1I8AA

Family 9 carbohydrate-binding module from thermotoga maritima xylanase 10a with glucose
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
189
Chain Sequence
MVATAKYGTPVIDGEIDEIWNTTEEIETKAVAMGSLDKNATAKVRVLWDENYLYVLAIVKDPVLNKDNSNPWEQDSVEIFIDENNHKTGYYEDDDAQFRVNYMNEQTFGTGGSPARFKTAVKLIEGGYIVEAAIKWKTIKPTPNTVIGFNIQVNDANEKGQRVGIISWSDPTNNSWRDPSKFGNLRLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE A
publication title Crystal structures of the family 9 carbohydrate-binding module from Thermotoga maritima xylanase 10A in native and ligand-bound forms.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 56
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06452 CBM9_1 Carbohydrate family 9 binding domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1190 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1i8aA00
1ULVA 4JPQA 2IVFC 1I8UA 1I8AA 1I82A 1UG9A
chains in the Genus database with same CATH superfamily
1HHIA 3W39B 7PCYA 2MOGA 5C0JA 5FFOA 1FPTH 3BQVA 2WP3O 5AW8B 1MNUH 4I48A 5HHXH 4HFWA 4NO3B 3VXSA 1I9RH 4IK6A 4GRLC 3UC0H 4B95C 2H0EA 3ESPA 3VM5A 4ZUWA 2NY7H 1WBXB 3JYBA 1CUOA 3DX2A 4ZAKA 5J13C 3P0VL 3MRBB 4S2SA 3ULSB 1YEKH 3AT8A 4OJDH 4QRTB 4DESA 4IEFB 5KJRH 4ELMA 1HZKA 2W0FA 3D0VB 1UUNA 4YSRA 1P4UA 4Q9QH 4I1PA 3EH3B 1KXHA 1YHPA 1NBQA 1U58A 2GAZB 1ZS8A 3W0WD 3QUZD 4XP1H 3U9UB 1IGTB 5FO9B 3EYOA 3E38A 3S96B 1QBBA 1LWHA 2N01B 2FJHA 4P5SA 3CFBA 3CFMA 3PXJA 2DM4A 4FG0A 3EBGA 4U6TA 5CIPA 3GBNL 5TDNB 3BRFA 1B4RA 1ASPA 1CK0L 4NO0A 2EEXA 4KJYB 1VKXA 2WNXA 3VI4A 4JDZB 2E7BA 4IKNA 4Z7OB 1FNHA 1BFSA 5HHPA 5I23A 1J0HA 1ZK5A 4PWJA 4JFHD 1BAFH 2WMPA 3MTRA 4TQHA 4U05A 2CKBL 3L4CA 1UUSA 2XA8H 1E9PA 1AO7A 2EEDA 3DX6A 4RMVA 2BSRB 3AZUA 3P3RA 1CI3M 4MD4A 3C60D 1BP3B 4AM0Q 4YR6A 2VLRA 2IGFH 1MIEL 2BJML 5EFIB 4X50A 4Z3GA 1I85A 1BIIA 5DEFB 1QSFA 1HHGA 2ICEB 5E9DD 3CFDB 5IB2B 4YHNB 1SLWA 4DVRH 1DBML 3LKNB 4V2CB 1J1XH 3KLAB 5F0PB 3VFVA 4B0MB 3HLAB 4KX9A 4AKOA 3O6KL 3WGVB 5IW1A 4OZGB 1E3ZA 1TTBA 4YE4H 4EN3A 2HKHL 1MJ7H 3WFHB 4PTUA 1A47A 1NCIA 1EK3A 2IH3A 1SJXA 4FLSA 1HSAB 5GISH 1UD8A 1DLHA 1KG0B 5FCUL 3UROR 2VZSA 5AUMB 5IUCA 2QADD 3N40P 3CK0H 