1I8AA

Family 9 carbohydrate-binding module from thermotoga maritima xylanase 10a with glucose
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
189
Chain Sequence
b'MVATAKYGTPVIDGEIDEIWNTTEEIETKAVAMGSLDKNATAKVRVLWDENYLYVLAIVKDPVLNKDNSNPWEQDSVEIFIDENNHKTGYYEDDDAQFRVNYMNEQTFGTGGSPARFKTAVKLIEGGYIVEAAIKWKTIKPTPNTVIGFNIQVNDANEKGQRVGIISWSDPTNNSWRDPSKFGNLRLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE A
molecule tags Hydrolase
source organism Thermotoga maritima
publication title Crystal structures of the family 9 carbohydrate-binding module from Thermotoga maritima xylanase 10A in native and ligand-bound forms.
pubmed doi rcsb
total genus 56
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06452 CBM9_1 Carbohydrate family 9 binding domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1190 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1i8aA00
1I8AA 1I82A 2IVFC 4JPQA 1UG9A 1I8UA 1ULVA
chains in the Genus database with same CATH superfamily
2WXJA 2CBPA 2QTEA 4G8FA 1M1XB 1O9VA 2XKSA 4FFZH 4AEHH 4O51A 1QSEB 5KANI 4J6RH 1TEGA 4G9FA 4PWKA 2NXYC 4U3XA 5IGXL 2GTWA 2N3JA 3FTGA 4Y2DA 3ARRA 5BCAA 3R06B 1D5ZA 3DPBB 1E50A 1OAUH 4HIEB 1AJ7H 5F3HB 3WHXA 1BQKA 3HE7C 4IRSB 5D5MA 3L6FA 2AQSA 1FDLH 2GT9B 4ZPTB 5FW6A 4ALAL 5BS0A 3HC0A 3NSJA 2YSSB 1RD6A 3NTCL 5F93C 1HE8A 1X5MA 3PXHA 4WY7H 1YG9A 2ZUYA 2WLLA 4LPYA 4ZMXA 1GVIA 2BVQB 1U2YA 5BZZA 4N3TA 5T5FL 1DJYA 4OV5A 3D9AH 1YA5A 1GMEA 1PGRB 3DRTB 4P5TC 5F1OB 2NY7L 3GSXA 2AXFB 3L4XA 3LPPA 4JM2F 1I8MB 3RZCC 3BVXA 3PWVB 1MHPH 3GSXB 5HJDA 5B21A 2PTVA 2WAQA 3TWCL 1QFWI 1RZQA 5A2CA 5C0JA 2Q6WA 4PLJC 3ARED 2BNRB 1CLOL 3DMMA 2PR4L 4P05A 4OV5B 1A0QH 2J21A 3E9UA 4ILDA 3KLAA 3BEVA 1D6VH 3MV7A 3U46A 4A2HA 3PAYA 4XVJL 4Q6YA 3K2UL 4KK9C 4NKDA 4Y4FA 5EZLA 3SOTA 3VMPA 5DJXB 5D7HA 1NAMB 4JRWA 5E70A 4OJEH 3SE4A 5L8JB 2IAMA 1KIPB 1AI1L 2NYZA 4OCNC 1HEJC 1MRFL 3M1BA 3WHXB 2BCKA 5IREA 2BERA 3E7JA 1AOZA 4H1LG 3HNTL 2AITA 2BNUB 1KLUA 2Y6SC 2EUXA 3W56A 4ODBD 3NIFF 5T3XH 1GS8A 3DX0A 5DFTA 3DX1A 4BE5A 1G6RH 4J3OC 2DZEA 4PLJD 4ALAC 1KPRA 1MFUA 1BM7A 1FFOB 4NWTL 5ICYA 2GFBA 4R26H 1HSAA 2FSDA 5FM4A 3QH3B 3EH5B 1UYWL 4KK9D 2AC0A 2GJJA 5DC4B 1MXGA 1THAA 4DF9A 1PQZB 3T3PE 5AVZB 3VGEA 2NYKA 3H9SE 2VMJA 3B56A 3I6LE 5TDOB 1OP9A 5GS3A 5EC2B 2B2XL 4PTUA 4DT2A 3JV0A 1RZ8A 4UM9D 5DZLA 4N0RA 5JOEA 1MCFA 4M03A 4NDMA 2VR9A 2LLNA 5HI4C 2GFBB 4HJSA 4IU3B 5I66B 4NXKA 4U0QB 5BNXD 4KHXL 1EFXD 1IGMH 5GRJL 1HHGA 1W8EA 3MXWL 4KTYA 4ZZKA 5AAWA 1UOVA 2WBJA 1I8MA 3QYCA 1O5PA 5JXEA 4TPRH 4BZ1H 3MODL 1XMWA 2W59A 1RI8A 2P52A 4L8DB 1TENA 5L9DH 3H3BC 5I28A 1Q9KB 4YDNA 5T1KA 3TLRA 3AWGA 4K71C 4MMYB 2O6PA 4KJPD 1P7HL 4WZ9A 1AD0A 1H8SA 3FMGH 3NCJH 2EO9A 4Y4FB 3DRQA 1ERNA 4NGHH 1T04A 5D7JB 4J12A 3FDWA 1ADQH 4IRSA 2QADB 4XXCA 5D5MB 2D7QA 4BK5A 1WRFA 3JUZA 4A7VA 1YUHA 3QNZB 4Z77A 5AYUH 3U1SH 3P69A 3C60B 4MD4A 1N6UA 4NQDA 4ZUUA 2V2TB 4KX9A 2QPEB 2ERJC 5J06A 1OQOA 3PL6D 2QR0A 3FFCB 1NCCL 4OD3L 5J12B 2O6FA 4P3DA 2VZ3A 3X3FH 2YN3A 4KJPC 5IEHA 1BLNB 1JK9B 2HVKB 3LKPB 3X1BA 4O5LH 5TK2A 5K9QI 2HMIC 4H88L 3NABH 1T2QH 2HVJA 5C6TH 5SX5K 4CBPA 4Y19D 1IC7H 2A6JB 4JFPA 3CU1A 4XAWL 2HLAB 2J6EA 1JF1B 4F2ME 4JMNA 3ZTEA 1U8KA 2DTML 3TV8A 4RFEB 4CVUA 2ZTBA 4HD9A 3K1KC 4W9KC 3QARA 3SPGA 3PNRB 5ICUA 5LJYH 5A2KH 3BKCL 3I6KA 3AM8A 1A6UH 3WKPA 7FABH 5FO8B 2JKWA 1PW3A 1OM9A 1TPXB 1DQQA 2J1XA 5IBLC 2NY1C 4MB4A 3KL3A 3RNQA 3ZE1B 4B9JA 3RHWF 2FT6A 3HNVH 1RUMH 4ZO8A 3SSGA 2HTLC 4BFKA 4FA7B 3MOAH 4OZIF 1A6AA 3N50A 4OAWB 5I1KL 4QDGA 2X12A 3GC3A 2P5WA 1NCBL 1TFPA 3G6DL 5C0CB 5K9OB 4WUUB 2X89D 3HOGA 1HH9B 2VKWA 3MJ8B 5JOPD 3EJZD 3RPIA 3BWAA 5GXBB 3KZ8A 1BVNP 5ITFB 2Y06H 5HHPB 5B7EA 1RKRA 1URZA 2FWLB 1CXKA 2WGNB 1D6EA 3VXQA 3SPVB 2CG9X 3B9KC 3T1FA 2FYYB 1OTTC 3CHSA 1EAJA 4HEPA 3TA3A 4L37A 4QRUB 4ZTOH 5E94A 4HPOH 3VQ2C 3PV6A 5BJTB 1AZCA 5EPMB 5I30L 5ISZD 4G7YL 2CM5A 5DRWB 2ZXGA 3RHWK 1V55B 5LDUA 4OGAC 4X99A 5JOFA 4CJ0A 2NTSP 1KZYA 1BG1A 1N7ML 2AJXH 1KJVA 2DM2A 3CVIH 4DPCX 3QJFA 2OMNA 3MX0A 2X4OA 4F8NA 2HH0H 2WTPA 2W91A 3ZTJH 4N85A 4O02A 2BVUA 3QFJB 5D6CA 3TIEA 1S9VA 5GGTA 2QMKA 1U8CA 1OCCB 1QI3A 5CLZA 3TN0A 5D4JA 4P2RA 1U3YA 4LLYB 4U1NA 1NC2B 4AQ1C 3V10A 1ED3B 3LXBA 1BQHB 3D4YA 4NAQA 3VXTB 2X1QA 2P80A 2X88A 1NL0H 4I0CC 2HPOA 1IM9D 4FLSA 3SKNA 3D08A 4CSZA 5K59F 5FA4A 4RMWA 1W80A 3MYJB 2NX5A 3WTYA 2IH3B 3V79C 4AX3A 5FV1L 4ZFGL 4Q89A 5E1QA 3MJ9A 4XP1H 4Z76A 3O2DA 1U3ZA 5DHDA 1CDBA 1BVKA 2J88L 3C8KA 3MLVH 4QHKJ 4CN4A 4FFVD 4GY4A 5DR5H 5CJ8A 3BD3A 2F8OA 2VAAA 3UJTL 5D7IB 4WIQA 1BAFH 1KTDA 3NFNA 5D1QB 3RVXD 1B0WA 4WWKB 1QD0A 3FT2A 4G3YL 4Q97A 4S0SD 2YAEA 4HPOL 5KYUA 5KTEL 4U6VL 3FO2B 3A6BL 3W0WB 2FTAA 1IE4A 2R23B 4G43A 4HKJB 1QHOA 3MQIA 3SKJL 3EO0B 3QIUB 3MGTA 4NUMA 5BVPH 2IEPA 4XN5A 1FYTA 3VFSB 1KJ2H 2I07B 5C97A 4UOW0 1GCFA 2AJSH 4NNPH 2IANE 3BDXA 2ZOTA 3AAZB 3N9GH 3UAJA 4JRYD 5F70A 1XGTA 2J56A 1N6QL 4WHDA 5DTFB 4U6HA 1FHNA 2AAAA 4AL8L 2ID5A 2VABA 3G5YA 4CNIA 2DJUA 4G9FD 3HHRB 4AVIA 3IDNB 5AVRB 5BV7L 3FRUA 4N2DA 2P5EA 2E7HA 5E6RB 3JVFC 4N8CL 4BKTC 1FH2A 4CMHB 2WUBL 1JYXA 4KO9A 1RUPL 4QHLA 5DHVH 3WGVB 4F57H 1IBGH 1Z3GL 2I9TB 