1F6LL 5DJ0A 5FDWA 1NC4D 2W92A 4EEEA 4Q6IB 3T04D 4NQCA 3QA3A 2R0LL 3CZFA 3WFZA 1FO0L 2ICEA 1G9MH 1ZLSH 5FV1L 2AJSH 3L5JA 4FZEH 3D48R 2RHEA 5DHVA 2MPAH 1NANH 2AJXL 4KUZH 3ZKND 2WUCL 3H42H 4L29B 3FQXB 3FFDA 4JDZB 1BBJA 1CZ8L 1BAFH 4YEFA 4HMCA 4J4PC 4HUXB 5E99H 3BQUB 2J1KA 3V6BR 2OXGA 3TO4B 1LE9B 4X9IA 4Y2DC 3E3QC 3AAZB 1JVKA 2X9XA 1JZ7A 1G9NH 5AG8A 3B2VH 4ODWA 3RUGF 1B0RB 1F3JB 3I2CH 2AS5M 2ADFL 5JNYA 4G9DB 1TQCB 5ID1A 4UOW1 3SDXE 4MB4A 5K9QG 3D39D 3QPQD 3MUZ1 4XPTL 4HC1A 4FZEL 5F7WC 3CK0H 3IDIB 3HG1E 3ZHKA 3RUGA 2BOCB 1TZGL 1QSFE 4NQDB 3O6FA 4JEGB 5T3ZE 5GGRB 3V4PH 1D5IH 5HYSG 3U9PH 3VXTA 4PJ7F 1BHGA 3MLSL 4TQEL 4V1DB 5C0CE 4P2RB 2XQBL 3BVNB 4FHBD 4PB0H 4L9LA 3DNKA 3OL2A 3WXWL 4LU5L 4CJ1A 2MQ0A 5IW6A 1LP9B 3MODL 3HNSL 5T5NG 5FKAA 4PV9A 1XF2A 4HKXA 2XZZA 1CFSA 5C2BH 1AP2A 1J1OH 1NJ9B 4Z78A 1BFVL 3SKJH 4KK8C 4QXUH 4S2SB 3BW9B 2CLRA 1BP3B 3AM8C 4EDXA 4YR6B 3OG4B 5IQ7L 5D6CB 3WIHH 1FSKC 1JFQL 4ZG1A 4LRNL 3H6JA 4ZFGH 4MQ7A 1RUAL 3DETD 3KS0J 4JN2B 4PJDF 2GCYA 4ZODA 1FAIH 5IFJB 5KN5A 3EYFA 2X89A 1S7TB 3IDYB 1N2RB 1BOYA 3IDGB 3IGAB 4M8QB 4UI2A 4MDJA 4LEXL 2CKNA 3K1DA 4U2YA 2R0ZH 1CU4L 3G5YB 3E8UH 5EUKA 3D0VA 1JNJA 1DQML 1SMOA 1F11A 5C09E 1NCBH 4TULH 1QFWH 2B1AH 1FV1B 1U8KB 4J23A 1KIRB 3O41B 4UINH 3ELAT 1S9WB 4JVPA 3FOLA 3QDJB 4R7DB 4XNUL 1SVCP 4TRPH 3GKWH 4HUMB 2BVTA 4HGKC 1S9XB 4GBXB 4U6VL 5I71C 3KJ4B 4OLEA 4ZXBC 3WO4B 4D0BB 4YDJA 1SJEB 3RWCA 2WP3T 2YUXA 1WZLA 4LVNB 4MNGA 4OLYL 4ZS6D 5I66A 3IDXH 3PABB 2XWTA 2PO6A 4L8BA 5C07E 1P4IL 5H37H 1OLZA 1YYML 5HHOD 1Q0XL 4OF0A 3FN3A 3R8QA 3IFNL 3Q48A 4OIIL 4Y4KB 3GMPB 5IBTL 3UZQA 2PYEA 3ULUH 2OR8A 3JVGA 4PRBA 2HH0H 4KTYA 5EOQL 3FO0H 2X05A 4U7MA 2ADIA 5I76A 1QHOA 2IH3B 5TF1H 1UT9A 4IRJC 3IU3A 5CILL 4YPGB 1BVKA 5FF6A 5FB8A 1I9RL 5DO2C 3MJ9A 1AE6H 3WFCH 5B3NA 4LHUB 3STZB 3ZYJA 4BSWB 1HHHB 2LU3A 1ZHLB 4WNQA 3SDDB 3U6RA 5HI5C 3UROR 4R90L 4WUKH 5IG7B 3T3ME 3H0TB 4OGAC 4W6WB 3P73A 1VEOA 2BVOA 1ZTXL 4HT1H 1MWAB 1JGUL 2VABB 5A40E 3P4MB 1NDGB 2NXZD 3W82A 1TPXB 1PEZA 1YUHB 2FJHA 1W0YT 1IC7L 4XNUH 1ZLWK 1F11B 3PWNB 3ZHLA 2PXYD 5F70A 4LVOB 1ACZA 2P1YA 3QDGA 4M3KB 4P59H 2QLVB 1MFCL 3DXAA 4G9FB 4MZ3A 1RJCA 3QQ3B 2B8OT 3D39E 3O4OB 5D1QB 4YBQC 3QDJD 4MCYB 4RQQA 3WNKA 3GO1L 4JHBA 3NCBB 3UZEA 3U46A 4JO3H 3OPZL 3QRGL 3OX8A 1H5BC 2FX9H 3WS6A 1U42A 4PJIA 3ME0A 3TBSA 5FFLA 2F5BH 1YEKH 2DQUL 3PWLB 1FIGH 1QD0A 2HJKA 3I85A 3M1BA 1OM3L 3WSQH 3HFML 2FL5B 5DQJB 3RGVD 5IVXA 2UY6A 2C26A 3UTQB 1DE4B 4FXLA 4XMKH 4LSPL 4JDZA 2OZ4A 3MA7B 4ZSOA 1V3KA 3C2SA 1GGUA 5JUEH 5GRUH 4PRPB 1JFQH 4MNHA 1NFIA 1AO7A 2PW1A 5C09D 3U7YL 4V1DE 5C0CB 1RD6A 5F21B 2XTJB 2HT3D 3CX5J 1A6TA 3U9UA 2QQKH 4HC1L 2X42A 5DEGB 2ENYA 2BCKB 4KKCC 4JFHD 4RFOL 3JV5A 3U48A 1YEIH 4JZJB 3WFDL 1JUFA 2EH7H 1OAZH 1UYWH 4TOYL 3FAXA 3T4AA 4JB9L 1MIEL 1G9MC 2IAMB 2R69L 1UCBH 4NKMA 2BXYA 2R8SL 1MI5D 4FP8H 5LCVL 5FUCC 2OSLB 1C7TA 4MAUL 1A7OL 2BC4A 5FECA 1FYTD 2J6EL 1MREL 1NAKL 4UT7L 4M6NL 2FWOB 2XKUA 3P4MA 3FN9A 2SEBA 3DTXB 5MP6H 3CFJB 5C0JA 1K6QH 1QLRB 5MEND 5L8LB 6CGTA 2JK5A 1C5DB 3ARED 5J11B 2FYYA 1LDPL 3SDCD 1HCFX 3TO4C 3QUYB 5C0BD 5GJTL 3TWCH 5DVKA 3DX9B 2W60A 3X3GL 4YDLB 1NCDH 2NMSA 3RJDA 2AJ3A 2DYPD 2F54A 4R7NA 5LQBL 1AP2B 4KZEL 1W72A 3U7WH 4HJGA 4Q9RH 1B2WH 1IKNA 5HDOA 5FA3B 1TQCC 1AO7D 4YHMH 1WBZB 5IOPA 1T0NA 2P8LB 3LZFH 4L8SB 4NUGH 1ES0A 5B39B 2B2XL 3LEVH 4IS6B 2AJXH 1A6UH 4RAUB 4X7SL 2OMBA 4J6RH 4F58L 4IOSD 5AZEL 4F2MA 4QT5A 5BZDA 1JCKA 4P23D 1FGNH 2NY6D 2XN9E 3V6OC 1OAKL 1DL7L 4MQXD 1UACH 1LDSA 4ZNCD 4U0RC 5B38G 1EO7A 1CF8L 4OZHA 3VJ6A 4IMKA 3EJYC 4I13B 3CCHB 1U95B 2PF6A 4PJIE 3BKJH 1EFXD 3QDAA 1VHPA 2BNRE 4KKAC 2ZKHH 4WFEE 1BQUA 4H8WH 1KB5B 1J8HD 4JY6A 2JJTC 4PY8J 3O3UN 1FFPB 1RZJC 1F4WH 1J05B 4Y16B 1A14H 4LARH 1N3NA 3F12B 3MV01 1S9WA 3BP6B 4X9GA 4F9LC 5D7JB 3RL1B 4WW1A 3TZVA 3B5GA 3NFSH 5DHYB 5C0BA 3QULA 5F6HI 1NBZA 4M00A 3T3PE 1Z5LB 5I19L 3OKOB 1RZKL 2YPLD 1NKRA 4RGNC 1Z3GL 3O2WL 4IJ3B 1WV7T 3GI8H 2XFXA 4PJ8A 5D2LF 4RFNB 1N5YH 4TN9A 3QUMA 1IC1A 2GQHA 3VCLB 1NGWA 2ZUUA 2ZUVA 3WFHA 4DEPC 4P3DA 2HFEA 2YD6A 3LKNA 2Y07L 5BJTA 3P0VH 3RGHA 1RJZA 5EBLB 3I9GH 3KYAA 4NCDA 4KPHL 2OL3B 1D5MB 1NCUA 2WW8A 3LSOB 3RWGA 4FABL 3RIAK 2M2DA 1Q1JL 3P30H 5JHDA 3PWPA 3RZCD 5FA3A 2ITCA 5CSZA 2NZ9D 3HZYB 1BFSA 5ALCH 2DMBA 2XT1B 1BEYL 4QHLB 4L8DB 3OXRB 3CFEA 3NGBB 4PB9L 4YXHH 4UAOC 3IKKA 2AGJL 4Y5XA 3SPVB 1FYTE 3HZVB 4Z6AT 2D31B 3BX7C 4YHPA 1NEUA 1NL0H 1OB1A 2RB8A 2OQJA 1AGBA 2XRAL 3N0PB 5F3HA 1HQ4B 2YSSA 2BSTA 5DGRA 1FO0B 2F15A 4N90E 4MWFA 1YNTA 3VJ6B 4FQLL 2FB4L 5IB3B 3CSPA 3LIZL 1BFOA 3K2UH 2H6PB 4U3HA 1UA6L 3BDYL 1QSVA 3HLAB 2FO4B 1YPZE 1QBBA 1UZ6E 3IDIA 1INQB 4JG0L 2ED9A 4UIMB 5C8JA 2EICA 4CMMB 2GY5A 4RFEA 3ILQD 4R6UA 2OTWA 4DZ8B 1UKQA 5J89A 3S3JA 2CDGB 