1UC6A

Solution structure of the carboxyl terminal domain of the ciliary neurotrophic factor receptor
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
109
structure length
109
Chain Sequence
b'GPLGSVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSNGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHATPWTEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ciliary Neurotrophic Factor Receptor alpha
molecule tags Protein binding
source organism Homo sapiens
publication title Solution structure of the C-terminal domain of the ciliary neurotrophic factor (CNTF) receptor and ligand free associations among components of the CNTF receptor complex
pubmed doi rcsb
total genus 13
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2003-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uc6A00
5C08B 1EGJA 1BVLB 3WO4C 1AXSA 4LSUH 2QV2A 1X9QA 4CW1B 2VSCA 5I15H 4IOIB 3RGVA 1NJ9A 2Q86B 1TJHH 2C4FU 1ZVSA 3MRDB 5DJ2A 4ZFOB 1K85A 5JO5A 2DJ4A 1T2JA 1V7ML 1Y18B 1FPTH 3ULVL 3OZ9L 1XF2A 2ICWI 1LK2B 4ZFFB 2I26N 4ZAKD 3TBSA 3QXTA 1MCKA 5CP3H 3UO1H 4DVRL 2YD9A 2CDEB 4YXLH 2BNRA 4U1KA 4L3ED 1SQ2N 5HGAB 1NCDH 4NZJA 1E4XH 4RISL 3ZDXF 2VAAB 5F7LB 4K71C 1IBGL 1OF2B 1CL7I 3EFFA 4G9DB 1JYXA 2OR7A 3ZKMD 3KPPB 2I9LA 4X6CF 1OPGL 4U1HB 2NY5L 5KSBA 1JVKA 4ZQKB 3QCVH 3QRGH 5DR5H 3SHSA 2DM4A 4NOBA 4JFZH 3F6IA 1UGNA 1ZT1A 3RVVC 3T8XA 3DV6A 2VZOA 1Q9LB 2DKMA 4OLWL 3TO2B 3UAJC 3VGHA 4OIAA 3ULSB 5F7FA 1I7UA 2H2PC 4PPTA 2VH5H 5TQ0L 4OCYL 3UC0L 4PTUA 4XCFL 2ADIB 4FQJH 5EOCH 3IDGB 2CLVB 3PDGA 4O51A 5D4QA 2D31B 3UTSB 4XZUA 1XF2B 1AHWC 2YMXH 1IEHA 4WU7B 2X1WL 4X9IA 3WFBH 5JHDE 3OAUL 4MXQC 1BQLH 2JCCF 2NQCA 2Y1VA 5FYJL 4QNPE 1U8NB 3OJ2C 5B3NA 2XOTA 4G9FD 3NCEB 3SGDI 2H1PL 5FCUL 4ZQKA 4E0RB 4DK3A 4J1UA 2W65B 5CWSB 2FWOB 2PTVA 4TVPD 2UVEA 1ZLSL 3ZE1F 1A6TA 2I9LB 2IALB 2RR3A 4P99A 1A6AB 1BJ1J 4K71B 4N90D 1LO5B 1BOGB 1UCTA 4OF5A 4X4XA 4FFWD 4D8PA 1Y0LB 4J3VA 4P5TA 1FGVH 2EEAA 3D39D 4YZFE 5SV3A 4WV1A 3O6ML 4G9FB 4MCYB 2IBZX 3RPKA 4PFEA 5CEXA 4L3EE 3Q6GH 3NN8B 1X5LA 4XPFL 4PJXA 4HKJA 5GGUA 1WT5C 5BV7L 4E0RA 4YR6A 4MCZA 4ZFFA 5DSCA 3VJ6A 3AREB 3QDGA 1F58L 2VXQH 3VXOB 4HX1A 5BS0A 4PJ8C 2K7QA 2D0GA 3V7AG 2MQ0A 4X6DE 1QBMH 1YEGL 4OZIE 3A67H 1U8QA 1JHKH 1XF5B 1AH1A 4K8RD 4E5XA 2O5XL 1G9MH 1Q72L 5HHOD 2P44B 4XMPH 1B4JL 1F3RB 3VJ6B 1U92A 3D85D 1U36A 1ACYH 4PJAB 1KIQB 2J1KA 4H5SB 4Y4FA 5F88B 5DFWH 4M48L 1OLLA 4RAVB 4Q9RH 3V5KB 3SBWC 3DSFL 2DLEA 3KPRE 4IIQA 2EE3A 1NUFA 2OI9C 5FUZH 3E6FA 3SE9L 2OSLA 1MCRA 2ZUXA 4UQ2A 1BF8A 3MXWH 4N5ED 1SBSL 2EDYA 4QRPE 1BJ1H 4F57L 5I8KL 1VESA 1ZHBA 3TF7C 4LPVA 1OCWL 3QO0A 2W0PA 5DRNB 1Y6NR 4ZPVA 1VA9A 5DTFB 5KSVB 4NZRH 1EAPB 1NGXA 3MRHA 4P5MB 3DV4A 2A9ML 3O2DL 4CDHA 2DKUA 3V4PL 1FO0B 5SWZB 2VLLA 4PRPD 3B9EA 3QAZB 1FQ9C 4RGND 3QEHA 1ORQB 2Q8BL 2YEZA 1HXYB 2VXSL 4G8GA 3V4VH 4JFPA 3C6LC 1Y18A 1P7QA 2CKBH 3V4PH 2ZCHL 1C08A 2OL3B 5KSAD 1I8KB 4YX2L 4J4PA 4KK5D 2LABA 4CUCA 5I1GH 3GSWB 3B5HA 1G7MB 3D69B 2ZWLT 4QF1A 5ERWB 3N1MC 5I8EA 4F8QA 2A9NH 1KN2L 2BMKB 3RVXC 5DJ2B 4ZFOA 4Z7VE 4YDVA 4TTDC 5IMLB 1UCBL 3X3FH 5M7QA 1TVBB 3JVGA 1F97A 4NPYA 1FC2D 1KN4H 4IJ3B 3QRFM 1A5FL 3KXFD 5EA0H 3RBSA 2YOCA 4D9LH 1UH2A 5D1QC 2O5YH 4U1MB 2BVEA 1I1FA 2CXKA 2Z35A 2BY3A 3BMVA 5IJVB 1FJ1A 1NFDB 3RUGF 1NH6A 1OSZB 3W9EB 3OB0K 1EBAA 3O4LB 4GAYB 2EE6A 4HLZH 1OM3H 2VQTA 3FT2B 1U95B 3T77B 2JJUA 5C6WH 3VCLB 3ZLQC 2IADA 1HNFA 5ICZA 3GSNB 4CVUA 3F12B 4JHAH 3WNKA 4GG6B 5CSZA 4GSDH 4Z7WA 1FORL 3X11B 3CSGA 2BNQE 3DROB 3V2AR 1KPUB 4TVSa 5IMMB 3T1FA 2AEWA 4YE4H 3PNWB 2IWGA 4QRUA 4AIZA 1YMHA 1OAQH 3NBNA 1X5KA 4HS3A 3RZCC 1J0IA 2JB5L 2ESVD 5E94B 3T0WA 3UXFA 5SX4I 4PBXA 2WWMD 4CRPA 4LSTL 4X98B 3QQ9D 5I71B 2R4SH 3O45B 1U8IB 2V2XA 1RMFH 1GGIL 3Q1SH 5I1KH 3ARVA 4WWKA 1P69B 3ZKXC 1F4YH 1MCHA 3CMGA 4PYHA 3STZB 2QQQA 5TE7H 5IIEA 1GCFA 4AM0B 4PJ5E 4Y4HC 1N5AB 4ALAL 3KLAB 2PO6D 3TZVC 1U8MA 1RV6X 3H7BB 3EW3B 2DM3A 1KJ2B 3WDHA 1WUNT 4KKBD 1FRGL 1YC8A 4LGSB 5LBSL 5FGBA 1UWEH 3WFHB 1E4XL 4PJ9C 4BFGA 3UX9B 1EERB 3H6JA 2VJXA 2DLTA 4EUPG 4MS8D 1FLRH 2FEDD 3RU8H 2HLFC 2LVCA 4XPFH 3BZEA 1MRDL 3HN3A 4RIRA 1DBAL 5HHVH 4X6DB 3VXRA 3MREA 4MAYD 5GS3A 4JFHD 1J7VR 5I73B 4XCFH 4L3AA 5IESL 3I50H 3K2UL 5C07A 1QR4A 2VDPH 3MYZA 1SY6A 4P2OC 4JG1H 3QBTB 3SGKC 1K2DA 3L95A 1I1RA 3W39B 1BGXH 3BESR 3MROA 1A6ZA 5EO0A 5JIIA 5T5NG 4PJCB 3JWDL 1AE6L 4F7TB 3EOYG 3TNMB 4CKVX 2G5BB 5AYUH 5E5RB 4GW5B 1KIPA 4YK4B 1ITCA 1WTGT 1MAKA 3L3GA 3QI9B 3R8BB 4RIRB 4JQIH 2ZUSA 1CR9H 3E3QE 4MAUL 1G6VK 1B0GB 2ICEA 3F7YB 4NQDA 3BD4A 4TUOB 3QXDA 4S1RH 3TBYA 4P46D 5E6IA 1UWGH 2XQBL 3UBXA 4ZFGH 4YO0B 3PQYE 1OAKH 4X7TB 5F96H 1XGPA 2NY4B 3U46B 4MSWB 4MJ5A 4WENB 5KS9F 2I27N 2GY7B 3HI5H 5TDOA 3HKFA 4GQ9H 5JA9A 3N50A 3LKSB 4PJFA 1H3VA 4XI5D 4MQXD 3S4SA 3LY6A 3W39A 4HUKB 2RAMA 1H5BA 4LCCA 4YHMH 3P9LB 1MHEB 3ZT7A 2NXZB 3QIUB 5FKPA 4F7PA 1U8IA 4POUB 3T1FB 4JDZA 4CU7A 4JRXA 2FL5A 1IJ9A 3RZCA 3IJHA 3MLZH 2NY5C 4XWGL 4I9WE 1ZT7A 3V5HA 1ITBB 4E9LA 1D9KD 3QEHB 5EORL 5HPMB 3VXQA 3PV6B 4FZEL 2OXGA 3W11C 4LRIC 1MCLA 3RTQA 5IKCA 2NX5E 5CLTA 5C7XL 3BJLA 2X4TA 3E2HC 2GCYA 1CGSH 4OM1L 4PGDA 5E2UL 