3EO9H

Crystal structure the fab fragment of efalizumab
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
214
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGYSFTGHWMNWVRQAPGKGLEWVGMIHPSDSETRYNQKFKDRFTISVDKSKNTLYLQMNSLRAEDTAVYYCARGIYFYGTTYFDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Efalizumab Fab fragment, light chain
publication title Efalizumab binding to the LFA-1 alphaL I domain blocks ICAM-1 binding via steric hindrance.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2008-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eo9H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eo9H01
4FA8A 4G43B 4KJYB 3KPRE 2R2HA 4YFLI 3QDGE 4GJTB 1IAMA 1LWRA 1YMMB 3GHBH 3TIDB 1CCZA 4DKAA 1MAML 5IB3B 3LKQB 5FCUH 3QULA 4EI5B 2FRGP 5F7DB 5FYLE 2D7TL 4JKPH 1YPZF 4KDWA 2BVTA 3P40A 1KLFA 1DE4B 1FJ1B 1MI5D 4GRWE 3SQOH 5J1AB 2FIKA 1OTUD 3LPWA 3MROB 4YHZL 3HRPA 3RWFB 5KBNC 4OCXH 4DQOL 1NLDL 4L3CA 3CX5J 1S7QA 3IJSB 5AWNH 5I66A 3B8YA 4L3AA 4ZFFB 5D1XB 1U6AH 5EBGA 2OJZL 2LVCA 4XWGH 1HYSC 1Q0YH 2Q8BH 1A7NL 4I18C 1KOAA 4AT6A 5E8NB 5IBUB 3BN9D 5HHQB 2FBJH 4AG4L 4CN4A 5DJAA 4KUZL 5GZOC 1TIUA 5MENB 1H3PL 2E7LC 2X4SB 4GOSA 5EU5A 5C9KA 1RHHB 1CDJA 5EBLA 1PLGH 1I8IB 4FQJH 4YPGB 1RZGA 3CVHB 5DHVH 2JCCF 1XR9B 2PXYD 1BAFH 4N1HB 1T4KA 3CD4A 4ORGA 3WFCH 4QOKE 3RU8L 2UZXB 4HHAA 3HZVA 4CKVX 3RL1A 3R1GL 5BV7L 4EI6B 4YUEH 1HOCB 3T0XA 1KJ2A 2WUBL 4HJGB 1KJ3L 5DO2D 4PJAE 1HCFX 4H1LH 4ZUTA 1IRAY 3UC0H 3EOAA 4RCAA 2EC8A 3PWLB 3W0WA 4Z7VE 4MWFA 1KPRB 3IFLH 5EIIB 4Z7QF 2JB5H 4ZQKA 1CLZL 3ARGC 4HF5L 3L5XL 2VLRD 1QVOB 3DYOA 4GKNA 1IGCL 3MLWH 5L7XH 3OKMA 4JG1H 4LDEB 4OZFB 4NRYB 2D3VA 5HYJA 1ZLWH 4L4VB 4F58L 1DBAL 3TC9A 3MLSH 3QFDA 3T0EC 3SE3A 4HIJB 4LVOC 1M7XA 1MCFA 5CZKA 4S2SA 1RURH 1OAXL 4PJDA 5C0EA 5MEPB 3TYGH 2CMRH 3IFOA 3ULUC 3ULVE 1WTLA 3TEUA 1U8HB 3NCEB 3AB0B 3VXMA 4GQ9L 1AO7D 1OF2B 5F44A 1K3IA 2A0LC 3DBXB 5DHXB 2WP3O 3S4SA 4PJHA 3VU2A 3MODH 1PKQA 4NWTL 2GTZA 2PYEA 4TUOB 4UT9L 2B2XL 2XN9E 1OGAD 1ZHNA 2E8YA 4NP4H 3O4LD 1NUNB 3I2CL 5IB5B 4G80A 3QCVH 4YDLB 1TPXC 1UACL 2AJ3B 4ZTOL 2E6PA 2J1KA 3QUYC 4TSAH 4LKXA 2FH8A 3CFJB 4HWNA 3VFTB 5DJ2B 5FKAB 2QBWA 5C0CE 1JCKA 3SDXE 4M1GH 4HIEA 4LASL 3A67H 2HRPH 4MVBC 1JWSB 4LHUA 4QXTA 3G5VA 4DN3H 1CFTB 4OZGE 3KS0J 4YZFE 1F8TL 5HGAA 5M95B 3IXAA 4N9OB 5JR1L 2ENYA 2VRAA 3BPNB 4PJIB 5FOBB 3DVNB 3NZHL 5E4EC 1GAFH 4JFQB 5I6XB 4ZO9A 3L5WA 5AD0A 2DIBA 3V6OA 5FUOH 3RBGA 1SEBB 4DW2H 3OKKA 1ZLVK 3BEWB 3OQ3B 1NBYB 2DQEH 3QISA 3QULB 4N5ED 1VACB 4GT7A 4PJ7B 3BDYH 4NM8L 1SY6A 2MNUA 2VISB 3HE7C 1S9YA 2XQYG 1HEZA 2FIKB 5JOEA 1FZOA 2VDNH 3RBSA 1JHLL 1S7QB 4KTEL 3ECBB 2H3NA 1LDPL 4DK6A 4GMTL 5D1ZC 1AGBA 1S9WB 1YUHB 1F4HA 4P23D 4AT6B 4WUUA 1RY7B 5D8JH 4O00A 3B9EA 4X7TA 3SGDH 2ATPA 1QZ1A 1UWGH 5EU5B 4D0DA 1WIUA 1MHHA 2DLHA 4K8RD 3VFGH 4KC3B 2MQ3A 4OLXL 1ETZA 5EBLB 2BOCB 1P4IH 2F8OA 2ESVE 5T5FL 4ONFL 1RZKH 4K71B 2NY4D 1RZGB 4U1JB 1MCEA 1F5WA 2EDHA 1H3TA 5J11C 3HRZA 1PW3A 4KI5E 3U4BL 4ORGB 3DRQA 4U1GC 3KJ4C 1MIMH 2E27L 4UINH 1DVFC 4M1DH 1FN4B 2VLJE 1Q1JL 2BERA 1Z3GL 4NJAL 5AZ2L 4EN3B 3HNTH 5DZNA 4PGDA 3WHXB 3PQYA 5E9DD 3F7RA 4UU9A 1T04A 4WU5A 3QB7C 5IK3A 4KHTL 3EOAB 3U6RA 3NIFE 4CNIB 3N0PB 1OPGH 3BWAA 4MWFB 3GSWA 1IGYA 5ITFB 4PJ9A 2HKHL 1NQBA 3JWOH 4M6MH 4W81A 5BZWB 2UWEF 4WY7L 4GKNB 3CLFL 1UCBH 4LLUA 4GXVH 2VZ3A 1FIEA 3UTSB 5HYJB 3NIDE 2WINB 3C60B 3D25A 5KVGH 2VN4A 3RPKA 1HKLH 4FMKA 4PJ8B 1SM3H 3UO1H 3QFDB 3SGJA 1A6UH 3GBML 3MRFA 1E6JL 3IFOB 3WO4C 2P4AB 5I15H 1MCWW 4XGZA 2NXYC 2DBLH 4CVZA 5HHOB 12E8H 3VXMB 5IHBA 1MQ8A 4DKFH 4LCCC 2JTDA 1FFQA 2IC2A 3O6MH 4K55A 3S4SB 1PKQB 2DJ4A 1R24B 2WSKA 5ESVB 3HUJB 4LSQH 5HVHB 5L2KA 4H20H 5C09A 1FL6A 3EYSH 2DBJA 1GOHA 4U1IA 4H0IA 4KZEH 3DHJA 4LKXB 3TBYA 4F8QA 4GW5B 3VGAC 1ZHBB 5GIRA 3M8OL 2WUCL 3P4MB 4HKBA 3TIEA 1LK2A 1QFWL 4Y4FD 4Y5YB 4OZHA 3ARZA 4HIEB 1TJIL 4N0FA 3B3IA 2HT3C 2FCBA 4LHUB 4QXTB 3G5VB 4TNWF 1T1ZA 2BNUA 1INEL 2FJHA 5HGAB 4KQ3H 3ZL4H 3MUGA 1MSPA 3QRGL 3NABL 4J4PA 3DOSA 1IC4H 1ZE3C 3F62A 2E6JA 1UYWL 3GSNA 1JTTA 4LGPB 2ZCLH 4H8WL 1FV1B 3QNXA 3MYZA 5DDHB 1EHXA 4NN7C 4WNQA 4IJ3B 5CGYD 2BNQB 4G9FE 1JK8B 3OKKB 5IESL 3IFNL 3U7YL 1EJOH 4LLDA 5F7EH 2R56L 4E0RB 2CUMA 4DUWA 3CVIH 4NNYA 4DKDC 4QCIA 3RKPA 3PHOB 2CR3A 1WFUA 2IFFH 2QL1A 1S9YB 1HEZB 3MA9H 3V5KB 5BOZG 1FZOB 1NEUA 4JFYB 4X99A 4P2RA 3LEVL 5JXED 3X14B 1J1XL 3D39B 4Z7UB 4YGAB 1YEEH 4NUGH 2H3NB 3V95A 3EJYD 3G08A 1HSBB 3ZYZA 1WQVT 2Y6SD 3ARBA 1D6VH 1B2WL 2EC9T 4KRNA 1M05A 3QBTB 3MBEA 4WUUB 4OCWL 3DGGA 2EDFA 4X7TB 5TF1L 2KZ1B 3FOLA 1UM4L 2ATPB 4D0DB 2HG5B 5DSCA 1ETZB 1BM3L 3DETC 4ODBD 4Y19D 5IJKA 3P0YL 3HRZB 4K23H 5FYKH 2PO6B 5IVXB 1UZ8B 5CBAA 4DAGH 1RK0A 3TCXA 1BMGA 4WDIA 3B2VL 4PGDB 4AEIH 3H0TA 4UU9B 1T04B 5BCAA 1AD9B 4Y5VA 4W6XB 3QUMA 3IJYB 5FYLH 3U6RB 3IDNB 3H42H 4FQXA 3VXRA 3GSWB 4O9HH 1IGYB 4GS7C 1UEYA 1V7NL 5F7MC 3H7BA 4PJ9B 1MJJA 3K1DA 1WBZA 3EYUL 4OZIE 3TFKC 3WS3A 4FTVA 2OQJA 3K81A 3KNBA 32C2A 3T0AA 4LLUB 2FB4L 3RDTC 3QZWA 1LO3H 4OGYL 3UJIL 5I18H 4IRJA 3MXWH 3VW3H 4QXGL 2VABA 4WRLA 5B8CC 3B9KB 3N1MC 3WNPA 3N85H 3MRFB 4N0RA 5DJDB 3VA2C 