3EO9H

Crystal structure the fab fragment of efalizumab
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
214
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGYSFTGHWMNWVRQAPGKGLEWVGMIHPSDSETRYNQKFKDRFTISVDKSKNTLYLQMNSLRAEDTAVYYCARGIYFYGTTYFDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Efalizumab Fab fragment, light chain
publication title Efalizumab binding to the LFA-1 alphaL I domain blocks ICAM-1 binding via steric hindrance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2008-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eo9H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eo9H01
4NQDD 1I8KA 2WP3T 3IJHB 3RL2A 1YYLH 5ESQA 4BH8A 4O2CA 1BVKB 4JHBA 2I25N 1GC1L 1PG7W 1HEZB 3SQOL 4IRJD 5C07D 4CJ0A 3U2SB 3FAXA 2ICEB 5DR5L 3T3ME 5HHMB 2YD3A 2PO6A 5I30H 4OV6F 1KB5B 2B8OT 4F7CA 3CLFH 3LN5B 3OAYH 5BVJA 3BGMB 1JRHI 3MLRL 4MLSA 5GGSY 2DLFH 2HH0L 3L5WA 1ZGLP 1T2QH 4ZAKA 2WINA 1MHPH 2XACC 3KPRB 1FZKB 5C0IA 1QFUH 4JRXE 3VDBA 4OSUL 4AM0B 4W81A 3F5WA 4JFDB 3GBNH 4LCYB 5FGCB 3MNWB 2HFGL 2VQUA 2Q7NA 5ADOH 3MYJB 1QLEH 4YUEH 2IEPA 3HNSH 5EO1B 1KCSH 3GHBL 4QHKJ 5DK0A 4MJID 3U4BH 4N8CL 4Y4KA 3MLTA 3F7YB 4PJHE 1H3TA 3LB6C 3ARUA 3FHQA 5D4QA 3FOLA 5CLTA 3VRIB 1IGML 3E2HC 1I8KB 3TN0C 5ESQB 2R2BA 5T3XL 2OL3A 2VTFA 2VLME 3ARGB 2NR6C 4BSJA 3K1KC 3FRUB 4NGHL 4O9HL 2GJZA 3SGDI 2EH8L 4X6EA 1ZA6A 5BVJB 2CXGA 1G6RL 5GS0L 5FKPB 3L5WB 1MIML 1VFUA 1ZHKA 2WINB 4WI5A 2FGZA 2MPAL 1DBKL 5KAQF 1U6AH 4QYOA 2OM5A 4FQLL 4R90H 3S37H 5F3BA 3KS0J 2EDBA 5DD0L 1WBZA 4G3YH 4LNRB 4ONGH 4UNUA 4WFFE 1ED3B 1IKFH 1UCBH 1ZLSL 2IBZX 3JWOL 1ZEAH 4LARH 1Q94A 3KXFA 4HGKC 5BV7L 3SDDA 5DK0B 2OYPA 4JFOB 1BAFH 3HZYA 2M26A 5J7CC 2ADGB 4W4OA 4Y4KB 2BY0A 3KYKL 5JHDE 4P57A 1OAKH 2EDOA 3FOLB 1HHKA 3B9VA 4RA0C 5F93C 3SEPA 3AY4A 5I1KL 4DUWA 1DLFH 1IEAA 3CD4A 2A77L 1S78C 2F54E 2UZIH 4LDLB 2F53E 4TOYL 1AXTH 1EMTL 1G7MB 2NY0D 4FQJL 3SGKA 1PKQA 3U6RA 5E99H 4LIQL 5IB5A 3WDJA 4HH8A 3NFSL 1BWMA 5K9KB 5SX5K 5EFIA 4NCC1 1EHNA 2ATPB 4DK3A 4HT1L 5EU6A 5TQ0H 3WHE1 5FDYA 5J6HB 1MFBL 4K07A 1BQLL 1EA9C 3WL9A 4Z76A 4X0KA 4R0LC 4ELMA 3DVGA 4QYOB 1K2DA 5GHWH 5IESL 1DFBL 1S7SA 5SX4I 3WO4C 1I7RA 5EOCJ 4DZBA 5IHLB 5D2LA 4D9LH 2HJKA 3D2UB 1S5IH 3KG5A 4XBPB 1BBDL 2HWZH 1BQHA 4JO4L 4NZRL 5ACZA 1L7TH 2KPNA 3AC0A 3VD3A 4G8IA 3O9WA 1XF4A 2EKSA 4FQCL 1KEGL 2M2DA 3NFNA 3X3FH 3HMXH 4Y89A 1DVFD 2E9BA 3GMLA 4R4FH 4NQXA 1B4JL 2FHBA 2GJ6A 4HIIA 2B4CC 3HG1E 5JXEC 4G8EB 2C1PA 2FGWH 4JO3L 1UA6L 4MQXC 4H26A 4LDOB 3GMMA 4D9RD 5ADPH 3CVHA 2FBJH 3OKMB 1PKQB 2PF6A 3U6RB 3QEGL 5LQBL 3QDME 3NABL 3K46A 5HD8C 5HYIA 4JFEB 3FQTA 1RHFA 5DUBB 5GGTL 3QA3A 1DBAH 5C6WH 3C5ZB 3NACH 4RMQA 3DURA 1N59A 3V6ZA 4M93C 1KOAA 1WZLA 1E4XH 1XIWA 4XP6H 2E27L 3SDXE 1ZK9A 4LU5L 4JFQB 5ABDE 4FFWD 4Z76B 4X0KB 2PO6D 4ELMB 5C09E 3EFDH 3B9KA 4LLYA 3RWCA 3MJ7B 1CU4L 4UIKL 4I9WE 3HI6L 1I7RB 1NAKH 3MLSH 1F11A 3H9YA 4DZBB 2ED9A 4ZAKD 2X4UA 3BVNB 1LQSR 2NY5C 4ZO8A 1V7ML 2IQAA 4M6OL 3FO9B 3S34L 5GRVK 1NGXA 4G8IB 4RMTA 4EQ3A 4IJ3B 1U3HC 5T3ZH 3NFNB 2PN5A 3GMLB 1NEUA 4NQXB 3QIBC 2ESVD 2GJ6B 1N4XL 2YUWA 3VFUA 5C9JA 5KVGL 5FYLH 5INDA 3VWKB 4QHMB 3GMMB 5D5MA 1QUNA 4XC1L 2ARJB 1I1YA 3V2AR 1OVZA 3PIQA 3TYGH 2P5EA 4KI5D 1N5AA 1W0VA 3QEQD 2JJWA 1LP9E 4OIIH 5GISL 1YEFL 5CP7B 4OZGE 3V6ZB 3DUSB 3T0XA 3JUYA 5F6IC 2VLRA 4TSBL 3U0TB 5DRXA 4GKNA 3OKNA 4X7SH 5JA9A 1SHMA 4XMPL 4N0FB 5C8JB 3STZB 1X7QB 1OSZA 3B9KB 4IMKC 4RISL 4LAQH 4ZUVB 3S37X 1OAZH 4XPHL 5EOTA 5F21B 5D7IE 1TFHA 4XRCA 4APQC 3EO9H 2X4UB 1NGWA 4WHYH 1G6RB 2IQAB 3PQYB 1FZJA 2FEDD 1OLLA 5DZOA 1R5WB 1YMME 4MHHG 3P4OA 4PRDA 3CFBA 1OGAE 4WGWB 1FV1B 2Q1EA 4PJAB 4PJBF 4AT6B 5J57B 5TJWK 1IEBA 3W39A 2VL5A 2IQ9H 4PJ7B 3KXFD 1YEGH 4Q0XL 1HE7A 3DMMA 3SDDD 3VFUB 3UP1A 4TUOB 3H9HA 3FQUB 3PL6A 3UBXA 5D5MB 5KS9F 5MERB 4S0SD 5BV7B 2YWYA 2FO4B 4ZXBB 3LEVH 1OB1B 4LPUA 1N5AB 4PJCE 1EFXA 3O6ML 2FNBA 3BISA 1UZ8B 3N1GC 1EO8L 1NFDE 2AJYL 4UAOB 3BDBA 2AEQH 2VLRB 3T4AA 3KPLB 2BDNL 3ORJA 3SO5A 2HTKC 4NZJA 4NO0D 2ICWA 2NY3B 3PGDB 3KPNA 1R0AH 2HJLB 4N8VA 4H1LH 3QP3A 4PJEB 2R1YB 1P5VA 5EOTB 5GGTA 5EU6D 1RU9H 4UV7H 1RV6X 1AE6L 2EDTA 3OPZL 3RWFA 5GS1A 3QRGL 3MA9H 1NGWB 4QF1A 1G84A 4DKFH 3VG9C 1IZKA 2XKNB 5LGHH 5HI5D 4JJ5A 3MACH 2IANE 3CFBB 3RVTD 4QRRA 3MJ9L 4L4TA 3P9LA 4I18C 3TJEL 1CLOL 1GOHA 4CW1A 2VL5B 3ALPA 3B3IA 2FLBT 2UUDH 5ICYB 4DJMA 4BK5A 4LSRL 4V1DA 2GW5A 2B4CH 2EEDA 5KSAB 5KAQG 3QJFA 1YY9D 3O9WD 4XTRC 2BSED 2FX7L 1NMAL 5LCVL 2EXWC 2EYSA 5I8CA 1AC6A 1HYSD 4Z0BL 1Q72H 2CMRH 4JCMA 2ZUTA 1CVRA 1KTLA 1P5UA 3EGSA 5D1ZC 4HKBB 5JOPE 5TPWL 1C08B 1QLRB 3LN4A 2AK4A 5L2KA 2BJML 4AMKL 1XF5A 2NY1D 4P5MA 2ICWB 2YD9A 1G0XA 4LVOB 4WWKD 3SDAC 5E1AA 1LDSA 5F70A 4ZFFB 2NLJB 4RGOH 4X8XA 5DDHA 4JY5H 3ARBC 3TBYA 1XIWD 3BIBX 3RWFB 4XP5L 5T3XD 2XFXA 4GOSA 2YN5A 4QCIB 4QF1B 3MCG1 5E2WL 3FOMA 1Q0YL 4JB9H 2NY5H 5CIPH 3FO0L 2YR3A 5A1AA 1AI1H 5IB2A 1HHJB 3O4LE 3GSWA 4CW1B 1QOKA 1U91B 1KXQE 3MLXH 3H9SE 4AEIH 3B3IB 4D3CL 1KJ2B 3BP7A 4V1DB 3F7PC 4P9HC 4L4VA 3QJFB 3BI9X 5DRNA 3UTSE 5JO5A 5I8CB 1EEQA 5C0GA 4EOWL 4U1GB 5JXAL 3VXPA 3LZFH 5D7JA 2ZOLA 2DQJH 3P0VL 