1I8AA

Family 9 carbohydrate-binding module from thermotoga maritima xylanase 10a with glucose
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
189
Chain Sequence
MVATAKYGTPVIDGEIDEIWNTTEEIETKAVAMGSLDKNATAKVRVLWDENYLYVLAIVKDPVLNKDNSNPWEQDSVEIFIDENNHKTGYYEDDDAQFRVNYMNEQTFGTGGSPARFKTAVKLIEGGYIVEAAIKWKTIKPTPNTVIGFNIQVNDANEKGQRVGIISWSDPTNNSWRDPSKFGNLRLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the family 9 carbohydrate-binding module from Thermotoga maritima xylanase 10A in native and ligand-bound forms.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE A
total genus 56
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06452 CBM9_1 Carbohydrate family 9 binding domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1190 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1i8aA00
1ULVA 1UG9A 1I82A 1I8AA 2IVFC 1I8UA 4JPQA
chains in the Genus database with same CATH superfamily
1T5WB 5KSAA 3UERA 5E8NB 3O41B 3MZTA 4ZD3H 5AG8A 2GSIA 5JNYB 3M8OL 4OCYH 3NJXA 1Q72L 2CO1A 3T0AA 1YEDB 1EJ8A 2HVKB 1XMEB 2H5UA 3BO8A 3V6ZB 3Q3GA 5HDQH 5IVXE 2B20A 1FL6B 2VYRE 3V5HB 3MA7B 5FB8A 4NENB 5HHQA 1YJDH 4JZOA 1UH2A 2X87A 1KPVA 1BZEA 1INQB 1KC5L 2WBJD 3BWUC 2ITDB 3KYMA 4UTBA 4HEMA 5LN8A 4NO5B 2PXYA 1GS8A 2ZWSA 3GMPB 4M5TA 3IJ7A 4N2EA 5CILH 5D7LE 4GAJH 1ZT4A 5GGQH 1T83C 1QFWL 3JYCA 2NSXA 3LSOB 5L2KE 1KJ2B 2I60H 3MZGB 2XN9B 4JO5A 3L1FA 4KUCF 2I5YH 4YDVA 2ODIA 2BSED 2IMMA 5HYQA 2BVOB 3QDJB 2XN9A 1N5AA 4LL9A 1RFDL 2Y7NA 2ZONA 3RUGF 5I28A 3VDAA 4RQQA 3ZRSA 3PWNA 3WS6A 2J1ZA 1RY7B 4JY5L 4XHQA 3TH4T 1CZ8L 3D33A 1T6VN 3SPVB 1ZVYA 4C4BA 4LF3A 3LH2L 1CVSC 2BDNL 2BHZA 3CUPA 4BWTA 3I6GB 1P5VB 1SLWA 4ZI8A 4MJ5B 5B8CB 3QCVL 5F6IB 4MD4A 1L4IA 2R0LL 3W56A 5C2BH 1KYUA 5T3XL 1QBLL 3H42L 1FL6A 3WDJA 3VMNA 2F58L 4RAVB 1Q94B 2XRAH 4PM1A 1KLGA 2WYIA 3BFQG 4J2XA 1MG2C 4J3OH 4UB0H 3VFOB 4XWGL 5HDRA 2EH8L 4JFDD 3VWKA 4KKLC 5F9JA 2VDLL 2OX5B 3CSBA 4NKQB 1ZT1A 2NW3A 3N44B 1TKWB 1CYGA 3RA7H 3EZJB 5IB5B 2BMKB 1U3JA 4BKTC 1E9QB 4K0OA 2W80C 4FCAA 3P77A 1OKEA 1GXEA 4M6MH 1YEGL 1OARH 3FL7A 2AGJL 2JJSC 4Q9RL 5FYKD 2H0PA 3SE3C 3X11A 2R51A 1MFVA 3WKPA 3S48A 3H1ZA 3M1OA 2IH9A 4MZ2A 3D39E 5DRWA 2A1WH 4YE4L 3ULUH 3F7RA 3SODB 4HUVB 5GHWH 3D12B 1IFHL 4J28A 3AU1B 2NPLX 2VE6B 3A6BL 4M6OH 4XTRC 3WUZA 4FADA 3ZE0B 1NLDH 5SV4A 3KR3L 4FABL 1MCEA 4FQLL 4KTEH 4NZTL 5E1QA 1EEQA 2C1OA 7FABL 1JK8A 3LKRA 2X4NB 3L2MA 1YNLL 4O51B 3EJTA 3WO4B 1BG9A 3O81A 2J3SA 1O6TA 2QDVA 4XVSH 3VD0A 3Q2VA 1P9MC 4K2UL 4J3BA 4Q6IC 4A7UA 3Q13A 2W9EL 4BFOA 5L4FA 5CZXD 1V27A 1T80A 4LVOB 4L3EB 5HPMA 3NH7L 4PI2A 4FZ8H 3VXSB 4JPIA 1AHMA 4B60A 3P40A 1MNNA 5HHME 2P1YA 3V4VL 4G8GB 4LGSB 3HBQA 1B6UA 2DQFA 2O5YL 3UEZA 3QUMB 1BBJB 4Y9EA 5CZXC 5DMIL 5FUOH 1KBGL 4QRUA 1Q8MA 4EBQH 3PWVA 4JFDE 4K7PH 4Y16D 5MEQA 2HTKC 1WTGT 3RWIB 1CGTA 1PNDA 4N2AA 4LAQH 2EYRB 2EE3A 3JV6A 3C75A 2J25A 3B43A 4XHJC 3VX0A 3ZE1B 1O5PA 1A8ZA 3MJ9L 1N0XL 5I26A 3LZFL 3RL1B 2W07A 4N2GA 4MMXC 5GQBA 3FQWA 3Q6GL 3CFCH 5JHLA 5HHXL 2CIKA 1MHPL 5FGCB 2F0CA 1GPOH 5KS9E 2XQ0A 4ISVA 3L9BA 3OWRA 1BQKA 2NY5H 4GW4B 3T0ED 4HFWB 3ARSA 5DQDH 3UG3A 1BYNA 2XZAL 1YO4A 1A9EB 4UZUA 4MKMA 2VAAB 3KH3A 4Z7QB 2QQNH 4L5FE 4GT7A 4NNXB 2QTEA 3QB7C 3HC0A 5LAXA 4GEIA 4J4PD 5A2BA 5DD6A 1P69B 2WOBA 2OMXB 5FEBA 4N0CD 4D3CL 3AAZB 4F5CA 5I1DA 1C5DB 1OAYH 3MBEA 4XBGB 3EO9H 4CC1A 3JWNH 1DHKA 2ZG3A 1Z3GL 4B6ZA 4ZOCA 3L95B 4M9OA 4RNRB 2CE6A 4P59L 5LCVA 3T65B 2QV4A 3DIFA 3RX5A 5IB3A 1SJHB 2I24N 5CEYB 1QKZL 4WGVB 1KXTB 1ORSB 3FO1A 1AFVL 3BP6B 2MSPA 5H4YA 4HEME 1FZJA 3E1ZA 1MVUA 2CR6A 4NKOB 3RZCA 2TAAA 2X9YA 1Q9WB 3NCEB 1J5CA 4MJ4A 4BFJA 5BQ7B 1AG6A 5L2KA 3W5MA 1A47A 1BGXH 1S7QA 4R2GD 5I16B 3SPHA 3RDTC 1Q9LA 3QUKA 4UTBH 4WJ5B 1LWHA 2Q86B 1A7BA 5D8JL 4F7PB 3WS3B 1OGAB 1EFXD 1OM9A 1HVXA 4LQ1A 4Y5XA 2QVIA 3VGBA 2EUZA 3CZJA 1HHGA 5DJXA 1CUOA 5F96H 2FWUA 4BFNA 1JWMA 1WG3A 5BO0D 3ZDZE 2G3ZA 2DEWX 3IETB 1EA9C 1RMFL 4IGBB 1UACL 1CGYA 1IC4H 3ET9F 1XGYH 2H7WA 4MCZA 3RWHA 1R5IA 4G43B 3MV7A 2J55A 3BUBA 5JDJA 3US9A 4M02A 3BQUB 4AYGA 3TA3A 3HNTH 5FFLA 3K74B 3UZVB 4JK0D 2BP8B 4PV9A 3FCTA 3MLWH 4JPWL 4ZFQA 3FRPG 5FYKH 1WA0X 4PVMA 4LARH 3RVUD 4QRFA 3QS3A 4F3FB 1JXDA 2V37A 4GBXC 5GZNC 1UWXK 3MN8A 4FG4A 2CK0H 2IALB 5GGRA 2ATPA 4H20L 3CZFB 4PJHF 3CCHA 4OM1L 2ADFL 3O3AA 2IANE 3D1MC 2BVQA 4ONFH 3QFDB 2FYVA 5FYLE 2WWNA 3GSRB 3LXAA 3Q1SL 4N8PA 4GP8B 4HSQA 1MCWM 1Z9OA 2BW4A 4NQEE 4QWWC 3DO7B 4XNMB 3F04A 4JN2B 3FZUD 1I31A 3P9WB 1FC1A 2ZCLL 1Q0XH 5DA0B 1EX0A 4FI6A 4HU2A 3KWWA 1UWEL 3IDMB 1UWGL 1VEMA 3FPYA 1GGCL 1T03L 5JOPD 1JYWA 2ERJB 2FSDA 2JKSA 3OR6B 3GKZA 4AM0Q 1OB1B 4ALAC 1QRND 4BQ8A 4B9PA 3DDFA 3HS9A 1TQUA 3VD3A 4K5MA 1JGEA 3LD8B 4M6NL 3MMEB 3ML8A 4PGCA 2YWYA 1YEEL 4A04A 4JPIB 1PSKL 4AE0A 4X7TB 1K4CB 2A99A 2GY5A 1DJGA 3BE1L 4D9QD 3Q2CA 2B1AH 1PLGL 3MRBA 4FI8A 5KTEH 4LPVA 3VU1A 4LRIA 5LXVA 4XP4H 4NKDB 3CX5K 4P2OB 4KX8A 4EN3C 5E8EA 4X4ZA 5ENWB 3WMPA 4TSAL 3QT2A 1A6ZB 5DO2C 3ASNB 1J0IA 5FECB 2ED6A 3W0WD 2WN2A 2PCPA 4U7MA 5LNGA 2I07B 4Y16A 1Z2KA 2YPVA 4Q14A 2FBOJ 1VFOA 4FKEA 2WY3B 4DOHE 3WTVA 3B9VA 3NAAL 3QDAA 1AD0B 5J8OA 1XF2A 5EU6E 3TF7C 4B9JA 