3MLYL 1A6AA 5ACMA 1YNKH 5CJXC 5GRJL 5FKPB 4V2CB 3VWJD 5H35A 4KKBC 4XGZB 2FL5A 4XP5L 4J8RB 1NSNL 1QLRA 1QSFB 3TBTA 4M6AA 4A2MA 4XMKH 1AKJB 1U8PA 3IJHA 4NM4L 3QIUD 4X0KA 5D2NE 3PL6A 1PY9A 4P5MB 1XGUB 1LEIA 3PP4H 4LQFL 5JA8B 2A9MH 2BSSA 3MLRL 2XKUA 1MHCB 1JYXA 4P48A 5L2KB 1ADQA 5C2UB 3B6SA 5C08A 4KKLC 1FL6B 4MXWL 1WV7T 1U41A 3VFWA 1W0WA 2IAMA 3P0GB 2EXWD 4D94A 5IBLD 4PG9A 1T3FB 5GJTL 3MCLH 3TBYB 1NCUA 3T3PE 1L6XA 3FO1A 5GIRB 1OD7A 3ULSB 4KUCD 1KELH 1T7VA 3CH1A 2IF7A 4HK3N 5CUSL 5HI4D 3SDCD 3GMPA 2GT9A 3GNML 5CP3H 5GSVA 3MFFA 3MUGB 5JOFA 1SJXA 3BIAX 1OAUL 5C0BA 3HMXH 1U3HD 3ULVH 2EE3A 3CFCH 3K0WA 4Y16A 4OBRA 4NOBA 3BP5B 2XY1A 1OQOA 1D9KC 2M26A 1CLOL 4OF7A 3X11A 3MV7A 2EKSA 3VGEA 3V4VH 4PJFA 4R0LC 3H9SE 3QIWB 1MFAH 4FZ8H 2A6DA 5T1MA 4LLDB 1MCIA 2FSEA 2H2PC 1N5YL 2H1PL 3U30C 4JY5L 3NCBB 2P8LA 5DK2B 1QFUL 1T5XB 4KK8C 4ZAKA 5GJSH 2W65A 2VL5A 4NDMA 1KJVA 1I1FB 1NFIB 1R3LB 1AC6A 4PRPD 3HZKA 2BOBB 4RFOL 5MP6H 3WS6A 4OIIH 3G08B 3OPZL 3TVMC 3HLAA 4IS6A 5DMIL 3H9ZA 3MBEB 1RIVL 1NFDA 1J0IA 4F57H 1YNLL 2LU3A 2GJ6E 1HN1A 5J7CC 4LLAA 3GM0A 4P2OC 3BGMA 3O9WA 4K3JL 2EDQA 3Q1SL 4F2MA 5DSCB 1JYNA 3QJFA 1TNNA 1X6NA 1IKFH 4F3FB 3P4NA 4XNUL 4PYGA 3RZCB 3BRFA 4WV1C 2O5XH 4NQEA 4PRHE 4PLOB 3SKJL 4MD0A 1OAKH 1MNUH 1D5XA 3K2UL 3BYYA 4MA1B 5E5UB 2BNRB 1TTFA 1JRHH 4Y5VB 4I3SH 3QUMB 4YR6A 4CL7A 3LEYL 1GL4B 2JELL 3TO2A 3VXRB 5FB8A 1Z9MA 3H7BB 2VAJA 5BO1L 4XPAL 4U05A 3RGHA 3U9UA 1WBZB 4LLMA 2XA8H 3WS3B 3F7YA 1DQML 4NHCL 1RZKC 3TN0C 1JPSH 3VRIA 3AM8C 2XPGA 1YA5A 4V1DE 1T22A 1REIA 3QZWB 2JCCA 3UJJL 3AY4A 3O11A 2Q87A 3TM6A 1Q72H 1C16B 2EDRA 5ICXA 3VJ6A 3RWJB 2EEBA 4NN6C 1BOGB 4ODTH 3LZFH 2XWJA 1DQQA 4MQSB 4GAGL 5T1LB 4DEPB 2J8OA 1AXIB 1A6AB 4OV5B 1LO5A 3DMMB 1HWHB 2ZG3A 4NRXA 4JFHE 3M07A 3CXHJ 1JHKL 1P6AB 4AMKH 5KSVA 3DX8A 2DDQL 3X3GL 3JWOC 1BBDL 1QLRB 3TBTB 1B0WA 5IW1A 2VLME 4X7SH 2V7NA 3V6BR 1Y18A 3WIIL 1EBAA 2VLKB 5J8OA 4RGOL 1S5HA 3PL6B 3BZ4A 2YPLB 1LEIB 3S5LB 1U42A 3ZHKA 1I4FA 1X4YA 2JIXB 2R69L 1MQKL 1CXIA 2BSRB 3B6SB 5D1QD 1VPOH 1EEZA 2NLJA 2DQDH 1JF6A 5I71C 1W0WB 2IAMB 3ABZA 4U0RC 1OSZB 2R8SL 4PG9B 5DJ0B 2GK2A 3HB3D 3QEGH 4OLYH 3MLUL 3ARFC 1CGXA 3QDJD 4EEEA 4X6CF 2BMKA 3ULUL 3EO0A 3NFPB 5FYJE 3LRSB 4FQPA 3MLVH 1QBAA 1RMFH 1A7RH 3CH1B 3L3GA 3KLDA 5LBSH 1UZ6F 1X5FA 4E42B 1ZA6A 3QCUH 3ULUF 1NCWH 3MFFB 5I8OH 1MIEL 4DVBA 1W72B 1XH3A 1HCVA 5C0BB 1S7VA 5DRZA 2NW3A 1XGQA 4Y16B 4JHWH 4M48L 1BZ7A 1G7QA 4OJFH 2AV7A 3CFIC 3TA3B 1YMMD 6FABL 4M43L 2V5RA 4TUKH 4K7FA 4HIIB 2Y06L 4BQBA 4EI5D 5D7KD 4WTZA 4ZUWA 1U8QA 1G9NH 4MCZA 2A6DB 5CS7A 3T1WA 4MAYB 5EC1A 5K9KB 1SHMA 4BSWA 2P8LB 4ZAKB 4H88L 2W65B 5FDYA 4DJMA 1KJVB 3W0WE 1CVRA 2Z35A 5D1XD 2HN7A 5HXMA 3HZKB 5BRZA 3SPVA 4C83B 5F72S 3FQUA 1LK3H 3FMGH 3BT2H 1NDGA 1U3ZA 4X9HA 1F13A 5GGQL 5MEND 3L3IA 1E4XI 4XP9L 1NFDB 3LPFA 4X6BA 4LCWA 3ZKMC 2VDKH 3FFCA 4R90H 1J0KA 3ROOB 2R2CA 3QJFB 5IM7A 4PJDE 3PDOA 4BYHA 2BY3A 4M5ZL 3MJ9L 2AEIT 2X89A 1F6FB 3H9SD 1YPZB 1FGNH 2XG4A 3EYFB 5HYSA 1C12B 3K1KC 3GMMB 4NQEB 4NBZB 35C8L 3BSZL 4L8SC 4P3CH 4D8PA 4JDTL 2PYEE 1LO0L 3CXDH 1C08A 3OJDA 2FGWH 2HFTA 4MGXA 3HI5H 4PUBL 1TCRA 3RI5K 4YQXL 2I9TA 3U9UB 2ICCA 2WNGA 4MLSA 3QIBC 1S7WA 5D9SA 2BVUA 4XVUC 4U3HA 1NGPL 4MSWB 4Z95H 4YNYA 3VXPB 4L4VD 4M8VA 1Z9SA 1OAYH 1ROWA 3WUWA 5FGCB 2Q76B 5EO9A 2XZZA 3SDYL 5EBMA 2RQ8A 1PSKH 1KN4L 2R4RL 3OG4B 4S11A 4BH7A 1DQQB 2AERT 3OJ2C 4PRAB 4YXLL 1LO5B 3D2UA 4BFEA 1DL7H 5CAYB 4GRMA 4FFYH 3NCCB 4PV8B 3CZFA 4YBQC 2BRRL 3LAFA 2MCPH 5DI8A 5BV7B 2FHBA 5IW1B 2V7NB 4RFNB 1ACZA 1RUAH 3MLPA 1T5WA 3V6OE 5DJZA 4Z78B 5LJYH 5K93A 1RJZA 3DV4A 3MCKB 2NLJB 1F6AB 4U3XA 4ZSOA 1ES0B 4GLRI 2FX7L 5GGVY 3H2WA 1MLBA 2ZKHL 4ZXBD 1P9MA 2X70A 3IDXH 3MTRA 1VFMA 3QUZA 4M00A 4GUPA 3C5JA 3UZVB 3EO0B 2WBWB 3LKSA 5B38A 2I27N 4OF3A 3OWEA 4KK6D 3CDGB 4HIHA 2ORBH 4M8QB 1UB6B 2E7HA 1Q38A 1CFQB 2LABA 3MJ7A 4TVPD 2Y7QA 4F15C 5I74B 4DVBB 1XH3B 2NMSA 2HKFH 4JZJC 5DRZB 1XGQB 5TH2A 2DQHL 2BVEA 4K3GA 4MNGB 1U8IA 4I2XA 5ACZB 1BZ7B 1G7QB 5F9AC 4C54A 1R0AH 4PB9L 5L6YL 1TZIA 4KVCH 4H0HB 5BVJA 3GMNA 25C8H 1U8QB 1MJ7H 4I0PC 1SEQH 3CMOL 1SYVB 1LO4H 1FYTB 2X41A 1N4XH 4HPOH 3PG2A 1RZIB 5INDA 2ADGA 5F9DC 2Z35B 4PJBB 2HN7B 4M93B 3ROLA 5BRZB 1RV6X 2APFA 2GSIB 2D7PA 2VLLB 2YPVL 3BJLA 1YJDH 5HHXL 4F33B 3DTXB 5DD1L 2EYRB 5AAWA 4LSTL 1LMKA 3L3IB 5EORH 5DT1L 1A6VL 1MRDL 3OAYH 3NAAL 5C86A 1KEGH 3BXNA 1ZT1A 4JO2H 2OLDA 1A4KB 1OB1B 3FFCB 15C8L 3L6FB 4NC0B 5I1AB 3LN5A 4NO0A 1SVCP 3BP4A 1C5BL 4U1NA 4KK5C 2EECA 2D03H 5IJVA 3PDOB 1MHPL 1FC1A 3LHPH 3KYNA 4KTDH 4JO1L 4DUVA 3UTZB 4KXZI 4QF1B 3PP3H 5HYSB 1MVFA 5IHZB 5IVNA 5E2TH 2GUOA 2P5EB 1NH6A 4AY0A 2NQCA 1DJSA 3NGBC 3CFDB 3VXNA 3A6CH 1DBMH 1EJ6A 1VGKB 5CEZE 4WEMB 4PP2A 4QTIH 4HC1H 2XTJE 1XGYH 3FB6A 3PWVA 4LLQB 3S35H 5C09E 4X4XA 3CUPB 1R5WB 2O61A 2NY3C 4CMHB 3UTSD 4GAJL 5HYJD 1GZQA 4YNYB 3C60D 3WUWB 3EDKA 2YZ8A 4X8JA 2DQCL 5EO9B 4JKPL 4LEOA 1IFHH 3TJEL 3ARXA 4JY4A 1KB9K 3SQOL 1OTTD 3ZT5A 3AAZA 1UADC 3VWKB 5DC9B 3I02A 1S5IL 1G6VK 5EBMB 3JBG7 4OCXL 4OZHE 1JN6B 5CJ5A 4KJQD 1QNZH 5AWNL 4Q6IC 5EBWA 1U6AL 4QGTA 1MWAA 4OLUH 1HH9A 5HHOD 3VXMD 4JQXA 1KIQA 