1UC6A

Solution structure of the carboxyl terminal domain of the ciliary neurotrophic factor receptor
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
109
structure length
109
Chain Sequence
GPLGSVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSNGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHATPWTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ciliary Neurotrophic Factor Receptor alpha
publication title Solution structure of the C-terminal domain of the ciliary neurotrophic factor (CNTF) receptor and ligand free associations among components of the CNTF receptor complex
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2003-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uc6A00
2VDNH 1YEDB 2AJSH 3BX7C 3G6DL 4KU1A 2CXGA 2UZXB 5IV2B 3RTQA 1M05A 4DGVH 3ULVL 2HJFB 4BQCA 5CZXC 2P8PA 3MRLB 5E2TL 4PJBB 5HGBB 4YDLC 4YUEL 3MXWL 5KVMC 4MYWB 3O4OB 3TPUA 2ZNXA 4G42A 5EIVA 5JR1L 1DQQB 2F8OA 2HLAB 4PPTA 1Q38A 4NGHL 1WICA 3TNMB 2DRUA 5DF0A 4YBQC 3S4SG 1I7TA 1LO4L 3EKCA 1QFWM 3KPOA 5J6GA 1BBDL 4U1JA 5FB8A 3O3DA 2AJZA 3MV8A 4MNQE 5MEPB 3LQAC 5ESVB 4U6VL 2PYEE 1R3IL 5HYFA 4CRPA 5E6YA 4X5WB 5JXEC 4JM2A 1ED3B 4ETQB 4FTVD 1EO5A 4GKSB 3TVMB 1KGCE 3PL6C 1BEYL 4NKDA 4A6YB 2VDQH 5IJVB 1T4KB 1DBJL 3UPCA 4DN4L 1R5WA 1YMHA 2NR6C 4L3EB 1HHKA 1NCDL 5DEFB 2W60B 1E4XL 2HP4A 3RWHA 1AGDB 3EFDH 5DD1H 3TBVB 3L5XL 3C08L 1F4XH 2PXYC 3BKJL 3G5ZB 3GSQB 3OMZA 3N9GL 4WO4D 3N1QC 3ZL4L 2P5WA 4U6HB 4IRJC 4NYLB 2IPUG 2UV3A 5I1KL 1HYSC 2XWTA 1FL6B 4MB5A 4LLMA 1K2DA 4JFXB 4YR6A 5JZ7C 4KPHH 3UTSA 1A6ZA 5DTFA 1AGFB 4DAGL 5LXGL 1HH6A 1T89C 1UCBL 2WM0A 1CDYA 4ISVB 2VITB 2QADC 2N7BA 4LNRB 1RIUH 4M1GH 5F71A 2R0WL 3U1SH 1DL7L 5DMKB 3CFDA 3BESR 4JPWL 4YE4H 2AAVA 3MR9A 5D7JD 2Q7YB 3LHPL 1NAMH 1PD6A 1NBVL 4KQ4L 4Z77A 1G6RA 5D1ZD 3OKDA 2R2EA 4K9EL 5DUBB 5IB3B 4KY1L 4AY0A 4ODUA 2WWMD 4S1DC 1H3GA 4MDJA 3BIAX 2XOTA 5FM8A 1HSBB 3BQUA 1F4YH 1I1RA 4NUGL 2AEPH 1QNZH 3SCMC 4YEFA 3LDBB 4IS6B 4RZCA 3RZWA 5DD0H 4PJAF 1AD0B 3E3QE 5BRZE 1XGRA 1T7YA 3QJHB 2JJWA 4PJ8C 2I60H 2ZUQC 4G6AC 5DJXB 3VXOB 5DD3H 5HHVH 2ZCHH 4M02A 5H2BB 3PABA 1NBZB 3B9KD 4F7PB 3O11A 4YNYB 2EIEA 4G7YL 4Y5VB 3D18A 5AZEH 5EZJB 4ERSH 1YNLL 2W9DL 3FFDB 2HT4D 3EJZD 5ICYB 5JMOC 1A3RL 4HUVB 1HIMH 1T22B 3O6KH 1G0DA 3OHXA 4M7JH 5J1TC 3NACL 2YD3A 4ELME 4KDTA 4FMKA 1JN6A 1B88A 5D8JH 2DDQH 5I75B 3V0VB 2OMBA 2GJ6B 3GMMA 3IFLL 2CO7B 2CLZA 3U4BH 4E41E 1JFQH 2A73A 3KWWA 4H25B 4FQJH 4M1DH 3NZ8B 3KR3L 1UWGH 1YDPB 3KYKH 4KTEH 1TZGL 4X6FB 1OAUH 1VKXB 3TBWB 3HPJB 4GH7B 5C0JA 3B5HA 3T4AB 2NTFA 3MCLL 2R1YB 3BZFB 4CL7A 2QSVA 1JF1A 1G7HA 1MCJA 4KRLB 3GMLB 2ADIB 1JGUH 4LU5L 1Q9WB 5HPMB 3BSZL 3QP3A 2R9HC 2ADGB 4HK3J 3IFNH 2AERT 3ABZA 4X4MA 4XPGH 1WISA 2FO1A 2EDBA 1KJVA 4OZGF 3QDME 1KPUB 4F9LC 4X6CB 4QKXB 1DEEB 1EO8L 4Q9RH 4X8XA 3NA9H 1KT2A 3SN6N 3H3KA 1KLGA 3TH3T 5EN2A 1P4BL 1AQKL 3AREA 5DS8A 1T3FA 3G5YB 1D6EB 5D1QA 2WAHA 3KJ6L 1U58A 5BS0E 5F8QC 3L6FB 1L0YA 3GO1H 5ECJE 4YC2B 1GSMA 3FN0L 3GMPA 3LS5H 4DUWA 3KPLA 4RX4A 4FQPA 1LP9A 5MI0C 4C56A 4JHZA 3OKLA 3CVIH 1NLDH 4YQXH 4AK1A 2AEQL 3H3BC 3PGCA 3QUYC 5MEOB 3F58H 3C9NB 1LO0H 3QIBD 2LAAA 1DZBA 3GIVA 3QG6A 3LKRA 1MJ7L 1N5AB 1P2CA 2ED9A 2GW5A 4FXGA 3SGDI 2NPLX 1P7KB 2R56H 1GHFH 3HI5H 5C0RL 5IMMB 4XNUL 4AH2A 5J4MA 4HMCA 5LVEA 3I02B 3OR6A 5EU3B 3WS6C 4BSWA 1J0JA 3FT3A 5IB5B 3SGJC 5IKCA 2AJUH 2BY2A 4FG6C 4JDVB 3MJ9H 2G2RB 3L3IA 4RSVA 5DK0A 4YDKH 3IDJB 1ZXQA 2GSGB 1MJUH 5CD5D 5F21B 1NDMA 2FSEA 4XWOD 5IW6B 1SBBA 4ALAH 4MA7L 4S1RH 3M17B 3CUPB 3VMPA 1P9MA 2VISB 3PV6A 5L0QC 4W70A 5D71L 5F96L 4GBXB 4YIQA 4Z0BH 3ARFD 5F70A 5C2BH 4L8DB 4HIJB 3RNQA 3QEQD 4UOW0 3DARA 1CXLA 4XAKD 3DX7B 1HXMA 3RAJL 4EI5B 4C58B 3LN9A 2HRLA 4GRLD 4NQDD 1CQYA 3H2WA 5KJRL 3V0WL 3O8XC 3ARBC 4Q97A 1VFBB 4XVJL 4L3EE 4U3XA 4RDQF 5GRZA 7FABH 2F19L 5F9JA 5GJSH 1KFAL 3GUTB 1KN2L 1XAUA 1BREA 3L7FB 2KDGA 1KXQE 8FABA 3MRKA 4Q58C 2EDJA 4LVNB 4MQ7B 2DMKA 4Z7VB 3FO1A 1JZ6A 3QEGL 3K2UL 5DURD 2A38A 5SX5K 4HLZH 3A0OA 1QLFB 1Z9LA 3MFFA 3PWPD 2J6EA 1I8MA 3CDGA 4WWKD 5DJ8A 1A4JB 4P5TD 3P77B 5I8OL 1R6VA 3H9SE 4AEIL 4PJ9C 3RY6A 5T1KB 1E4XI 3QPQC 1I8IA 3JSSA 4YO0B 2UZIL 5FXCH 1YQVL 1BD2D 2ZZUT 3BP5A 1RFDL 4H8WL 5FYLE 2CKBH 3HCVA 3L95B 4EBQL 2VDRH 3WSQL 5EZIH 3OXRA 1H0DA 5E8OB 3TP4A 2CD0A 3BI9X 1MEXL 3FT4B 4KJYA 4XMLH 3KS0H 4MQTB 1XR8A 5EOCL 4HCRL 1NGZA 4NO5A 4NZRL 1TJGH 1A3QA 2YRLA 5EOQH 5KVEH 4B53A 1NCCL 4LAQL 5DJAB 4DTGH 3ESVF 3PP3K 4HZAA 1PX4A 4X80L 3R06A 4LSSH 5FO9B 4JM2F 1KXTB 4KKAD 3TO4C 2QL1A 3MLVL 5BOPA 3HLAB 4IOFD 5C0CB 2AQ3A 3N50A 3V6FA 3RWJA 3UBXA 2FJGB 4E9LA 2XNAA 1XZ0B 3O3BB 1S7XB 4TUJA 1CD8A 4OI8A 2NTSP 1OTSC 5KN5A 4Y2DA 4OAWB 1JPTL 2P24A 5TE7L 4I18A 4OCNC 5MENB 2F54B 1MREH 2DJ4A 5B8CB 3EO1B 4NZJA 4TVSa 3AROA 1FFOA 2GJ6E 2NY2C 1AO7A 5I1AB 3C2SA 1AGBB 1YEGL 2DQGH 3H3PL 4HPYL 4OLYH 2F8VA 4J8RB 1I4FA 2FJHB 5CUSH 1OTTD 5FHAH 2OJEA 3ECBA 3WUZA 3TBSB 3D9AH 3EIFA 3AS2A 1OOAA 1N0LA 3GM0A 3DVNA 1EDQA 5GGRB 5HJ3A 1ZTXL 3MYJA 1T0NB 4RA0C 3R8QA 2CDFB 1NGPH 4PRID 2C3VB 4MA8L 3WN5C 5C6PB 1NCTA 3KYNB 1ERNA 1LK2A 3ZE0E 2R4RL 1U9KA 2W0FB 4OFVA 2G9HB 1IQDB 