5DRXA 3M17B 2IAND 1MFAL 3KS0H 1ZLWH 2V7NB 2JCCA 3T1WA 3MUUA 1P4LA 1LQSR 4IRZA 2NY3C 2X2JA 3KE0A 3ULUC 3LZPA 5L9DH 4Z3FA 3QUYB 4DVRH 1YG9A 4S11A 3SE3A 2J6EL 2X1XR 5DFTA 5B38B 2R2EA 2VN4A 3EHBB 1H5BA 1EUUA 3UIYA 1R3HA 2CU9A 5JR1H 4IBTA 2EE2A 4ODWB 5MHSD 1K2DA 4UT9L 1T1WA 1I3RB 2VM4A 4PP2A 3V95A 2X88A 4J12A 5HHPA 1OTSD 1ACZA 3M07A 4QRRA 3CZFA 1KPUA 2OYMA 4HS3B 4F5CE 4JM2C 1EDHA 2IGTA 3H54A 2YQBA 4Z8FH 3MBED 1MWAB 1VA9A 4F3FA 1WZAA 3CE1A 3PAUA 4Y8DC 1AE6L 3WIAA 2YN5A 5TE6L 3P1VA 5C86A 2DH2A 4AITA 1RSFA 4NKDA 2DTMH 3Q48A 3JVGA 2JI3A 15C8L 3P0YL 4OZFA 3CQFA 4X9IA 4OIFA 5CJBA 3MV7B 4XP9H 3EYOA 3QWQB 2VLME 4Z76B 3LKSB 4UI2A 3RHWF 5H35A 1LK3H 4B9FA 1XB8A 2KZKA 4LCCB 4H20H 2UYLB 3FQRB 1A66A 5AZEH 1LEKB 1XBDA 3VTTA 3V0WH 1A6TB 2GI0A 2CKBH 4M93C 4NO5A 2MKLC 3MUGB 3T4AB 5D7KE 1UXSB 2Z8WC 3MLWL 1F11B 4M5ZH 1BIIA 3QRGH 2BIOA 4JM0A 3VYPA 1JPSH 2X9WA 1ACYL 2WWMD 1F45A 1XGYL 4YR6B 1WUZA 4HHWA 5JQ6H 1IC4L 2BS71 3W9EB 2VR6A 4HKJA 2Z93B 4OTXL 3RILA 4A7QA 4AT6A 5HBBA 4GAGL 3LHPH 2MFNA 4YSDA 4E41B 4PRIE 3MI6A 5IB3B 3TA3D 5KUMA 1HESA 2IGFH 4RMQA 4Z95L 1Q0EA 1KGUA 2YAEA 3GMMB 4ZMYA 4YEEA 4O4YH 5CWSB 1BOGB 5C08E 5DJ8B 1B2WL 2DYPA 5DWUL 2FATH 3MU3A 4L1HA 4MBRA 4JREC 4V2CB 2HFGH 4C56E 5L7XL 3PS6A 1U8IA 2D4FA 2XX1A 2VL5A 3FBKA 5EEVA 3BIKB 3MTXA 1P7BA 5K59E 4ZFGL 1R5WB 4XNAA 1L9NA 4LP8A 2WQRA 5I1CH 4IHOB 2EYSA 1IGIL 4BJLA 3S2CA 1U0QA 3UPCA 2AVGA 2Q1EA 3Q1EA 2DMBA 4RGNE 2QFPA 2Z6FA 2E7LC 3MRRA 4OH2A 1RLBA 3CK0L 4ZOEA 1GOGA 2HFGL 4KVPA 5LB1A 5KAQG 3Q01A 5BQ7A 12E8L 2DKMA 1QRNA 3APDA 3ZIYA 1AOZA 5C0AA 1UXWA 2VQUA 1D2PA 1NIFA 1X9LA 2EE6A 2QGEA 2WOYA 4O4YL 4WFHE 3VI4E 5KSUA 2HJFB 5E4EC 3RIAF 5C70A 5IUCA 4IEFA 4F20A 3FOMB 4J39A 2YD5A 5IJKA 5EU3B 4PR5A 2IXQB 2NY7H 4CBPA 4TUUA 3CN4A 4X6FA 3LHPL 2GJZB 1JGDA 2X7LA 4M7JH 4OD2A 4ZW8A 2V17L 1HXKA 2A6IB 5E6UB 2GIYA 5JQ6L 3SO5A 3CGTA 5AKTA 3VXSA 1UCBH 4IU2B 3MJ9H 2NW2B 4GQRA 3PGFH 4MS8D 1I8KB 3NRQA 1HCFX 1KTJA 1QTSA 1J1OH 3QRGL 3DBXB 3ECBB 1KZQA 5CFHA 1VB9A 4KUZH 4S0TD 4CU6A 4POZD 1JK8B 5JXAL 2CAKA 1YN6B 5FCUL 4FLHA 3IMUA 5FUOL 4N26A 3IJYB 1TYEB 2I9LB 4HUNB 1NCIA 5AZEL 2PXYC 4MNGA 4DK5A 1A3RL 1RERA 3SDCA 1KJVB 2DLHA 4QRTB 5KANG 1JZFA 1CF1A 4G80A 1KN2L 3BEVB 3RL1A 4O02H 1C8QA 7CGTA 5JO5B 3IGKA 4LP5A 4JFEB 3FTVA 1W8NA 4QF1A 3WTXA 4K2UH 2BH0A 15C8H 4XVSL 2EEAA 2DDQH 4MAYC 2EDOA 2HRHA 1PAMA 3O6LL 3BRGC 4TLSA 3REWA 2ZNWA 1HEZB 2IWKA 1TKWA 3QEGL 2DQEL 3T0XA 3GBEA 4JE0A 4AVHA 3C87A 5DFVC 1Z5LB 3BZ5A 4MX7B 2VCOA 1OXYA 1BZ9A 3S8GB 1B4TA 5I8KH 2JV6A 1KIUA 5T8IA 4YE4H 2RALA 1T0MB 2BOBA 4NWTL 3WFZA 3N44F 3QJOA 3T1FB 1QVOA 5J13B 3DV6B 5EZJB 5E2WH 4X6CA 1CICA 1GJUA 4JB9L 4JDEB 3MV9E 2YXVA 4X8JA 1OARL 3VJ6A 2UY6A 2WCPA 5AVZB 1BMZA 5FYJH 1KYOK 2A6JA 3LPWA 4O9HL 3RA7L 1T6BX 3M7OA 1RP9A 3QIWB 2ENPA 5K9QI 3WNKA 1JZ6A 4HXAL 4PJ5B 3OKLA 5GS1C 1D9KD 2A4CA 1L6PA 1EAQA 2EH8H 2IQAA 3X1BA 1AYOA 4XNXL 3DOSB 4KJPD 2DH3A 2WUBL 1SMDA 4H88L 4YIQA 4R97B 1OW0C 2WGNB 2EQDA 1ZRUA 3D3VD 1FO0A 4I3SL 2JKLA 5E9DA 5CJ5A 1ZAGA 2ARJB 3H42H 4WW2F 3ZKXC 1E40A 3G04B 3TBTB 2IOMA 3OJ2C 5I2IA 1J10A 1MW3A 1HL8A 2YKKA 1NFDE 2ZG2A 1TQBB 2R1XB 4AEFA 4KHXL 3V4UH 1HQ4A 4ZG1A 5MEND 5BUAA 5EU4A 2AMUA 2XWEA 5HVHC 2UZIH 1EK3A 2OKMA 5IQ9A 4ZRGA 1ZLWK 5C0CA 3WTUA 1AH1A 1EO8L 1EAJA 4F8LA 1UD3A 2R83A 4FNSA 2FDBP 1RFDH 5KJRL 4LNVA 1PSKH 4PP2B 1CBJA 2JK5B 3FBQA 5B3SB 1KLGB 3BYTA 1F90L 2I60L 5ADOL 3NFNB 1MHHA 2DYPD 4F57H 2VR9A 3L7EA 1S8DA 3D7PA 3M88A 5T1MA 4IJTA 3DYPA 5KVEE 4RX4D 4WJG3 1G6RA 3AQZA 2VOTA 3MREB 4EO5A 2PLTA 3WEXB 5IR1B 1BEYH 1GGCH 1ZJBA 4GQZA 4TNEA 4MB5A 1DBBL 1VRSA 3D8MA 5HVWA 3CBKB 1O6VA 4LGRB 4OFKA 1YJDL 4OGQC 4JX0A 5ELIA 1PKOA 2ZCLH 2OAAA 3BVNA 3FB5A 4WO0A 1FBIH 2ARJA 1XF4A 1DDHA 3Q1SH 2W0KA 1VAHA 1XIWC 2FJHA 1EPFA 3QAZC 4YDVB 2XZQH 4XN1A 2AK1L 1XGUB 4OCWL 5B4MC 4FQXD 4FFVC 4AQEB 1AD9B 1WAPA 2V9RA 4EAEA 3QEUB 4EPSA 2ENYA 3AZUA 5IFJA 4MA1C 1I3VA 3MR9A 1IGJB 1M2OA 2Y07H 3D5OF 3VXRE 4MJHA 5FYKL 4PRNA 2JQAA 1YNTF 2QSCH 5SWSD 4JCMA 1BZQK 2H8PA 4PVLA 3KJ6L 2A3TA 5INCA 4PJGB 3DV6A 3FQYA 2KQNA 4WHCA 2WVVA 3KXFB 2ICWJ 3HRZC 4X7TA 5HGDB 4G6AD 2VMJA 1KN4L 1A7RL 3RP1A 1KXQA 2VUOA 2DMKA 1JNJA 1LHZA 1A64A 1KENH 3MRHA 1X6LA 4O5LL 2NYKA 4Y5VA 4UDUB 4M8QA 3X3GL 1YEJL 4J27A 1M9SA 4DP2X 3K8LA 1ZHNA 1TPXC 3BLBA 1RHHA 3GSWA 1NGYB 4DHLA 5DJ2B 3KLKA 4U0QB 1LYQA 1MJUL 3NACH 3EGXB 1MI5A 3BFOA 4NPKA 2ED8A 3UTSA 1R47A 1FZKA 1UG9A 4A7VA 3B4NA 4BQ9A 3FUKA 4C54A 2ZXAA 2TRHA 2R4RL 4EE2A 3KVPA 2ZYSA 1OLZA 1I8AA 2PPFA 1FFPB 1HKLH 1TVBA 4HKBB 4DESA 2C3HA 1FIGL 3OSVA 2CRZA 2RFXA 3L5HA 5SWQA 3FNKA 4GAYB 2NZ1A 1VHPA 4U1HB 4RAUB 2HTLC 3G5YA 3MV11 4BFIB 1W6LA 3DK2A 3AU0A 4KJWC 5EBMB 2Q0ZX 1JGVL 1Q9KB 1OTTD 4KH2A 4Y88A 4Y16C 3BUQA 3EYQC 1KYFA 3QEHA 3ZN6A 4YPGB 1OAYL 2CRYA 4PN6A 5I8OL 5ITBL 3BZ4A 1AXIB 2AV1A 4Y4KD 5EO9A 3N43F 1M6UA 2IH3B 4AMKL 1E2ZA 1CYXA 2WO4A 3BLPX 3HMXL 3E38A 1JHTA 2QQLL 3CH8A 4GJTB 4W6XB 5JUEH 4R83A 3GNML 1DYZA 4MMYB 4MNHA 5EU7E 5FW6A 3IVKA 5C07E 4P46C 5DUML 1HILB 2ITEA 4ZMQA 2FNWA 4R96A 1KBWA 1HT6A 2WN3A 5GJSH 3BSGA 3CVCA 2VO8A 3LZFH 3N55A 1A6AB 2EC9U 1QRNB 3CZSA 4KROC 4U33A 2X1QA 1XD0A 3V6BR 3D4YA 3FTYA 5SX4I 1CG9B 2R2BB 