2R1WA 1NGZA 5DQ9B 1NDMA 5J57B 2V7HB 1IZKA 2P7TA 2A83B 3RWJA 4NBYB 5F6HJ 1RMFH 3JUYA 1JGVH 3O6ML 5MERA 4A6YL 5I2IB 4ZFFB 5IGXH 4PRHD 4Z95H 5CEYB 4ALAH 1DBBL 2HFTA 1OARH 1PKQB 4YLQT 1JNNL 2Q7NA 4FQ2L 4KK5D 1UQSA 1T7WA 2DKUA 3CMOH 4NQVA 4ODTH 4N8CL 2D7TL 1F3DJ 1FL5A 1YZZA 3QQ4A 1UM6L 4YE4L 5HHVL 2OS7A 4BQ9A 1MCPH 3KHOA 3R0NA 3VFMA 1MHCA 4PGCA 3PDOA 3VXQB 1WFOA 1EO8L 5FO8B 3V4VH 4YE4H 5HHVH 4Y19B 1D5MA 2EE6A 1L9MA 1F45A 1KLGB 5AZ2L 1YEJL 3TBWA 4PJAA 4FQ2H 4FQXC 1R5WB 1JP5A 1MCIA 1X44A 2CUMA 4PS4L 1N6VA 1OARL 1PZ5B 2A9ML 2DBLL 3D3VB 2QTEA 2W91A 2EXYC 5IB5A 2W1NA 5JMOC 1EHXA 4BH7A 1YEHL 3RI5K 1ULVA 5IV2A 4OI9A 2Z31A 3IXTA 3H9SB 1HIML 5I1KH 2KZ1B 1N64H 1A64A 4HIJA 4FOMA 1F58L 5IT2H 4OZGE 5HYJD 4FQCH 4OCRH 3LHPL 3P9LA 3GSWB 5JXAL 4C55A 2VISA 1DLHA 5IQ9A 3AY4A 3MLWL 3IDNB 1MRCL 4G5ZL 1A6AB 1B0GB 2I25N 2QSVA 4OF5A 3MX0A 3TBYA 1M7IA 1U8IB 4HGWA 2E27L 3MC0A 1JYWA 5BO1H 3G08B 1F90L 2LFGA 2IPUK 4HUWA 1MH5A 3O3EA 1IQWH 3ULUE 4XC3H 4MNGB 2XQYK 2XRAH 2BY3A 4IRSC 1NL0L 1X6LA 2CIIA 3VXMB 1WAAA 5J13C 4PG2C 3U2SA 5ILTL 1U3HD 2XN9A 3DMMD 1PKOA 4CVXB 1N5AB 2XIDA 1JK8B 3JXAA 5FGCE 3ULVD 3DSNA 4YXHL 4XCEA 4OI7A 2JJSC 5J0BA 4JM2F 2JJSA 1P5UA 4RZCB 2Q1EA 4E41B 2R2HA 2R1XB 2R39A 4JFQB 2LTQB 3QI9B 4WUUA 4P2QE 1T0MA 1Z9LA 4ELKB 3L3DA 5IBLC 2NQCA 2XWJB 2ZUQB 3UTZA 5EORH 3FB5A 4JFDE 4G80B 5FYKD 4ERSH 4PD4K 4JQIH 5CJBA 1CE1H 4JM2D 1CDUA 3L9RB 1JPSL 1KBGH 3TGXA 2DQIH 3S98A 1KV3A 5SWZB 1DBMH 3FRUB 4KVNH 3ROLB 4G6ML 4O02L 4JN2A 2XWBA 5CWSA 5E2WL 1KCSL 3MUY1 1KFAL 4OD1H 4PR5B 3OKKA 4ZOBA 4OCWH 5BOPA 3NIFF 3IDGA 15C8L 3C5SB 5I73C 1OLLA 3H3PH 1I4FA 1HZHL 5HDQL 3I6GB 1CFNA 1R5IB 1A14L 4IHOA 1BM3L 1EAPA 1KB9K 1FNHA 3MV9A 1TTUA 3G04B 3CDFA 4NQUA 5DRXB 1VFBB 3BKJL 1INEL 2JCCB 1NUDA 5C6TL 1BMGA 2KBGA 4MD4A 1FV1A 5FYKE 2X4SA 3V5KB 4MA3A 4Q97A 1FYTA 3UO1H 3ECBA 3N50A 2V17L 4WUUD 1I7UB 3TIDA 2VSDA 3IVKA 3MBEC 5AZEH 2GK2A 4ZDHA 1HILA 1J0ZA 1NEZG 4UDTB 5LGJB 4U1KB 4Z7NE 3WN5C 2DWDA 3WEXA 2ITDB 4YNYA 1CFQB 4NQTA 5DUPH 5C08B 2MJWA 2V7HA 4OZ4B 2A73A 2CR3A 3GMOB 2NZIA 4Q74A 1SBSH 4JR9H 5E4IA 2YUVA 1ZSDB 3GBNH 4Z7OF 3TT3H 3T4AB 1H9VA 1U9KA 3H3KA 4J7RA 1CVRA 4AENB 5JZ7D 2FH8A 2E7CA 3TA3B 2DQCL 4PJEF 3B9AA 1XT5A 2DQTL 4PJ5D 5DUBB 1G0DA 5L0QB 1ZT4B 1CLZL 4BK5A 1D5BB 1RV6X 2JJUA 2PYEE 3C5JB 2Y25A 2EEDA 4XBPA 4CKVX 1PG7W 4AYFA 1U8PB 4Q6IA 2H2SC 4M1CD 5D1XD 4GAYA 3CDGA 4JRYD 1CFTB 4LF3A 3BH9A 5HBBA 3DUHA 3QXVA 4S11A 3RTQA 4POUB 4QHKJ 5AD0B 3BE1L 1IM3A 5F7EH 5FUOL 1RZFL 3OHXB 2X2YA 3MGAA 1AKJB 2WIMA 2PETA 5HD8C 4F3FA 4F57L 4RGNB 2D4FA 3WFDH 3RBGA 4GW5B 3RX5A 4PJCA 4W4OC 3MLWH 2DMKA 2E7BA 4PV8A 4JO1H 5D9SB 3WFEH 7CGTA 2WAHA 4M62H 1DN0A 4ZOEA 5ALBH 3I6GA 4RWYL 4ZPVB 4O2EA 3SDYH 4MHHI 4GRMA 2X4UB 2D9QB 1EAPB 3RWHB 5FUCE 4FQ1H 2YD8A 3OV6A 4HAFA 1BF2A 1S7RB 3DX8A 4YFLF 5DD5H 4I0PC 5IESL 5LVEA 4QRPE 2WLZA 5ACLA 5KJRH 3JTSB 1J1XL 3OZ9H 3JV6A 2ZZUT 4M4RA 4XP9H 1HWHB 1XGPB 5C7XH 4UIKH 1DQJB 1HHIA 1VACB 3VWJD 2GSIA 4ENEC 5BZWA 1BIIB 1MCHA 4M02A 3IFPB 1OSZB 3KJ6L 3ARFC 2EDWA 3DI3B 3U0PA 1D9KD 4ZSOE 3OKDA 1CICB 5D7IE 4PJ5B 4E42B 3QUYD 5C0BB 1TJIL 2P45B 1RUKH 3VH8A 12E8L 1J0IA 3RVVD 3FZUD 1JPTH 3MUGA 4OFYD 3MRJB 1K8DA 4MA8H 3WUZA 1FCGA 2R9HC 3MSPA 2DQJL 3RHWF 3T65A 1KB5H 3QHZL 1AC6A 5E4EC 4HEPG 1FG2B 4OCYH 3UMTA 3X3FL 1DBBH 4DVBA 3VRIA 3ZDXE 4ALAL 3TBTA 4KVCL 4XMPH 2ENSA 4QRSA 3T4YA 3T1FA 5L8JB 5T5FH 5EPMA 2F74B 5I15L 1ADQL 4NQSB 4F3FB 3BGMA 4M48H 3VGAB 4F7CB 2ZCKL 5TF1L 3OHXA 1UB5A 3MMEB 4U1SB 3BZ4B 4F7TB 4NRXA 4IRZL 1Q9KB 3R8BB 2YBRB 4DWHA 5FO7B 5IMMB 2MTPA 5IMLB 3LQMA 3VWJA 2EO9A 1Q0XH 1U8QA 2Z92A 2A0LC 2YD1A 3TYFB 1VESA 4XVJL 5B3JE 1XF4A 1AFVH 3QZWG 5I8KL 4NZTH 2X7LA 3FT2B 1YEEL 3K4DA 3RA7H 5C0DA 3RRQA 4X6FA 4PRIB 6FABH 2WMPA 4FTVB 4HBCH 4N9GA 2KL6A 4F7EB 4YFEA 5EU6E 3SDXA 4IRSA 3T0XA 1S7QB 4APQB 1IJ9A 3C6LB 2VQ1B 4FXGB 3VG0H 3EYUH 1CICD 5TE4L 2V6HA 2FHBA 4MA7L 4WFFE 5F89A 3TO4A 4M5ZH 1C5BL 1CL7I 1RJYA 1CLOL 4P9HL 5KOMC 3MRFA 3OJDB 4LKCA 3OMZA 5D7LA 2YPLE 4C56A 2ESVB 4QKXB 5HDBE 1WWWX 2AI0L 4KPHH 4NQVB 3SGEI 2IH1B 1RIVH 2Y07H 1NC2A 3M8OH 4NN6B 4MA3B 4LKXA 3BT2H 1UKTA 3NZHL 3T77B 4POYA 4G6JL 4F37K 2N1KA 1A7PH 3O45B 1DE4A 1RUAH 3KWWB 1ZT7B 4K8RH 1MI5A 1QA9A 4XPBL 4MJIB 4LRNH 1IAMA 3ALPA 3ZKNC 3DGGB 3NFSL 3JZ7A 3NTCL 2XOTA 5IJKA 3AC0A 4X4YA 1CDGA 4Y1AE 1SEQL 3SKJL 2VXUH 1FG9C 5DD0L 4ZFOL 4NT6A 43CAA 4DOHE 5D1QA 4PJGE 4POZC 3VXRB 1IL1B 2ZKHL 3G6AB 1ZGLB 1HYSC 1OGAE 3VDAA 4I2XA 3HI1B 3MACH 4JVUA 5SWSD 3FTGA 1P7QB 4AG4L 4ZOAA 1R3LB 5HHPA 3L5IA 5E94A 4L4JA 3FO2A 4DOHB 2V5TA 1JGDB 3GMRA 1A3RL 4HX1B 1C08A 1CGVA 4RNRB 5M95B 5F1OB 5EC2A 2X7LB 3FT2A 3DVFA 4YJZL 1HHKA 1YPZB 5I1EH 1EV2E 2CDEA 1OGAD 4AL8L 1EH9A 2DYPA 2F54D 2AJYL 4PJHE 1QYGH 5GXBB 2NY1C 4J6RL 1IEAA 4WFHD 3ZZ1A 4EBQH 3N1FC 