5ICYA 3WLWD 4DN4H 1JHLL 1N6VA 4H0HB 3MLVL 3BPOC 3TV3L 4XBPB 5DRZB 3WO4B 3BT2H 4Q97A 4PV8B 3J8F7 3D39B 1MRFL 3ZKMC 1OP5H 5ALBH 5SWSD 3K2MC 2EKSA 4ZXBA 5D8JH 5BZDB 5ITFB 5ICXA 4JO2L 3VCLA 1H15A 5IW1B 1QKZH 4ELMA 1T04A 2EE2A 1EO8H 1HEZA 1MJJA 4J6RL 3VFTB 1G9EA 5IEHB 1QSZA 3IJSB 3LMJH 4HUXA 5D7LA 2ZNWA 3KPQA 1AJ7H 3QWRD 4K23L 2HTKC 3RWHB 5FV1L 3DXAB 4UTBL 3H8NA 1MFEH 3Q5YA 3U7YL 4WWKC 1R3LB 4F7CB 5EIIB 2GQHA 1R5WB 4NQVB 1TTGA 3ARPA 1AP2A 5MERA 2OMBA 2GK0B 5FYKH 1FO0A 3O6MH 1KPUA 4JFDA 2E9JA 5ISZA 4ZS6D 5EC2B 2GHWB 5EZIL 4RAUA 4OZHB 2C9AA 2A83A 4PRPE 4QXTB 4Y5XC 1ZV5A 1P7KB 1QBBA 3IAGC 1DVFD 3WNNA 2WWKT 4MCYA 4NWTL 3WNMA 5IBTH 4EDWL 3F7VB 4GRLB 5E70A 1KXVC 2XICA 4HZLB 4LEOB 4OQ1A 5IJVA 4TVPL 3O3DA 2NXYB 2IMNA 5BZWA 4D2NA 1I8IA 3FB8B 4JDTL 4UINH 2AV7A 3BGAA 2FWOA 2WINA 4OBRA 1HSAA 3C60A 4X7EC 4QKXB 4G80A 2IPTL 1BEYH 4LK4A 5F9DC 4NPYB 2OMNA 1EEQA 3MFFB 4XVSH 2IAMC 1U8NA 2OSLB 4HBCH 3KS0J 3VD7A 1I7TB 5CINL 4EXPX 1Q9WB 5KSUB 1CGYA 2HFFB 2O5XH 1OGAA 2HJLB 3GBNL 1KPRA 2Z91A 4IRJC 2H45A 4QRRA 1N4XL 3C8KB 3N9GH 5EWIH 5I0ZA 3SDXE 4U6XA 1GGTA 2WBKA 1X5HA 4P23D 2DYPA 1AGBB 1BGXL 25C8H 4UI2A 3TBWA 3GSNL 2BSTB 4LIQH 4NJ9H 4F7EA 1HXYA 4G8GB 5C0RL 4PTTB 3OL2A 3WNLA 4LSQH 3OKMB 3BQUC 2GJ6D 3OG6B 1M7IA 1YPZF 2ZUQC 4WV1B 3T08A 4OZFA 3VXMB 3PWPB 4L4VA 3QO0B 4P5TB 3C8DA 4PJ5A 3QDJA 2QSTA 4A2LA 1IGIH 4NHCH 4NN6B 4U3CA 3MODL 4JB9H 1DQDH 1CVRA 2J8OA 3OKNA 2DQHL 1T1ZA 5MEPA 5ESVB 4NN6C 1YMMB 2ZUVA 4KRPB 1U6AL 2C1PB 3IKCA 3KAAA 3LKNA 1JZ5A 4RAVA 2EDDA 1HH6A 3RIFF 3OMZA 3QHTC 3GI8L 3G5ZB 4J12A 5EU6B 3KGRA 2HT3D 2R1XB 2OZ4A 1KIRB 3CFCH 3GSUB 4DJMA 2H3NA 3S9DB 4NQVA 3BH9A 5MHSD 1OB1B 1HN1A 3T4AA 5J89A 3VD5A 3BH8A 3ARGB 1E6JH 3HC4L 1M6OA 1FLTX 4FQHB 3U6RA 1WSST 3PGDB 1I8LC 1MH5A 5DMGC 1ZWIB 5K9KA 3NFSL 3OJVC 1U3HA 3ILQD 4N0UB 5GJTL 3PWLA 1NCAH 4Z6AT 3VXPB 2F8OA 4P59H 3WD5L 3LRHA 1IFHH 1HHKA 5GPRA 4ZDHB 3S36L 5E2TL 3ZE1E 3K4DA 4P2RD 2V5SA 5INCB 4J6RH 4YFDB 1S9YA 5DC0A 5LQBH 2GFBB 1AGCA 3DTXB 1IGFH 1T4KB 3ZTNL 2CR3A 4JM4H 4N8CL 2X7LB 1I7ZB 1T6WA 3KYKL 2BJML 5HHOA 1Q9OA 2XKNB 3LRSB 3SJVD 4UU9A 3FQWB 4HK0B 1VPOL 2F53A 5D7SL 1U3YA 1AGBA 1T7XA 2WBJD 2DI9A 4B0MM 4NO0D 1J0YA 4JZOB 2DJUA 3D3VD 4U49A 1HKLL 4FQIH 1MELA 1OAKL 1YN6B 1N0XL 2XZCH 3ME0A 4I4WB 3WKML 3P0VH 3DVGA 1FSKC 5JW4R 1NANI 3U4AA 3STLB 3R06A 4OF3A 4XBGB 2B5IC 1Z9SA 2DJSA 2BCKA 2UZIL 5JDSA 3CGTA 5DJYB 3RVXD 2X5PA 5T1MB 1MAMH 1MFAH 4KDTA 5F9AC 1WV7T 3B9KD 4OF8A 2RJMA 3G5XA 3MUJA 5T5NF 2FIKA 5JW4M 4ZUTA 5C8JA 2Q7YA 5DC9B 1Q1JL 4APQD 1UM4L 4C55A 5HGAA 1HHHA 4YGVA 1A6WL 3JWDC 4TNVF 5H2BB 2D0HA 4WI9A 2AJUH 4NKIH 3GIVB 3Q6FA 2I5YL 3GI9L 1T66C 4PRBB 5J3HC 2E7HA 4APQB 5DJAB 4KMTH 5FK9A 1A0QL 1JV5A 4XNQA 2EYSA 4XNMB 2Q8AL 5ACLA 1FDLL 1QVOB 2B4CH 4OLYH 3BPCB 4PUBH 5TFSH 1C16A 1E4JA 3M1BB 4HXBH 4WI8A 5C0GB 1N4XH 1T1YA 4L4TD 2JCCE 3K3QA 3QHFH 5J57B 1O0VA 4PJXE 5L9DL 5F9WC 4AQOA 3KPQB 2EDTA 4LQFH 2YPLE 5EFIA 1QLEH 2WM0A 3RWHA 5SWSB 4TN9A 2NLJA 4XWOC 5C0BD 4EUPH 4OIIH 2XYCA 4JRYB 1SMAA 2B5IB 3GSVB 3IDYB 4L8BA 3T65A 2W92A 2OCFD 1N7MH 3ARUA 3OPZH 3BO8B 4LRNL 3IFLL 3G5VB 3L3DA 3O9WC 5JR1H 3HRZA 2HKFL 1KCUL 3P11L 4M6NL 1NDMA 3FT4A 3GMPB 2HTLC 2X89A 3ZE0E 3HS0A 4KZDL 1GOFA 1P7KA 3HI6L 4MJ6B 3IVKA 2KPNA 3VFMA 3QT2A 2VMFA 3RUGE 1IGCH 3L95B 3G04B 1HCFX 2I9TA 3NCCB 4W4OA 2BRRH 1NEZA 3AUVA 3BAEH 5HPMA 2ENSA 4XC1L 4PJGE 1B2WH 3CCHB 2A6JA 4QHNB 4X6DF 4F15B 4ZUVB 5IM7A 4YHNA 3RVWC 1RIVL 4P2RE 4W6YB 2AJXH 3K4AA 2OJZH 4NQXB 4M1GH 1PAMA 5D7IB 5GS2D 4BM7A 1YN7A 3RY6A 3MFGB 2I60H 2GSIA 2IANE 1K6QH 3BIAX 3BKYL 3S4SB 5DRWA 1YEHH 2HN7A 1QSED 5ALBL 5F1KC 2CMRH 5HY9B 4GOSA 3GBNH 4WGWB 4FQ1L 3EDDA 4ZS7L 5IWLC 3BN9D 1XGPB 3MV8E 4U3XA 4ELMB 3K7UA 3SGKA 2P8PB 4JKLA 4J8RA 2ZUWA 3UBXB 4NQCD 4LF3B 5BQ7B 3P9WB 1H0DA 1EHAA 4JHWL 3O9WB 3WLBA 1IC5H 3IS0X 3VG0H 1JWUB 1G9NL 2QSQA 3L9RA 2VYRE 4ORZC 2A1WH 5TQ2H 1A9BA 3KJ6L 2JKXA 3GRWH 5A40E 5IR1B 3WFDL 5L2KB 4J8RB 2AABL 4M6OL 2OQJA 2AK4D 5J1AB 3T0XA 5E6IC 1ORSA 5F8RC 4YEEA 1PVHA 1JUFA 1ETZA 1JZ8A 2AI0H 4LEXH 3QNYA 1K2DB 1FFOA 3TN0B 3VXME 2WNGA 4P5KA 2R8SH 1TJIL 2PXYD 5CEYA 1EZVY 4NRZA 3NABH 5LKNA 4KAQH 5J56B 3PWPD 5IB2A 3VXSA 4KU1A 3QQ9C 3P4NB 4LSSH 3IXAA 4YLQT 1DDHA 1NBYA 4DZ8B 1OWWA 1WIOA 1RUPL 4EQ3A 1EO5A 3CDCA 3L5JA 3OAZK 2OLDA 1ZLVH 5B4MC 3AMLA 1XGUB 2CDFA 1YMMD 3LEXA 4YHYB 1MJ7L 3ARBA 1IGML 4X99B 5D2NA 1MCIA 4P2OD 4OD3H 2A74A 5A2LH 1WGOA 3TPUB 4PRPB 4L1DA 4R4FL 1KTKE 3D2UB 4KY1L 5JDSB 2VKWA 5DR5L 4M61B 4JPIB 2NY2C 3F62A 1FYTE 3FO0H 3P4MA 5E9DA 4WU5A 2FX9L 2QKIB 5FGCE 5FHAH 1UJ3C 2QTEA 4KY1H 3D3VA 4LKXB 5D5MB 1MQKH 2P5EE 4NYLA 5AUMB 1XGQB 3MV7E 1KIQA 1DEDA 4FXKB 5GGQL 3H9HA 3BWAB 3CFEB 2X1XR 5KS9E 4UIKH 2CR6A 5GJTH 5INDA 3FRPG 4GBXC 4LBEB 1M7DA 2GW5A 5AAWA 1ZSDB 4D0CA 1MY7A 4K7PL 5JOFA 1FYHB 1NGPL 2A6JB 3D87B 4HUMB 1NCCH 3WIFA 4S1QH 1ZHLA 3SCMD 3SDYL 2X4RB 1SVZA 5LWYL 2NX5D 1P5UA 3FQTA 4OZIA 3HE6C 4PP2B 3MX0A 3DHJA 5E5MB 4KTEH 3JUZA 1BBJA 2DL9A 4UZGA 3FTGB 3DYPA 1A1NA 5KSAC 1S5IL 3AXLA 1QFPA 4DUXA 1WF5A 4RMQA 2B1AH 1N59A 4NNYB 4YDLC 3QH3B 3ELAT 4OD2B 3E0GA 5TF1H 4HKZB 3X13A 4J2XA 4Y16A 3MV7B 1DFBL 1CGTA 3RRQA 5CSGA 2DWDB 5E8NB 