4M6OL 5AG8A 3L5WB 3VFSA 4GG6B 3C5JB 3ZT7A 1OHQA 3TN0C 4GJTB 4MMXC 5MERA 1TQCC 5ITFB 2WZPD 4ZO9A 3WLBA 4NZUL 3BEVA 4KJWC 4NKIL 4RMQA 1G9MH 3V4VL 5FKPB 1DR9A 2ICES 1S7WB 1J10A 1NEZB 1Y18B 3MJ7A 4XP6L 4ZO7A 3GHEH 4O2FA 1TTGA 5GGRY 3WKML 3ZDZF 5ILTH 2E8YA 1MSPA 1YNTA 5GS0L 5DC0A 3HNVL 4YPGB 4F9PC 4EVNA 3B2UD 2WSKA 1UH4A 3V5DA 1L9MA 3QEHB 1PYWB 3CC5A 2YS4A 5E8EB 3S34H 1C16B 3PQYB 4JFYA 2AEWA 1U95A 4LVHB 5IMKA 1CLCA 1KF9B 1CK0H 3WE6A 3NN8A 4XCCL 3D69B 1F02I 1J1XL 1JGVH 1KCVH 3GSNB 3OG4B 1DN0A 3PJSA 2C5DC 1YC8A 4M9PA 4OUUB 5T1DH 4WV1C 4L3CA 3E6HB 1Q94B 4NC1C 5TQ0H 4Z78B 1K4DA 4I0PD 4GKNB 12E8L 4S10A 3FHQA 43CAB 5LQBH 2VLKB 4O51A 4Y4KA 3FQUA 4DK6A 1S7VB 3RUGF 1BOGB 5F7LB 3I75A 1MCDA 3OB0K 4I3RL 1OAQH 4JE4B 2PTTB 3KHOA 3NTCH 4YHPA 2DS4A 5TFSL 4G43A 5H35A 1NC4A 3T1FB 1NAMB 3O6FB 2NY0C 2QSQA 2FGZA 4PLNC 1KEGH 5EUKA 1QRNA 2ZCKH 3RX5A 1CLZH 4RNRB 3UXFA 2CLVB 1T83C 4D9QD 5IT2H 5C07B 3AUVA 1OCWL 3BW9A 3CFBA 2OX5A 4C4KO 2ZUSA 4MXVE 1J0KA 4P3DA 5EBLA 1UZ6E 5EIIA 1GGCL 4GS7C 3DTXB 1ZLSL 3ME0A 3DMMA 5F7UA 4PGZA 2NMSA 2ATKA 4QGYA 4PRHB 1T6VN 2LQRA 2AK1L 1ZVYA 1OAYL 4UT9L 2FJFA 2OBGA 1C8PA 2CIKA 5C08D 1D5IH 1JHTB 4YWGL 5FYLL 4LLWA 4R3SA 3RBGA 1I7UA 1LP9F 3ULVD 1KTDB 1PGRB 4Z7VE 1NKOA 3O9WC 5GGQH 5HYIA 5JOPE 1J05B 2C1OA 2CK2A 1E28B 2P8MB 1Y0LB 2VXUH 1N3NB 3NPZB 4XP4H 2F15A 2GSIB 1KBGH 2H3NA 2X4UA 3CSBA 2DBLL 3HZKB 2OM5A 4HF5H 4HFWA 3DXAB 4G9DB 1KJMA 3CX5J 3ZKQD 1FN4A 4KAQL 2N4IA 2WBJB 1OTUC 1FO0B 1M7IA 4MCYA 1IBGL 1PG7X 1Z0MA 2DQIH 3WUWA 4FQCL 4HWEH 2G5BB 2HFGL 4OD3H 4BFEA 1FG9C 4HFUL 1NGQH 1G7QB 4MHHI 5KS9B 3P0YH 5DR5H 3DETD 5FHBH 4X6EB 4OF6A 4LPWA 4JO1H 2IGFL 5I0ZA 1ZA6B 3HTLX 2DN7A 4QNPF 1HZHL 4XMKL 1SM3L 4JREC 4K3DH 1MIMH 5LKNA 1N59B 1ODAA 4RQQB 4M6NL 4KVNH 4PREB 3PDDA 2JK5A 5FYKH 4JY6A 3E8UL 5DRWA 1GZQB 4XNZC 2XPGA 1R3JB 4PTTB 3RL2A 1N5YL 5IG7B 1JV5A 2R0KL 2VXTH 3IKCA 3ZSTA 3V5HB 3UTZB 2DBJA 1V05A 4QXUL 4PJDF 1PW3A 3P9LA 5MENE 1LMKA 1S7RB 3BMWA 2CKNA 5J11C 4LSVH 5I8KL 5GS1B 4YHIA 4N9GA 3MBED 5KSVA 5FYJU 3W0WE 4OM0L 5C0IB 1Z9OA 2Z31D 5L6YH 2VDPH 4U1MB 5HBBA 2YD6A 3HC4L 3KPRD 4NFBA 3TT3H 3C60C 5DMIH 3GK8H 3VG0H 4XI5D 5JDSA 4MJIA 5JO5A 3PDOA 4JPVL 4ORGA 4LCWD 1MRDL 4XCFL 1HI6A 1PG7L 5EO9A 2QSCL 3G6AB 3SDDD 1ZHLB 4KMLB 2EDFA 2ED8A 4HKJA 5EBMA 3U9UB 5IFAL 1LQSR 2FHBA 2DM2A 4F7CB 1WVZA 1ETZB 3IFPB 2XKNA 2IH3B 4CNIB 2FGWH 2Z35B 2D03H 3OF6D 1G9MC 3HS0A 4NQTA 5D7SH 3VWJC 4WNQB 4DKDC 3U4EA 5E56A 1OPGL 1N8ZA 2W65B 1CIDA 4GG6E 2GITB 4N5ED 4OZFG 5T3XH 4F8QA 3JTSA 4QXGH 1W72A 4RMSA 2FNBA 3NBNA 4LEOA 2BCKA 2ZOLB 1WEJH 4K7PH 1QPPA 1NMAL 5A3ID 4K2UL 3ARGC 3WFBH 2AI0L 4XHQA 5IQ7L 1GH7A 4MVBC 1U92A 5E03A 3VRJA 1FFRA 1MCWM 3QXVA 1Y6KR 3S35X 3RGVD 3C5SB 4KZEH 4U0RB 5BJTB 2VZSA 4K8RH 3SBWA 3B3IA 5C0BD 1FNAA 4IM8A 1R3HA 3BUTA 4PV9B 1FFNA 4M61B 5JORA 1R5IA 3BDYL 5ISZB 4R4FL 4PJAB 1T7XA 5CCKL 1AJ7H 5DGQA 1T1YA 4XBGB 3V6BR 3WFEL 2ZSVA 4LHUB 1M1SA 4NO3A 5B39A 1MPAH 5A2FA 4LRIA 5DT1L 1TPXB 1DLFL 4GW1A 4Q2ZA 1UA6L 5CIPH 5ALBL 2IMMA 1XT5A 1NMBH 4M3KB 4O4YL 2PR4L 3BT2H 4HPOL 4QRPA 2CKBB 3SJVE 4Z76A 4P46D 4M48H 4JVPA 3HMXH 3NFNB 3RA7H 4NJ9L 4EN3A 1DFBH 5IROC 3BGMB 2EECA 1T1WA 1RZGB 4Y8AA 1A7QH 1A8JH 4HUMB 1MFNA 3MV9B 2WUBH 1U36A 1MQ8A 3BH8B 4E5XA 4L5FH 5FDYA 3BP4A 2JJTA 3LKOB 4MJ5A 5IF0A 1CGSH 4MB3A 1U8MB 5IW3A 1ZOXA 3C5ZB 5ICZB 5IBUG 1WF5A 5L8LB 5FUZH 3S35L 5D7LA 4GLRH 4MNQD 5DQJA 3VXRB 4KI1A 3WXVL 2PYED 4R97B 3CNKA 4I2XB 4OT1H 4ODBD 4J3SA 4G80A 3U30C 3TIDA 5EG6C 2OTUA 1P4IH 3LRSA 3VD3A 1B2WH 2HYMA 1KGCD 4NPYA 4YAQA 3QH3A 5CHNB 5C0GB 4R4ND 4OIIH 2N56A 2E7LC 2EDHA 3N85L 2GY7B 4MNGB 3QUKA 3DURB 5H94B 5C7XL 2DICA 3DXAE 5HDBF 2J4WL 5J3HD 2GY5A 2X40A 2HVKB 5IMOA 5EBWB 1I85A 4OZGB 1KNOA 2DIAA 3SE3C 5K9OB 3KYOB 1AQDA 3TYGH 1TVBA 1BJMA 4X6BA 2VLME 5SX4I 4I4WA 1SEBB 5GGTL 3UCRA 5FECA 1KYOJ 2XA8H 1EIBA 5C0NC 3S4SA 2H6PA 3VGAC 3F7YB 3EYSH 4YHYC 3FJTA 4W4OA 5CJQL 1IKNA 2HTKC 4IMKA 1HYRC 1B90A 2J2ZA 5C09E 4CBPA 3OR7B 4GKZA 3LRGA 4JHWH 5J9PB 3MNWA 1F4WL 4Y16B 5L2JA 2XN9D 4MDIA 4P2RB 4XH2B 1A02N 1FDLH 2BY3A 4K23H 4ZPTB 1FP5A 3HG1A 4NKOA 5IHZA 3A67H 5I18H 1BX2B 2A0LC 4NSKA 4LQ1A 4U1SB 1NH6A 2OTWA 1V7NH 5F9OH 5D5MF 4Z7NF 5C71A 3O4LD 3MXVH 5EO0B 5BRZD 1U8HB 1CE1H 4JG0L 1HQRB 3WEXB 1FE8H 3EDJA 2B0SH 1H15B 3OJDA 3EYOB 3BJ91 1GZPB 2WINB 4ODWA 1QSZA 2FX7L 1FNSL 1OD9A 1DUZB 3SKOB 1UWXK 4PRNA 3GSOB 1SJEB 2VAAB 3WFHB 3MRQB 1AFVL 3LQZA 4ZFGL 4NQXA 4KK6C 5I1LA 5DZLA 4XCNA 5CZKA 1YY8A 5F9WC 4OF0A 5EU6B 4PGEB 1JI1A 1CFQA 3O6LH 1QHOA 5ID0A 4IOIA 1FVDA 3NCCB 3V7AG 2DTML 4LLDB 5TDNB 1WWAX 4YHZH 4NQCB 1WCBA 1TJHH 1YEFH 1W2KT 4GRWF 3FQRB 1A7OH 1MCPL 5AEAA 3BGFC 1K6QL 4E41D 2BFVL 2VN4A 3G5XB 4Y1AB 4FXKB 2DQHL 5DUPH 3EYVA 1I9JH 5EFIA 5EH1A 2A77H 2OXGA 2AJYL 3UPRA 3HE6A 4HC1H 4YLQT 2D9CA 4LOUC 5I1IL 4FABH 4K8RC 4EDXA 5DO2C 3RTQB 1M05B 2KBGA 3EOBB 2DL9A 1OGAA 2P8PB 4GQ9H 4NZTH 4YFLI 1U8NA 1MLCA 3TPUB 4G42B 2CSPA 2QQNH 3EOTL 1TCRA 3BE1L 3O81A 4JFZL 3SE8H 3VFGH 3ARDD 3PGFL 3QDMD 1V8HA 3STLA 3DX9A 2EDRA 1I7TB 3KPOB 4HKXA 5J6GB 1NANI 2R2CA 2V17H 1RUML 4U1JB 4OLUH 5FB8B 1J0IA 3O3DB 2AJZB 3MV8B 4HK0A 4OLZL 3MMEA 1D5MA 1YN7A 4QXTA 5ISZE 