3WTXA 2PPCA 4UOJA 2F5AH 4TOYH 3O4LE 3A22A 2AV1B 4DO6A 5EC1A 2RQ8A 4QT5A 5GGUB 3KDMB 1RZKC 3LIUA 4I77H 4Z18A 5GIRA 3QUXC 2BNQA 5B1JC 5T1MA 4LHUD 4XX1E 3ZDYB 1CR9H 4HGWA 1AZVA 3CK0L 3DARA 2NW3A 3EJSA 1QWHA 4Y5VC 5DZAA 1KB5B 4UM9B 2B3RA 1QI4A 2WMPA 3FOLA 1RV6X 4YSPA 3E8UH 4BUHA 1LNUB 1WCQA 5JHDB 3BI9X 3CN2A 3F6IA 2WYTA 4Y8DC 1KFAH 4NQVA 2WW8A 4B0MB 5BQDA 1WBZB 4FQXD 1D5XB 4P5KA 1S3KH 3OPZL 2GJ6A 3B8YA 3SDDA 4LARH 3NIFB 4GRWF 3FQUA 4HUNB 3L45A 1MHCB 5DHMC 4WFEE 1C16B 3KWVA 4M7ZB 2ZX8A 3MKKA 2XI9A 4J4PA 4AGQA 3VXOA 1NGPH 5LXGH 4X99B 1V8HA 1T4WA 1FFTB 3MLRL 5CLXA 2Z8WC 3HHSA 4FTVD 2ZG3A 3KDPB 1CDGA 2DQTL 4TMPA 5EOCL 2ZG2A 1P4LB 1XB6A 2AQQA 1BD2B 1DDHB 1FC1A 3B1TA 3CZLA 4OCSL 2W38A 3VGAC 1IE5A 4XMUA 2FO8A 4XGZA 1KB9K 3ECBB 2CKBH 4NO3A 4N2AA 1QZ1A 2Y9RT 4U05A 1QHQA 3DBXB 5F1KC 1YEJL 4QEGA 1M71A 5JO5B 2VLRB 3U4AA 3KLHC 4X4YB 1IFHL 4L9LC 2VN4A 1J05A 3LEVL 1NC4D 4NJAH 4BQ6A 4JFZH 2VABB 5F7MC 2E5EA 2P8PA 2V3DA 2WCGA 5DD0L 1PJWA 1DBAH 4EOWL 5LNDA 1UQSB 1K4DB 4TOYL 3RWJB 3ZZQA 2LTQB 1PBYA 3HEIB 5T33H 3QCUL 4AYFA 1A25A 3QUMA 2CA3A 1PY0A 4MHHI 4HUUB 2H45A 2CO1A 3Q13A 3MV9A 4FMFA 3DLQR 3VE0B 2P24B 1E5UI 1AO7D 1HQRB 2WXGA 3ET9F 4HOWA 2NNRA 1BZDA 2V2XA 1I3GL 4E2OA 1KTDB 2ZAIA 3NFNB 3BP7B 4JO8A 9CGTA 4JFSA 3KLKA 2AJSL 2BSSA 3O4OC 5KVMC 1KJ2L 1NCGA 1J8SA 2P45B 2MNJB 2QVKA 2XC8A 2XOTA 2ZCHH 4PU2A 3I75A 1TZHA 5C0AD 4F9PA 3GSNH 3OLIA 4QNPE 5CIPH 4QY8B 4NQEB 4TUKL 1AS6A 2E7DA 3HS9A 4N8VB 3TO4B 1KLGB 2RALA 3P73B 2CK0H 3U0PA 1INQB 4Q9RL 2WWMC 3IGUA 5KBKA 3GMRA 4EBQL 1JN6B 1FLRL 1D5BB 2BHZA 1JN6A 1I9IH 3NH7L 4G6FD 1MFVA 4N3UA 3O4LD 4HOZA 1HAUA 2YPLA 4JFYB 3P73A 4Z7NF 3LKNA 2Y6SD 3C5JB 1CF8L 1NUNB 4JRLA 3QJTB 2IQAB 4BH7A 4X6DF 4ZS6D 5GRUH 1XGYH 1PZCA 2C1PB 5EO1B 5EBGA 2ALAA 3KHOA 3F7VB 3ZZ1A 2IDSA 3EW3B 4X7TB 4JFFB 3RA7L 4NQCA 3WTUA 2A1WL 4AXWA 1HQRA 1EDHA 5AVSB 4I0PA 4JG0H 3WN5B 3BQUA 3UPRA 3MJGX 2MTAA 3MV9B 1NZRA 1JXDA 4BFFA 2BP8A 1ETZA 4H1LA 2J5LC 3L2MA 2DL9A 4XHJD 3W57A 4O02H 2R1XB 2ZP0T 2MQ3A 3WFEL 1CGSL 5TK4A 1E5AA 4XCYB 4JKMA 4RIRA 3OJDA 5HHMB 1NDGB 3VI3B 3H4FA 4S1QL 4OIBA 3QQ4A 1RZJC 4ZUVA 2ATPA 1H3GA 2AK4E 2PYFB 3BQUC 3ZUCA 4YHYC 1Z9PA 4FXGC 4Y19E 2VNCA 5A3IC 4Z8FL 1EMTH 4L5FH 5JLZA 1OLLA 2WTRB 3R4DA 5EC2A 2KERA 5BRZB 1G6RB 4N0UB 3MNMA 2GK0A 1TU2A 2QL1A 3RL1A 3KYMB 4I5BA 3WSQL 3L13A 2DD8L 5F7AA 1F00I 5DQDL 4C47A 3HI1A 5H94A 4HMDA 1DLFH 2K4WA 5IW1A 3T4YA 4PUBL 3LH9A 4KGJA 2WLHA 3ZT7A 2I25N 4L4VE 3SE8L 4WJG3 5I2IB 3Q3GB 5IB3B 2NUPA 2BCMA 3DX8B 5EO1A 3UH8A 2C3GA 3LRSB 3VAEA 4P46C 2FK9A 4LASL 5GS1B 4GG8B 2NQDA 3CFNA 1GKOA 1KGYE 3EH2A 4J23A 3QDGB 4KI5D 1VENA 3VI4B 4PJDF 1UOLA 3N1GC 3QB7C 1KYAA 1AD9B 1VF5C 5JOPE 2BXZA 3AREB 3IYLW 1JFQH 5LKNA 4IBLT 3ZBMA 4QRPE 2XZAH 3SPIA 1FV1A 5C3LD 4EDWH 1AANA 1RIUH 4JAMB 3IFLH 1HFUA 1HHIB 5EU6A 3EKCA 3OAUH 2H2PC 1GYVA 5F2FA 3FO1B 2CM6A 4LBAA 3IDMB 2HCZX 3DETD 1ZIBA 5CWSA 1ZDQA 4GRLB 1NPUA 3II2A 5DRNA 1ASQA 4NLHA 3RWCB 4E9SA 3ZR5A 5D7EA 3KHQA 4YDLB 1QRNB 3NCCB 3KPSA 4EUPA 3EYVB 5C6TL 3DURA 4LXFA 1P7QA 4DUXA 4N5ED 3U9WA 1SVZA 4MNHA 2BIOA 2KLRA 4HGKC 1SBSH 2VDQH 3PYCA 4MNQA 3PJSB 2N4IA 1SEQH 1NLDH 4HG4J 1CFQB 1HIML 3D85A 1XIWD 4RMSA 4UV7L 3H0TA 2F08A 4KQ3H 4WU7A 3UG5A 1HHJB 3VW3H 3VXSA 3P77A 4Z0XB 3IVKA 2XACC 3JTSA 1CTOA 1KJMB 1MJ7H 2WANA 3OXSA 4QTFA 2YAFA 5IROC 4Z7OE 1CQYA 5IOPA 5GISL 1IGFL 3WFHB 1J9RA 1SXNA 2H32A 2FZ3A 2CPUA 4BKLA 4EO5A 1LP9F 3V0AC 2MOVA 4JFFE 3TT1L 5C09E 3IFPB 5DYOA 2FEEL 2LU5A 3D52A 5EMYA 1TQTA 1BYOA 2Y7QB 1NIEA 2OAAA 4WV1C 4JZNA 1A14H 5BMFH 3QWQB 2FD6L 5F7HA 1F11A 4Z7QE 1QEXA 3DUUA 4G8GE 3ARDD 2JVUA 4UB0H 1WBYB 4WWID 1AKJD 5DO8A 2XLLA 2N1KA 2FJUB 4P49A 1OAYL 2B1AL 3WHE0 1NMCB 3NRPA 3GMMA 2FB4H 3VD3A 3RURA 1MVYA 1JI1A 1W0WA 2K8MA 3OV6A 4XH2A 2BVTA 4N6RA 4R5VA 2H7WA 1Z9NA 2Q9OA 1MI5D 3V0VB 1DBBL 1FNAA 5KVDL 1TTGA 1JPSH 4JBSA 3OHXA 4KUCF 4ZO7A 3DC0A 3H6JA 1E3XA 2J73A 5G55A 4ZMQA 1ID5I 1AIFB 3ARDB 2Q7YA 3G6JF 3FONA 3PWUB 2BC4B 5DEFB 2IJ0C 4KNSA 2IF7A 1AG0A 4LKCA 2HWZH 3MNVB 2BSRA 4K3HA 3QUKA 2PO6D 5E8NB 3F12A 3A67H 3ILQD 3RDTC 2LABA 3ENEA 2GTZB 4A2MA 4M3HA 1ZK9A 1U8CB 5DGRA 2AEQL 2H32B 2P42B 4NO0D 4WGWB 3ORJA 4N87A 2ZSWA 2LLGA 4GIOA 1M57B 4MA1C 5MEOA 4I3RH 5I76B 1A9BB 1JNLH 4HDIB 4OFQA 3WIIL 5CAYB 1FVEB 5KEZA 5L2JB 1BG9A 4WUUA 3UO1L 4BSJA 1TFHA 2VLRE 3HRZB 1P1ZA 1ACXA 1NUFA 4LT7A 1F6AA 3UXFA 5AL0A 1DJZA 2Y7OA 1FA4A 2ATKB 1XEUA 1PSKL 3TF4A 3DYOA 4NP4H 1WT5A 1JHTB 4Y16C 1MNNA 2R0WL 3OKNB 4KTDH 3Q05A 2NSXA 2OL3L 1ZSDA 3QORC 2UVFA 4JPIB 1OCRB 4Z7VE 1KCBA 4NUPA 4HHGA 5DMIL 2RHEA 4AH2B 5DMIH 5CFHA 1AS8A 1RFDH 3EF7A 3K2KA 4JPVL 3QAQA 4X6EB 1WWCA 4J3OH 4ALAH 3CCHA 3HUJA 4QXGL 3PGFL 3GK8L 4XO3A 2F53E 2HRHA 2AV7A 1ZLWH 5FV2A 2H8PB 2QJDA 2X1WL 3BP5B 4M61A 1WCBB 3EGSA 3GPSA 4JEGB 1G7JA 4PVMA 4TUOB 5GZOD 4HXAH 1QEWA 5EIQA 2FNWA 2G75A 4FQ2H 1D2OA 2F58H 1CD1B 1L7TL 1X5XA 1AR1D 3CQFA 3ZDYF 2ZD0A 2R2BA 1JZ7A 5E5MB 1T20A 3V0WL 3VXMD 4ZQTA 2XY1A 3D4ZA 4IBUA 3I2CL 2YARA 3QDAA 3SYPA 4B96A 3LSOA 1A21A 3I50L 5HYQB 2HN7A 3WTSA 1NINA 3U7WH 1PYWA 4XB8A 1WAEA 3Q8BA 4Y4KC 2PCFA 2RA1A 3FZUD 4LE8A 4EMZA 4RFEA 3ULVF 2AEQH 2PPAA 1YEKH 3IXTA 4X9FA 2PWHA 3BSZH 4XX1G 5F9OH 3T6VA 