4TULH 4NZUH 2ICCA 5J0BA 5E8PA 4UT7H 1T0NB 2EYRA 3RDTA 4P23B 4L4TA 2YPVL 1TCMA 2Z0BA 3ARGC 3NTCL 1NCWL 2DD8L 3OTTA 3WJLA 2UV3A 2HJKB 5F89B 4NBXB 1QQDA 2X70A 1WZMA 3PP4L 4A2MA 1G7MA 3D69A 5L88H 1F4HA 1XGTB 2BVTA 4XMKH 4Z7UF 4F37K 3WE6B 1I9JL 1BVKA 3MMEA 2WLYA 4WHDA 4XBEL 5H35A 3VFVA 4HMCA 5F7YC 2PW2A 4JQXA 1RPQA 1X6NA 4RFEB 2Q3ZA 3Q6FB 2AERT 3WFEL 4XNXH 5CSZB 5JW5A 1JJUA 5EOQH 3KG5A 4RBPK 1IEBA 3OGCA 4HKBB 3IDXH 1WBYA 4ZPVB 2ITDA 3F7RA 1NLDH 4WFFE 1KB5L 1KUMA 2OTUA 2BK8A 4CDGC 3LN9A 2AJZB 2R4RH 1EVTC 3OQ3B 5MEQB 4HXAH 5EU4B 1J87A 4C58B 1NAMB 2A1WL 5B39B 1G7JB 3VWJA 1CBVL 1QFOA 3FOMB 4NNPL 3FQRA 4PY7A 3VG0L 2OJEA 4M6MH 4JRWA 1UWXK 1RAMA 4RFEA 5BO1L 5L2JB 3C5ZB 4JM2D 5I16A 4FHBD 1IGYA 3RX5A 3HMWH 4ONFH 4QF1B 5ERWA 5C70A 1LO0H 4PJGA 5LGHH 1CWVA 2UY6A 2X42A 4K23H 4LNRB 2Z8RA 4XNZC 4RDQF 1XF5A 3QO1A 4Z7WE 2HFFA 2IC2A 5JUEL 2VL5B 4PG2A 4NOFA 1A8JH 2MWCA 3NGBB 5E6ZA 4DCQB 1K5NB 1RUPH 4RRPG 4RRPA 4ODXB 1Q0YL 3MRNB 1LDPH 2F74A 5FOBA 1ZOXA 5F1IB 1OWRM 3L3HB 1I3GL 4QY8A 1SEQH 3SDXF 3D18B 4ELMF 2DLHA 3ARQA 1CICD 4WW2B 5FUOL 4HKZA 1V3MA 3X13B 3MV9A 5I19L 1HILB 1C8PA 3L5HA 3G6AB 1CE6B 1QPXA 5BS0D 5GSVB 3S98A 5E2WL 5DQ9A 2DLIA 4R4BB 4IHOB 1KLGB 4MDIB 2X09A 4X6FA 2IG2H 3UBXI 4DZBB 5J4MA 1T3FB 1CDIA 5FGRA 4WW1A 4JJHA 5ACZB 1AGFB 1KJMB 3EOBA 4P5TC 1X5ZA 1T20A 3N85L 2DI8A 4ZODA 4EN3C 4MA1C 4JLRA 4HIHB 1WT5A 5IVXF 43C9A 2WQRA 1GGYA 3BHBB 3OKEA 3UC0H 3GJFK 2CD0A 2D7OA 4GMSL 4XNZB 3RFZC 4RMSA 3RWGB 4PP1C 3IDYC 1EGJH 2FJHA 5DUBB 1IC4H 3BKCH 2P47B 4AENB 4ZUSB 1GGUA 2GSGB 5I74B 4JFXB 4Y4KC 4YNYB 2ADJB 2QQNH 2R0LH 1IC7H 4X6BA 1JRHI 1S9VA 2D9CA 4LCWE 4MNHB 3L6FA 3MRGA 3RA7L 4MCZB 4QGTA 5IEHA 2H32B 2Q76A 3MRKB 1F90L 4IRJB 1ZT4B 3QIWB 4M7KL 1LK3L 1AGDB 5IB3A 4U4BA 4UDUA 3ZZ1A 2DTMH 1HI6A 5TE6H 2WZPD 3TWCL 1WFTA 4XP9H 2GJZA 3D3VE 3C08H 4E41B 2GAZA 4U3HA 4QHUB 3VFOB 2NZ9C 5GXBB 1KB5B 3O9WD 2PNDA 2AJZA 4UILL 3RAJH 4L8CA 2NCMA 3TVMB 1GGBL 4P9HC 1FZKB 4NQEE 4P9HH 3ZDYF 1CT8A 3MRRB 4KUZH 3T4YA 2VN4A 5KJRH 2XZAH 5ESQB 1QSEB 4OCLC 2XWBB 3HNSH 2XZCL 2QHLA 1IAIL 3O41A 5ISZD 1UACH 3NACL 4XCNB 2IAMA 4XVTL 2V5MA 2NY6C 2YZ8A 4GMTL 4LCWB 4PRHE 1AC6A 4QWWC 4PR5A 4JN2B 2RB8A 5I74C 1W2KT 3FT3B 4JZJA 4U1JB 2HRLA 5D2LA 3L7EA 4YX2H 1KBGH 2EE9A 5JHDD 5F21B 2VZUA 3DURA 4X4YB 2CJUH 2HLAB 4Q0XH 2XXMB 1XCTA 1YPZE 3QULA 2W59A 4L3EB 3W0WA 1YY8B 4ONHA 2DDQH 2A73A 1OGAE 1PEZA 3QIBD 4WI6A 4WJ5A 4ZFGL 1B3JA 4KMTL 1U93A 2BC4A 1V7NH 4Z7VB 2A6KA 2CK0H 1MCWW 4NHUB 4OV5B 4NQDD 4JPKH 3ULUE 4Y19D 4LCCC 1D6EA 5E2TH 4UNUA 4P49A 2EC8A 4FQXB 5IFAL 2BXYA 4EDXA 1S7XB 2CK0L 3O6FB 1A64A 5DJDB 3TO4B 1RZKC 8FABA 3U82B 3B6SB 4BKLB 2NW2A 2BOBA 4FQXC 4JFYB 3REVB 4XNYL 1IGTA 4AIOA 1FE8H 4TRPH 2JJSA 3LS4L 2APWA 3KNBA 3JV6A 3V6FB 3WYRA 3IFOB 5JHLL 3S35L 1NMBH 1ED3B 3RX7A 1NC2B 3RGVB 1V5JA 3O0RL 4HFUL 3I75A 3VRIB 4GRMB 4PGBA 1S8DA 1T5XB 4C59B 4GRLD 4B7LA 2NY2B 1FL5A 2WUCH 2XTJB 2X89D 4OLZL 3G6JF 4DQOH 3CFJB 4HGWB 5HD8D 4NUJA 3VD9A 4D3CL 2YA0A 3O2WH 3G5VA 4QOKD 4X83A 1W72A 4P48A 3U46A 2GTWA 4U05A 3RJQB 1JYVA 1S7WA 2EKSB 4R0LA 4ZXBB 5BZDA 3DMMA 1K8IB 1NCBL 4UAOB 4X6EB 5D72H 4XAWH 4Q58C 4D0BB 2X4UB 1RZIA 2IBGA 4DKFL 4Z76A 1F13A 1OM3L 5DYOA 1OARH 3OKDA 3LKRA 4OQTH 5DJXA 2XQYK 1VEOA 4PJ9B 1AD9B 3MBXL 1KGCD 5IV2A 1OY3B 3C6SB 1HZHL 4Y16C 1F3DJ 2VE6B 5IB2B 4M7JH 3ARYA 4G6JH 1DBAH 1Y6KR 3S6CA 3E6HA 4QHLA 5E03A 1S9WA 4EVNB 3RZCB 2FCBA 2FZ3B 4HEME 3MUGB 3NFNB 1D5IH 5DVNA 1R6VA 4ZSOE 4YFLF 2XNAB 2XIDA 2F5BH 4AH2B 2WWMC 4FRWA 3P9LA 2CKBA 1ZANH 4C56A 3PV7A 5CBAA 3MRFB 1H3WM 15C8L 1MCNA 3GEWB 3VGFA 5DJXB 5HJ3A 2HMIC 1FYTB 4L8DA 5T3ZE 1OTTD 3PWUA 2DMBA 2DQJH 4YPGB 1LDSA 4Q9QH 4PJHB 4F58H 1VEPA 5JORA 1A1OA 3FB7A 2P7TA 1F4XL 2RFXB 4MD4A 3LEVL 2J8UE 3U7WH 2ZUUA 3Q1SL 1FGNH 2VDLL 5EBLA 5L8KB 2ADGA 2P5EA 1D9KB 5AYQA 1NGWA 4Y8DC 1CVSC 4G5ZL 4IRSB 3SE3A 2BVPB 4P4KD 3O6KL 5C0JB 3QQNA 4RCAA 2E8ZA 1AD0B 3D85B 5MEOB 2YSSB 3VW3H 3IJYB 3ARGD 2XXCB 1F4AA 1JPGA 2ZG3A 3GSWA 3U36A 1FNLA 2VXQL 3FRPA 1VERA 1YY9C 1SJHA 1G7LB 1UM5H 2Y7QA 3C60D 3MTRA 1NBVH 3I75B 3VRIA 3TCLB 2NXZC 3QIUC 2Z92B 3O2DA 1UT9A 4XPTH 1AKJA 3RKDC 3TIDB 3BPLC 4YHNB 4FQXD 3IFOA 1IZJA 3UJIL 4M02A 2B7DT 1IT9H 4DKAA 3ARDD 3SKOA 4FS0A 3T2OA 4PJXF 1I8LA 4JGUA 5L6YL 1JGLH 1MFCH 5KSVA 3QCUL 1KCSH 4K94H 4QLRA 3KR3H 3C6LD 3PL6A 4HJGB 5D5MF 4PG2C 3FJTA 1IKFL 4ZDHA 4ZFOL 2JLLA 1CBVH 4GLRI 4WFFD 1DUYB 4YC2C 5I8CA 3GMLA 1PBYA 2VLMD 5F7DB 3B4NA 4JY5L 1LO4H 2E3VA 5IB1B 3GMNB 1JK8B 2VLKE 3KYNA 2LTQC 2E27L 4BH7B 4EDXB 4YUEH 3WKMH 3NVQA 4G43A 3QFJE 4R3SB 3INUH 4L8BB 2E7LA 1I3RB 2DM2A 4WWKB 2A0LC 2XQBH 5D1QD 1J8HD 2GK2A 2L0DA 4KV5E 4OZIF 1CZ8H 2Y07L 4XP5H 3BI9X 4LAQL 3S4SG 2DLFL 4OCSH 2R56L 3U4EA 1NLBL 2V7HA 1DQLL 4Z77B 4UDTA 1L0XA 2K3TA 3MLSH 1KIRA 1UKSA 3N1QC 4WFGD 4L3CB 4OCWL 3QQ4B 1G7QA 2PTUA 1YZZA 4PR5B 5EBGA 2EO1A 5IMOB 3QWRA 2B1HH 1YEDB 4M1GL 2UVFA 5BV7C 5FB8B 2WUBH 1MFNA 3F7PC 3MA7A 5BV7H 4EIGB 2AQ1A 3EDFA 5IG7B 1G7HA 5IBUB 1X6LA 4K2UL 4MA3B 5ADOH 2AGJH 4MJ4A 5CEZH 2HVJA 4MNQA 1P84J 4X6CA 4D9LL 4JFDD 4P3CH 2H8PB 3VFGH 1XIWD 3P73B 1UEMA 4H20L 4DAGL 1L7IH 5C8JB 3UZVB 4DVRH 4EXKA 2DM7A 1FLRL 5I15L 3NTCH 4JHBA 5FA3B 4GH7B 