1N9PA 1WC7B 2BNUA 1XCQA 2PXYC 1KCVH 3IPEA 3LPFA 2XG4B 3G04A 3H7BA 3SYOA 5MEQA 1QKZL 2Z34A 5HJGA 3NRQA 1EUUA 1CIUA 2X4RB 4Y2DA 4ZUTB 1RJCA 5JW4N 1F3DJ 1RJZA 1TTFA 1KV7A 3D2UA 4YUEH 4ZYKA 3QIBA 3ZRFC 5J1AA 3PIQA 1IEAA 2PYEA 5AAMC 4TTDD 4YPJA 4YAQA 3KBEA 3P0YL 3VYPA 3GSXB 1GC1L 2BXZA 4AE0A 4WO4B 4P5RA 1MHCB 2JCWA 2KC0A 4PJEB 1HI6A 4X0NA 2QT6A 3NG5A 4OZHF 4BH8B 4QT5B 4E9TA 4UDUB 5IBTL 5TD4A 2PR4H 3DNKA 3HPLB 4BQ9A 1QFOA 4ZS7L 2I26N 3SQOH 1DQVA 1U33A 4G6MH 3ARDC 1RL1A 5IW3A 4UIKL 2IPTL 4WI0B 1KTJA 2EO7A 3P30H 2X1QA 1ROCA 2ZCKH 3FQRA 2D7TL 4XN2A 2HH0H 3Q5OA 3ZHDA 1ZY9A 1KTBA 4K5LA 3MV7A 4YHIA 5CHNB 2NSQA 4OQTA 3HG5A 1SBSH 4GRLB 1P6WA 5CINL 2FBJL 2M2DA 1T6VN 3O2DL 3BHBA 4OZFB 5C0FB 5GRYA 5F9JA 3L3OC 2XWZA 4I8DA 2HRGA 3DX1A 4RGMB 4ANWA 4I0PD 5IM7B 2WUBL 5ICZA 4HIPA 3GSUA 3FB8A 1OTTC 1E4HA 5I1CH 4E42A 1DE4B 1EGJL 4L3AA 3BD3A 1MWAB 3H9ZA 4R5VA 5BW7A 1PLCA 3JTTB 4EIGB 6PAZA 1AS6A 4N0FB 3TN0A 2DJSA 4G6FD 3ZU8A 1MG3C 2CGYA 1Q8MA 3RVXC 1TJMA 2GFBA 1KYUA 1CIDA 3V4PA 1EHNA 1YEJH 5AKVA 5K39B 2EJ1A 2Q7YA 5FUOH 4XO3A 3UP1A 4C58B 3D1MC 4EXKA 4LPTA 4PJIB 2YGOA 4PY7A 4E41B 4I7ZC 5D1QE 1ITCA 3L3GA 2AJZA 4GXVL 4U1SB 4MDJA 2W07A 3MLUL 1J1PL 3MODH 3KPMA 5F3BB 3N1PC 5TH2B 5C08E 4YHPB 2DWDB 2VZOA 2WVVB 4NFCA 1YEIH 3P3UA 3GMMA 2XX0A 1QZNA 3H42H 5BV7C 3DGGA 2F74B 4NENB 1A4CA 3LHPH 4NP4L 1NL0H 1UD2A 4FKHA 5GJTH 1CLYL 4LSTH 4WJG3 2C3VA 5DLMH 2NTFA 2SEBB 4PJXF 3CDYA 5I16A 3I3EA 5LQBL 3LDBB 3BMWA 4F33A 3FQXB 1G7MA 1MCOH 1E6JH 4HCRH 2HMIC 1HINH 1EFXA 3OAYH 4K4KA 3V0GA 2XA3A 4U4IA 3SOBL 3UBHA 3JYCA 4CRPA 4PLOB 4NLAA 1RK0A 1VFUA 3CSYB 3CXDH 5MENE 2RAMA 3LEYL 2VDNB 3TNNA 4OLUL 2FZ3A 4X7FC 4A6YL 1TJGH 1VHPA 4JFEA 1CR9L 3PNWB 1XV8A 4W93A 4C4KO 2VDLL 3BWUC 4N0YL 5HVGB 3SGKC 5D1ZC 1BOGA 2CPCA 1DR9A 1H6TA 1KZYA 3MO1B 1P1ZA 2E9WA 4JJOA 2WO2B 2XZCL 4L9DA 4FQXB 1NCUA 3WFBH 4G71B 2DYPA 3PGFL 4OZIE 1EVUA 1DJWA 4GW5B 2O5XH 5CD3A 5IBLD 4LCWE 4YSAA 1DVSA 3FQUB 3I75A 2VL5A 4I87A 4DUXA 1TFHA 2CG9X 1BREA 1XGQA 1IBBA 1JHTB 5ENWB 2NYZA 1MFEL 4ZTOH 2EYTB 1QBLH 1KCUL 4OV5A 1TZGH 4N87A 4TNWF 4M1CC 2AQNA 5E8DH 3TJEL 2X0UA 2VUYA 4M61A 3RFZA 1F18A 2IC2A 4X6FB 2NY1C 5TF1L 3IMBA 4JRXD 1E3FA 2C34A 