3HNTH 1J86A 2DMKA 1HINH 4X6CA 2P5ED 1QP1A 1ZGLA 1X9QA 2N1KA 5K9OA 1NC2B 5E1AB 1XF3B 4U0QB 1P84J 2KL6A 1KJMB 1IGIL 4HIEA 4P4KC 2WIIB 2VITA 3SCMC 3IFLH 3N1PC 5DDHB 1CFBA 5CZXC 3TBYB 1JRHH 2WQ8A 3TO4B 1D3CA 2NXYC 1CF8L 2YD2A 4KROB 2QL1A 3O2VH 1T66D 2VSDA 3FOMB 3NPZB 5IMLA 2NZIA 4X7TB 2CGRL 2CLRA 3ZE0E 3VRLE 3WLWD 1YNLH 4U4BA 3ZSSA 3FCTA 2OS7A 4EI5B 5IB2B 3TBTA 5FYJL 1T03L 3BDYL 4WI6A 2PCPA 1AQDA 1PEZA 3O2DH 3QULB 3BP7B 4LCWB 1E4WH 2DDQL 3GSVA 3HNVL 5EWIH 3Q5TA 3TT3H 3MV9D 4OCNC 4S2SA 3VXPB 1WZ1L 4KKAD 5D7LB 4ZDHB 5HGGS 2J8UF 5H37H 3PL6D 2CKBH 2VB5A 4LVNB 1JWSB 3FMGH 2X05A 1RZKC 2YK1H 4ZFGH 4IOIA 2AXFA 3QH3B 3HE6C 4ZPTB 3O6FC 3MC0A 4WFGE 1EFXD 5DRWA 2EKJA 4FRWA 4NOFA 2K9UA 3SGDH 4D9QD 4TSAH 4AEHH 5I8OH 4HUWA 3MPCA 1UWGH 2AV1B 2NY6D 5DTFA 2IALA 5E94B 2XI9A 4GMTH 3DYOA 5AZEH 1TITA 1UH4A 1ORSA 1KFAL 1UEMA 2OSLB 5E6ID 5T5FH 4KI5F 3FCTB 1RK0A 4BELD 2WUCL 3TBTB 1Q38A 4M61A 3D39E 3QI9C 5L0QB 3T0BA 2PCPB 4XP4H 2QLVB 1AQDB 1AD9A 4JZNB 5D7KD 1MQKH 4O2EA 1EJOH 3BKYH 4KDTA 4QRRD 3NIFE 32C2B 3I2CL 1G7QB 5EZLA 1P6FA 3WKML 4Y0GA 4UUJA 5FOBA 5L6YH 1U8NB 1FNAA 2D4FA 5BOPA 2VDNH 5JZ7C 4ZOBA 1ERNA 1BHGA 5IMOB 3WFZA 3D69A 5CAYB 4P23B 2CIKA 1OPGL 3HUJE 2AAVA 4OLXH 4XCFL 1BGXL 1T7XA 2DWDA 2CDFA 2PW1A 5D1XA 5CEXA 2LU3A 1ITCA 2DM4A 1MVUA 4QKXB 2AK4D 1WIOA 5L2KD 3QRFM 4X8JA 3CK0L 3O81A 5DQJB 5IM7A 3LRHA 3A6CH 3VGGA 2DWEA 4YXHL 5HY9A 5D71L 5C9KA 1K8IA 5C92A 4DOHB 1JHKL 1T1WB 4ETQA 1RK0B 3V4VL 1KGCD 4UT6L 3V4PH 1FFPB 1WZKA 3QUYA 1RIHH 4C56A 3C60D 4M61B 5ETUA 3BD3A 4ODXB 3I6GA 1SJEA 2YD6A 4YXLH 2VLJE 3DGGB 4KY1H 5JW3L 1AD9B 2H41A 4OD3H 4YDIL 5BVPL 1RK1A 1MFEH 3O3UN 2W60B 3AM8C 4P9HH 2GFBB 5EZLB 3UO1H 2AK1H 1PAMA 4FXGB 1DTUA 1DSFL 3OJ2C 3EJJX 4IDLA 3S9DB 3ZKMC 4MJ4A 4MSWA 5AG8A 2LVEA 3WLBB 2ATKB 1RJZA 2F74B 5HYEA 3PXJA 4P2OA 4GXVH 3BRFA 5IB4A 1Q9WA 3KWWB 4RNRB 4I0KA 2IAMC 2VIRA 4KHTH 5D7JD 2D31A 3CXDH 3MX0A 2CDFB 2PW1B 1RZGB 3C8KB 5D1XB 5CEXB 2JJSC 4XHJD 3BPLB 5D2LF 5CKAA 2E7CA 3ZTNH 3BKJH 2EIDA 5I1AB 5DEGA 3RFZC 4ZD3H 4YPJA 4ONFL 2O5XH 5HDQL 2ZNWA 3QUZC 4L5FL 1U2HA 1QHPA 1IAOB 1KPVB 1KTRL 4EBQL 5KN5B 4GG6A 4ODHL 3NMEA 2ED7A 4WTZA 4HK3N 2ARWA 3QUYB 2JCCA 4XNQA 1U36A 1DBBH 1MCWM 3BZFA 5TF1H 5E56A 2XYCA 1RJLB 4I4WA 5BQ7A 1ETZA 4XVTH 3WN5A 1NDMA 2EC9T 5T1MB 5DSCB 3RZCC 1T7VA 4M62L 5F9OH 4LLDA 4YHNA 1BF2A 4DGVL 5DD6B 4OB5H 2D03H 3FONA 4KRPD 1FL6A 3ZTJG 2F5BH 4UBDD 1R3JB 3AREA 4U3CA 1RZKH 4OLEA 3EJYD 5IB4B 1BM3L 1I1AA 4LQFH 2VIRB 1NGYA 1YY8A 3C08L 1FN4B 4Z7UE 5E6ZA 4H8WL 3TNMA 1XR9B 5HYQB 2BCKB 2Y36H 1YC8A 2GYSA 2GITA 4RMWA 1NC4D 4OFVA 4RGNB 5EB9A 1WT5C 3WFHB 1EAJA 5ID1B 4XPFH 4W6WB 3QDGA 1U8JA 4M5ZH 1YPZF 5JOEA 3T2NL 3ZE1E 2L7UA 1L0YA 2XA8L 3DYPA 1HWHB 2R0WL 3ALWA 2D0HA 3LMJL 3MLZL 3AS3A 4HX1A 5IVOA 1S9WA 4EXPX 4XNQB 2A9NH 4K7PX 1L0XA 3BZFB 5EC2B 1X5FA 5J13B 2FR4A 4PJGB 4Z7QF 4JM2D 2EH7L 4I4WB 2OK0L 4LLQA 3VWJC 1ETZB 1X5ZA 3TGXA 1F2QA 2C3GA 5D2NA 1FNLA 1X5XA 5IFJA 5D72H 2OZ4H 4LRIA 4LLDB 3L3HB 5E9DE 4YHNB 1A7RL 4NPYA 2M1KA 3EOTL 3EYOA 4KKCD 4ORGB 3WHXA 3QDJE 3NCFB 3DBXA 1A2YA 1TZGL 5C0CA 4QWWD 1P4LA 2PXYC 1TQCB 2X89A 1P69B 3H2WA 4DGIH 4L9LA 3MRLB 2MNUA 1NGYB 3AFLA 3I3DA 1UQSB 5CD5D 3PDOA 5IW3A 2FHCA 3UTPD 2YA2A 4WFED 3EDKA 4O51B 2GITB 5KOVC 2X9WA 2X1PA 3F6IA 4UIMB 1U8OA 4NKMB 4JZOA 4TVPE 4ONHA 5HHOE 3GSQA 2J6EH 2MQ0A 4P2QA 3UXFA 3QFDA 2BVUA 3O6LH 4P2RE 3G5XA 1U8LA 3DROA 4YEFA 4X98B 4U1SA 4H0GA 5CJOH 3EW3B 3WNPA 3SKJH 2RQ8A 3T0WA 3QSKB 3AXLA 5DJ8A 1E28B 3QIUD 5IBLD 5EU3B 1XCTA 3B2UC 1IM3A 4LLQB 5C0AA 5BOZG 4C56D 4KFZC 2Y06H 2VKXA 4DFHA 5CZVH 5D2NB 5A16A 5SWZA 1JHTA 2J1KA 3F58H 4XVUC 4BZ1H 1G7PB 5CGTA 4DGYH 3ILQC 4NPYB 5GGRA 2R29H 3VXSE 1IFHL 1QZ1A 2XIDA 5C0CB 5F7EL 4KK8D 4PLKD 4QXGL 4YLQT 5IMMA 4L9LB 4MS8C 2AW2A 5I76B 4PPTA 4WUUA 3H7LA 4P59H 1QA9A 4O58H 2B39A 4W6YB 1CFSA 3LQAL 2O5ZH 5F9WC 4L8DA 1D5ZB 4JAMB 4RFOH 5KW9H 3BUYA 5LJYH 5E8EA 3OX8A 4U2ZA 1HK6A 4JZOB 4Q7DA 2YPLE 4ERSH 1T1XB 2X6MA 1J1XL 1Q0XH 3BEWA 4PRBA 4UB0H 1RZJH 4Z7WB 2AGJH 3DROB 5IIEA 4JHAL 1I9RH 4Y1AD 1N6UA 3DI2B 1BQSA 4WU5A 3QISA 2Y5EA 5EIIA 4OZHE 1AHWC 3W2DL 1UXSA 4NKDA 3PWNB 2VDLL 4GW4B 3E6HB 3OV6A 4FQHB 4MNHB 5F7FA 3ISWA 2R8SL 1DEEB 3SE4C 2DI9A 4EUPH 4XHQA 2XQYK 3MRHA 4YZFF 3P4MB 1E4KC 1PZUB 4WO4C 5KVFL 1AGEA 1MHEA 4L3AA 3L3IA 5I18H 1KYOJ 1VERA 3X12A 5C0JB 5IUSA 1BLNB 3S6CA 1QTYT 3O8XC 1FBIL 1FIGH 3LHPL 2OJZH 5CUSL 2VABA 5F97E 3ARSA 4XZUA 3VG0L 5GS3A 1ZVSA 3EO0A 1C5BH 3KVQA 5HGHA 2YSSA 2BVYA 1G7IA 4GRWF 1WCQA 2DQUH 5KBNC 1XCQB 1A1MA 1CFSB 1YEDA 2X7LA 3VFVB 3N85H 4CDHA 1JYXA 1S7QB 3TT1L 5KS9B 5JOFB 4YHLL 4KVNH 1AO7E 4NSKB 3M1BB 1F3DH 2JK5A 3BHBB 3MJ6A 2AERT 3BUYB 3PWPE 1TVHB 2XTJD 5E8EB 1UWXK 1HHHA 4KUZH 4P3CH 3CFCL 4KXZI 4PGEA 3BEWB 3VD4A 5DK3A 4PRBB 2DM2A 4BKLB 5IIEB 4ODBD 5I1EL 2H1PH 1UKSA 1A6VL 1N2RA 5ALBH 4GRLC 5I6XB 5LWYL 1JWUB 2JJTA 2ZUXA 1CBVL 1UXSB 2UWEF 1RULH 4LCIL 4WHTB 4UDTB 1DP0A 5DEZA 5L8JB 4HWUA 1WZMA 3O3EA 4L3EE 1AGEB 4KK5C 5I8EB 3AS0A 3X12B 1CT8B 2IH3B 2Q76B 1BQHG 4QY8A 1GHFH 2AQ1A 1HILA 5MEQB 3GNML 5HGHB 3F7VA 1N0XL 2P5WD 2JIXD 4CU7A 1CN4A 1G7IB 2DMCA 3P2TA 1R5IA 4HFWA 3P4NA 4Q9RH 5KVEL 