1K5NA 4GAYA 4CDGC 4N2BA 5IMOA 3DO4A 5F0MB 4AE0A 3KGUA 3HR6A 3BRGC 1QX1A 1T83C 4FQJH 4JZOB 1OM3L 1XGZA 43C9B 3RI5K 4LGRB 3S37H 5HGBA 3LB6D 3LRKA 3CDGB 4OZFA 5D96B 3FN0H 3GI9L 3ZTNL 3PY9A 4HDIA 3IXTB 3D18B 3VA6A 3M17B 1AGFA 1GC1C 2R1YB 4TXVB 5EU5A 1BLNA 1JK9A 5MI0B 2V4LA 4M43L 4PRIA 5F6IB 1U2CA 2EDXA 2DH3A 1HL4A 3VWJC 2FYVA 3TVMA 4DN3H 1OAQL 3KLSA 3ARBA 3CFEA 5EBLA 3TVMD 2ZOLA 5FHBH 4K3EH 4XBPA 35C8L 4ZFOB 3FH7A 3VTMA 2CU9A 4PD4J 5CILL 1M9WA 1B4JH 1UWXK 3X1NA 2ICEA 3K74B 2E9JA 2Q76B 4JHWL 1ZY9A 1G7JB 2DWEB 5LBGA 1XB3A 3ESPA 3NZ8B 2FDBP 4IHOA 1AMXA 3EGDA 1AHMA 3FO9A 2ED6A 3MUUA 1U8LB 5JMRA 1A4KA 1URIA 2DWYA 4H25B 2CO2A 1Z9SA 2Z31B 1DBML 3KCWA 1GKEA 4YZFF 1J1OH 4IIQA 4MXWH 1GTFA 3F04A 3H3PL 3RFZB 2B9BA 4JREC 4CMMA 4G80A 1E8WA 3RJQB 1K2DB 5IW6A 4HKZA 4ELME 2FEEI 4LLDB 4M00A 4NSKA 5AFAA 2CR6A 1UH3A 3NZSA 2AGJH 3VW3L 1TVHB 4M4PA 1QOKA 2F19L 1EZVX 4NIKB 4LLVA 2X38A 5HYSB 3LZLA 2K7PA 5CCHE 1XGQA 4LNRB 2BS8A 3FCGA 4XP5H 3MMEB 3RIAK 3DXAA 4XNZC 1KIRB 3P4MB 3ASNB 5J4MA 1OW0A 1ZHKA 1U8NA 3MRPB 3LJ3A 1RHHA 4UOQA 1TQWA 3CN3A 4N2FA 4XXCC 2GG1A 2W1NA 3VH8B 3NSDA 2A83A 2YKLH 2QR0B 3FFCA 4MASA 4IMLB 4Z3FA 2Z7YA 3EF4A 2H41A 2R7EB 5HDBB 2HSIA 4QRRB 1WGOA 5FIEA 4E36A 3T0XA 1AHWB 5GGRA 3V0WH 3HE6B 4HH9A 4LESA 2ICCA 5AKTA 2AJYH 2WZAA 4WV1B 2UX6A 3DSFH 3TP4A 3WIHA 3RQ3A 3IF1A 5FOBA 4ANXA 5CGBA 1NICA 1T1XA 3ASWA 2ZOOA 2WKLA 1FHGA 2QEJA 4L3ED 4KPHL 4ZW5A 3L95B 1WA2X 3KBEA 5D71H 5GS2H 3W2DL 1BEYH 1QTSA 5I17A 4YIQB 3BEVB 2ZF8A 1LK3L 1DVXA 2R29L 4JS7A 5DJDB 3GHEH 1LHZA 5KUMA 1JF5A 1IAKB 1VACA 1KB3A 1QO3A 2NY5C 3BPOC 2EVFA 4OM1L 2G9KA 4N4YB 3E2HB 3QPXH 1FVCA 2O6CA 2BXYA 1XH0A 3PV7A 1P7KB 5C86A 4N26A 4BUQA 3QQDB 4HIJB 5I1CL 5TGBA 2R0KH 2WYIA 5MEPA 2UWEB 3SKNB 4RAHA 1FN4B 5C0ND 1YAIA 3O6FD 3L81A 1WS7A 4NERA 4HJGB 5JUEH 4POZC 4OGZA 4FI7A 2OJZH 5DLML 3RWFB 4OIFA 1FNGB 1R24A 1JRHH 4N2LA 1ZT4A 2H9GA 3QEUA 4CDHA 3H42L 5I0VA 4Z7QB 5I75B 4JDEB 3HG1E 4IQHA 2BSEA 3NQIA 5F9WB 1OT4A 2NY6B 3KR3H 1QSVA 2YD3A 4A68A 4P5TD 1QG3A 4Z3GA 2VZVA 5E95B 1F18A 3MREA 4J4PD 1NLBL 4N9GB 4AYDC 1H8OA 5FGBA 5I6KA 4IMKC 1R24B 1KJVB 4HEPG 3WD5L 1PZSA 3EOAA 3GGWA 3WO3B 3RWFA 4GMTL 3AREC 1P4IL 4MS8D 1ORSB 5CN2A 4ZNEE 3PDDA 3MJ6A 1I7UB 2PXYB 2ENPA 5DRWA 2IPUK 1U3HD 3RL1B 1NGQH 1P6WA 4AK2A 4P2RE 2W94A 4QF1A 3MJWA 5TGBB 4P46B 4UINH 5JHBA 2N0KA 1C12B 5IR1B 4XRCA 1B9ZA 3OMZA 1MRDL 3FBQA 3V4UL 5AW7B 2JCWA 4IS6A 1UUNA 5DQ9A 4JKPH 3CH1A 5AENA 3QDMA 5HVFB 3TPKA 2A83B 4N5EC 1HH9A 3MJ8A 4KQ0A 2HKFH 3LHPH 2NXZC 2H6PB 4X8JA 3F58H 3TEXA 4I9XA 5BZDB 3X3GH 1KGWA 4B6ZA 2VMEA 3VSVA 3G6AA 1AHKA 3WNNA 5F3BA 4EN2A 1QSFE 2E4TA 2VLKE 2RCSH 2IDUA 1XIWA 5D2LE 2CLVB 3LEVH 3VFPA 1QW9A 2VR8A 2B77A 3K71A 1ECZA 3CVHH 2FCBA 3P9WB 5I5IA 1P7QD 1SOQA 4HIIB 3U4EA 1CCZA 5HYEA 1AHWA 2R2HA 2LT9A 4G8FB 2QGEA 4IHBA 5D1QA 2KYIA 1DP0A 1JF1A 5BO1L 4QHNB 4EI5D 2V9TA 3U2SB 3OB0H 3BDYL 4DGYL 1N0LB 5JNYB 4MJHA 1J5IA 1KTLA 4NCC2 5HI5D 1H3VA 5I5MA 3FYIB 1WGVA 2W9DH 3GNML 3FB5B 3G9VA 3TA3D 1K72A 5DSCA 1XD0A 2DI9A 3NJJA 4LARL 2C8NA 4GKSA 4JX0A 4JJOA 1RVFL 2L7JA 4WSJA 1A3RL 3T0EC 3TBSB 4PGEA 3AGWA 5J89A 1G6VK 1N70A 4OQTH 5KVEH 2DQIH 2QZ5A 3CFJB 4GG6A 3PHAA 1CFVL 1LE9A 4LFHG 1OK0A 2CDGA 4LCYB 5TE4H 4V1DE 3K5SA 2DYPB 5FKPA 5KG9B 4RBPK 1V3MA 1IM9A 2UYLA 2UY7A 3SYAA 2FR4A 4GSRA 1WP6A 2MQ0A 2ZAHA 4JL1A 3MKGA 2CPCA 1S5HA 5F1IA 2OJZL 3VFRA 3VD0A 4JB9L 2D3NA 4UAOC 1A6TA 3IMRA 1XH3B 3BT2L 2VCOA 3BLBA 4HOMA 1CJYA 5DJ8A 4K3GA 2QLVB 4G8GD 3FRPA 4QRSA 2MPVA 1A5FL 1CL7I 1PLGL 2I60L 2MNUA 3QUMB 4ADJA 3BAXA 3QG7H 5HJ3A 3WIFA 1ZA6A 1TYRA 5ECGA 4LRIC 2WBWB 4QNPF 3LKRA 5EA0H 4PJDE 1HILA 2GCYB 1L9NA 1AG6A 2Q8AL 2J8HA 4JM2D 1T3FA 3QPXL 1FG2B 3AG1B 3JZ7A 2PWGA 4KK6C 4DKEL 2F1EA 5IEKB 2JKTM 4NM4L 1D7BA 2ITDB 4LL4A 4PW4A 5IESL 3BD5A 4OF0A 4XCNB 4X9GA 3OZ9L 3L4ZA 4NI3A 1UGNA 1ZLDA 3LVEA 4S1RH 4MNGB 3D18A 3WFBL 4QO1A 3S88H 2D3VA 1UM4L 1P84J 3DYMA 1RZFH 2XDHA 1G9MH 3SDCB 4YSRA 2RCSL 1AKJA 1OXYA 3NIDE 4F7MA 1T0PB 1F4WH 1CVRA 4JFDD 4WWPA 2W0FA 3F58L 4L1HA 1MQKL 3P3TA 3Q5OA 4JR9H 4FYRA 4UM8A 1PKQA 4WO4B 3HMXA 3JWNG 5FM5O 1MRCL 1PVHA 4DN4L 4P9ML 2YUXA 1GY1A 4RFNC 3OKOA 2A74C 4UT7H 3ILEA 1Q9OB 4HS8L 3R8QA 3ZMEA 4ACTA 2Z7UA 3BXNB 5K9JL 1U21A 1BECA 3SE3C 2A6KA 1WO2A 2AK4B 4BE6A 1U4EA 4YXKH 3KWTA 3IRZA 1UZ6F 1DCLA 2EDLA 3GLZA 2AVFA 2FIKB 1UXSB 1FVEA 1ZDSA 2HP4A 1DUYA 1SM3H 2WO3B 4R2GB 1MW0A 2G3ZA 4EI6B 2UZPA 1LEKB 2A74A 3AXIA 1P7BA 3O8XD 4M48H 4IBYA 1ASPA 2OR9L 3MFFB 1OK8A 4KXAA 1NDMA 2VDLL 2VDLH 3SE3A 2V6HA 2DDQL 4M1GH 1IFRA 1QR1B 4RX4D 1SXAA 5GGVY 3UPCA 5CBAB 5E00A 2CK0L 4M62H 5DC2A 3MRLB 4G6KL 1I1AD 3HPLA 1TT6A 4FG4A 3MRNA 1C5BL 1QSFD 3T0EB 3O2VH 2P8PB 4L3CA 3CFDA 5C0FB 2R69H 4Y9GA 1QR1A 4WWKD 4HZLA 1LQSR 2WTOA 4OQ1A 4X6DA 5IWLC 2WCPA 1F45A 2XYCA 3OAZH 1VADA 4LEOA 5DVNA 3FS9A 4OBRA 4MJJA 4QAMB 3ZE0B 2JIXA 1S7XA 4XNUH 4WI8A 2D0FA 3D4GA 5FUCE 4FYQA 4AVKA 1JMXA 2ETWA 2ZUSA 4J3BA 5F7BA 1JGUH 3J07A 3GBDA 3NJLA 4K8RD 4JDVB 3X14B 3PABB 5INDB 3RG1C 1HHIA 3DHMA 4KKAC 2IBGA 4KX7A 3U0WL 4F5CA 3MRFA 4OLXH 1NGWB 3PP3H 5MENA 3QFDB 3ZDXF 4ADIA 2CGZA 2WQRA 1F2XK 1CDIA 5FGBC 2VRAA 5TJWK 2X3AA 3U4BL 2QPDB 1ILSA 2XNAA 4A66A 3X14A 1C5DA 