3EGSA 1MJJB 2Y36L 3QAZB 4QNPE 2YA2A 1NCTA 1U8LB 3B9KC 5CLTA 5HYFA 2C5DC 5BRZD 4MX7A 3VRJB 1UEYA 2Q3AA 3VFVA 4R26H 3V0VA 3ARDC 1OF2B 5KG9B 1NCDL 3L3IB 3S5LA 1WAAE 1A1OB 3PGDB 3ARUA 2AQ2A 3CFBB 3AXLB 1H3TA 3G9AB 5TDOB 3FOMB 5DRNB 3ILPB 4TSCL 4I8DA 1K6QL 2BNQA 3NCJL 5GGSY 4HFWB 1ORSB 1FO0H 4UT7H 2R0LH 2ZG1A 5DD6A 3UTTD 3MCKB 2MHAB 2VXVH 3MREB 3VGBA 2YA0A 3V52H 3BWAA 4F7PB 5DA0B 1VB9A 3DSFL 2XPGB 3IDUA 2YPLA 3RIFK 4FFVC 4ZUWA 3SQOL 1FFOA 1U8HA 1B4JH 3EKCA 2FJFB 1BIIA 3QH3A 4OM0L 1VFAA 4HIIA 3RY5A 2DQDL 1UYWL 3E2HC 3QDME 1T0MB 5B39G 4E41E 1WZKA 2Y72A 3O8XA 3REVA 5EH1A 5BV7H 1LK3H 1HE7A 1JGDA 1QFUH 3RTQC 3NH7H 3TO4D 5TQ2H 5IWLA 2BSSA 3O3DA 3MJ8B 3ZL4L 2R2EA 1IKFL 4BQCA 4K3DH 4JKPH 4TTDC 2RFXA 1NBYA 1U91A 2E9IA 1BZ9B 3Q1SH 2VH5H 5F96L 4YHOH 1EDQA 4G7YL 4EN3B 2DWEB 2N7BA 2OZ4L 2QSCH 3ZMRA 3EOTH 3IS0X 4KKBC 4A6YA 5FYJD 4OCSH 2HMID 2AJUH 3OAUL 1WWAX 2GY7B 4WU7B 5EIVA 2OTUB 3ECBB 1WCBB 3GO1H 2CMRH 1JE6A 1AQKL 2AEPH 4WWKC 5D6DA 5F44A 2AK1L 3QCUL 2ICWI 1YYLL 2VAAB 1HHGA 1I1FB 3ESUF 4HWEL 4QWWD 3BH9B 1GC1L 1KLFA 4CADA 1L0QA 3I50H 3FQUB 1JJUA 5MEQA 4HIJB 3UTTB 3BN9D 4EI5B 1MJ7L 2VLRA 2R29L 5H37G 4X7EC 3HG1B 2H41A 1XGUB 1K8IB 1OAYL 1YPZF 2RCSH 3WKNA 4NYLA 3NAAH 4JJHA 3AMKA 4HUKB 1KIQA 3DYPA 4QTIL 4G9FD 4Y5VB 3BWUC 3QUZC 3UDWC 1DLFL 4GRMB 5K9KB 2E6QA 4NQXB 1IAOA 2IMMA 1DJSA 5FO9B 2NXYB 1QKZL 2X4PB 4WCYL 5KVGH 3PWUB 4OIIH 3UJJH 1AKJD 1QFWM 4N0UE 4HXAL 2FD6H 4ZPTB 4OBRA 1KCUL 1I8IA 5I0DA 2EYTA 1XH3B 4Q7DA 5KVDL 5SX4I 2R4SL 1A6VL 3HZVA 4ESKA 3S34L 1P84K 4OLYH 1HSBA 5B38A 2BSRB 4WGWB 3NA9H 3HI5L 3K0WA 4M4PA 2X41A 3RVXC 5I1HL 3CVHB 3LN4A 5D70H 3IFOA 5E70A 2H9GA 1W72H 3QEHA 3BPCB 1EIBA 4M8QA 3GRWH 4XVSH 4OUUB 2UYLA 5I8OL 3GJEB 4K3DL 3OAYH 2GI7A 3D3VE 3EO9H 2G75A 5IF0B 3SKNB 4P4KB 4P2OC 2VITB 2EDEA 2FECL 3T2NH 5MI0C 4JHAH 2AK1H 3QCUH 4Y4FD 4PD4J 3VFPB 4HJJL 4DGVH 2WQ8A 5ACMA 5GIRA 1YJDH 4GW4A 5DLML 1TMCB 3KPRA 1M6OB 4Y7MA 2BVPB 5GS0H 5EUOB 2FO4A 5DYOB 2XXCB 2OL3H 2PR4H 2R4RH 1YQVL 1FNAA 2CO7B 1MJ8H 4PJXB 5H2BA 1BFTA 1XGUA 3HKFA 3SJVD 2Q8BL 1INQA 4Z0BL 4OQTA 3DROA 3O41A 1KB9J 1T20B 3DXAB 2GAZB 1MLBB 2DTMH 1HKLH 2VLME 5CZXC 5IMLA 4I48B 5HY9A 1I7ZB 1FFPA 2OR9H 2P44B 3QFDA 5DWUL 1IKFH 1CT8A 2AJZB 3VI4F 1PDKA 4NRYB 1PD6A 2W07A 1JF1B 3V5KA 5GS0C 5I1AA 4L3ED 4RMRA 1KJ3H 4JPVH 1BFVH 3QIBB 3O81A 2IH3A 2PYEB 5EZLB 3FO9A 1HINL 5C2BL 4UTAL 4EXPX 4OZIF 5D7KD 3WXWH 2DQEH 3S6CA 3X17A 3ARGB 4YPGA 5DFVD 4GS7B 4TQEH 1J10A 4ODHH 3E6FB 2I07A 1MHCB 1UCTA 3UAJC 3D9AL 3WNPA 4L4VB 5JOFB 3AU1B 3V52L 1UZ8A 2CIKA 3TM6A 4AIZB 5KVMC 1NMBH 4NC1E 2V9TA 2NLJA 5KS9F 4Z78B 4QYOB 4Y5XC 2KPNA 5E8OB 4JDVB 3BYTA 5I1EL 5HHNA 3MJ7A 3S3SA 3QEGL 2JIXD 5ESVB 1OWRM 2JIXA 2YZ1A 5DJ2A 1SYSA 3QEUA 5DJAA 2C7UB 4ODSH 4AG4H 3CNKA 2CJUL 3FQWA 1A4KB 2GK0A 2NY5L 1FL3A 2CDFA 3ARRA 5IKCA 3SDXF 5C0CD 1IILE 2Z8RA 4HJ0D 3CU7A 3IJYB 5ADPL 3MR9B 2VXUL 1Q72H 1P69B 3OX8B 4EI6B 4MNQD 3DHJA 1GGBL 4G7VH 1U3HA 1ZLWH 4EUPB 4HW6A 1G7JB 1AGEB 3VFTA 4U7KA 4RQQB 3QFJD 1S7TA 2I9TB 2AJYH 4QCIA 2GCYB 5F7HA 1T7VA 1A7PL 3SDXB 1NFIB 3BGAA 3V6FA 3ULSA 3A67L 4RMTA 4NFCA 3N1GC 2IALB 4V2BA 1MH5B 1T0PB 1JK8A 2EKSA 5B39A 2D9CA 5HHMB 2JJTA 3CPLA 3KPNA 1VGEH 2DMCA 3S37X 3ZHDA 2ZOKA 1I8KA 4LLUA 5DD0H 5SWSA 5KS9B 3SE8L 4NQCB 1HN1A 5B4MD 4FS0A 2IF7A 2ORBL 4L4VA 1RU9H 1ACYL 2F5AH 32C2A 4P5KB 1MNUH 4WEBL 1TZIB 5DR5L 3T0EC 2FATH 2VLRE 2BHZA 3GMPA 5IFAL 3RY6C 3VWKD 5I30H 4KI5F 3PNWA 2IMNA 2GJ6A 5JDSB 3LOWA 5CS7A 3B3IA 1PJ9A 4HIEA 3HI1A 3L5XH 4RRPG 4M03A 4X8JA 2YN3A 3A6BL 3P11L 4NZTL 3VXTB 3KLHC 5GGQL 3RKDD 4LOUC 4U1JA 1URLA 4UT9L 1DBKH 1J0KA 3FT3A 3T3MF 3BPOC 1TQBB 2WV3A 3MV7E 1X4ZA 2AXJA 3RVWC 4WHDA 1CLOH 3GHEH 3S37H 1A2YA 4MJ6A 1EMTL 5TE4H 5BRZB 4LLDA 5F9JB 4LIQE 1OAXL 3HPJB 4K7FB 2A2QT 1N0XL 4UTBL 4EI6A 4OZGA 5C09B 1INDL 4X9FA 3MV7D 1BGXL 5E8DH 3QDMD 2WINA 5EC1B 4PJXE 5EB9A 5GS3A 2FZ3B 1GZQB 2F54E 4XAKE 5JW5A 4H0IA 2E9WA 3GDBA 4P9MH 2P5EB 4PPTA 2XZCL 3VFOA 4LHQB 1K3IA 4PJIB 2EDXA 4MA8L 4QXGH 3ZTNL 5EFIA 3T0AA 1DUYA 2FL5A 3BSZL 1QO3B 4FQIL 3PP4H 2EDOA 1KIUA 4AK1A 3S88H 1MCJA 3TNMB 1FDLL 3U0TA 4EN3C 1R0AL 4NKDB 4UV4L 2HKHH 5E5MB 3U4EA 5K59E 3V5HA 5GGUA 3GRWA 5EU4A 1IVLA 5CGTA 5T3XD 4J4PA 5D2NE 1ZEAH 4UIKL 3MCLH 1KTLA 3O6KH 5EZLA 3DYMA 3RVXD 3TH4T 2B39A 3RL1A 3HNVH 2E6JA 5DRWB 3QHZH 4JANA 1T2QL 5I18H 2GT9B 3LD8C 1C16B 5IROA 4D9RE 4KRLB 1LE5A 4OZHF 3QXDA 4M7LT 1MCRA 1QP1A 3HUJA 3VFSB 4OGZA 4L8CA 2H45A 4XBPB 4GAJH 5I1CL 4XCEB 1KJVB 3LRSA 4JZJC 4M62L 5F9JA 1CBVL 1AGDA 3V2AR 4OIAA 4WI5A 2FX7L 3MRLA 5E6IA 2R56L 1FVDA 3WNLA 2IAMA 4NBXB 3WUWG 1KENL 4JDVA 2NW3B 2HN7B 3ZKXC 2VLRD 3GUTB 2NLJB 5F9OL 3GMQA 4CW1B 5DMIH 4KI5C 4Y16D 1CXEA 5KW9L 4HPOH 5FYJL 1E6OL 1P4BH 3Q5YA 3CIQA 3TIEB 3GBML 1FAKT 1FZKA 2ZUYA 3UPRA 3UJTH 4K7PL 