1EUTA 3S88H 3QXAB 4AW7A 2B1HL 5C6TH 3SDAD 2PWGA 3WNLA 1NCTA 3BFOA 2MEJB 5IJVB 5F88B 1G7PA 1JP5A 1XMWA 5FA3B 3O6MH 1T1WA 4FA7B 4PWFA 3B9KD 4F1SA 4NO5B 3LPGA 5KSAC 1LEGA 5E1IA 4LPCA 4KJQC 2HXAA 3MLZH 5E1AA 4G42B 5CXPA 2YUXA 3QORB 1E2WA 5DRZB 4AEFA 1O9VA 1SMDA 4M8QA 2X4TA 4U7KA 1PZ3A 2BVOB 1E8YA 3HZVB 4JHZA 1AVAA 3LH2H 5IJKC 4HCFA 1P84J 3T8VA 3T8MA 4AXWA 4B9ZA 1PX4A 2F58L 3ATAA 4DW2H 4NPYB 2R2BA 3NSFA 4HKZA 3ULUF 3SE4C 2Q8BL 2O1AA 3B37A 3QDAA 2AJUL 2LLGA 3NCEB 3E6FA 4EIZC 1G9ML 1BQHA 1LO0L 4FQ1L 1ZEAH 4KDWA 4X6BB 4RGOL 4CGTA 5GRJH 1N68A 3G5WA 5B4MC 4OH2A 3O81A 2W8CA 5DRWB 2HJKB 3BGAA 3HRZA 4IU3A 5C0RH 1P84K 1CICC 4KAQH 2DQDL 3MV01 2BIOA 4QRFA 1B6UA 3T0EE 1OLZA 3FFDA 3AQDA 5DVLA 3RVVC 5GGRB 3ZMNA 4APXA 5GGVH 2IWFA 4WJ5B 3UC2A 3OXRB 3M17A 4M7ZC 5LGYA 2NNXA 1AXSB 2NUPB 4IRZH 4WEMB 4D2NA 5C2BH 5F3FA 3RWFA 4NNYA 3CZGA 5IHBA 4KU1A 3TTYA 4DKDC 3K2MC 3S5LB 3BEVB 1FYHB 1HILA 3S7GA 1QW9A 5E5MB 3BISA 4A2DA 4IOIB 3WY1A 4UTAH 3GFUA 2AEQH 3CLFL 1RUPH 4GFTB 4N2AA 3ZTJG 1B4JL 5BV7B 4G43A 2AVFA 4JO4L 5ERWA 4BQBA 2H5UA 3O6FB 3QFJA 1WTGT 4IRSB 4M5ZL 3VTTA 3BX7C 4CVWA 2H41A 4PVMA 5HYQB 1PZSA 2BDNL 2Q2EB 1M4KA 3NP4A 4HIQA 4YDKH 1NMAH 1LMIA 2B1AH 3FTGA 5ITBL 3TP4A 1SF3A 2VXVL 4FTVE 2HRPL 3SDXB 4OVUA 3GKZA 2G9HB 3D34A 3HB3C 3S3CB 4AUUA 3DUSA 5KWYC 2VM4A 4JY4B 1W0WA 1C1EH 2PKDA 4GW1B 3B9AA 2W91A 3BGMB 1U91A 2UYLB 3P4LA 3V6OC 1ULVA 3BH8B 1UXSA 5K33A 3N06B 3TFBA 3ML8A 4K8RL 3WUWG 1BVNP 2VRQA 4J6RH 2UWEA 3VD2A 3UDWA 2BSSB 4G1EA 5E4IA 4H0GA 1T6BX 3APDA 3GBML 2ZYRA 1QI4A 1PVHA 2EDKA 3NJFA 5DGRA 4HK0A 4BZ2A 1VESA 4K3EH 1IM9B 4XBMA 2NY5L 3W2DH 3LH8A 1FFTB 3FO9A 4PW3A 1T5XB 3AS2A 3OJDA 3GMNA 3HFMH 5HDBB 2CO6A 3I2CL 2JK5B 3SQBB 3K5SA 4N85A 4UU9B 4G7YL 1IBGL 5D7LA 4GUQA 2DQCH 4NDMA 3KXFE 4ZRGA 5BJTB 2Q8AH 3WS3A 1FE8L 5HHOB 5E2TH 5D6DC 5JW3H 3VXRA 2VQ1B 1XXDC 5I76B 1NCHA 5DZLA 1KIRA 1AQDB 1MH5B 2WZ0A 1AR1C 1LXMA 1XR8A 1U3ZA 1FNSL 1R34A 1TZ8A 2XWBA 4NM4L 4WW2C 4WO4D 2QEJA 1X3DA 4UNIA 5D4IA 4YVNA 5E2VH 2AS5M 3IDJB 4J4PA 2BVQB 4J2QA 4R2GB 4XNQA 4FI7A 2IPKA 4NQEA 1TTCA 4LEBA 3U30B 2K6WA 5FGSA 4JO1L 3U0PB 2MNJB 2OXHA 1NGXB 4Y16C 1WCBA 5JQHC 3QQXA 3WTYA 1V5JA 4O5LL 1BJ1J 2H2PD 