2C7UA 3MGTA 4FABL 1A1MB 3IU3B 2CPCA 5JMOC 5K59F 5GZOD 2R9HD 4JQVC 1ZHBA 4DN4L 4KI1A 1TZIB 2NZ9D 4YX2H 1JHLH 1RMFH 1RJYB 3TBWA 5FHAL 1RUPL 4CU6A 3VFMA 4XMKH 1MHCA 2A9ML 4P49A 1WAAF 4S1DC 4LSDA 4R6UA 3DX9B 3T0EB 3WV0A 4ETYA 4OGYH 1OW0A 4MA7H 5A2IH 3IKKA 5D1QA 3VFNB 1H3PH 4CAGA 1D6EB 4G6ML 4HGMA 1CXEA 3GMPA 4P2QD 1J18A 3DRQA 4MA3A 2DI7A 4L29A 5D96B 1OWRM 3EDDA 4HS8L 4NJAL 3P11H 4DVBB 3L3OA 5B8CB 3MRPA 1J9CT 2DQDH 3F7RA 4KQ4L 3S35L 5F7UA 5HYSB 2I5YH 3MYZA 1YZZA 1QFWH 5I17A 1CICD 2NY0B 5C0AD 2VDML 3OWEA 1OTUD 5LBSH 3O3AB 5SWZD 1DL7H 5HHXL 1U95A 4GRMB 4XNYL 1VSCA 4M1CD 5GGQL 3B9AA 4HFWB 4TNVK 2EE9A 4Y4FA 5GJTH 3U36A 2C7UB 2DQIL 3D18A 5E00B 1JF1B 1NJ9B 3QG7L 5LVEA 4OGZA 4DKEH 1JGUL 1I8MA 1ZT7A 4FFVD 3VFMB 1BJMA 2Z31A 3RGVB 5ENWA 3GK8H 3HAEB 2OMBA 3TJHD 5HYJB 1D9KD 1MLCA 4JM2F 4CMMA 2R56L 4JHZA 4J3XA 1MCJA 2BNUA 3MNZA 4NQUA 2W38A 1MF2L 5D1QB 5J12C 3X11A 2FZ3A 1WF5A 1EZVY 5F9DC 2VLLB 1CWVA 2FATH 5GGVY 4PJFE 3NVQA 4H5SB 3EYQC 2DKSA 3RDTB 4LKCB 3VXNA 4HCRL 1CTOA 4U1HA 4NNXB 4RFEA 4YH6A 2JKXA 3TA3C 4Z7NE 1KCRH 1VENA 5JPNA 1QBML 2R2CA 2HG5A 1I85C 1MNUL 3RWIA 5I1GH 1CXFA 2K1MA 3LIZL 3TZVA 3UC0H 3S5LA 3T65A 3EYSH 1N6VA 1U95B 3IU4H 5ECJE 1B6DA 2V5TA 5L88L 3BGAA 2I27N 3D18B 4HKJA 5C08B 3FN3A 2Q6WA 5M94B 2NY2D 4NUGH 4HZAA 3J7HA 3SDCA 2CRYA 2GK0B 4FHBD 3UBXG 3QO0B 4RQQA 2DIBA 1WFOA 2BOBA 1MHHB 2V2XA 3CSPA 2AXGA 2QHRL 1R3KB 4HKXB 4HBCL 5I0ZA 2BNUB 3BOVA 4OQTL 1KXTB 1OSPH 1AD0A 3KPPA 2NX5B 1PY4A 5C6PB 4JDZB 1MRFL 4G43B 4WCYL 1SEQH 5B38B 1XGRA 3LAFA 5IVXA 3OTTA 1G7JA 4PJ8B 2CH8A 3MV7A 2XTLA 3LEYL 3BN9C 4LASL 3G6DH 1RUQH 4HPYH 3UYPA 4N8VG 2VL4A 1UACL 4TUKH 5TH2A 3FT2B 3MRKA 4WW2A 4X7DC 2I26N 2NW2A 4U1HB 4X6DE 4E41E 4QRSA 5EBWA 3FO1A 2O93L 4YK4C 4PJDF 1T5WB 3OKDA 1BD2A 4UILH 1QSED 3BPCA 3RWIB 4KRMB 4P5TA 3VE0A 4XCCH 2EDFA 1IM9B 1TCRA 5ESAB 3TZVB 3DXAA 2AJVL 1OP9A 4NZUH 3U30B 3D87B 5CILL 1MJ7L 3DHJA 4M43L 3R06A 3NTCH 2WQRA 4JPKH 4Z95L 1F45A 2HKHH 2ED8A 5C0BA 5I74C 3QZWB 2BOBB 1Y18A 4TTDD 2YPKB 1QPPA 3BW9B 4MNGB 4GG6F 3O3BB 5TE7L 3B2VL 4Y2DD 1K4DA 4FFYH 5TE6L 3KPPB 4JPWH 2AEWA 3N50A 2ZG2A 2JCCF 3RWEA 4U1IA 4OFKA 5IW1B 2ZCLH 4S1SL 4Y4HC 1PLGL 3BP4B 1G7JB 2UVFA 3MV7B 4RWYL 3LKPB 1M6OB 1WGOA 4XAWL 3UX9B 3WIFA 1OTSD 4F7PA 1TXKA 2OQJA 2ITDB 3CDCA 3P3YA 4Q9BA 5TH2B 3T2PA 3L3KB 3VI4E 3MRKB 4HK0B 1U3ZA 35C8L 1QSFA 1CE1H 2ZUYA 3RPIA 4LPCA 5EBWB 5J1AA 3O2WL 3FO1B 3K2UL 4GBXB 4I3GA 4NZTL 1A1OA 3EIFA 4KMTL 4XBGA 4YDJB 1YEEL 3RIFK 3VA6A 1IE5A 1BD2B 3BPCB 5DO2D 1FE8L 1U3YA 3IDGB 2XKUA 2AEIT 4KKBD 1BOGB 1S7UA 5DJDA 3GJFB 1N5YL 3ARVA 2O61B 2FL5A 4HQQH 2P1YA 5IROA 5DD3L 1OM3H 3BZEB 1UZ6F 3BXNA 3P0YH 4HCRA 3V5KA 3H42L 3VMPA 4R97C 2W07A 1MI5E 4KK9C 4WW1A 4NM4H 3RL1A 1PD6A 1SJHA 2X4RA 25C8L 4HC1H 5F3HA 2VN4A 3HMWL 1BZ9B 1W8OA 3Q5OA 1L7IH 4Y4FD 4OFYD 4PY8I 3CUPB 3N0PB 4YHIB 1K4DB 4TVPH 3DECA 5E8DL 3HZKB 5F1IA 2Z31D 3RWEB 1CFVL 4U1IB 5IHUL 1FSKB 3MRIA 3MR9A 1MREH 5T1KA 2FIKB 2D0FA 4WDIA 3GSNH 3TV3L 3BEVB 5K93A 3V0AC 4QHLA 1KPRA 1IBGH 1F4YH 2CSPA 4F2MB 5IG7B 4K2UH 1J7VR 4OQTA 3NAAH 4FA8A 5FGBC 1YEJL 4XPTH 3ZDZF 1GIGH 3R0NA 4F58H 4Z7OF 4XBGB 2K3TA 1T6VN 4Y5XB 3LCYA 4ZODA 5DK2A 1FGVH 4AEEA 4UV4H 4OCRL 1GAFL 5FGCE 2E7LA 5JR1H 3L3DA 4QHNB 3ZL4L 3CDGA 1S7UB 2VWEE 1KB9J 2C9AA 2VH5H 1NCAL 1VEMA 2GAZB 3KAAA 2FL5B 2B1HL 1T89C 3IS0X 4GS7C 1J10A 4B5EA 1HIMH 1UFUA 1K5NA 2FX8L 2FH8A 2NY1B 2ZCKL 1LD9A 3FQXA 2BRQA 2UVEA 4WW1B 5H2BB 4TUJB 2XOTA 3RL1B 2J5LB 5L9DL 1IQWL 3KPSE 3UPAA 3PNWB 3QUMH 2CO7B 4RAUA 4M4PA 4LCCC 4XB8A 3SDCD 3T77A 4F3FB 1J0KA 5IV2B 4XP9L 1MCIA 3MRIB 3WJJA 3HB3C 4JM4L 3WFEH 4WDIB 3PUCA 2XICA 5EBLA 3LPFA 1QRNA 1KPRB 1U9KA 3NCYS 2YRZA 4HPOH 5FYLD 4JKMA 3VGEA 2C3WA 4I13B 4R26L 2XQYG 2RBLA 3LQZB 1A5FL 3JWDL 1QKZL 3WIIH 2X44D 4PV9A 4KVCH 2NR6D 5JA8B 1S5HA 3DVNB 5DK2B 1KELL 4HSQA 4N90E 2VLKD 3L3DB 1JZ2A 1FFQA 5CGYC 3CX5K 3UDWC 1GZQA 3BRGC 3RUGB 2OTUA 4P5TD 1JPSL 1M1SA 3FQXB 2MCPH 3DXAD 3BO8B 4LSVH 4NRZA 4IRJC 1T22A 3F8UB 5B3JF 4XPBH 1CDHA 1QNZL 4KMQA 1B2WL 4HUXA 4RAUB 3KDMA 4DAGH 2YD7A 3T77B 3UTZA 4KKLD 1TNNA 2IFGA 5FO7B 4G9FA 1FO0A 5I15L 4XXDB 1RUAH 4KXZH 4XCNA 4QXWA 5CGMA 4TRPL 3FT3B 4JKPH 1ZLVH 4F9PA 4GSDH 5I1CH 1VACA 2ORBH 3IDUA 5MENA 5EU4A 5IMKB 4RAHA 3MBXH 3SE3A 4PV9B 4F57L 2BVPB 1BFOA 3QNXB 1S5HB 1AY1H 2OXGA 3EOBA 3MV9B 1JZ5A 3D85A 2DIJA 4JDVA 4XC3L 1XGTB 1NUNB 3VD9A 1S7XA 1QSFD 1VB9A 1A6UH 1X44A 4HH9B 3PWUA 1B6UA 5F89A 2OTUB 2HKFH 4FXLA 1H15A 4LRNH 1JGEA 2WBJD 1TJIH 2DAVA 4HJ0D 4S10A 4J3WA 1BMGA 4MCYA 3NCJL 1CYGA 2ICCA 1O0VA 3QCTH 4HUXB 2Q3AA 4D0DA 4JFHD 5DVLA 5ILTH 5DS8A 4MQTB 4NFDA 2H32H 1MCFA 2GUOB 1PKQE 3QQ4A 4G9FB 1KCVH 2BP3A 3KYMA 4JFEE 4XCNB 4LEOA 5A2KH 3GGWA 1FVEB 1LNUA 2YBRB 3GUTB 2P8PB 3C8DA 5JHLL 5EU4B 4ODTL 3FQWA 4FS0A 1F97A 5C0DA 5T1KD 3RY6A 2P43B 1A14L 4ELME 4TPRH 4OLUL 5F6HJ 4E5XA 2NQCA 1H5BC 5HD8D 1NBZA 4MX7A 1LEIB 4K3EH 1INQA 5DHVB 1AKJA 4WTZG 1G9MC 4JDVB 1JGLL 1NEZA 3D25B 5T1LD 1UJTA 5DLML 2IF7A 4XX1E 4IMLB 4HXBH 3PWUB 2ZOKA 4XAKE 5E5RB 5C6TH 4CBPA 1T0NA 5IEKA 1JGEB 4PB0H 1J0YA 4DUVA 4LFHG 2GIYA 2GJ6E 5CEZL 2QV2A 5FYKD 3KR3L 4ISVB 4Y5VA 3L7FB 1MFCH 1MWAL 1JGDB 5DS8B 