5FUOH 4LL9A 2DWEB 3EYUH 1Y6NR 4XP5H 1BMGA 1TENA 1N7ML 3DRTA 4JM2B 5E00A 5BO1L 2D7OA 4BA8A 1ADQL 2VLRA 3F65A 5HHPA 4NO2A 3FAXA 4BSJA 1KB9J 3DLQR 3QFJA 4PV8A 4P23A 1R5WB 1YMHB 4J4PD 1HHKB 5KVFH 4G3YH 3B8YA 2UVFA 3RWHB 4K71B 5GS0D 5BV7L 4QOKA 4UIMA 4LEXH 4U3HA 1YMMA 3KPQA 1FNFA 1KJ2L 2A6IA 2YA2A 4M43L 3UX9B 4M5ZL 1J0ZA 1OLLA 4NRXA 4FFWD 3MLTA 3W11C 2BXZA 4U05A 4YR6B 3LEXA 1FORH 1EGJA 2XWJA 3UTSB 1A6ZB 5DTFB 5DZOA 2MPAH 4PJXA 1HH6B 2EZ0C 3QJFA 2A6KB 4L9DA 3T2NL 1AIFA 4OM1H 4HXAL 3CFDB 2EKJA 3TT1H 3MR9B 2NW3A 4L8SC 5L88H 4JVWA 4Z77B 1G6RB 3VXRE 3OKDB 2R2EB 3VGAB 2WW8A 4ODUB 4QRUA 3GRWH 2JCCA 5BMFL 2E8ZA 3NZHL 4MDJB 5INCA 3BQUB 1FZKA 3TVMD 1SBSL 4AIOA 2YPLA 4N0CD 4RZCB 3VXQA 3GHBH 1XGRB 4X5XB 1G7LA 5F7DA 3C87A 4L3ED 2ZKHL 3K74B 5T3ZE 4PP1D 1QUNA 1YY9C 4FZEH 1H3XA 1UM6L 3VD4A 3PABB 4OZGE 2B2XH 1WJ3A 5GGVL 3V8CA 2WLZA 3KPNA 1E4KA 1N6VA 3D18B 1D5BA 1X6LA 4NFCA 4JLRA 3OHXB 3U0WL 4BJLA 1PY9A 2B20A 1LO3L 3K80A 3DUUA 3UZVB 1V7MH 4ODSH 4APQA 1NC2D 4X7SH 5HTSA 5J6HB 1KEMH 2NZ9D 1CLYH 4XVUC 3GMMB 2Z93A 4G7VL 5SWZA 2CLZB 3A6BL 2IJ0C 2A73B 5D2NC 3KWWB 2JTDA 4TN9A 4KZDL 5JW3L 2Z8VC 4ODHH 2XA3A 3S3JA 3CFCL 1RIVL 2H2SD 2VR5A 1ZWIA 2XZQH 4Y4HA 1BVKA 5C0JB 5GHWL 2X4QA 3IS1X 4KJPC 5IHBA 3FO0H 1JF1B 1R24A 4RFEA 4X8JA 1G7HB 5KSAA 3MSPA 4Y2DC 1JHLH 1LGVA 5GRJH 4OLVL 3DI3B 1S78C 2E6PA 3UJJH 1LDSA 2HFFB 1KPVA 1XIWC 4NQUA 4KK8C 5MHSE 1K4CA 1OARH 4NWTH 5EU6E 1CD0A 4U31A 3SKUD 4LLAA 4NQSA 4WGVB 1N4XL 1MCEA 1QR1A 1KJVB 3LS4L 3WXWH 5BZDA 2YD8A 4K94L 4ZTPL 1RULL 3CX5K 1KT2B 1KLGB 5EN2B 3AREB 1N6UA 4NCC2 5DS8B 1T3FB 4ZDHA 5HHOE 4AL8H 2HG5A 3P9WB 4G6FB 2GJ6D 5D1QB 1U58B 4KDVA 4NUJA 3RVWC 2A6DB 2ID5A 3I2CH 4O2EA 1JZ3A 3IJHA 2YWZA 3WLWD 3VRIA 1BZQK 4OCSH 3KPLB 4LGSB 5TQ2L 1LP9B 4R9HA 4C56B 3OKLB 4MAYA 5F9DC 2ZUWA 1J1PL 1FAIL 1PJ9A 3PGCB 4M5YL 3FB5A 1Q1JH 4R7DA 5E8NA 3GIVB 3QG6B 3LKRB 3RWEB 1P2CB 4FXGB 3H8NA 3C6LC 4IMLA 4AH2B 1FBIL 3IDNA 2EDKA 4JKPH 3OR6B 1YQ2A 3TV3H 4BSWB 3LPFA 4YHOH 3FT3B 1FYTA 2WLYA 2ESVA 3K4ZA 3QIUA 4RAUB 5IKCB 5CJOH 1U41A 2AGJL 1X9QA 4IIQA 3TA3C 2CO6B 1QQDA 5DK0B 1DUYA 1Y6MR 4POUB 1G1CA 3P73A 4KXZI 1RUAH 2FSEB 4NM8L 3IDGA 4POYA 1QR4A 2DQUH 6CGTA 3PV6B 3MCKA 3K8LA 4YIQB 4KMTH 5IMLA 3FRUA 4JHAL 3RNQB 4R4BA 3S98A 3DHMA 5B4MC 3QCVL 3FONA 1HXMB 3FQTA 5AZ2L 3GGWA 15C8H 3LMJH 5IVOA 3HAEG 4DUVA 5FGCB 3CMOH 3VGEA 2DQDH 3MLZH 5JXED 1BJ1H 5F9JB 1BBJA 1MCOL 4R8WL 3CVHA 8FABB 2P5WE 3FO1B 1K9TA 4FQHA 4OLWL 3CXDL 1EEUA 1F00I 2BOBA 3MFFB 3I6LE 1I8MB 3OPZH 3CDGB 3UTSE 5I73C 2AP2A 5DJ8B 4HUWB 4OCRH 4F57H 4RFOH 1I8IB 4HV8A 2VSCA 3NCYP 3PXHA 3BP5B 3HCVB 4MB4A 4FP8H 5T3ZL 1EHLL 35C8L 4FFYH 1WZMA 3OXRB 4XC1L 1H0DB 4GBXD 4JN1L 3P30H 1I7RA 3FTGA 2WIIA 4KJYB 4Y4FC 3UDWA 2A83A 1VPOH 1XR8B 1DQLL 4AMKH 4EI5D 3M45A 1NGZB 4NO5B 1XH3A 1HINL 5DD5H 3R06B 1D6VH 3X13A 4L4TA 4PJGA 3VCLA 3V6FB 3RWJB 3EDKA 2P8LA 4F58H 3UBXB 2DQEL 2XNAB 3QXWA 1QLEL 3LAFA 3UPAA 4H88L 1BZ9B 3MV7A 5IFHL 5JOPD 2DQTL 2J12B 9CGTA 4TUJB 3ZDZE 1X5GA 4G6AD 5KN5B 4Y2DB 2PTUA 3VW3H 5DMYA 3BPNB 3HB3D 4I18B 4L4VA 1H5BA 4PLJC 1GOHA 5ERWA 4RA3A 1FFOB 1GIGL 4UOW1 1AR1C 3SGEI 1AO7B 2F9BT 1EA9C 4L4JA 2IH1B 4PJXF 3O2DL 4G8FA 1D5XA 3WJJC 4AQOA 1INDH 4IOSD 2Z8SA 3JV4A 1I4FB 1J8KA 1OLZA 2OJEB 3ECBB 3K1DA 2OL3H 4UV4L 4FA8A 3THML 4LPCA 4UTAL 1JRHL 1CLOL 1MFAL 1S3KL 2JCCF 1KCUL 3BHBA 3DVNB 5HJ3B 4F3FA 3MYJB 4JM4L 4MQXC 5C0CD 4NM4L 3RUGE 2ICWI 4OGYL 1CXKA 3T0EC 1LK2B 2LTQB 5HHXH 4PJ7A 4C54A 3QXUA 3VFSB 3MLUH 2X5PA 1ZT7A 2HLFC 5MERB 4X4ME 1HDMA 2AABH 3WLBB 5TE4H 3BEVB 3WIFA 3GKZA 3GSWA 1B0RA 4MJ2A 4X6DA 1WZLA 3STZB 3WNKA 1GAFL 4M62L 3TJHD 3V9FA 5MEND 3MJ7B 2F54D 1GGUA 3WO4C 1P69B 2AV1A 2R9HD 1F90H 1YNTB 2L7JA 4XWGL 4RGNC 3VDCA 5EWIH 1MAKA 4GAGH 1ZS8A 4W4NA 4ZOEA 4EVNB 1X5XA 3V5DB 3CC5B 3UTQA 4KRMB 1NCWL 3NH7L 4PY8I 3SE9H 3DSFL 1LP9E 4C56E 4LVOB 1AXSA 4JFYB 1U95B 4PGBA 5D96C 1JHKH 3BIKA 1EMTL 1MY5A 5IMKB 2OK0L 3WE6B 2D9QB 5JOFB 3NN8B 3JBG7 3GJEA 3WFZA 4RBPH 4DOHE 1N64H 1DN0B 3PJSB 1QBMH 1RK1A 4L3CB 1K4DB 2V2TA 2Y9RT 4OZ4A 2R0ZH 4YHNA 4O51B 4Y4KB 3FQUB 2ENYA 3RU8H 5GRUH 4XP9H 5HYSG 5GJTH 2CDGA 3I75B 5I1GL 3D39B 4G8GE 4JFFA 1RHHA 2KQNA 4YHPB 4G43B 4UIKL 4HAGA 5H35B 4BFIA 1NC4B 1NEUA 5I8EA 2WQ8A 1RUKL 2VIRA 5EUKB 5F6HJ 1QRNB 4BZ2L 1FL3A 5EUOA 1XEDA 3ZT6A 1ND0A 4QNPE 2FEEL 4JO3L 3HZYB 3BW9B 3CFBB 3ILQD 5DVMA 3MACL 3WS3A 2J88H 3U7WH 2W0KA 5BVPL 4P3DB 1PLGL 2WANA 5EBLB 5EIIB 4DZBA 3NGBC 3DMMB 4M8VA 5KBNC 2ATKB 3CK0H 2Q3ZA 3VXMA 5FGCE 4Y0GA 1WLHA 2AJVH 2P48B 4LRIC 1UH2A 4PS4H 2FJFB 1MFBL 4LSTL 1VGEL 2CIKB 1UM4H 5EC1A 1ZSDA 5J57B 2EIZA 1C5CH 4EI6A 4LLWB 4R3SB 1G9NH 4HDIA 5GGSB 2M2DA 1I7UB 1IGMH 3BP7A 3PHOA 3QT2A 5J12B 2AV7A 4GXUM 2IFFL 5E9DE 2K7PA 2AXJA 2W9EH 4OZFA 4PJDE 4PBVC 4NRYA 1ZT4A 1GYAA 1C7TA 4NN7B 4JFQB 4P4RA 2C1OB 3QNZA 2VLKD 3T4YA 4FQ1H 5HY9A 5T33L 4UINH 4C55A 1QFUH 4GMTH 2H3NB 2X4UB 5FUCC 3V6OC 2VXSL 4HFWB 1YEIH 1P53A 1KJMB 5IUSA 1B0WA 1NGWA 1M7IB 1Q0XL 3O6FD 3FCTA 4MCYB 4PRPA 2FLRT 5F89A 4TQEH 3WUWB 1RUQH 3IAPA 3TGXA 5F7MC 5C07D 5FA4A 2WWKT 1FRGH 5T5FH 1DQDH 4GRWB 4EUPH 1K3IA 1HKLH 4PRHD 3KLAA 4B41A 1WT5C 1CDHA 1U8PA 4TSBH 5HI4D 3VFTA 4XPFL 