3OXRA 1U58B 1CBVH 4NCC1 3BJ91 3CZFB 3QO1A 4KDTA 1K8DA 1C7TA 5D7IF 1QYGH 1T5WB 4X4MA 1N3NA 2UWEB 4Y4KA 5DJZB 1M71A 2XG5A 4FQJL 2QQQA 5JMRA 4QHUB 5C07B 3LMJH 3D3VB 1RJZB 1BAFL 3DV4B 1MFCL 1OAQH 1GHFH 3WYRA 4GG6E 2UZIH 4LSSL 2A6IA 1KPVB 3BKJL 3F7VA 3V9FA 4RMVA 4YUEL 3MBXH 2VXVH 1F3JA 3I3DA 3BKCH 1D6EA 3K46A 2X70B 4YO0B 1ZHLB 5DFVC 4ZUSA 4P2RE 1KC5H 1UH4A 3UC0L 1H5BA 4OM0H 1WC7B 3S88H 1MJ8H 3C5JB 1TZGH 3LKSB 5B38B 1JZ7A 4LHUD 2R0LL 3IFLL 4BQCA 2RJMA 4KKCD 3GHEH 2JB5L 3T1FA 5IW6A 2EH7L 2AXFA 1WFTA 3VDAA 2CRIA 3ARSA 5L7XL 4JG1L 1NAMH 3WJLA 4TRPH 4CVXA 5HHNA 5F1IB 2P8MB 2XV6B 5TH2B 2BVPA 3E6HA 3MSPA 1IJ9A 1U8IB 2BNQD 1RZ8B 3HS0A 3AC0A 4FQCL 4XMLH 2R4SL 1PG7X 1TZIB 3I3BA 2PYFA 3V5DA 1YEIL 5BVJB 4S1DC 1MFDH 3VFSA 1I3UA 3P9MA 4GBXC 2ID5A 2X4UA 4Y1AA 4IIQA 2AP2A 5HPMB 5LAXB 1TITA 1JGDA 2W38A 4N8CH 3D39D 5DJYA 3BKML 3MODL 2ADGB 2C7UB 2EDXA 2DWDB 4WI4A 4MXVE 3REWA 1BVKB 4XWOC 4ZOAA 3G5XA 1HNFA 4NP4L 3FT2B 3HCVA 3I84A 4FTVE 4WUUD 4WI8A 3RFZC 4JGUA 2J6EL 1HHGA 3BPLC 1F2QA 3QI9A 3MV11 1N0XH 4QXUL 4NQVB 1S9KC 4P9ML 3IDYB 2EYTA 3BXNB 1ZT1B 3OG6B 5D5MA 4PGEA 4XP6L 5DRWB 3E8UL 5F6IC 1G9NC 3C09C 2VWEE 3IAGC 4LVNC 3LN5B 1NAKL 2BSTB 5I1IH 2V5SA 4U1NB 4H5SB 1T7YA 3EJZC 2PO6D 3BQUC 1TNMA 3C6LC 2C3WA 3C6SB 1VFUA 1UC6A 4DN3L 2QEJA 5E00B 4ZNEA 3QQ3B 3PQYD 4ETQB 2VDQH 1CGSL 2GUOB 3K8MA 3N1FC 1GGBH 2FEEI 3FQNB 3SDAA 2E9IA 4N9GA 4NRZA 4L8DB 1BFVL 1GAFL 2P8PA 4PJ9D 5D71L 4XCCL 1F02I 4BFIB 3PWVB 5C08E 1L0XA 5TDNB 1MCJA 4X4XB 5GS2H 4DW2L 3ZDYE 2DKMA 1IAII 2VTFA 2YBRA 2DQEL 4FZEH 5CD5D 2YHGA 1A47A 2VDOL 4G8GE 3KLAA 1T89A 4R4FH 1QRNE 4WO4A 5JO5A 2VQ1A 3AAZB 3B9KD 5KSAC 3QYCA 1RUPH 3HNSH 4WENB 5DGQA 3SKNB 2F5AL 4Q9RH 1MPAH 2X44D 1WFOA 4JRYB 3LQZA 4NQCB 2DN7A 5C0AA 1DBKH 4YJZL 3KGRA 5GGRA 3GJEB 1FO0H 1MWAB 1XEDA 1QSFD 4YAQA 4EDXB 1SJEB 4AK1A 1AKJD 5DMGD 1CDYA 5D8JL 3QO1B 2MKLC 1K8DB 2GJZA 2E7MA 1UWGL 5D96B 1A7OH 3QO0A 3VFGL 5L2KD 3EGSA 3MV7E 1RZKL 1RIHL 4I18A 4A2LA 4N90E 4I3RH 2VH5L 4E41A 4YBLB 4CUCA 1BEYL 2UYLB 2E7LA 4M1DL 5TE7H 2A6IB 1LQSR 5JDSA 3RI5F 1MCWM 5FM4A 5IQ9B 7CGTA 3HNTL 1XF1A 1D6EB 3JUYA 5ITBH 4UDUB 1EMTL 4WWKB 2E7BA 2JK5A 4JFEB 2XOTA 5T3ZE 1OPGL 3WN5B 1G7JB 4ISVB 2IBZX 3AROA 2IPTL 3JWOL 4M6ML 5FYJU 4AENA 4WI3A 4D2NA 5JW4M 3JUZA 2DF3A 4RISH 4J4PD 2G60H 2NY1C 1NUGA 1UCBL 5DTFA 1J05A 3UMTA 3QDAA 3IXTB 4M61B 2GIYA 4CVXB 4NIKB 1QLFA 5GISH 2BVPB 1SM3L 4BH8A 3ARGA 3VI4F 1A6UL 4JKKA 3DVIA 2F9BT 1QHPA 3PWJB 3QIWD 4H25A 3LD8B 2Z91A 1P1ZA 2PYFB 5E2WH 4X6FA 1RZ7L 5I1KH 3MRHA 4MJ5A 4RMQA 5I15L 4JY6A 3DX7A 2Y25A 4X6CA 5GRWA 4RMTA 3RWDA 12E8L 4IIQB 3T0EA 4DKFL 1JGDB 2MQCA 2XQYK 1SY6H 4EVNA 4NZTH 1HHHA 2HVJB 3T3MF 3LKRB 3BKYL 1WBXB 2AKRA 1A6TA 1RZJH 4ZPTA 5I76B 1N0LA 2XICA 2VKWA 4KVNL 3DO7A 3NPZB 5DS8B 1KPUA 2DRUA 2NY0C 3ARPA 3HCVB 1ZLUH 3BZEA 3MBED 3BIKA 3EYSL 1ZWIA 2NXZB 3BMVA 2OK0H 1G7LB 2KKQA 1WJ3A 4KZEL 5D2NC 2EYTB 3UEZA 2JCCE 3E3QE 2XACC 5DWUH 2J2ZA 5L0QC 4PBWD 4DKEH 1CF8H 1YZZA 1X5GA 2OL3L 3C2AL 4S0SD 2F19H 1YNTA 3ETBF 4LDOB 1N2RA 5JHDA 3QUYA 4MQXD 1RUMH 2DL2A 2WIMA 5C2BL 5CBEA 3VG9B 3BUYB 4KQ3L 1ZGLA 5IGXH 2BNRD 1IC4L 1L7IH 1YJDC 4XVTL 4FFZL 1B4RA 4B0MM 4FQXD 3UAJD 3VXRD 5I1DA 4NRZB 1Q9WA 2Y36H 2ZCLL 1LE5A 2YD9A 5FUCC 4WWID 4OCMC 5JW3L 2X4PA 3SGEH 3U9PH 3U7AA 1CD1B 3MRKA 1P7QB 3BHBB 3HPJA 3HAEG 1J9CT 1MCPH 2VITA 5F7EL 4CN1A 3UCRA 3L3HA 1NANI 5EUOB 3JV6B 5ETUA 5TE6H 3CVIL 4LARH 4LK4A 3O2DA 3LCYA 3F58H 4WW2C 3SEPA 4ZTPH 2IFFL 5JO5B 4LCIH 3S6CA 3MA9L 1CLYL 5T1LD 3RWCA 3X13A 3GSXB 2APWA 5CJOH 1FG2A 1W8NA 3CC5A 5BS0E 1YEEL 1ZHKA 1CGWA 3DMMD 2Y9RT 5C0AB 3LB6D 5GGRB 1ACYH 5D6CB 1MEXH 5K9OA 1PBYA 2YD1A 1FPTH 3MJ9A 4DGYH 2GI7A 3HE7A 4PIRF 4DGVH 4X9FA 1AXTH 3HE6C 1MFNA 3QQ9D 1AIFB 3PL6D 4OAWA 4FP8L 2YPLD 3WFZA 3MNVB 2IBZY 2C4FT 4JN1H 4MJIE 5D70H 5EFIA 3HZMA 1IKNC 3GIVB 2JIXD 2VAAB 3LS5H 5D1ZA 2NY7H 3MRBA 5GGUB 4MQ7B 3BP7A 5CSZA 1N26A 3NCFB 5CEZH 2IAMD 4E41B 3C08H 5FYKL 4XNQA 3BH8B 2X05A 4PRIA 1P4BH 4DAGL 3DX9B 1HZHH 5D93B 3P77A 3QXDA 2A77L 4AEIL 1CK0H 4LF3A 5ANMA 1R3IH 3LVEA 2HTLC 3WIHH 2JK5B 1ZS8A 2YUZA 3U0PA 5F1KC 4XTRD 2AV1A 5D7SH 3QP3A 1DVFA 3WD5L 4GMSL 5JXAH 3STZA 5GGSA 4B50A 4WCYL 1L0YA 1JV5B 5A1AA 1EVTC 2XY2A 5C0BD 3T2NH 3B43A 4XI5C 1J05B 2PF6A 4LCWE 1FBIH 4Y16D 3AU1A 4G8FA 3LEXA 2XZAL 5L88H 1LO3L 3TA3D 5I18L 3MXWL 3VW3L 1VHPA 3ARGB 2NNAB 4XX1G 1C7SA 1FSKC 1LO2H 3N85L 1NUFA 4APQB 4MAYD 3VRLE 4LCYB 1OT1A 1YNKL 4MJ5B 2UUDH 1NCBH 4OF0A 4ZAKD 3DX7B 1NGZA 2KQMA 4X7EC 4QTHB 3VD5A 4JPIA 5C0FB 4LLYB 5T5NG 3ZYIA 1P7KA 4YHLH 3HZYA 4LVOB 4EVNB 3PDDA 1GH7A 1HHHB 1FL3A 2P5WA 1NBQA 1VFBA 3SY0A 3KHQA 3SE4A 1Z0NA 3L7EA 3V4PL 2X4TA 1A6TB 4ZPTB 3DO7B 5CFHA 2WQRA 5KSUB 3TO4B 4AQ1B 3WJJC 4X4YA 5BVPH 1KPUB 3RKDD 2JE8A 3BZEB 4OLEA 2F15A 1ZWIB 4LCCA 4PY7B 1MF2H 5IBUG 3WSQL 3VGDA 1DLHA 1BJ1J 3O9WD 4NHUB 1IQDB 3MCLL 1G7IB 5DD3H 3LH2L 2UVFA 3NA9H 3CPLA 2NZIA 1DQTA 4Z7VF 4KMLB 4ELKB 4RGNB 4TTDC 4G8EB 3VXTB 1YNTB 2GK0B 4RAVB 1TVBA 1HQRA 1GGIH 3CLEL 1TPXB 1JNHB 1N2RB 3GMQB 4NQED 1A3QA 1RZFH 5T1DH 1A14L 5CBEB 1E6OH 3GJFA 3CDFA 5HBBA 1NGWA 4I5BB 1NJ9A 4B41A 1KT2A 3CZJA 4M62H 1HXYA 3CFCL 1EZVX 8FABB 5I1DB 