1HH6B 4WW1A 1JSYA 2C9PA 4JEGB 3IDIA 1AXTL 4ZX3A 4BFEA 3KYNB 4DP0X 4FXLA 4A6YA 2Q10A 4NDMA 1J9QA 3H2WA 2VKXA 1WH0A 3OQRA 2BIPA 5JA8B 4NZUL 4H0IA 2YRBA 4IRJA 3G6DL 4C57C 4Z3JA 1AHWA 2NYZA 1XGRB 3GM8A 4G9FE 4XPAH 2EINB 3UDWA 5CD5D 1L0XA 4CADB 3MGTB 3ZQWA 3ISRA 3SKOA 4ELKA 5MENA 1JK9A 1WZ1L 1UD8A 4LIQH 2EXTA 4PWGA 2AEIT 4FZ8L 4JGNA 2XNAB 4L0ZA 2CD0A 1IKNA 5KVDL 4YHZL 2WXKA 3AAZA 3MCLL 1VZGA 4G5ZH 4YUEL 5I1HH 1MAMH 1A4AA 1ZS8A 2QKIC 3BX7C 1UEYA 2XFXA 2XWZA 1K85A 1MPAL 4OD1H 4UM9A 4N6RA 5F2FA 5HYJB 5IESH 2VLLA 2VAAA 4EQ3A 3PPSA 4FQLH 4NZTH 4PRDA 4DUWA 4NQQA 3UZQA 5D1ZC 1YN7B 2HFFA 4I8DA 5DD1L 2BFVH 4Z7NB 5C0NC 1OWRM 5GHWL 4PJ8C 1E50A 2Y2YA 3ZT5A 1EEZB 2A1WL 2ZWZA 3C60C 5CGMA 2OW6A 1E9OB 1U8PA 2V9TA 1GYWA 3AREC 3WIIL 1BFOA 4WNSA 3RWCB 3U7WL 1QHOA 3L3OB 3FU5A 4MASA 4EKJA 4K3JL 4KC3B 4Y9CA 2AGJH 4MA3B 3BRFA 1YEGH 2Z1KA 3QIBD 3ZL4H 2P8MA 1IEAB 1N59B 1FLRH 2V6HA 4C4KO 4FQXA 2GQHA 4P46B 4R96B 4XNZB 3CSYA 5ANME 1ASPA 2CH8A 4W9GC 4HX1B 5CIPB 4MMZC 3B56A 1SQ2N 4EZLA 1W9XA 5INDA 3C5ZD 1JPFA 2R15A 2AJYH 2Z34A 2P5ED 4XX1G 2A9AA 4TN9A 3L4ZA 3L5WB 1QBLH 3OBAA 1HOCB 3HC2A 1S7WB 1F4AA 2R0LH 4Y4HA 2J8HA 4FXKB 1DVQA 5IVXA 5E1GA 1XHHA 4EDWH 4G6FD 3WTWA 2WLNA 3VXUA 1U8HA 5HHOE 1DE4A 5F7LB 2CO2A 2EUXA 3QUZB 4RH4A 1SYSB 2I9TB 4IOFC 4JY5H 1T3FA 4PUBH 4JHVA 3V0IA 4J8RB 4W9CC 1T7YA 2OCFD 3HN8A 2ZT9C 1IU1A 3GMQA 5FW8A 4Q9CA 1TMCB 3UTSD 1JAEA 5L0QC 2W81C 1EO7A 2X4SB 3WG7B 2OMTB 5DHEA 2GAZA 2CHWA 4OF6A 4WKXA 3VQMA 3VCLA 5F7EH 5AYQA 3BIAX 1M2VB 3KPRD 4JJ5B 3BWAA 4PG2A 3IRCA 4Y2DA 3S3DB 3CLEH 2FBJL 3QHZH 1C5BH 5EWIL 4K23L 2HG5A 5E0FA 3LXBA 4YDLB 2WKLA 4LLMA 2CJSA 3ARGC 3GTVA 3DXAA 5MP6H 4ZNCD 1U3HB 4QHUB 3FO2B 1MCHA 1RULL 4KOCA 5T1JA 3MA9H 2JSFA 1Y6NR 1XGTA 2W0FA 4IMKC 4QXVA 2X4UA 5ESQA 4A2DA 4QY8A 5F9DC 1Y0LA 4JRYB 4LMQE 3MBXH 5I15L 1V05A 2CNYA 1Q94A 1DJXA 4KU1A 3CZNA 4JLRB 4EUPG 1ZTMA 3UC2A 1QLEH 2GVYA 1NIDA 4XX5A 5KSAD 2AJVH 1TO5A 4LDLB 4HIJA 2VN5A 1ADQA 2BVYA 4NPYB 5F8RC 2NY4B 2P42B 4M61B 2P5EE 1IBHA 2X38A 4AEIL 1J86A 4MQTB 2HSIA 2WSPA 3UBXA 3L1GA 1GS6X 5BVJA 1J8HE 4N0UA 4HWBA 4IQHA 2B4CH 3FHAA 1CDBA 4ILDA 5GS2D 1NGXB 5DMGC 5K1JA 1SY6H 3T4YB 5ILTH 4F9LA 4B9CA 2VXTL 5HDBF 2LV4A 1KTCA 3UO1L 4L1TA 3TZVA 2PW1A 2EE9A 5AAWC 2Q7YB 2LU4A 4G8FA 2X6MA 1CTOA 1ZTXH 4D0CA 1GW6A 3ESOA 3ZE2E 3C60D 5DURB 3A6CH 2FO8A 3X3FH 3CBJB 1JCVA 1DLFH 1AQDA 1TF4A 1XF4B 2YQGA 3KGSA 4ZUSA 3RI5K 1N6QH 3I50H 3UTTB 3WE6A 5FF6A 1NCAL 3VD9A 1Z7JA 1AKPA 1EZUA 1U91B 3QIUB 1OE3A 1YEKL 2B0SH 3RBGA 3IU4H 3IE4A 4E9TA 3KCPA 3KPTA 4AJYV 4ZO8A 1G9EA 1T7WA 4KAQL 2AXHA 2ZAGA 2XKUA 4FS0A 1ZV9A 2ATPB 4JRWA 4WK2B 2FLRT 2VH5H 1YY9D 2FSEA 4TNFA 4AE1A 4LP4A 1FNSL 3LQZA 4FYQA 2AQ3A 4I89A 4OCMC 5HGBB 3W81A 3UP1A 5BS0A 1UA3A 2HKHL 3VD7A 3FFCE 4WUKH 3OHMB 4JN1H 1QQDA 4JY6B 5FLVA 1CB4A 3BIBX 2YPKB 3D85A 1FGNL 3JV5A 1N9PA 2BNQB 4MTMA 4TQHA 3ATFA 4PS8A 1WISA 4PJEF 3G04A 4KO9A 4HIXH 1AAJA 4ZX4A 2BHFA 2PO6A 2ARWA 2R1YA 2CGZA 35C8H 4HOWA 2YXFA 3SDDC 5KN5A 1IM9D 5D9SB 2F08A 3KDPB 1RK7A 2BY2A 1VEPA 2WBJA 2FBRA 4H26A 2F54B 4LKXA 1OGAA 3PJSA 4PJ5A 2XY2A 1N7ML 4NKMB 5LQBL 3LB6C 4NYLA 1WC7B 5CZRA 3MLYL 4XH2B 5KOMC 1ZD6A 5B39A 1SLVA 2NX5B 1FNFA 3N85H 4BELD 4EI5B 2OJEB 3T77A 1EV2E 4GKNA 4P3DB 3ZE1F 3HZKB 1IC5L 3CVDA 3LPOA 1FZJB 2EIZA 3G9AB 5EH1A 3ML9A 3H9SE 4G42A 5AD0A 5F7UA 3B2VL 3MJ7A 4FHKA 1PBYA 1TCMA 1S5HA 4GUOA 1Q90A 1NTDA 4Y9GA 4JM2B 2DQTH 1J7VR 3D18A 3VXUD 5G4MA 5IM7B 1SHSA 1MCOH 4GKLA 2JIXD 5A6IA 2UXFA 1IGYB 1URZA 2DRUA 4LHJB 2CALA 1UGNA 1WLHA 3STBA 3NCJH 5IFAH 4NO2A 1BVNP 5FDWB 3O11A 4TVSa 4DGVL 1A7PH 5ACMA 4D8PB 2WNGA 1IJ9A 4XCYB 4NOBA 1YEIH 5DDHB 3VWKD 1F3JA 2BIMA 4QJ3B 4HH9B 3ARDB 3OHXB 1CGSH 5E8DH 4Y2DD 4L37A 2VNCA 3WTSA 4GW4A 4L3EE 1MREL 1DQDL 3AXHA 1LWJA 2EXYD 3MGTA 4N9OB 3WO4C 3VFRA 1EGJH 4Y89A 3RNKB 5GGUB 1TETL 2RA1A 4M5YL 4L2YA 3FUFA 9CGTA 4ZAKB 4NDMB 5AOKA 4TULL 5AQ0A 4J3OC 4HSAC 2Y7MA 5LGHH 1BDYA 2EYRA 3DBXA 4LCWD 4NN5B 3VGDA 3VFVA 1BFVH 3TU6A 3DRTA 4QTHB 3IRPX 5B38G 2CR0A 4YO0B 3N04A 5GS2H 3DO3A 5BQDA 5LG6A 3EH5B 5AW3B 3O3UN 1OP5K 4KGLA 1HQRB 1ZKAA 3AWGA 1LLAA 5GZNA 1TJGH 2UWEF 3K4ZA 2X3BA 2AJSL 4U7SA 3SGDI 3FU9A 2R0ZL 1U21A 1J0JA 2FR4A 4UNIA 1A3ZA 1ADQH 2IAMC 2VH5L 2WLLA 3V4PL 5AD0B 3QQ9C 5KSUB 2V5YA 5T3ZH 3VXUE 4IIQA 3MCYA 2W9DH 1X5ZA 3ARGD 5EUOB 5JHDB 4FZEH 1YYMH 3VD2A 2BVPA 5F3BB 1S5IL 4DP9X 2VZTA 3SGKA 3S35H 1E4XL 3U36B 5C0BA 2BO0A 4TTDC 2CLVB 2NNXA 3S6CA 4JO3L 4N5UA 1E30A 3LTVA 5C0EB 5M95B 5L2KD 2Y6TE 4QKXB 1UQSB 1A7QH 4S1QH 5D7SL 3TN0B 1F6LL 2E0PA 1KTBA 1IAII 4NEHB 2QPUA 2JB6A 5AG9A 4X83A 3WUWA 4D9RE 3NJVA 1L0PA 3T6VA 4S0SD 3EJYD 3P77B 2VZUA 2ADIA 4FNLL 2YPKA 3T0EA 1SM3H 4P5KB 1FRGH 1D5XB 3SQBB 3GBNH 4JG5A 3EAKA 3LZLA 5IP4A 5F9JB 3QUHA 2BRRH 2H0EA 1TQCC 5BRZB 1KGWA 1J12A 4U05A 5BS0D 2W9LA 1NFDF 3TBYA 5M94B 1CDCA 5FO2A 1TQTA 2X4OB 5DO8A 4LCIH 2AJVL 3K1KC 5BMFH 5IQNA 1FPTH 2J12B 4YH6A 2GTWB 1U8MA 1U8LA 1HIMH 1YCSA 3UCRA 2C7UA 1T89A 4R5XA 3DJTA 1B0IA 2DS4A 3HI1A 1WCBA 1UM4L 5C9JA 4QDGA 3AQXA 4LCYA 4EF3A 1JYNA 3SPVA 2EDQA 2QPFA 2JCCE 4WI5A 3SDXF 3VWJA 5MP6L 1EAPB 1ZVSA 5HY9A 4NT6B 4BQCA 2Z8VC 4F9LC 4UIMA 4K23H 1FNGA 2PKDA 4L18A 1XGPB 3ILEA 