1AXTH 1Z2KA 4ZD3H 1MHHA 4JJ5A 1N64H 4AT6A 3MRRB 3X11A 1ZKAA 3IETA 1EANA 4B27A 4WJ5A 1E27B 1KJ3H 4FQIH 4NUGL 5E2TL 1JPEA 3I50H 3WS6A 5ILTH 4H26A 3D34A 3FXIC 5E8OA 3I2CH 4NOFA 1VHPA 3LY6A 1IBFA 4PTTA 2J4WL 1N6VA 1T6WA 1MCPL 2Y06L 2DQTH 2DPKA 2PKDA 5EOCH 2JCCB 3J8F7 4BSVB 3LKQB 3CZGA 1QRNE 4PJ9A 4WFED 3MLYL 1BP3B 4LSTH 1COBA 5KS9A 3K80A 1TCMA 3WBDA 3E38A 4PBWD 4OU3A 1KTRL 1E30A 2P47B 3FQWB 2MQCA 3QCVL 4GRMA 4NKDB 4F7EA 3TFKD 3FQ1A 5TF1L 2GSGB 3DVGA 1ZLVH 1SRDA 3WJLC 2P7TA 5I1LB 3VFNA 2X40A 3NGBB 1B0GA 1E2VA 3AS3A 2BNRA 3MRJB 1HC1A 4BQ8A 5C0JB 5E9AA 2R4SL 3SBWA 4KV5F 4EI6A 2R0WH 1S7WA 4ZX3A 5EULV 2DKUA 2HFFA 2IGTA 5EF0A 4XCYA 1KXQA 1AQHA 4PJCE 3ZTDC 1JV2B 1AE6L 2D7NA 1E90A 1OTSD 5EO0A 4D0DA 3VG0L 2M26A 4DGWC 2WCSA 2BVPB 5TE4L 5D7IE 1CFNB 5IMLB 1E3FA 1MCOH 1NCIA 1FQ9C 2HRLA 4ODXB 4ELMA 3B9KB 2OXGB 1A3RH 4LO9A 1NC2A 2CALA 3O4LA 4I3GA 4RNRA 3OJVC 1IC5H 5I6OA 2BY2A 3IKCA 2OA9A 3ZL2A 4G7VH 4G9FB 1BFOB 5TDNB 3AT0A 2VAAB 5I19H 1MH5B 5FHAH 5BV7H 4MCNA 1O7SA 2FIRT 3KPLB 2WIMA 2YQGA 1N68A 5BS0D 3K72B 4YUEH 2YAOA 5ETUB 1UB5A 2NY4C 5CSGA 5IMMA 3E2HC 4IHOB 4Y19B 1FE8L 4U1JB 2VZUA 3ZTNH 2B0SH 3MV8E 3HS0C 4R2GD 3LTVA 2X4NB 4PJ6A 1MN4A 3RIAF 5KTEH 3MBXL 2P5WD 2P80D 3FMGL 3ZUNC 2E75C 2NT0A 5EU4A 2H1PL 3WE6B 3CFBA 5C6PB 3PL6B 2BIPA 3TIEB 3FSWA 5AW5B 2L7UA 1LEGA 1AO7B 1QUNA 3HE6C 4R7NB 2GJZB 2I27N 4TV3A 1WFNA 3BIBX 5D2NA 2FL5B 3ARZA 3JYBA 3KS0J 3OJDB 4X7CC 4X80H 5EG6C 4BM7A 3KGRA 2PF6A 3OKEB 5IJKC 4PCKA 1A14L 3VTAA 4X42A 1NL0L 3IS0X 1H5BB 3GMQA 2XKNA 3IKKA 4HEME 5J9PB 2A7BA 1BFSA 2E3VA 3CMGA 1ZVHA 4LGSB 1K5NB 4YDIH 3IWVA 4AGNA 3PV6B 2X6MA 3IGFA 2E9GA 3D39E 5J12C 3Q1SL 1FNLA 4X6CB 4Y0GA 4Z7UE 2F7PA 2AS5M 4P4KC 5C0GB 4X0KB 1LGVA 5C0CE 5T5FH 4XP9L 4YXHL 1L6PA 1IC0A 2AXJA 2E7BA 3FCUB 1D6EB 4XNQB 3TESA 2OSXA 2YK1L 1CLVA 4TQEH 4GMTH 1LK2B 1JWMA 1KN2L 5KZCB 1WHPA 5TH2B 3WD5H 1F3RB 3HKFA 4Z6AT 4JFQA 2FO4A 3WNIA 5I8OL 4OCRL 2BP0A 5K9QG 3V4VL 2HG0A 1EEYA 1EEZB 3PL6A 3UP1A 4KQ3L 1E8ZA 2C9QA 2WV3A 4MAYC 4HETA 2ZICA 4CVZA 1D9KD 3BZEA 4EIGB 4OCYL 4ZMVA 1MRFH 1PSKH 4C56A 5I30H 1M05A 4H13C 1AO7E 1Z9LA 5F7NC 1OAKL 4LOEA 1ACYH 5E0FA 2VDKB 3ARPA 1KULA 3EYQD 4XXWA 3CGTA 3A24A 1S9KC 3K2MC 2H2SC 3N06B 4PW3A 4XO8A 4P4RB 1K8DB 3FB7A 3REWB 1CB4A 4LVHC 3SCMB 2PYED 3DNKA 3LX9A 3OLEA 3JQOB 1I8KB 2ICWA 3KBPA 4Q74A 1N3NA 5DUPL 3MV8B 4FLOA 1RIHL 4LPWA 2X70A 3EOYG 1AGCA 2XZAL 3IAQA 3OF6D 4RBPH 3RPBA 1LO5B 1KNOA 2BO0A 1ZLVK 1QA9A 2VN3A 4LKXB 2DYSB 5CLTA 5L2KA 5I0DA 2V7HA 3RWHA 1JWUB 3T0ED 4FP8H 2FNBA 1UWYA 1H8LA 2IBZY 1AR1B 4BA8A 4YVNA 1U8HA 2BNQB 4CADA 1R46A 1UWEL 4QT5B 4P3DB 4LASH 1VFBA 3DV4B 2JJSA 4MZ2A 4HUCA 1EAPB 4AV0A 4QOKD 5E8EA 3MNZB 4U3SA 4PUBH 1MHEA 2H0JA 2YBGA 4WEBL 4MGXA 1XSIA 5EHFA 4J1UB 5CUSL 3IDNA 2OW7A 2ZXDA 1FZMB 4UQ2B 3BH8A 5C09D 2P44B 3ULSB 2YKLL 3CDCA 3EYFA 1XGTB 3V6OA 4IRSD 3TPUB 3RX9A 2YD0A 2X0VA 2R4RL 2CA4A 5CJBA 4YE4H 3F7LA 2ZYHA 2IBZX 5FFLA 3DHPA 4MA8H 4ELMF 1I7UA 1T0OA 4M3KB 3GMPA 2XJKA 5F3HA 1OB1A 5E8DH 2XWCA 3EJRA 3EO0A 4TVUA 4MD5A 2JJUA 2NSQA 1TJGL 4WGKA 3U2JA 1FO0B 3BUYA 1XGUB 2X4QB 4J3VA 5T1KD 1I8KA 3RWEB 3TJEH 4KHTL 3Q2WA 2VDMB 5SX4H 4X4YA 1TTUA 5AYUL 3QGVA 4U31A 2K3TA 1S9YB 4HBCL 4G80B 2JH2A 3CZFA 3S98A 2CBOA 1MCSA 2QPSA 4PGCB 2YUZA 3RX5A 4DW2H 1X9RA 1QYGL 4UTBH 1A1OB 1BOGA 3LXUX 5ABAA 2VZ1A 1U8NB 1AXIB 3MRPA 3GT6A 4FJZA 5GRWA 1G1CA 5I1AB 2YQ3A 1QFWL 3DROB 4QRRE 3V2AR 1KCWA 4OM0L 5DXWA 4UM9A 5IJVA 1XGPB 2NXYB 4G42A 4LLVB 5BOJA 2DJSA 4UQ2A 2QV4A 4L0ZA 5B1CA 3S2CA 3JT0A 2PN5A 4OD2A 4PGCA 2IAND 5D5ME 4R4FH 3ZLQC 5ADPL 3Q6FB 3HNSL 4XOAA 1MDTA 5E6ID 4ZS7L 5DJZB 1FYHB 1FNSH 5FUCC 3FSAA 3IDXH 1Q9LA 4P2OD 3ARBB 4P5KB 1YNKL 2E27L 3X13B 5ES4B 3TVMB 4WDIA 5AUMB 3K81A 2HT4D 1UD5A 2QMJA 4FXTA 3SPJA 3QW9A 1T83A 3THML 1A7NH 3X1GA 3VQMA 4M9PA 1I9IL 2Z31A 3NH7H 3B9DA 5KANG 3TN0C 4KTEH 4ODTH 1JTTA 3TPUA 5DS8B 3OLDA 3B7YA 2DF3A 2I32A 4EQ3A 4LAQL 2E7LA 4TUKH 1N12A 3OAWA 5IP4A 3N43B 4YXHH 2J6EH 4G8GB 4I1NB 4QLWA 1YYMH 1P53A 5F0LB 5K39A 4ETQA 4FQJL 5CZVL 4U1LA 3AY4A 4GQRA 3U36B 1ZT7B 2D7OA 2EYTB 3HAEB 2IPUG 2NZ9C 2HJFA 1GGBH 2LU4A 1R3JA 4NPYA 2F68X 2YPKB 1NGYA 1AQKH 3TN0D 4AKOA 5EEZA 1YRKA 5K1VA 3ARGC 1NMCC 4YEEA 2UZIL 3CFUA 5HJBA 1XGRB 1YNTA 4OLWL 1YPZF 4Z7OB 1U3NA 4BZ1A 1BX2B 1MSPA 2LHAA 4X5RA 5E56A 2AK4A 3C6EA 5T1DL 1T0MB 1H6FA 3BAEH 3G5ZA 3UC2A 1D5MA 2OPCA 2PR4H 4OBSA 2B3IA 3OJMB 2CLRB 3ME0B 3RKDC 3APCA 4Y9BA 3FAXA 2PO6C 3B43A 1SF3A 2EEXA 1NBZA 1DE4A 5FO2A 5JHLA 1P2CB 5HI3D 2UXFA 2GAZA 4KROC 4NJ9L 4JGUA 3CLEL 1L7IH 3APDA 1KMGA 4OSUL 2VQ1A 4OCSH 1UENA 2Y2TA 3L1OH 1GYCA 2OM5A 1WJ3A 1CGSH 3ZE0E 3G6JA 3ZL1A 4YUEL 1I75A 1G6RA 3JUYA 4PJBA 5CU5A 1O5DT 5C07B 3DX4A 1CBVL 1I7RB 5FHAL 4ONFL 1MAKA 4Z3EA 1WV7T 1DDTA 2H5UA 3N91A 1GCYA 2JLPA 4X7FC 3TGXA 4XTRD 3LOWA 3WNJA 4DGYH 1FNEB 2I9LB 1WD9A 2Q7NA 2QELA 1YN7B 1CLCA 1IQWL 2A9NL 3F62A 3QG7L 4J7RA 1AOHA 5DURB 3VWKD 1KXVA 2A1WH 4Z3JA 1A5FH 3DO7A 2EKSB 1R3HA 4E5XA 4D9LL 1D3CA 3SPHA 5CJXC 5CR8A 2QVTA 1PX8A 3M17A 1VGEL 2FEDD 4MZ3A 3DYPA 5I1LA 4O4YH 2ENSA 4GAJL 4W1TA 3HS0A 2I9LA 3P02A 5C0RH 2XG5A 2YR3A 1HHHA 1G5AA 5CKGA 3V5HA 3B6SB 3BUPA 5ID0A 1EFXA 3PQYE 3KYOB 3GQFA 4LPVA 4M6OL 