5HDBE 3MLYH 1MAML 3QQ4B 1UB6A 1J1PL 3HG1A 2Q8BH 3EYUL 2MHAB 4WEBL 1DQLH 4N1CA 4J7RA 2HTLD 1BFSA 3QDMA 4AENA 4OUOA 2VQTA 4NC1E 5T3XE 1EPFA 1OQOA 3AAZA 3QHZL 1C5DA 1YQVL 2YMXL 1FLRH 4UNTA 5F7NC 5C0FA 1YMHA 5HVHC 5CJXC 5DC0A 1NBYA 1NBZB 2QSCH 4JZJC 4MX7B 1INQB 3MRMA 4CJ1A 1AKJB 1A8JH 3U9PL 3DX6A 4ZSOA 3V0WL 2JB5L 1CGWA 1DVFC 2ZOKB 3PQYE 2L7JA 3WD5L 1C16B 2Z93B 1DBMH 2VMFA 3W5MA 5JLZA 5F7LB 1JBJA 1T0NB 5SX5H 3M8OH 2J7LA 3C5SB 1RIUL 4JFPB 4QTIL 1DEDA 4QRPA 4OUUA 1I7ZA 5J56B 4Z8FL 3IJSB 4JRXD 4R4BA 4PJ7E 3HC4H 3IFOB 1NBVH 1PVHA 1LO2H 2DTML 3T1FA 1CLZL 1HQRA 4GW5A 4APQD 4Y5VB 2QJDA 5IW6B 1U2CA 5D5ME 1G7LA 1LILA 3WIHL 2AJSH 4LOUC 2C3XA 1UB6B 2P5EE 3MOBL 4AIOA 4MJ5A 1IT9L 1WVZA 2Z92B 3E8UL 1LO4H 4FFWC 4I0PB 1Y0LA 1DN0A 2D9QB 2PO6C 3OAZK 5DUMH 4RRPA 5IBTL 5IKCA 2H6PB 4BH7B 2VXSH 3GJEA 4LVHB 2VLRE 3OKLB 4AENB 1CTNA 4OBSA 2WWKT 3UTQA 4GW1B 5MEPA 1C5DB 2YUZA 5CCKL 1LP9A 4NOBA 1YYMH 4ODWA 4ZAKC 4OZGA 5GZND 4JFFB 4DQOL 1YMHB 2VLMD 4LIQE 4PJEE 2DOCA 1C1EH 2X40A 1NBYB 2V5SA 3L6FB 4MA1B 1NLBH 5FO8A 4ZSOB 4U3XA 1OAUL 1N7ML 3OR6A 3OB0H 3R0MA 4BFEA 4CGTA 3CSBA 5D7IA 4OM1L 1L6XA 5JLZB 5I9QC 3D85D 2R1WA 4JREC 4FP8L 1TIUA 3S88L 4QRPB 1YEIH 1ZANH 3N9GH 3KLHC 1HQRB 5HI3D 5I16B 4WFFD 3BKML 1ZS8A 5FV1L 1UEYA 2X1OA 2QSVA 2X4OA 4ZUSA 5IVXF 3FB7B 4FQXA 2R2EB 3FRPA 4K7FA 1TPXC 4Y2OA 3HC3L 4X4XA 2ICWI 1S7WB 1FCGA 1KENL 2BC4A 2M8XA 4WW2F 1CDBA 3OG4B 6FABL 3UTQB 3IXTA 5MEPB 4O02L 1MWAA 2B1AH 3IFPA 4ODWB 4XTRD 4PR5B 1HH6B 2Y72A 3NH7H 2F54D 2EXWD 2F53D 5BS0A 2FEDC 3MUGA 2VC2L 3B6SB 1A6ZB 5GIRB 1AGFA 1JTPA 5D1ZD 1TQBB 5GGUA 1QEWB 1NMCB 1P4BH 1TMCB 1G9MH 3OR6B 2QEJA 1JZ4A 5D7KE 5C2BL 4KPHH 3SDDC 4NHCH 4N5EC 1IQDB 2QKIA 3MOAL 4QRRE 4L4TE 5KSBA 1UWEL 4NKIL 2MCG1 3BKCL 3ZTJH 3RBGA 1NAMB 2FJHA 3QCUL 3ARBD 2BERA 3ARFB 3TYFB 4RCAA 4G6JL 3AY4C 4N1EA 4V1DE 1S7TB 1KN2L 1LGVA 1MJ8H 1CVSC 3MRRB 1CDCA 1Z0NA 2X4OB 3R1GH 2G2RA 4ZUSB 2ITCA 3E0GA 5F7DB 3M45A 4MAYA 3SGKC 1RSFA 3NIGF 4XVSH 5EOCL 3LKQA 1T1YA 5F7MC 3TVMA 1QPXA 4H88L 1WFUA 3TH4T 1FZOB 4Y16B 1H9VA 3MCKB 1BEYH 3CC5A 2AK4E 5E08H 1J05A 1JF6A 2YKLL 3DV4A 3HG1D 1MWAB 3WIHA 1CLYL 4OF5A 1KEMH 1F6AA 3V4UL 4JN1H 3PABA 1N26A 5BS0B 1NCWL 3PWVB 1IC7L 4K8RL 4G8GA 5HI5C 3QDMD 1T83A 4M6ML 5IBUG 3RVTC 1OAQL 4WU7A 1NCTA 2P8LB 2PW2A 5GRWA 5AZ2H 5KSBB 2A6JA 2XNAA 1CZ8H 1YY9C 3O9WC 1RIVH 4P4KD 5C09D 3I50L 1I1CA 2Z8SA 5CZXD 1HYSC 5JDJA 2R0LL 4YQXL 2NXYD 4V2BA 4I9WD 3EBAA 3OMZA 1E0OB 4JG0H 4L4JA 3QUXA 4LCWE 5I1IL 1N3NA 3HHRB 4L4VE 1Q9KB 3RI5K 3LKRB 3MRFA 2OP4L 3H9SA 3NA9H 3V8OA 3STLA 3IDJA 4OF0A 5D7LE 4WWKC 4H20L 1KCUH 4Z7VA 5BZDB 2N7AA 2EDLA 3X3GL 1CIUA 4LPXA 5DUPL 3WE6B 4X6CE 1J05B 4X4ZA 1XIWC 3DV4B 3OKEB 1XH3B 1SBSL 1UJ3A 1KPUA 1F02I 4KAQH 3K3QA 4ZS6D 3CLFL 1F6AB 1OCWH 2AJ3B 4A2MA 2VZ3A 3PABB 5I2IB 4DN3H 2ZUVA 4GKSB 4G8GB 5TDPA 1M71A 2KQMA 4MDIB 4OZIA 1MHPL 4P9ML 1QFUL 4J3OC 5D93C 1INDL 2ZNXA 3ROOA 4JY4B 1FPTH 4LBEA 3EOAB 5J6GB 5HHQA 2QR0B 5GS2H 3L9RA 3ARDA 5ADOL 1QLEL 3WS6C 1JK8A 3O6FD 1W0WA 5HGDB 4R3SA 3REVA 2A6JB 2F8OA 2XNAB 3SKUD 4M1GL 3U4BL 1QFOA 5TGBA 3VFRA 1HHGA 3H8NA 2P7TA 3O0RL 3D9AH 3S4SA 1ZVYA 3P9WB 5ICZA 3MXWH 1N3NB 4OTXH 1QG3A 2Y25A 3DV6A 3JWOC 1M7IB 1U8MA 5DMIH 2FLRT 5BV7C 2OL3H 3STLB 2FJFB 3IDJB 5BZWB 3KYNA 1YMMD 2H2PD 1LO5A 1TZHA 5HHVL 5HJ3A 4Z7VB 5IVZA 5IGXH 1OGAD 3U1SL 3T3MF 1BBJA 3OSKA 2DL2A 3MRGB 1J0HA 3VGHA 1A0QH 3OGOE 4XCYB 2FO1A 1ZHNB 1QRKA 4HLZG 1T66C 4NQSA 5EN2B 1UB5B 3T04D 4HUKB 1YEKH 3ZO0A 4PJ9A 5TDPB 1M71B 1E4JA 3HI1A 3R8QA 3LS4H 4HIHA 1U6AL 2OI9B 3P77B 2GTWB 5JZ7D 3S37L 5I1JH 4G3YL 4J1UA 1MFAL 1CLCA 4DOHE 1GPOL 3EO1A 3IAGC 4JG1H 4MJ6A 2R2HB 4G6KL 5EU7E 3CSYB 1GGIH 1NCUA 4X6FA 3IRPX 3IJYA 1EZVX 5TGBB 4PJHF 1HHGB 1FNFA 4M48L 4G5ZH 3S4SB 3DMMC 1OAKL 2ZSWA 1HQ4B 3PL6C 1H8NA 4EDWH 2PTTA 4M6NL 5KANI 3BMVA 3ZKND 3KJ6L 3P40A 5HXMA 3T1WA 3S5LG 4PRPB 1A6WH 2IAND 1NMBH 2UYLA 3VA2C 1KULA 1VFAB 3MCLL 1HCVA 5FCSH 1JPFA 4QOKA 4GH7B 5HPMA 1F4HA 4FG6D 2VXVH 2HLFD 4Q6IA 2ERJC 4MAYD 5KZCD 1M4KA 2NY6C 3KHOA 4EIGB 2F8XC 3IYLW 5FEBA 3SQBA 3JTTA 3K8KA 3TVMD 3RI5F 1GC1H 4U49A 3SQOH 2B5IB 3QCVL 2A6KB 4HIHB 3ZYZA 3HUJA 5DR5H 2HRPH 5GS1C 1KACB 1ORQA 3LEXA 2IH1A 4YAQB 4J1UB 3CIQA 5DA4A 2NNAB 1T1ZA 3Q6FA 3QFJB 4D9LL 4PY8J 4OAWB 1IAKB 1SM3H 3MLRH 2HH0H 2RCSL 2EDYA 4D0CB 3NN8A 4X6FB 4M8VA 4G8FB 3WFCL 3ULVL 5F1SA 1FL5B 4OSUH 2W9EH 2X5PA 3HMXL 4PRAB 2HFGH 4UI2A 5I73B 5IK3A 4PBVC 3GHBH 1IAIH 5CBAA 3QUXD 4N8CH 2FBJL 4PP2A 3P4LA 5JW4Q 5ANMB 3GSOA 1JPFB 3W9EA 3O4LD 4QOKB 5HPMB 5IEHB 3H9SD 3CLEL 4Q6IB 5AD0A 5BRZA 1IGMH 2Z35A 4X99A 3CZFB 5TDNA 4M7ZC 5K9JL 3HS0B 1UVQB 5T3XH 4OT1L 3ELAT 3RZCD 3CXHK 4YHPA 1GGUA 3UTTA 2J3SA 1DANT 3IF1B 4RGNE 4Z9KB 1VGEL 1PFCA 3LEXB 3QG6B 3HLAA 4F8TA 2IH1B 3MLPA 4O9HH 4HF5L 4OLWL 3KJ4C 3OB8A 5T5NF 3FB8A 4GG6E 3BQUA 1G6RH 5KJRH 2IADA 1HI6A 1MIMH 5IP4A 1F5WA 2MPAH 1DBKH 3O45B 3JXAA 2JCCE 1NGQL 4MB5A 4MD4A 4FQLH 5HHPA 5T3ZL 4DWHA 4LSTL 3UPCA 1J1OH 2A1WL 4QGYA 1ZLSH 4Q6YA 3JWOH 5D7SL 1JYWA 1T7YA 5BV7H 3G6JB 4J8RB 4P46B 5D7JC 2J12B 4PP2B 1R3HB 3GSOB 4UINL 3KYKH 3W0WA 4OF3A 3W9EB 4XHJC 4KWUA 5FDWA 3DO7A 2Z35B 3AU1A 4IRSA 2XTJE 4R7NB 