2G0LA 4H0LC 3BPCA 3COOA 3AM8A 2FLMA 1RZGB 4X99B 3QORD 3AY4C 4GUPB 3OJMB 4G9FB 1FVDB 4OJYA 5CD5C 5E2VL 4KK9D 1HZHH 1RJLB 3II2A 4W9DC 4YHPB 4UIMB 1EFXA 5DFVD 3H9SA 4JY4A 4PRPB 5I66A 1J9TA 1TJXA 3L4WA 4QEGA 2EDKA 2QLVB 4UM8B 4U1NA 1NCJA 3PGCA 3QPXH 5KBMA 2R59A 4NPYA 3C12A 3TBSB 5DI8B 4I88A 1PZ5A 4EDXA 2DQGH 1NGQH 1A25A 1GGIH 3UJJH 1KPUB 3O2WL 4QRQA 3GSVB 1E9PA 5EU5B 3F64A 4YZFE 2B9BA 4PGZA 3X1GA 1FH5H 2X12A 3MACH 5CGBA 1ZY9A 4ZQKA 3EADA 3IMRA 3QQDB 2A0LC 2YAQA 1FJ1A 4A2LA 1ETB1 4M43L 5FOBB 4DN3H 5K59F 1KV3A 1X9QA 3IAGC 3UP6A 2UXVA 4NWUH 5EU4B 4WF7A 3V0AC 1JD7A 3JZ7A 2YUZA 1H0DB 3P4OB 2EDTA 3EHBD 2Z35B 3OLIA 4OCLC 5AVQB 2XU9A 2H32H 2JCCB 1JHLH 1NFAA 2FT7A 3K91A 4HHAB 4KPHH 1N0LB 4FNRA 1KG0A 2WWKT 3Q5TA 4DP6X 5D2LF 1J1XH 5MI0B 4F24A 4U1JB 1YY9C 5J5EA 4IM8A 1XWVA 2EADA 1O7DC 3GXDA 3QJQB 1OD7A 2PR9A 4I7ZC 4L9DA 5DT1L 4Y16B 4G7YL 1ZK5A 2QHLA 1DSFL 4IRJC 5DS8B 5F9OL 4F1SA 5CJXC 3KGUA 4GH7B 5FECA 5HXMA 5IKCB 4OKDA 1DQQB 3MNZA 3Q6FB 5DCCA 1VDGA 2DIAA 4KK8C 2H6PB 3S5ZA 3V7AG 2ZUQB 2O4EA 1F00I 1GYCA 4DTGL 3CFNA 3L5WA 4X8XA 2WLKA 1U58A 1YMMD 3FQ4A 4OZGF 4X6CB 5CGYC 2QKIA 3DDGA 5C0FB 2J44A 1WV7T 2W1NA 4LIQL 4YXLH 3L3IB 3ARGA 3KPSA 5TE7L 4M3HA 3ZXAC 4BINA 1Z9PA 3H9YA 3D48R 3QR2A 1RU9L 1NOLA 2E9GA 1SUHA 1INDL 1LO3H 4PJ8A 4AGNA 1A4JA 5ESAA 4TSCH 1O9ZA 4LFHD 4KRLB 4ORZC 3VH8G 2DBLH 4HAKA 2EDLA 3D51A 43CAB 4KH9A 4ZMXA 2R9HD 5DZOA 1SYVB 3U2SA 5A2AA 4I48A 4JHWL 4G6KH 3L2LA 3WEOA 3D9AL 3N0AA 3SBQA 4QLWA 4Q9BA 1QO3A 3OD3A 4G6ML 1GMIA 3DO7A 2X0WA 4KKQA 3BN9C 4OCSH 4XAWL 2JI1A 4OAWA 4GIPD 2Y1ZA 2F6AA 5J11B 1LNUB 1NOAA 4XMZA 3WE1A 3RNKA 3ZDXB 1CGWA 5TPWH 4L0YA 5T1DL 4FQ2H 1BPLB 3CSPA 4FTVB 4MNGB 3I9GH 2IPUG 4O58L 4XP1L 4ZUTA 4M5SA 3GNMH 4J3TA 4LKCB 3U46A 5JPMC 1YN6A 4HCRL 1I3GH 3MKKA 3U83A 1FFTB 3RAJL 4FULA 3JVFC 2EH7L 3ESVF 4F9PA 4FNUA 3OMNB 3US1A 1F4WH 1JI2A 4FEMA 2FH8A 4QHNA 3ZGIA 1DO5A 3B34A 3F3HA 2YMOA 4JW3A 3RX8A 4RFNB 2GTZB 3D25A 3HG1B 2C9AA 3RWHB 5CSGA 2QFRA 3VD5A 1B4RA 2LQRA 4AG4H 1E28B 1B3JA 1HC1A 5E4IA 1U8QA 1QEWA 2J1XA 4ZS6D 4HKZB 5L8JB 4V1DA 1DP0A 2Q2EB 3CU1A 4R4NC 5DC9B 3BW9A 1AZZC 2H47C 2NZIA 3E0GA 4WZ9A 3NCYS 3F7QA 4HS8L 5E8OB 4FAAB 4GKZA 2J7LA 2V2XB 3KYNA 2EC8A 2BP3A 2LAGB 2FUQA 1Y07A 4AGPA 4JR9L 4JJHA 5D2LA 3BD4A 1ZLVK 1I1RA 1T4KB 3E80A 4FHJA 2DF3A 4HA1A 4YVUA 1WVZA 3QORA 3KVQA 2DQHL 5I8CA 4OLZL 4NZRL 4RBPH 4YAQA 5DQJB 1MIEL 3CSFA 1WC7A 1AGEA 1KFAL 4G7SB 1RZKH 3D69A 3MBEC 3QCUH 4MNHB 5D1XB 4F7KA 1SJHA 3GPSA 4E5XG 5HGGS 1C7SA 2EDMA 4U6YA 4I0PB 4RGOH 3HR6A 1E5UI 4D9QE 3O2DA 1YNTB 4O02B 4XXDA 2RB8A 4H2AA 4C56D 1KN4H 4PCTA 4AYFB 3IMBA 1XCWA 1RVFH 2CM6A 4QCIA 4MD0B 3WMQA 4RVBA 1RL1A 5GRJL 2WINB 4WIQA 3W57A 1Q9KA 2VLKA 1CT8B 4QNPE 4DGIH 4XVTL 3GMMA 3MLPA 3IMWA 2MQ3A 4P4KB 2E9WA 2IAMD 4F7MA 3WAJA 2E76C 4ELME 3ARDC 5EU6D 2EYTB 1UKQA 1YPZA 1F2XK 3HFML 5EZIH 3AMLA 4JGUA 1CXKA 3BH8B 5EO1A 1MY7A 1OCWH 2AERT 3KD4A 5E9DE 3T2LA 3UYPA 2XPGA 2WQVA 1FBIL 1KEML 1TSHA 4AUJA 4D9LL 4I48B 1DSYA 5KVGE 3SZ6A 1DBBH 2NCEA 3FSWA 4JM4H 1RUML 1AQ8A 4HC1A 1BEYL 4J3OD 3O2VL 3OJDA 1OAXH 3VFMB 1HJBC 3V4PA 2DQCL 1M53A 2GT9A 3AY4A 4M56A 1LEKA 5I75C 3UOAB 4PJFF 3HI6H 3S3JA 3B2MA 4JUSA 4NN7B 2R1WB 5C71A 5C0AD 1L9SA 4QTFA 1J11A 1FVEB 2MNJB 4HJSA 2KLRA 2QEJA 3WGVB 5D5MB 3U1PA 2F7RA 4DW2L 3L7FB 4PRAB 1T2QL 1QSEE 1P53A 4L0PB 5JOFB 3IKCB 1XCTB 3PGDB 4JFVA 3VFSA 4LU5H 4XWOC 5IW1B 3S0PA 4NUGH 3MODL 5DRZB 4YHLL 3Q8EA 4FRWA 5IFJB 1Z9MA 4AGMA 4Z7NF 1WWBX 2X0VA 5CCGE 4XMKL 3F01A 2CO6B 4F58H 3LRHA 1PVHA 4S1SH 5D72H 2ZUTA 3JTSA 3KL3A 4YFLF 1KJ2L 3BPLC 4WDIB 4BM7A 3RWDB 5A16A 5IQ7H 1J18A 1RK1B 3LMJH 3CNKA 4HJEA 1R3HB 1G7PA 3NZSA 4UNTA 1MH5A 3MRIB 1JMXA 4QHUA 3CVHL 5E9DD 1AGBA 2C9VA 5FGRA 1H0DA 4ATTA 5FYJL 3G6AA 4R26L 4N0FA 1OWWA 1Q1JL 3OZLA 4XMPL 1FL3A 1J8HB 3SE4C 4GW5A 1I8MB 4WGKA 1R19A 4UTCA 2HJLB 1SJEA 5F71A 3T0VA 4KV5F 4ZUUA 1Q9OA 3WHE1 1SN2A 3QFJE 2CXGA 3MXVH 4M7ZC 4WSJA 2QPSA 4G7VL 1U8CB 3ZZ1A 3PAZA 5B21A 4WUUB 5AWNL 1RJYA 4P9ML 5E00B 3X17A 4PSPA 2DPKA 3BPNC 5C7XL 2DQEH 5I5MA 2XCMC 5J3HD 3QDGE 4V1DD 2M2DA 2DDQL 4RX4A 2WNWA 2ICEC 3HVDA 4WI0A 4JHBA 3LZQA 3KLLA 4U3HA 4WWNA 1SQMA 3ZZLA 4RQQB 1O7SA 3H6AA 2ZUSA 3NJFA 2HX8A 1WFMA 1ZLDA 4XPFH 3CQQA 3T8XA 3C5SA 1EHKB 4PRAA 4AENB 4AEHL 4O02L 5ACLA 3QNXA 5IMOB 2Y06H 4UILL 1FVDA 2J4WH 3ARFA 1Z9LA 4Q4EA 3ZQXA 3WKQA 5FC9A 1NAML 1A3RH 4ZNEA 2ZNXA 1G7LB 1H8LA 3CSYB 1Z9NA 4RGND 1B3IA 2CLZB 3C9NB 1VGKB 3EJZD 3OJDB 3R06B 3VFMA 2WZ6A 3S8WA 1FG2B 1V5JA 2JB5L 2K45A 2UY6B 4KUZL 1BF8A 1A65A 2WNKA 4PW3A 3HZ3A 3IF1B 2FJFB 1UJ3C 3LKPB 5I19H 4LLQA 2AXFB 4PJIE 2AJXH 2NXYD 1HEJC 2AQQA 2GBAA 3KVDD 1QVOB 3L17A 3QRBA 4WWKB 1WCBB 3PGFL 4HXBH 4LRNH 1H15B 3CZLA 4YXHH 1UCBL 1G9MC 2XOTA 3F12B 1F6AB 3NJHA 3NSFA 5ALCL 4C56A 3KBPA 3IM1A 4NJ9L 4TPRL 4UIKL 2V17H 2E86A 4M48L 5CHNA 2HLAB 1WITA 2XVLA 4PSRA 5LNEA 4BQ6A 3FN3A 1P4BL 1UYWL 2NY7L 3T08A 4I5BA 1EERB 3IXTA 1CVRA 4F2EA 1OK8A 4GQ9L 4F7EA 4RMTA 2E5EA 2F5AL 1NCCL 2IAMA 4Y2LA 1ZS8B 2VDNL 3KHQA 3OB0H 5CJOL 2ZPKH 4X9HA 1OGSA 1ORQA 3H0TB 4MCZB 4ZSOA 3FOLB 2Q20A 1J5OH 3KBFA 4QI3A 1RZJH 4GS7C 4TKWA 4LEXL 3C09C 4BFFA 1U8JB 2ZUWA 1G0DA 1AHWB 4OUUB 2NQDA 1ET8A 