4IOFD 1IGYA 3W5NA 1DN2A 4WY7L 2AERT 1JHKL 3RGVC 3B6SB 3LB6C 5SX4H 4KJYB 4QTHA 2YPKB 5FA4A 4X6DF 2GJZB 2Q7YB 2H2SD 4IRJA 3QXUA 8FABA 1XGYL 3Q5OA 3DURB 2OTUA 4DTGH 5GGTA 3QUYA 3VWKA 4ELMF 1PG7L 2FYYB 1OP3H 2NW2B 1OSZA 2J2ZA 5D7KE 5LAXB 4KROD 5J7CC 4ZUUB 2G5RA 2HT3C 4I18C 4OB5H 3B9EA 2G5BA 1HHIB 4FTVD 2CXGA 1NBVH 2P49B 3RNKB 4YHYB 1FNSL 3ALXA 2PO6C 3EYVA 4PLOB 4NZDA 1E4XI 3BPLB 3PWPD 3RZCA 2J8UE 2EKSB 4MQXC 4ZXBB 3WO4C 4K9EH 3GI9L 1Z0NA 1LE9A 1WZMA 3OKEB 4JJ5A 3TT1H 3QQ9D 4CVUA 4NZJA 4P2OD 5DS8B 2ARWA 1NMCC 4GSDH 5C70A 1OVZA 3RWFB 1YDPB 1F3DH 4R4BB 3FCTA 4UNVA 1LP9F 3P2TA 4P3CL 4QHNA 3UTSA 1FL5B 4ZUWB 1KGCD 3SDDA 3LH2L 5FOBA 4PFEA 2ICWJ 4XCYA 3HRPA 3D0LB 3HI6L 3MOBL 4U1GB 1PY9A 3QEHB 3VXSD 1TZHB 3V6ZB 2W9EH 4NP4L 3VGGA 1IGCL 3BZDA 3QT2A 3WE6A 4QXTB 5INDA 5I74C 1UM4L 2ITCB 2ADJB 5CSZB 2EC8A 4DFIA 1DVFA 4NO5A 1EGJL 1IARB 4LVOC 1X5YA 5DJ8A 4U2ZA 3QWOA 3ARGC 4FRWA 4JQIL 5C0JB 3TH3T 3ARBC 4NM4H 2GITB 5D1QC 2DWEA 1CXFA 3DMMB 2DI7A 4NP4H 4ODUA 5JQHC 1G7PB 4KRMB 5J6HB 1FZJA 3HI6H 3MOBH 4C4KO 3O4LE 5EU7E 5IVXF 2X10A 5EIIB 4UAOB 4QOKA 1I7TB 1BJ1J 2VLKA 4ZO9A 3P0YH 4Y5XB 5D72L 2HTKC 3BKCL 4PLJC 5KSAD 3EYQD 4I0CC 2A0LD 2H2PD 2DQFB 4RIRB 3T0EB 5I75C 2D31A 4YHPB 1A6AA 1I9IL 5GS2H 5HI4C 2BFVL 3KDMA 1UXSA 5FYKH 3GSNA 2NY4B 2X4TB 3MRDB 1KBGL 1QNZH 3UPAA 1I75A 4JFHE 2X1OA 2AK4B 1J12A 1GIGL 1A22B 5EORL 5HYQA 1QBAA 2ZCHH 5FYLE 5A3ID 2VLJE 2BNQD 3IDJB 1AI1H 1F4XH 5GGSB 3QO0A 1SY6A 1DUYB 4G8GB 3IYLW 1RIHL 1T04B 3BD5A 4X6CB 4NT6B 4QGTA 3ZT7A 4BFBD 1BQSA 4L8BB 4HUUA 4PJXF 1U3YA 1QSEA 4JRXB 1RIUL 1PLGL 4NNYA 4OI8A 1PG7H 1UZ8B 3ARYA 5TH2B 3U1SH 3UEZA 3UTSE 4DK6A 4Z77A 1R3JB 4HMEA 5HVGB 5D2LB 1JHTA 1AGDB 3DVGA 1QSFD 3PXHA 4PGZA 4ELMB 4UNUA 5D8JH 3C5ZA 4RFNC 1DVFC 2NR6C 4BSWA 1FGVH 3ROOA 1EHAA 2JB6A 5AZ2H 4RSVA 4AH2B 1DUZA 3PQYD 5BRZE 4LGPB 1N4XH 3LV3A 5E08L 4PJEB 5ISZE 3HTLX 1KENH 3W0WD 3Q5TA 4GFTB 3SGJA 1QVOA 5C3LD 1EO8H 4OZFA 3VXMD 1I7RA 3RDTC 3DXAE 5L88H 2YPKA 1CBVH 5JXAH 1Q94B 2XN9D 2VDRH 3DMMA 2PCPB 4XBEH 5T1MA 2BRRH 3SDDD 5IT2L 5SV4A 2ZNXA 4WWKA 1D6VH 3ZLQC 4M93C 4F37F 4Y5YB 1MFDH 3CVIL 4OZHE 2H32H 3ARSA 1SHMA 4PJAE 1T2QH 3KXFA 3I3BA 1I1CA 3MLTA 4U0RB 4F8QA 3LD8B 3QHFL 5D6CA 4OZ4A 5SWSE 3SOBL 4C56E 1A9BB 2F58L 5ISZD 5E0QA 2EC9T 1OAQL 3TPKA 4BSJA 4O51A 2UZXB 3H9HB 1KACB 3BVNA 4XPGL 4Z7WE 1G7IA 1S5HB 5FEBA 2Z35A 2BRRL 4QRQA 4UV4H 2VDRL 4XBEL 5IW6B 1YY8A 5I1JH 4I9WD 4K71C 5KOVC 1NC2B 1V5JA 5CHNA 2ITDA 2VDKH 1OQOA 2PTUA 3G5VA 3L3HB 4F33B 1FNLA 4HS6A 5GRJL 3RWFA 5A3IC 3QDHA 3BSZH 4MAYC 4MCZA 3RPIB 1MQ8A 4M8VA 4XPAH 4I18A 5JHLL 3BDYH 4Y0GA 4BFEA 2I9LB 3MLZL 3LIZH 1MPAL 3UBXI 1G6VK 4JQVC 4L1HA 4U05A 5EU7C 5FV2A 1T5XB 3H9ZA 4ZAKC 5B22A 3BFOA 1Z9OA 3TBVB 2HP4A 3NABH 4ZTPH 1U8MB 3KPPB 3AREB 3C6SB 4JRXE 3IB4A 1FFRA 1TDQA 1K4CA 2B1HH 4NWTH 5JR1H 4OD3L 3RNQB 3DRTA 2WIIA 5K9KA 1I7RB 4X80L 1YY9D 2EKJA 1XCQA 2JIXB 1C1EH 2PNDA 1EEZB 1P7KB 4CBPA 2ZUQC 3PDDA 5GZOC 3CLEH 2P5EA 4FQPA 5KVEL 3G5ZA 4LBEA 4WGVB 3E6HA 2ZCHL 3MROA 5DJ2B 1FFQA 4CDHA 3LKSB 1GIGH 3NOIA 4U1SA 4Y1AD 5IMKA 1VGKB 1KCLA 1A9BA 2XZQL 4CADB 4JPWL 4K23H 4AQOA 1R3KB 1EFXB 5AUMA 1CIDA 4DGIH 1I3UA 2Y06L 5CKGA 1MNUL 4X98B 1FN4B 2Y6SC 4F2MB 4JRYB 1X5JA 1I1RA 4LSRL 4LIQH 4ZS7L 5K9OB 1OW0A 3FB7B 1F5WA 1BEYH 1U3JA 1F3JA 3LEXB 2M1KA 5L6YH 1JIBA 4M61A 1ZANL 4N0YL 5DRWA 3KR3L 2A77H 4Y88A 4G6KH 4Y8AA 1JWSB 2MOVA 2DI8A 5ID1B 1IAIL 3BPNB 5I74B 5IBLD 2NY2C 4XP1L 3S35H 4JHWL 1T1YB 3MBEB 2W0LA 1MOEA 3BRFA 2QBWA 4M7ZB 3OR6B 5EO0B 3DROB 3GI8L 2QQLL 3HAEA 3O6FD 4N0UB 1HI6A 1RZKH 2WZPD 4YDIH 4XPFH 3CX2A 1DFBL 5BXFA 4L4VE 1MQKL 4F58H 3X12B 1QFOA 3EYOB 3QPXL 5J13B 1JNHB 1F13A 4KK8D 4Q0XH 4R3SA 3BZ4A 4F7TA 5L2KB 5C0GA 4FFYH 3I02A 3MMEA 4MYWB 5T1DH 3BKYL 3RVTD 4ONHB 5DC4B 3IXAA 5A2FA 2A74A 3EUUA 2YK1L 3TA3C 4H8WL 3SDAD 1NH6A 3LH2H 2CJUH 4KROB 4FQXB 3VXNA 5D5MA 1JGEA 3BZEB 1RVFH 3SBWC 5HYEA 1OT1A 3DVNB 5CSGA 1Y18B 4HGMA 2IANA 2IG2H 5J6GB 5EU3B 4NCC1 5C09A 1T5WA 5J3HD 1WUNT 4EVNB 3GJFK 5IVZB 1Q9WB 2IWGA 3QEQB 5HD8D 1S7XB 3QCTL 1IAKB 1GJIA 5F1SA 3TEUA 3LMJH 2YRZA 4FG6C 4E9LA 1ONQA 3DUSB 5JQ6H 2FJGB 1KIPA 4Z7VF 3EZ8A 3Q3GA 5CZXD 3QHTC 1S9YB 4QEGA 1F4HA 1YPZA 5CCKL 3OXSA 5FYLD 1T20A 1MELA 4J1UB 4UQ3A 5LQBH 2B4CL 4GKZB 1N6UA 3QR2A 3MA9H 4Z7VE 2ICWB 4UBDC 3HZKB 3W2DL 3CSYB 3SKOA 5IEKB 1YQ2A 2R15A 1MFAH 3ULVL 2DAVA 4L4TB 3DYOA 4Z7UB 2MNUA 5GJSL 4S1QH 5MENA 2V5SA 2X4NA 1NANI 2LE9A 4GRLD 2X4OB 4RMUA 1OY3B 2FHFA 1NGZB 4YBLB 1NFDF 1P1ZB 1ES0B 1A7OH 2YR3A 3JWOC 4GO6B 1PQZB 1NMAH 3HAEG 3VD9A 4IIQB 4OV6F 1NC4A 3WSQL 3GBMH 4U1KA 1P4BL 3CFIC 5FYJH 5HHXL 1YQVH 4B7LA 1GXEA 2EE9A 1KXQE 1B88A 4QXTA 4OZFG 2OL3L 1OOAA 1C12B 5E24E 4I3SH 4QHUB 1TZHA 4KWUA 5CJQH 4WEUD 3QP3A 4JHAL 2X1XR 2VKXA 4JFZH 4WDIB 3K3QA 1N59B 1XH3A 2WBJB 