3GBMH 5DGRA 3S36X 3QBTB 1MAML 2V2XA 5FOJA 5E2JA 4WO4C 3BXNA 4AM0A 4JO4L 2JK5B 3BP6A 4JY6B 5DRWB 2XTLA 1TDQA 2P5EE 5SX5H 3RL2B 4KI5F 2ADJA 1B6UA 1JV5B 1GPOH 4LCIH 3HUJA 1WAAA 3IKCB 4JZJC 1IRAY 4G8IB 1S5IH 4KVCL 3V7MA 4OSUH 2ZCLL 3P9LB 3C6SA 2HWZH 2OLDA 2OI9B 3DXAD 2UWEA 4LBEA 4YHIB 5KSVB 2Y06L 1AXTL 2WBJD 5D7JC 1A22B 5D1ZC 1AO7E 3OGCA 1ZE3C 2WWMC 3QCTH 1PQZA 5JDSB 4MJIB 5JO5B 2VLMD 1HHGA 4KDWA 3PDOB 4ORGB 4FZ8L 4BM7A 1DVFA 1HI6B 2XG5A 5EO9B 3ZYIA 3RKPA 4CDHA 1X44A 4TSAH 1IJ9A 4HKJB 5EBMB 2PKDA 5BW7C 5JIHA 1IC7L 5ETUA 4G5ZL 1CFTA 1I1FA 3PWLA 3PP3H 3AM8C 2XKNB 4MMZC 4JPIA 4PJ5A 2DQFA 3VG9B 4YDIL 5D7KE 4NO0A 3BAEL 4O9HH 1R0AL 3HS0B 3B9KC 3BN9C 5DWUH 3UYRL 2JELL 4NN5B 3U4EB 1RVFL 5CGTA 2RIKA 4PJFA 1A0QL 3HMWL 3QIWA 1KC5L 1G7PA 4XAWL 4PJGF 1DBKL 5C9JA 5ELIA 1KCRL 3S36L 3VGDA 1IAOA 3JV0A 2HT4C 3EJZC 3MGAA 1JRHI 4N8PA 3JTSB 3MJGX 3RKDD 4NN6B 4QT5A 5ACZA 4Q9QL 1W72B 3HI6L 2OMNA 4LEOB 1N0XL 1U8LA 2BCKB 1K85A 4C57C 4MJ6A 1UACL 5ACMA 3HE7A 3VMOA 4HCRA 5KVDL 2NQCA 3C2AH 1CDGA 3MZGB 4UUJA 2IF7A 3DVGA 4KGJA 1VSCA 3BZEA 4XT1C 3VRJB 1OSPH 1U91A 3U46A 5D72L 1CTNA 1HHIA 3TBYA 4RMWA 2YK1H 2DMCA 1EBAA 5HHME 5JTWA 3D85A 4PJHA 4CN1A 4RISH 3HNSH 3B3IB 1E6JH 2APTA 4WUUA 3QPXH 1R3HB 2VYRE 2C3HA 1F4HA 3CSGA 1FFNB 4OJFH 5JORB 1R5IB 1L7TH 2CJUL 5IGXH 5JLZA 1CFNA 3HE6C 4BUHA 1T1YB 3QSKB 2ZSVB 4NO3B 5B39B 5HDBE 4Q2ZB 4YXLH 5GPRA 3QRGH 3AU1B 1CI5A 2R69L 3HN3A 2AXGA 5A2LH 1FNHA 2WUCH 4PJ7F 4QRPB 4Z76B 3RQ3A 3MPCA 4LGPB 2YR3A 2FRGP 4EN3B 2J7LA 1GGIL 1QRNE 4ZFZA 2APFA 5DK3A 4KQ3L 1T1WB 5M94B 4ZD3H 4X6DF 4HIXH 1KELH 4X4YA 5D9SA 1G9NC 2QJDA 1ZANH 4WDIA 1WTGT 2VB5A 5EZOL 1A21A 5I6XC 1QO3B 4PYHA 1PAMA 4YZFF 4E5XB 5CD3A 3LN4A 1KULA 1GJIA 3BP4B 3O2VH 4MJ5B 4DVRH 5IF0B 2C26A 2VR4A 1VGKA 3VXTA 5BS0A 1INEH 4OF7A 5IESH 3QIBC 4KK5D 4P9ML 5BZWA 5CZVH 4Z7NE 5D5ME 5D7LB 2IADA 1DCLA 5DQJB 5TE6H 5ISZD 1N2RA 2FEEI 4NQVA 4HHAA 5BQ7A 1BQHG 1QFWL 2IAMA 4XPHL 4J3XA 4G80B 1FL5A 3TIDB 4U6YA 3LRSB 5B3JF 2JB5L 4NPYB 4YAQB 3QH3B 4JR9L 1MRFH 1F3JA 5CILL 1U3HA 3LQAL 4CADA 3QUKB 1I1AA 4QTIH 5L7XH 5CD5C 4XWOC 3FMGH 2XY1A 2FD6H 5IMOB 1KNOB 2W1NA 1P6AB 1X5ZA 3ARFC 1AQDB 1ACYH 2Y36H 4GXVL 1NBYA 4X6BB 2GAZA 1NBQA 3O6MH 2Z91B 2EC9U 4I4WB 3OGOE 5FECB 1YEEL 3MV9D 2YUZA 3S4SB 1IGIL 2H6PB 3S37L 4GRLC 3ZKXC 5EUOF 1O0VA 2EICA 4GKZB 3L3KA 3KYMA 3C5ZD 3R0NA 1RMFH 3MNWB 3QUZA 4ODVH 5CBEA 5L2JB 4L1HA 4IRZL 4FQIH 1A3LL 2XZCL 5LWYL 3VXRD 5D70H 2H1PL 4GT7A 3T0XA 2XV6B 3SKNA 3KAAA 3HG1B 4NKOB 5IHZB 2JE8A 3QB7C 2A9MH 4JB9L 2ADFH 3KJ4B 1RAMA 4NSKB 4JY5H 3HFMH 2OTWB 4WW2C 4KTDL 1EZVX 2VZTA 3E2HB 4PIRF 1D9KA 4P5TC 3LCYA 1F45A 3BRGC 4NZDA 3ULVH 3OJDB 2UVEA 2PTVA 3B83A 2VR9A 5E2TH 5T3ZD 3CU1A 4PD4J 4ODWB 2VLJE 3NCFB 4ESKA 1NAKH 4PRNB 1IKFL 2F58L 1P5VA 3H9SA 4KRPB 2AKRB 4FNLH 3LQZB 4NQXB 2VDOL 5I1LB 4XCNB 2YEZA 1YY8B 1SY6L 4HS3A 2ITCA 1CFQB 4J6RL 1JBJA 5ID0B 4IOIB 4U1GB 3RHWF 1FVDB 2DWDA 5IBLD 4KKAC 1S7SA 4Y16D 1WCBB 2G60H 4L9LA 2YUXA 1IILE 1MHHA 5DQDL 4K3JL 3NAAL 2PETA 5FO7A 2Q87A 5E5RB 1DBJH 4QCIA 2V7HA 3QUMH 5ADPH 3EYVB 1T2XA 4P4KA 2H32A 5EFIB 2CUHA 2EH8L 1TQBC 4WUKH 4X5LA 3L5XH 3UPRB 3C08H 3SDAA 4HIEA 2D31A 3AY4A 3N9GH 2MFNA 2Y23A 3HE6B 3ZL4H 2C7UA 1CGVA 2D7TL 1JGLL 2M1KA 3P4NA 3H0TA 1S9XA 1NSNL 1UJ3C 1XFPA 2O5XL 4U1KA 5ACLA 4EDXB 3HUJF 1WAAF 2X1WL 3CDFA 4H1LG 3VWKA 3QWOA 1OGAB 4DAGH 2M8XA 3KLDA 1EX0A 1AGCA 1U8NB 3LD8C 2UWEF 5MHSD 5HDQL 4HWBL 3GDBA 1FZMA 1TCRB 1OTTC 5EU6D 4JPWH 1B0GA 3LHPH 3N0PB 1CBVL 1O5DT 5E8PA 3STLB 3DX9B 2BVPA 4ONHB 4HKXB 1N6QL 3ARRA 3K46A 1EK3A 3SHSA 1RURL 4NQCD 4HK0B 4MAYC 3MMEB 1D5MB 1YN7B 3WHXA 1W0YT 4GAJH 3ZE1F 2P1YA 5HGHA 5TF0A 1FLTX 3DRTB 4HLJA 4LK4A 5E00B 1IGCL 1X6NA 2VLRB 5HHPB 4NO2B 1CFSA 2BNQA 3ZKND 3QG7L 4P9HL 5SWSE 3QFJB 4PV8B 1BIIA 4P23B 4Y7MA 4IRSA 4EDWL 4XPTH 4HD9A 1MF2L 5F1NB 4PJFF 2VDNL 4QRPE 3U9PL 3QIUC 1P84J 2AJSL 2XFXA 3JZ7A 4BKLA 4QOKB 4UIMB 4N1CA 4IIQC 5IVZA 3LKPA 1GXEA 5HYJA 1YMMB 1YNLH 3KPQB 4DGVL 2A6IB 4JQVC 4EIGB 1LE5A 3RTQD 3AS1A 2YPKA 4IEFB 3B2UC 4V1DA 3EGSA 4KKCD 2APXA 4K55A 5DMGC 1T1ZA 3VJ6A 1RJCA 4NRXB 3MLTB 1BGXH 4HBCH 4OTXH 1AE6H 3LEXB 5J13C 2XWJB 4OCYH 3OAZH 2CPCA 3BPLB 3MLRH 4Z7WA 4PJXB 4WHCA 4QRSA 3QJFB 3ARFB 3T3PF 2I26N 2FHFA 1AIFB 4RGOL 5D7LE 3TFKD 4FRWA 2NW3B 3MV8D 4BH7A 2IQ9H 2I24N 3B5TA 3IF1A 1TZGH 2PF6A 2JCCB 4JM2D 4I0PC 3ZKXB 3FHAA 4PJHF 5CMAA 4JFHE 5INCB 4D0DA 5HI3D 5D93C 1FZKB 4M03A 3MCLH 5AD0A 3BJLA 2VDQL 2YPLB 3VXQB 2CMRH 4GW4B 4NC1E 5CBAA 3BZDA 4RRPG 3EFDL 5DD1L 3GSXA 3Q0HA 4RMVA 1F4XL 3SKMA 4ZYKA 5J1AA 4X98A 1QFWI 4XZUA 1MFDH 4BSVB 3VFPA 2P5WD 3CD4A 3CJJA 1NJ9A 3KPNB 3V4PL 5E99L 2O5YH 3I6LD 2FO4A 4KPHL 1XCQA 1D5BB 4LDOB 2LVCA 3CH8A 3UTSD 3E0GA 1AQKH 4JLRB 3QA3A 1RZ7H 3ORJA 1RIUL 4M1GL 3U1SL 3T2PA 4YE4L 3DUUB 1YNKL 4APQB 4AIXA 3OAYH 3W81A 2Z93B 5SWZB 3ULVC 1B6DA 3ZT5A 5I9QC 4UI2A 3FQWA 1JYVA 2HTKD 4H0HB 1F4YL 1FG2A 3HAEA 3BQUD 3S5LG 2AEPL 1QNZL 4NNPH 4WU7B 1H3UA 1EFQA 2V9QA 1EEQA 1MJ7H 2GFBA 1ZWIB 4Y4HB 4ZUWA 3VXUA 2I60L 2X4QB 4X8JB 1R24B 4RFEB 2XICA 2ZCHL 5KSAB 1H3WM 5E94A 1INQA 5LGJA 3F7RA 4WJ5A 3PXJA 1J5OH 5AZEL 1KPVB 2VTFA 2X9XA 5E6IA 3GB7A 1K4CB 1AXIB 3DETC 