2B16A 1HCYA 3EXLA 2Q7AA 4JL2A 4NKDA 3BI9X 5FYLL 2GIMA 4Y4HC 3LZRA 5DUBA 4JO3H 4ZO7A 4ELME 5IQNA 4K94C 2PWFA 4WV1B 4YBQC 1F2QA 1QNZL 4OFIA 3RWGA 4N86A 4TV3A 3WNNA 1U8MB 3EDEA 1SXBA 4F91B 1SDYA 4M5SA 4JLRA 1PBYA 2YPLB 3QISA 4LLMB 2EIMB 1CICB 1H3PH 4A7VA 1OAQL 4AH2B 4YHZL 1PY0A 3JWNG 1VAHA 1UG9A 5T1MA 3QJHA 3TO2A 4BZYA 2OULB 1QRNB 3H9YA 3X13A 5CJ5A 2X10A 1AR2A 3EFDL 1EH9A 1YG9A 3QDGE 3RYMA 4PGCA 4JFFA 3WY2A 3CFNA 4ZFGH 4TQIA 1SXAA 4N5EC 1A8ZA 4KQ4H 4M5YL 5T1LA 4Q56A 1F3JA 3DC0A 1AO7E 1ECZA 4G9FA 3HE6C 4XP5L 4U1KA 1M05B 4XNAA 1HSBB 1N4XL 5DT1L 3FC8A 1M71A 3QGVA 2VLRE 1Z9NA 1MRCH 4ZMAT 1QSFE 3O0LA 5JA9A 3GD1C 4QO1A 4PUBL 1P7BA 1CFQA 3HB3B 2NY6C 3MLSL 4OD2A 4J8RB 5TDPA 1DEDA 2Y2YA 3TBSB 3MRLA 2F7IA 5D6CB 3IXAA 4MA8L 5DR5L 2YN3A 1K8DA 4MAYA 4MQXD 1MWAL 4OQ1A 5FWQA 1MW0A 3AUVA 2J2ZB 1KCBA 1CBVH 2G3MA 3BAEL 1JHLH 1NKGA 2WK2A 1MCJA 1X9LA 2VLKB 4OGAD 2XLLA 3FMGL 5GZOD 4QHNA 4NQSA 2AVGA 3ES6A 1EHLL 4N2OA 4ABQA 2F6AA 4RA0C 3KLHC 4KTEH 5IMOB 1ZVSB 1NCJA 4GW4A 4HDIA 4FQXD 3GIZL 4Y2NA 1J9RA 5IVXA 2QQNH 2RCSL 2PYEE 4PJHB 5EZIH 3GEFA 7CGTA 1IBDA 5I6LA 3H55A 3I6KA 2JXMB 2J25A 1UWEL 1JZFA 1QVOA 5GGQL 2XVLA 5D7JA 4OLXL 4ZMOA 4TUOA 3IMTA 1QUPA 1ZHBB 3V5DA 4AQZA 5BMFL 5HGBA 1NQBA 4ZMTA 4DO6A 4LGSB 4U7MA 4J3OF 1EBAA 2A6DB 5I9QC 1OKEA 2HN7A 5E6UB 4OFQA 1OE1A 3MNVB 4TUJA 4F7TB 3AADB 2Z4QA 1VPOH 2HKFL 3PABB 3E3QC 1BQSA 3MV7E 5J6HA 2KT6A 3G08A 5E08L 3DX9A 1XH2A 4Y16B 5DQDL 1IKFL 4TVPL 3M8OL 5KBPA 2BSED 1VZGA 1NGZB 2IBZX 3I9AA 4D9LL 2XC8A 1E4WH 4R3SB 1CD1A 2VDOL 4X7CC 2VR3A 4Y4HB 15C8H 4I5BA 5EO9B 3VSQA 1GGCL 4XN1A 2PYFB 3DJZA 3F64A 3Q2NA 3QORD 4YK4C 4R7VA 4PV9B 2ATAA 4JMXA 4DVBA 4QY8A 3MRHA 4TNEA 3DO7A 3C8KB 3GWJA 4DP8X 3GJFH 1PLBA 3Q43A 2ZCLL 3WJMA 1NAKH 4BFIB 1JYWA 2H0PA 2E9IA 2YD5A 3EYUH 5GGTL 3K3QA 4HPOL 4FNLH 4DOHE 8PAZA 4BXVA 2V3DA 3TS8A 5DJAB 4L4VE 1TUPA 1KJMB 4HWBA 3MXVL 5AVWB 4O2CA 3H6AA 3UMTA 3KYKH 3QJUB 1WZ1L 3SDCA 4BELD 3LTVA 3Q9QA 1OCRB 2XV6B 4PBDA 4EN2A 3Q1EA 3QZWA 3GXIA 4OZ4A 4NJ9L 3WFEH 3ILQC 3AQXA 3WL9B 2L0DA 4GY4A 3S5YA 4FFZH 5KN5B 1P2CA 3F3HA 4NAQA 3UAJD 2VITA 4W68A 4BA0A 5BRPA 4FYTA 5J6GB 5LXGL 4YHOL 2UV3A 4K23L 2DEYX 4Z18A 3T3MF 5FYJL 2BOCA 