5CEZD 5GS0D 3SQOH 5BMFL 2UWEF 3RJDA 5HHPB 4DVBB 4QT5B 1BQUA 4QWWD 4V1DD 3MRCA 3MLTA 4UT6L 3P2TA 4IMKC 1MPAH 4RWYH 1KLFA 4G8IA 1EK3A 5LWYH 4L8CB 1IC4L 1MIEL 4XX1E 1ZTXH 4M5ZL 5HI3D 3ULUD 3MQIA 3FQUB 2IPUG 2RIKA 4Y4HA 1OGTA 1PYWA 3K2UH 3I50L 3KWWB 5T33H 2AKRB 2Q87A 1I8KA 3MRLA 2VLJB 4PRAA 4MNQD 2VRAA 5JIPA 1MF2H 1OAXL 4MJ2A 3VRJB 4PRDA 3RAJL 4DW2H 3MFFA 4QEGA 4CU6A 3MBEC 1J12A 1VADA 2R15A 4Z7UE 4HGMA 3LQAL 1CQKA 4QXGH 3AREA 1EMTL 1BIHA 1R5IA 1U58A 1CIUA 2ZJSH 3VGGA 1JGDA 2VO5A 3QPQD 1OT1A 4O2EA 5CFHA 1B88A 4FABL 3M17A 2CDGA 5JXAL 4DZBA 3HUJA 1J5OL 1MFEL 5INCA 3CU7A 3ARDC 3CUPA 3RNQA 3PHOA 43C9B 1HHKB 1W0VB 4XTRC 2FX8L 1TPXC 1F4XH 3P9MA 3DXAE 5EU3B 5EIQA 5CLWA 3O3EA 1HYSC 4H26B 4XTRD 1VGKB 3O4OC 3U9PH 1MNUL 1JIBA 4QRTA 5DZLA 1UADC 4G6AD 4JJ5A 1RZGB 4UT7L 4IS6B 3P9MB 4ZAKA 3TYGL 1JZ4A 3V52H 2BY0A 2XKUA 3B5TA 5FUCE 4I2XE 2Z31D 5DVOA 3D48R 2H3NB 3P0GB 1DUZA 1D6VH 4OCMC 4TPRH 1OSPH 3JUYA 3R1GH 5GIRA 1TTUA 3VXOA 1XMWA 3KPRD 1T89A 4WHYH 3SGEH 1RZKL 5ALCL 2NY5H 3GBML 3DSNA 3AVEA 3K1DA 4HULB 4IOSD 1V3LA 5D7LE 2ARJQ 3JV5A 3WO3B 1PSKL 1ACZA 3CFDB 1YJDH 4PB0L 2PYFB 1S9KC 4BQ8A 4LLMB 4Z7QE 1U3JA 1S7TA 2F8VA 1QSFB 5A16A 1TZIB 4FNLH 1I8MB 4M8QA 1CK0H 1LO4L 5DJ6A 2DOCA 2H9GA 3NPSC 5IF0B 4EUPB 3DGGA 2BVQA 3WMSA 5C71A 2HG5B 5GS0C 3OX8B 1CXIA 1JWSB 2WK2A 2BVUA 4NRXA 4TOYH 3VDBA 4KROD 3T0EE 3QDMA 4Z8FL 1HHJA 1NMCB 4LVNC 5EU4A 5DUPL 2CDEA 3LHPL 4AG4H 4KI5C 4KPHH 4NQSA 1S7QA 3RZCD 4F3FB 2DD8H 4FG6C 1H3XA 1KGCE 4Q6IA 4PJHE 1ROWA 3QUXC 4KUCD 1YYLL 1JZ7A 1E0OB 1VB9A 3ZTJG 1VDGA 2FSEA 4CMHB 3IU3A 4LSVH 3QUZC 2DQIL 4U7MA 4F2MB 5GRUH 3U2SB 3QIBC 2O26U 5FDWB 2EYTA 4OM1H 4HC1A 4NIKB 3G9AB 4R4ND 1E6OL 5LAXA 3BEVB 3QUZB 4G80B 3DV6B 2OL3H 4HWBA 4MDJB 5LJYH 5E08H 3WEXA 1PX3A 5DEGB 4OCRL 4NWTH 4UV4H 5JLZB 1LEGA 1BLNB 3NCYP 4RX4A 3LN5B 2PO6B 5CILL 5JQ6L 3MYJB 4FQQA 3F6LA 2NY6B 4Z5RA 5B39G 2ATPB 5D7IF 1R24B 2K7PA 5F3HA 2A6IB 2ED9A 4WW2C 2VAJA 4YHKL 1ACYL 1AR1D 1MCPH 4NSKA 4QXUL 3BRGC 1MIEH 4MHHG 3W2DL 4TTGA 2VZ1A 4XVUD 5F7DA 2V9RA 5EC2A 1R3HB 1IRAY 3SE3C 1T66D 3RUGA 4MXWH 1Q0XH 1JNNH 4NT6B 5ID0B 1NUNB 3VI4E 3WL9B 4G7YL 4JAMB 1OTUD 3RX8A 4M00A 4PB9H 1U3HD 3DBXA 4W4NA 5DD3H 2FO4A 1QACA 3ARBC 2CIIB 3VXTA 3OWEA 4RZCB 3MRMB 4KRMB 2IPKB 4RQQA 5IB5A 1LILA 1MCCA 2IQAB 1IEAA 1S7SA 3ZHDA 4XPGL 4HUVB 2OBGA 4OJFH 2E9WA 1M7DB 1L6XA 2Y36H 1JWMB 1DCLA 2VXSH 1VENA 3L5WB 3U0PB 5IW1A 3WJJA 1NDGB 4KMLB 3HRPA 4PG9B 4WUKL 1QG3A 4PRPA 2XTJD 3ARDA 4FXKA 1RULL 4OAWB 2MHAB 4YWGL 2FD6H 4I0PD 1QBAA 3RP1A 2APBA 1REIA 4ACPA 2QKIA 4H8WH 3AS0A 3O8XC 4J4PD 4PGCA 1FNGA 1A7BA 4CMMA 3STBA 5K9OA 2JTDA 1ZMYA 3HI6H 3MNWA 1H3TA 3UBXG 5LGJA 3LN4B 5HXMA 1C7SA 3C87A 2UUDH 3WS6A 4L4VE 4H88H 2XZQL 5GHWL 3LEYL 2I24N 5EOCL 2F8XC 3DVIA 5DS8A 5HYFA 3OKKB 4C83A 2GIYA 3RWJB 3ZSTA 3CVIL 4MJIE 3H42H 2EC9T 4ODBD 4I3RH 2IH1B 1MQ8A 4G8FB 3I3DA 5GQBA 1U95A 4LQFL 2KUTA 4AJ0A 4FQJL 2B0SH 4EI5C 5J1TC 5DRXB 3RNKB 3RY5A 3ZT5A 4YHLL 4M9OA 1KJVB 1UXSB 3CH1A 4I48A 1M1SA 4XAKD 1F4WH 4TSAL 4X4MA 1QSFE 4WIQA 2DQFB 1U3ZA 3MJ8A 3QCTL 1KFAH 2GTZA 4Y1AD 4PJDB 4O5LL 5AYUL 1OAZH 4E42B 5FYKE 4AEIH 2VOTA 5ACMA 1E28B 1YEEL 4QRSA 5HGDB 3GO1H 4B41A 1CXKA 5JQHC 1DTUA 4JEGB 1QSVA 5DMGD 3W0WE 4HJ0D 4UT9L 3GSRB 1BZ7B 5F44A 4Z8FH 5ETUA 3O8XB 1FZMA 1LP9F 4KKAD 2X4OA 1I3GH 4D0BA 4F7TA 2VZVA 4PD4K 4ZD3L 2F58H 5ADOL 4NKMB 3CLFH 1RUKL 3MJ9L 3GMRA 5F7EL 1DZBA 3KPRA 4KI5E 3EO0A 1KJVA 2ADFL 1FZJA 2VABB 3OR6A 1TXKA 1JF1A 2X4QB 1YYMH 2EZ0D 2E7CA 1MCSA 3QUXA 4NDMB 5EUKB 4ZFZA 2D2OA 1IEAB 5HHXH 2FHFA 4N90E 1GRWA 1DQML 3TZVA 1B4JH 3M8OH 4I0PA 1TJHL 2R0WH 4FQLL 4O2FA 3DX8A 5C0CA 2ZZUT 3IF1A 3MXVL 3BYYA 4LMQE 1OTSD 1ZLWH 4I18C 2Z9TA 1QEWB 1W72L 3FFCE 2BY1A 4HH8A 1QFWI 5I1CL 5DK0A 1AKJD 5GGVL 1N5AA 3E6FB 3RGHA 5IWLA 1A6VL 5KW9L 2E7BA 3BIKA 1NFIB 3QJFB 1DBJH 3HZMA 3H3PL 5IMKB 4JZNA 4XRCA 5C3TA 2DQGL 3VRLF 1JE6A 2Q20A 4JO4L 3LQAC 1L7TH 1KJ3H 3MUZ1 1YQVL 1A3RH 1F11B 1UVQA 2A6IA 5FUCC 1PQZB 3OXSA 4X98A 4JO1H 1KCSL 4K94L 1IGIL 1QOKA 4NHCL 4NM4L 1YNLL 2R2EB 3K1KC 4YIQB 1CDCA 1FL6B 4A6YA 5IFJB 2QQLL 3ESUF 4NUGH 1JZ3A 3N0PB 2Q6WB 5JW4Q 1DN0B 1CL7L 1IAOA 2QQKL 3GSVA 2Y5EA 5GGTH 2AI0L 5DVLA 2VXVH 4K7PH 1HSBB 1MUJA 1BFOA 4PJDF 2G2RB 3KJ4B 4X5WA 3CFBB 4XPGH 3QDME 1CU4H 5D1QA 1J11A 4FA8A 2P24B 2AXGB 4Y19A 3IXTB 1N3NA 5D93B 1BF2A 2XPGA 1S3KL 4OZGB 3JVGC 1F3DH 1UXWB 2AJVH 4J3WA 5IVNA 4HC1L 4NKOB 1KN4L 4HT1H 3DOSA 3W11D 4MJIB 4GAJH 5F71A 5D5ME 3GIVA 5C9JA 4UBDC 2AEQH 3I84A 4U2YA 3WN5A 1KN2H 5I1HH 4KKNA 1IGMH 2P49B 3M07A 3RY6C 4JDVA 4ZOCA 4M1DL 2UY7A 5TH2B 2P8LA 2YWZA 1AHWB 3GI9H 5DYOB 4M8QB 3VFNB 1C5DB 3M8OL 1U8JB 3HNVL 1AO7A 2EXWC 1T7VA 3EO1B 1U8KB 4Z0XA 2AJYH 1JN6A 1S7WB 2D03H 2IEPA 2ZUQB 4WV1C 3GJFH 4ODTH 3C5SA 4FNLL 1U2CA 1D5IL 1HH9A 4ISVB 4U1IB 3CSYB 1HOCB 2ATKA 5DVKA 1ORQA 2NTSP 1CLZH 2ICWB 1CGWA 1MJ8H 1ZT1B 3L3IA 1UZ6E 4TUKL 5CGMA 3TWCH 4JM2A 2WIIB 3ZYIA 3JZ7A 4RMTA 1DANU 4PJBF 3TEUA 2ZSWA 2DYPD 3DBXB 2B0SL 3PIQB 4JPVL 1A3RL 5FYJD 5CEZE 3O11A 4MQ7B 1YNTA 1HQ4B 1YYLH 3LDBB 3QCTH 4IS6A 2XN9D 2R4RL 3HE7C 4OFKA 1MHCA 2BDNH 3VDCA 1ADQA 1AFVH 2NY7H 4G6MH 2NX5B 5E95B 5J12C 4MA1B 2QJDA 3GZKA 3AM8A 1G7IB 3NFPB 