4XC1H 1C1EH 1Q9WB 3HI1B 3BDBA 5F3HB 3TP4A 1JZ5A 5J3HC 1FVEB 3MA7A 3IFPA 3V4VL 4C4KO 3ULVF 1BPVA 1AGEA 3MRKB 4ZSOE 1EV2E 3HPJB 4Y2DC 1MFAL 3O4OB 4PV9A 3PP3K 4FZ8L 3V6FB 4EBQH 2VZSA 2DI9A 3L3HB 5E4EB 3ZKQD 3GK8H 4Z7NE 4OZFG 4TTGA 1FL5A 4G5ZH 4KY1L 3VXUA 1NC2A 2P24A 3JV0A 4PP1D 3RWCB 4OGAC 5ESAB 5EZOH 3CC5B 5GXBB 1UKSA 2MPAH 1DUYB 3VFNA 3HR5A 4ZFGH 4KRPC 4QHNA 5HHME 4WFED 1IQWL 4HV8A 1U8LA 3I75A 2GQHA 1IC5H 3KPPA 4MDIB 4QWWD 1HI6A 4I2XE 3U7WH 3QRFM 1Y0LA 3HZMB 4JB9L 4PJ5B 1OT2A 1YY9D 4NN5B 5D1ZB 1B6UA 4IRSC 4R2GC 4X80L 2D31B 4DCQA 3MRBB 1NGYA 4OZGF 1YMHA 4YZFF 1A5FH 5J89A 2VC2H 3RA7H 4CBPA 2YMXL 4QHMA 3UTTA 3IT8D 4PREB 2O5XL 3I85A 4PRIB 1GGTA 2VOTA 1H15A 4G7VH 3P77B 1CDUA 2ERJB 3QXDB 4N0UB 1K5NA 5J6GA 2OTPA 3RJDA 1P4LA 3QFJA 2QADC 4PD4J 5ANMB 4QRSB 2CQVA 1A1NA 5J11B 4D9QD 3MRMA 4HUXA 5IMKB 4AL8H 4HZLB 3WNKA 1DFBL 1DVFB 3QUXC 3STZB 5D7IA 4DGIH 4ELMF 2DD8L 5CWSA 1JPSL 1OCWH 2DLEA 2LE9A 1GC1C 1QEWA 3WE6A 1BFTA 3AU1B 4GAYB 4JFDB 3SKMA 1T20A 4UNTA 5EU4A 3F7PC 2DKUA 1Q72L 3C9NA 2PTUA 4XB8A 3RZWA 3O6LH 1BFOB 3LZFL 5E6IC 3AGVA 2GCYB 1GPOL 2QQNH 3UTPD 3VH8A 5DHVA 1F3RB 3N9GH 1DLFH 3UZQA 1U8JA 3RDTA 1FYTD 3MFGB 2VR4A 1NGZB 2IBGA 3CFEB 2YC1B 4BSVB 2NY6C 4JPIB 4XP1H 5B8CA 1P7KB 3FOMA 1HKFA 4P3DA 4TSBH 5BRZD 1FL3B 2P5WB 2IEPA 3WLWD 3P0VL 3SY0B 3VGFA 2O5YH 2X4TB 5CJXA 3WO4B 4UDTA 3MNZA 1MREH 4X4YB 2AGJH 1VPOL 2QSCL 5T3ZH 4FQIH 1F3DJ 5B39A 3I6LE 1EZVY 2DQDL 2GKIA 3BIBX 3FFCD 5T3XD 3QEGL 2N7BA 4OLYL 3CPLB 1PVHA 3NIFF 3WDHA 2ZUWA 2CKBL 4IRZH 1U3JA 2W07A 4NYLB 3AXLB 3RL2B 1RMFL 1A7RL 1XGPB 2PNDA 4X7CC 2P5ED 2B1AH 2DI7A 3KYMA 3QCUL 5I8OL 1RZJC 5ELIA 2DJUA 4MCYB 4HX1A 1MAMH 4PS4H 1LVEA 1HXYB 4MXQC 1N5AB 1I1CA 4OJFL 3E2HC 3EDJA 3VXQA 5I8KL 5FM8A 3OSKA 3MA7B 4TUKL 4YDKL 5F7FA 5ADPH 5DO2C 1AGEB 1NLDH 4F7EA 5L2JA 2R1XA 2EICA 4PV9B 3D0VB 1G9NL 4IMLB 4LHJB 3OR7B 3VWKD 4GRLC 5F6HI 3O6FB 5J13C 1D9KA 4L4TA 2XA3A 4NN7B 1BD2B 4AG4H 1ED3A 4KUZH 4R0LA 1MCSA 4JFXA 1LK3L 3FMGL 2EE2A 3BT2L 4ZO8A 3HR5B 3O2WH 4DZ8A 3RHWK 2DYPA 5DD6B 4JVPA 1TETH 5EU6B 4YK4B 1QBBA 3GZKA 3K4ZA 1UM6L 1EO5A 2VDKL 4XBPA 5EUKB 4PJGA 1JF1A 2CLZB 2ED8A 4R90L 3S4SG 3RNKA 1K9TA 1Q9OA 5C07D 3FRPG 2GW5A 1TVDA 3D3VD 4JFFE 1E28A 1KJ3H 1JPST 5JNYA 2FO4A 3TVMA 4DCQB 4PGBB 2F8VA 1YMHB 2W1NA 4NKOA 4ORZC 1ZKAA 3RUGA 1YC8A 5HJ3A 2YZ1A 2NY2C 4HFWB 3FONA 4Q7DA 4Y1AE 4HPYH 1X4ZA 4JR9L 4YHYB 4P2OA 4GG8A 2H32H 3RVXC 2VE6B 4HF5H 4WHTA 1MCOL 1K5NB 4I9WD 3L5XH 2R23A 4FQHA 3RVUD 3QUZD 4R96A 1JNJA 1IGCH 4WTWA 3KLHC 3CXDL 4ODHL 1VCAA 4JPKH 2FGWL 4M7LH 5IFHH 1DQDH 3HI5L 3FCTA 4TSCL 4WV1A 1A22B 5LQBH 1DBAH 1CFSB 2AI0L 4LHUG 4O2CB 4WTXA 1EAPA 4JM2C 4L3EA 4Z95L 3SJVA 5CWSB 1FNFA 1OAYL 5KW9L 1QEWB 5D5ME 1G0DA 4Z76A 5HGHB 3MO1B 2ATKB 4LOUD 3DUUA 4MA8H 4ONHA 1N8ZA 1PSKL 2AJUL 3VMPA 1ZAGA 2XKNA 3CIQA 4UT7H 5C0RL 1B0GB 3TN0A 3RY5A 3VH8B 4K94C 2CXGA 3QCTH 4ZNEE 4UT9H 1DDHB 3EHBD 3C5SB 1PQZB 2MCPL 5B8CB 5CEYA 4LQ1A 1RUAL 5B21A 1FFPA 1B4JL 4H1LB 1MVUB 5DQ9B 4UDTB 1G6RB 3V4UL 5F9JA 3PV6B 3KYOA 2X4NA 4NQXA 4UQ2A 1GGCH 1CT8A 5E8EA 1A4JB 4NQUA 2QJDA 2YSSA 1FLTX 4NO0D 5DFTA 5ILTH 1IAIH 1JYVA 3IF1A 4K3EH 3ALPA 3P11L 1XF2A 2LU4A 5JORA 3HAEH 3SDDB 3VFRA 1IZKA 1ZLUK 4KJPD 4KU1A 3ARFA 4YBHA 2ZSVB 1PYWA 2NY4C 3GSQA 1ZLSH 2C3VA 3KPOA 2N4IA 3FT4B 4D0CA 3LIZL 3CSBA 1EO7A 4NT6B 1M4KA 5IMOB 1HIMH 2OR8A 1R0AL 5KVFL 3D9AH 5TDPA 3MOBH 5L2JB 1JHLH 2R1XB 1RJLB 1T66C 2WWMC 1MJ7L 3BVNA 1SEQL 2MTPA 1LDPH 1LO4L 4QO1A 3QJHB 4L4TB 3SOBH 1INQB 4HPOL 1M7IB 1UB5B 5EPMB 4JRYD 2H26B 4NQCD 4PPTA 1GVIA 1PEWA 3MV9B 2WP3T 2OL3A 4R0LB 1ITBB 4UT6H 3PGDB 5F93C 4NOFA 3U30B 4OLXH 1FZMA 4ONFH 1CN4A 2DAVA 5EORL 3FN3A 3T3PF 4BQ6A 4UTAH 3W9EB 1KEGL 3QXAA 4JO2L 3R4DA 4XBPB 3IDIA 4W6YB 3RNKB 1Q9OB 4PLJD 4PJXE 2NX5E 3ILQD 1E28B 3HNVH 1J0YA 3AS2A 2UV3A 5JNYB 4M6OH 2CDFB 4U3CA 3LHPL 1SYSB 4KTDL 2NCMA 4Z6AT 4P4KC 5HJ3B 4QRUB 4X6CE 3TYFA 4R97B 2HKHH 4RAHA 4WUKH 3T0EE 5E2TL 3EYVA 2VWEC 4WWKD 4WY7H 5KS9E 4FQHB 4JFED 4OD2A 1A7BA 5BXFB 1TCMA 1UZ6E 4WW2F 1KIPB 3A6CL 3PHQB 1DBML 4G9DB 2EO9A 2APBA 3P4LA 4HWEL 4QTIL 1XGYL 2J8UE 1FVCB 3V7AE 4Y5XC 4P5TC 5FEBA 4J3SA 4L8SA 4DN4H 2YUVA 1LE9A 4U1MA 4OCLC 5DD0L 1T1YB 4HGMA 5SX4H 5EO0A 1IFHL 1AGFB 4IOSD 1IBGL 2GITA 1WIOA 4JJ5B 2VXQL 1PGRB 1N8ZB 5GSRB 5C0JA 3D0LB 3QIBA 1V5JA 5JHDE 4YEFA 3MRNA 4OLUL 1KCUH 3D85B 4P59L 1PX4A 5I8CA 1CBVL 3KPRA 3BZDA 3QDGA 5CGYC 4HK0A 4NN6B 3PE9A 4LLWA 5CEYB 1OLLA 1X6LA 1CG9A 2WLZA 3K3QA 3MXVH 3TH3T 1KTKE 4XAKD 4ZFZB 2WUCH 3LMJL 5DZOA 2NXZD 1F58H 2A1WH 1OAQL 1QFWH 4NQXB 2UZIL 1CT8B 1GYAA 1X5LA 5JXEC 2UUDK 2CDGA 3MBXL 2VXVL 1ZOXA 3BKCL 4RFEA 1UT9A 4NQSA 4AEEA 5KAQF 2Y6SC 3QPQD 3NABH 1PZUB 4YDJA 3S88L 1NANH 4I4WA 1TZGL 5KSBB 1UYWH 1YYLH 5K9JH 1XF2B 1CDBA 4PLNC 5IMMB 5HI5D 5JORB 1J8KA 4EIGB 4NKMB 2CK0L 1B90A 1E27A 4RSVA 1NKOA 4MNQA 1MCLA 2J88L 4HEPG 1IM9A 4C56A 1BWWA 1C5DA 1NAML 1PYWB 2OSLB 2E7CA 4OI9A 5E5RB 3IFNH 3KPOB 3U7YH 2OJEA 1T21B 3DUSA 4QOKA 3KR3H 5GRUH 3IS1X 5I0ZA 2EC9U 1L7TL 2R9HD 4F37K 2RFXA 4UV4H 1P7QD 4ODVH 4CMMA 3Q0HA 5TDPB 3LEVH 1J1XH 3WXVL 4JZJA 4S1QL 2DQGL 2VXSH 3BPOC 4NZUL 1N7ML 3QZWG 4EUPH 1JL8A 4N8CL 4F7PA 