2QGCA 4QRAA 3Q06A 1OIOA 4UWQB 4DZBA 5JPNA 3ATEA 1OF2A 4LSRH 3VXMD 2Q8AL 4GFTB 4ETQA 3VXTB 5C6TH 2CUMA 5K9KB 4TUOB 1G0YR 1SJMA 1NAKL 4LSDA 5I8CB 4BFRA 1FH2A 2FATL 2M8XA 5TH2A 5CU5A 1B2WH 3MRLA 4NUPA 3NZ8B 2YRPA 3MUHL 3HI5H 3EJQA 1S3RA 1BQUA 3K46A 3MRJA 1I75A 2C1PA 4JZNA 3QJHA 2ORBH 5F7FA 1D5IL 4JFYA 2D3JA 4XNUH 5CLWA 1FNEB 4HLZH 5D7IB 4Z95H 1F4XL 3WV0A 1IZJA 4KJYA 1P2CA 4G8EB 3ARYA 5IG7B 3G08A 4K9EH 4FFZL 4AC4A 5DMGD 2XWXA 1DN2A 1KZYA 5DD5H 4YHKH 4AYSA 1A4KA 2WV3A 4R7NB 1N5YL 4XMWA 1MJJA 3POHA 1A9VA 1GW0A 3IJEA 5D93B 5EZOL 3TEYA 4L4TE 1KJ3H 2RJMA 2CJUL 3OKMB 4R4FL 3K6FA 3PV6A 2K7QA 1NA8A 5LAXB 1NBVH 4YXKL 1C08A 3MGOA 4NCC1 1TENA 4WHTA 1I1AC 2XIDA 4GAYA 3V0WL 3D0LA 2A9DA 3QJSB 1DUYA 1TQSA 5IQMA 4PLJD 3ESNA 2RBLA 3CXFA 1QABA 1A02N 3HAEH 3MFGB 4P4RB 4ZUVB 4YLBA 4XP9L 3NIDB 5DJ8A 4ANXA 4MXQD 1MY5A 3JV6B 1D5MB 1GS7A 1QOKA 1R5VB 3QFJA 2O6DA 3GF8A 2EIJB 3TO4B 2DTML 3BQUC 5G4NA 1HXYA 1K8DA 1LD9B 4NQUA 4AV0A 2HT4C 3T6QC 3RZWA 1H3PL 1XF5B 3GJEB 3S4SA 4ANWA 5LWYL 3FSOA 2LHAA 1XTLA 4BZYA 3VXOB 4E41A 1HYRC 2ICWI 3DJSA 5IIEB 2WWKO 3IB4A 5BVPH 5H37H 3TTSA 1T2XA 3HC3L 6TAAA 2QADB 4W93A 3NIDF 2ITCA 1I9EA 3U0TA 4H44C 1KT2B 2TSBA 3MRNA 2HWZH 4GKNB 4P3DA 3IMVA 4A7SA 1X7QA 1GAFH 1KB3A 5F9AC 1ULVA 1NQBA 2P8PA 2IDFA 4QWWD 1CLZL 2D7NA 5JXEA 4CSPA 1I3UA 3LKRB 1HSAB 1G7MB 1TEYA 4I1PA 3MNZB 2WPGA 2MCAA 3LKOB 3DYOA 3U0PA 1MW2A 4AQEA 3RY4A 4EJ1C 2FJGB 3GZQA 4R8WH 5LLIC 2XY1A 6CGTA 3ZDXE 3QI9D 2V8LA 3D87B 5I6NA 3S5LB 5EN3A 2WTOA 3W5NA 2GJ6D 2P48B 1MG3C 1TZIA 3EDJA 4GS7B 1CL7H 3GS4A 4W4OA 3FN0H 4ODSH 4IOIA 1UATA 3NIDE 1RQ5A 2VLRD 2BWQA 2J73A 1PG7L 3P4OA 7PAZA 1IE5A 1R24A 2A6KA 1NL0H 2XTJB 5HGAA 3V9CA 1OT4A 1G6RB 3IRZA 1RZQA 3TPKA 1DR9A 2P3YA 1VACA 1OAZH 3TCLB 1BWWA 2CXKA 4HPYH 4RMRA 5DFAA 3QULB 4BK5C 3HBGA 1EEYA 3T9WA 1E9PB 5EU5A 2HKFL 4DSYA 3RVXD 4DKEL 3M1BA 1LEIB 4ZXBC 4N4YB 4ZMVA 5CEZL 1KCWA 1FVCB 4X7SH 3FUHA 2CRIA 3SBPA 5JYLA 2OJ1A 1NEZA 4UM8A 4DP8X 2MCG1 3REVB 3TWCL 2OK0L 1LO4L 1IBYA 4XNQA 3DV4B 1KB5B 2A74B 3VYOA 2C9SA 2RQ8A 5F89A 1CE1H 3F58H 3M17A 1ZVHA 3TASA 3TL5A 4DKFL 4UTAA 5E24E 1M6OA 3CVBA 1AG0A 3H9SB 4JY4B 4PRPA 4MBOA 5TD4A 2R7EA 1Z0NA 2H2PD 5HYSA 1NKGA 2YD6A 1NAMB 1MAJA 1FAIH 4ONFL 1F41A 1QA9A 4F8NA 1UEMA 1IKFL 1QPKA 4N87A 7TAAA 1FA4A 4X7DC 1RIHL 2PCPB 4MHHG 3ARXA 2PWHA 2NR6C 1OM3H 4FF9A 4JFQA 2A83A 2H9GB 5D1QB 3UG4A 4K8RC 3BZEA 2GJ6E 2ZUVA 2ITDA 2QVKA 3KYMB 2Y72A 2DKSA 1ML0A 4XHJD 1X7QB 3FCGA 3RL2A 3THML 2F74B 3UPAA 1KPRB 2EDEA 3NIFE 5F6IC 2B1HH 2IPUK 4FXGA 4M1GL 5JTWA 2WQSA 4BYHA 5MENE 2GUOA 4U4BA 3VW3L 3MLRH 1CD0A 4I2XA 2J1WA 1C1EH 1J0YA 1WF5A 1RMFH 1KLUB 1P7KA 1JL8A 3BUPA 4AKOA 1RJZA 4HG4K 4ZMWA 2AAVA 2FX8H 1ZEAL 2AQRA 4MB3A 5AB9A 2QHRL 4IKJA 4DZ8A 2X4UB 3VXMB 3LKNA 2UUDK 5D96C 1YEHL 2IWEA 1P6FA 4FFZA 3UX9B 3NMEA 2I27N 1I7RA 4JO4H 4HH8A 4X5XB 1BCIA 3ZDYE 5JHLH 3E6HA 4ODHH 1QFWI 1JPTL 4GG8B 1ANUA 3BWAB 2HH0H 4QRTA 4DAGH 5HYEA 5GGRB 4L1SA 2KT6A 1TCRB 2PWDA 5AB2A 1KULA 3VD1A 3B2PA 5EFIA 4I2XE 5GRVK 3ECVA 4W81A 3OXRA 1F97A 1YDPB 4JFTA 3DHJA 2VDKB 3ARBA 4K7PY 3B9KD 2XPZA 2Q3AA 2DD8L 3D34A 3EO9L 1KCSL 3NSDA 3RHWK 3K2KA 5C6WH 2HFEB 2YA0A 1II4E 4OLWL 4IRZH 4KQ0A 1HOCA 4XPGL 2OJZH 4JREB 1MZZA 4YLCA 3WTTA 3K6IA 2GY7B 3U9PH 4H8WC 1PTZA 3IFLH 3BGMB 5FYKU 2YD1A 1ETZA 2PO6D 3NYKA 2G3XA 3N42F 4O2EA 4WI4A 4ODUB 5CS7A 5E6RB 5KVEH 5GGSB 1VEOA 3FMGH 5E56A 4IOSD 1MHPH 3NK3A 4PJFA 4PI0A 1NMAH 1QLRA 3CFCL 4MA7L 3ZQ9A 1U93A 4LPCA 1EEUA 5E1AA 5CF3A 3OPZH 3C60A 2Q7NA 1S9YB 2YIHA 4MRBA 2H1PH 2Y7OA 4FJYA 3TC9A 4LK4A 3DGCR 2JCWA 1E2VA 4FFWC 5F7HA 1OTUD 2GHZA 5F9WB 3FTWA 4WWKC 1TLMA 5DMKA 2O5YH 4HMEA 2MCPL 1A0QL 1BM3H 1AI1L 2G75A 1HSBA 3GO1L 3K72B 4BFGA 4LEBA 3BIKA 4HJ0D 3L1OL 3MQIA 5IVZA 5HYSB 1U8IB 1BG1A 2NY1C 4ZSOB 3GK8L 5EBWA 4LHUG 3TJHD 3QZWB 5C3TA 4ZPTB 3S97C 4Y1AE 1KB5H 3IFOA 2VXQA 1RD6A 3WNNA 4XCYA 1JS4A 4NKIL 5D7JC 4MMZA 4OF7A 2GFBA 1CDGA 4UQ2B 2YA1A 5HVHB 1MVFA 1YQVL 4GOSA 1KBPA 1P5UB 2B39A 3O3DB 2YPLD 5C0BE 4I5BB 3W39B 2DQUL 2ZF9A 2X28A 2BS8A 1JNLL 1YEWA 1MI5E 4DGWC 2Q87A 4P9HH 3MLZH 5ANHA 1HE7A 4AQ1B 4BH8A 1JV2B 4HKJB 3FTXA 1S5HB 3QXVA 1UZ6F 5KVFE 5DMYA 1G4MA 5I1EH 1JF5A 4OFYA 1H15A 4RRPA 1TFHA 3MJ7B 1AR1B 2EVJA 3MGAA 4W9IC 3VGHA 4HF5L 1IM9A 1O9WA 2XDHA 3P73A 1HH6A 4Q9RH 3CHRA 2FJFA 3C60B 5DURD 2OS7A 5I76B 1OHZA 5ID1B 1QBAA 4M3KB 4PJFB 5HHOA 4XH2A 3ZE0E 8PAZA 2JH2A 3MRCB 1R0AH 3IXAB 1NEUA 4XO3A 3ARVA 3LV3B 2W38A 3ARFB 3D39B 4QJ5B 3F7VB 2JELH 3ROLA 4XB8A 3Q9QA 2XX0A 3DO4A 1EHLL 1IAMA 1OP3H 5AYUH 4YSQA 4OGXL 4B3VA 5T3XH 1D5RA 1A5FL 2DWEA 5F1IA 4KHTH 1LO5A 3AUWB 2NY3D 4JFFE 3TBVA 3CN3A 1CLYH 3IDYC 5C07A 2BSDA 4ZW7A 2VWEC 4TRPL 3FU7B 1MFEH 5IKCA 3BAWA 3HNSL 2IADA 2CIIB 3AQDA 3HRPA 5DS8A 2ITFA 3VVWA 3C09B 1CFSB 3FUNA 2PNDA 4U1HA 4FFYA 4Q52A 1H9DA 4CA4A 1J0ZA 2AEQH 1K5NA 4YSSA 3ZTNH 3AMKA 1VPOH 1QFWH 2D0FA 2MJWA 5FGBA 3RVWD 3GKWL 1QLFA 2D0HA 5K39B 1GC1C 5DHVA 2VN7A 5CILL 5T1LD 2Y3AA 1I8LA 1L7IH 3EO0A 4K4KA 2J5LB 2F5BL 4X4XA 1LL1A 1ZT1B 1NOFA 1TQBC 3GMNA 2H3NA 4PJDA 4Z7QE 1XB3A 4GSRA 1JPGB 4GRMB 2NNFA 2KH2B 4P23A 5GRYA 1AD0A 1JDCA 4Z7WB 4JFHE 2CO3A 1Q72H 1FG9C 3I2CH 3UPRB 4QO1B 4G8FB 4P5RA 3R8BB 3I75A 