1KLGA 4H5SA 4MDIA 4Y4FB 4L4JA 2C26A 4K07A 1A2YB 4TULL 2BSRA 4HHAB 1T89C 2C4XA 5GGSA 5C3LD 5IOPB 4U6VH 2FJGB 5ITBL 4IOFC 5DJZA 4AMKL 4U0RC 1MEXH 2AAVA 5JW3L 5C1MB 1KEMH 1JGDB 5C08A 3O6LH 1VACB 4EDWH 2NTFA 2PO6C 4LFHD 4NO3B 4ZOEA 2NY2D 1MFDL 3S5LB 5I1DB 2ORBL 4XI5C 4WTWA 3VI3E 4BQ6A 1E4KA 4Z78B 4MWFA 5FM5M 5I66B 1PG7W 3MC0A 3S35X 3B5GA 2N1KA 1KJ2H 2XWTA 1SEQL 3AS1A 1WWCA 1YUHB 4ODHL 4JY4A 4NWUL 1T1WB 1R3IH 5IOPA 3ZE0F 4JFDE 2V5YA 2XG5A 1RZGA 4M8VA 4Q6IB 4D8PB 2O61B 3BQUB 2DN7A 4PB9L 1A6VH 1J8KA 2IQ9L 2N4IA 4PBVC 3G6JA 4HWUA 3GSNH 3ESVF 2W1NA 3C5ZC 1T7YA 4LL9A 4L29A 1P4BL 3MRQB 4K8RH 1LE5B 4AEEA 3HE6A 3QEQD 4M43H 5EU5A 5HHPA 1ULVA 1JI2A 4YHLH 3GHEH 5DVMA 5HSFA 4LRNH 4OF6A 2Q3AA 5EN2A 2L7UA 3RWIB 2FX7L 2MJWA 5TQ0H 2XWJB 2ZOLA 4LQ1A 4Q9RL 1RZ8B 1P4LB 1WBZA 4LHUD 3EAKA 1RZ7H 5IHZB 3A6BL 4A6YH 4PJ5D 1FVDB 1DLHB 4FTVE 2VDKH 1A22B 1KB9K 2ADIA 3MODH 1G6RL 5IQ9A 3CJJA 2DBLH 3ZTJH 5JHDB 2VISB 5KZCB 4WWID 4Y5XA 3WIIH 3QA3B 4JFFD 4U1NA 3UROR 1TITA 4U31A 4QOKE 4WVRA 4LOUD 4GKNB 5EPMA 3ZSSA 1SJVA 3PABA 1Q0YH 1CXEA 4LARH 3BN3B 3I6KA 3OKLB 3CMOH 5GRXG 5KTEL 3D9AH 3V52L 1KEGH 3CXDH 2VLKA 1JYWA 1F45A 2O5ZL 3JV4A 3LS5H 2EDHA 2DWEB 1R3JA 4XAKE 5JUEH 4FQCL 4XAWL 3TBTA 2MFNA 2J88L 5KANI 5L88L 4JN1H 3EJYD 3ULVH 1S7VA 5D1ZA 3BDBA 5IFHL 2X4PA 3G6DH 4N0RA 4C4KO 4JCLA 5C9KA 2E9BA 5IQ7L 3GMNA 1RVFH 4KVCL 4HZAA 1T21B 5GGSY 4I3RL 4CU8A 3EOTL 1QLFB 2F5BL 3SE8L 1S7RB 2R2BA 3T0DA 3IB4A 1CICA 4GMSH 2W60A 3V4UH 3RL1A 5FYJH 2OXHA 3EOTH 4LVNB 2KBGA 4DKEL 2C3VA 2X05A 4XP4L 1A21A 3MO1B 4XXDA 5H37G 3MCG1 2FECL 1FBIL 3BGFC 1CGVA 4OCXH 4BSWA 5IW6B 1DLFH 3PF2A 5K93A 2ADFH 5DK3A 3U30C 4YAQB 2YS4A 3WFDH 3RPIA 3LPFA 2VABA 2VIRB 2A0LD 3OB8A 3RTQC 2HT4D 3VE0A 1JNHB 5DHVB 2FX8H 4UUJB 4Z0BL 5DEZA 4LNRA 4WGVB 5GRVK 4OZHF 3F58H 4OD1H 4HWZB 1MCOL 3FQNB 1VFBA 4XCEB 5TH2A 1YNKH 3O6FC 5CZXC 4BYHA 5D7KE 1WIPA 2A9NL 5FKAA 1OP3K 3D2UA 5MI0C 1LDPL 1W8NA 2V2TA 4E42A 3BP6B 1KCVL 3EYFB 1DBKL 4HEPG 1L7IL 3D39A 4U1SB 4WHCA 5AZ2L 1PZ5A 1QYGL 3DLQR 3VFUB 3SJVE 1GOHA 3KDMB 5I1LA 5DRXA 4ZMAT 2AEPH 3HLAA 3TNNB 1INEH 3MRPA 2VDQL 1QZ1A 2WAHA 5I71C 4MZ2A 1EEZB 1KTDA 4Z7NE 1W0YT 3HNVH 1PGRB 4L4VD 3VI4F 1QRNA 2YD7A 4ODUA 4POZC 4U1IA 4YDKH 3DHMA 4G9FE 3BP4A 1JL8A 4DTGH 3MRIA 5I1JL 1DBBL 4EOWL 1BOYA 3P77B 5T1KA 3NA9L 4Z7QF 1KTLB 2EDNA 1J10A 5IVZA 3Q5OA 3LN4A 5DD1L 5HYQB 5B3JF 4OGXH 3BP5A 2VDNH 1U91B 3ZDZE 1FNGB 1KLUA 4H0IA 4C56D 1K4DA 3OR7A 4JGJA 4L4TB 3DO7B 2BNQA 4GSDL 1EHLH 5C08D 3M45A 1T0NA 3IDJA 4QXGL 4CADA 4N8VA 4WI7A 5T1KB 1HQRB 4YHYC 1SM3H 4RMRA 1LEIB 2FX7H 3B9KA 1FFNB 4JVWA 4NC1C 1RURL 4BFIB 3LAFA 1P9MC 3MR9A 1H5BC 5ENWB 4HIIB 3D0LA 2YUZA 2Z8WC 5DMKA 2CIKA 4RMUA 1QLRB 1UYWL 3RNKA 3WJLC 5I1HL 1QEWA 4OLVH 4ODSH 4X9FA 3BPOB 3QNXA 4ODVL 2R1YA 4P3DA 4FFYH 4QOKB 5F7KC 3LZFL 3MR9B 3LHPH 4AG4L 3T0EA 4KTYA 4YBQC 1I4FB 4P3CL 4JFQB 4HSQA 3AS3A 3VD4A 3GM0A 3QUYC 1FH5L 1V8HA 3JTTA 1F4YL 3S88H 4Z95L 2LAAA 1U8MB 3ZYJA 5HVWA 3NIFE 2LTQB 4NO5B 5LCVL 2D7NA 4J3TA 4BK5A 4HIIA 4Y19E 4LDEB 4WY7L 2HFGH 1ZA6A 3DUSA 1AR2A 5CKGA 1F3JB 1UZ8B 1A14H 5AZ2H 3KPRB 2CUHA 4JKPL 2V7NB 2A2QT 1I9IH 2HFEA 2JJWA 4H1LA 1C7TA 5TDPB 3ES6B 4EBQH 1J8HB 2I07B 3RU8L 1HINH 3ZTNH 3H7BA 4LCWD 2F54A 3VMPA 3W2DH 4TYUA 1ZA6B 3DUSB 2ICES 3ROLB 1M71B 1K3IA 1QR1B 43CAB 4UV4L 2EO9A 4YDLB 4P4KA 1A7RL 3L3OA 2ZKHH 4NCC2 4M93C 3SN6N 4NP4L 1N8ZA 6CGTA 4Y5VC 1I9RH 4JHWH 5AAMA 3V6BR 1EUUA 1MHHB 5D7JB 2YBRB 1BD2E 1CD1A 4KI5F 4RFNB 4D94A 4NGHH 3B2UD 1OOAA 3DURB 1QD0A 5KW9H 1G6RH 4N5UA 2NY6D 1P1ZA 5HVHB 3IKKA 1A4JB 2MQCA 5FM5O 3RVVD 4WHTB 1IM3A 4ZTOH 5IHLB 2V17H 2SEBA 4LCIL 3KYOB 2HYMA 3ARWA 3NH7L 4YBLC 4M7JL 2NY4C 4PREA 4JREC 5CEYB 2NY7L 3B6SA 4BKLA 3D25B 2HJFA 1CR9L 1RIHH 3LB6C 3TCXA 3MGTB 4WUUB 5IJKA 3PUCA 2ESVB 2QSCH 3QNYB 1ONQA 2XWBA 1TNMA 1U3HC 2UYLA 3PWJA 5GGVY 3L3JB 5FKAB 1FFRA 1S7VB 1A7PL 4OFPA 5D1ZB 1CT8B 5DJ8A 5DMJB 2OQJB 5J1AA 4WI4A 4O02L 1KT2A 4I8DA 1RZJC 2HTKD 4KVNH 3W9EA 5JPMB 4AIXA 1LEGB 4WUKH 3REWB 1RU9L 2VLKB 1UA6H 2MHAA 5HYJA 2PO6A 4HWBL 4YHOH 3WS3A 4XGZA 5F6IB 2EDOA 4OGYL 4OM0L 4RFOL 3RDTD 3RWDB 3X17A 5FDWA 2KZWA 5HPOA 2IANA 1S7RA 2WV3A 4YXKL 1NBVL 5A3IC 3LSOB 3QIWA 1GPOL 3IDNA 4PJCE 3HE6D 4N0YL 5C09A 3UTTD 1T21A 1FYTD 2HN7B 1J05A 2ZSVB 4FZEH 4JKPH 2VXUH 2OL3L 5FYJU 4O2CB 3WIHL 4WI5A 3RIFK 4F3FA 1RJLA 1CICB 2AVGA 4PJDE 5HGBA 2MKLC 3SDCB 2NNAA 5I1EH 1C5CL 5EN2B 2H2SD 1IAII 3SDAA 5EU7C 3V6FA 2YPKA 2MNUA 3DIFB 1AO7D 1IC5L 5E6YA 1DVFB 3HE6B 3HI1A 1MRFH 3RUGB 1GAFL 2VNCA 3QDMB 4O00A 3LKPB 5CJXC 4M7LL 1E4XI 1MI5E 1XGRB 5KSAB 1QLEL 4RGNC 2FLBT 4CN1A 3B2VL 1VPOH 1LP9E 2N7BA 4LLDB 5MENE 2Y23A 3OGOE 5DD6A 3PABB 4RGNB 4Q2ZB 1AE6H 3W9DB 3NCFB 2J8HA 2IFFL 2E6JA 1MHPL 1UB5B 2DMCA 5F7WC 4D0DA 1KG0B 2MTPA 3D9AL 4KJWD 5EBMA 2XWTB 1JNHA 3I9GH 5DHVA 5GZOC 4FQQB 1KFAL 4HFUH 3ROOA 5DUML 1MHPH 5J6GB 1NBZB 1BLNA 5GISL 1QA9A 3WIIL 2H6PB 1UYWH 4JFOA 3T0VA 3HAEH 3ZE2F 3MV8D 4DGYL 2IGFH 1UFUA 5ADPH 1NCUA 3QNZB 2DQCL 4RAHA 5JXEC 5GZNC 5EZIH 2R2BB 2YPVH 4XP6L 3Q48A 1IQWL 2IPTH 3EYOB 1QUNA 3QUMA 2J6EA 5EU5B 4LP4A 4ZG1A 2X9YA 4QRRD 5EBMB 4Q2ZA 2YN5A 4OTXL 1NC4B 2CO6B 3GUTB 2EZ0C 2XWJA 5FYLH 5I76B 1FCGA 