4R2GD 4M7JL 4MA7H 4NQSB 5KSUA 1QR1B 1YPZA 3EZ8A 4LFHD 3I3EA 5D71H 2VL4A 1U93A 5BZDB 2H41A 2DDQL 4HGWA 4ZDHB 1MELA 2HG5B 3RAJH 1EV2E 4LNVA 5D7IB 4NUJB 1FH5L 3VGFA 4O2EB 1IL1A 4FQJL 3BISA 4M1DL 3IJHB 4DJMA 1DTUA 4OF8A 1LK3H 2PO6A 3QAZB 3KYKL 4KTEL 3VRIB 1MJ8H 2IG2H 3N1PC 1OAUL 2F19H 4MAYB 3ISWA 4JJ5A 3CZFB 4ZAKA 1DN2A 3FB5B 1UB5A 2H9GA 1CGXA 4LP4A 4R7DB 4BZYA 1MFCH 2EO1A 5E8NB 3GMOA 3MBEC 5GGTA 1X5AA 1HHHA 2Z31C 1TITA 2MKLC 1JGUL 4R0LA 4IMLB 2W0PA 1OGAE 2X70A 3IDNB 1UWXH 3ALXA 1IC4H 3Q48A 4Q74A 4XI5C 5LJYH 2HRPH 1A1NA 2DIBA 1YQVH 1FYTB 2K9UA 3PV7A 3QIUB 4JQIH 3CXHK 3C09C 1D5ZA 3QHFL 4EBQH 4IIQB 3SDDC 3W0WA 3OG6B 5E2VH 1QQDB 1DUYB 3NA9L 3P73B 2D7QA 1GGTA 1OAZH 3VXSE 4HWUA 3IDGB 3ARED 4QRTB 3WJLA 3SE4C 3MCKB 3W9DA 1ZVSA 2E7CA 4G6FD 5D1QD 3IJYA 4OCXH 1AGEA 5IMLB 3FRUB 4U33A 3GO1L 3UMTA 4R4BB 4WGWB 3LS5L 2PYFA 1UZ8A 4XX1G 1XR9A 2QQKH 3FQTB 4N5EC 4RX4D 5IJKA 3MLVH 3AC0A 2VWEC 3CVIL 2Q8AH 3GGWB 1NLDL 1ZA3A 4C56D 3ARQA 4OFDA 2YXMA 4YQXL 2EE3A 3F58L 4QHMA 1M7DA 1T04A 2F5BH 1BBJB 2CRZA 3QDGE 4C4KT 2CRYA 4QOKE 3CVHB 3X11A 2HTLD 4TOYH 3HC0A 1YMME 2R56L 1GHFL 3HI5L 5A3IC 3BVNA 4U1LA 4FQHB 3OX8A 4KKBD 1I1CA 3G5VA 3OKEA 3BKYH 2BOBB 5TE7H 4JRXE 5M7QA 2AJUL 1NFIA 3MA9H 1I1YA 3MJ9L 3RGVC 1GGBH 4PJXE 2NY3B 4YDKL 4HV8B 3EO9L 4ALAL 1T1XB 2Y5TA 3TWCL 2GK0A 1SJVA 3BUYA 4HPYH 1J7VR 1F6AA 1TZIA 4Z0BL 4MCZA 5JDJA 1NCBH 3N06B 1U8IA 1IE5A 1I7RB 3FTGB 2WIIB 1AHWA 4DGIL 2A83B 1CZ8H 5I76B 4CVXA 4FQXA 4G6JH 1YEHH 4ZXBA 1TFHA 4UU9A 1UG9A 4JANA 4D3CH 4OIAA 1XH3B 1FNGA 1FFPA 3U0TB 1ZMYA 1JGEA 4CJ1A 3X13B 4L4TB 2R4RH 2FBJH 7FABL 5GJSL 5C0AA 5J8OA 3VCLB 4HEPG 4P46C 2FR4A 2XACC 2P8LB 3MRMA 4NZUH 3K0WA 5DXWA 5HYSA 4LLQA 1ONQA 3MV7B 5I17A 3G04A 2QSTA 1PSKH 4XPBH 4NIKB 4A2MA 1RJZB 3SJVA 3X12A 3CPLA 2DLIA 4KH2A 1HEZA 4BQ6A 5GS0H 1V3KA 4OD1H 5F6IC 4MNHA 2EDTA 3ELAT 4U1NA 5F88A 1IAIH 4E0RA 1H5BB 1NCUA 1EEZA 1T6WA 3QISA 2VDRL 1ADQA 3MO1A 3GZKA 5ERWB 3VDAA 4XGZA 5TDOA 5SWZE 4Z7WF 4XMLL 4WHYH 4G8FB 5I71C 2HH0L 3JWOL 3JV4B 1TJGL 4XCCH 2ENSA 1CG9A 4WI7A 5EOQL 5KVEL 4P2OA 4QRRE 4R4NC 5EOTA 4LSSL 4JGUA 1KJ2A 2W59A 1RZKH 3MRIB 3BHBB 3B9VA 3C8HA 4QRQB 1JNLH 4F3FB 1F42A 1P4LA 3I84A 3QQ3A 2EE6A 5J3HC 3QI9A 1EJOH 1I9EA 2B5IC 1S8DA 5EU5A 1PDKA 4PJ7B 4A6YH 1ZT7B 2Z4QA 1CICA 2PW2A 4KJPD 1QACA 1HDMB 2E27H 4XRCA 4Y2DD 3WIFB 3GSWB 1B0RB 3SGKA 4X6DB 1TZHA 1MREL 4X9FA 2AV1B 3GFUA 3QNXA 1T7VA 4YHMH 5DD6A 1Z9SA 4ZMAT 1AO7D 1BHGA 1ZS8B 1GGCH 1QFOA 4N1HB 3UTQB 4J2XA 2DQGL 4OLYL 5C09A 4Z8FH 3EYQD 5CUSL 1T5WA 5FHAL 3LQMA 5E7FA 2CDEA 2C4FT 4PFEA 5DJ6A 5SV4A 3D9AL 5DVNA 4MXVF 1ZGLM 4PGBB 3E3QC 1UZ6F 3BIKB 3RVTD 3IJSA 5D4QA 4TYUA 1UH3A 5HVFB 1FSKC 2R23A 1T20A 1RK1B 3BFOA 1AKJA 3IVKA 2P45B 2V2TB 2YMXH 4OZ4B 1S9WB 4K7FA 4YHNB 1P1ZB 4BZ1H 4NC0B 1MHCA 1OT2A 2BC4A 2ESVE 2CDGB 1RI8A 4LDLB 1AH1A 4FMFA 5HDOA 2GHWB 4OI9A 1IBGH 1UENA 3W9EA 4IJ3B 2I07A 4JFFB 1A7RH 1RHHB 2CK0H 2ICWA 4N0UA 3GJFK 3RZCA 2HFGH 3O0RH 3TZVA 3JVGA 1CCZA 1LO5A 4BFIB 5ILTL 2Q7NA 3OB8A 1ZHBA 2Q8BH 4PP2A 5I8EB 6FABH 2VIRB 3W5MA 1OP5H 1FL3B 5EUOB 4X7EC 1KJ3H 1ND0B 1YPZF 4JFOA 3P9MA 4OFYA 5IWLC 2H45A 3WMSA 5T3XE 2BOCA 3S34L 3WS3B 2CXKA 4M7ZC 2DMBA 4D9RE 4XMKH 1SM3H 4DZBB 3MLSL 3SQOL 5E5MA 2VMFA 4N5UA 4RMRA 3VXMB 1S7QB 1CK0L 3U4AA 3DROA 1OAXH 1B4RA 1UKQA 4OKVA 5EC1B 2I9TA 1KCVL 1ZSDB 3RBSA 2EIZB 3REWA 4HDIB 4HIIA 1J86A 1WBXA 3F7VA 1XF2A 3BP7B 3PHOB 2AV7B 1JMXA 5TQ0L 4TTGA 4OZFB 3O41A 3NFPB 4NRYB 1ZT4B 1T03H 5LQBL 4P4RB 4XVSH 3QNZB 2GUOA 3T4YB 4Y4KD 4F7EA 5I8KH 2LAGB 4HUXA 5HY9B 3ARDC 1Q72H 3NTCL 1NEZG 2ED7A 5L9DL 3S6CA 3HC4H 1G84A 3FFCA 5E1HB 3RL1A 1NC4D 3FCTB 4PRPB 1KEGL 4HJ0D 1MRDH 2ZCKL 3F62A 5F89B 1MWAA 1CLZL 4YXHH 1QRND 3ROLB 1ORQA 5IT2L 1U8JA 4UV7H 5D6DC 1UYWH 5LCVH 1MQKH 2BDNH 1HXYA 5FA4B 3GSRA 4FQ2H 1OP3H 2D7PA 2VUYA 3U79A 1RJLA 3DMMD 2JJSA 5AG9A 4L4TE 3KLAB 4PJGE 4OFKA 5IK3A 1U8PB 1D5IL 3W39A 3VFTB 5GS0C 1MVUA 2FX8H 1A9EA 3BXNB 4KHXH 4WHTA 2BK8A 4L3AA 5FOBA 5GGQL 3MV7E 1IAIM 3BPCA 4PRBA 3D5OF 3ZTJH 3BP6B 5I66A 2VL5A 4FFWC 3O4OC 1TTUA 2ADJB 3LN5A 3GSUA 4XP4L 3HUJB 1KBGL 3SDYH 1SHMA 1K8DA 2ZPKH 1UQSA 4O58L 4L4VE 1KB5L 3C6SB 1B3JA 2XTJB 2UWEB 1P7QA 1P84K 1LD9A 3LV3A 4LBEB 1X5LA 1MHPH 3IDMA 1IEAA 1ZEAH 2V5YA 2HKFH 2I5YH 3SDXA 2DQIL 1RZKC 3IRPX 4HWEL 3OGCB 1SQ2N 1F97A 4OD3L 5IQ9A 4WWID 4DQOH 1YEJH 1PQZB 3P0YL 5C6WH 5EORH 3IDYB 3NIDF 5DR5L 1CTOA 1DVFB 5I74B 3TVMC 5I8CA 3ZHKA 5IBUB 4JO1L 2VZUA 4N0CC 1UM5L 2DKUA 5TF1H 5FGRA 5ETUB 1CFTB 1I1FB 3PWLB 4K3DL 3WFEH 1MI5A 3WNLA 4JPIB 4PJ5B 2DQFB 4QLRA 1BQHA 4NO0B 5DT1H 4XTRD 2DLFL 3LEYH 1UA6H 1QFHA 1R5VA 1JPSH 4KVNL 4IHOA 4O4YH 3CCHA 1ORSA 4PJFB 2HN7A 3QIWB 4TULH 4HH9A 1G7PB 5LBSL 2H8PA 1C1EL 2MCPH 2WWKO 1IAOB 4XB7A 4DUXA 4K7PX 4JKLA 4QT5B 5ACZB 2UY7A 4X6DE 4EOWH 1CDCA 3GIZL 1VFUA 4LSVL 4M8QA 1KIUA 4UDTA 4ZQKA 1U8LB 2JIXA 4MJ6B 1JTTA 3HE7B 5L6YL 2VDPL 4YZFE 2NZ9C 3U7AA 3CSYA 4TVPE 4UUJB 3TT3L 4OV5A 3DVGB 1GC1H 4MD5A 3GK8L 3VG0L 3B9AA 3BZEB 2R2HA 4WFED 1FC2D 4MJID 4G9FE 1U91B 3U46B 4JN2A 5C3LD 3MBXH 3RFZC 1HHIB 4XP1L 5CS7A 3TBYB 3LDBC 1S9VA 3RI5F 2H2SC 1QA9A 5I1JH 4I13B 1IM9A 1F3RB 3D85B 5I1EL 4LARH 3HKFA 4WUUB 5B3JE 