3O6FD 4JQVC 4U1JA 4IRSD 2B59B 2QSCH 4C4KT 3IVKA 4PJGE 4XC1H 3ZKQD 3NACH 4CILA 4A37A 4CSTA 2Q5BA 1HESA 1LK3L 2LABA 4JFXA 4JFEE 3ZKMD 4CMMA 3T4AC 2CHXA 1FFOA 4RX4D 1KTDA 3L5HA 4LARH 3KLKA 1YEHL 2NYYD 3UO8B 3BWAA 3MR9A 5KBMA 1YECH 1BG9A 4MVBD 3UYRL 2W5PA 3O0RH 1DVUA 1WIPA 3U4EA 2WYIA 4JM2D 1UZ8A 3TESA 2ITFA 3QUYC 3MRDB 1JN6B 1UYWH 1GCFA 2EDNA 5AKTA 4KKRA 4B53A 4JB9L 5B1AB 5IOPB 1AOZA 3ULVC 1I7UA 3SY6A 3H6JA 4GMTH 1K5WA 1KCRL 1JNLH 4HU8A 1A0QH 3DETD 3O45B 1DL7H 3DKHA 4UQAA 4F8OA 3SYAA 3ROLA 1CLCA 3ZUCA 1H8NA 1DO5A 2CA4A 1QO3B 3ATFA 4OIIL 1UVQB 1IGFL 2BIMA 3QPXL 4NT6B 5T3ZL 1MCKA 2F19H 3BPNB 3L9RA 1WEJH 3VFRB 3GHEH 3ZLQC 5BV7L 4BXSV 1M57B 4AEIH 2D03L 3C8HA 5IW6A 3M6DA 5E8PB 5CAYB 8FABB 1V3LA 2YD6A 4U1IA 1T1XB 3A22A 2ZX7A 2GB2A 2EIEA 5J06A 1V7MH 3CNKA 2K0RA 3OX8A 4AZ8A 5LGJB 1NH6A 4U33A 3TVMB 3FL7A 3OKMB 4ODTH 5GRVK 1AY1H 4LLYA 3PV7A 3CFIC 3UCQA 1PNCA 1CF1A 3D0LB 2XWCA 5CJ8A 2VMJA 3BKML 3PL6B 1XGTA 1AKJA 5I1DB 2NNAA 4R2GD 4JPWL 1IGIH 4OI7A 1UD3A 3RTQA 3K4AA 12E8L 3UH8A 4YJZL 4L37B 1BEYH 1I9IH 4YK4B 5GZND 3CZFB 2NY0C 3NT0A 3BQUA 1UXMA 4DEPB 5KBNC 1Q9OA 2LR4A 3EO9L 5E4EB 1OHQA 2YKKA 3LEXB 3IXTB 4MX7B 5AVRB 1A9BA 1ZJBA 2BVPA 3HHSA 1RXLA 2VGLM 2X3CA 4UZGA 1X5AA 2A6KB 1JFQL 3G9AB 3FU8A 2YQ2A 3KBFA 4LVNB 4WFHE 1R3IL 2K6ZA 2Q76B 3BLBA 4K9EH 1MJ8H 1DUYA 2VAAA 3PWNB 4OF3A 4YFLF 5FV2A 1M7XA 4ZD3H 2YPLD 1NLDL 1CICD 1NPJA 4UM8B 4HOMA 4FZEL 1GHFL 4HWEL 4FX5A 3BH9A 3VFNA 2VWEE 4LCIH 1RPKA 4ZW8A 3M1BA 1JCVA 4IJ3B 4XCNB 3SHSA 5MP6L 2W65A 2J1WA 1QRND 3GBDA 4QRQA 1R5WA 3QFJE 4PB0H 3VI4F 4C55A 1OAZH 1GKEA 1L0XA 1LILA 2WZPD 3IAQA 2FDBP 5I74C 2G75B 2MSPA 2DL2A 3EJZD 1GMIA 3S3JA 1QHQA 1IVLA 1TQSA 3ARQA 1GL4B 3DV4A 4X5LA 2FQEA 3V0HA 5BZWA 2YD2A 5FUZH 5IFAH 1KPUB 3ARGA 1E5AA 2EVGA 2X2YA 1GYWA 5KANI 4X5XB 1JUFA 2R7EA 4JRWA 2QKIA 3DO3A 3HB3D 1ZWIA 4LU5L 2UWEE 4LEXH 4YXHH 3ATDA 3MRNA 4UWQB 4XX5A 2VLMD 4JN1L 1LYQA 4F80A 5I6XC 3UJIH 5JPMB 1DVFB 3ME0B 4NUJA 1D5RA 2L8AA 4D9QE 5C0AA 5IJDC 2CSPA 4WEBL 1F41A 1NLBL 1BQ5A 5JIMA 2F7PA 1P7KB 3QUYB 5L88H 1YA5A 4LK4A 5JNYB 3HI5L 1Z3GL 4GKLA 4B7LA 1Z5LA 1SPDA 2BS9A 4D0CA 5D7LE 5FHAL 3SPVA 3VI3B 3KL5A 4P9ML 1Q72L 2J72A 1GOHA 1MI5B 