1LE9B 4D9RE 1CE1L 1J1PL 2P43B 3CFCL 3S37X 2OR8A 3NN8A 2V2WA 3RIAF 4I1NB 2CMRL 3ULVC 3RI5F 1QP1A 4K9EH 4GT7A 5DQ9B 2VLJD 1GPOH 4N9GA 4YDJA 5I9QB 1J0ZA 5JOPD 1J1PH 3PQYB 5F1SA 4EBQL 1CFTB 5IF0A 3JWOL 3K8MA 2AXFB 3SEPA 3U83A 3MLYL 3QUMB 3LDBC 3QNZA 2IPUK 3TJHD 1GGCL 1S78D 3CLEL 5IT2H 1OD9A 3RWFB 4WDIB 2B4CC 2EXYD 4IMLA 1CFNB 2Z31C 4ODHH 3U7AA 3U30B 5I6XB 4P2QB 3OBAA 5CS7A 3OGCB 2YXFA 2AJ3B 4QCIA 5IVXB 1DQDL 2CUIA 1D7FA 5FO9A 2MKWA 4QNPF 4WFED 4I3SL 1XZ0B 4LPUA 3FHAA 3TO2A 4BUGA 3Q3GA 4ESKA 4HCRL 2FSEB 1VFAB 2CKNA 4Z78A 4X80L 3LMJL 1UH3A 4TUKH 5FCUH 1MLBB 2OZ4L 4ONGL 4X6BB 3RGVD 1F4WL 5EO1B 2AJ3A 3FQUA 4JKWA 3VI3F 2CQVA 5CZXD 3UTTB 1U8LA 1IM9B 2ESVE 4LAQH 3VD3A 3HPJA 3W9DA 5FUZL 3SE9H 4WDIA 4LHUA 1P4IL 3IRPX 4XNUL 1F6FB 2VITA 5F3BA 3VFWB 4HW6A 1GZPA 4YDJB 4GAGL 5DI8B 4OCWH 4PY7B 2W9EL 4GRWB 3JTSB 2EDLA 1CFTA 2XN9E 5DJ0A 3ARFB 4WUUA 1I85A 4XCCH 3G6JB 5I9QC 3O2WL 1HYRC 1WK0A 5TDNB 3ETBF 2AJSL 4JFHE 4R8WL 1MCJA 4I9WD 3VFSB 4BSVB 4X6CB 2EC9U 4HF5L 3GBLA 3NMEA 3V0AC 1J5OH 3EUUA 1ZGLA 4HUNB 1VFAA 4LPTA 1PX4A 2YWYA 4KHTL 4XPHL 5FUOH 1A5FH 4NRYA 3HR5A 4ZXBC 5C09B 1BBDL 4R7DB 1DQMH 4KJPC 5I66A 5DDHB 2LU3A 2ITCA 3PGDA 4CNIA 3PG2A 4ORGB 5I1AA 2QLVB 5DK2B 5EDXA 4ZNEE 5CCKL 1URLA 4HH9A 1TENA 5D7JA 3A6CH 3FFDA 3C2SA 3L3OB 4KTEL 4JM4L 4NZTH 3QXVA 4LRIA 2FYYB 4ODTL 3RKPA 3TFKC 3WHXB 3CSYA 4LSPL 4UB0L 3C6LB 1H8NA 2H26A 5DXWA 4DN3L 2W91A 4NJAL 1QFWL 4YIQA 5E4EB 3G5YB 3MOQA 1BWWA 3MXWL 1YEIH 1ZEAH 3GMMB 1QHPA 2J6EH 3TJEL 3BSZL 1ADQH 3FOLB 3QUKA 4JANB 4X4ME 2J5LC 5DD6B 2JK5A 3ALWA 1MPAL 4CVWA 2VSDA 4BZYA 5C0JA 3TA3D 5CUSL 3H7LA 4U6HA 4XP5L 4JPIA 3PL6C 3P0VL 2BXZA 1LD9B 3TIEB 4PREB 2FHBA 4HKXB 3NCBB 5E24E 4LCUB 5D1QB 5DHYB 4XVUC 1XF4B 4X8JA 5BXFA 3O11B 1DFBH 4MQ7A 2D4DA 4BZ1L 5FA3A 4CVZA 3MSPA 3QUYB 4ONOA 1JMXA 4OLUL 3CVHL 1FSKB 1OAYL 1U8PA 2W38A 3UTPE 5F9JB 4ZPTA 1K8DB 2J88H 3KLSA 1RHHB 1J05B 4U6YA 1GC1C 3FN0H 5D2NC 3FO1A 4GRWF 4JVUA 2CGRH 4NRZB 1C1EH 2IBZY 4CVXA 1FFQA 2DQUL 1M71A 4OCRH 1KEML 1A7RH 4OFVA 1JCKA 3TN0A 2JJVA 1H5BB 1IL1A 4AMKH 1ETZB 1FZMB 3HG1A 5I75B 2Q8AH 1Q1JH 2B2XH 3LD8C 4Z7UA 4ZO6A 4M4PA 1R0AH 1BZ7A 2CRZA 5B8CB 4LHJB 1YPZA 3MLTB 5H37H 1NCBH 4K3JH 4BZ2H 2ZUTA 3B2VH 5L8JB 2VDQH 3DIFA 3FRUB 2A74B 1E28A 3NA4A 5BRZD 4X6EA 3FB7B 3EOAA 3HG1B 1QSEE 2CO7B 3QJHA 5FHAL 1OARL 1XGUA 1WEJH 4CL7A 4HMEA 5CIPA 3O3DB 4AQ1B 3TZVB 1QBML 1YEGH 5JNYB 1B4RA 3WFBL 2QR0A 2EIDA 1IC7L 3R8QA 4JREB 3PHSA 4OLYL 3U0WL 4FFZH 3IETA 1G7HB 1E4WH 3MROB 5FF6B 5KOMC 3V5DB 2G5RA 2IH1A 4Y2OA 1A9EB 3CFKA 5J13C 2F53D 2XNAA 4NN5C 4OUOA 2FLRT 4P4KC 4PV9A 4R96A 2Y5TA 4TNVK 1QBLL 1N8ZB 3WIFB 4QTIH 4E41D 3KNBB 3VXNB 4ZO9A 1LNUA 1YEFL 3ISWA 1IGTB 4N8VB 1RURH 1Q38A 2GJ6E 4HKXA 3ULUH 1H3PH 3O0RH 4KJYB 3SO3C 2BNQB 3E2HB 1F11A 1UVQB 3CC5B 3UAJD 1M4KA 5JHLH 1BMGA 3X14A 4HUXB 3U9UB 5B21A 4Y8AA 3LH2H 4HUUB 3C9NB 3WHE1 4UUJA 3NFSH 4OGYH 4OM0H 2FB4H 4PS4L 5IK3B 1GVIA 3KPOB 3DO3A 4K7FB 5LBSH 4KHTH 1RHHA 4J4PC 4XPHH 5IIEB 2J4WH 5E08L 5L8LB 1FL5B 2RBLA 4Z9KB 1KXTB 1BX2A 4EI6A 1RULH 4M1CD 1GAFH 4YHPB 2IFGA 5I30L 3BQUD 3QXAB 3RVTD 3MLXH 4K3DL 2HFGL 1NGZB 1G6RB 4WUUE 2X9XA 5J3HD 5IM7B 4HWEH 1I1AD 1T1YB 1ZKAA 5EU7E 5J13B 3CX5J 3H42L 4NQEA 4JG0L 1HE7A 4P3DB 4S1SH 4UINL 3HAEB 1YMHB 4Q0XL 2EXYC 2YUVA 3QCVL 2R23A 3ARTA 5EC1B 4DGIH 2WBJA 3LEYH 5CJQH 4GAFB 1P7QD 1T7WA 4NC0B 3QHFL 2BOCA 2I07A 3FONB 3NAAH 3CFIC 4HS6A 2D9QB 4LU5L 1FFOB 2DICA 3HZVA 4HUUA 4P2QE 3VE0B 1NDMB 3EOAB 3UYOD 3UYRL 2RHEA 1ORSB 4KH2A 4MXQD 1F3JA 5FYLE 1DSFH 3LKRB 4JQVC 2D7PA 2EH7L 1DR9A 2EDFA 4DUVA 1IGCL 5F3BB 5I0DA 1R3JB 1FZOA 1BQHB 4RGOH 2AJSH 1QPPA 3DARA 4TQEH 4GLRH 5F93C 1TTFA 2P7TB 3SJVB 5L7XL 2Y36L 4ZOBA 3WS6C 3H9ZA 3DETD 4HWNA 3EZ8A 1KCUH 4PJHA 3S96A 2PR4L 1WFOA 1WAAF 1TJIH 2R1WA 3RL2A 1X5IA 2VXVL 1RIHL 1A3LL 4LKCB 1UWXH 3MCLH 3RI5K 3EKCA 3TT3H 4OUUA 3WFCH 4F2MA 3D0LB 1EEZA 3IT8D 3ET9F 3MV8A 2EIZB 2DLFH 4OCSL 4YDKL 4JZOA 3BP7B 4OSUL 5IUSA 1JPSH 4XCYB 2V6HA 3THMH 4KFZC 1JPFB 1N64L 7FABL 4OKDA 4PUBL 2ZOKA 1AD9A 2ATPA 1I9RL 3IDMB 3BW9B 2F5AH 2Z31B 3DI2B 1MCPL 3WHXA 1XIWA 1OQOA 5DTFA 1EFXA 1KTRL 2YD5A 2BVQB 2FGWH 3ARSA 4U6HB 2CLZB 4NSKB 5EO1A 4KHXL 5C2BH 2CUMA 4TSBL 3HC0B 3FT4B 3GMPA 1NAML 2A6KB 4NHUA 1YNLH 3DVFA 2P5ED 5IGXL 3MNVB 1LEKB 1DBBH 4EOWH 3FN3A 1CDHA 5DGQA 5TQ2L 4TSAH 4S1QL 1MH5B 1DLHA 4BUHA 4OLUH 1M6OB 3AAZA 4YUEL 5F9JA 4ZYKB 1BIIB 4G42A 1JFQH 5D93C 1QRKA 4XC3H 4M6OH 3NZHH 2N56A 3RWFA 1DLFL 5BXFB 4LVOC 5D7IE 3IU3B 4DK6A 5DT1L 2YHGA 3GSQA 4HIHA 2YKLL 4GS7B 4KRLB 4EQ2A 3R4DA 4OIBA 1IC1A 3KPTA 4F9PC 3NIFF 3CXHK 1UWGL 1CFSA 2HFTA 1RK0B 1W0WB 3BEWA 1I7ZA 4ODSL 4YJZL 1FP5A 2WANA 2QQKH 1LE5A 3CDFA 5FGCB 4OGZA 1XF3B 3HE7B 4LPWA 4ZO7A 1HXMA 3PHQB 4G8EA 3WUWG 3S34L 3EIFA 5F97E 4KJPD 1GGBH 3CFDA 4UIMA 2HG5A 1RUQH 3A6CL 5KANG 5I2IA 3O4LA 4YAQA 2UZYB 4GXVH 1E4KC 4HIXL 2VITB 1UM5L 3WXVH 3G6AA 2X1PA 1W8OA 5CEZL 1ZLWK 3D18A 5HHME 1QFWH 5E6ID 2ARJA 3SPVB 5T1MA 5HVFB 2F74B 1U8LB 3IYLW 5JTWA 2OTWA 2B2XL 4E41A 1VACA 3QA3A 4GJTB 4P59L 5FAAA 3WD5H 2GUOA 4KUCF 4PJEE 5ILTL 2DMKA 1XZ0A 4XBGA 1DQQA 1JMZA 2J5LB 4NQCE 4V1DA 4FTVD 3SOBH 1MQKL 5C6TH 4F80A 4XB8A 4G3YH 5GIRB 1YEKL 