2FGWL 2SEBA 5CLWA 4ZS7H 4M7ZB 4HQQH 5D7SL 5SWQA 5JLZB 1C5DA 1CFNB 2NX5A 3Q3GA 4I1NB 5FF6A 3KHQA 3B6SA 4Y5VC 3N85H 5CEYA 5T3XL 1FVCA 1E4WL 2BVEA 4QXGL 5CP3A 3U0PA 2AXGB 1W8OA 5C9KA 1FJ1A 2GTZA 4JFFE 4GXUN 3BO8A 3P11H 1G7JA 4UTBL 1WEJL 4K7PL 2X1OA 1U2CA 3EFFA 5I75C 4ZFZB 3BMVA 5CJXC 3ARPA 2D3VA 4X4YB 5D9SB 4NFDA 3RVVD 3WLWC 4WDIB 2X4TA 5CD3B 3LN4B 3QYCA 5HHOA 1MRCH 3P40A 1OQOA 1PG7W 3VXME 4K8RL 4WFHE 1VGKB 3VXTB 1SJHA 5BS0B 1LHZA 1NFDA 5BZWB 2A2QT 5JHDE 1CU4H 2IADB 3CFJA 2GEEA 1N2RB 3ULUF 1AJ7L 4U1HA 4JRYA 2FX9H 4HHAB 5BQ7B 4F37K 2ZP0T 1MPAL 2IAMB 4ZODA 3VFWB 1FL5B 3ARVA 3GKWL 4U6YB 2LVEA 1HKFA 2BVTA 3LPWA 4OQTH 4LHQB 1NMBL 2F74A 3TH4T 1F3JB 4PG2C 1U3HB 1CF8H 1DBBH 3BT2L 3MLYH 2CRIA 4CADB 2FX7H 1FNSH 2HJLA 4F7MA 3WV0A 1RZ8A 1I1AB 2EXWD 3X3FH 2ARJQ 3S9DB 3KLHC 3DO7A 4QRPD 2DI8A 4H1LA 3NPSB 4M48L 1BFOB 3HMXL 3RA7L 4D8PA 2EYSA 4PRPE 3LKSB 1DFBL 4QHKI 4EN3D 1LEIA 1NBYB 4DGYH 2GAZB 3NCEB 1DANT 4YC2C 5IBTH 2WUBL 4BK5A 4LSQH 2EYRA 3WDHA 2K3TA 4PUBL 1U6AH 5FGBA 4L5FL 3M1BA 5TDPA 1MCPH 4XNMA 5DRXA 3DVFA 3L3KB 3KYMB 2BFVH 5JUEH 2UYLA 4RMUA 5GRXG 3QUZB 2FL5A 4I0CC 5D7LD 5CBEB 5DHVA 4HLZG 3T0BA 2VABA 1JL8A 1JWSA 4LHUG 3IDIA 4OT1L 2X4RA 3SKNB 2CUMA 2AJYH 3Q5TA 1P4IL 5BCAA 4JFHD 1B2WL 1F58H 5A1AA 1R3LA 5TJWK 4W6YB 4HJGA 4QWWD 3UZQA 1E6OL 4OIIL 3RWFA 1D9KB 3HUJE 1WAAE 1WIOA 1J8HE 4HEME 4N90E 4S1SH 3GSNH 5I1IH 2NY5L 1OAKH 3QUXA 3U7YH 2FATL 4Y5XA 2XTJE 2UWEE 3QCUH 1DDHA 3EZJB 2F8XC 4Z7UA 1YEKL 4O02H 3PG2A 4LIQE 1UC6A 3EOTH 3BE1H 2B8OT 4ONFH 4JFZH 4ZG1A 4GBXC 4RIRA 5IB1A 4OI7A 3PWUA 1C12A 4LKCA 4NWUH 4DCQA 3IETA 1FCCA 3H9SB 4CN4A 4JG1H 5AWNL 3ROOA 2XA8L 4ZFOL 2YEZB 4EI5C 4Q0XL 2BMKA 3EYSL 3ZE1E 4HS3B 2ITCB 1CWVA 2I9LA 1NC2B 3WIHH 3D25A 4CJ0A 3OZ9L 2DWDB 2YBRA 4WHDA 4DKAA 1N7MH 4DKEH 1S7SB 4PJ5E 1FDLL 1L0QA 4L9LB 1MHHB 4K23L 4UT6L 1CIUA 1HILA 4LVNC 5FO7B 4NBYB 4TVPL 3SDCA 4MXWL 4PJFE 4QCIB 5I18L 4RGMC 2V7HB 3HG1D 1H3VA 3X3GL 2X4PA 5F9OL 1V7NL 2BSTA 4LCUA 1I8LC 1MCBA 2H32B 1PKQA 1YEDA 4PBXA 3MXVL 2W9LA 1GC1C 4RRPA 1CN4A 1MCQA 1CE1L 3RIFK 4Q6IA 3SDAB 2D31B 3BN9D 4LASH 2B0SL 2HJFA 3HB3C 4HWZA 2C7UB 3MUGA 3ZLQC 4M5ZH 3D87B 3ES6A 1WITA 5KTEH 3P4NB 3H0TB 1S9XB 3V4UH 4U1KB 4WTXA 4LF3A 5D1XA 3VWKB 2JJVA 3QWOB 2X4OA 3T3PE 1AGCB 1RJYA 4KRPD 2X89A 3H7BA 1FZMB 1LNUA 2IPUK 1B0GB 3SDXF 4D9LH 1FO0H 1FGVL 3OXSA 5I16A 1ZHNA 5E8PB 2BVPB 4CW1A 4PJHE 4YHZL 4HJJH 2XZAL 4WUUE 5A40E 1TJHL 2HAZA 3DUHA 2YKLL 3MGTA 3I50H 3WHXB 3CDCA 1QP1A 2EXYD 5IVXF 3S5LA 4TUOA 5HGHB 5E24E 1TVDA 5DUPL 3FL7A 3BKMH 3QHZH 1QKZH 1BPVA 1I9JL 1CFSB 1WWBX 1Q8MA 3I3BA 4FQQA 4YH6A 3WO3B 1BIIB 1UFUA 3G5ZA 1UM6H 2OR8A 4IRSB 3RUGA 3T0EE 1MIEH 4R26H 2OZ4H 3HE6D 4HC1L 3TJHC 4D0CA 2XFXB 3MODH 5B8CC 4BKLB 4OQ1A 5IVZB 3LKPB 4FABL 5HYJB 1PKOA 1AGFA 1XF4A 2X44D 1LE5B 3ARXA 2YPKB 4V1DB 5JQ6H 1OGAD 4NZTL 3EGSB 4KTYA 4F15B 3PF2A 2ITDA 3U0WH 4CMHB 1T1ZB 3VJ6B 3HNTH 3WFDL 1QZ1A 2BNRA 1LO3H 1PEWA 3SE8L 3V7AE 2DQJL 2BVQA 2P4AB 2VZ1A 4RGNE 4Y5YC 5EU4A 5IB3A 5DUBA 4MLSA 4OGAD 4PRAA 2V17L 3LSOA 3A6BH 4OLUL 1BVZA 3H6JA 3UTOA 2MQ3A 2L7UA 5EA0H 4KZDH 4R90L 4BH7B 5FUOL 1QSEA 4XP5L 3IF1B 4P2CG 1F6FB 2DKMA 4ZO6A 4OGZA 4BQBA 5K9KA 2X09A 4LPTA 3NFSH 5CMAB 4D0DB 2VLRD 3QXDB 5AD0B 3H7LA 4LRNH 3NIGF 3QFJD 1NL0H 5TH2A 4F7PA 4P23D 4P5MA 4WTWA 1OVZA 2IPKA 4OLVH 5CBAB 2VLLA 3GSXB 4LEXL 2ZSWA 4QOKD 4ZYKB 3SKMB 5J1AB 1YMMD 4X98B 4XZUB 3L3DA 5IIEA 1M71A 4HT1H 1Z3GH 1NJ9B 5HGGS 5H37H 1I3UA 3LS4H 5HYEA 4G8GA 4PLKD 2FO4B 3ILQC 4NJAL 2DQCL 2MPAL 3HC3L 3WYRA 5F93C 3U6RA 3RWCA 3QA3B 5IEHA 3DGCR 4IBLT 4LVHC 4WEBL 5E2WH 4OM1L 2MNUA 1BQLL 3TT1L 4JQXC 5MEQA 1A64A 3OKMA 5L88L 3SY0A 4HMDA 2B1HL 4ENED 4X6FA 5TQ2H 4LIQL 4QYOA 1EAJA 3FQWB 1J1PH 3OV6A 4M5YH 5DI8A 1FG2B 4QTHA 3HAEB 1NFDF 3G9VA 4WFFE 3D3VA 1KCSH 4JKKA 32C2A 1NUDA 3GHBL 2YPLD 5DRZA 4I3GA 2GFBB 4ZUWB 4ONGH 4PTUA 5DJ2A 1TTFA 5E9DA 4GLRI 4BFBD 4PJDA 4FZEL 3STBA 4RGMB 2HVJA 1HN1A 4PGJA 5E94B 3RGHA 1PVHA 3D0LA 3O6FC 1INQB 1PBYA 4U49A 3DV4A 4C83A 5LGJB 2AGJH 4WJ5B 1Z0NA 5FCUH 5FUCE 4X6CA 5E6IB 3GB7B 3DECA 5EOCJ 4G6ML 1UXWA 5KSUB 1KV3A 1IAKA 1YPZB 1F3DJ 4OD2A 5F7EL 1U93B 4JHAH 1OW0C 5FGSA 1A7NH 4NNYA 4WVRA 4FTVE 1EH9A 4ODSL 4X7SL 5HI4C 1UT9A 3IXAA 4HGWB 1CLYL 4APQD 5FDWA 4F33A 4FFZH 1JPFA 3TYFA 3VFMA 5SWZD 2E5EA 2VXVH 1IL1B 4S0SD 4BH8B 2XRAL 5MEOA 4ODHL 2PO6B 2RCSL 5E1AA 4GOSA 1WK0A 5FCSH 2NXYD 1MCOH 2XZQL 3PL6A 4JJ5B 4MA1B 4ZAKB 4Y4HD 2A74A 2YUWA 3O3AA 1UB5B 2H9GB 4XBEL 5A2IH 2IPTH 4OLWH 3FO0L 1T2JA 5ADOH 4JDTL 4MX7A 1JHLL 3GMOB 5KSAD 2MHAA 2WBJC 5GRJL 5IB5A 2P5EA 3SGKC 1A6VL 4WCYL 1HHHB 2R8SL 3UJJL 4R0LB 4UZGA 2PXYA 2I27N 3QEUB 4AIZA 4IRJA 2P46B 1OARL 4NWTL 4DEPB 3PHQA 4Z7UF 2VISA 4H5SA 1D5ZB 5T3ZH 4YBLB 1EHLH 3W0WB 3WXWL 3VFRA 1QG3A 4R96A 4JFEA 4JN1H 1T89A 1KLUA 4AL8L 4NP4H 4DW2H 1N26A 1ZVSB 3BYYA 3IJYB 3ALWA 4Y5YB 3RVXD 5CP7A 2V5TA 3ZMRA 2FWOA 2PYFB 1JIBA 1KPRA 1UZ8B 1VACA 3MJ8B 4OCSL 4QY8A 4I77H 1XR9B 2YD4A 5GS2D 3I6GA 2BNQE 3L7FA 1XGQA 1ZA3B 3RKDC 1YYLH 4MAYD 4XXCA 4QF1B 3SCMA 4JCLA 2EDWA 4TUKH 4QHMB 1L6ZA 2DQEH 1Q1JL 3AB0B 1M7DB 3RY5A 5I15L 1T04B 3GJFA 4CVUA 5GS1C 4PJ8A 2EC8A 5CEXA 3X11B 1WBYA 4P0DA 3ALPA 