4X99B 5TDNB 3VWJD 1MCRA 1QACA 2C4XA 3RKPA 4TOYH 4X7SL 1EMTH 2A6DB 4FQJH 2XWBB 1B0GA 5FUCE 2H2SC 1FFRA 3UTTB 2UY6A 4LIQH 1MJJB 1I4FA 1OAZL 4Z7UA 5IJVA 2G5RA 4NQVB 3QDGE 2BK8A 3KPOA 3BH9A 5EU5B 4HT1H 4JFYA 4PJ9D 3BSZL 2FD6L 2A74A 1HI6B 3SJVB 1FIEA 4WFGD 1MFBH 1BVLA 3GMNB 1U8KB 1BQLH 1PJ9A 4ZUUA 4F15C 4HUVA 1GGCL 3QO1A 4U1NA 4MD4B 1KLGB 5HHPB 4L8CB 3I02A 2GSGB 3M07A 1QQDA 3QXDA 4FQ2L 3K8LA 2BNQB 4PJXB 5D2NE 2DLHA 4UBDC 4ZTOL 4GMSH 3CCHA 1FVCB 2A73A 3MODL 3MRNB 4X6BB 4Y2DB 3EJYC 1KTDB 3ZKXC 1A6AB 2DQCH 5A40E 4JLRB 5DJAB 3MFFB 1KEGH 3D39D 5T33L 5C0CE 1P7QB 2FECL 2LABA 5DHYA 1LP9F 1GXEA 4OZGF 3L5XL 5E9DA 4IRSB 1B4JH 2DLIA 1KBGH 1Q8MA 4JO3H 4KRLB 1UA6H 2AKRA 4RZCB 4JKWA 3QJHA 1JN6A 1TJGL 3KYOA 2HLAA 3QEGH 2BXZA 3GKWL 3ILQD 3BWAB 1R0AL 1F8TH 3NABH 4X9BA 3U7AA 5GGTH 1R3IL 3LPWA 5D7IF 4QEGA 2HFEA 4P2QE 1YN7B 5FXCH 1SBBA 3MA7A 4MS8D 4ELKB 4Z7WE 5FF6A 3MA9L 2A74B 2E27H 3X14B 5CBEA 5CEYB 4LU5H 4G80A 1BVLB 2V6HA 5HHOA 2Y7QA 3G04A 3LDBB 4ZUUB 1J87A 5EU7C 2BNRB 3G6AA 3MACL 4XNZC 1FFNA 1B0RA 5BO1H 2E9JA 3I02B 4UIKH 3GSNA 3HI6H 1B90A 4KKCC 5C0AE 5B39A 5DFWH 1GGBL 2VQ1A 4KDTC 3TPUA 5IB3A 4QHUB 1V7MH 2B4CL 4IEFB 1RZIA 2UY7A 4Y5YC 4RWHA 4QT5A 3S34H 4YBLB 5CD5C 5CSGA 4F7MA 5CSBA 4R7DA 5DHYB 4U6VL 2VLJD 1RI8A 3WEXB 4YHYB 1KLUA 5DXWA 3VI3F 1NFDF 5AUMB 1N4XH 4WUUE 5KVGH 1ONQA 3VXQA 2P48B 2CJUH 1H0DA 4WO4D 4XC1H 3MUJA 1M05A 2HLAB 1JPTL 4WNQA 5BRZD 2X4NA 3O8XD 9CGTA 4BFIA 5EBGA 2HFEB 2MQCA 1YEFH 5GISH 5DJCB 3VXRB 3GHEH 2VAAB 3MA7B 1CFNB 2AJXL 5IBLC 3DIFA 3FZUD 5FF6B 4TSBH 5DJ0B 2MTPA 2YPLA 4PYHA 1YEHH 2MOVA 3S96A 1OP3K 4XMPH 5E2TH 2NY5L 3GMRA 2OR9L 3SPVA 1K4CA 4XXCC 3QXWA 1FFNB 3DTXA 4RBPH 2FYYB 5F9JA 4U6YA 1VKXA 4RISH 4BJLA 4XPHH 3FFCB 3BQUD 4HJGB 5HBBA 4NYLA 5DZLA 2E8ZA 3D0VA 4XMLL 1X4YA 1MCNA 3SOBL 1XGQB 2P4AB 4MA8L 1K85A 2PUQT 3QWRD 4PJ5A 3EDJA 4KK8C 4PLKC 3IDNA 5CJBA 4HS3A 1QO3A 3MLUL 2QHLA 4TN9A 1DQJB 4LHQB 2FH6A 5JDSA 5DVMA 2QADD 1LEGB 4F7MB 4MMXC 3LZFL 1KG0A 2HVKB 3MUY1 3GM8A 3PP4H 4PBXA 4PREA 1P1ZA 4Q0XH 4P2OC 4HWBL 3VXQB 1JZ3A 1P4IL 2VDPH 3TN0B 5EUKA 2AQ3A 2XPGA 4KK5D 1HWGB 3MO1B 1AXIB 3NFPA 1Y6MR 1JVKA 2BVOA 2DLGA 4FQIL 1JPGB 3O6MH 4BFIB 2F15A 1EO8H 3E6FA 1NLDL 3T4YB 4H25B 3OHXA 1SEBB 2AJYH 4UT9H 4Q2ZA 4W6XB 2FSEB 2YEZA 3FB5A 2YA0A 3PWPA 2DQTL 3QNYB 4CRPA 3S96B 1GH7A 3SPVB 3DTXB 1YNLL 1MY5A 5F9JB 4U6YB 4YHKL 1VKXB 1FC1A 4TQEL 1U42A 3LH2L 1L6ZA 4PRIB 1AE6H 1INEH 3D0VB 3DNKA 3QRGH 3FQNA 4S1DD 3WN5C 4AH2A 4YHOH 3IDNB 3H0TA 4PJIA 1NEZG 1FVDB 1E4WL 1QO3B 3CFDA 2YHGA 4C59B 1CL7H 1X5IA 4A2LA 4KJWD 3ARQA 3MJ9H 1RUKL 2X4QB 3S36X 1KG0B 2X1QA 2GTZA 3TJEH 5HVWA 5LKNA 4PTUB 3DUHA 1TQCC 3AREC 4JQIL 4PREB 1P1ZB 2CKBL 2XTJC 1I1AC 2YK1L 4LSRH 3RU8L 5FK9A 1ZT1B 5FM4A 5TFSH 5FB8B 4K71C 3QXUA 5EUKB 3ARRA 2FX7H 1NMAH 3HI5H 1RHHB 3PHQA 5LCVH 3UMTA 2FJGB 5FO9A 1D5IL 5E9DD 4Z0BH 5FUCC 4OFIA 2EEAA 4NNPL 1OGTA 4TSAL 3QDJD 5I8OL 2R4SL 5DRZB 2AJUL 3V0VA 1IL1B 3JTSA 5TPWH 2RFXA 3GIVB 1UH2A 2GT9B 1FNEB 2FBOJ 3JV6A 2BJMH 3OQ3B 4AMKH 1EEZB 5E4IA 4GMTL 3ZE0F 2X9XA 1RVFH 3VRLF 4YO0B 4X4MA 5DC9B 4MNQA 1OHQA 4FQ1L 1U8HA 2BHYA 5T5FL 1IILE 1NDGA 4H1LB 4R0LB 5FHBL 4XP4L 4TVPD 2OJEA 2EE2A 5HHOD 4OF7A 4AH2B 1UXWA 5E2WH 1JP5A 1A4JB 5D2NC 1Q0YH 4P2RD 3VFOA 1YJDC 3CFDB 4LRIC 1UWXH 4KTEH 2CQVA 2D3VA 4I48A 5GZOC 2R9HC 2GTZB 2XWTA 4X4YB 2NZ9C 1WLHA 4D3CH 4RGMC 5FK9B 3QIBA 5C08E 5IHBA 5B21A 3HFML 2D4DA 3S3JA 1V3JA 5IF0A 3GO1H 1HNGA 3PHQB 2X2YA 4ZO6A 3QAZC 5FO9B 5GPRA 5I1DB 2VDKL 4BQ9A 3VXSD 4NP4L 3P0VH 3BGFC 3V0VB 3KLSA 3MV8B 3BP6B 3SKNA 4HWBA 4RRPG 1P7KA 4MAUL 2Q3ZA 3IDMB 3HCVB 4M93B 1FFOA 1MH5A 1U58A 1S9YA 4MNQB 1SQ2N 4Y88A 3VGDA 3VGFA 1BVZA 1IGIH 4I2XB 1LEKA 1GOGA 3OG6B 5ITBL 1HSBA 4M3KB 4J3UA 1BF8A 1KJ3L 5BJTA 3RJQB 3OJDB 4IMKA 1I1RA 1CF8H 1CICC 2D7OA 2YPLD 3LPGA 1H3XA 5TE4L 1OTUC 4R96B 4X9GA 5FUOL 3ULUL 4G6FD 4EDXB 3A67L 3VXMA 1HXYB 4RMVA 2CGRH 1WFTA 2AI0L 3NIFF 4P9HL 4M1CC 5DJYA 3S8WA 5CP3H 1LK3L 5DI8B 4MXVE 2C26A 4LMQI 2XWTB 4OJFL 1T03H 3BDYH 2ZSVA 3VDAA 4FFVC 2R0ZL 1U3HB 3CZJA 3OZ9H 4B50A 2DICA 4U7MA 1BQUA 4IOSD 4LMQE 3QIBB 4X9FA 3TJHC 3SKOA 3HUJF 3AGVA 2V7NA 3OBAA 3T0AA 3QXAA 4LSQL 3WUWB 3C09C 4MB4A 1WZ1H 1I3VA 1J8HA 1IGYB 1JFQH 3IETB 4MNGE 4V2CB 4ZFZB 3FRPG 2YPVL 3U0WL 3U9UA 5FM5M 5D6CB 3PWJB 5LGJA 3MRCA 1MCOL 4KGLA 3ZHLA 4CVXB 1MH5B 1KB5L 5CSZA 1SJXA 4HV8A 5JW4R 2VR4A 4KGJA 1MQ8A 3I6KB 4OZFA 4NCC2 1XGUA 4NO3B 3ZLQC 3MV7E 1AO7D 2VOTA 4LCUB 3AS2A 5CINH 3PWPD 2LU4A 3M17A 3RX5A 4IHOB 4FZEL 4EIZC 3TNNA 5TF1L 1AR2A 3DX7A 3VXMB 4OM0L 4YC2C 3ZKQD 4APQB 4KH2A 2SEBA 4DW2L 5F72S 1T4KA 2HFFB 1KFAH 3OR7A 1BD2E 4Y4HD 2WUCH 3MXVL 5F9OL 3TBSA 2NY2C 1IGJB 3ZHDA 5FUZL 1EAPA 1DQMH 3MNVB 3RNQA 5SWSA 3C6SA 3WSQL 4OB5L 4P4RB 4PJHB 1FC2D 3LSOB 5H8DA 4OLVL 1RZKL 3KYAA 4LQFL 4L3ED 5EZJB 1LWRA 5C0BE 3WKMH 1UH3A 3QXAB 5EZOH 2R23A 4PS4L 3RVVC 4JKKA 3T8XA 1OQXA 2CKBB 1E27B 5DJ6B 4XT1C 4AL8L 3G08A 4NQEB 5LGJB 3MRCB 2EYRB 1Z9OA 3PV6A 1OPGH 2E9IA 1J11A 43CAA 4HWEL 4XGZA 4ZOEA 5E4EC 5F7YC 2JJTC 3MREA 3DX8A 4GUPA 3NIGE 5D70L 3AS1A 3I84A 3RTQA 3TNNB 2MMXA 3QHTC 3MQIA 4YXHH 2F58L 3TH3T 4NM8L 3C6LA 5J11C 2W0FB 1JHKH 1JNHB 