4G7YH 5D9SA 2CJUL 1KXQE 1FNHA 4UOJA 3U0WH 2OI9B 1EFXB 4NNXA 1YEFH 2W9LA 1YEJH 2NY1D 5CZKA 2KZ1B 2FEDC 3MJ7B 5DJ0B 3MRBA 3FMGL 2NMSA 3INUL 2AXFA 4LLYB 3GB7A 5I2IB 1T1ZB 2E27H 5MEPB 5KZCD 4H0GA 4TUJB 3B3IB 5SV4A 3WSQL 4S2SA 4WW1B 5ACZA 5B39A 3DTXA 1J1OL 1I8MA 4D9RD 1R3KA 2FGZA 2XG4A 4Y7MA 1QO3A 1TVHB 1K9TA 2FB4L 4PS4H 1NPUA 4N0FB 5D9SB 1S78C 1CF8L 2P24A 2J8UA 1BIIA 4Y4KB 3Q3GB 4EN3A 4UQ2B 5CP7A 4YE4L 2YXMA 2BNRB 4M9PA 1X4ZA 1CK0L 2I25N 2CDGB 3B43A 3K81A 5IQ9B 3DX7A 3KXFE 1CLOH 2OP4H 4MLSA 4WO4B 3L6FB 3TESA 1JGUH 4LLWA 1VGEL 1KENH 1RZ8A 5EOQL 5FYKD 1OQXA 5JPMA 1MRCL 3E3QC 3UYPA 2R9HC 4JFEB 3QFDA 5F1NA 1JGUL 3B3IA 1TETL 4F15C 2AJYL 1WITA 5I18L 4YHOL 5GGSB 1YECL 3L7FB 4DQOL 1RZJH 1GGCH 3CLEH 5EWIL 3WN5C 1MAML 5IT2L 4QT5A 1IFHL 3SDAB 4OGAD 4UIMB 5HYJD 3VXUE 1P2CB 5HHVL 3T0BA 3V7MA 1UG9A 5GHWH 1XF3A 3HE7A 4RWYL 5ANMB 3S3PA 4EI5A 1GL4B 3PHQA 4G8EB 4X5XB 3QH3A 4JM2F 2VR4A 1I9EA 1M7XA 1TJGL 2HVKA 5DURB 1P7HL 1YDPA 4OZGA 1SJEA 5D1ZD 4R7NA 5I1IH 2A83B 3HUJB 2FBJL 3N1GC 3GJFA 4HDIB 1AY1L 3CUPB 3RNQB 3QDJB 4I0PB 2BDNL 2AK4E 2JJTA 4UV7L 4O2EB 3P30L 4PD4J 5HGHB 1AI1H 2VL4A 1QA9B 4R4NC 4OFIA 3MJ6A 4HCRA 5BRZE 1ES0B 5TGBB 2HAZA 3LB6D 1FNEA 4N8CH 3SKOB 1JYNA 2IAMD 3ZKNC 1RHFA 3EO9H 5T5FH 2EEBA 2P46B 1EFXD 4KGLA 1A1MB 5IK3A 4I2XB 4LP5A 5BCAA 5HDQH 3T0AA 4QRRB 4NFDA 1B6UA 1N5YH 2R29H 5JA8B 3SKNA 1C5DA 1CF8H 2Y06H 2A77L 2P8LB 4UILH 3UO1L 4XRCB 3MLWL 5CD5D 3CVHH 1ERNA 4G8IB 3H3BC 3T8XB 4OSUH 1ZLVK 3WIHH 2DF3A 5KG9B 4XCYA 2UZIH 4LHUG 2ZCLH 3HPLA 4PJDA 3I2CL 2JCCA 5HYSG 4FQ1H 4ZS7H 2MPAH 3RIAK 1DBKH 2R1YB 2J2ZA 5HGBB 5T3XD 3KYOA 3IETB 4YXKH 4WTZA 3V5DA 4QHKJ 2YD8A 3QUXB 1D6VL 1FG9C 4QXWA 1P1ZB 1XT5A 2AXGA 4Y19B 2NY1B 2VXUL 1NEUA 3IJHB 3OKKA 4KTDL 3SQBA 3EO0B 5L0QC 1OAUL 1A47A 2AJUL 2HMID 3U36B 3C9NA 2VE6A 4GRWH 5TF0A 1YPZB 2B39A 4PJ8D 3CVHB 3EHBD 3FRUA 1AKJB 4GRWE 4Q9CA 3IDIB 2AW2A 1L9MA 2R8SL 1UKQA 1A9BB 3JTTB 3I02A 1U91A 4Z18A 5GJSL 4LVHC 2CRIA 4NUGL 4MLIA 3U79A 1Z3GL 1PZUB 1PG7H 3WBDA 4PRHB 2V7NA 1RUML 2UWEA 2VLRA 3FONA 4PJIB 4J3UA 1JHTB 4KZDH 1H15B 5BW7C 3HAEA 2IH3B 6FABH 5C09E 3CFJA 3QUML 4P5TD 2DQJL 4L4TE 2Z8SA 1UZ6F 4QRPA 4UQ3B 2KDGA 1J0HA 5JR1L 4LPXA 3I6GB 4GAGH 1BJ8A 1PZ5B 3QUMH 1RUQL 4PRHD 3B9KB 3SDDB 1ZGLP 3FO2A 3LQMA 2PYEB 2JB6A 1CD1B 3IXAB 4AL8L 3N85H 4QRPB 1NEZB 1QLFA 1A0QH 4G3YL 1A6UH 5JIHA 4P57A 5CILH 4JRYD 3OR6B 4HK3N 4YHML 3TA3A 4OTXH 3QUYD 2X4UA 2UWEB 2VLRB 2FGWL 4K3HA 4YXHL 3VWJD 4EI5B 1FFPA 5J1SC 3MRIB 4P46C 3SKNB 1F58H 3IGAB 1NGPH 3HB3C 1WBXB 4NN5B 3KJ6H 4N0CC 1G9MC 4NZTL 4XC3L 3DSFH 3EFDL 4KK9C 1AD0A 5MEOA 1C5BL 1UKTA 2BVOA 4CJ0A 5HHOE 4U1GC 2EDBA 3DX6B 3MLRH 5D7JC 1AJ7L 1VFOA 4KTDH 4MMZC 3H9SE 4XXDB 1VEMA 4BQ9A 1NUDA 3V8OA 4KKCC 4FP8L 3T2QA 4JO1L 1DN2A 3QYCA 4P2CG 2DQFA 1V7NL 1A1OB 2BSSB 2XTLA 4F9LA 3STLA 3VXUA 4JY6A 1ZLUK 1UXSA 4FXLA 1YC7A 1KF9B 3NAAL 1NGYB 32C2A 1G9NC 2JJTC 5HJ3B 4JO4H 3GMQB 3S34H 4XMLH 3IFPB 4X8JB 4MGXA 2W9DH 1UM6H 3CU1A 1P5VA 4PY8J 4ONGH 1SM3L 2JJSC 2EYSB 4U33A 1NMBL 1LP9B 1U8PB 3NCJH 4XC1H 5I1LB 4U1SA 4N68A 5GS2H 1ZA3A 4QTIL 4XVJH 4MD5A 2FEEI 2A77H 4OB5L 3CC5A 3EYFA 5EOCJ 5HHOB 5CGYD 4U1LA 3PP3K 1SHMA 5IFHH 2Q8BH 3EYUH 5C0IA 5K9OB 3C6LA 3V6OA 3ZT6A 4HH9B 2I5YH 5CMAA 5C0BA 2O61A 3FO0L 1H0DB 4DOHB 4JR9L 1JF6A 1KTLA 1FIGL 1BVZA 4RNRB 3QIBA 4LLMA 3UJTL 5T1LB 5ILTH 2ZCKL 3DX9B 3HMXA 2NZIA 3TN0C 4OD3L 4OKVA 1IARB 1X3DA 4GAJL 3CAFA 3TA3C 4XXCC 5D72L 4NO2B 1NCCL 4BZ2L 5GGVH 3TFKD 5EA0L 3PDDA 2V2XB 5K59F 1B0RB 2ZOLB 3VXTB 4NO3A 1P7QB 2RGSA 4HDIA 1WWBX 4RGMC 3MA9H 3QISA 1JGEB 4HWEL 1YEJL 3WL9A 3ARFA 4NQSB 1AXTH 5H94A 1S5IH 3G9VA 1IAKB 5DI8A 3RKDD 4N5EC 3HR5B 5D2LF 3O4OB 2V2WB 3VG9B 1E4WL 1KJMA 2HKFH 5EULV 2WLZA 5GGTL 2NYYC 3F58L 2E6QA 2EIEA 4B53A 2PYED 4N9OB 3AC0A 2QQLH 1EGJL 1F2XK 2IAMB 15C8H 5D71L 1AGFA 2FH6A 4UTAL 1E27A 1YNKL 2GFBA 3PWNB 1CZ8L 5HGGS 1YMMA 4F58L 2IADB 2X40A 3GIZL 3LH2L 4CVXB 1CLCA 2XZZA 3LOWA 4UDUB 5E2JA 1WJ3A 2ZG1A 4JFEA 2YPLA 5DF0A 3LN5A 4F33B 3IU4L 3QZWA 3KLHC 1XEDA 3PIQA 3T65B 2BFVH 3QI9D 5DK2A 1VADB 3MBEB 2Q7NA 2DQHH 2W65A 3HC3L 1P53A 3GKWH 1CTNA 2VDML 2NXYD 4MX7A 4G5ZH 3MACH 1IVLA 2B1HL 2VL5A 4M1DH 5DJZB 3SDCD 1N0XH 4F33A 1KG0A 1JGVH 4KJQD 1CICC 4O4YH 1A2YA 5JMRA 4FQLH 4I4WA 2QSVA 4IEFB 4HX1B 1R3HA 4EN3B 1MJ7H 3VH8B 1WBZB 4DN3H 4WEBL 1JZ2A 1JN6B 5FDYA 1T80A 4ZNEA 2PXYA 4PTUB 3TYGH 3L3KA 4AYFA 3SBWA 5I1CH 1QKZL 1I7TA 4QRTB 3IFNL 7FABH 1S7QB 1A7NH 5I76A 1SYSA 2PW1B 3DPBA 3AS2A 3UPAA 5EU3A 3H3PH 2X10A 4X9HA 1FZKA 5EUOB 4GS7C 2GITA 3BQUA 1NAMA 1ZGLM 5BOZG 1JNLL 2GJJA 1RUMH 5DQDL 1IKFH 3E1F1 3GNML 5J11B 5TE4L 3H3KA 1RD6A 5J12B 1YEEH 3O2VL 4GG6F 3MV7D 5CJBA 4OKVB 2RCSL 1NL0H 1RJYB 1WAAE 2VWEE 3ZKSD 2VQ1A 3GMOA 4RAUB 2H2PD 3V79C 2APVA 5A2FA 4N1CA 2OTWB 5FO9B 3ZYOA 3HZYA 1S9VB 4PJBA 3O2DH 4ELME 1OD7A 3KYKH 5T1DL 3WS3B 2A6DA 1JPTL 2Q86A 5B3JE 5AZEH 3JWNC 1QHOA 3ZDZF 3AB0C 4L9LC 4KK8C 2XRAL 2GITB 3QO1B 5GZND 4JRXD 4S2SB 1HQ4A 5T3ZD 2KL6A 1XH3A 4TUJA 1NAKH 4PLOB 3VFWA 3L3JA 4DVBA 1HXMB 4ZTPL 2FX9H 2VZSA 3OHXB 4KJQC 1F02I 3BZDA 5CJXA 2F54D 4H26A 1PKQB 2YUWA 3IAQA 2MPAL 3MACL 3EGSB 3KPMB 3WUWA 1KJ2L 2E6PA 2EIZA 5C0EB 4S1DD 4XP6H 1WEJL 