2ZUVA 1SMAA 4LCCB 1XEDA 2YWYA 3WE6A 1N19A 4MJIA 4NGHL 2DY2A 1YJDC 4Y4FA 3UYOD 3L4XA 4U4BA 2MCMA 3KGTA 3VXRE 4GQ9H 1AH1A 2Y5TB 4HXBH 1NEZA 2IOMA 5EZLB 1UM4H 4MXWL 5E0FA 2F18A 5TE6H 1Z2KA 1VSCA 4ABWA 4F1ZA 1S3KH 3SJVA 2WIIA 5AW0B 4Z7VA 4XN8A 3VFTB 4NYLA 4UM9B 3QEUB 5DMGC 4MMYA 6TAAA 2P45B 5FO2A 1J5HA 5GRUH 3BWUF 1KV3A 4JRLA 2X4QA 1HT6A 4NQEE 2APXA 4NWTL 2QPUA 3QWRA 5C7XL 2BM3A 3K6IA 3WNKA 2J21A 4R7LA 4YFDB 5I8OH 3NCCB 2EKSA 5CEYA 1TVBA 3VE0B 4N0UA 2KUTA 4MKMA 1FGNH 3VH8B 3X11A 1AACA 1JDAA 3FH5A 4PJDA 4H0LC 4YC2C 4CUCA 4IBZA 2COQA 3ROOA 1KGIA 3BFWA 1UQSB 3FCSB 4HT1H 4GIPD 1RK1B 4PRDB 4Y16D 1RUAH 4Y5VB 5EOTA 1BCIA 1OGPA 2IAMC 3OPZL 5CJOH 3K5RA 2VJXA 4XH2B 4ANXA 1JRHH 4AJVA 5A6IA 2VL4A 2YMXL 4XVSL 3KS0J 4XNZC 4APQA 4CKQA 1A25A 3I9PA 3NJVA 3QZNA 2L4OA 3EKCA 4NX0A 3QC5X 1I7RB 4TLSA 5LNGA 3CVDA 3QWOA 4KPHL 3LS5L 5FPIA 2A77H 2AJXH 3BMVA 1Y18B 2UXFA 5AD0B 5KSBA 1OT1A 3RZCA 3NRFA 3DX8A 3G3LA 4WW1B 3TBTA 1SY6A 1YY9C 4AKPA 4PWGA 4B6ZA 2X9YA 4JFFE 2CBOA 2VZ3A 3PJLA 3UZVB 1ANUA 5L6YL 1OZTG 2J56A 1DVZA 2RMNA 3X3GL 2X4PB 3WDIA 4AMXA 1RV6X 4AYID 4JKKA 2VMDA 3G5XB 2DEWX 4G9FE 3D39B 3EO0B 3KDMB 5DJDB 2BHYA 3BAWA 4LLQA 4QCIA 3WN5A 2RQEA 1OD9A 1JNJA 1IC7L 4DGVH 3MXWL 4JFQA 4N5ED 1QPPA 4UDTA 3N5AA 4YPGB 2UZXB 1CGWA 5HDOA 2Y23A 4PJ9C 4WO0A 2V3EA 3GPSA 4IKKA 3QIWA 5ABDE 2OTUA 5T1KA 2WXPA 1SYVA 4JKPH 2HT3D 4GKSA 1HOCB 3LSOA 2FHFA 3Q01A 4K94L 4YDIH 4Z8FH 2BWDA 2OZNA 1MZYA 2F7QA 2XWTA 4JDEA 4X6DA 5GSRA 1W80A 3OB8A 4FA6A 3Q8BA 2EH8H 5B3JF 1EAPA 4LFHG 5FGBA 4G8FA 2Y07H 3NJLA 3UGEA 5IZ7A 3T1FA 4W9KC 4IMLA 1R17A 3FQTA 4IRZA 1RZJH 4YXKL 4BQ8A 4MNGB 4FC3E 3SPJA 3U7YH 2JB6B 1OK0A 4AI7A 4G7VL 3TASA 3AXLB 1OM3H 1D9KA 1U8JA 2VW7A 3TBWB 1B9KA 5IVXE 1RMFH 4LLDB 4LAQL 5E7BA 1IQWH 4LSQL 3K6OA 2C7UB 2BFVL 1A7NL 4R7XA 3VGGA 5KVEL 1AG0A 4J39A 4L3EB 5CJQL 1FFPB 4D0BB 1UEMA 4LVHC 5HY9B 2OYLA 4XAKE 4JDVB 4N68A 4YBHA 4XN7A 1HE8A 2WGXA 1XTMA 3BRDA 4OKDA 1RVFH 1ZTXE 5A2CA 4NZDA 5DQJB 1EXUB 1OP3K 2CIKB 4XRCB 2DQUL 1A4KB 2VC2H 3R4DA 2NRDA 5I1AA 1IO4C 2EUZA 4M6NH 3GXTA 1FVEA 2PPAA 3EYFA 1HHHA 4XNMB 3W1ZA 3DPDA 4LSVL 3RX9A 1RFDL 2MOQA 5CEZH 4BK5A 2A74B 1H8SA 4N2HA 4B96A 1UWGL 1TTUA 2GSGB 