3TFKC 4FNQA 1FGVL 2E46A 5E9DD 3O2DH 1E42A 4ELDA 3Q2CA 3BAWA 2C3WA 2QQKH 1EHXA 1RUPH 5DVPA 1Z7JA 3NIGE 4RGMC 3GBML 4JRXA 4OCMC 1KCRL 2OZ4H 3BDBA 4FZEL 1JERA 2WBXA 3VG9C 4X8CA 2AK1H 3M7FB 2FX9H 2ZJSL 1WA1X 4UT9L 3MRRA 2PCXA 4Y4KD 1TIUA 3ZL4H 3GMNB 2FHBA 3UACA 1PTZA 2V7NB 2BW4A 1KGCE 5FGRA 3RGVD 5LAPA 3LPFA 4GW5B 4UQAA 1I7RA 3QA3B 3QA3A 5I0ZA 1TZOA 5FEBA 3SKJH 1CDHA 2LR4A 4E41D 1OHZA 1NFIB 3K4DA 3VI3E 2X6BA 2FX7L 3ETBF 1SMOA 3CFQA 2X1OA 3GMNA 4EOWH 1DCEA 3Q9PA 3QIBA 2V5SA 2OKMA 4MYWB 2JIXB 4IRJC 1GHFL 4Q4IA 3I6KB 4LP5A 2GIXA 4E0RB 2YPKA 4Y2OB 3TT1H 1JD7A 4DP5X 3D25B 2A6DB 3D2UD 3VD9A 1D5IH 3KS0H 5F96H 1MJJB 1EX0A 1CL7H 3VFNB 3Q7JA 3MV9E 5I1EL 4O4YL 1OARL 1OWRM 4ZYKA 2WSKA 2PPEA 5SWSD 1MFDL 5CD5D 1R3LB 3GSUA 3I6GA 1OF2A 5B38G 3G5VB 3ZKQD 2ATAA 4NBYB 3CDZA 5CIPA 4YFLF 3V4UH 5FECA 2VXUL 2BVPA 1P1ZB 2O5XL 1U6AH 4WWOA 4F3FA 2K78A 1YMME 1XIWB 3WNMA 5ID1B 1RURH 1IVLA 1REIA 1S7QB 2WSPA 1G5GA 4JQXC 2J43A 2CGRH 1FL6A 1G43A 4XO5A 5GGTL 5I76A 1Y0LA 4ABUA 1JG9A 5MEOB 2FQFA 3D06A 2OJEA 4OFYA 3N55A 2IG2H 1JGLH 4D94A 3EZJB 2VDQL 2ZXWB 5I1JH 3HE6D 3QJHB 3NIDF 1X5HA 4YHPA 4GRLD 5A16B 5JPMA 4WHYG 3LCYA 3PUUA 3S8FB 3P77B 3W2DH 2HAZA 5D1XC 4ZDHA 3KJ4B 1IMHC 4U1SA 3SKMA 1DBJL 4HPYH 1WF5A 1HK6A 3WV0A 1ZTXL 3NUKA 1X6NA 3WJJA 3V6ZB 1KXVC 1XCWA 4DUWA 4FLHA 5EU7C 4W6XB 1GS7A 2ADFL 2N59A 4BQCA 5FGSA 2IVFC 1ADQA 2ARJB 1PF3A 4KNUA 3QHFL 2DQFA 2R2CA 2QADD 2VZSA 1F56A 2Z4QB 2WBJB 3WXVL 5CN3A 1I1FB 2QDVA 3BOVA 1L0PA 2DQJH 3P0YH 2EXSA 1WBYA 1VFAA 3PWNB 2VSCA 4MD5B 2P8LA 3JV6B 4KVCH 4OKDA 5TE7H 3V0JA 3ULVH 1HH6B 2A4EA 2JB5H 1C8PA 1MRCH 3UTTE 1FRGL 3HG1A 4NHUA 5H4ZA 5E2UL 3FRPG 1HKLL 1IC4L 4R84A 2EDQA 1F02I 5EZLB 3QXAB 4K7FA 4PJ8D 2WP3O 3SE9H 4CA4A 2NCEA 4GO9A 1Y07A 1EZSA 1E65A 4LRIA 1R1CA 1YMMB 2RB8A 2ZCLL 4AMWA 4MXQC 4KUZH 1HL5A 1YDPB 1WUZA 1ZGLB 5C7ZA 1J5OL 4U3SB 2FWSA 2DTMH 1YEHH 1CT8A 5F1SA 5IVXB 2O61A 4ZSOA 1CK0H 1MI5B 4X5XA 7TAAA 3FQXB 2BOBB 4XMLH 4F37K 2WY3B 1IGJB 1ZAGA 4L8SC 3IJ9A 4J3OF 5EFIA 3KPSD 3R4RA 4YVUA 2CBMA 3IFOA 3D85B 3OZ9H 2AI0L 3ZQ9A 4U1HA 3X1FA 3G5VA 4PJ8C 5EEYA 2F9BT 4G43B 4LRNL 4P5SA 2DWTA 3RUGF 1BMGA 4JRFA 5EIIA 2EDNA 4FFYH 3Q2NA 1FZMA 4IBTA 4RGNC 3X3FL 1CFSA 1C7SA 5IVOA 4DTGL 4ZMNA 4HIEA 4HJ1A 1B4LA 4P04A 4HUXB 4YO0A 4ZODA 4XNMA 2W60A 4NKIH 3WJMB 5CGYD 2IV9A 5GRXG 2CO4A 2G0LA 4I13B 4BFJA 1FFRA 4LHUB 4UDTA 4UM8B 1RURL 3MPCA 3ZXAC 4NAJA 5D1XA 5IZ7A 4UI2A 1JI2A 3STZB 5E51A 1FL3A 4YPGB 3S4SG 5IFHL 3CIAA 1B88A 1E5CA 1WIOA 4HUWA 4BIKA 2Z8RA 3W9DA 3TJEL 3NIGB 2QQNL 2VDNB 1BFTA 2GJ6E 3C6SB 3D07A 5EZJA 4UZSA 5HHXL 3LZFH 1RZ7L 3DVIA 1OPGL 1K3IA 1GC1H 1IIKA 4FQHA 2QQLL 2OMXB 1BLIA 1CXEA 3DWTA 4TPRL 1YYLH 3QUXB 3QR0A 5D7LA 2BP0B 1L3WA 1QSEA 3ZKSD 5DEGA 4LSDA 2WNKA 3H56A 2K0RA 4QI3A 1XSJA 5DC0A 1GS6X 1U91B 3IFNH 4A2EA 1GGUA 3M86A 1JDDA 1ND0B 3GRWH 4CMHC 3EXLA 1EXGA 4IIQB 1DEEB 1NUDA 4DGVH 3GM8A 2O5YL 4YWGL 2AQTA 4A2GA 2CGRL 3LXAA 1HZLA 2OMZA 2CIIB 5IB4B 1XF3B 1LO4H 4UTAH 3EGDB 1AQDA 3MRBB 3D2TA 4H2CA 3BH8B 3ARUA 3LRGA 1S7SB 5INCB 2LV4A 1BBJA 1HS6A 5D70H 4HKBA 1NOFA 4UMGA 5C07E 5T3ZL 3LV3B 1ZWIA 4M1DH 2QLYA 1W8NA 1FPTH 3QIUC 4NOBA 2VMDA 3SJVA 4BINA 2XN0A 1A1NB 4HV8A 4K5MA 2FLMA 2YSTA 3L4TA 2OTWA 2K70A 2W5PA 4WLCA 3T77B 3UG3A 4Z7UA 2WWKO 3QDMD 1R9FA 4GQQA 2BFGA 3QIWB 1S7SA 1S78C 5INCA 5C3TA 4UTBA 4JFXB 4YH6A 2FX7H 1SYSB 2CWRA 2HA1A 3MGOA 3C5ZA 3CXHK 3Q6GL 1ODUA 2V8LA 1AGDA 3K2UH 3QRBA 4KI5F 4P4KA 1BXVA 3STLB 1NKRA 1KGCD 3ULVE 1LO5A 4LEXH 3O3EB 3CZEA 4JFWA 1H5BA 3GMQB 1CDYA 4F8TA 5HXMA 3GZKA 4AXWB 4I0PB 4JDTH 2RQEA 1BFVH 1U3HA 1YEGH 3OM3B 4I1RA 1CFMA 2WKGA 4AM0A 4AQ1B 2DQDH 1G7MA 1OOAA 3WL9B 3KPLA 3MRKB 3ES6A 3ETTA 1RZIB 5IQOA 4QXGH 3GBMH 4XHQA 1PG7X 4Q9CA 2GSMB 5I9QC 4HZ1A 4ISVB 3UYPB 2C7UB 3EYSH 1BREA 1JZGA 2O93L 1V27A 3CLEH 5E8PA 2HVJB 2JJVA 2YA2A 4YLQT 1ZLEA 3D7PA 5JW4R 4KDTC 3BC9A 3U6XA 3MOQA 4JFXA 3RKDD 4WUUD 3QZNA 2IFGA 1VEOA 3H7LA 1B90A 3GS4A 1YMMD 3DIFA 4IOIB 1A3LH 2NY2B 2DBLH 1AACA 4R4ND 3V6BR 2JF1A 5HI3C 3KBHE 4WKXA 3MODH 2UY6A 1YUHB 1JL8A 1X3DA 1FBIH 3RFRA 3GBLA 4JHBA 4PRPD 5IB1A 5I1CH 3L48A 4K2UH 1A7RH 1A8JH 2MNWA 1Y1UA 5SX4I 3WNPA 3DJSA 1JGDB 1Z3RA 2EDDA 4HALA 4NN7C 2FQEA 1Z9OA 1E5ZA 1SUJA 3KPRD 3OGCB 3UAEA 3RWJA 1HI6A 1WHOA 3MRDA 4PJXF 1KC5H 4U4IA 3VFGH 1ZXQA 3Q8EA 3U30C 3T3MF 4FJYA 3EJJX 5AD0B 4R4NC 1MPAL 5I8EB 3BIKA 2GSIB 1IAOB 1WE5A 1ZXKA 3M8OL 5DUJA 5BZWA 4LAQH 4JANA 3FSVA 4N20A 3AITA 4LOFA 2DJMA 3GXUB 1CC3A 3G08A 3MHZA 2PPDA 2X4UA 2IH8A 5HDBE 3T8MA 4BZ2H 3B7RL 4FXKA 3OQRA 5EWIL 2DMKA 3F5WA 3L3OB 2B14A 4AQZA 2AJZB 1UEYA 3U6XS 1UB5B 4OZFH 3HNSH 4YBQD 1KYOK 3GXDA 1ED3A 1HDMB 3UZEC 4JY6A 1NC2D 5GZNC 4NUJA 1OGTA 2H1XA 2QSTA 2Z6FA 1X5YA 4JLRA 4G6JL 4JLRB 5KJ4A 4H0GA 3FQNB 4ETYA 1QHPA 3LEXB 5DFVC 3IS1X 2EH7L 2ZUUA 1YHPA 3C2AH 1NC4B 4P9HC 3D39A 2DWSA 1X5LA 1GW0A 2A73A 1HSBA 4WU5B 5DJYA 4XNYL 4PRPB 3PS6A 4DFHA 3PRZA 4YK4B 3QPQD 1CFNA 4XMVA 2IH3A 5IMLA 2NW3B 3FT3A 4MJ5B 4HU2A 2NY5L 3DOSB 4RAVA 5I9QB 1T1XB 4L8SA 5DJAB 3A47A 3T6QC 4KHTH 4JG1H 4CJ1A 1PD1A 1RZJH 2IAMC 2LQRA 4PRHD 3ISYA 3DJRA 5GGRB 4HULB 3HJEA 3OMAB 1UASA 4OCLC 1F58L 2K7QA 4XX5A 5D2NC 1VSCA 5CCKL 3UTTB 1DANT 1IFGA 2BSBA 1KDJA 