4EDXB 2AABH 2XUWA 4OZIA 2BHYA 2GUOB 2JKRM 1JPEA 3I6LE 1CFMA 3CVIL 1T20B 1P5VA 3D4GA 3HAEG 5ENWA 1DFXA 3N6YA 4HWZA 1MUJB 2FGWH 3P11H 1RZFH 5DMJB 4YDKH 4HCRA 2IH1B 5JHMA 3GB7B 1PZBA 3WKYA 4G1MB 2QADD 1NMCC 1S7VB 3IU3B 1IRAY 1NM4A 2K78A 5DGRA 4KTDL 2VDNB 5I66B 5I1IL 1IGJA 4P4KC 4X5PA 2H32A 4EZJA 2BZCA 4IOSA 4P5MB 4G11A 2GEEA 4PGCB 4PQXA 1AD9A 2WZPD 4GP4B 3BPOB 3NABL 3TT3L 4PGBB 2WMPB 5DRNA 3U4EA 1JHKH 4GSDL 1EXUB 4NZFA 3BPCB 4RGMC 3W2DH 4AL8L 4XRCB 4AYID 4HUXA 1SDYA 4A7TA 2PO6C 3LYRA 2P45B 3EYQD 1DCLA 2H26A 3GMOB 4WU5B 4XC1H 1IUZA 1DBAH 1MRFH 3MSPA 5I71B 1KB5A 2VJXA 2DYSB 4OZIE 3L3OC 3H9SD 5DJYB 2YLHA 4GYBA 1TLKA 2K8QA 2Q76B 1BEXA 2NSQA 4PB0H 4OJFL 3Q44A 1QLFB 3W2DL 3HRZB 3SY0A 3QQNA 1AZUA 2GSIB 1YYLL 2VRKA 1ILUA 3FUJA 4WSGA 4JQIA 4WRLA 3BDYL 3ILQC 2ADJB 1J9RA 4LEOA 1MRDH 1QHPA 1UGKA 5KYYB 1BVKB 3OLGA 5D6DC 2CA3A 3SOBL 4BZ1H 5DD0L 1QD0A 3KPLB 1ZTXE 3TO2A 3ARRA 2ZSVA 2YPLA 3HBPA 3D6GA 4QRBA 1IC1A 2J2ZB 2NY3B 4N2LA 3TBBA 4DKTA 3B5TA 3I6LD 3IT8D 1B0RB 1SXCA 2X4PB 5DJCA 3TYFA 3NCWA 3WUWB 3GFUA 2HMID 4Z7OF 4KNQA 1R75A 3N1PC 1TZIB 1EWHA 5CKAA 2VDQH 2MOGA 2XXCB 4LSUH 1V7MH 2RTTA 4HBCH 1CBVH 4KV5E 5KSVB 5CZVH 2Y5TB 4M9PA 4Y5XB 4YPJA 1M1XA 1OB0A 5D4IA 2P4AB 4FN0A 4HIPA 1JVLA 2R4SL 1FFRA 4QT5A 2Y2TA 4N20A 5C0GA 3SPIA 5ISZE 2J8UF 4ACTA 3IWUA 3VVVA 4M62H 1OTTC 4FQXC 3T3ME 1RIUL 2Y4SA 3INUL 4KFZC 1F13A 3V0FA 1L5GA 4U0RC 5J13C 1CYWA 3OC8A 1RIVL 3VRJA 3SQRA 1YMMA 2Y7SA 3L95A 2APTA 1QI4A 5IK3A 1BF5A 5FK9B 3HNSH 4PH8A 3ZHKA 3CXDL 3TESA 2YK1L 5EG6C 2XG4B 3ZO0A 1MHCA 4XT1C 2AXWA 4UMSA 3EFOB 3B7SA 2I26N 5H94A 3C8KA 1I9JH 3NG5A 4KHTL 4HIEB 5I9QC 3GBMH 1RUKL 2GFBB 4P2YA 4AEEA 4HEPA 4KVCL 2G9HA 2JXMB 4WWID 4E9WA 4LNRB 5DJ0B 5BOZG 3EJZC 2XWTB 4EUPA 2JELL 5CGTA 5TQ2H 3PDOB 3O6FD 3BHBB 1FE8H 2K3HA 5DXWA 4HOZA 2ADYA 1DZ0A 2WLHA 1MWAL 3TFKC 3WJMB 4K7FB 1JYXA 2DMCA 3S36H 2XQBH 4PHXA 3I74A 2ZWYA 5AW5B 1S7SB 1LM8V 5KUKA 4FFYL 5F7YC 3MDJA 2LGNA 4JKPL 4PJCA 5DWPA 3IDIB 2WO2B 4MA8L 1A9BA 3QG6A 4ABUA 5SX5K 1B4LA 1DSWA 5JW4R 2X4RA 5LN4A 1NFDB 4OLYL 2VMDA 2AI0H 3QIWD 2E27H 1CF8H 4P2RD 3SGEH 1R3IL 4Q9QL 4K8RD 4Q0XH 5L8LB 1PW3A 1FNHA 4R0LA 4G8EA 4ODUA 5CSBA 4XC3H 1S9VB 4M8RA 2DQUH 1V8HA 5FYLH 1A1OB 4KI5F 1M7IA 4LLUA 1KCKA 2BVUA 2QKIB 1I9IL 3MRQA 4MXVF 4ADIA 2IFGA 3B7YA 4FLSA 3RNQB 4F7CB 1J9SA 4JO2L 4NI3A 3MRLB 1IQWL 2AV1B 2WZPA 2VXUH 3B3IB 3CC5A 3IYLW 2KERA 1G7IA 1UXLA 4P5TD 5HP5A 4OT1H 4XO4A 3ARBB 5L8KB 4WTQA 2OSYA 3DGGA 4UDTB 3UYRL 1AI1H 3FRUA 3ECQA 4IHOA 4BCYA 1ID2A 4JQIH 1CR9H 5FO7A 4F2MB 3FSVA 4EKXA 3HS0A 2K3TA 3PFQA 4HGWA 4WW2B 1L7TH 3BVTA 3R0MA 1MF2L 1W0WB 1JYVA 2Z35A 2H1XA 3ZJAA 4R2GC 4HJUA 3QC5X 3TVMD 4IIQC 5FLUA 2NW3B 2VDQB 4P4KD 1BQSA 2YPLB 4HJJL 4W6WB 1S6NA 3Q2LA 4B5EA 4RISL 2YRLA 1UTDA 4FMKA 3BAEL 3RGVD 5I1KL 2VABB 3UTZA 1ONQA 4X9BA 4PWKA 3PV7A 1XL6A 2VB5A 2H2SC 2GJRA 3GSOB 4GQQA 2X09A 4DGYL 5A2IH 4IS6A 4XPGH 4C56B 4KDTA 4XZ4A 1MLCB 5BOPA 4WWKA 5L2JB 3S96A 3C6LB 2MPVA 1W8OA 3RL2B 5FM4A 3HLAA 3GI9L 4WEMB 2ZKMX 1BQHA 2N3JA 4LESA 3BP5B 2C9XA 4LSVL 3EGSB 3CFTA 5LGJB 4YGVA 3DSNA 1OANA 3SKNB 3GSNB 4HLEA 5IT2L 1EXUA 4LHUB 5CUSL 3LX9A 4PGBA 3S37X 1KCUL 3LSOA 4KOBA 5J4MA 5AAPA 3FFDA 4PGDB 4JG1L 4ODHL 2W60A 1PL3A 3RJOA 3EGSA 1NBQA 5D2NB 2UZXA 4JO4L 4FFWD 3U6RB 3WDIA 2AK4D 2OXHA 5HHMB 4D9RD 2JQMA 4NENA 5HHQB 2CO7B 1KELL 2QMKA 3HNVH 3AACA 3LS4H 4UINL 3FXIC 1AXSA 1NDMB 1ZDSA 4U6XA 5DHVH 4UQBA 2WLZA 4G8GE 1T1YA 4QD2E 1DTUA 1UA7A 4JPQA 4P2CG 4N5ED 3FTGB 2N4IA 1X7TA 4ZFZA 2VW4A 5B1JC 1NGZB 4BSVA 5JOPE 2EIBA 1I1FA 2XJKA 3MLVL 1E4WL 1FIEA 4X4XB 5DU7A 5E5LA 2EXSA 4N0FB 3MLTB 3MOBH 4G3YL 3HG2A 3WJJC 2VXSL 5T3XD 2DLGA 2IANA 3GMRB 4K94C 1U36A 3QIUC 4ZOBA 4XNZC 3QZNA 1CFNB 1P6AB 5HYFA 3GHEH 2W8CA 1F4HA 1RIHH 4J6IA 5E1HB 2N0KA 2A9ML 5FWQA 1GJWA 5EZPA 2CCVA 5FO9A 5D2LE 5FO7B 4P46D 4AKQA 5D7IE 5DTFB 1AMYA 1WFTA 5LDUA 1PG7W 2AW2A 3IDJB 3F58L 5I23A 5FR3A 2IADB 1OAQL 1FAKT 3QIWA 3KJ4B 2BSTB 3FB8B 2OK0H 2ZAIA 3A24A 3TBVB 4NNYB 4NAMA 5J6HA 4XCNB 3PWJA 1TUPA 1N6UA 1I7UB 4IRSC 1S7WA 2X2YA 2HT3D 4UT6H 1MXDA 3FQTA 4PS7A 2O6FA 3QDMB 3RNQA 5GRUL 4GXFA 4RDQF 4X4YB 1CLOL 1TJMA 4L4VE 1T66D 2L8AA 1A1OA 4P05A 5EDSA 5J1SC 3NIGB 5EULV 2YGPA 1RURH 4YSEA 1ZIBA 2CKBA 1TZAA 5FKPA 3VH8B 5ICYB 4K5PA 2X6UA 4UT6A 3UABA 1C5CL 1MFDL 1OD9A 5F70A 4DIXA 3OAUH 1K3ZA 4FG6D 4QRPE 1MSPA 3HUJF 5HJGA 3GSUB 5CINL 4QAWA 2XKSA 2CG9X 2VXQH 1LO0H 1A14L 3LIZA 2R9HC 3CN0A 4X98B 3WIHA 3L08A 4F27A 1XEUA 1OTSC 1IGMH 2ICCA 1O9VA 1D6VH 4CL7A 4XZUB 3CZGA 4CU8A 2HCZX 3BPNB 4NQSB 5TGBA 1A22B 2CWRA 1SXBA 4MAZA 1A4BA 4PJBF 3ZW3A 4K7FA 2OSXA 3SKMB 4AQ1A 2O6CA 3NEOA 4QNPF 1HEHC 3LEVH 4P4KA 5FAAA 2FEDC 5SV3A 4EUPB 1JFQH 3DRQA 3O0RH 4OFDA 5KYUB 4WFEE 5E6YA 4MVBC 3K2UL 5E6IB 3RGVA 1CT8A 3TX4A 1ROCA 1EMTH 4ZS7L 1G9NL 5HD8D 1WHOA 5CN3A 1M71B 3IJHA 4E0RA 3EO1A 3KH4A 5I18H 4E42A 4YN3A 2E7BA 3D0AA 1LE5B 3QE5A 1A4KB 2R0WL 2YD7A 3H2PA 4XGZA 1NUNB 4AGOA 4U1LA 3FB6A 3LVTA 1B6DA 4RSYA 1WAAE 3GD1C 5BVPL 4L4VB 3Q2WA 3RFZB 4OD2B 3KWXA 1QSEA 3KPNB 3LQAL 1BBDH 4R7DB 4RGNC 4YS4A 2A38A 1DVZA 1I4FA 2C3XA 1VSCA 4PRHE 2RR3A 1H3PH 1KXHA 2AKRB 3SD2A 4WO4D 4OGAD 5KVFH 4DNLA 1HINL 1N68A 1LTXA 1V54B 