1ERNA 3MRQA 3RIAK 5C0AD 1S8DB 4HGWA 1A1MA 5TF1H 2DLFL 3EZ8A 4RGMB 4I0PA 1IAKB 5HVFB 4QHKJ 1BM3H 1QO3A 5LCVL 1CICC 1UXWA 2H2SC 1JGEA 2CRYA 5C7XL 1N0XL 4PGCB 3PABA 5CP3A 3QXAB 1AGDB 1FDLL 3FKUS 4RRPA 1CXHA 2HFEA 3HMXA 3IDIB 4J3UA 1H3VA 1HYSD 3BESR 3ZMRA 4AIXA 5FA4B 3VWJC 3S5LG 4YIQA 5I1IL 4E41D 5FFLA 2ZCKH 2M2DA 1L6ZA 2F53B 1NCAL 2KZWA 4TUJA 1QSEB 2B1HH 3QIUC 3LY6A 4G6JL 4P2YA 1I1RA 3E3QC 4TVPH 2VDQL 4N5UA 3EYVB 4XXDB 1GGBL 1H0DA 1ZK9A 2FDBP 2DMBA 3GMOA 1I7TB 4QHKI 4R7DB 4ZOBA 2FB4H 5E70A 1EBPA 5DXWA 2EXWC 2GHWB 5IBLC 3UTOA 1ZXQA 4OGYH 5CINH 3UJIH 2ZOLA 5F71A 3PWPA 4L8SB 4U1MB 5D7LB 1G7PA 3MLYH 4KKNA 1BJMA 2G9HB 5A2LH 3RHWF 5AG9A 3ARGD 2XWTB 3NCYS 4OZGA 4NKIH 4XP5H 3L3OA 5C0JB 3HNSL 4JFZL 2OR9H 4APQD 1MPAL 1MCHA 2BVOB 4NKQB 1H9VA 1HHKA 4NM4H 1U3HC 1FO0L 2VIRB 2PR4H 5I8CB 1Q0XH 3HR6A 2C26A 4FNLH 5MERB 5F9WC 2I07A 2QSQA 3QDGB 4XH2A 4MXWH 4HK0B 5EZIL 1RIUH 4Q6IA 1TLKA 2BCKA 1A7OL 3D18A 3SCMB 1HHJB 1CG9B 3VRJA 3ULUD 4PJDF 1RPQA 3TO4D 3FT3B 4IHOA 4ELMA 3KDMA 1GC1L 1YECH 3FQXA 1TQBB 4P2QE 4GRWB 2FX8L 3TBSA 2IMNA 2VLKE 1M6OB 4NO5B 4WW1B 1DCLA 4CJ1A 5TE7L 5L8LB 4RGND 4L1DA 3VXUE 4NBYB 1CFNA 3RWHB 3ZE2E 5IOPB 3GNMH 4W70A 1YEDB 2D0FA 3ZLQC 1B9ZA 3DXAE 1I7UB 1XGTB 1RUQH 4BELD 1KULA 4Z8FL 2YUWA 2LU7A 5HI3C 1TQCC 4OCYH 5GRXG 3TBWB 1KTLB 1WF5A 1XGRB 4RISL 2BXYA 1CLOH 2G60L 5FOJA 2KDGA 2ESVA 2AS5M 3X3FH 4G3YL 4UV7H 4NCC2 4AM0A 4ZG1A 1UJ3A 1KCVH 2JJWA 4Z7WF 1R6VA 4G8IB 5GGVH 1ONQA 5C0IA 4JY5H 1QR1A 2VLJA 4JREB 4A6YB 8CGTA 5J57B 2DWEA 1ZA3B 2VDLL 2ZG1A 3OKEB 3T2PA 4PJAB 4JHAH 5E2WL 2IQAA 3UTTE 1LP9E 5I1KL 3NFNA 4JZJB 1V3KA 4Z7VB 4N0YH 4Z0BH 3BH9A 4MA3A 3O81A 3OPZH 1IEAB 1A0QL 3JTTA 5CGMA 1G9EA 5IFAH 5IVOA 3O3DB 1NL0L 4UBDC 1GZPA 5DMIH 4NZTL 1RIVH 4XXCC 5DLMH 1BP3B 3QWOA 4O58H 4XPTL 3MOQA 2CKBA 3KPSE 1RZJL 3QUKB 4I0PB 4K3JH 5FA3B 1OP5H 1CL7I 5D7IE 4DK3A 4GBXA 1JHTA 1RVFH 3O3UN 1EFXB 1RFDL 4FXGB 4C59B 2OK0L 5JPMA 2A38A 4Y4FB 4P9HH 4GQPH 1I8KA 3MV8A 5DWUL 3RX5A 3LN4A 2AJXH 2HFEB 5D1ZD 3DROA 5TGBB 3SKJH 3Q6GH 4JRXA 4DKEL 2DQTH 3IS0X 3TNMA 2F19L 4M9PA 4K7PL 3NBNA 3ZSSA 4HG4J 3L3JA 2EDLA 1X5KA 4PRID 2JELH 2OBGA 1Z5LB 4XPHH 3LKPA 5K59E 2G75A 2WBJB 1P84K 2RHEA 2XN9B 5BQ7A 5IGXL 5D1QC 4CADA 2Y36L 3BQUA 3C6LA 1DVFD 3IVKA 2GSGA 4EZMA 3UJJH 1T2XA 2XWBA 4X98B 3U9PL 1K2DB 2ZOLB 2ZSWA 5C0CB 4H26B 3NGBB 1MCPL 3SDXB 1G7PB 3RAJH 4HKZA 4JN2B 2X4QA 4BZYA 1GGYA 4LARL 4PRDA 3F58L 1JHKH 3VD4A 4OZGB 2CUHA 5CJOL 2PETA 2GFBB 4KKAD 1HHKB 4RGOH 1VEPA 1ACYL 1IMHC 1T1XA 1MEXL 1FPTL 4MQTB 4DGYL 3FFDB 4LNRB 4DGVL 1T0MB 2R69H 5KSAA 1RJYB 4XH2B 2P5WD 3LSOB 4EI5C 2BCKB 3KWWB 4JN1L 5D70L 3D18B 2HMID 5DRXA 3VRJB 3R06A 4W4NA 4ZD3L 1JVKA 2NXYD 5HGBA 3NPSC 2ZPKL 2F58L 2NY7L 3MLUH 4ALAL 1DQJA 1TDQA 3FQXB 3MOAL 2PTVA 4QEGA 2OYPA 3TBSB 3BE1L 3C08L 5SWQA 4JM2F 5C0GB 2ZJSL 5IROC 1K8IB 1P4BL 1U8KA 3IKCA 4PB0H 3VI3E 1HYRC 5C6TH 4HKJB 1U8MB 1H8NA 2ADIB 4K94L 4TVSa 4HUWA 1TTGA 5F7NC 3L5IA 5D7SL 3W39B 4P5KB 5E2JA 1AFVH 3SN6N 5HYSG 2CRMA 3G04A 4HMDA 2ESVB 1X5JA 3HPLA 1FBIL 4PJGE 5CP7A 1UJ3B 5L88L 4OZHF 2AXGA 4YPJA 4RWYH 5DJ6B 3G6JE 5C0IB 4UOW0 1CE6A 2VLJB 3NIGE 3KYKH 4H88H 1LO2L 2FYYB 3RY6C 3MPCA 3F8UB 3RUGE 5KVEL 3U4EA 5E8DL 4U4BA 2IQAB 1UWEH 2Q6WA 3RGVC 4TULH 4QKXB 1NCBL 3FB5B 1MY5A 3WUWG 4CVUA 3BH9B 3MUHL 1NC2D 1BD2D 3OKYA 3JTTB 5GGQH 1X44A 3O41B 2FHFA 3HMWL 4XP9H 3PWUA 1J8HA 3QWOB 5CD3B 3TZVB 1BZ9A 2ICWA 3GBNH 2IH1B 1A6PA 2F8XC 1XF3A 4X6DB 5EU6D 2HJKB 4L3EE 4GG6F 3VFUB 1KGCE 3GI8L 3WKMH 1JHTB 3SJVE 4N0CD 1J87A 3TH4T 1CGYA 5ID0A 5IFJA 4HWBL 3SGKC 2IH3A 1MF2L 4M5ZH 4K7PX 4ERSH 2L7JA 3DARA 2QKIA 5DD3L 2FZ3B 3L3KA 3EO1A 3LN4B 3UPAA 2CIIA 1XCQA 2DIJA 3IDJA 3AB0C 35C8H 5EC2A 3VXSA 3WIFA 3WLBA 2ZUTA 2W0FB 1GGIL 4OTXH 4Z5RA 3BPLB 5KJRH 5IW3A 1NBZB 1U8OB 1B88A 2B0SH 3DUHA 5D2NA 4UIMB 3VDCA 1RZFL 4F37F 4YQXH 1E6OL 3QFJD 3C09B 3DETD 5E8OB 2LTQB 4LVNB 3EJJX 3WL9B 1NGPH 4YDLC 3M1BB 3GI9L 3UBXA 4XC1L 4CADB 3BQUB 2K1MA 3C6LB 2AQ2A 5B38G 3SDYH 2CLVA 4X4ZA 3U36A 3O8XB 4WI2A 3RIAF 5I2IA 4M5YH 3BFOA 4S1RL 2EO1A 3S36L 4HKZB 5B22A 1LEKB 3OGOE 4XNYH 4PRDB 4PLKC 4KK6C 1BGXL 3TFKD 2ICES 2YUXA 4MXVF 2APXA 3BPNC 3OR6A 5EZOL 3R8QA 1WK0A 2BZDA 4Q9QL 3MRCA 5I6XC 3RDTD 4LVHB 1I3GL 4ZFGL 4JQIL 3DRTA 3H3KA 3WV0A 3O2VH 2AXJA 5JLZA 4WW2A 2Z93A 3ARDB 2F54E 2JB6B 2X9XA 4G9FB 2X5PA 4YDVA 1IC5L 4OI8A 2V7HB 4JFPB 3U7WL 2DQUH 3MLXH 2FX7H 3R06B 1JZ4A 3JVGC 4KKBD 1JNNH 2ZKHH 1KCRH 1PG7W 5IG7A 4KAQL 4HC1A 1FFOA 1A5FL 4CU7A 3HE6A 3IDMA 2VC2L 4GKSA 1S9XB 3ILPB 2X9YA 3IKCB 5K33A 1IKNA 3L5HA 5DRNB 4KMQA 3BO8B 5EN2B 4DUXA 3PHSA 3NN8B 4ESKA 4U1HB 5SWZA 4M03A 3RWGA 3SDDD 3ZDYF 2GJ6A 4NUJA 4RX4A 2DQHH 4AL8L 2C3HA 4FQ1H 5FK9A 3WXWL 1DSFL 3QXVA 4DGIL 3G04B 4O2EA 1OCWL 4I0CC 3HPLB 2C1OB 2AAVA 1Z9LA 4KFZC 2EDTA 4LP5A 3GJFH 4HH8A 2P42B 3CMOH 2FWOB 1KBGL 2NPLX 4EN3C 4EJ1C 1PG7H 1W2KT 1CE6B 3O6LL 1KCKA 4K7PY 2QQNL 4FS0A 3TPKA 3N9GL 4MB5A 4J23A 1WUNT 2QSTA 5FAAA 2YPVH 4L4TD 1U3YA 4K3DH 1BX2A 2XI9A 5CGTA 2YD8A 5HHXH 2R29L 5DD1H 2AEWA 1DQLH 4OZIB 5DJXA 3MV9D 3IETB 1T7WA 1A9BA 4TSBL 1A6VH 1MRDH 1F6LL 3NAAH 3PWUB 3BRDA 2ICEB 3QQ4B 3C60C 2O5YL 1BZ9B 4XZUA 2ICWB 