4HS6B 4FC3E 4DZBA 1MCIA 1VACB 4KQ4H 4KVNH 3T0WA 1CICB 2CIKA 3T3PB 3KLDA 4YFDB 3MLWL 4R7VA 3G5YB 4PJ9D 4CNIB 5K9KB 4K8RC 1T4KB 3H0TB 5C0AE 1RLWA 5D7LE 3G3LA 2J20A 3QIWC 3PDOB 1DVSA 4PJFF 1QPPA 5JHDD 4XB7A 4ZMPA 1O7VA 2QSCH 2BOBA 1I9EA 5EPMA 3NAAL 3QE5A 5IBUB 3V9FA 5DD5H 3WG7B 3O9WC 1U8QB 3U9PH 1MJJA 2DQFB 4Y2OA 1K8DA 4Y1AA 2YOAA 2OTUB 1MPAH 2EIBA 2YLKA 2WLNA 4JFFD 5DLLA 4TQPA 4HHAB 1SNRA 4ODHH 4PJ9C 2V3FA 3VFGL 4N90D 2EINB 1T66D 2ZE0A 3ULVL 4O02L 5JIKA 3A0OA 3GBEA 3QIWD 1A7BA 1YECL 5B1KA 4MB1A 4X9IA 3OMIB 2GEQA 5FA4B 1N59B 2DS4A 3P0YL 5BW7A 2NX5B 2A6KB 4DGIL 3FTZA 3VXMA 5TF0A 2A77H 1UFUA 3O0LA 1EEZA 3DV6B 4P5MB 2HB0A 2YEQA 1A3ZA 4JQXA 3P3RA 4TNWK 3GMLA 2VDLB 15C8L 1KCSL 2A0LC 3BUIA 2NLJA 4A6YH 3VGHA 2YEZB 4GH7B 2JI3A 3B7UX 4WEBH 1W72H 1HCYA 5DZ9A 5DO2D 4EI0A 1ZTXH 2YGOA 5F7EL 5C07D 1H3PL 3V6FA 3W0WD 3HR5A 3TCXA 4AYBA 5L6YH 1IKNA 2X4OB 1ZHBA 1QBAA 2IPKA 5MERB 2GBUA 1LMKA 2WKOF 3A6CL 5JOFB 4K8RH 5E5UB 3OR7A 4M48L 4NPKA 4OCRH 3OR7B 5JORB 5FDWB 1DQLL 1TU2B 4IBSA 4IJ3C 3NCWA 3PE9A 4ZDHB 2C4FU 5F44A 3GSNL 5AOIA 5C2UB 4QR7A 1ZHBB 2QVFB 5E9DA 3PWPB 4XVSH 4WKZB 1IRAY 1DVFC 1UD8A 4XMWA 1F3DH 1A2YA 1OT2A 4BHUI 2YBRA 4TNWF 3UIYA 4X8GA 3MN8A 3NPSB 4OW6A 3KVPA 2C4XA 2PCPB 2ITCA 4IDJH 1RUAH 1KB9J 1ZANH 5TFSH 4D2NA 4ZAKC 3AU0A 4Y1TA 4IKKA 2FWOA 2DM3A 3R0NA 1G7LA 4TM9A 2FECL 1FAKT 1PFOA 1H3TA 2WNWA 3HC3L 4RRPM 4UTCA 4RWYH 3DOIA 1XAUA 4U49A 4OCYH 3SGJC 3FQRB 3V8OA 1DBKH 1RK7A 1WWAX 2AZAA 3W9EA 3QZOA 4PREB 4N0YH 1OCOB 4QD2E 2CO3A 3UZVB 1I7TA 2DMBA 3MBXH 4EIZC 4TNVK 1L9SA 1OY3B 3LS4H 2OZNA 2XG4A 2K9FB 5T1JA 3EHBB 4K9EL 1KLUB 5E4OA 2XN1A 4FQHB 5GSRA 1DZ0A 1U8JA 1UKSA 2HG5A 1G6RL 3LKNB 3RUGB 1HE7A 2CJSA 1MAMH 3RVWD 4DSYA 2LGNA 2MMXA 2KHAA 4N0FA 4GAGH 4FNSA 3EO9L 4PRHB 1T5WB 1CXFA 3MCKA 3VXNB 5B3SB 1I7ZA 2DTSA 2FX9L 1P1VA 2FWOB 2NQ3A 2OZ4L 2WBJC 4FZEH 1GJUA 4FQXC 3SGKC 4B5EA 4N8VA 3W11C 4MMZB 5A1AA 1URLA 4UB0L 2IC2A 3MV7E 3ILPA 2I60H 3LEYH 4WK2B 4BKSC 4E9XA 1QBML 1E6OL 2PNDA 3M07A 4PJGA 1BVLB 2HJFB 3BPCA 2EKSA 2JCCE 5E2WH 1OE2A 1A0QL 4PV8B 2GC7C 1ZOXA 5AALA 2DBLL 3WJMA 2ZXEB 1A3LL 4G8GA 5HDRA 3SEPA 2C3VB 1KENL 3EGXA 2MQGA 5FA3A 5IQ9B 2COQA 3KJ4C 2X4RA 3VE0A 3FTWA 3HKZA 2VH5L 4MXVF 1NAMA 5D7JA 3V5HB 1KSRA 3BKML 2QPUA 2WBJD 3VXSD 3M7OA 2ADJB 4DQOL 3UMTA 3WLBA 4ODWB 4UAHA 1A6TB 4KITB 4I4WB 1MJ7L 4OQTL 5T1KB 1GOHA 3OWEA 3BEWA 4MMYA 4I9WE 4YE0A 4YDMA 5FCSH 1LWJA 4IKJA 2Q6WB 3MLRH 4TVPE 2NY0C 5DRNB 3WOVA 5IQ7H 1HEZB 3DKHA 4RRPA 5SWZA 4FFYL 3L16A 1PFCA 3APMA 1HL8A 1IC5L 2KMWA 1MLCB 1SEBB 4JE4B 1JDAA 4MCYB 4FNUA 1RZ8B 2CD0A 3WKML 3ZIMA 1AFVL 3AUVA 5I5RA 4GBXB 4OUUA 1YC7A 4MA3A 4FG6D 1OP5H 1S6NA 1EJ8A 2W80C 2B59B 1NANH 1WAAF 3TL5A 1CK0L 3O3AB 2NUTA 1SVBA 3NA9L 4PRHE 3EJYD 4M9OA 5D4HA 3B2DC 1XCQB 3MRCA 5IMKA 3CK0H 1WFOA 4Z3IA 4AYEC 4E9RA 2F15A 3QZPA 3LRSA 4IGBD 2ZPKL 5IBTH 3RUGE 4FNRA 4QXTA 3VFTB 5T1DH 2XV6B 1HCZA 1WBZA 2AJZA 4PJDA 4OLWH 1IAKA 2LE9A 5ITBH 1F4XH 1KPUB 2J1KA 4RZCA 4B5ZA 3M1BB 3SYQA 3TBCA 5BXFA 1U36A 3FOMB 2DQ6A 3NRQA 4B95C 2BLFA 3BKJL 1OLZA 2VWEC 3EAKA 5CGMA 1FN4A 1N19A 1ZJAA 2QKSA 4Y1AD 1VB9A 2G9HB 1JNNH 1IBBA 1PD6A 2DQJL 5K33A 3VG9B 2JIXD 5JLZB 1Q9WA 1SXSA 3EGXB 4TTDC 2R2EA 2O5YH 4RGMB 2VITA 4JPSA 3B5HA 2EEAA 3T8XA 3RWCA 3D4CA 1TTFA 4UU9B 2DIBA 5C7XH 2WB7A 1C5BH 2CRMA 3VFOA 4B9FA 1NEZA 2NW2A 1ILUA 3DGCR 4PLOB 2YXWA 1E4XI 3HN8A 5MHSD 1UC6A 3RGVB 3SDXF 4JVUA 2XUWA 1I1AA 1BAFL 4LDEB 3ZIYA 5HHXH 1GZQA 3QUZC 2XBTA 3ZGHA 1UZ8B 1CVSC 2ZG1A 3L6FB 3RTQD 3ESOA 4OLXL 4V1DB 3W37A 4PRDA 4YLBA 1CYXA 3HN5A 3GSOB 4UIMB 4TNEA 4IOFD 1P5UA 2RR3A 1I85C 1JUFA 2Y7NA 3NT0A 4HKJA 4IOSD 4M8RA 1NBYB 1A6WL 1R3LA 3GWJA 2WQVA 2EXYC 2VQ4A 3BQUD 4KC3B 4PV8A 1Q94A 4AIZA 1IGIH 4K7PL 5E6IC 3JWDL 3AS2A 3L2LA 4ORGA 2IANB 4PJGF 3QYNA 4HP5A 5GRVK 3GTTA 2D7TH 3AQXA 4DH2A 2Y5EA 3HS8A 3VM7A 3QDGE 4NZ8A 2NXYD 5FW7A 1JPFA 4KZCA 5BOZG 2WQXA 4P07A 2IDTA 4O2FB 3TZVC 3IJSA 3VGGA 1J5HA 3BKJH 5DI8B 1QWNA 1X5KA 3HCVB 3TA4D 2I26N 4CVXB 1NEPA 2AABH 1F8TL 3Q2LA 3EYUL 2Z3FA 4L8CB 1BVOA 1RUML 1SYSA 2AANA 2E9IA 4FG0A 1V3JA 3U0PB 1VPOL 2XTJD 4JHAH 2ZOUA 2BNQE 4R97C 1BQHA 4R6UA 4WAFA 1F4WL 1RZIA 2GTQA 5J11B 4DVBB 5BZWB 2D4DA 4G5ZH 4QYOA 1A4CA 1TITA 4N2OA 3VH8G 4AV5A 4TN9A 1JWMB 3CZNA 3AWEA 3LS5L 2Y0SA 3WI9A 2AEPH 3ARGA 3DHJA 3M46A 4Q7DA 1XR9A 5FYKH 4YDVA 3D0LB 1E5BA 4X0KA 4Z9KB 1QFOA 2J72A 2VZOA 3GFUA 1YO4A 2Z9TA 3QZBA 1IC7L 3SDYH 4P23D 1ZE3H 3KYMA 4I5BB 1U95B 2EH8H 1YEDB 3E6FA 1BVZA 2BS9A 4QWWC 5C9KA 2ZWYA 2G30A 2NTFA 2NT1A 2OXHB 1FFPB 3FTYA 4KGLA 5LCVL 5B1JA 1MWAL 2NZIA 2EADA 5DJ2B 4OFIA 2F0CA 3IBEA 5FK9B 3RP1A 4OI7A 1AGCB 3FTUA 3CXDH 1AMYA 4GXFA 4LSUL 2XFGB 4M6MH 4XMXA 5I24A 3ULUD 5HYJD 4B9ZA 4BDVB 4XCFL 2CLZB 1RZGA 4PV9B 5I6XB 3S5LA 4R7NA 5I1KH 1HT6A 1J9QA 3QQ9D 2EDRA 4GSXA 4F37F 4IOIA 2V5TA 4ZX6A 5JW4Q 1MQKH 1U8HB 1FGVH 1WICA 1BPVA 5EU4B 2MH4A 4EN3C 3FJTA 4KROD 4WFHE 4OZGA 1ADQL 4PIRF 2PTTB 4EZMA 4URKA 1H6UA 4NJAL 3FUDA 5D1QE 1MCLA 1SDAB 43C9A 3FHQA 3MGAA 4HUWB 3FQTB 3SY0B 3MSPA 4Y19A 2CXKA 4CVZB 3CSFA 1YEJH 4IOSA 2WVUA 2JKIS 5ENWA 1RCYA 2WQSA 3RDJA 4OD1L 4S2SB 3HUJB 4LBEB 4XTRC 1B4RA 2H0FA 3O81A 3KGTA 1DQDH 2ESVD 4PGJA 1OP5K 2DYRB 1FC2D 