4M03A 4BSVA 2MFNA 3VG9B 4UT6H 2DKUA 5TF0A 1IGFL 3PGCA 3PXHA 2X4TB 1EAPB 1AJ7L 1WIUA 4HWZB 3RNQB 5JW3H 5SWSB 3CFIC 4I18B 5BVPH 5JHDB 4YDIH 4TTDC 3SY0A 3QIWA 3WDIA 4K3JL 5GGSA 4NO5A 4Z7UF 1PG7X 3DSFL 2F53B 5KVDL 4EUPG 1DSFH 3SO3C 2H8PA 5DD5H 1MI5A 3B83A 2X4PA 4HHAB 3G08B 5D1ZB 2Y9RT 1OTSC 2J6EL 4PY7B 2XWJA 1OW0C 4R8WL 1A4KB 2QQQA 3I75B 5GRYA 2IPUG 5D1QC 1BREA 5DJZB 3PHOB 4GAJL 1BVKA 3MREB 3SDAB 4ZFOL 1PYWB 43C9B 1HEZA 1O5DT 4AQ1B 3U2SA 1A1NB 4XVJL 3F6LA 2ICEA 3RTQB 5DO2C 3ARBB 4ONFH 5HDQH 4KTDL 3G9VA 4L5FH 2EO9A 2YC1B 1KB5A 2P8MB 4XNMB 4EBQH 3LN5A 3OKYA 3BGMA 4MQ7B 1GVIA 5LXGL 3O11A 1JNJA 1L0QA 3SDYL 3DGCR 1T7WA 3KPRA 1FZKA 2EDWA 3VFTA 1Z5LB 5L8KB 3SY0B 3W82A 4JFDA 3FTGA 2IJ0C 4Y4FC 4KQ3L 4O4YH 3S4SG 5FYKE 1F13A 3BD5A 2AXHA 3MYJA 4P59L 4PP1D 1PY9A 1ZLVK 4O58L 4M62H 3GFUA 2RAMA 1S8DB 2Z31C 4DGVH 2NY4D 1PKOA 3OJMB 3MJGX 1W72L 3GMOB 4ERSL 2E6QA 4PGBB 2BOCB 3BFOA 3VRIA 2XWJB 5MP6L 4YE4L 1BM3H 2ZJSL 4WY7L 3C08H 2KQNA 1J8HD 1F00I 2BFVH 3SDXB 4GAFB 4H8WH 1QRNE 4LL9A 4UOW1 3ARGA 5FECB 3SCMB 1UM5L 1CXKA 3NIDE 4J23A 3FRUA 1JV5B 3T2NH 4UT7L 1CDIA 4BQ8A 2XA8H 5EUOA 2R0WH 3O11B 5E8PA 3LMJH 3UZEA 5D8JH 5FKPA 5IB1B 2YXFA 4K3DH 3D0LB 3TZVC 5L2JB 4YNYB 3VFTB 4CN6A 2OJZL 1SJVA 3RX7A 2IPKB 2FX9L 2EH7H 3FTGB 4R2GD 4LNRA 3RPKA 2OK0H 3UROR 1ED3A 4RFNC 1BX2B 3SDCC 4E41D 1LO0L 2DQUL 4CMHC 2WW8A 1X5JA 4JFOA 1A7RH 1I9IL 3EOTH 15C8H 4KVNL 2ADGA 1BZ7B 1GZPB 2MKWA 3OKKB 1UM4L 3VFWB 2BSTA 4G9FE 4L3CB 4PRHA 5I1HH 3HE6B 3WNOA 4MYWB 2H1PL 4FN0A 3O6FB 4P5KB 4JN2A 1G7MA 4OZHF 1I8IB 4CADB 5MENE 4NT6B 1YECH 2G5BA 1RULL 4WIQA 1C7TA 5K9KA 4WW2C 2ATPA 5HVFB 3PJSB 4D2NA 5EUOB 2H3NB 1HH9A 1K3IA 1KTKE 3BYYA 1QLFB 4TULH 5E8PB 3V7AE 5J6HA 2VN7A 4BUHA 2GHWB 4P5TC 4ZFOA 1BPVA 1SY6L 4UQ2B 3K7UA 3C6LD 1ZKAA 3NZHL 3QI9B 5CKGA 5F7KC 1KSRA 1XR8B 4UTBH 5CMAB 4XI5D 2DQFB 1QBBA 3D2UA 3GDBA 4KKLC 1SMAA 3IDXH 4XBPA 3N06B 1IARB 4KDVA 1ZMYA 2R69H 3T0VA 4YX2L 1IFHH 1FYTA 4PJCB 5EO9B 5F7EH 4LAJH 5IJKA 2Q87A 4QXGH 2BSTB 5E8NB 4G8EA 1N64H 4PRHB 4BUGA 4JN2B 1MI5D 2IAMA 4POZC 4KHXL 3KPQB 3OKMA 2JJSA 3LQMA 4PJIF 4JFEA 2G5BB 1ZE3C 5DA0B 4RAVB 4HXAL 5DUBA 1W72A 2EYTB 1J1XH 1Y6KR 3D48R 3C5ZA 4DVRL 2V2TB 3P11L 2HT4C 4XBEL 2XG5A 5HVGB 4JHAH 1HH9B 3T3PE 5KSVB 4OLZL 4WGVB 4ZFOB 3BT2L 4JFQA 1FJ1A 5HHMD 2A6IB 2EECA 2IANB 3O41B 2WBJC 4HJ0C 2P42B 3MJ7A 2VDLH 1WEJL 4AG4H 5IROC 5IQ7L 2R8SH 1FH5H 1H3GA 3MBEA 3BVNA 3KPRD 4IBLT 5KVFH 2BVEA 3FO9A 1JZ8A 2ZPKL 4JFDD 3CPLB 1A7QH 5DF0A 1FBIH 1MCPL 3LHPH 1FYTB 4PG9B 5GRXG 5CUSH 3DRTA 6CGTA 1JI2A 4HLZH 3LV3B 5DT1H 3VG0H 5C0ND 4WUKL 2VXUL 1CFQA 4K3GA 1D5BA 2BY1A 4QXTA 4OKDA 3VWKA 4QHMA 5JPMB 4GLRI 3TT1H 4M1DL 2IAMB 3FN9A 4YHLH 2ARJA 4UOJA 3IVKB 2A2QT 3OB0K 3KPSD 1P2CB 1QVOA 3BYTA 2D7TL 4J6RL 4PV8A 1W72B 3CFCH 4POUB 4IOFD 4WFHE 4I77L 5CP7A 1T20A 3B8SA 2GSIA 3DUSA 4HULB 4LOUD 4JFFE 2YUVA 3MFGB 3QUZB 4JO1H 3ARGD 3U0TA 3ZKSD 1A6VH 1FJ1B 5LWYH 1WWBX 4N0FA 5IQ9A 2E7LC 5C8JA 4ZSOE 3STZA 1X7QA 3L5JA 4PTTB 5T1DL 1CBVH 3QPXL 3Q2CA 5EH1A 4ZUVA 4LCIH 1G7HB 4DTGH 1L4IA 3HR6A 4ENED 1YNKL 1D6VL 1KJ2L 3MBEB 1PQZB 2DD8L 1LK2A 4KJPD 4EJ1C 3CFEB 1G6RA 1RPQA 4LLMB 4I3SL 4QRPE 3PQYA 1KIPB 4NUGL 2VZVA 3RZCB 3UTSB 4CKVX 1R5WA 4YBQD 3CDYA 4N90D 4M9PA 1CDJA 1H8OA 1SY6A 3DRTB 1FV1A 4PJAA 4AT6A 5GJSL 5GS2D 2CLVB 4PJ7A 4ZQKB 2HTLC 3QHFH 1CFQB 1D5BB 2PXYA 4IS6B 4NHUB 2VXTL 4Y8AA 4QXTB 3SE9L 4TUOA 3WJJC 3FQUA 1OSPL 1GOFA 4Y4KD 4ONOA 4J3VA 5MERA 4OLYH 5EA0H 5FHAH 1RUPH 2FO4A 3P9MB 4ZXBA 3QYCA 3H3PL 2JTDA 1OB1A 4PJFF 1QVOB 3KLHD 4YHZL 3GI8L 4PV8B 2A9MH 3B8YA 4OF8A 1UZ8A 1UKQA 1T20B 2GSIB 2XN9B 4TUKL 3EYFB 4UNVA 2G75B 3KPLA 5J8OA 3MLVH 2CIIB 5EZIL 1ACZA 1CXLA 1HN1A 3CDFA 4G6MH 4Z7NF 5IQ9B 3PGDA 2QQLL 2D9CA 2HJLA 5DMGC 3ZYOA 4N9GB 1YNTA 4PJEA 4L1DA 4Z78B 2R1YA 2IMNA 4HS8H 4NJAH 1V05A 4M02A 3S35H 2B20A 2EC9U 1LK2B 2IC2A 5B39G 3VWJB 1J8KA 3RP1A 4JPKL 4WI9A 4PD4K 2XKNA 3BAEL 3VMOA 1AH1A 4BZ2L 1FZMB 5E5MA 4ZNCD 2VDMH 2APTA 2HT3D 3QWOB 3D2UD 5HHXH 1JWMB 1U8IB 3DWTA 4YDKH 3TPKA 2PXYB 5GGQH 5ICYA 4NWTH 3T09A 4GAYB 3QR2A 2DQIH 4N5ED 3QUKB 1FDLL 3QG7H 5KSAA 1BFTA 1JGUH 3BMWA 5GZNC 1O7VA 2ZCLL 4ESKA 3ZZ1A 4DEPC 5CEZE 3BH8B 3VFPB 4U31A 1E6OL 5E2UH 2PYFA 3JVGA 4QRTB 5E5UB 3WS3B 1OARL 3W81A 4HKBA 3VI3E 2R56H 3SE3C 4WV1C 4LLVA 1C08A 5BS0E 1QLRA 1VFMA 4X6DF 1MF2H 2BHUA 3K2MC 3G5VA 2AV7B 4JFED 4FTVA 3HC0A 3MTRA 2AJZB 3CJJA 3RX8A 1K3ZA 4XPGL 5I75C 4ZFFA 2NLJA 3VH8A 1YNTB 4QTHB 1AXSB 4GQ9L 5CFHA 4JRYA 5HI3C 3CX5J 3AVEA 4JDTL 1MRDH 3OAZH 4HCRH 5KSBE 4QCIA 2CLZB 1CG9B 3MRJA 5E5MB 5EDXA 3EDFA 3BPOC 3LIZH 1UADC 5C0EA 1HHJA 1U91A 3VCLA 1KJ2A 3IXAA 5L88H 1WJ3A 4XAKD 3OL2A 1OLZA 2HVJB 4NN5C 4LGSB 5H35B 1MREL 1DQDL 2X09A 1TLKA 5F9WB 2R4RL 3SKMB 2GJ6D 2QHRH 4YPGB 4HBCH 2PYFB 4TNWK 5ACLA 2QSTA 3V6OA 1ROWA 4LPWA 3RY6C 5EULV 4LLVB 3RVUD 3VI4F 4OQTH 2VERN 4K2UL 2ZCHL 4NBZB 4QHKI 4P48A 4G8GE 1EGJL 1MFDL 1MRFH 3G5VB 3Q3GA 4WCYH 4M9OA 5F1NB 2ZUQB 4F58L 4WI3A 4FTVB 4BFGA 3HC0B 3IFNH 1NC2A 1XF3A 1KJMA 1FGVL 2UZXB 5EG6C 3VH8B 2WIIA 3LEYH 4LASH 5JR1L 3TO4A 4JRYB 1AHWB 3TWCL 5C3LD 1UACH 2VLJB 5JW4N 3JWDC 4OCWL 1U41A 1FRGL 5A3ID 1ZVHA 5FYKH 3L3GA 