3PJSA 1FG2A 1S78C 3VXUB 5I17A 3EO9L 5SWZD 1TVBB 3LN9A 2HAZA 1RZIA 3DV4A 1HQRA 4D0CB 1W72L 3WJLC 3UPCA 4HT1L 1ZTXH 1P7QA 2LAGB 3VE0B 5IJVB 3NA9L 3C5SA 5CP7A 1AGEA 3VFTB 2HFEB 5GIRB 1W0WA 4JQXC 3QUZD 1HEZB 3QJFA 3G5XA 4HUXA 5EBGA 4XBGB 4S1RL 1ZWIA 1KGCE 1KCUH 3RWGB 5JW3H 5DHXB 5KSUB 1RJLB 1FVCA 1FFNA 2NW2A 3V7MA 3B9KA 2NY3B 1ZS8A 5EOQH 4BH7B 5DJDA 2DLHA 3V7AE 4M7KH 1B6UA 2GJZA 1V3JA 2B5IB 1A02N 2GHWB 4CRPA 4ZYKA 5FYLH 3FFCA 3V0WH 3PUCA 4OBSA 4YBQD 3U4AA 1YN7B 3QISA 2W0FA 3BN3B 3CH8A 3M1BB 3MREA 5DTFA 4BFIA 4EKXA 3MRIB 4D0DB 4DW2H 4OZIA 4HDIB 3VA2C 4HUUB 3HG1D 2EDJA 3QRFM 4PV8B 2VXSL 3HR5A 4XVTL 2Z93B 3LCYA 3AGVA 1I9RH 2EIDA 2R29H 4Z76B 4EUPH 5CGYD 3RDTA 2BVQB 3V4UL 3BXNA 3WNMA 1WVZA 1K2DA 2NY7L 3DV6A 4J3VA 3T2QA 2CIIB 3VXMA 3RIFF 1CGWA 1UADC 4HWEH 1A6ZB 2YEZA 3FQNA 1CCZA 3REWA 1SBBA 3OJ2C 3QZWA 1HKFA 1UM5H 4P2QA 3EYOA 1A4JB 2D0FA 4UILL 5C0RL 3RVWD 4J8RA 3VXPA 5CAYB 1OL0A 1Z6JT 3VXSB 3F58H 1RK1B 2E7MA 2K7QA 1QZ1A 2I60H 4NHUA 5K59F 1CD9B 3SE4A 2FEEI 2GFBA 3OB0H 3N85H 4GW1A 3DUUB 1FAIL 5CZVH 1HEZA 1N8ZB 5CBAA 3GKWL 2ADIB 2P7TB 4K9EC 4MAYB 1FHGA 5CP7B 1GAFL 4JZOB 3WKMH 4X4YB 4WEBH 5F9DC 4KFZC 5HI3D 1YEDA 1B4RA 2B1AL 43CAB 5T3ZL 5C8JB 4I2XB 5JHDD 3SE3A 2C3VB 3GGWA 3HLAA 4LHUD 4M5YH 4X5LA 3DI2B 5F1NA 5DC0A 5TQ0L 4LLMB 3KYKH 1EEQA 1H0DB 2GJ6D 3T3PF 4M7ZC 2Z0BA 4Z7WA 1HDMA 3VFUB 3GJFA 2VLKD 3MRIA 4D0DA 1TZGH 1KIPB 1NGPH 3O8XD 3W9DB 5DHVB 4FFWD 1VFBA 1Q8MA 4K3JL 1BF8A 2P48B 3IJSA 4UQ2B 7FABL 2FGWH 3IKCA 4TUJA 3MROB 4OCNC 4NQXA 2DM3A 1FJ1B 2NX5D 4P5TD 4APQC 4H1LA 5EG6C 1HXMA 4YHLL 1YNLH 2X4PA 5FGSA 1GGTA 1T2JA 1QG3A 4JFPB 5CCKH 3AREA 2DD8L 3VFNA 1R6VA 2XQBH 2R0WL 3RNQA 3E0GA 4N8VG 4BZ1L 5DQJA 3LPFA 3CU1A 5DD6B 2VQ1A 4FXGA 1OSPH 4YUEH 4Z7UA 2HG5A 1ORSA 2J3SA 3DUUA 3QUMB 3VG9B 1F8TL 3CLFH 1PZUB 2YD4A 5JPNB 1CWVA 1IGMH 2CK0H 3GUTA 3WUWA 4R0LB 5HPOA 4H88L 2IQ9H 4YAQB 4NKQB 1KCRL 1KT2A 1QSFA 3GSXA 2P5EE 2AJVL 4YUEL 4RGND 1XF4B 5FKAB 2QQQA 3HRZA 2DQEL 1AD0B 2HFFA 2HT4C 5E9DE 2VLMD 4E41A 5DJCA 4UTAH 2UZYB 3CDGB 5HI3C 4G42A 4JPVL 1YC8A 5K9JL 5LJYH 1TLKA 5EU5A 4FFYL 1LO3H 3PHOB 3VWKB 3G6JF 1FN4A 5L7XH 3OTTA 1MF2H 4YXKH 5ACZA 4XPFL 1VADB 5ICYB 3OGCA 4IIQC 3FT4B 2E3VA 4QRPA 3GB7A 1Y0LB 3TC9A 3KXFB 3MR9A 5E2VL 1A7RH 4WU5B 3CMGA 1BBDH 3M8OL 5KSVA 2B0SL 2Z91B 4Y5YA 5LXGL 2AKRA 3HE7A 1HNFA 3MV8E 2L4OA 2XKSA 4ZYKB 4M5YL 3EJZC 3B9KB 1UENA 2VN7A 1OAUH 3D2UD 2XWTB 4JO2L 4WW2B 2AK4D 3HZMA 1Q9WA 5HPMA 1MI5B 1QA9B 1T7YA 3JWDH 4ZS7H 3OAZH 5BZWB 4G8EB 4LIQL 2XWJA 3QDMB 1DCLA 1FJ1A 4YO0A 5DURB 3SE9H 5A2KH 4Y4FA 1S9XA 2J6EA 4X5WB 4QHKI 3WKML 5I8OH 4QRRA 1QRNE 3L7FB 4Y1AA 4N90D 5CZVL 3PG2A 3I6KA 4PY7B 3U0WH 2RBLA 3U4BL 1U95A 1OGAA 2EO1A 1F2QA 3S34H 5JOFA 5D5ME 1U8MA 3KPPA 1NSNL 1J8HE 4I4WA 2VXTL 3V9FA 4XVJH 3DVNA 2DJ4A 4PRAB 2DIAA 4AEEA 3R4DA 5ETUB 5KVFH 2XTJE 1T22B 4DVBB 2JB5H 3STBA 1ZVYA 4GXVL 3VXQA 4XRCA 1A6WL 1SJHA 1C1EL 3MRBB 4GG6E 4PLKC 4KHXL 5HXMA 4LDEB 3SN6N 4D2NA 1GOGA 2QKIB 1IT9L 2Z8SA 2F54B 2Q7YA 4K94L 4QTIH 5DUBA 5E03A 4HULB 1C5CH 2GW5A 3KPSD 4M43H 2VXSH 1M71A 2X4TA 2KQMA 1CD1A 1RQ5A 3GMNB 1ZA3A 2R23B 1F6AA 4NC0B 1X5IA 4GW1B 2DQFA 4EDXB 2VXQL 3BKMH 4LSTH 4ZS6C 5I71B 3S36H 4AIOA 3TBSB 3MRGA 3V8CA 1DANT 1UXSB 3CX5K 2R0KH 2X1WL 3V0WL 1T89C 3VFPA 3OGCB 5CD3B 4KQ4L 3VMNA 5CINH 2IBGA 3P9MB 4K8RD 3HZKA 1J1PH 5I16B 5CKAA 2GSGA 3WIIH 1WJ3A 4ZUTA 4OZFB 2VDKL 4GW4B 4WFED 4W6YB 1YNTB 5F7DB 3L3KB 5BV7C 3LEXA 3VI3E 1FVEA 4JRYA 2ATKB 2NPLX 1JUFB 2QSCL 4XP9L 4LSSL 4Y19E 4EI5C 1TCRB 1FLTX 1UB6A 5EZJB 3MFGB 2BY2A 3I6KB 1T21A 2PW1B 4XP5H 3VRLE 4FFVD 4UQ2A 4XCYB 4I77H 1QBML 2N7AA 3SE4C 5TH2A 3QIBC 1HH9B 4I0PA 5I8CA 1AO7E 5ALBL 5SWQA 4XCFH 1G7IB 1S5HA 2I5YH 4H26A 4Y5VC 1Z9SA 5IHZA 1QFUL 2LVEA 1LK3L 3WDIA 4PJDA 5C6PB 3LKNB 2DKMA 1DQJA 2SEBB 3DTXA 5E6ID 3ULVC 2FWOA 1SEBA 1U8JA 5LGHL 1NCCL 3EOAB 4NM8L 3F7RA 1JNHA 4I2XE 5MERB 4U0QB 2BC4B 5L2KA 1P9MC 5C08E 3L9RA 1D5XB 3RY6A 3FKUS 4U1IB 1I3RA 4JZNA 4MJID 3CXHK 3MNVA 5HYSB 2FZ3A 2OTPA 5B8CA 3VGDA 1DN0B 2XZAH 2VLKE 3WD5L 1FZMB 4TUKL 5DSCA 2VZVA 3PV6A 1LGVA 1A6WH 4HPYH 4KKBD 4PJHA 1ZLUK 3KPTA 1UH3A 2JB5L 4B5EA 3ULVH 2DQTH 3LDBC 5FKPB 3MV11 4PYGA 3PHOA 4OCXH 4DKEH 4OLZH 2CLZB 2NY0C 3PXJA 3QG6A 3CFKB 1SY6L 2XTJC 1ZLUH 3WS6C 3KDMB 4R4FL 3U4BH 4M6AA 4CGTA 2YUWA 5HI5D 3D85B 2X4SB 3DECA 2DQHH 4MD4B 1A9EA 5JW4Q 4DN4H 3OF6A 4RX4D 5AYQA 3TVMD 4WTWA 1MY5A 4PP1D 4PLNC 3MRCA 1W8NA 3WO3B 4CU6A 2R1WB 5DQ9A 4D94A 3IDJA 1VFUA 2FR4B 1GCFA 3KYNA 4Z7VA 1KPUB 5TFSL 1M6OA 2HRPL 4JO2H 1TVDA 3WDHA 1I3GL 1JZ5A 1S7WA 5EDXA 2R1YA 3B5TA 2JJVA 1ZLVK 3BDXA 5C6TH 5GGSA 3O2DH 3UYPA 4GRWB 3OG6B 1Q0YL 1K5NA 1LNUA 5ANME 1SM3H 5E6IB 4ISVA 5KS9A 5J11C 2B0SH 3TZVD 4MLSA 2NW3A 1DZBA 1XCQB 5A2LH 2DM2A 2M8XA 3MRLB 2L0DA 4P2CG 1EEZA 5IVXE 2O5XH 4GMSL 