3LEYL 4NZUH 5D2LA 3UBXB 1BIIA 3PIQA 1IGML 4KFZC 1NCTA 4PJHA 5D2LB 3UBXA 5HYJE 4HJ0C 5HPOA 5D1ZC 3D09A 4WI2A 2Y1VA 2ZXAA 1S3RA 5IT2L 1PLCA 1JZ5A 5JHDA 3OKNA 3WDHA 5CP3H 3CC1A 1FNFA 1BM3L 3N85H 4PJ5D 1T1WB 1KFGA 4DN3L 5IHBA 1SN2A 3VRLE 4TSAL 1D9KB 4NC2B 3VXPB 1RUKL 3N41F 3D6GA 4TUOA 2ADYA 3GI8H 1I85A 1SDDB 1S9WB 1W6LA 2HUHA 2EC8A 1PX4A 3PP3K 2LFGA 2FLBT 3TYFB 4HJIA 1M7XA 1Y7VA 4UNUA 5KSUB 1ACZA 1UVQB 2Q2LA 1FL5B 3FTXA 2L4OA 3RBSA 3S8GB 1NJ9B 3FFDB 1HOEA 5FR3A 1OARH 3HMXL 4UDTB 1CU4L 4QHLB 2AQ1A 1AS7A 1R0AH 3OL2A 4NPYB 3BSZL 5F9OL 1DJXA 1DUZA 2DL2A 3IMSA 1KLFB 4TSCH 1LLAA 1MFMA 1N2RB 3V55A 5E2WL 1HAWA 9PCYA 4KY1L 3HG1B 1KV7A 3MA7A 4M5SA 4LCWE 1IX2A 4IRZH 1G4RA 3FT0A 5EWIH 3DVNB 3BFOA 1AQKL 3RPKA 5B22A 5EDSA 2XWZA 1DTUA 3RTQA 5CEXA 1AP2A 3EBHA 5JW4M 4HF5H 3BCFA 2O30A 3MLZL 5FYKE 4RSYA 2V9QA 5GHWH 2HJLA 5E6ZA 4N6RB 2OV0A 3HC2A 4DZ8A 4X9BA 5KSAD 2OL3B 4M02A 4HJJL 4XC1H 2E47A 2GTZA 2ZYIA 4BFBD 3ULUL 2BOCA 5IBLD 4BK8A 5T1LA 2X4NA 3EIFA 3T09A 4ENEC 2WMPB 3AROA 1I8UA 1HJBC 4GUCA 5CJOH 2K4AA 1P5UC 3PWJB 3PWLB 5T3XL 3SJVE 5L4JA 1FDLL 3PWJA 2XN9A 1PNDA 1A7NL 1KWGA 1VFAB 3UP6A 4DK6A 5T1LB 3KPRB 3DJ9A 5E03A 4F2MB 3MV7D 2E9WA 4YOKA 3HUJE 4GRWB 4YXLH 4M6NL 4BFOA 4FCAA 2D31A 2OYLA 1N18A 1XH1A 2IH1A 3BPNC 3L5IA 3F7RA 1NMAH 1YZZA 2VLKA 4L3FA 4M5YL 4B9IA 5MEQA 1P4UA 4QUOA 1NQBA 4A6YL 4AC4A 2ROYA 1G9MC 1VADB 1T7VA 1I4FB 2CXGA 3HZ3A 3QP3A 3RRQA 1MXDA 3ECVA 4N0CC 1U8QA 4Z5RB 2WVVA 4OGXL 4XXDB 3C09C 1NPJA 4ZXBB 4ADGA 3OX8A 3FOLB 4UINL 4OM0H 3RL2B 1MJ8L 2R0LH 3S5LG 4KDTA 1F6AB 1KWKA 5D1XD 3HPJA 4QTHB 1JXKA 4BWUA 5DJ6B 2IAMB 3RIFK 4P59L 1TZAA 5T1MB 4OGAD 2R4SH 2XBZA 5GGUA 1FFQA 2CKNA 5E7FA 2ZUVA 1S9XA 3EO1B 1UXWA 4CL7A 2F8XC 3HI5H 3S3JA 4UQ3B 1H9VA 2EC9U 2R7EA 4OSUH 3SE4C 4D9QD 4EF3A 2WM0A 1Z5HA 3INOA 3CJJA 1IKOP 3I9PA 4G7RB 5BRQA 4IEFB 4OFKA 4KZDL 2VLJD 5E8DL 3BAYA 1CN4A 2DQDL 4BD4A 1TEYA 1JXFA 3P40A 3QAZB 1HQ4B 4RX4A 1AYOA 2V5MA 2Z0UA 4XI5D 4Y9CA 5IV2A 4U1GB 3AAZA 2F54D 3DTDA 1H5BC 3GEWB 4PRHA 5JW5B 1UWFA 3GEFA 4JL2A 3WUWA 4HPHA 5E4IA 3O8XA 32C2A 5H8DA 4KXDA 4WI3A 3QIUA 1RK0A 2IIJA 5KSVA 2HG5B 3C9NA 4AUUA 4ZXBA 3GRGA 5JHAA 2NCMA 2EEBA 5ALCL 3QULB 1R5WA 1MFEL 4R5TA 3QK0A 4K23H 5E6SB 4FFYA 4PB0L 5IW6B 4PJEF 2NY0D 2CSPA 1NSNL 3MV8A 1XTLA 3LNIA 3OWRA 2UXTA 1HESA 25C8H 3FO0H 5LGJA 1NCJA 1UWEH 2W0FB 2Y07L 3EJUA 4GAAA 4HZLB 1E9OA 4E9LA 3KPRA 1J0JA 1U3JA 3BWUF 5JHMA 3AABA 5KSBE 3VXSE 1K5WA 3MOBL 2XICA 2ZP8A 5GISH 1BZ7A 2J6WA 2JTDA 3NCBB 4XNXH 5D6DA 2XHNA 1DN0B 3U30B 1GGYA 3B6SA 4MJID 4XNYH 2HUEA 2NY4B 4AYMC 3WMQA 3NYKA 5KVFL 1QPKA 2H3NB 4JN2B 1BZOA 3AB0B 3IGKA 5EF1A 1T7YA 2FVNA 2WTRA 4ODTL 2N56A 4X6FA 3VVVA 3QNXB 4Q6IB 3NQKA 4DGVL 2BHYA 1AC0A 5SWZB 4BCZA 3VXQB 3WL9A 1GW6A 5E2VH 3MBED 3MUY1 3PWPD 5DUBB 4N0UE 4NNXA 5M94B 3A4DA 1TLKA 5BRZE 4ZW8A 1KB5L 3BO8A 3DX3A 3PG2A 4H5SA 2AZUA 1B4JL 2XQ0A 4H8UA 4X6BB 1DO6A 1VGKB 2W9LA 5DMGD 4WK4B 3UTPE 4ZW6A 2NY2C 1OEZW 3BWUC 1ET8A 5AYQA 5C07A 4X7EC 3HI1B 1Z0NA 2R1XA 3KNBA 5F88A 3FFCE 2DLTA 3QDJB 4A7UA 3L54A 1RUQL 2VJ0A 3QCTH 1RZJL 4NNYB 3SDXB 1RJZA 4HX1B 4APQA 4AJWA 4Q9QH 2VDML 4HXBL 4MNHB 2ODHA 1SOSA 2VSDA 4K3DL 1P7QB 3S8WA 3ZTJG 4ATTA 4LLMA 1QYGH 3S3SA 1YMHA 3HAEG 1ZS8B 2CCVA 4JUSA 4NAMA 2XVKA 2CE6A 2VQTA 1XEDA 4B9YA 3NSFA 1LEGB 3MJ7B 1YN7A 5GGVL 1WA0X 4HGMA 1B6DA 4GXUM 1FNEA 2V37A 1H6TA 2IQAA 2JQAA 4BH7B 1MUJA 3L7FB 4GG6E 2D9QB 3P1VA 2BFVH 3PP4H 3IJ7A 1A9EA 5FYLD 1D5MB 2HYMA 4PRBA 1T0MA 2DEWX 5DT1L 1S5IL 4OJDH 1F5WA 2CNYA 5IVXE 1CO1A 5DK2A 4K2UL 1AD9A 3TTYA 4Z7VB 4N68A 5BZXA 3SGDH 3T6XA 1N0LA 1UJTA 4HAGA 3WEXB 2DQGL 2VM4A 4MXVE 2F74A 4GSQA 3K72A 2V3EA 2NY3B 2O4EA 2VGLM 2MCMA 4AUYA 4F9LC 4OZFG 4NQDB 3OBAA 4AKPA 2FECI 2Q3AA 5TPWL 3UZVA 2XA8L 5HHNB 3GJEB 3WEXA 3ZTCC 2PXYD 1UD4A 3L3IA 2ZCLH 4HBQA 5H94B 3GJFA 1ZGLP 1RL1A 4OFPA 1RJZB 4HX1A 4KKLC 3S36L 5D4IA 1UZ8A 2V9UA 2W0KA 5KSVB 3S35L 3TBTB 1BXUA 2D03H 4MJ6B 2YA1A 1FH5L 2CIKB 3LZQA 5BZDA 1VGKA 1KG0A 3FCTA 4N1CA 4B9PA 3JTTB 2KBGA 1N5AB 2BK8A 3CH1B 1JXGA 3QDMB 2H6OA 2GUYA 4FNPA 3APFA 2C9RA 3D1MC 4U3CA 4IS6B 3TYGL 5FKPB 2IBBA 4IRZA 3A5VA 5I8CB 3WIAA 3FN3A 1BFVL 5FYJE 3V5DB 3W81A 3DMMD 1E0OB 5J1AA 3F12B 3W38A 2AEWA 2I24N 2DH2A 3H8NA 3VWKB 3F83A 4XPGH 5D5MF 1L4IA 5DA0B 1SY6H 3VD7A 4Y5YB 3L3JA 2F58L 1FF5A 3QHZH 2H3NA 5DFWH 3ZKMD 3SIKA 1HXYB 1EHLL 1EUTA 3GSVB 4PR5B 1T5XA 3K6DA 1TZIB 3HZVA 4L8BA 5BXFB 2MPAL 1HYSC 3F7QA 3WNOA 5AZ2L 4GKNB 2N01B 4YQXL 4L1DA 3PWNA 1TJMA 5JPMC 1OAXL 2EXWC 3TJHC 1WISA 3KPOB 3V4VH 4NZDA 3H9SB 5IVXA 1MCWW 1QSFB 1OD7A 2GB2A 2ZIDA 4UT6H 1D5XA 5C09B 4W9LC 3LN9A 5T3ZH 1KIUB 3S35H 2L0DA 4FJ6A 3VVWA 1CXHA 1CDCA 4UQCA 3W39B 1HXMB 3QT2A 1SJEA 2VN5A 1KCUH 4PGDB 4AG4L 1LE5B 2AHIA 1Q4NX 4LSQH 4HCIA 4H44C 1DVQA 3NIFE 1CGWA 1F4YL 4R4BB 4RMUA 1Q0YL 5JQIB 4OCWH 5GGQL 3JV4B 5E4AA 4NQCE 3IXAB 2MWCA 4MCYA 3GRWL 2CRZA 1RZPA 2O5XH 5JNYA 2EXWD 4MRBA 3TJHD 4XHJC 1S7UA 2B9AA 3IBOA 4X50A 4UANA 2AJUH 2BZCA 4PJCF 1DVZA 2B5IC 3PWVA 4OB5H 3HMWH 1WDAA 3WLWD 4YBHA 3JT2A 3JTSB 5D1ZD 5IROA 5SWSE 3L4UA 1ORQB 4KRMB 3PU7A 4POYA 5DZNA 3IMWA 3ZDYE 2XWTA 2CKBB 3S4SB 1GSMA 4JFZL 3VDAA 3MO1A 5DK0A 3EFDL 5I8KL 5CEYA 4M8UA 3RWDA 1CFTB 2A4CA 