3B3BA 3KLHC 3MO1A 4AIZA 3IDUA 4QRPD 3EKCA 1S9YA 1CFTA 1ITBB 4XVUD 3WN5C 3NZ8A 4LOUD 2XWJA 2ZIDA 2BNQE 1VFBB 2IAAC 5JMOC 2YJLA 1U6AH 4Z9KB 3O4LD 4U4IA 1HHKB 5I6PA 2N7SA 2N1TE 5IOKA 3AB0B 3CIAA 2NY6D 5CEYA 1AS8A 5C0AE 1RZ7H 5JPNB 4NCC2 4NQDB 1WDAA 1W80A 1FC2D 1IBZA 1NC2D 5EN2B 1D5ZB 1RI8A 5DUPH 2BINA 4HUUB 1U8QB 2NY0C 2OMWA 2F1AA 2NY4D 1VCBC 3GJFA 1U3YA 4U1LB 3U6XS 1KJ3L 3MFFB 2Q3ZA 4K3DH 4K3GA 4PRHA 3MBEB 5D1XC 1FQ9C 3UBFA 2EUVA 1DQKA 4FQIL 4L8BA 4U1KB 5E03A 5BNXD 2VDKL 4PY8J 4J8QA 3AW5A 4BUHA 4OY9A 4TUJA 3AGWA 3N1GC 2HPOA 2V5SA 3IMTA 1P1VA 1GOFA 1SJVA 2BIQA 2WNXA 2WKGA 5IMLB 3OXRB 4K55A 4ZYKB 1GY1A 1ILSA 3QH3B 4OQTL 1IFGA 2G2RB 3L3JB 2WC7A 4XNUL 2B3RA 4YSTA 1HDMA 3BAYA 4HMCA 2ADJA 2P8LB 1D5BB 2COQA 2X3CA 3EJSA 4KY1L 5IB4A 5KVGH 4PLKC 3SY0B 3ELAT 4NHUB 2EEBA 4WFHD 3LN5B 1FFPA 3FN9A 3ULVF 4Y5YC 3L4XA 3CSGA 1CGUA 3HZVA 2X6BA 3PF2A 1U4EA 3H9HB 3EUDA 4JFFB 4NQCE 3UTSB 4RGNB 5FF6B 1R3JB 3VXPB 2H45A 3OAWA 4LSRL 4WU5A 3RKDC 3VXMA 5LBSH 2WXJA 3KYOA 2R29L 3MROA 2GCYB 2VTFA 4H8WH 2J20A 1QHQA 5HTSA 3PHOA 1NGWB 5HI5D 4M8QB 3HB3C 4GO6B 3VH8A 3P2TA 3CFJB 3I9IA 2H41A 4MCNA 4IBLT 1KTLA 1RZJC 4E41D 1LGVA 5E0QA 1KYDA 2YN3A 2ZPKL 5EUOF 3NA9H 2C4XA 2GK2A 3R19A 2LTQB 4PCYA 4Q4IA 1OPGL 5JPMB 2ZX8A 3EUUA 4PJAF 3GB7A 4NNYA 2QZQA 3T2OA 3ZKQD 5J6HB 1EZVY 2DTSA 5ERWA 3MNVA 4HJ1A 1DVFD 3BZEB 3STLA 4ELMF 1UFGA 1O6SA 4FI7A 4OLVH 4RETB 1GYUA 2F68X 3S37H 1RJYB 5GZND 4F8OA 1F1DA 3F6LA 4D8OA 4R6UA 4UIKH 4XMXA 4PGJA 3V9EA 1NUGA 1KY6A 4FQ1L 3O3EA 1Y0LB 2X1WL 2VDOH 3WOVA 2G60H 5AFAA 2WLIA 3L48A 1FV1B 4YFEA 4ODTH 5EDXA 3SKUD 3H3PL 4LOEA 3LOWA 4OZGB 4X6CF 3ZK0A 5IR1A 3BN3B 1PLBA 4WI7A 1E43A 1FN4B 4FG2A 1MNUH 3S7GA 3BKCH 3NDYE 4NQCD 5EO0B 4HWUA 1NGZA 3UBXI 1NAMH 3H3BC 3VWKB 1WBYB 1ET5A 1BAFH 3CLFH 1E3ZA 5C0CD 3FTGA 5IW6A 5A16B 4FP8L 5I0XA 4PRIB 1JWUB 1U92B 3SJVB 4AEHH 3LH8A 9PCYA 2I25N 1U3ZA 1OCRB 3IJ8A 2CR3A 4M7LL 4U31A 2JVUA 4GLRI 3S8FB 2ZOUA 4XCFH 4Z0BL 1YUHB 1QSED 2VSDA 3CDGA 3BN9D 5C7XH 2DM4A 3HS0C 1QSFA 2HJKA 3ULSA 3WSQL 4E5XA 5BPPA 5C1MB 4WKZB 5EF3A 1WSST 2CUAA 4WO4A 3PNWA 1N18A 4PTTA 3RGHA 1CDUA 2B1OA 4G6JL 4AIOA 1NMBL 1XH3A 2BVOA 3MXVL 3QXTA 2FD6H 2IPKB 2L4OA 3F7VA 1FVEA 2C3VA 2P24A 3FQUA 2R56L 4YDNA 5DVKA 1BAWA 3ME0B 1RZGA 1U2YA 1DBKH 3TYGH 3O4LA 2GIMA 3PHOB 1OE2A 1F3DJ 4JPKL 3RWFA 1DBJH 4FQXB 4NFBA 4KVNH 1QYGL 2L3BA 3VXSE 5C0IA 1A6PA 1CFBA 2K1MA 1THAA 2DJSA 4J4PC 3M7FB 3UJIL 3GSXB 1KT2A 1E4JA 3ZDZF 1T66C 3CV5A 2W88A 3IFNL 3BSZL 4HC1L 4L5FL 4DO4A 5G55A 2A77H 1S7TB 4ODVH 3CIQA 2X4OA 1NH6A 1TG8A 5AVWB 3LQAC 2GITB 2IBGA 3OG4B 2G2RA 3L3JA 3VRLF 3GLZA 4NQVA 4YHLH 4MHHI 1LD9A 5IMLA 2GK0A 3KLQA 3SQOL 4NS0A 3PP4H 4TUJB 1QFHA 1T2QH 4RSVA 4HZLB 4YSOA 4GUCA 5AOLA 4PBXA 4NQEB 1W0WA 4MYPA 1KF9B 4RIRB 1Q0YL 5LBSA 3C6SA 4RCAA 2ZOTA 4M1DL 3ROOB 2BVTA 2HRGA 3TV3H 4HCGA 4NP9A 1E2WA 2TRYA 3BGFB 3K81A 3VXQA 4AQZA 1GHFL 4P07A 1JN6A 4XBEL 1X5HA 1HZKA 1S9WA 3LDBC 3O2VH 3H2QA 4X9FA 2BSRB 1J1PL 2XN2A 3AG2B 3TJPA 5C09E 4F7PA 1OEZW 4KK5D 5DQJA 1PGRB 2NT0A 1AO7B 1OK0A 1BXAA 4LB8A 4NN6B 2V2WA 3MRKA 4L9LA 3U7AA 2ALWA 3GZKA 5E8PA 3B9KA 3R1GL 4CVXA 2WQ8A 5EZIL 4F7CA 3MPCA 3C2AH 3QWOB 1NCHA 3LPGA 4TTGA 3BP6A 4JPVH 1DJYA 3GSQA 4Y4KA 1J5IA 3MV9B 3OMAB 3VFUB 1XVSA 2V3FA 5C97A 4OQTH 4HJGB 5T5FL 5AW6B 3CXHJ 4KUCD 3MRJB 4KITB 4G5AA 3SGJC 2UXTA 2WW8A 3UMNA 4E9VA 1R46A 3GIZL 2PYED 3BAKA 3FB6B 1SXAA 2O5NA 1UXWB 3ULVL 4FA6A 3HG1A 1QBML 2HFEA 4N6QA 2VQTA 3E9UA 4U1IB 3ULVH 1ECYA 3K4DA 1TTBA 1TTRA 3S88H 3IPEA 4WFFE 5GRWA 3BWZA 1E8WA 4AX3A 4AK2A 2HYMA 3HC0B 1YDPA 4RGOL 5DLML 5T5FH 4ZFOL 5EF1A 4RAUA 4POUB 2ZX9A 1A9EA 4RMWA 1SDAB 5IV2A 2FIKA 2DEYX 3LN4B 3IJSB 2H3XC 2K0RA 4OF8A 4TQIA 4G7RB 2YQ3A 1MIEH 5CXPA 5ECGA 3R1GH 3QR0A 4NZRH 3JQOB 4WJKB 2VXVH 1CE6A 4QIRA 5DDHA 4X5XA 1DEDA 5E5MA 2G9HB 2JXMA 2K6WA 5ABDE 4YSPA 3M86A 4B9IA 1HINH 2PP7A 2XBDA 5AEAA 4OF5A 4P49A 3GRWA 3PIQA 3G5VA 1UJ3B 3ARBD 1PJ9A 1ACXA 2YKLH 2V7HB 3BSHA 2OTUA 5DZJA 5IK3B 3RY5A 2WKOF 4GMSH 3ENEA 4M1DH 5GGSY 4UQ9A 2IDQA 2Y7QB 1QSFD 4P3WA 2GHWB 5A2KH 4Q58C 2VDPL 3O45A 5BZDA 1HFUA 3OQ3B 2MOQA 3WKMH 1B0GB 5TFSH 4DP4X 3MUGA 5TK4A 4ALAH 4IU3B 4HMDA 4M7KH 4HOMA 3SB3A 1GTFA 3FUIA 2M26A 2VE6A 1CD8A 1KXQE 4ODVL 2A77L 4K71C 1UENA 4PLNC 3LPPA 4JGJA 3ORJA 2WBJB 3A4EA 5I75B 5HI4D 5AUMA 3BXNA 4L5FH 3SDAD 2Z31D 1OCZB 1OSPL 2FJHB 4CNIA 2PTUA 3OTTA 5F1NA 1E42A 2FB4H 5KANI 1A14H 4ZTPL 5HSFA 1IKOP 3C5ZA 3RVVD 3KDMB 2LVCA 3GXPA 4U3SB 2DBLL 5DQ9B 2YRZA 1QYGH 3LZRA 4JQVA 1QQDB 3NPSC 4JY6A 1RZKC 3BEWB 2NXZB 1T0NA 1HYSC 2J2ZA 4KQ4L 4Y4HD 4H8VA 2E9IA 5ETUA 4N90D 2MWCA 4JRFA 1U92A 5FIEA 3SJVA 4ICXA 5CJQL 4MCYB 1I3RA 3LXCA 1NMBH 3GSVA 3L9YA 4NRZB 2GPZA 1AZCA 1EJOH 2HJLA 3GUTB 1VACB 5I8EB 1UOWA 2JI2A 3WSQH 4HPHA 4C4KT 2ZCHL 1P4UA 2YAPA 4N2NA 4L8CB 3CVHB 3BZFA 3TEXA 2CKNA 3KPRA 1EFQA 4KO6A 4LF3B 1WYJA 2O72A 4M7LH 3LAFA 3G6JE 5T1LA 3GBLA 1LP9A 4OFYD 5A3IC 2FHFA 4BRJA 6FABL 4CILA 1WJ3A 1DSFH 3KNBA 5F9OH 5JHBA 32C2A 3DXAD 2Q8BH 2MQCA 4FJZA 4J1UB 2XVKA 5C09A 4YSAA 4JFZL 3JUYA 2X3AA 4FP8H 5GS1B 1OQXA 4OKVB 4UQEA 5AUMB 4KZDH 2Q7YA 4FG6C 4GP5B 3HE7D 3X13A 5G2NA 4WNQB 5ANMB 4E5XB 3ULUE 5HHOD 2Y9RT 4TLTA 1MNUL 