3HC0B 5HYJE 1SY6A 3BVNB 4H20H 4U1LB 3NCYS 3OX8B 4V1DE 1CYGA 1W0VA 5T1KA 3CFEA 1FV1A 3TV3L 3G5VB 3OKEB 3F5WA 4M6MH 5CJOL 1NFIB 3FRPG 1FYTD 1UWEH 2ESVD 3QIUD 1I9IH 2OP4L 1OM3H 4DN3L 2VOTA 3UTPE 1I1YB 4Z7WE 2FH8A 3RWDA 1L9NA 1D3CA 1RUAL 3AMKA 3O2DH 4HGMA 2DQUL 5DMGD 4OCWH 2Y5TB 3UTTA 2GK0B 3BUYB 3S7GA 2R29H 1F6AB 1TZIB 4MCZB 4KMTL 2B39A 1U8IB 3GI9H 3VFOA 5HPOA 3ZYOA 1PZUB 1AHWB 3THMH 5JMRA 1CLOH 3MOAH 1S3KH 2QKIA 4CVXB 4FQXB 4JM4H 4ZXBB 3LMJL 2RQ8A 3D1MC 2FDBP 4OFIA 4UU9B 4JANB 3NVQA 1FFPB 4UQ2B 4M00A 4LSUH 1JGEB 4OGYH 3OJ2C 1EO7A 2HT3D 5C0AB 1BM3L 4KI5D 1IC1A 4HWBA 2FR4B 4HG4J 1RPQA 4LHJB 1XGUA 3MRMB 5DJ0A 2DM7A 1QLRA 4LLQB 1ONQB 3OKNB 1J18A 5I17B 3G04B 1IGYA 4LCCA 43C9A 3OPZL 1GAFH 4M62H 4ZNCD 2BNUB 1LDPL 4L29A 3UO1H 5HVHB 4OCRL 3ESUF 4RFOL 3SJVB 3X12B 3CPLB 3M07A 2NY3D 4JY4A 4U0RC 4MNHB 4U1NB 5F88B 4E0RB 1EEZB 1AI1L 4UBDD 4F9LA 2IWGA 4FP8L 4KK5C 3P4OB 1SEQH 1NCWH 3MO1B 4FFYL 3OL2A 4XGZB 5TDOB 3P30L 3HPLB 2DM4A 3HA0A 3BEWA 1VPOL 2KPNA 2Y7QB 4UB0H 1TPXC 1T0NA 1CG9B 5GZOD 2DF3A 2WMPA 4CU6A 5BV7B 5D5MA 3LIZL 4P2OB 3B5GA 5DD5L 4URTB 5EOTB 1D6VL 1KJ2B 1MCKA 3KYNA 4L4TD 3VXUE 4LLVA 3OWEA 1KN4H 2RFXA 1P4LB 3QQ3B 3QUYA 4MWFB 1KG0A 1E4JA 2A9NL 3QI9B 2LABA 4NKMA 4F58L 2BP3A 1S8DB 4ZS6D 5EU5B 4QO1A 3NCJH 5HHQA 3T8XA 3VFNA 1BZ7A 5E6ZA 4QXWA 3ZDYF 3MV7D 3O2WH 1NEZA 2Z4QB 4UIKH 1CICB 2PW2B 2DOCA 1T0PB 3P0GB 1Z5LA 4UAOC 3WS6A 3VA6A 1MH5A 4XRCB 3VW3L 3MV01 3SGJA 4YPGA 1YPZE 3AAZA 3FB8A 2QLVB 1RUKH 1X5JA 1TZHB 5DLMH 1S5HA 2BSSA 2DD8H 3QEQE 4BZ2H 3E6FA 4L4VD 3ZKMC 3C5ZC 4JO3H 3QNXB 3LB6D 1NCNA 5DD6B 3PQYA 4WI4A 4R97C 1IC5H 4XB8A 3WFCH 1INDL 5C09B 1MNUH 3QZWG 1OQXA 1URLA 1T5WB 2IQAA 1MFBH 2CDEB 2VJXA 2O26U 4XPAH 2OL3L 5DJ6B 2VE6B 3QXTA 4HKBA 5J0BA 1RK0A 2GIYA 1Q94A 1G6RH 3L1OH 2C9AA 1OL0A 3IJSB 3O8XA 1WQVT 3ARBA 4IDJL 2VDLH 4JGMA 3L7EA 2A1WL 3MREA 3VU2A 1A6UH 5CAYB 5HHXL 2VXQH 5BVJA 4NRZA 4MAUH 1AKJB 2PTTA 3IVKB 3MLUL 4JZNA 2D0HA 2F53A 3HRZA 2H2PD 2Y07H 3MX0A 4K7FB 2L0DA 1MHCB 2AABL 4UQ3A 2GK2A 2BC4B 5TE4L 1NAMA 1F2XK 1TMCB 3ZE2F 5I1HH 2VLJA 1JGDA 3EO0B 4X7CC 3W9EB 2I07B 4N0UB 2ICWB 4PJ9A 4X6CF 3RZCB 5IBLC 3TZVB 3P0VH 1LO5B 5GGVY 1F90L 3QNYA 1ZHBB 4Y16C 4PJIA 1OF2A 5EWIL 3Q1SH 4PP2B 4GAGL 2IFGA 5AUMA 2VQUA 4ELKA 5CSZA 4TVPD 2ERJC 1VERA 4JPKH 4JFOB 5GSVA 3AFLA 5GRYA 2BOCB 5HI5D 4NT6A 4XPFH 1T80A 5E5MB 5BXFA 1JHKL 1KTDA 4P99A 5GIRA 1YYMH 2EKSA 3DROB 4A2LA 4OKVB 3GBNH 5DHYA 2I9TB 2JKXA 2VERN 1DJSA 1N64L 3C8KA 3REWB 1MOEA 4HIIB 3TO4A 1WBXB 3F7VB 3P3YA 1XF2B 3ARSA 3KLSA 1SYSA 2YN5A 3F8UB 3FO9A 4ZOBA 1FZOA 3O41B 5A43C 2R0ZL 5KW9H 4KVCH 5EPMA 2ZCLH 3RU8L 5GRUL 4XP9L 2GUOB 5GJTL 1A7PH 3GM8A 4F7EB 2OJZH 4HUXB 2X10A 5KSBE 1TNMA 4LAJH 4HK3N 3LZFH 4JFFD 4HW6A 3RJQB 3FFCB 1ES0A 2A6JA 3RL1B 3NIDE 5KS9A 2IBGA 4RAHA 2AXHA 4TNVK 3MV11 1MWAB 5HD8C 2AJXL 4M93B 1MLBA 5FM5M 1ORQB 4YX2L 1U8JB 2AVGA 2DJSA 1FPTL 3E1F1 3GSRB 3U7WL 3IFOA 4S11A 3DYMA 4J3WA 2B4CL 3ZKNC 2AK4A 1FGNH 1RJLB 3CK0L 4RFNC 1R0AH 1N59A 1AD9A 4CMMA 3VXMD 1RVFH 5IK3B 5C0AE 3T0AA 3W39B 1C5CL 1CL7H 1KC5H 2NXZB 1IGML 1MVUB 1X5IA 2W9EL 1A9EB 3ETBF 5SWSA 3RTQC 3WN5A 1F8TH 4WHTB 2Q6WA 5FOBB 4KKCC 2VDML 3BPCB 4PRBB 3IRZA 4HUNB 2VL5B 4FQ1L 1S7RA 4KHTL 4G6KL 3LN5B 1N0XH 4UINL 3GSUB 1QFUL 4GMTL 3TN0A 5CGMA 1K8DB 3MCG1 2R1WA 1NMCB 2YA1A 1WIPA 1UQSB 1YEIL 4YXKH 1XGYH 2Q20A 1P7QB 1LD9B 3T65A 3IDMB 1IEAB 5C6TL 3TFKC 4PRPD 3JWDL 3SDXB 4TQEL 4UAOB 1RUQL 5DQ9A 5D72H 5T5NG 5IQ9B 2X4NA 5MP6H 3RX8A 4F9PA 4JM2C 4LCYA 3WD5L 1FRGL 3L3GA 5T5FL 3EOYG 5HI3C 4R7NA 5HGDA 5I8CB 4CNIA 5KG9A 5ESAA 4B7IA 4OCMC 2BSED 3RP1A 2C1PA 1JTOA 3RHWK 5TPWH 5EZLA 4TSBL 1XF5A 3GBML 3DUSA 2GITA 1BQHB 4M7LH 4JAMA 4K71C 3O3UN 1H9VA 4XVTL 1R5VB 1BAFH 4YK4B 1QSVA 3MJ9A 2YRZA 2R69H 4IHOB 4KMQA 5EU7C 3T2QA 3CCHB 1QEWA 1ORSB 2HN7B 2XQYG 2OQJA 4WV1A 4HH9B 2H8PB 3VE0A 3ARUA 1GPOL 2ZOLA 4LCIL 4I5BA 4QHLA 4OF3A 5L2KA 1S5IL 4YHKL 4N90D 3FOMA 4OSUL 1IZKA 2HWZL 2OR9L 4EIZC 4M8QB 1G0YR 1J88A 1M6OA 2XTJD 4XHJC 4UDTB 4ZQKB 3VH8G 2JIXB 1ZLVK 3KPTA 3WUWG 2V5MA 2YC1A 3GNMH 2J6EH 3CSYB 3QCTL 4MLIA 4OV5B 4MD5B 3T04D 2FCBA 2R2HB 5DJYA 1T83A 4F7TA 3BQUC 4JN2B 5C08E 1KIPA 1DVFD 4ZTOH 4J1UA 5HGAA 3ULUE 3INUH 2Z92A 5CSGA 1QA9B 2NY6C 1IM9B 5I2IA 2ERJB 3QQ9D 5DSCA 4XBGA 1L7IH 2NY4B 4LHUA 4LSPL 1ZHKA 2SEBB 5IB4A 4O9HL 4PJ5D 3KPSA 4NO0D 2BVUA 3OKKA 5DWUL 1JZ7A 5SWQB 1C5DB 4JR9H 3T0DA 3Q3GB 5FF6B 3B6SB 3QIWD 4O5LH 1YUHA 2E9JA 5F7HA 5LGHH 2CKBA 3O9WA 5CEYB 1FVCB 5J1SC 5DJZA 4R2GC 1K5NA 3NFNA 4CKVX 1DQJA 2D0FA 1FJ1B 2GTZB 3IDXH 4N0UE 2VH5L 3BO8B 1ZKAA 3SKJH 1UGNA 4KDTC 1G7JB 1LEKA 2XQYK 3C2AL 3EFFB 3G9AB 3HE7D 4G8EA 4HS8H 2EIDA 4KROB 3LKOA 5JXAH 3IU3A 5GQBA 4YHLL 3EOAA 3NABH 2X4TB 2MMXA 2P42B 2YK1L 4GKOA 5HHOB 3OAUL 4GUPA 4KUCD 2EO9A 3D85D 4U2YA 3QPXL 1SJHB 4WUUD 1NFDB 4Z0XA 1FIGH 5DK2A 3CFJB 4JB9H 4X4ZA 5IGXL 2BY0A 1DQTA 3ZTNL 5DYOA 3MRHA 1IZJA 4JRYB 3O3EA 1HE7A 4RFNB 4MNGA 5I1CH 3G08A 3JTTA 2F74B 3DNKA 3O45A 4WI2A 2WUCL 1YECH 2HJLB 3B9DA 3KPRE 2HMID 4F7MB 1IQWH 3W2DL 3FFCE 3DO7B 4AG4L 2RBLA 3V8OA 4M7KH 4CGTA 3JV6A 4D8PB 4LCWE 2VDOH 3AREC 2EYSB 1XCTA 5D1QC 1EVUA 2VNCA 1LEIB 4ZD3L 4HIXL 4KJQD 3TCXA 