5E7BA 4X7TA 3B9KD 3MRJB 4WO4B 2E9WA 4HAGA 4P2CG 4HBQA 4EI5A 5C0EB 5CILH 3VCLB 3UJJL 4HJJL 3UAJD 3QULA 5GS0D 3PQYD 1MJ7H 5LAXA 3IXAB 4M43H 4MWFB 4LCWA 3LN9A 4Z95H 4Z7VE 5I66B 4D8PB 3UZVB 1WV7T 1EVTC 3WBDA 4JQVA 4CN4A 4U1KB 4ZDHA 3QQ3A 5D7LA 1T21B 4WEMB 5TE7H 3B2VH 2KH2B 1JYNA 1JWSA 1IC4H 1JF5A 3BWUC 2PYEB 1CXIA 4ZXBD 3QH3A 4ZPTA 3Q3GB 4OZIE 4S1SH 5AG9A 5D6DA 3TH2T 5I1LB 5JIKA 4EEEA 4RWYH 4GRLB 1A64A 1ZT4B 4NRXA 4U0RC 4U1JB 2VLRD 4KKNA 2V2WB 3ESVF 2AV1A 2VKWA 4JR9L 1MFNA 5E94A 4L8BB 35C8H 2NY3D 1I3GL 5ISZA 3L3GB 5FV2A 3O2WH 3FN0L 3K2UH 4NZTH 1YEEH 4NKOA 2OSLA 3UPRA 2VISA 4XPBL 3F12B 3RAJH 4FZ8H 3OGCB 2DBLL 5EC1B 4QLRA 1N5YH 2MWCA 3IKCB 5LAXB 4JZNA 5DD3H 3MLWL 1YDPB 2AEPL 2OR8A 4PG2C 3WNLA 2JF1A 3H42H 2C3VB 4ZS6C 1UM6H 1FO0H 2XQBH 5I19H 1RUAL 5I0DA 32C2A 1G7QA 4ZUWB 3OJVC 1SVZA 2P45B 3HMWH 3MJ9A 3DMMD 3QQ3B 1U8NA 4GSDL 2P49B 1FAIL 4X9IA 5IMOA 3T2QA 5E8DH 5INCB 1PEWA 4P23A 3MBXL 1K6QL 2DYPA 5IHUH 5E2JA 4Z5RB 5C71A 3LKOB 3CX2A 1W8NA 4NRXB 4DKAA 3H7BA 3TLRA 4YR6B 3U4EB 4HG4K 5DQJA 5HGAB 5C7XH 5ISZB 1YEJH 4NKOB 1T1WA 2DN7A 3UPRB 2VISB 2H2PC 4K9EC 4OCRH 1GAFH 1FFPA 2X41A 4NO2B 3ZL4H 1A9EA 4ODXA 3QCTL 1MCQA 3DGGA 1NCAH 3UEZA 4FQXC 3SE8L 1R24B 4A6YL 5DFVD 2FX8H 1MJUL 2ZCKH 4GKZB 2W60A 2EIZA 4L4TD 4HMDA 2GFBA 2NCMA 4QOKE 3GRWL 2BY2A 2Z91B 4U6HB 1IQWH 1HHIA 4FXGA 2QTEA 3FQRB 4J4PA 4V1DD 4XNXH 2J8HA 2CXKA 3WLBA 2ATKA 2F74A 3VXTA 2DYPB 3KWWA 4RNRA 3ARZA 4JM4H 5J12B 3HR5A 2V7HB 1RZGA 3C8KA 4OZFG 2IPTL 3T2OA 3H7BB 5I1AA 5HHNB 3THMH 1IKNC 4R26H 4YFLI 4K23L 1NC2D 4MZ2A 1MCBA 1SYVB 3JWDH 1QKZH 4LSPL 1IAOA 5C6TL 3ZKNC 4ZYKA 1KPVA 2A83B 4LHUA 5KN5A 4N8PA 5SX4H 3BDXA 2R0KH 4FOMA 3PP3H 3TA3B 1ZAGA 4KROD 3OXRA 1A9EB 3IT8D 3FFDB 2FDBP 2VE6B 3VXSB 3TIDB 2R15A 2E7HA 4J12A 4FG6C 2HLFC 2O5YL 1MFCL 4MAYC 1A7BA 4RMSA 5JORB 1RJLA 1Z6JT 5A2LH 3TVMC 2EIZB 4EI5D 2Q8BL 1NCDL 5T1MA 5DSCA 5CP3A 3JV0A 3KLAB 3X13B 1HHIB 1QNZH 3WCYA 5BRZE 1B2WH 4UMGA 4LCWD 5EBMA 3QUMB 5DD6A 5DURB 4GLRH 1FAKT 4L4VD 5SWQB 4GAGL 1R3JA 4XWOD 1X5HA 3VXTB 3QB7C 5DEFB 4ELMF 1F58H 5H94A 3UTTE 5I15H 1QFPA 1T83C 2BHZA 5D7LD 1NGPL 3HR5B 5MI0C 4TRPH 1R5VB 1FN4A 5IOPB 5J06A 4ZPVA 1BIIA 1XR9A 5HYQA 2BCKA 3PDDA 4DZ8B 3GSRB 4BK4A 3WFHA 5ID1A 2XY1A 2AABH 3Q6GL 1RZJC 3ILPA 3RWJB 4IRZH 4ZYKB 4LHUB 2H2SD 1NL0L 3GI9H 4M6AA 4YK4B 3QUXC 3OXRB 2MKLC 3CVIL 4EN3A 1ND0B 5CZKA 1Q1JL 1OP5K 1JGVL 2PKDA 4PJXE 1JUFB 5J9PB 5EC2A 4PJGA 1C12B 4HKZB 1EHLL 5HDBF 5F1OB 1D7FA 1IAMA 1ZLWH 3W0WE 3I9GL 4XP1L 2FWOA 3NCJH 3L3HA 1T3FA 2WK2A 5EBMB 1WC7A 4ORGA 2HT2D 1UJ3C 4U2YA 3CMOL 4KJYB 2RIKA 4A6YA 1PX4A 4PGZA 1NSNL 1CXHA 2NXZC 2YUXA 3MRLA 1FORL 5H94B 1NGZA 3KHQA 2W65B 1UQSA 3V6FA 3IAPA 3GRWA 3ULSA 1URLA 4ZPVB 1BIIB 1JIBA 4JPIB 1FG2A 4O51A 4NQCA 3ARDC 5JHLH 4UIMA 4NKMA 1IC1A 2D2OA 1A7OL 1KV3A 3ILPB 3TIEB 4DUXA 2ENSA 1A14H 2BNRE 1IC5L 4OLUH 1FNSH 2EXYD 4PJAF 1EEYB 5FGBA 3RGHA 4X98A 2IWGA 4PJ7F 1TCMA 4EN3B 4U6XB 4K9EH 2B7DT 3N9GL 1E28A 5DLMH 2Q20A 4XNUL 5D5MF 5EU3A 4PGCA 1LVEA 4X7CC 1S3KL 5JIIA 3ULVE 2ZKHL 5FA3B 1QYGL 2O26U 3I3BA 1G7PA 2FWOB 2VRAA 4XCEB 3REWB 1T3FB 3P30L 1I1FB 1WC7B 2G60L 5CEZH 4X7EC 2BMKB 1LO3H 4Z6AT 5JW5A 3UYRH 3Q0HA 1MWAH 5GRVL 4A6YB 4RBPK 4S11A 1MAMH 2B5IC 2H32B 3KPTA 4LCCA 3O3DB 4PJ9C 5AAMA 3WFBL 1NGZB 5I76A 4PJEF 5BW7A 5F71A 3V6FB 4BZYA 5JNYB 4J4PD 4WJ5B 3STBA 3ULSB 5BXFA 4WEBH 1VADA 1A7PL 2B0SH 2NTFB 4HIJA 1D5ZA 2V17H 4JAMA 1FG2B 1TTFA 1QFWM 3C2AL 4NQCB 1KN4L 1G9ML 3FL7A 4C54A 3QHZH 2EO1A 4MDJB 3HE7A 1T1XA 4OCXH 1YQVH 4K8RC 5D1XD 1JCKA 2YMXH 4Z7WA 4PRNA 3VFGL 2I60L 4Y19B 2DTSA 5CJQL 4X5XA 1WBXB 3FFCE 4I3RL 5GGVL 2VJXA 3U9PH 2XXMB 2KBGA 5HSFA 2JB5H 4LLUA 4N0YL 3PWNA 4PGCB 4GW4A 3E6HA 4FQHA 4EI6A 4MNHA 4AY0A 1DEEA 3QUYD 4LP5A 1B4RA 3P4MA 4K94L 4FFZL 1ES0B 4Z8FH 5T3ZE 7FABH 5J4MA 4HGWB 1DLHA 3GB7A 5C0JA 2DTMH 3D3VB 1BLNA 2VDQH 1CLZH 2V9TA 5AYQA 3VFSB 3LKNB 3A6BL 1EERB 1AP2B 1RZFL 5JW5B 2W0PA 1CQKA 4LGPB 4WHDA 3QT2A 4KDWA 3WIHH 4PJBA 2WNGA 1G1CA 4HDIA 3VXUB 3ES6B 4LCCB 2X4SB 1NUGA 3DVFA 5I8KL 5FYJD 3E8UH 5BXFB 1XCQA 3VFVA 1VADB 1UENA 2QBWA 1S7QA 5KS9A 5JOFA 3EZ8A 5IBTH 4HIJB 4NSKA 3M1BA 3BHBA 1T7ZA 3U79A 1O7SA 5AYUL 4N0CC 1TVHA 4P2OD 5K33A 4PUBL 1KIQB 4MXQC 3HE7B 5CCKH 1A3QA 1HZHL 1S7RB 1VEOA 4JPVL 5TDOB 4BKLA 4DQOH 2CR3A 4PRNB 4X5XB 1RIVL 4NNYB 4PRIE 3WXWL 4RGND 2EDXA 1JWUA 4AJ0A 4PJ5E 4F80A 4JG0L 4LLUB 1OAUH 1N7MH 2V9RA 4EI6B 1KXVC 4UDTA 4WHTA 4OM1H 4NQDB 3S88H 1KNOA 1T5XA 5I8EA 4G6AD 1DLHB 3EJZC 3GB7B 1CT8A 1XGYL 2IH3A 2Q76A 4IRJB 5C07B 3BKMH 4P3DB 3HTLX 5MEQA 4PJBB 3RHWK 4LFHD 4HDIB 2FECI 1WBYB 4NIKB 4U1LB 3KS0H 3FZUC 3CH1B 1QBLL 4MB3A 1FHGA 3RWGB 3LD8B 3IU3A 1LE9B 3HC3H 1KENH 1TZIA 4LHJB 1RJYA 2APXA 5JTWA 3ARED 4UU9B 1HKLH 6FABH 1FPTL 5IFAH 1I1AD 3BQUC 2CDGB 3S97C 4O02H 1TVBA 2NTSP 5ID0B 1P53A 5M95B 3QXVA 3DX9A 3F7QA 3T0EA 5A2JH 4E41B 3BE1L 4P0DA 2J4WL 2XV6B 3VFNA 1F6FB 1A9BA 3B9DA 1D6EA 2VC2H 2QADC 4MJIB 2OXHA 1B3JA 2PR4H 3QDGD 4WWID 4PJIE 1N6QH 2DQHL 3G9AB 1RZ8A 2DL9A 4DVBA 3ARPA 5B8CA 2XRAL 1XZ0B 4U3HA 1VHPA 1II4E 3MOAH 1HSAB 1KNOB 1UWEH 4NKIH 5HYSA 1T5XB 3DUUB 3U7WL 5IGXL 4XX1G 1G1YA 2VDRL 2EDJA 3INUL 3NOIA 4EZMA 