3CH1A 1L9MA 2YD4A 4OJAA 2D8KA 1HNGA 2XI9A 2ATKA 4NP4L 3FUMA 1MWOA 1E0OB 1S7VA 2DM7A 2NRDA 1VFUA 2D73A 4X8JB 1ZHKB 2QPEB 4XXCA 2PPAA 3EFDL 4JZOB 4BEIA 5JOFA 1QP1A 2VR8A 2G60L 3N41F 4M61A 4AQ8A 4N0UE 1GZPB 4JDVA 4PJ9D 1LP9E 3GXMA 3L5XH 3HZMB 5CZKA 1PDKA 5C07D 4EIZC 4FQCH 2RMNA 3G6JF 3L5JA 5DUBB 3AY2A 5EA0L 4OLVL 5KBPA 2Y36H 2V7HA 3GXNA 3MX0A 2X9XA 4UINH 4Z3EA 1TNMA 4UUJA 2XC8A 5TQ0L 2WQUA 2F7OA 4KXCA 1WS7A 3EJCA 3FT1A 4RLDA 4YX2H 4QXUL 1UD2A 2VR7A 4RDQG 4FOMA 2RH0A 3ZHFA 4Z7AA 3UYPB 4JRXA 4XBPB 1KDJA 2PR4L 1Z9SB 5CEXA 2BSSA 4R5VA 5C0RL 3QFDA 1MEXH 2KMWA 4JJ5A 2OSLB 1KJMB 5E4AA 4KKAD 3VCLB 3ABKB 2PP9A 2Z0UA 1HCZA 1U2HA 3DXAE 4U1MA 5DA4A 3K6SB 1TO4A 4B5ZA 1NSNH 1NINA 2CJ3A 3QH3A 5D5MF 3STLB 2F7PA 2VRAA 1CDYA 4Y1AD 1OHQA 3VE0B 1T3FB 3HE6D 2CNZA 3RPKA 5A7EA 1HK6A 4XP5H 3BQUA 1ES0A 4BUQA 1COBA 2E75C 4IU2A 3ARTA 3PUUA 2X2IA 3GRWH 4MNQD 1GSKA 3HMXA 5I73B 4CSSA 4OZHE 3D85D 4KY1H 4M1CC 3G08B 1UM5L 2VW6A 1DEEA 4DK3A 1BVZA 3BOVA 4MJIB 5DS2A 5H2BA 2IXQA 3FW6A 2R23B 1S9VA 4OVVA 3VNZA 2QSVA 3UC0L 3KYOB 1DL7H 1H3GA 4JZNB 3FAXA 3BKMH 3QWOA 5ABZA 4FEIA 1VF5C 5D1QD 1CD1A 1SM3L 1JGUL 3EYFA 1HAUA 4Z6AT 1G7HB 3QDGB 4Y1AB 1WK0A 1F5WA 3VFVB 2DMHA 3LN5A 5AVTB 1X6NA 4XMLL 3MJ9A 3QQ4B 4ETQB 5K9KA 5IEHB 3NBNA 4ZFFA 4HS6A 5DJ6A 3SE9L 3S34L 3MLXH 4UZSA 2CA4A 1A7QL 1JN6B 3QZBA 1KTRL 4K07A 5IJVB 2ENQA 1MFBH 4FYRA 5FA4A 3F65A 4OT1L 5CN2A 2DIJA 4PW9A 1BD2B 5FV2A 1E4XH 1F58H 4E0RB 1YYML 3NFPB 4JO2H 2IOOA 1VLXA 5CWSA 3HPLA 2LVEA 3V0HA 2KS0A 2WXGA 2XTJC 3NFPA 3C8KB 4PU2A 3T5WA 4WSKA 1A7NH 1T1ZA 1TYRA 3TLRA 3QZWA 3KWTA 4L8SC 3EJUA 4UT7L 2BSBA 3N91A 5G5DB 3PXHA 2DQDL 4FFVD 4X4KA 1UOKA 2WXOA 1MQKH 4ELKB 2HT2C 1IIKA 5MENB 3LZNA 4MNQB 5LCVL 1BBDL 1MOEA 1R6VA 1X5JA 4OB5L 1LNUA 2YD3A 4MLIA 1EBAA 3VRJB 2FECL 2YUVA 3O6FA 1K3IA 3PJNA 3EYUH 4XOEA 3NCCB 1TZGH 4ZFFB 4TL4A 4J6RL 3D3VB 5HJ3A 1C12B 2EIZB 1BVLA 3I85A 4HIIB 1BECA 2VRQA 2QQQA 4M7ZB 2YBRA 3O0RL 3ZKMD 3VXRB 4EI5A 3DUUA 4LT7A 2YZ1A 1HI6B 4M5YH 4FG0A 2VQ1A 2AHIA 3BP4A 1X9UA 3S36L 4RMVA 3RWGA 3AS0A 3PAYA 4BCXA 5A3ID 1TJHH 2LR4A 2ZKXA 4KGJA 4JKWA 2IPTH 1OGTB 4UQ3B 5E8DL 1LXMA 1DLHA 3P9MB 4AUYA 4OCRH 3SKJL 4LSSH 3EYSH 3FQXA 4JVPA 3IGLA 3TH3T 2IH3A 3CN1A 2R1YB 2WO3B 5F0MB 1AGFB 1LO0L 1N6VA 2AV7B 3QIBC 2A6DB 3WTYA 2ERJC 1CDIA 2WIIB 2NY6C 1W6WA 1MCOL 2PTVA 5FO8B 4PJFE 3OAUL 3RKDD 1KCRH 2A9NL 2DQTL 3ZTJG 4P5TA 1A7OL 5C0BD 4JE4B 3UFIA 5D1ZB 4WO4C 5JIDA 4CMMB 3AXLA 4JFED 4Z7VF 3HUJB 3ARED 3BUYA 3B2VH 3O9WA 5DC0A 3U4KA 2WJ7A 3ECWA 4NNPL 3QJFB 2WVSA 3QI9C 4HALA 4UT6L 5BZWA 3NSCA 3QS2A 4N8CH 3RPBA 4C59B 5D1ZD 4LCVA 2VISA 1FN4A 3C6EA 4WI2A 3SDYH 2F9BT 3VQ2C 3HE7B 4A66A 3GIVB 2D7PA 2WTRA 2AS5M 2N01B 3ALXA 5FHBH 5F1OB 1I1FB 5LQBH 1NFIA 4I3GA 2CLRA 4UAHA 1GC1L 5TDPB 1FORL 1RK0B 1XDTT 1T5XB 3HE6A 5IWLC 3JWOL 1JXJA 3NCYP 1DFBL 3WEAA 5E94A 1V7ML 5FYKE 3TA4D 1NGPL 5HD8C 2VDQL 2Y69B 3EDEA 3AG3B 2CGRL 2PW1B 1NDMA 4IKIA 4PJ5E 2AQNA 4P2RA 1O6SB 3UGXA 2NY1D 4LE8A 3KBHE 5KSBE 4MAUH 3MXWL 1A1MA 2VDOB 4AUUA 5D6DA 1UD5A 4WWKD 5DD0H 4AH2B 4PBDA 1CS6A 3ESMA 3Q7JA 1MRDL 3QEUA 5GS1A 4Z3IA 4PP1D 3MRDA 1FNSH 3VWJD 1PY9A 3EJYC 3BDYH 4V2BA 5DK2B 3X13B 4X99A 1GGBH 2AP2A 3OR6A 4Z7WA 1V7NH 5JIHA 2FO4B 32C2B 2CLRB 1D7DA 3IS0X 3SGJA 5HY9B 2SEBA 3BPOC 3VMPA 4DEUA 4Z78A 2IV8A 4JQXC 1A6UL 3MA7A 1Q4NX 2BOLA 4LPUA 1U8KA 1WFUA 3FT2B 1GH7A 2XPGB 1U3HC 4JDZA 2HVKA 3TONA 2EVGA 3UZEC 1JUFB 3DHMA 2Z65C 2CBMA 4PJBB 3RDTB 5DZVA 3V55A 4CW1B 5K9JL 1MJ8H 5HJBA 5BCAA 3GSOA 3NDZE 5E08L 5FKAA 3TT3H 1JV5A 2L7EA 5B4MD 3QJTB 2FT6A 1SHXA 3DSFH 2JK5A 3IE9A 3TBYB 4F7MB 4U6HB 4X0KA 4HULB 1CFSA 1EZLA 1F3DH 3GDCA 2VAJA 3P30L 2VMEA 4P5TB 3RURA 5I1IH 5EOQH 2E9JA 1U4FA 1PAZA 4QGYA 3ZTJH 1R24B 1WUNT 2FGWL 3P11L 4G7QB 4X6EB 4APQC 2UZXB 2WIIA 4PJ7F 3QAZB 3HMWH 3B9EA 4DJMA 1E5ZA 1AGFA 3OR7B 5D4HA 3I02A 4NHCH 4LLYA 1QR1A 4LVNC 3F85A 1XD1A 4W9JC 1CXHA 4RFNC 3S5LA 5CBEB 5I15H 2LLNA 1BJMA 3MRFA 3BXNB 1OGTA 1FO0H 3DOSA 4UQ3A 2DWTA 4OQTA 1YMHA 1FDLL 4PB9H 2V0AA 4RISH 1PEZA 1T7ZA 1RULH 1JXKA 4P46A 4YDJB 2DI8A 5BZDB 5IHLB 3JBG7 4FD0A 1G7IB 4ABVA 5E23A 3TURA 4G8GD 1B0GA 3C08H 2G4EA 1MLCA 1QBBA 1G7QB 3QZMA 1L7TL 3O45B 4H2CA 2V33A 3DMMA 3F6JA 3KPMA 4ZDHB 3PWUA 4DCQB 2ITCB 1X4XA 4HK0B 2OBGA 4Y5VC 5KVDE 2R29A 4PS4H 1JTOA 2CDEB 3F7KA 1QASA 1MFEL 3KPSD 1ZK9A 1WIUA 2GTZA 2J8UE 4I0PC 3V10A 3P4LA 3VFPA 1X44A 4XR8C 5DR5L 4XBMA 4NRYB 3T8VA 4JFEA 1EHLH 3V79C 4LVHB 4R3SA 3BH9A 5DHDA 5FYLL 3O4OB 4GRWF 1I85C 1CU4H 2G5RA 3KLAB 5GSVB 5TF1L 3P4NA 3T3PB 2IBZX 1QRKA 5F3FA 3PWPB 1WO2A 3X12A 3LN4A 1DUYB 3P4NB 3PAVA 1E5CA 1OSZA 4G1EA 3HR5A 4OAWB 3OKEA 4X80H 1NCGA 3AT0A 2RGSA 4G8AC 2WVTA 4HS6B 3PQYE 5DJ6B 5AVRB 4ATWA 5AW2B 5GS0L 3PDDA 1H8NA 4Z7IA 5AOMA 3QNZB 4MA8H 4NO2B 4EI5C 5FDWA 5T1KD 1INEL 5DSCB 4FFYH 4P23C 4P2AA 3W0WB 3OJVC 4A2HA 3RVTD 2CBPA 2XACC 5J3HC 4OIAA 5FUZL 5EV7A 5IZ7A 3ZHLA 2YGOA 4ENZA 2PWFA 3FSZA 5JQIB 3VFGL 1VENA 5TF1H 5DUJA 1OAUL 2BLFA 4IYKA 2YC1A 5E7FA 4JFYB 3BGMA 3QHTC 4L3EA 4IEFB 4AWJC 3KPMB 4ZDHA 4CDGC 3F7YB 5HI4C 5FDYA 1YC8A 3DTDA 3QPQC 2DJ4A 5ICZA 1BIHA 1RUAH 1RUKH 1JXGA 4UMGA 5EO9B 2B15A 4UAOC 1I7UA 3VGEA 4KI1A 1GSMA 2VMCA 1OE1A 2C4FT 2HKAA