3TVMD 1GZPA 2QTVA 4MJ5B 3MA7A 2DWYA 1HCVA 1MOEA 1F4HA 2IO5A 3Q0HA 4XO4A 4BCZA 5CM1A 4L48A 5CD5D 3DROB 2ZX6A 1KB5B 3PL6D 3QQ4A 3I3DA 5BQDA 3LXCA 4OCRL 1DHKA 4BQCA 1A5FH 4QLRA 3TBYB 2ZP0T 1ORQA 1T7XA 1CI5A 4JHAL 2HFEB 3NFNA 3BPOC 3NSXA 1S9WA 4HS8H 3CH1A 2JJUA 1MF2L 3O3EB 4J3TA 4MB1A 3X2QB 3LNFA 2BY0A 1E27B 5D96C 3IJHB 4P23A 3SE9H 3KJ6H 4WW2F 4RNRA 2ARJA 3CU1A 2FATH 3QFGA 5CILL 6CGTA 4N26A 4KH2A 3ZVVA 4KMQA 3QIUB 4LEOA 5CP7A 3CSPA 2XKNA 4KX7A 2KDYA 4JFDB 3ABMB 4YSCA 3IJSB 5J4MA 1CTNA 4JO2H 5CEXA 3AGWA 3KPRA 3GSVA 4N8CH 1SFHA 3TBVB 1TSRA 5C8JA 1T0NB 5A16B 2ZSWA 1VEPA 1MJUH 1A9EA 4PCTA 4PBWD 1AHWC 1KPRB 1HEZB 2WAQA 3D69A 1T2JA 3QI9C 1LO4H 1NMCC 3GF8A 5B1CA 5LBVA 4GKNA 1XF3B 1A6AA 4U6HA 3F58H 4AYFA 3PDDA 1X7QA 1T0MB 1TT6A 4QTIH 1J0IA 4LKXB 2MTAA 4LSPL 5IB3B 2WIMA 4RFNC 3F8UB 2NZIA 4PWIA 4RRPG 1NAMH 1OGTA 4XMZA 1ZLSH 4FQLH 1NCBL 2JJVA 4MBOA 1IBHA 2C9VA 2D2CC 4JANA 3HC0A 4ODWA 4GOSA 2VLJA 4I9WD 4PRNA 5ILTH 1G84A 4P2RD 3BFQG 4JRFA 2F5BH 2ZXBA 3MOBH 1EJ8A 4LCYB 1XH1A 2A1WL 3VRJB 1SDDA 4R26H 5J3HC 1IAIH 4LRNL 1WZKA 3CLWA 4GIAA 4PGBB 1SNRA 3QRBA 4ZPTA 1BHGA 1DVFD 1WYJA 3JVGC 4UT6L 4XO9A 1XGRB 3TA4D 4ONFH 1YUHA 1KGCD 2FD6H 2XPGA 4PWHA 4UBDC 3ZOAA 2VUOA 3QUYD 1C5DA 3LVEA 1DQKA 1OCOB 2HTLD 1ETJA 3VFMB 4NC1C 3IDUA 2EXYD 1J87A 1XGPB 4FFTA 1FG9C 1QR4A 4JG5A 1GJIA 4PYGA 4MYPA 5HJ3A 2CIIA 5JPNA 3DRTB 2FUQA 1CTMA 3MRRB 2KKQA 1FLTX 2Y36L 5LN4A 2DOCA 1B3IA 3C6EA 5FDWB 2ZCHH 2DQFB 4EBQL 2YA2A 1G1CA 32C2B 5F7EH 4ZODA 5BQ7B 4L4TB 3NSYA 2CAKA 2A6IA 4IDLA 1S7TA 4I3GA 5F1NB 2X05A 4UM9D 1S46A 4P5TC 5DJ2B 4HISA 1A7PH 4P9HH 1C8PA 5IBUB 3RLSA 3MGOA 3I6SA 1ZT4B 3EGSB 5LCVA 5E6IC 2H0FA 3BT2H 2L3BA 3QZLA 3WXVL 4NN6C 3WIHH 5KYWA 2WCSA 2P8PA 3V4VH 4AVIA 4FF9A 5C2UB 4PRAA 2QGEA 3EJTA 1JS4A 3CZNA 4YHKL 4MD0B 4FXLA 4HUWB 5AVZB 3GTTA 4R83A 3QJQB 4HAGA 4YBLB 1IU1A 5JDSA 2XFXA 3VXPB 5I30H 3ULVL 2YBGA 4EI0A 1RU9L 1I8KA 1BFVH 3BPOB 3K81A 3PFQA 4FQQB 1NIAA 5L9DH 1J8HA 4Z7QF 2GSIB 4KI5C 5ETUA 1C5CL 1Q0XL 3EOTL 3IDIA 2NCMA 1MLBA 3DXAB 3MCYA 2JIXB 4IHOB 3MLRL 4DZBB 5ID0B 2FJFA 3BO8A 5FO8A 1AZCA 4U3SB 5B21A 3SCMC 4ONOA 1HIMH 1YNTB 2B39A 3KPSB 1E4KC 1DBJH 1KGWA 4MAZA 2P8MA 4ZSOB 1XCXA 4HVBA 