3SBWC 4PJ8C 1V7MH 3TF7C 1XF3B 1MREL 4KK8D 5MEQB 4FQIL 4JZNB 1C5BH 1JPTL 4X7DC 5F7UA 2G5BA 2V9TA 3TNNA 4D9RD 4DOHE 1NAMA 5H2BA 3EOBA 3L3KB 1XF5A 5ISZE 4OGZA 2CIIB 3Q3GA 4PYHA 3IDJB 3CFBA 1NLBH 3H9YA 5GRZA 4IRZL 3WJJA 4HUVA 3KLSA 2NY0B 5MEOA 1BQLL 3WLBB 3AREC 1EVUA 1NEZG 4Z5RB 1NDMB 4RMWA 3X12A 5F3BA 2HT2D 5FYKE 5D2NB 1CIUA 5HVHC 2O5ZH 2B1AL 1T1WA 1W72H 3IKKA 3W81A 5L0QB 3TH2T 2P43B 4QT5B 2HP4A 3F5WA 1UQSA 5DUBA 4PS4L 4GAJH 4RIRA 5ICZB 3UBXB 1UM5L 2R2EA 2XQBL 2DQCH 3TJEH 3S36X 4P9HC 2HA1A 1U92A 2X4OB 3IDGB 3OKOA 1S5IH 5ADPL 2HJFA 1QLEH 3CJJA 3OTTA 5I2IB 4Y5YC 5IF0A 2EZ0D 5FGBC 3ZDZE 5CZVH 5HDOA 2YD2A 3Q6FA 4ONGL 3GMRA 5E1HB 4KKCC 4HLJA 3UYRH 1KYOK 5EO1A 1YN6B 2P46B 2VZTA 5DF0A 1KSRA 2YRZA 3KPTA 4NO2A 1FNGA 3D48R 4JANA 3OR6B 5DMYA 3D85D 4Y2DA 3VE0A 2QQKH 1H3GA 4RMUA 2P7TA 3MRCB 4OQ1A 2BDNL 3O2WL 5CEXB 5FO8A 5IKCA 4LPXA 4MNQE 1WGOA 3DRTB 1OL0A 4OFPA 4C56E 1S9VA 1TETL 3ALWA 3SKUD 4RZCA 3TPUA 4HIXH 2Z93B 3MLZH 2Q3ZA 1MFCH 4AJ0A 5T33L 1CFBA 4JQVC 4LSSH 1Z9OA 3LDBC 1I9IL 3H9SB 2APVA 3BKJH 2AJVL 3PNWB 2ZUQB 4LMQE 3U0TB 1FZKB 4WFHE 1U95A 1FFOB 5CMAB 3BEVA 5INCA 4NPYA 3WHE0 2R0LH 2K7PA 4GKSB 1JPFB 2J7LA 1WWWX 4HPYL 4I8DA 4Q9BA 1JPGA 4EQ2A 5IEHA 2EH7H 4KUCF 3PGCA 1YDPB 4AEHH 1G7MA 1HDMB 1UWXH 5DVKA 4IRSA 5SWSA 4AIZB 1BLNA 2WZPD 4JPKL 4M7LL 3DVGA 5IFHL 1JZ2A 1DQDL 1X5HA 1CFVL 4K2UH 4FXKB 2GJ6B 4JLRA 5LQBL 4ODXB 4IOIA 5FK9B 3ARFD 4ZYKA 1FO0A 4FQCH 2R4SH 4J3OC 4O2EB 1WCBA 3GIZH 4QRTA 3TWCH 1YEIH 1CWVA 2UY6A 2PO6C 3ZYJA 2IG2L 4MA8L 3QUXA 3ZKSD 4PRHB 3NVQA 3QDME 4UT7L 2DIAA 3BKMH 5EZJA 4CU8A 3QCTL 4U1KA 2K7QA 4URTB 1CXKA 3OV6A 1D7FA 4NSKA 2OI9B 3OHXB 1I7ZB 3HC3H 3P9LB 3C5ZB 5DEZA 1OM3L 2IANA 4LAJH 1JGLL 3IAQA 1A7PL 5FM5M 3F65A 2J6EH 5E6IA 1A9BB 1FSKB 4QXUH 4P9MH 5C8JA 5ABDE 5CD5C 2EYSB 4N8VB 1S7UA 4V1DB 4XP6H 3RY4A 1K4CB 4RDQG 3PWPE 3E8UH 2XRAH 4GKZA 4G6ML 2FEEL 4ZXBB 1NAKH 1FORH 3B9KC 2GYSA 5I17A 1GGCL 3IRZA 4Z7WA 3TNNB 4PGZA 4ENEC 2O26U 3W5MA 5LKNA 3E0GA 2H8PA 4K3HA 4HJ0D 1VESA 1XF5B 5ILTL 1IAIL 1CGSH 4XVJH 1II4E 1UXSB 5MEOB 1MI5A 2F53D 3AMLA 1U93A 3V52H 3ORJA 1AXSA 4K3EL 1QSED 1QFPA 1BFVH 4ETYA 4NBXB 3ZKMD 5D71H 1OP5K 5F3BB 4XCCH 2G2RA 3M17B 4L4JA 2WIIA 2R2HB 1T1WB 3LV3A 3N06B 1ZLSL 3TBVA 4NZRH 3OB0H 1Z0MA 2HFGL 3D6GA 4KROB 2H9GA 2VDOH 4ELME 4YDIL 4NNXA 1HIML 1I8LC 3F12A 3VRLF 3D9AL 3OKOB 4JKLA 3N1GC 5D7LD 5H37G 4L3CB 2F5AH 3MOBL 5I66B 4LSDA 2JJTC 4RBPH 3LPGA 4HKXA 1MY7A 3EIFA 4EXKA 1D5MA 1WWAX 3GMRB 1KB5L 5I75B 5H94A 4BQ9A 3SOBL 4BUGA 1I9RL 3OX8A 1SVZA 3QEHA 5MHSE 4NO2B 1NCDL 5DJAB 4O5LL 5F1OB 4O2FA 4UT6L 3VFPA 2W9EH 3QT2A 2YEZA 4HQQH 4GRLA 3KPRD 1RIHH 3QDGD 4M7LT 4UTAL 1T4KB 2VLRA 5HDBE 2VH5H 5A16A 1AD0A 1QFWM 4UOJA 3SCMD 5FF6A 3QIWC 1EEQA 5T3XH 5A3IC 4HHAB 3HZVB 4OIAA 2GY5A 3RL1B 1BEYH 4LVEA 4OT1H 3MGOA 4KH2A 5FYLD 5C3LD 5LWYL 2JLLA 1KJ2B 3HNVL 4KRPB 3FO9A 1ULVA 3CCHA 4M6OL 2ITDA 1EMTH 4IMKC 3CSYA 4ZUTB 2BY0A 4UAOB 4KJWC 3W0WB 3BEVB 4NPYB 1M7DA 5TPWH 4WFFE 2IPTH 1JPGB 4ZQKB 5TQ0L 4WUKL 2M8XA 3DV6A 1QBLH 2Z4QA 3BPCA 4YHIA 3OKMB 1AO7A 1BLNB 3I50L 4P57A 4YHMH 3NACH 3DVGB 2D7NA 3ZTNL 6CGTA 1U91A 4JLRB 3VFOA 3U1SH 3Q48A 5AYUH 1MHEA 2EE9A 4QRRE 4DN4L 4Z7NF 1ZMYA 2QADB 1QTYT 1WCBB 4QOKD 4S2SB 3MV8E 4PJDB 3RZCC 5C0EB 1RZ7H 1CL7H 3QNZA 4JRXE 4HS8H 3QEUA 1XZ0A 4OF6A 4MQXC 3ZHLA 4Y8DC 2W9DL 3C8HA 4JM2A 4MA1C 4OSUH 2IPKA 1A1OA 3Q2CA 1S7XA 3EOTH 4PJHB 5EZJB 2VO5A 2GTZB 2PYEB 1KCUL 3BKYH 4U2YA 3UAJC 1H3XA 2OP4H 3EDFA 4KVNH 1ZHNB 2AK4E 1TZHA 4PJCA 1AQDA 4G80B 5E24E 5IVZA 3W2DL 2MHAA 4I0PD 3B5HA 3MXVL 1S7UB 3WIHA 1EFXD 1FVDA 1F58L 2A1WL 2OL3H 3C2AH 2NY6B 1VKXA 2WAHA 4CDGC 4HZAA 5I17B 4DEPC 1BWMA 2DM7A 2QV2A 1KENH 1TXKA 3DMMC 2Z31C 2H8PB 3ULVD 43C9A 4CN6A 5C2BH 3L7FA 3GGWA 3IXAB 3AS0A 4ODWA 2X1PA 1ND0A 4KRMB 1EPFA 2RCSH 4XVTH 1U93B 4FFZH 5DK0A 3R8BB 1AXSB 2KQNA 1YYLL 5K9JL 4WHYG 4Z77A 2BHYA 2WBJD 3PL6C 4OFKA 2G2RB 2XN9D 3L5WB 4OF5A 5AD0B 1SBSH 2WIIB 5JW3H 1NGXA 4POYA 1V3JA 4JG0H 4NKDA 5MI0C 3KR3L 1S7SA 4C58B 4N8PA 4GG6A 5GRUL 5DYOA 4NZJA 3WNMA 4YGVA 4NNXB 3WFHA 1KXTB 1UVQA 3H9HA 4UV4L 1PFCA 5C0CD 1BFSA 4M9OA 4ODVL 1AR1C 1CLYH 1IEBA 4X5WA 2VJXA 4LPCA 1NBVH 2Y72A 3FTGA 3MQIA 2C4FU 2OMNA 1YEGL 2VXSL 1HILA 4XPFH 1FLRL 4MJ4A 4NNPH 1F11A 3L5JA 2V2TA 5JTWA 1AGBB 2NY3D 3QEHB 4U49A 3NZ8A 5E9DA 4CW1A 3I6KA 5M94B 4RQQA 4FP8H 4HLZH 1YC7A 4O2FB 1FFNA 3MYJA 1D5ZA 1MHHB 4NC1E 4OCSH 1R3KA 3TA3C 5CJ8A 1A9EA 4GRLB 5J13B 4XPGH 4ZOEA 2DLTA 3CGTA 1D3CA 3WCYA 5FF6B 1GOGA 3QQNA 3DRQB 2VNCA 1UA6H 5A43C 4OFDA 4MAYC 3MRRA 5FHBL 1VGEL 1FP5A 3T8XA 2A77H 4HUMB 3PQYB 1BZQK 4XNZB 2ZCKL 4WU5B 2ITDB 4U1SA 5IK3B 4MJ6A 5C9JA 2B1HL 1M7DB 3BWAB 4AZ8A 3T04D 4Z0XA 2EDOA 3WD5H 4QNPE 4TVPL 1K6QL 4GMSH 1ZANH 2JKXA 3DV6B 1LD9A 1FNSL 4WCYH 1ZT4A 1J8HE 2BRQA 3MMEA 3ZKND 3OXSA 2XZAH 4P4KA 3HG1E 3D25B 3QEQE 1U91B 5CINL 5F1NA 2ESVD 5DFVD 1T0NA 5JHLL 5E8PA 4KI5D 5DVNA 4BM7A 3RTQC 3JZ7A 3MJ6A 4M02A 2VLJD 1XZ0B 3VXSE 4NKIL 1DEEA 1L4IA 4P5TA 1WAAA 2MOVA 4Y5XA 4CVZB 1MCNA 2VQUA 4L29A 2OR9L 4JM2B 2FO1A 2J4WH 2A6KA 4BJLA 1HXMA 1A1OB 5CKAA 3BDXA 1UKTA 2PR4L 3V4PH 3OKDA 3MR9A 5GZNC 4WFFD 5KANI 1Q0XL 2M1KA 2XTJB 4FNLL 