1MWAL 1INEL 5DC4B 2DKSA 2P48B 5IVXE 4BH8B 1F6LL 1WIUA 3EYOA 1GIGH 5L0QB 1KB5H 1CCZA 1K6QL 2ICWA 3BKYH 4JPWL 4M62L 4G7VH 1MFAL 1YUHA 4CMHC 1U0QA 3RHWF 3EDEA 2BSSA 1LK2A 3CSBA 3MBEA 3VXMA 1RY7B 4JFDB 5C0RH 5IESH 4IMLB 1KULA 5DJCB 1HSBA 1FAIH 3VXQB 4WEMB 3MNZA 4UMGA 5FO8B 4ZOAA 4ETYA 1FZOB 2IFFH 4PBWD 5CCKH 4TSBH 3PQYA 4C56E 4PRNA 1ND0B 4TSCH 4DKEH 1FC1A 2UYLB 5CJQL 4JHAL 5CD5C 1J86A 4KRPC 4NYLB 5LGKA 1SBSH 4OIIL 5D2NE 4XWOD 5C0NC 5H8DA 4MD5B 2FDBP 4X8XA 4UOW1 3AY4C 3MCKA 3NFPA 1JNNL 5EB9A 3REWA 4P57B 3ZDYE 4RSVA 3U7YH 1SJXA 2X41A 1K4CB 4MZ3A 2EDJA 5AG9A 4JFEE 3UEZA 1CN4A 5FIEA 1P4IH 1NFIA 4XNUH 2BHUA 1HSAB 3C60B 1CXHA 2D7QA 4M61A 4MAYB 1RJCA 1GGIH 2JE8A 3GMLB 5FEBA 3C09B 4MJIA 1T0PB 3L5IA 4UAOC 4U1HA 1R5VA 2X9WA 4ODVH 3WN5B 4X9BA 2QHRL 2DQTL 2NNAB 2IAND 5FOJA 3SDDA 3OF6A 1NGZA 3QUXD 1BFVH 4GW4B 1WBYB 2H6PA 1ZS8B 3MLPA 4OUUB 1J0KA 4P46A 3SDXA 1FL6A 3UTTE 1M05B 4PJEF 4NQCB 4OFYD 2R29L 5JDJA 4P9HL 3HC3H 1QR1A 1HOCA 2ATKB 4WHTA 4F7EB 4LVHB 3DX9A 3DX6A 3G6DL 5CINH 4H1LG 1RIVH 5C0CD 3VRJA 4N8PA 1OTUC 4LFHG 1LEKA 5HHXL 3I85A 1IQWH 4NKIL 4P5KB 5T1LA 2XN9B 3SJVA 1CD9B 4OZFH 3QDJE 2P5WD 2V9TA 1PSKH 1OGAD 5FYKU 4A6YB 5J7CC 1NJ9B 4NKMA 1DN0A 1IAOB 2V7HB 1XIWB 5GRJH 1D5MB 3IJYA 1BQHA 3D1MC 3I02B 2IBBA 5F89A 1CGUA 1TIUA 2YPLD 3S36X 5C0ND 5FYLD 2VDPL 3DUUA 1WC7B 1XF1A 2ZPKH 1D9KA 3WLBB 1NMCC 1RZIB 3O4LE 3WUZA 1CFQA 2FH8A 4OFYA 4TOYL 2YN3A 4MB3A 5C0BE 3MOBH 1FAIL 2E5EA 4HBQA 5DT1H 3T3PF 5KAQF 3CH1B 5C0AD 1RZ7L 2ZUYA 4BSJA 3DMMD 1FE8L 3HNTH 4I77H 5E99H 4Q9QL 2AV1B 5DK0B 3HCVB 5TPWH 4AH2A 3CPLA 1ZEAL 3O45A 4OF0A 2W9EH 3H0TA 1A1NB 4LSVL 3CSPA 1A6PA 2YR3A 4G6AC 4GQPH 5CIPB 4V2CB 4OZIB 1I1YB 4KAQL 1Z2KA 4OJFL 5MP6H 1LEIA 1INDH 3BDYH 4W4OC 4P4KB 2R4SL 5HDOA 2VN7A 1FIGH 4GMTH 4KPHL 4QRSB 5HGDA 5I75C 2YRLA 2FL5B 5DMKB 3MREB 1K4CA 1KCVH 2CGRL 4RFNC 3EYUL 5F1OB 3MGOB 1I3RA 3GK8L 1H3PL 1EHXA 5SWZE 1E6OH 4NCC1 3RWCB 4PG9A 1JTOA 4YPJA 3X14B 4OAWA 4GAYA 4IRZL 4ODUB 2Z4QA 4HIJB 2V5TA 1VGEH 4U6YB 1UZ8A 4PGEB 4HGWA 2H26B 1FJ1B 3O6FD 2NXYC 1QRNB 1OAUH 3QDHA 3ZE2E 3IF1B 3TBVA 2PYEA 5EFIB 3NOIA 1NEZG 4NQDB 5GRVL 2N7AA 4GW4A 2ED8A 3HLAB 3ULVE 35C8L 5DDHA 1IGJA 3MA9L 4XBEH 4M4RA 4OI7A 3B8YA 3QXAA 2FO4B 4GW5A 2HLFD 2XV6B 2AS5M 1SEBB 2HVKB 3O3UN 4JAMA 5JZ7C 4C56B 5E94A 2LV4A 1X4XA 2WW8A 4G8FA 1OLZA 4ETQB 1J1OH 5CBAB 4XCEA 3UZQA 3SDYH 5E8DH 2YKLH 4PGEA 4K9EC 3S37L 3VGAC 4WRLA 4AIZB 1PEWA 3GKZA 2YC1A 4ZD3H 5JNYA 5F70A 5HI4C 5ENWA 2NYYD 4LLQA 3MCKB 4XP1H 2YA1A 2P5WB 4WTZG 4DUWA 1BM3L 2DWEA 3QFDB 4FFYL 5IFAH 5B22A 2EECA 2FIRT 3KPLA 3I6KB 4JO3L 5DA0B 1QFWM 4JQVA 4XH2A 5ESAA 3I6LE 5GISH 5L2KE 1XFPA 2R2CA 1C1EL 3FFDB 3DMMB 1NFDA 3EO9L 4PV9B 2A73B 4P9ML 3HZKB 3CXHJ 4GRLC 4XB7A 4NZRL 1NCWH 4X4YA 5MP6L 4QOKA 4M7ZB 4ORGA 2YRZA 5I1AB 4R7DA 3FO1B 3DX7B 4NQCA 1YA5A 3V5KA 3WNOA 3B2UC 1V7MH 2FEEL 1C16B 4YH6A 1AGDA 5IB3B 2H2SC 1X44A 4MNHA 1KYOK 5FHBL 5DRWB 5I30H 2H32A 3JWOC 4C83B 3JWOH 1ZS8A 1MCBA 1CFNA 4GG8A 5E8EA 4OI8A 3SGEI 1TJGH 3KR3L 4HAFA 4HS3B 2K1MA 3QCUH 4WCYL 4YHIB 3C6SA 4RA3A 3VGEA 3SDDC 1GZPB 1K4DB 3OR7B 1YDPB 2HRPL 4NT6A 3V0WH 4LHUB 3AMKA 5AD0A 4DFIA 1LD9A 3VA6A 3MJ7A 4DGIL 3UJIH 3ZKND 2NY3B 4JO2H 2XA3A 1EVUA 4BELD 3OG4B 5D70H 1T2XA 1LE9A 5EZJA 3F65A 4N0YH 3WEXB 1IM9A 5FM4A 3ARDB 4MA7H 3PE9A 4KV5F 4XNYH 3HRZB 1A1MA 4R2GC 4RGOL 2X2YA 2XKSA 4EZMA 2GUOB 3G5XB 4RDQG 2DQTH 2MMXA 5HGHA 5CP7B 4IRJA 3HMWL 2DTML 1WLHA 5HDLA 4LVEA 4PLKC 1SYVA 3VFUA 3I9GL 4M93B 1I75A 4FZ8H 4JRYA 2ARJB 2CH8A 1A3LH 3QSKB 3ARFC 3OPZL 3BJ91 4XHQA 4OV6F 5C92A 4PLJD 3RWGA 1QRNE 1Y6MR 2YD2A 2EDQA 3L7EB 4KDTC 3WUWB 1V3KA 5JOPE 4XPAH 4D0DB 1EIBA 4HHAA 4EUPA 5L7XH 1RZJL 4WY7H 6FABL 5ANMA 3EYSH 2R39A 5DSCB 4XPBL 5CGYC 3X11A 4X5XA 3LCYA 3BPNC 5D8JL 1FNFA 4GKSB 4GBXD 1Q9LA 2O5YL 3FOLA 4JANA 4RFOH 1KEGL 3EYSL 3W82A 2YRPA 4R4BA 3ULVD 1Q94B 2DBJA 4WEUD 1QSEA 2GYSA 4LGPB 5KSBB 4YEFA 1U3HB 3AROA 4OLWH 7CGTA 3UTQA 4NP4H 2A6DB 2EEDA 4M6AA 2F19H 3OKLA 4U1NB 3S5LA 5I1DA 3K8LA 2ERJC 5LAXB 3SPVA 4WCYH 4K3EH 2YUXA 3OKYA 4MQTB 4NO2A 5IHBA 3P30H 5DFVC 4W68A 3BISA 3IDNB 4U1JA 2VR5A 2D7MA 4W70A 2Y9RT 1N2RB 2LFGA 4KK8D 1KBGL 2ADJA 3VFSA 5BVJB 5D1XA 4DW2L 2CLZA 4LSDA 5JO5B 4LLDA 3QEUB 5HHMD 3IDGA 2GSGA 3WNPA 1H9VA 1CDJA 1INQA 2B1AL 2X4PB 5SWQA 4M7KH 1QQDB 4Q6IC 3QEGH 4C4KT 1EJOH 2EYRB 4F57H 3TC9A 2R1XA 3BD5A 3OHXA 2CRMA 2HTLD 3LRSA 5ESVA 3PHOB 1HKLH 4FQIL 4HUWA 2VB5A 3U1SL 3DGGB 4MQSB 4HK0A 2ZCHH 1N6UA 1XR9A 3BMWA 2AXHA 3LS4H 2ESVA 3BZFA 1U58B 4CAGA 3VXSE 4IRZH 4FZ8L 1CU4L 1MLBA 5HYJE 5CEXB 3H9SA 4HKBA 3I2CH 2BZDA 4Q74A 5MENB 5DURD 2DQCH 1CFSB 3QFJB 2AEPL 2W0FA 3MRJA 3MUHL 4NC1E 4OB5H 1N2RA 2VXTL 3LSOA 4ZSOB 1AGEA 5JMOC 5FHBH 1T7ZA 4J23A 1HILA 1MIMH 3ARFD 4P4RA 3S36H 5HI3C 3ULUC 1SYVB 3WFEH 1BQSA 5IFJA 4HLJA 4GG6E 3K4ZA 4NJ9L 3MLZL 1WZKA 4E5XB 4Y4HD 5I6XC 2LVEA 5MERB 2HT2C 4UDTB 3DECA 1VSCA 3DWTA 1R3LA 3V0WL 3NH7H 3JSSA 3EOBB 2ICWJ 4R3SA 3RDTB 4ZS6C 4N9GB 3RVWD 4LSRH 2P5WA 1I8IB 3FB8A 3KWWA 2BOCB 4C54A 5EZJB 4PJ7E 4HS6B 4LKXA 3FMGH 3GSXB 4R9HA 1IGYB 2JB5H 2NX5A 3LVEA 3PGFH 2K9UA 5H94B 1XGRA 5KSAA 3KYAA 5KN5A 1B0WA 3GHEL 5ITFA 5E8DL 3IXTA 1WAAA 5BZWB 2EDEA 2F54E