4JGMA 1NM4A 1S7QA 3EDFA 2X1XR 4AYFB 2G60L 4MQSB 5TQ2H 3O2WH 1A6PA 4HC1H 5L7XL 2FAUA 2X4RB 1TMQA 2CKBA 2FGWH 1YY9C 2V33A 3LVTA 3R06A 3DMMB 2X9XA 1CZ8H 1RSFA 1RJLB 1DBBH 2YS4A 3KPSB 2HVBA 4POUB 1E4XH 4WEEA 4ZPVA 5EH1A 1UFGA 2ZWKA 1UZGA 1BD2E 4F9LA 4ZSOB 5KYUB 3RNKB 4DESA 3NJGA 1ID2A 4OLVL 3P4NB 4U1KA 3F2LA 3VA2C 1C12A 5IR1A 5FXCH 4JKKA 2BVQA 4HWBL 4LPTA 3CLFH 4DP1X 1RHHB 4KI5C 1ODAA 2N1TE 3X2QB 4G6KH 1WEJL 2OJ1A 4BXSV 3T0DA 2OCJA 5J1SC 1CYGA 3GXFA 4M4RA 4FFWD 3MCKB 3VSUA 1IZJA 3QPQC 1QFUL 3KGSA 3N1QC 3H2WA 1UJ3C 5HGDB 1T1WA 4N2HA 5ELIA 4CC0A 3VXUE 2FLRT 5JHDE 2E7LC 3FTSA 1RIUL 1W0VA 1BMWA 4GS7B 4MLSA 1XCTA 2WUCL 4LQFL 5IM7B 3SE9L 1B6UA 5T3ZD 5ADOH 2EP6A 3NSCA 3IRCA 3ROOA 5AZUA 4D9LH 1Z9SB 1O9WA 1ZEAH 4HS3B 4XPBL 1XL4A 4ONHB 4G6MH 1Z5YD 4FFWC 2QHRH 2XWJA 2A9NH 2XV3A 2ZSVA 4DKDC 1W72A 1HXYA 1LDSA 4OH2A 2XPGB 2JKXA 3F8UB 3MGOB 3NCYS 1M7DB 4QRPD 3S3CB 2DN7A 2XKNB 3U7YL 5J9PA 1H3XA 1TCRA 1G9EA 3VTTA 4FNLH 2Q3ZA 1NCHA 1XIWC 2EDEA 4JPWH 2XV0A 4RDQG 1MWAH 4KKBD 1J0ZA 2B1HL 4G8IB 4HWEH 4QRRA 3OR6A 5K5YA 2KS0A 2DQCH 5LWYL 1SXCA 1XD1A 4ZO9A 3WS3B 1P4BL 1Q0XL 1N5YH 3AY4C 1EXUA 5ILTL 3N42B 4U33A 1AGEA 5KYWA 1NAKH 1P84K 4G6AC 3RI5F 1AGFB 5EOTA 1WWWX 5D6DC 5JYLA 1YQ2A 2ZUXA 4U0RC 3IFLL 3MCYA 4OZFB 5C0DA 2MCG1 2R8SH 1XF3A 1EZUA 2YGVA 4KO7A 4RMBA 2R39A 3EG9A 3WFBH 5IHLB 3UZQB 1BW8A 1CXLA 2YHGA 3GSNB 3JWOL 4NENA 1E28B 4P2AA 3OSKA 4XPTL 1E8YA 2NSMA 1CGTA 4JHAL 4XN4A 5EUOF 5LGHL 5JA8B 1EQWA 4XBEL 5EOTB 1JBJA 1IBDA 5E2UH 4NN6C 4BYHA 1PZ3A 2IG2L 5CSZA 4G8AC 4FFVC 4WRLA 2AMGA 5CLWA 43CAA 4HISA 4KAQH 4APXA 2CMRL 3QUYB 3VXRE 5L2KD 3QPKA 4XP5L 4QRFA 1GGBL 5EA0L 2GJPA 1A66A 4ZUWB 5I74B 1I8LC 2D7TL 3UYOD 1J1XL 3RWIA 2CQVA 1E4HA 1NIBA 3C6SA 4K7PH 1AZZC 5AKSA 5JPNB 4P2QA 3UROR 3N44B 4B9CA 3MC0A 2AFNA 1J12A 2ADFH 2ICEB 3KH3A 1JK8A 4Z95L 3IJYB 1BQLH 2R0ZH 4ZFQA 3RWIB 4ONHA 1FLTX 2C7UA 4ZUWA 4X6EA 5F96L 4BWWA 1UACH 3ILQC 4BQBA 1MFAL 1CUOA 2ZYSA 1JXJA 2YXFA 3QXTA 1JIBA 2XWDA 4EJ1C 3ES6B 3CU7A 1C7TA 2N0MA 2V2XB 4MB5A 4C56D 2Z1KA 4OZ4B 4EBQH 2Y2YA 3MBEA 3NVQA 2R1YA 3AADB 4A37A 3O0RL 4ZUUB 4JHWH 3LQAL 3QC5X 3RAJL 1N26A 1JD9A 1F41A 1VFOA 3ZYZA 1CE1H 3NZ8A 1G4MA 1JGLL 4LNVA 2ZCHL 3V4PH 4FKKA 3ZO9A 3CFKB 4JZJB 5EEVA 4LLQB 2OXHA 2VDRB 1XAKA 4PGBB 1AZBA 1GGCH 4H5SB 1W0YT 3ZKXB 2H1LM 4HF5L 1KTJA 1R19A 2O1AA 4NCC1 1MCEA 1OOWA 3IE4A 2UWEE 4XVUC 1H8NA 2FE0A 1PU0A 3LKSB 4YHMH 1Y18B 3POCA 4Z7QF 5HDQL 3O6FB 3RIKA 4PJAA 3L4VA 1H3WM 4UILL 4MD4B 3P4OB 4MLIA 2IPTL 1GY2A 3KYKH 5DURD 5IBTL 4LVEA 1OZUA 3LDBB 2P5WB 2HT3C 1M6OA 1EHKB 1W8OA 1DQJB 1QI5A 3P54A 2W07B 3FT3B 4ZXBD 2Q86A 6PCYA 4LF3A 1CU4H 3UBGA 4YHNB 5IMMB 2H6UA 3U7WL 1E9QB 2J25A 1HSBB 5J7CC 5E24E 5AKVA 2Z91A 1NC4A 2QTVA 3J7HA 4R5XA 1U8OA 3HFML 4AOFA 5TDPA 4CW1A 4ELKA 2AJUL 4MA7H 4H26B 4ZNEA 4FQQA 4X4ZA 4YSQA 1MH5A 4FE9A 3IPEA 4LCCC 2XXMB 3ARGB 3L1FA 2F1BA 3IGAB 1LILA 2WXNA 3O4LB 1GGCL 4RNRB 2ZX7A 4V11A 1IM3A 4W9EC 4BGDA 1Q1JL 2CO6A 1LWHA 2OBGA 1RK0B 2A6JA 3QI9D 1KCRH 1XMEB 5DWPA 1KBVA 2R56H 3AM8C 3IU4H 2G4EA 2ZUWA 2OULB 4F8PA 1T4KA 2FSEB 4UIKL 4POZD 1E40A 1JPTL 5FF6B 1QNIA 2FQDA 3RAJH 4NZUL 5GZNA 2WOBA 4PSRA 4B97A 3LB6C 3V4LA 3IN0A 2DLFL 1M53A 1OQXA 3FCSB 3N42F 5C0EA 5KSBA 4W9GC 3FHEA 5HDBF 3WFHA 2A9CA 5CD3B 4N2GA 1RIHH 2IANA 4GKZA 1PNCA 4CC4A 1RERA 1ACCA 2BX5A 3MBWB 4PJHF 5DUML 3S96A 3EOTL 3D51A 2DAVA 2O26U 3NCMA 3QEGH 2A6IB 1EDYA 1QO3B 3MZGB 2VITB 4MS8C 4Z95H 5FYLH 3HE7D 1T03L 3ZU8A 5SV3A 1TQBB 2ZAGA 3RTLA 3RGBA 1CFVH 3VFVB 4WHCA 3U1QA 1E6OH 3T4AA 1P9MA 3NFPA 1L5GB 1C9SA 3S3DB 4XVTL 4S0TD 5L88L 4ODUA 3RVVD 3TNNA 1OF2B 1LQBC 2GIMA 4PJHE 4KRPD 4N8CH 3MROA 3D39B 2KDYA 1WQVT 3BW9A 5ANMA 5BVJB 4XP4L 1U41A 1CBVH 3S4SA 1E4KA 3WU1A 2OK0L 1QRNA 3LPGA 4HS6A 5FFOA 4DOHB 2Z31D 2X41A 5D7IA 4HZAA 3UJIL 5D8JL 3S97C 4DUVA 4J8QA 2ZF9A 1WWBX 5BO1H 4AEIH 2VXSL 3F84A 1DN2A 4OVVA 1RZKH 1X9UA 2XVBA 3GHEL 5DJZA 3MLTA 1KN2H 3BLPX 4XBEH 4GW4A 1J11A 3VU1A 3REVB 4PBVC 3E80A 3FU5A 4E41B 4Y5XA 5A7BA 4CADB 3L2NA 1E5YA 1GJWA 4RISL 2WWNA 3UAJD 3UTQB 5IFAH 4S1SL 4YDZA 5KVDH 3VX1A 4OZIA 2W8CA 4U6VH 1UADC 1NAML 5KOVC 1AC6A 4W9CC 1TSHA 4BXVA 3VXNA 5DJYB 4K0OA 4PRNA 3LZNA 4HUVA 1HYRC 3GJFB 3QNFA 3BAEL 2BDNL 1MW2A 3X3GL 1MCHA 5FKAB 2B5IB 2IPTH 2NYYD 4P0DA 5C6WH 1EBPA 3FT9A 2Q3XA 3NN8B 5JIHA 3Q3GA 5IB3A 1F8TH 1KJMA 1ZRUA 1L9MA 2Z4TA 3NEEA 3NZHL 4GO8A 2H3KA 2L3BA 2ZX9A 3BVTA 5JHLL 1OB1B 4AGMA 4JRYE 3VFWB 2YGQA 1F11B 5BQ7B 3IAGC 3TA3C 2DYPD 3NZUA 1GOFA 1TR7A 4Z7VA 1T5XB 1QFWH 3QXVA 2GQHA 2BJML 2X28A 4JCLA 5I16A 5IHWA 3IFPA 4XPBH 5DYOB 1NGQL 3EYQC 2OSWA 5L4MA 3UEZA 3VWKA 1FORH 4FN0A 3UGEA 4JO1H 2WUCH 4XN8A 5ALBH 1RK1B 1P4IH 4X4KA 4MJIE 1EJFA 3VXUD 1B2YA 2ITDA 5DYFA 5JPMB 3QI9B 1X7TA 1BQ5A 2F53B 4TRPH 2GUOA 1DUYB 4JGJA 4ODVL 4AKQA 1QACA 4G7YH 3BEWB 1H3PH 3PWPA 4GRWH 5EZIL 4Y5YC 3ZT6A 1YNKH 4I4WA 4LCIH 3K8KA 3WIFB 1QLRA 3F3HA 2EZ0C 4MJ6A 2K6YA 4NQED 1D9KA 1MNUH 1DFXA 1I7ZB 2VDPL 2X2JA 4QXUL 4HSAC 4ZX4A 1G7HA 2DWDA 4M8QB 1K6QL 4JW3A 5CZKA 2BVYA 1I3UA 3DPBA 5BQ7A 1QTYT 4HCGA 2C3VA 1W6WA 2YRLA 4NC0B 3BIAX 4N2EA 3VXRD 2E6QA 3NP3A 1XZWA 4KZEH 3ULUE 3F7VA 3BGMB 3P9LB 2HT2D 2J55A 3FN9A 2YWZA 4Q6KA 1FGNL 1NMBH 1W9XA