3NCMA 1TZHB 3KXFA 4NO3A 5C09B 5DVLA 2GAZA 1AY1H 5IVZB 1DANT 3G6DH 1RIUL 3TZVD 4AIOA 2HVKA 5F70A 3GJFK 4S1DD 3WSQH 4U1IB 5J0BA 4XMPL 4F9LC 4ZNCD 3RNQA 3PF2A 3LH2H 2AW2A 2PW2A 5JOPE 4G8GA 4XAWH 3C8KA 5EOCH 1QRNA 4PTUA 1YECL 1FVDB 4HKBB 3TIEB 3BP6A 1LK2B 4J3XA 4PP1C 3PUCA 4OZHB 3CLEH 4N0FB 3B3IB 3CX2A 5FUCE 3T0BA 1BQUA 3VD3A 1T1ZB 2BNUB 4JRXD 2FJHB 1A14H 5LVEA 3GGWB 4ODWB 3J8F7 2R0WL 1RUQL 4IDLA 2BX5A 2MCG1 3GSNB 4OCYL 4Z77B 5JXEA 4XNMA 4QWWC 3QNXB 2Z8WC 5D5MF 2OXGA 5FYKU 4WNQB 3X3FL 1ZT7A 1YY9C 4UV7L 3BQUD 4XHQA 3C6LD 1KCVL 2BVYA 4NKDB 1F4XH 4GG6B 5GGVL 4HULB 3O8XD 4LGRB 5DYOB 5FIEA 3ZE0E 4NNYB 4QCIB 2ARJQ 5DUPL 3QG7H 4KY1H 3QHFH 4M4PA 4XHJD 1WCQA 4XCEA 4JHAL 4X99B 4P2RB 2P48B 2OS7A 4N0YL 3MNWA 4Z0BL 4POZD 1JWMA 2V2TB 3S37L 3ARBB 2FLBT 5IFAL 1NC4A 5I74C 5SWZE 1UH2A 1DTUA 1M05B 3FO2A 3NZ8B 5DLML 1IQWH 4NZDA 3DGGB 4O58L 3I6KB 4LAQH 4RAUA 3FOLB 4KTYA 4WJ5A 4C57C 3JTSA 2R1WA 5LGHH 4L5FL 3ARDD 4JB9H 3SGDI 1R3KB 3ES6A 1RVFL 2NW2A 3MGTA 1D5IL 4X80H 4G9FD 1I3RA 1JI2A 1I9EA 2QHRH 1D5BA 1NCNA 4P9HL 4HFUL 3UXFA 2YMXH 2AEPH 1WZMA 2AJXL 1TMCB 5CBAB 1URLA 1MELA 2W0KA 3MRRB 1RK0B 3Q6GL 2DQTL 2IMMA 3GSUA 4H1LG 4WDIB 3H0TB 1CICA 4U1SB 2JF1A 4C55A 1X5YA 3G5YA 4MJ6B 5C9JB 1MCBA 4FQXB 4XPHL 3VGBA 4NQDE 2Z92A 1MJJB 1DFBH 3D5OF 3QG6A 2NZ9C 1TJHH 3VWJA 5J06A 2DD8H 5D4QA 1FRGH 4FTVB 4NJ9H 2OQJB 1KLUA 1OARH 5IB4A 3KNBB 32C2B 4UIKL 1UG9A 4MX7A 4WEBH 1ZGLM 1YN7A 4MDJA 3OXSB 4P4KB 4JPVH 3QIUA 1HNGA 4HH9A 1KCLA 4IRJB 4TYUA 2JJVA 4LKCA 5F1NB 2VABB 1T0NB 4PJEA 1SMOA 5IB2A 1RU9H 4CDHA 5HGGS 3VGHA 1MFBL 1GPOH 3RAJL 3T4YA 1ITCA 5DC4B 1UWXK 5H35B 2FL5B 4P5TB 1EIBA 2NY1D 5KANG 3MRLA 1FZJA 3DURA 4WFGE 1CDIA 4J3VA 2ZNXA 1ZLWK 2A6KB 1U8PB 3IJHB 4X0KB 5EOQH 2VUYA 4X8XA 3MRDA 3P0VH 3B2UD 3OKDB 3MR9B 2BSSB 3CMGA 5CILL 1KXQE 1MCKA 5C08B 2QSCH 1AHWC 2AK1H 4NO3B 2H32A 4PJXF 1CGTA 3Q5TA 3VFWB 1A3LL 1U3HA 2EEDA 4BK4A 1OSPH 2J12B 1EEYA 1QRKA 3FO1B 3VWKC 2CKBH 5I9QB 1QRNB 5TDOA 5CCKL 3HC0A 3LQAH 1U8NA 1PY4A 4R7NA 5KS9F 5BS0A 4PB0L 2EIDA 4YHPA 3GMPB 5C6TL 1C8PA 1BOYA 2NY0D 2GT9B 3RRQA 5GSVB 2J8UF 1I1AC 5JOFB 4P4RA 1IAOA 4IOFD 1MLCA 3T0WA 5FO7A 4HUUA 3WMSA 4N1EA 1JWUA 4FFVD 4MJIA 1AFVL 2Y5TA 3PV7A 5I8KH 3X11B 4YDKH 1CU4H 3MV7B 1ZT7B 1JZ3A 2EKSB 3SO3C 4UUJA 4MB3A 3QWQB 4PJFB 4DFIA 5T1MB 2FSEB 3TT3H 5KN5A 3ARQA 3DPBA 4RWYL 2XNAA 4NCDA 2V5TA 3KYKL 4BKLA 2VL5B 5IQ7L 4NDMB 3S37X 3QHTC 3P4OA 4X5XA 1UWEL 4JAMA 4TULL 4P46C 4HEME 2A74A 2ZUVA 3MNWB 1JWMB 4HCRL 3SO5A 1FNAA 5SWSE 3DWTA 2AJYH 1NC4B 3HLAB 3P73A 4IS6B 1IT9H 2VDML 3OGCA 3OB0K 3FO2B 4OV6F 1UM6H 5IUSA 3GBNL 4F80A 3LS4H 1EO8L 3JTSB 3BGMB 3O9WB 1J0JA 5EOTA 4BZ2H 3KYAA 4F2MB 3WKML 3B83A 4LOUC 4QXWA 5BZDA 4HS3A 3ZSTA 3HC4H 3G9VA 4U6TA 4E5XA 1CXEA 3HAEA 5L9DH 5FUZH 1R5IA 4RBPK 3P4NB 4NWUL 4XXCA 3ET9F 4ERSL 2RIKA 4CU6A 2R15A 3LKOA 4JR9H 4JCLA 5ENWA 2AEQH 2YD7A 4QRPA 4MD0B 2Y23A 3GSUB 5HHPA 1MCOH 3R0MA 3EHBC 1D5XB 1FIGH 1CICB 4ODHH 4OTXL 4TPRH 5DD5L 5ICYA 4P99A 5KJRL 1KJMA 4YR6B 2B0SL 4R3SA 3TO2B 4YC2B 5FB8B 1JGVH 4TSCH 3RPIA 2IANE 4M3JA 2AI0H 2AQ1A 4YXHH 2WLYA 2HFFA 3QG6B 5ERWA 4LLMB 2KPNA 3F7YB 4Q2ZA 3VRIB 1KB5A 2MWCA 5KW9H 2GJ6D 2XPGB 4RX4D 1T22B 4UQ3A 2FHCA 3THML 4MDJB 5BJTA 3K2MC 2JCCB 3G5ZA 1DBBH 3O11B 5ICXB 2AJUH 4Z7WE 1E4JA 3VJ6B 3GKWL 2HTLD 4M5YL 2XWJB 5IB2B 5C0RH 5IEKA 2Q8AL 4J1UA 3NH7H 5D1QA 2ZOKA 1OGTA 4XNYL 4NRXB 3O3EA 4P3WA 3DSFL 4PRHD 2D2OA 2NY5C 3ZHDA 5KG9A 4Y8AA 3DX8B 5KSVB 3MGAA 1MI5E 4HT1H 1I9JL 3DURB 4XI5D 5I8EA 1YYMH 2J5LB 3AUVA 1Y18B 1CD8A 4HMCA 2I24N 4LLVA 4J6RL 1S5HB 3O3BA 3UJTH 1B4JH 3BZ4B 5J6HA 3O2VL 3C5ZD 4X6EA 1S7TA 1I4FB 3V4UH 2DM4A 1EEZB 3C2SA 2H32B 1I85C 2X6MA 4V1DD 2DQUL 1CS6A 3MLXL 1BBJA 1EERB 1JNNL 1EEYB 4WHYH 1KCRL 1RD6A 4ACPA 2FATL 4ZUVA 3V0WH 2BMKB 1YMMA 1JGUH 5TDOB 3TIDA 1OWRM 1U8NB 3P11H 4M1CC 3LKQA 5BS0B 4EI5A 4OKDA 5GHWH 3L3GB 5F7DA 4JFHD 3S3JA 1ZA6B 2Q7YA 4L9LC 4LSRL 1DE4A 1FJ1A 5J1AA 4KZDH 3MROA 3KS0H 4KDTC 3RWFA 4WFGD 2VLMD 3OBAA 1S7VB 3IJSA 1VEMA 2NW3B 1IAOB 5D96C 1MLCB 3FQRA 1J0ZA 3LIZH 4B7IA 1GGUA 5IROA 4FQ1L 4UNVA 3RVVD 2IBBA 4MJIB 2AV7B 4OLVL 1EEUA 2Y5TB 4N68A 4TTDD 2VLRE 3ILQC 5KVFH 4K7FB 5E8NA 1JYWA 1G0XA 3JWDC 4UUJB 5HHQA 5MENA 3QAZB 4KROD 5E95B 4ZUWB 2X4SA 4MCZB 5DVMA 2Y07H 1RHHA 1TQCB 3EBAA 5EC1B 2I60H 1PG7L 2HLFD 4ZS6C 4BSWB 4YPGA 5LGJA 1KN2L 1GOFA 1T2QH 4WWKC 1ZEAH 3P4OB 4X5XB 5FYJD 2IGFL 3WN5C 3SPVB 3FQUB 1NDGB 4K3DL 4EI6A 1HOCA 4HJGA 1AO7E 1DQLL 4R8WH 3K8KA 1YY8A 2AABH 1P53A 2YD5A 3RY6A 4CJ0A 5CKGA 1V8HA 3PWLA 4X6BB 4LCWB 3RGVA 4HAFA 5EIIA 4JZOA 2YXMA 1V7ML 1OGAE 2DLIA 1WICA 5EOTB 4JEGB 5BZDB 4HS3B 3O4LE 2JJUA 5JDJA 5IM7B 4OGAD 3LD8C 4RMRA 3ZE2F 4NRYA 4U6YA 3TCLA 3RVTC 4L4VA 4KRPD 1S3KL 4QY8A 3LKOB 1NLBL 4JDVA 4IIQC 2EE6A 4D8PB 1L9NA 3W0WD 4YLQT 4HXAL 5ICYB 5GS2D 3SGKA 1C08B 3OJDB 1KJMB 4R3SB 3FN9A 1G1CA 4HWEH 4IEFB 4TN9A 5E6ZA 1JRHI 3O6KL 2O5ZL 1TCRB 3RPIB 1LHZA 1W72L 2D4FA 4PJCE 2I9TB 5DJCA 4R2GD 2HFFB 1S7WB 4OGXL 5D9SB 4LGSB 1YEJH 1OF2A 2HYMA 1N6QH 5DD0H 2XZCL 5EA0L 4EUPA 4TUOA 1J11A 1IBGH 4OKVA 1Y6NR 1LP9F 2VXQH 3ELAT 3QNYA 2QADD 3IAPA 1QLEL 5IB5A 4BH7B 4ODSH 1RUKL 2NR6C 4I0KA 4J1UB 5CZVL 