4QRUB 4HCRA 3IRPX 2WIIB 1FNFA 3D3VD 3I3DA 4XHQA 3D3VA 3QPXH 1TJHH 3Q6FB 4Y8DC 4OGYH 1V3MA 4WTZG 1LD9A 4O02H 5GSVB 4GKSA 3L6FA 4L8DA 3O9WC 4DJMA 2XXMB 4OZFH 1HQRB 2Z4QA 4O4YL 2DI9A 1TVHA 3WS3B 3T1WA 5F7FA 5MI0B 5FM5M 3W39B 5ID0B 4KJPC 2VQUA 1ZVHA 4E41D 1IAIH 1CL7H 4QY8A 1NGYB 5J56B 1RFDL 3ARVA 1H8SA 1IGIH 1A4KA 2GK0B 5L6YL 1YY9C 4DVRL 4MSWA 4K07A 5TF0A 1QRKA 4QOKD 4I0PD 4H88H 1XGTA 4NO3A 4OGXH 5HHQB 1X5AA 5CD5C 1WLHA 3CDCA 3PGFL 4U1LB 3LS5H 1F8TH 3CLFL 3C2AL 3WV0A 2P5WE 1JPGA 3KPSE 3K81A 3WCYA 2AK4E 1DBJH 5EC2B 1YNKL 1CGSL 3BQUD 1TITA 1QUNA 2A1WL 3MLTB 5A16B 4U1NA 5GGVH 5IROC 5GGRY 4WFGE 5EN2B 3WN5A 2HJLB 4JN1L 1S7VA 3MBEA 1EHNA 5C71A 4RZCA 2PYFB 4LLYA 2E27H 4RMWA 5JXEC 2W59A 4RFEB 2F8XC 1FH5H 1BPVA 3SBWA 4ZFZB 4MXVF 4DZ8A 7FABH 1T7XA 1X6NA 4G9DA 4NYLB 1A1NA 4K3JH 2V2TA 4OCXL 4BZ2H 4DKEL 1T66C 5GRVL 5KAQG 2HTLD 3BMVA 1U8OB 3EW3B 2HT2C 1XR9B 4LCIL 5IK3B 3VH8G 5DVNA 4JKMA 5AAMA 1JGLH 5I15H 4NWTL 4HPYL 4NN7C 3MLUL 4HZLB 3JWOL 1AD0A 4MD0A 1EX0A 4KTDH 2A6KA 5FK9A 1FNGA 4LFHG 3PNWB 4C57C 3X3FH 2ICCA 1O7SA 1KB5L 4PRBB 1A4JA 2DQJH 2FRGP 2W60B 4IHOB 1LO5A 3VXUD 4JY5L 1GVIA 3OF6D 4RX4A 1OTTD 2YBRA 3VFWA 5LGHH 1T5WB 12E8H 2NY5C 3V4VL 1BQHG 4BUHA 2KUTA 2VO5A 3ZKXB 1T03H 4ZD3H 3PQYB 5I1DB 3GMQB 4KJYA 5FA4B 2Z31B 3KVQA 3WFHB 4OF7A 1I4FB 1F4YL 1U8NB 1AXTL 1IGTA 2OI9B 4XHJD 1FZKB 3OKNA 4UQ3B 4OKVB 1MCEA 3IF1B 1MHPH 1U91B 5TDOA 3MJ9L 2LAAA 1EAJA 2NTFB 4W68A 3C60B 1NLDL 5D7LE 3HR6A 1X5ZA 3CFKA 3QG6B 1HHJB 4WV1A 4G3YH 1E4KA 1AD9B 1UWGH 4MD5A 1WWBX 4Y4FB 4JY6B 5JIHA 2HKHL 1JWSA 2NY7H 2QSTA 1WEJH 4M7LL 3HZMB 1R24A 4M1DH 4TSBL 5HPMB 5LGKA 1FDLH 1QRNA 4YHYC 2YWYA 4MDJB 1VEPA 5L88L 5BOZG 3F7VB 4WHTA 5CINL 5IUSA 4F57H 3UTQA 4DW2L 4AY0A 3L7EB 4UBDD 4QXGL 4Z0XA 2MQ3A 4W81A 2VLJA 3TH2T 3GHBH 3B3IB 4HWBH 3S36L 3F65A 2G60H 4LAQL 4MJ2A 3ISWA 4Z8FL 2HVJB 4KTEH 3P0GB 1KN2H 1MWAH 5F1KC 3QNYB 1S78D 5I8EB 1OW0C 2Q8AL 3TNMA 5TE7H 1MUJB 5F9WB 1KPRA 2WWKO 3MRPB 2I07B 3S35X 5C0NC 3L95B 2AGJH 5HSFA 3K1KC 1N0XH 4UTBH 1LEGA 4PJCB 2IPKA 2NY0D 1X3DA 2D0GA 1JPFA 3GNML 4BQ6A 5FM5O 4FXKB 3D0LA 3SGDI 2ZNWA 1M7DB 4WUUE 5HGHB 3W81A 1AI1L 1F4XL 5KSUA 5GGQH 4JKWA 4RNRA 3P0VL 3DBXB 4PJAB 3MYJB 2WM0A 3O2DA 4NBZB 2ZCLH 4EJ1C 3FHQA 4QY8B 1QNZL 2DS4A 2IC2A 4ZPVA 1QQDA 2D0HA 3C60A 4YPJA 4M6MH 43C9B 1G9NC 1HHJA 4PJFE 3WLBA 5CJQL 1S7RA 5DDHA 4XB8A 5E6IC 1ACYH 1RU9L 1HCVA 5C0IB 1E0OB 5FGRA 3L5WB 3VW3L 4HDIA 3SY0A 5HTSA 3JWDL 2AP2A 3MNVB 2CRZA 4U6TA 3SE8H 4OUUA 3RAJH 4Q9QL 3O4LA 2FIRT 3AB0C 4EN3D 1BWMA 4OJFL 3G6DH 5A16A 2ZSWB 2Z35B 4QRQB 4X7CC 2IEPA 5HDQH 5ICXA 4XAKD 3DURA 5MEPA 1U93B 2P24A 2YXMA 5IVXB 4EQ3A 4QHMA 4KK9C 3OR7B 4ETQA 1G0XA 1YN6B 2HJKB 4O4YH 4ZNEA 1UACL 4KRPC 2AK4A 2ED8A 4KVNL 5BS0E 5E6YA 4FFZH 4NUJA 3KPOA 4L4VD 3F7YB 2VL4A 1UGNA 1KEGH 4OGYL 4H25A 1NMCB 4NZUL 4W6XB 5IHUH 2BNUA 3O6FB 5L7XL 1QFWI 5C9JB 2CPCA 1JHLH 1UC6A 2XICA 1EJOH 1XR9A 4MMZC 5JIPA 3LMJL 1B2WL 3ORJA 5IM7B 2F74A 2DQGH 4ONOA 2Z8WC 3ALWA 2ADGA 2W65A 4HLZG 4FQJH 2Q6WB 1YEDB 5DK2B 1N59A 4IRSD 3VXOA 1QSEE 3FT3B 4DAGH 4XNQA 3UBXB 4FXKA 4P2OA 3E3QE 5CJXA 4IOFC 2DBJA 5BCAA 5KSBA 1DVFB 2CK0L 4GKNB 4NO5B 4U6YB 5DHVH 1IGML 3KPSB 4CNIB 1M71B 1IQWL 2DQGL 4DGYH 3H8NA 1EJOL 4UU9B 5JXED 4WU7A 1QLFA 2IGFL 3VXRA 4IM8A 3ARBB 1JWUB 1NBVL 4P3WA 1B90A 2DICA 3QIUB 1JTOA 4UOW0 2A6DA 1YEIL 2X9WA 1JTPA 4YDIL 1Q94A 1CI5A 4G6AC 2QQKL 4HC1H 4LEOB 2CRYA 4PJFA 1LO2H 3W39A 5DJ0B 3MXVH 4EUPA 5GRUL 25C8H 1TETL 1YMME 2BXZA 2EDKA 4RDQG 4H1LG 3DETC 2DLFH 3QQ9C 4PG9A 1QBLL 3BOVA 4TVSa 4IMKC 3SJVA 4KJPD 5HGAA 3BMWA 5I66B 1K2DB 3ARGA 3WD5H 4E0RB 3JWDC 3HAEB 4N0UA 5CJOL 4E42A 1QRND 5JOPE 1LVEA 4K7PY 1E6JH 1HXYA 2XG5A 5C0AD 1K8DB 4X9HA 1YEJH 1FBIL 4X4MA 5DMIL 2I9LA 4HKBA 1SYSB 3QEUB 2C1PB 5HJ3A 5E2TL 4HIXL 4KKCD 1TCRA 1N3NB 1FNEA 1QSFB 2R56H 2FX7H 4R0LA 1H5BA 4F33A 4M6ML 3LAFA 4F7PA 2WWKT 4K23L 3WDJA 1I8IB 4MA1C 4XCFL 1UM6H 4OZGF 2YPLB 4YO0B 3EYSH 4GAJL 5I1CH 2W0KA 3SDDC 4KI1A 4XVSL 4DK3A 2HKFH 4X6BA 3P40A 3CZJA 3BAEL 1GSMA 1VADA 4P4RB 5EULV 1T0NB 2P8LA 3BESR 3N85L 4KRNA 1LO0H 2MWCA 4MVBD 3BH8B 5EZOL 3HNTL 4XNZB 3GIZH 1PX3A 5MHSD 4R2GC 4WU5A 2A9NH 3TYFA 3ARBA 5KVDH 1JRHH 5CMAA 2J4WL 2ZPKH 1NJ9A 4C83A 5BQ7B 1A1OA 3HMWL 3PGDA 4RISL 4MD0B 1CLCA 3ARFB 2ESVD 4GW5A 2HH0L 1WFUA 4LL9A 3GJFB 1ZHKA 1LO4L 4YWGH 4F8TA 5EOCH 4AEHL 4RBPK 3BYYA 2NY4C 3LEYL 3EDFA 3QI9D 3GHBL 3HCVB 3FFCD 3QB7C 4I5BB 4J3SA 2ICES 3RJQB 4MJ6B 4NQDA 1RUPL 4XVTH 1MVUB 3OBAA 4Y5YC 3LEYH 35C8H 1F2XK 1JZ4A 2ATPA 2DLEA 5FGBA 5DK0A 2F19H 4M6OH 1DR9A 4E5XA 2X1PA 4KDTC 4U3XA 3RGVA 4L4TA 2OK0H 4R96B 3UXFA 1ZSDA 2D03L 4ZQKA 1INDH 1G7QB 5FYLL 1KUMA 5INCA 1IZJA 4LQFH 3OGOE 3P4LA 2Y5TB 3H7BB 4NFBA 1YYLH 3KPQA 3GKZA 3PHQB 5IW3A 3FAWA 3GHEL 3S37L 3L3HA 1MJUH 4NUJB 5ALCL 5MEQB 