1KELL 2VC2H 3MLPA 5IW1A 2VZ3A 2IANA 4HXBL 1MFEL 5J9PA 2EYRB 3C60A 3LEVH 4XNQA 3OKOA 4JHBA 3M1BB 3O2VL 4P2RA 4PJIF 3A6CH 5TDPB 3VXSA 1KCLA 25C8H 4XNMB 4K3JH 1U8OA 4JFDA 4NQEA 1INEL 4XNXH 5DRXB 1SMAA 1T21A 4ZPTA 1JZ2A 4Q6YA 5BS0D 2UYLB 4M6AA 2FL5B 5TE6L 2KZ1B 1AY1L 2HKHL 2HTLC 2VABB 5DFVD 1JWSB 2YD1A 3DGGA 3IDIB 5C3TA 3BPOB 4NKDB 2X4RB 4KKBC 3VWJA 2IAMD 1HQRA 3MNZA 3N1MC 4AEHL 1R3LB 4J12A 1MRFL 4HJGB 4XC3H 3MRJA 3RWFB 4ZUSA 1A47A 3QDGA 1U3HD 2O5XH 4QTIL 4OIBA 4GSDH 4N8CL 2NLJA 1I1AD 1T2QH 2P5WB 3QUXB 4Y5XB 3WFHA 3ZHDA 1DDHB 2BSRA 1ZLUH 2FD6L 1RZFH 2XWTB 1U42A 3SDXE 4LLMB 1P9MC 4JRXA 1K2DB 4EZMA 3RIAF 3HR6A 4RIRB 5IB1B 1IAMA 3PWUB 1C12B 4LKCB 4DCQB 2Y5EA 3IETB 5KZCB 3ARGA 4WI5A 3MRFA 4POZD 3ROOB 3SO3B 3BD4A 5KS9F 2YWYA 2BMKB 2VZOA 5DC4B 1JJUA 5DC9B 5IVXE 2R0LH 2I9LB 1G0XA 3ARTA 1EEYA 5F1IA 3D25B 2UUDH 1MUJA 1CDJA 2YBRB 1RMFL 4Y1AA 5LGKA 2IBZX 4F37F 4ODVL 1MI5E 2BJMH 3QUZD 4FQIL 4W81A 1IGCH 4JDZA 2VSDA 4P9HH 1HILB 3T77A 3BWAA 3DVIA 3SDCB 5FYJE 5E8DL 2DLEA 2A9ML 3V5KA 2NY6B 2ADFL 4JY5L 1MF2H 3HFML 2BSTB 4LCUB 1TVHA 4LQFL 2XKSA 4WFFD 3U9PH 1PKQB 1U3ZA 1D9KD 2BVOA 3ULUL 5K59F 3W82A 4Q6IB 3RY6C 3EOBA 2VN7A 4FQLH 4HWZB 1DSFH 2J5LB 3CLFH 3MUGB 3O11B 4HX1A 3ES6B 2MWCA 2IALA 3L5JA 3DX8A 5DFTA 3T1WA 3F6LA 4HG4K 1NAKL 4LF3B 5D1XB 4R2GB 5GZND 2X4OB 4FNLL 2YD2A 3H9SD 4M9OA 4U7SA 1RJYB 2ICWJ 5IROA 1LO2H 4PY7A 3H7BB 5JPNA 1LNUB 4RGOH 5FYLD 1JN6B 1C08A 5I19H 4P2QA 2DWEA 2EDYA 3OXSB 1ZHNB 5I16B 4S2SA 4CW1B 5GGUA 1R3KA 3L3OA 2G60L 4D2NA 1FIEA 3MGTB 3NIGE 4Z18A 3NMEA 3F7PC 4GRWH 3S5LB 4TUOB 3VXNA 2NX5E 2BY1A 3QUML 4QRRA 1VA9A 4WIQA 5ADPL 3MRBA 2LU7A 4V2CB 1KB5A 3SEPA 4P4KD 2NTFB 3JUZA 4WUKL 4FQQB 3OTTA 3RUGB 4PY8J 3SDAD 5ABDE 3BPNC 1HHJA 4I18C 2E7LA 3V4PH 4D0CB 1CR9H 5I30H 1EFXA 3GMRA 2N1KA 5E2UH 5E99H 3JV5A 5DVLA 1XF4B 5BOZG 3VWKD 3MRRA 3FQXA 1I8KA 2ITDB 3QDJA 2A6KA 3BIBX 5DMJB 3SE3A 5JOEA 3DSNA 2BNRB 3EYQC 4KKLD 2FECI 3WIIL 2XN9E 3TH2T 1YNKH 2UY6A 4ODTH 2BVQB 5EU4B 1B4JH 1JMZA 1A6AA 4PRAB 3LSOB 3RVTC 4PB0L 4P5KA 3UJTL 3S3SA 1LVEA 1NFDE 2GT9A 3GMPB 4GAJL 4N68A 4XXCC 5F1OB 3O4LE 1QSEB 2HT2D 4JRYE 2NCMA 2LTQC 1MWAL 3MLWH 4X5XA 3PWNA 5K9KB 3RIFF 1NCAH 2BNQD 2WQRA 1CGTA 4XPTL 5TH2B 4DOHB 4IRSD 4P5MB 3VA2C 4GMSH 3P2TA 2IPKB 1NQBA 2DYPA 2VLLB 2WP3O 2ORBH 1Z6JT 2ZSWB 5HYJD 4OZHA 1QSFA 1A9BA 3L3DB 1YJDL 5IIEB 1M71B 4V1DD 1BGXL 4HBCL 4G8GB 4OTXL 1W72H 1AE6L 3L3IB 2EDDA 3KLHD 1K8IA 2XI9A 4OCYL 1NDMB 3MLRL 3U6RB 3RWCB 3UTPD 4FOMA 5C1MB 5J6HA 4LVOC 5IEHB 1BVLA 1CVRA 1FH5H 5MEQB 3OKMB 4OUOA 3SY0B 3L9RA 2IQ9L 4LSRL 3FB7A 1VENA 4QYOB 3BOVA 2P7TA 1WBZA 4RBPK 5DI8B 2YZ8A 4UNTA 5LG1A 5JHLL 4QTHB 3D3VB 4Y4KC 3V6ZA 32C2B 3X14A 2CMRL 1T7ZA 2E7MA 1IFHH 2FEDD 5DRZB 2ILLA 2EDQA 3MRKB 4LCCC 4PTUB 1NPUA 5DJ2B 5E9DB 4P3CH 1KENL 1DQMH 2HFFA 4PJDB 2HVJB 4Z7UE 4XNYL 1JF6A 1MFDL 3D0LB 2XT1B 4HJ0C 3DV4B 4C83B 4ORZC 1LILA 1JZ4A 3FRPA 4EUPG 3QHFH 3HZMA 5GISH 5FYJL 2O5YL 4YDLB 4P9HC 5FO8A 1TETH 1RIHL 1RZ7L 1UXWB 1BF2A 3I6KA 1IAKB 3DMMC 4YPJA 4OD2B 1AP2A 2A6DA 1PZ5A 4NNYB 3IXAB 4PJEA 5CIPA 3MUHL 5FDWB 4F33B 3CX2A 5J12C 1JPFB 1JNJA 3TYFB 3VFMB 4AT6A 3Q2CA 2R1XA 4Y19A 5E08L 5IM7A 5CINH 3V52H 2V7NA 4NN7C 5E1AB 4X83A 5IHUH 1H3PH 1PKQE 4NNPL 3HMXA 4UT7L 1VEOA 3UJIH 3RWEA 3PL6B 2A74B 4PB9H 4Y8DC 3IDUA 3O3AB 3VXUD 4PJBE 4WEUD 4MX7B 4YGAB 2MHAB 4OF5A 4ODXA 4RAUA 1TLKA 2P5EB 1A5FL 1OWRM 2PXYB 1J5OL 3QQ4A 2CGRH 4AIZB 5E6ID 4IRJB 1NDGA 2P24B 4C59B 3QDHA 3EO9H 4MXQC 3PHQB 4YBHA 1CGUA 3EDEA 1S7TA 4H5SB 3TWCH 3KPPA 1GOFA 3VFRB 4R96B 1OB1A 3PWJA 1WWWX 3ZKSD 2K1MA 4JFEB 3MRCA 2IBBA 1A14H 2QADB 4DGIH 1KLUB 4KWUA 1I9RH 4XTRC 4L8SA 2CH8A 3R8BB 4PRDA 5CP7B 1SVZA 4TRPH 2FWOB 2XY2A 1LK3L 5CJ8A 1KPRB 1VACB 1MJ8L 4QY8B 2IG2L 2PO6D 4K3EL 3I6GB 5DUMH 1XGQB 3TPKA 3UC0H 3K81A 2BRRH 2W92A 4ZAKD 3SCMB 3RX7A 2EH7H 4YGVA 3B43A 1MFCL 2OI9C 3GJFB 5CEXB 4PJ8B 4ZFOA 2ZUQB 1WBYB 4XMPH 4HUWA 3QO1A 3ZZ1A 4MJ4A 2FZ3A 1DBMH 3R4DA 4E42A 1W0VB 3CFEB 1FV1B 1IC4L 3F5WB 2HRPL 2IMNA 4Z5RA 2BNRE 3MQIA 4JQIL 4O2FB 4NCC1 5E2VL 2V9RA 2I25N 3W0WD 3RWDB 2APWA 1QYGH 5IFJA 5C0DA 1OAZL 1WUNT 1A6WH 5K9JH 2HH0H 5C8JA 3UTTB 2CIIA 3VG9C 3JWOH 4G9FA 4OCXL 1QSEE 3QZWA 1JK8A 2NY7H 4NN5C 4OKDA 3VFOB 8CGTA 4DWHA 5HHMB 2QQKL 5D2NA 2QKIB 2EDOA 2W91A 2Q8AL 3S96A 4H0IA 1S9KC 5HVGB 3WL9A 2ZJSH 4NN6C 5ITBL 4JCMA 1JYXA 2EE2A 4HSQA 5JW4M 1U3YA 3ZDYE 5F7WC 3MC0A 1BFVH 1BZ9A 2F5BL 1DBAL 3KNBA 4TOYL 3RDTA 3I9GL 2J1KA 3QRFM 2K7QA 2R4SH 1XGUB 1MAJA 2DTSA 5INDA 3NCBB 5DJ0B 3LY6A 1QLRB 3BKYL 2XG4A 43C9B 1IGYB 4LCCB 2VRAA 3RVVC 3CAFA 3MA9L 1XIWA 4L29B 3QFDA 1GGBL 1VFOA 3MGOA 1EZVY 4JY4B 2IH1A 2QR0A 3SBWC 1O7SA 2D7NA 5GXBB 1JZ5A 4WI8A 3CH1A 4Z95H 1OSZA 1NCBL 2B1AL 4XX1E 1JI2A 3BEWB 1CZ8L 1IGFH 5EULV 1QBLL 4HC1A 4G6JL 1YEHL 3D3VE 4FQXD 4ZXBD 1WSST 4D3CL 1HOCA 5D5MB 5JHDA 1TJIH 3MTRA 5FV1L 2FLBT 5MI0B 2FBJL 3ULSA 2EXWC 4LLVB 5C0AD 2RFXB 4PBWD 3QUYB 4D0BA 2XQBH 3PP4H 3D0VA 1KG0B 3RVUD 4NKMB 1HQ4A 3ZE2E 4EN3C 1T0MA 5HHQB 1I7ZA 5EBGA 3T8XB 1I3GH 1PSKL 3STZA 1BZ7B 3VFNB 4X6CE 1F6LL 4XPBL 3C6LA 1NLBH 4N0YH 1Z5LB 3VI3E 1FN4B 3DI2B 5C0EA 1QHPA 1MH5B 3SJVD 4OZHF 4OD1L 2DI7A 3TBTA 3AAZB 3FB8B