2AJ3A 4UB0L 1BF8A 1OGTB 4P59H 3D2UB 5HI5C 3UYRL 3MACL 5D6DC 5DJ2A 3VG9C 5FKAA 5KG9B 4GRMB 4U33A 1A64A 1LGVA 4QRQA 5DI8B 2PYED 4M7JL 5I8EB 4W6WB 2QQKL 3FN0L 3O3BB 1JWSA 4XT1C 5DMJB 1CFTA 2B4CH 2IAND 3NFSH 3GSVA 4X6EB 2HTKC 3D69A 1S7TB 4HIXL 3MLZL 3FO0L 2R9HC 4KV5E 5E5MA 5E6ID 3JV4A 5FOBA 3DVNA 4ZSOB 3OKNA 4JRWA 3AVEA 3DSNA 4JFQA 4Q9CA 3UPRA 4B53A 2RAMA 1MLBB 2NY6D 1IVLA 4DZBA 1QBML 1SEBA 4ZUVB 5K59F 3QUZB 4GUPB 3BEWA 2X40A 2Z8VC 1NBYA 3V7MA 1ZTXL 3W9DA 1VACA 4PJ7A 4HIHB 4OQTL 4AEHL 2CK0H 2VISA 3MZGB 3JVGA 2Q7YB 4RRPG 4XPBH 5IHLB 1SQ2N 3MJ7B 4I13B 3NPSB 4EOWL 2J88H 2Y7QB 5E9DE 2OZ4H 3DECA 5DK3A 2X1QA 5IMLA 5HHMB 4MA7H 2FX9H 4K2UL 3ECBA 5HD8D 3FQRB 4RMSA 4I2XB 1E4WL 1FE8L 1L7TH 4FHBD 1S9WA 1YUHA 5A2IH 4JFFA 1KF9B 3GIZL 3TWCL 3GMNB 3WXVH 4S1QH 1HQ4A 1CQKA 3HA0A 2DQGH 3LQAC 5DVOA 4NZUH 1N7MH 5D93C 2CH8A 2BOCA 4HUNB 3BD3A 5TJWK 4KDVA 1B0RA 4U1JA 5LGJB 5INDB 3BGFC 4MXQD 2DLFH 3ROLB 4QLRA 1SJVA 3HC3L 1FN4A 4R4NC 3HTLX 5F7YC 4EN3A 3EAKA 5JQ6L 3WHXA 5LCVH 3KG5A 1YY8B 2MKWA 4RWHA 5C7XH 3UDWC 2X1XR 2UVEA 4CNIA 1FDLH 1G6RH 2CGRL 5E4IA 3RGVB 5ITFA 4JZOB 4GRLD 4LEXL 5E08H 2XRAL 5BZWA 4NO0B 3S97C 1AI1L 3BP4B 1FORL 5JIPA 3W11C 5IJVB 1XCTA 4PGJA 3VI3F 4APQC 3KYNB 1N64L 1NCAH 3VA6A 3ESVF 3UTSA 4U6YB 3TCLB 2WINA 3C60A 4G6JH 1JUFA 1UCTA 3SBWA 3UYPA 1WAAE 4QY8B 4PJ8A 4JDVB 4DTGL 4XVJL 3V52L 3VXNB 2D9QB 3CK0H 1CD9B 1NMCC 5IWLC 1F4AA 5EULV 4PP2B 2YA1A 5T1KA 4Y4HA 3FB6B 5DR5L 1BJ8A 3L3DA 3KXFE 4PJGF 3TO4C 5DJCB 4YFDB 5HHOA 5AZEL 2O61B 5HDQH 4OFVA 4NZRL 3G6JF 1GZQB 3FQTA 3AREA 2B5IB 3NIGF 4EUPB 2NY2D 3FRPA 1R24A 4X8JB 2YN3A 5GRVK 5ESVA 4LEOB 3HUJA 3RUGF 3RVXD 4JY4B 4OKVB 3GRWL 3H8NA 4RGNC 3I02B 4FFWD 4JFZH 3KLHD 3UPCA 3QNYB 4LCUA 5EBWB 5D2LE 4WEUD 4BFBD 5IHUL 4M4RA 1HINH 1HH9B 4HS6A 1F4WL 4GW5A 2ICWJ 1KIQB 1ZHBA 5A2KH 3OXRB 1MFEL 4JM2D 3P4MA 1A2YA 4QRQB 2OTUA 5EZIH 4Y5YA 2ZNWA 1BQHA 5FGBA 2ADFL 2W9EL 5CEZD 4O4YH 5E03A 4HQQL 5EWIL 1N3NB 2XTJD 4Y4KB 4PJBF 1M71B 3GSVB 5C09D 3D69B 4G6AD 1GC1H 2IWGA 5E5MB 1J10A 2EXYC 2FX8H 3FAXA 3KJ6L 3OZ9H 7FABH 1O0VA 3JV4B 5T3XL 2C3XA 3O4OC 1JMZA 1WBYA 3WDJA 4OT1L 3OKNB 3F7VB 3MRPA 4K07A 1FV1A 3UPRB 4NC1C 1DN2A 1F3JB 5DDHA 4Q6YA 4DZBB 4XBGA 4ZUSB 5E1AA 3PGFH 2BNQA 2X1WL 1JK8A 4Y19E 1H5BB 2VERN 4Z8FH 4XP4L 4JQVA 3CSGA 2ICWI 5TPWL 3T1FB 5IW6B 4HBQA 3W9DB 1PJ9A 4MS8C 4XNXH 4E0RA 1QBLL 2AXFB 4FQQA 3ZZ1A 2K3TA 3PHOA 1UGNA 5JIKA 4G3YH 5DURD 3V5KA 4YHML 5IMLB 3NACL 5HHNB 1A7QH 4JFYA 3MUJA 3X14A 2YOCA 3D39A 4Z7UA 2A83A 1A6WL 3E6HB 3U1SL 4KQ4L 5AYUL 1HSBA 5ACLA 3HS0B 3ARWA 4NN5C 4HDIA 5BW7C 2R1YA 4LRNH 3D1MC 4PJXA 2NX5A 4JFFB 2VDLH 3V5DB 5AYQA 1CL7L 3ZKXC 1VERA 3F6IA 1HQ4B 2B7DT 4HS8L 3VFSB 1GRWA 3P9MB 4XC3H 1H3WM 2HG5A 2X4UB 2ERJC 4Y1AB 1A0QH 2YA2A 1ZVHA 4P2RD 4OSUL 1B0RB 1NL0H 1OTSD 2IQ9H 2J8HA 5KS9A 5DJYB 4AYFA 3EOTL 4FQLL 3RVWC 3UBXI 4J3TA 4XPTH 3D87B 2OP4L 3CNKA 3K8LA 3REWB 1K4DA 2PO6A 4JPWL 5IVXA 3ARBD 1UZ8A 5IT2L 3G5XB 2J8UA 3F7QA 1MRFL 5ECJE 1RFDH 1HHGB 1F90H 3QI9B 1AD9A 1T66D 3K80A 2WWMD 3IJYA 3IDNA 5D5MB 4PGEB 1KG0A 4PJEE 5GS0D 3S98A 1YQVL 4K7PH 1WEJH 1O7VA 1XCTB 1KENL 3CX5K 4GO6B 3QDHA 4KKAC 2ZUYA 4X6DE 1JUFB 1T2JA 5I1HH 1XIWC 1PX3A 2RCSL 1X5AA 3B9KA 1YEHL 4FOMA 3SDAB 4N9GB 5DJDA 2DM2A 3BW9A 2P8PB 3SE4C 4X9BA 2HMIC 5T1KB 4Y4HB 5DHYA 4M7ZB 5FKPA 1SBSL 4D9LL 3L3DB 4FTVD 4J8RA 1QSFA 4HCRA 1AKJA 2AJZA 2YBRB 4JG0L 3FQTB 4P4KD 3AREB 4JE4B 1CE1L 3KLAB 4IRJD 4P5MA 1XGUA 3TJHC 4WO4B 1MHCA 1XF4A 2VQ1B 2W9LA 5J12C 4LCUB 1NBVL 4FG6D 3LQZB 5E94A 4XPFL 2HJLA 1INDL 4GXUM 4NNPL 1T3FA 4P5TD 1JNLH 3ARYA 4HS6B 4WHCA 4XCFL 3IDUA 4YAQB 1I8LA 5L8JB 3EO9L 2W92A 5TQ2L 4F7MA 2ILLA 3ULSA 1A2YB 4TOYH 5DFWH 4I77H 1B3JA 2OTUB 4PRPE 2GJZB 1BQHB 1Y6MR 2JJTA 1RQ5A 3QO0B 4OCSL 3WNOA 4ZD3H 3EGSB 5C08D 5FV1L 2ZPKH 3KXFD 2F58H 4ALAH 4XPGL 3OKLA 5F9OH 4I18B 4GW4A 3MOAH 5B4MC 4L1HA 5J9PA 2W0PA 2DQJL 3JWNC 3BE1H 4MAUH 1UA6L 2P44B 1WBYB 2ZJSH 3B5GA 1GJIA 4G8GD 5JDSB 5HYQA 3MRPB 3BP5A 1QRND 3O6FC 3VXOA 3M45A 5AUMA 4XBGB 4K94H 5E1AB 3JXAA 4EIZC 1W0VA 4CAGA 2NY5L 3QIWA 1CGUA 1NFKA 4W4OC 2F74A 3LDBB 4WI5A 4AENB 1ZANL 5ID1A 4FQQB 5DK2A 1T5XA 4YK4C 2B4CC 4N0CC 1AQKH 5DTFB 1GIGL 4IMKA 1I1FA 1NFIA 1R3LA 5I1CL 4D3CL 2BOBA 1A21A 5C92A 4OI7A 2CJUH 5JW4Q 1QLFB 2A83B 4BH8B 1E4XH 3MV7D 3ZDZF 4HDIB 2R1YB 4PJXB 1KLGA 2NX5B 4N90D 1EA9C 4H25B 2Z91B 5KVEH 1P1ZB 2FH6A 3QXWA 5E8DH 4X6FB 3ESUF 3MRHB 5GPRA 4Z7OE 3Q5OA 4QRPE 5KVMC 4JY6B 4YHYC 3UBXG 1F42A 4X6CB 3RWDB 2VYRE 2LAAA 3T0EB 2B20A 4YXKL 1MWAL 2J4WL 3HMWH 5KS9B 3B4NA 4F3FA 5T3ZD 3QPXL 4K8RH 3RZCA 2AKRB 4KK9D 5D7JC 1K4DB 2PW1A 4JKMA 3I9GL 1NC4D 1QHOA 2J8UB 4HJJL 2V9QA 3GI8H 4M6NH 3WUZA 3B9AA 3BIKB 4RA3A 1AY1L 4HWBH 4Q74A 3G6DL 2BNRA 5I73C 5CSBA 2CXKA 4W68A 3QSKB 1XAUA 4XAWL 1T6VN 4GRWH 3JWDL 5EOCL 4KWUA 1KG0B 3RIFK 1IZJA 1ZV5A 5JHDB 3QUYB 5LXGL 4XBEH 2HAZA 1I3VA 2FECL 4AEFA 1YEFH 2XT1B 1ZGLB 4OUUA 2F5BL 3QDJE 1C16A 1CICD 3OAYK 2H2SD 2WANA 1E0OB 2FNBA 1FGVH 3RWJA 1I75A 2BY2A 1BOGA 1QUNA 2EDKA 3GI9H 5T1LA 5B3JE 3BW9B 4XVSH 1WWCA 1LE5B 4OV5A 4FMFA 3DMMA 2Z31A 1ORQA 2FEDD 5DHYB 3KPQA 4HBCH 2X4PB 1OOAA 4PR5A 2WK2A 4ZFOL 2DB8A 1J0HA 3MRIA