1NANI 4OFPA 3RA7L 4X6CF 1KN2H 1OP3H 4H0IA 1ACYL 2QQNL 1XF1A 3O3AA 5AWNL 4CDGC 4GRMA 4RDQG 3CXHJ 1MIEL 4GQPH 5E00A 1JF1A 1NJ9A 4H88H 3LS4L 3OXSB 4I0CC 5C0CD 3MV8E 2X89D 3MMEB 4OZ4A 3RGVA 1ODAA 2DF3A 2YKLH 3HAEA 4JFZL 1TVBB 4G9DB 1CLYH 4NZDA 5HYJA 3HZVB 4X4ME 4MNQE 4JGMA 3NZ8B 4D0BB 4JVUA 1NCWH 4I2XE 4K8RH 3TEUA 3IB4A 3WHE0 4NFCA 2EDKA 4HUUB 1GGIL 5HTSA 3BJLA 4M6MH 3WFDL 1A9BB 3ZYIA 2GCYB 4KJWC 1H5BB 3GSUB 2DQEH 4JZJA 4BSWB 1OAQH 2VLLA 3IRZA 3L1OL 4KU1A 3BP5A 4H5SA 1RZ8B 1T2XA 1MRCH 2LTQC 3RDTA 5DJXB 3ULVC 4LKCA 4X80L 4XPAL 4NNXA 1E6JL 1V5JA 3QDAA 4YHYC 2R0LH 4YQXH 2H9GB 5I1IH 3GSXA 2DM7A 1J12A 1RJCA 2X70B 5ALCL 4Q9QL 2P44B 2OP4H 5EORL 5C08A 1IMHC 4QNPE 4H20H 2CR6A 4F9LA 3X3GH 4HS6A 2GK0A 4C83B 2HRPL 3QO0A 1F90L 1KIUA 4OZ4B 5DUPH 1MHHA 4WUUD 1DBJL 1SBSH 1ULVA 1R3KA 4HKXA 3QNZB 2J8UA 2EDRA 4UQ3A 3RHWF 3EDEA 1SM3L 2E7BA 1F4WL 2NX5A 3MJ8B 4NUJB 4JDZA 4G43A 1Z3GL 1WK0A 4P9MH 5B4MD 5HVHB 1YA5A 5B38A 1INDH 1WCBA 4JZJB 2W9EL 2XZQL 4PJ8A 1ZWIB 3VXME 3BP5B 4Z0XB 1DVFB 5F9AC 1AQKL 2V5MA 3GIZL 2ESVA 3FT2A 1IAIL 2Z9TA 4M1GH 3CVHL 1K8DA 4AIXA 3MRQB 3HPJB 3O0RH 1T5WA 4P3WA 3GSXB 3PDGA 3KPSB 1IM9A 4S0TD 5ESAA 3RL2B 1RUMH 3QEQA 3UJTL 3HN3A 4BH8B 2FCBA 4O2CB 1MUJA 5HDOA 1OT1A 4KJQD 1PSKL 1CDYA 5HHVH 1J8HE 2I24N 2CK0L 1I8LA 3U1SH 2HRLA 4HS6B 4JO2L 3BD4A 3QZWA 4M7LT 2PO6B 4NQEE 4BQ6A 1RURL 1D5MA 2YPKA 3NCYP 5CLWA 3BW9A 4BQBA 4MNGA 4F7CB 1EH9A 2J8UB 3O3BA 4UQ3B 1EHXA 5KJRL 2EDDA 1N8ZA 4LPTA 4ZAKB 3AUVA 4ALAL 5C0IB 2HN7A 3RVVD 5IW1A 3B5HA 3ARXA 2FB4H 2NYYC 1CGSH 1PDKA 1WCBB 3F5WB 3BP4A 3W5NA 1J1OL 3LKPA 3T0ED 1M6OA 1MFAH 3SGJA 3VH8G 3VGAC 4NKQB 3LY6A 1AGDA 1GPOH 1FP5A 2ITDA 4C58B 2ESVB 4NWUL 3L3KA 1F3DJ 3PGFH 4HK0A 4G6KH 1K8DB 5I9QB 4LPYA 4JREB 2WUBL 1TJHL 4GBXA 4YDJA 3MLTB 5SWSE 4M48H 5KTEH 2EDEA 4HAFA 3IDGA 4JGUA 4RMRA 1BOGA 4M6NH 3QEQB 2R2BB 3KJ6H 3GJFA 2O61A 1MUJB 4CN1A 3BZEA 2OL3B 3SBWA 1P9MC 4OCMC 4KV5E 3MCLH 1IVLA 5DQDL 3QEUA 1NCCL 1IZJA 1Q9LA 5IT2H 3JZ7A 4NO0A 1TPXB 4KK6D 2W1NA 4N0UA 1BZ9A 1D5MB 2GJZB 1ZTXL 4X6EB 1ZA6B 4C4KO 3CUPA 3BPNC 1F42A 3A6OA 5DJ2A 4YHIA 4OCSL 1N8ZB 4LEXL 1ZHKB 4JQXA 3HZKA 4MXWL 4NN6C 2QQKL 2Z4QA 3QCVH 4TNVF 3RGVD 4OD1L 4OI9A 2HN7B 1T6WA 4PJGF 5F3BB 2FIKA 5HYJD 1WBZB 3IDYC 3UYOD 3GZKA 3BEVA 4DFIA 2EDHA 3GBML 4F2MA 5J3HC 1WTLA 5CS7A 1AGDB 2LQRA 5IG7A 5D1QD 3HZMA 2NY7L 1Q94B 2RCSH 3KXFB 4GMSL 5DHXB 3SDDB 5FA4A 2W9DL 3HZYB 3WFCH 3ULVH 2DQCL 1U3JA 3S36L 3GM0A 4Y5XA 4F7TA 3PF2A 4DK6A 4P57B 3ULUE 3CMGA 3RDTD 4BA8A 1HHKB 4QHNA 2CDEA 1KBGL 1BFVL 1IEAB 1A3RH 2GAZA 2RJMA 2E6PA 4YDVA 1JTOA 1KT2A 3QEUB 1Q9LB 3W11C 4NO0B 4ZTPH 4AYFA 1F8TL 2IFFL 5IB5B 5H2BA 4WWKA 4TUJA 3CLEH 4N0UB 4YFDB 5EFIB 4GJTB 5GRJL 3PNWA 5K9JH 1C5CL 5C08D 4ODSL 5EU6B 4TYUA 5DJ2B 2XZAH 4OT1H 3ZE2E 2VR9A 1H3WM 1RFDL 4OGXL 2YWZA 4BFBD 5JW4M 4F3FA 4E42A 2Z4QB 5BMFL 3WL9B 3V95A 1QR4A 5IV2A 3DVGB 1K2DB 5BO1L 1X5KA 1A02N 5HHME 1VGEH 2DJ4A 1S7SB 2OTWA 5ICXA 4QXUH 4HF5H 4OLWH 5D2LB 2HMIC 3S98A 4G42A 1MEXL 2HJKB 2NX5D 3HZMB 4FNLL 1BQHB 5TQ2H 3LQZA 5FA4B 4C4KT 3WS6A 5ACZB 2OBGA 3KPRE 4PJ8D 1NGQH 3O9WB 1XF4B 1YPZA 2EKSB 4F7TB 2B2XH 3DVNA 4JFDE 4LSTH 1EEUA 2A1WH 1VPOL 4HIIB 2CDEB 2IG2H 2C1PB 1NFKA 3G5YA 2Z8RA 5D7SH 4H26B 2CJUL 1B0WA 1NKOA 2ADFL 5C0RL 1Z9LA 3AROA 3DETC 4YDVB 3CVHB 5DVKA 1KT2B 3RUGA 3S3SA 1U8PA 4UINH 1IM9D 3NPSB 3TZVD 3BO8A 4WWKB 3FQTB 3QA3B 4F37K 2CD0A 3DURB 3LRGA 1N59B 4FQQA 4Z7WF 3GHEL 3GBLA 4ZS7L 2Z8VC 2MSPA 1XIWB 4B0MM 5C86A 2E3VA 3B5GA 1YEHL 4E42B 5FO7A 5E2TL 1V7NL 3DARA 4C55A 4XXDA 4LLYB 3RWCB 2OTWB 3FT3A 5ICXB 2YS4A 1CCZA 1F11B 5D93B 3JV5A 4G42B 5FCUL 3I3EA 3BSZH 2FD6H 3RVWD 5E2VL 5EUOE 5FYJU 5IMKA 4PP1C 1GGCH 1NGXB 3MV7D 1YPZB 2CRMA 2BVPA 3QNXA 2C1OA 3MV9A 1MPAL 3EKCA 3PP4L 4FQ2H 2NY4C 5C9JB 1XGTA 4PLJD 5INDB 3G5YB 4ZTOH 3H9ZA 2CUHA 4G7YH 3MODH 4HH9A 1YUHA 2VDPL 1X5GA 4GBXD 5F96L 1X5AA 2WZPD 3O6KL 1BD2D 1I1YB 3PIQB 1U8PB 2F9BT 1CK0L 2P5EB 3KPMA 2ILLA 5T33H 1ADQL 1W0VB 5K9QG 2PTVA 5IWLA 2Y07H 3RIFF 3L5XH 1WWCA 4FQQB 4UT9L 1HDMA 4PRHE 2ZUUA 5DRXB 5KANG 4GKNB 3OKNB 2WWMD 1N0LA 1TJGH 4S1QL 5C0BD 2GUOA 4POYA 3GKWH 1OSZB 1F4XL 3VW3L 5DYOA 1UYWL 2EE3A 1R3IH 2A0LD 3AMKA 5E6IA 1INEL 1TETH 1FVEA 4XRCB 4N0RA 3U46A 4YDLC 2YBRA 4FMKA 2P8PA 4YHOL 4R2GC 3GUTA 4YWGL 1FZJB 3ETBF 2I07A 1CL7L 4POZD 5E1HB 3P4OB 3GKZA 4PRDB 2C1OB 2NMSA 1IEBB 4LHUG 3W39B 2DJUA 1LEIA 5DHVA 3L3JA 1GGBH 2GQHA 3DMMB 2HT4D 3D25A 2F5AL 3LVEA 3H9HB 3PL6B 4IMLA 3UBXB 2Y4SA 5TFSL 1YUHB 3DI3B 3ZDXF 1NANH 4WHCA 3HI5L 3KPMB 1FYTE 2FEEL 1EFXB 1QFHA 4ZG1A 1AFVL 4U6VH 4I1NB 3VJ6A 2EICA 4N5UA 3FO2A 1HDMB 3QWQB 2ERJB 2D7QA 3T4AB 3TESA 1X5LA 4ISVA 2NY6B 3L7FA 1JGDA 2YD8A 1JNNH 1RVFL 2JJVA 1VGKA 3WMSA 3KPNB 1JPTH 4TVSa 4N8VB 4NN7C 5DYOB 4LSUL 3RTQC 2MHAA 5E6IB 3QPQD 5GS1B 1EX0A 5MHSE 4LK4A 1JL8A 2AJXH 3C60A 3EHBC 3C6LC 4F37F 3U46B 2XXCB 3EZJB 2I07B 5DFTA 4XI5C 2OR9H 4KTEL 4JJ5B 3LKSA 4QRRB 4L4TB 2VXQL 3P9LB 1T0MA 4KMLB 2J8OA 1NAML 4UZGA 3QIWC 3ULUC 2J2ZA 4XMLH 3L3JB 4MCZA 3SOBH 4MA8H 1TVDA 2UWEA 2IGFL 3GO1L 3MLUH 5HPOA 1C16A 2EYSB 2Z93A 5EIVA 1PG7L 2YZ8A 4LDEB 3C5SA 3NGBC 1KTLB 3EUUA 4JFPA 2W91A 3VJ6B 5DMKA 1VFBA