5EZOH 2IAMC 3QHFH 3MJ9H 3P30L 3QEQE 4HIIB 2AJUL 5J1AA 5DRZB 5HVHB 4K2UH 5DI8A 5A2JH 4QHMB 1CGYA 5FOBB 3EOTL 4NNXB 4KHTL 1D9KC 3VFRB 3MRHA 3PWVA 3C9NB 1R24B 1AXTH 1UXWA 3ZDXF 3O8XC 4PBVC 1UB6B 4MGXA 2V7NA 5ICZB 5IP4A 2XY1A 5FXCH 4ZAKB 1ADQA 1I9JL 4WI3A 1IAOB 3ZYZA 1J8KA 3QUYC 4NQDD 4D3CH 1DEEB 1SJVA 4YDLC 5IW1A 3O3BB 3NH7L 5CBEB 4JY5H 3C6LC 3IF1A 5GS1A 5DVOA 4AT6B 2HVKA 4K55A 4LPWA 2GSGB 2PN5A 3MRRB 1ZV5A 2I24N 2H6PA 1QR1B 4Z7QE 1JGEB 3BZEA 4I3SL 2VDQL 1KYOJ 2E7HA 2X70A 5C0EB 1HWGB 3PL6A 4LU5H 1IEHA 4KTDL 1G7PA 2WSKA 3KYOB 4RAVA 4YDVB 2DLFL 3MV8A 4XZUB 3STLB 3FONB 3VRJA 5T3XE 2WWMD 1EO5A 1CTNA 1MFNA 1A7QH 1UVQB 4LCCC 3RWEB 2VXVL 5D2LE 3T8XB 4BH8B 4BZ2L 4JFDB 2VL5B 3PP3K 3ULUD 1MJJA 5H35A 4XXCC 3FHAA 3O6FC 2R9HD 3EBAA 1C16A 1LE5B 4RIRA 2J88H 2Z92B 4Y4KA 1FH5L 1U6AL 4FNLL 3W11C 2GJJA 4IOIB 4WV1C 3MBED 3GSWA 2J7LA 1U58A 4YHML 1EA9C 4ZOCA 1Q72L 5ADPH 3QWQB 3MA9L 1ZAGA 2BVPA 5CEZE 4Q9RL 1X7QA 3H9SA 2PKDA 3U7WL 2IBZX 4ZUVB 1I1AD 4K8RC 4R26L 5DRNA 1GPOL 4KZEH 5D7JC 5ENWB 5E99L 4NO2A 3VXPB 1U0QA 3GMOA 1EFQA 3SHSA 3RUGB 1A7NL 1LDPH 3WMSA 3O11B 5FYKL 3B2UC 2MPAL 3QIWC 3PGCB 3F7QA 3HAEH 3AREC 3BI9X 1P5VA 1MHEB 1YEFH 3U2SB 3LS5L 4OFPA 1FNEB 4M6NH 3VXME 2EDQA 4HSQA 5EZIL 2VYRE 4YIQB 3O45A 1RSFA 1A1MB 2J6EH 4PY7A 4IMLB 3PDGA 5FM4A 5I0ZA 2IBZY 3KLAB 4L3EB 4Z5RA 3WJJA 4OSUL 5IJKC 4KY1H 1OSPL 2RIKA 1HOCB 2OMNA 3SDAA 2LU7A 4ZFOA 3GSVB 3QAZC 4HZLA 1JHTB 5BRZA 1GPOH 1CLYL 5CLWA 1NGXB 1A2YB 1T7ZA 1YNLL 3AVEA 4RFOH 3VWJC 3PV6B 4Y4KD 3BKYH 3FTGB 5EUKB 5EU6A 3CFJA 1L9NA 3S7GA 4Q0XL 4YFLI 1ED3A 3LKOA 5F71A 5LBSH 5IB2B 2FGWL 2APBA 2RGSA 3Q0HA 4NRZB 3RWIA 3TJHC 1BJMA 1T1WA 2IPTL 1ZVSA 4XBGA 2Q8BH 2VLRB 3BT2L 5DJZB 1W0WB 3BGFB 2DQUH 4JHWH 1YEKL 5EIQA 5ERWB 2O61B 1L6XA 4JKLA 1MFEL 4LPUA 1U8LA 3TLRA 4XWOD 1KXVC 3KR3H 4AMKH 1ZANH 1NUNB 5DLMH 3V0VB 1RZ8B 2PXYB 4ETYA 3W11D 1XMWA 4GSDL 2NXZB 1CYGA 1XGRA 3CXHJ 2HA1A 2IPUG 2D3VA 3EYUL 3H9HA 1C7SA 2KZWA 4EDWL 4JCLA 4K94C 1IGFL 4NKIL 3TVMC 1EEYB 5GRWA 3QFJE 4HBQA 3D6GA 3QUMH 5D7JD 1A6ZA 2CLVA 4NKOA 1AR2A 4YAQA 4L3CA 2FNBA 4YBLC 4KHTH 3EFFB 1NGQL 5B3JF 4PRID 2IQAB 2VB5A 1ZHNB 3LQZB 5FGCB 1KEMH 3MRKB 4LSQL 3G6AA 2IANE 5KVEH 3IJYA 3VDCA 3VA6A 1ND0A 4N1CA 4YGVA 5B21A 5MENB 1QHPA 3T65B 4YNYB 4YHKL 4TUOB 5CBAB 4XPHL 4P2QB 1J7VR 5FCUL 2C7UA 2Y7QA 4P57A 3ARPA 4HWUA 5E1HB 3WIFA 2JE8A 5F1IA 2MKWA 2YD9A 3N9GH 3EOYG 3TO2B 3D1MC 3TYGH 4OD3H 4PY8I 1FC2D 3PHSA 1IAKA 3OXSB 2H9GB 1T22A 1D5ZA 4QO1A 1MIMH 5HHQA 4XRCB 1BECA 1H3PH 4U1LA 3HC3H 1ONQB 3DUSA 5GS1B 4PGDA 4TRPL 2J8UA 1FYTB 3SPVA 1Q9OA 43C9A 5J9PA 4G9FA 3SGDH 4YK4C 1L7IL 1LO4H 3S5LB 1HDMB 3V8OA 4PG9B 3QG7H 1AGCA 1KC5H 4M7KL 3DV4B 4D0CA 4DN3H 1QBMH 2B4CC 2D7MA 4YZFE 3X11B 1WAAF 4LAJH 2CMRL 2VWEE 4X5WA 2E7LC 1WT5A 1VA9A 4XMLL 1JRHL 4FFWC 3C5ZD 5ANMA 1OGTA 2A9NL 2VZTA 2VZOA 4QRRB 2R2BA 1WITA 4QLRA 1HK6A 4IRSB 1RJLA 3QIBA 3HNTH 4G7YH 3GMMB 2DLTA 1F4YH 3KNBA 2GSIB 3VXSE 5DEZA 2FJFA 3QH3B 2HKFL 5JLZB 3KPMB 4PBXA 2FDBP 1PYWB 3PP4L 1T1YA 4NC1C 1MFDL 1D6VL 2DDQL 3NZ8B 4EI5A 3QUKB 4RWYH 1U8PA 4X0KB 2H26B 5IQ7H 4ZNEE 2R1XA 3HB3C 1DANU 4IDLA 1G7HA 1IC5L 5L8KB 2AABL 2XNAB 4QXUL 1GL4B 3U0TB 5BS0A 1CIUA 3PJSB 3KG5A 3KXFD 3FQNB 1P2CB 1H3PL 4HIXH 3B9KD 1MLCB 4MNGE 4LCYA 3QXAA 1RZIB 3JWOH 3VG9C 5F7EL 1FL6A 2B20A 5FUOH 3MLSH 4PJ7E 4PP1C 3BXNB 1T4KA 3C8HA 4WENB 2XTLA 4B7IA 2VLJB 4MWFB 3EDEA 3B9VA 4Z7UE 5HGGS 1AXSB 2HFFB 4ZMAT 1NMAL 1H3WM 5D1ZB 5T1LB 1S8DA 3JWNC 5JPMB 1WZ1H 1M05B 5C1MB 1ROWA 2PW2B 1DQLL 5D1XA 3FO1B 3BISA 1WFNA 4RAUA 1WWCA 4YHNB 5E00A 1BOGA 3WJJC 2I26N 1OTSC 1KEML 1O0VA 4KJQC 1WBXA 2FGZA 1AD9A 3ZYIA 1G6RA 5DSCB 2XYCA 4Z7QF 4DKAA 5DFVC 2FIKB 3UCRA 4H20H 4TNVF 5I30L 3MZTA 3U36B 3QIWB 2EDHA 1SQ2N 5CEZD 1KF9B 3GBLA 4OFVA 5IB2A 1CR9L 2QHRL 2OX5A 1P84J 1S9YA 4HK0A 3BUTA 4EDWH 4PRIE 2HTKD 3PGFH 1T5XA 3SE9L 2YKLH 4QRPB 2GUOB 5EUOE 2LTQC 2H32B 4DZBB 1G7QA 3BO8A 1EEUA 3NCCB 1II4E 4HWZA 3EZJB 4BQ8A 1OAUL 4LGRB 5KG9A 4HFWA 1I9IH 1HILB 1VGEL 3CAFA 3VFMB 4TUJB 5D71L 5I8CB 5C0CA 1G7MA 1U92A 1J05A 3C09B 3RBSA 3L7FA 5D72H 3MRHB 4Y19A 3MBXH 4G8IB 4BQBA 2MCG1 4ACPA 5CP3A 4HCRL 4AQ1B 3MA7A 4ZSOB 4JHZA 1ZKAA 3GSRA 1T2XA 3INUL 4HH9B 1XGRB 5HGHA 2UVFA 1FNGB 3H3PL 1R3JA 4PLJD 5KSAC 1U2CA 3C9NA 4NM4L 4W70A 4NGHL 4UV7H 4NZUH 5LBSL 3ZE1F 4CMHC 4UV7L 4RMSA 2XA3A 3M17A 1XF5A 5GHWH 3SO5A 1JL8A 4L3EE 3QFJA 1DEDA 5D1XB 4L3AA 2LV4A 4FFZL 4HIHA 3MRMB 4X6EB 4Q58C 4JDTH 5FYJU 4P23A 1LEKA 4P23C 5DMGC 4NOBA 1CLYH 5DUMH 4TUOA 3BP4B 4JZNB 5BVJA 3V5DA 5JORB 2RR3A 3QEQD 1TJGH 1WISA 5DZLA 2W9EL 3WL9B 4EZMA 3KXFE 3PWJA 4OJFH 3TBYB 3QEGH 4TYUA 4O9HH 2AJVH 3RAJL 4Q9QH 2ED7A 4JLRB 5J8OA 5D7IF 1RUML 3KYMB 5CUSH 4AM0B 1U3ZA 2Z8VC 4PJIF 1MEXH 1NMBL 4GG6A 2UZIL 3VG0L 3UBXA 2L7UA 3HPLB 2WBWB 1RAMA 2BSTB 2VE6B 4DN4L 1B3JA 1E4WH 4H1LB 1WICA 1BZQK 4EVNA 3SCMD 3UP1A 3QA3B 3G04A 3MGTA 3TT1L 2VUYA 2CR6A 1NUGA 5DJXA 3QNXA 2MCPL 4N0CD 5BO1L 5L0QC 1HSAA 1MHEA 1Z2KA 3LKPA 2J88L 4P5MA 5BV7B 3QQNA 3GK8L 4OKDA 3O11A 1TIUA 3LPGA 5GGUB 1N0LA 4XCCL 4R8WL 3B8YA 4TUKH 3RDTD 2DTML 3I02B 3BGFC 4LEOA 2XA8L 2DTSA 2O5ZH 1V7MH 3VH8B 1PYWA 1OF2A 3FB6A 3ROLA 3HHRB 2Q8AH 5KS9E 1T04A 1XIWB 1JHKH 4G6FB 3E1F1 4KTEL 3UTTE 2VDQH 3C5ZC 3RQ3A 3TNNA 5KZCD 4PJHF 2CK2A 3ARWA 3CUPB 1CXIA 1IC5H 4YK4B 2C3XA 3MRQB 5C07D 5HJ3B 1JPTL 3UTPD 1CDYA 1R3HB 2JELL 1AXSA 3OQ3B 4C4KT 2V5MA 3AS3A 3OKMB 1T4KB 3T0ED 5EBMB 1DP0A 5FUZH 1MCPL 3NFNB 1LEIB 4QGYA 1TCMA 4ODUB 2F53A 1QR1A 4XCNA 4TTGA 2VZ3A 4ODTL 3CMOL 2A6DB 5JOPD 1EUTA 4S0SD 5L2KE 1XGQA 3MLVH 4K2UL 3SOBH 3NIGE 1NLDH 3RNKA 4LASL 3PWPE 5I1DA 3O6KL 2O5YH 1YMMD 4BSVA 3QXWA 2OP4H 4LMQE 1B0GA 3SO3C 1UJTA 1QKZH 3K4AA 3L3JA 2GIYA 3O3EB 1L7IH 4N8PA 4U1NB 1SVZA 1HQ4A 2YSSB 5SX5H 5DO2D 1BREA 3UZVB 5E4EB 3VFUA 2D03H 1JF5A 1NC4B 4IOIA 4G8EA 3SGKC 4PJXA 5H2BB 2OK0L 1BVLB 3RX8A 2VMFA 2E7LA 4ORZC 3BKML 4LSTL 2VZUA 2YRLA 2CDGA 4PTTA 2BMKB 2NTSP 2YWZA 4TSAH 4LP5A 1ZHNA 3OJDA 1RUPH 3MLXH 1FGVL 1C5CL 3TYGL 2BP3A 2XKNB 4N0FB 4CVZA 1SJEA 3NIFE 3N1PC 5D8JL 2VN4A 1GOHA 4MDIA 4M1GL 1CDCA 4K7PX 3SQBA 3ROOB 3MLUH 2OBGA 3LQZA 1BGXH 5E8DL 2EIBA 4GQPH 3RGVB 2Z93A 2I27N 4LDLB 5DQDH 1K8IA 3HMWH 3LS4L 4QXWA 5JW3L 5C92A 2IFFL 1K3ZA 2ZG3A 1RURL 3QI9A 4S1RH 4WUUB 4A2MA 1KTDA 5FCSH 3CSBA 3QCVL 5KTEL 1JZ2A 3L3DB 1EMTH 1NGQH 3L3GB 1PKQA 5FO8A 4I18B 3RVUD 3KLAA 2VH5L 3D25B 3L1OL 1VFOA 4OKVA 1GGCH 3RTQD 1KSRA 3BUYB 3BAEH 1OT2A 2WBKA 4N5EC 3HRZB 3BPLC 5DI8B 3ARFA 5EU6D 2YEZB 4MQTB 3DGCR 4WJ5B 5TE6H 2AAVA 2NY2D 4C83B 3ZDZF 5E2UH 3UPRB 2VERN 5DJAB 5TQ2L 1KN4L 1N5YL 4P46D 2IAND 2AXGB 2VR4A 3D69B 3BGMB 4WI9A 1DBJL 5DMJB 4MAYA 2V2XB 3TCLB 4PUBH 5CFHA 3C2AH 5ESAA 1CDBA 4PJGB 5C0FA 4I0KA 4OLXL 4QT5B 4MCYA 5I9QC 5JA9A 3BKCH 4NRZA 3RWIB 4DVRH 1AC0A 1E6JL 1RZ7H 4P99A 3M45A 3KNBB 4TNWF 1WK0A 4X7TB 3PWNA 5CJOH 3OWEA 1PG7X 1XF1A 4U7SA 1K4DA 4U3CA 3QDGB 1FE8H 4YGAB 2Y1VA 2G9HB 1QBLH 3OAZK 4W4NA 3RIAF 4FQHA 4JPIA 1MHHB 3VI3F 2C3GA 4N68A 4OCWL 2G5BB 1EXUA 1KFAH 4OD1L 1XCTB 1MFAL 3K8LA 4XZUA 2ARJQ 2X40A 3NIGF 5CJ8A 5DHYA 4RWHA 5E2JA 1SYVB 2C1PA 2GAZA 1AHWA 4JM2A 3BP6A 3EHBD 4L8CB 2A6JA 1L7TL 2OCFD 4Q6IC 1AIFB 4DFHA 3V0AC 2FECI 3K7UA 3MYZA 4H5SA 5TDNB 1N6QH 1V7NL 4LK4A 2R1YB 1LEGB 2JLLA 4HS8H 5EOTA 5F88A 2Y36H 4JFEB 5F8QC 1BVZA 5JHDE 1YA5A 4LCUA 4UNTA 3QCTH 1EZVY 3UYRL 4PJ9D 3BO8B 3HZYA 3O2VL 4WDIA 5CBEA 1H3UA 4PGEB 1VGKA 5IBUB 4GG8A 5INDB 4JZJA 5I75B 1A3RH 4YDJB 2AXGA 4NFDA 2HRPH 5F1IB 4BZ1H 4YFDB 3H3BC 2EXYD 1A7NH 1NAKH 2APFA 1E4KC 2CD0A 4FQJL 4OFIA 4EOWH 3LDBB 4ELKA 4LSDA 4YHLH 2YK1H 1CFBA 5GGTH 3ARTA 2K9UA 2X4RB 4M3JA 4G80A 1EBPA 4L1DA 5T1DL 3GMRB 4HX1A 4DUWA 5DT1L 2DQHL 3SDAB 3ARXA 5JW5B 1FVCB 2P8MB 4XX1E 5IHUL 5IVNA 3RWHA 1L7TH 1MQKH 3D0VB 2ID5A 2X4QA 3NN8A 5D2NC 2XTJD 2OI9C 5HYJA 3P3YA 1LEKB 2APVA 5IB4A 4QNPF 4G6JH 2CKBH 3LKQB 3HS0A 4KKLC 3IETB 2Q3ZA 1X7QB 2OR9L 1XIWC 3G5VB 1WIPA 4MJIA 2AI0H 2BNRA 1HKLL 5EFIB 5IB1A 2NZ9C 1F00I 2BNUB 4R3SB 1JMXA 4N0YH 2A9MH 1OM3H 4P9HH 1FIGL 1NEZA 1REIA 3WEXB 5D7LD 2VKWA 4GMTH 4S1DD 2F5BL 1AJ7H 3U82B 4WW2F 5IEHA 5DZNA 3O3AB 3MTRA 5DEFA 1NC2D 1QSZA 1CGTA 4JO3L 4D3CL 4LPVA 2NY1D 4Z7WF 3HE6C 4HLJA 3GSRB 5I6XB 3AS1A 3DO7B 4QWWC 4MNQB 5JLZA 1RZGB 1KN4H 3CPLB 3QWRD 4HAGA 5E2UL 1KPRB 2ZCLL 4CU7A 3O9WB 4J3UA 5SWSB 4OQTL 4EQ2A 5I18L 3QNYA 1KLUB 2HVJA 1CDJA 3L1OH 2HN7A 3JVGC 1UM5L 3QO1A 2B7DT 3VXOB 3SO3B 4A6YH 2FJHB 4KI5D 5F9WC 4QOKE 3MCLL 1F3RB 1OGAB 2F53D 4CVWA 3OKOA 1AE6L 4X80H 2BSSB 3MJ8A 5DEGA 4LVNC 2HJFA 1FIEA 3KLSA 3OKLA 4HS3B 3LS4H 2RFXB 4XC1L 1ADQH 3A6OA 4GRWF 5D2LA 3UJJL 5KVGL 4Y4HB 1FZMA 1BX2A 4HKZB 3OKYA 4K71B 2J12B 3FO1A 1CS6A 35C8L 1FYHB 5L9DH 3CUPA 1UA6H 3SJVB 1P4IH 4YXLL 4IRJB 4YXLH 2H1PL 4NC2B 4XTRD 1N2RA 4XPAL 5F3BA 4TSAL 5BQ7A 1JMZA 2OR7A 4E0RA 3O4LB 4N5ED 2F8VA 3G9VA 4X98A 5ITFB 3EDKA 5HYJE 4YZFF 4RISH 5E56A 4FMKA 3LKRB 3SY0B 3QPQC 5DMKA 5C3TA 2OTWB 2BZDA 1JI2A 2OP4L 4CMMA 4JKKA 3IAGC 3ARBD 2ERJC 1P4LA 4JM2B 1GHFL 4BYHA 2RJMA 4OCSL 1FVEB 4P4KC 5EO0A 5HVWA 5CHNB 1AIFA 1H5BB 1W0VA 3A6BH 2OZ4H 1N26A 1YY8B 4LNRB 1AGFA 3L3KA 1QEWA 3WFEL 4JO1L 3BN9C 3VD3A 2BVQA 4GT7A 5DJ6B 3WHE1 1H15A 4BKLB 2BNRD 5E8PA 1KTLB 4CN4A 4D8PB 4D9RD 5E8OA 5I9QB 1XR8B 4WI6A 4KDTA 2Z31C 1FBIH 5IMOB 1J1OL 1C08B 4PGCB 3DIFA 3MJ6A 2V7NB 4XI5C 2K3TA 2GTWB 1UH4A 3SDCC 3QQ4B 3FFDB 5C0AB 4JQXA 2UYLB 1CFNB 1R5IA 2X4RA 1MCWW 1L0XA 2CGRL 3SKNA 5HGDA 1XF2B 3PDOB 3C60C 1PAMA 4TVPE 4LLQA 3MXVL 5GS0D 2O5ZL 1WGOA 2N56A 2DF3A 3A67H 2YUZA 3J7HA 3BPCA 1TPXC 3EHBC 4LVHB 3W2DH 2V9RA 3E6HB 3EOBB 4P4KA 4DKFL 3B83A 4BA8A 1JNLL 4RBPH 1GGBH 1KB5A 4G7VL 4QRRE 5INCB