2XBZA 1M2VB 3LZLA 3D6GA 5HYSA 1A3LH 5C0CA 4WU5B 1GY2A 4QR7A 5LB1A 2BC4B 4KVPA 1R0AH 3ZTEA 3II3A 5C0GB 4O00A 3SDDA 2Z8WC 2KQNA 4DHLA 5IG7B 3GMPA 1AHWB 3PNRB 2GPZA 2R0LL 4N90E 1SZNA 1OSPH 2PTTA 2RR3A 1A7OH 3K8KA 5IFHH 2AV1A 3D39D 4LF3B 2JKNA 5ICXB 1L4IA 3FFCD 5HP5A 5GIRA 4MYWB 4WFFD 5EMYA 3S37H 1MAKA 3RY6A 3D3VB 3MMEB 1U3HC 5IVZA 3GJFA 2JVUA 2UXVA 2E7LA 4WUKL 4JQIL 1GMEA 3L48A 1BZ9A 5C7ZA 3JVFC 5DJXB 1MNUL 3ZQWA 1WS7A 5JIQA 5C0AE 2QR0B 5I1IL 4F7EA 2XNAB 1PEWA 2NY7L 1EX0A 3NA9L 2MOVA 5D1QB 4F93B 1Q0EA 5A1AA 3NJHA 4HXAL 4L9LC 2J1XA 5DZVA 4QLWA 3RIKA 5EWIH 1H3XA 5C08B 2EYRA 1DQMH 3VWJA 4AEEA 4UZUA 5DRXA 4FQPA 4MJIE 3RI5F 4BHUA 1OTSD 1HQ4A 1WBYA 3IRCA 3BCDA 3L4VA 4EI5D 5AVVB 4QRUA 4XOEA 4TSAH 2X5PA 1WIOA 2X89A 3P4NB 4BD4A 1XIWC 5DC2A 2NR6A 3S4SG 2JKLA 4TSCH 3SDYL 3SJVE 5D5MA 1HXMA 4Z7VE 4L3ED 4AITA 4OM0L 3L16A 2WWMC 1GAFH 5AG8A 5BUPA 1JI1A 3L5JA 1CF8H 1UH4A 3FU6A 5MENB 1IKNA 1AD0A 1EBPA 1J0KA 4HS6A 4ILDA 4KDTA 1LO3L 2XBDA 1RP9A 3H9HA 4DWHA 5MHSD 1IT9H 1T20A 1WAPA 3O11A 2XA8L 4UAOB 3ZQXA 1YYMH 5DYOA 3NCJH 4XP6L 1GYAA 1IC5H 1BBJA 2G9KA 3DTDA 4NM8H 5H37A 1GTFA 1RJLA 5I8CB 3RGVB 5E6IB 1COBA 3MREA 4KZEH 1EXGA 3RL2A 1INQA 1X5IA 3RVTC 4OZIB 3W56A 3QQ3A 4X7TA 4ZTEA 4NWUH 1FIGH 3TJPA 5I1GL 1N7MH 3IFPA 1XT5A 4B9YA 1J1XL 3A24A 4FHJA 1PG7W 2JNZA 4PS3A 4AMKH 3QFDB 2WINB 1NUFA 1JF6A 3LD8C 1RH8A 4H8PA 4YE4L 5DJ8A 2XT1B 1MFDL 3BZDA 4TL5A 3A6BL 2YQGA 2ZQKA 1S5IL 1A2YB 3UO1L 5JOPD 2FGZA 3F6LA 5KSBE 3OLGA 1U8NB 3GXNA 2A9ML 1YJDL 5DTFA 4X7SH 1UT9A 1E3XA 3CK0L 4H7VA 4ES8A 3QWNA 3SCMB 1GH7A 3S48A 5KAQG 4ODHL 3U1SH 2FX9H 1AIFA 1KCVL 3UBGA 4EUPA 3KD4A 3BOVA 1H3GA 3LKPB 1NUNB 1T21B 2XWJB 2OXGA 1SN5A 4YUEL 4M1GH 5FM8A 3QIUD 2FB4L 1QI3A 4JFDD 4PREA 2HPTA 3ULUD 4KTGA 2F61A 3ZX1A 3NPZB 4KZDH 1QA9B 4Y4KC 4YNYB 5BZDB 4MS8D 2O6EA 4M4RA 4UANA 3S9DB 3PFUA 2X53A 3D85B 5DK0B 4HIIA 4U1LA 1TQBC 2R23A 4G6ML 1KNOB 2P3YA 4X6DE 3MHZA 3WTWA 4OKVA 4WAFA 1CFNA 2A0LC 2VZUA 3L3KA 4C54A 3DIDA 4RFOH 4JN2A 3T0EB 1SBSL 2QQKH 5CWSB 1YN6A 3TFKC 1UGNA 4NRYA 2Y7QB 4XN5A 2JSFA 4CMHB 5GS2D 1YEEL 3GHBL 4GAGH 5C6PB 2W38A 1QBML 1LM8V 3AB0B 2B15A 4HLZH 5G4NA 3ZBMA 1XGYH 2HVKB 4JY6A 5IMLA 3AS1A 4LDEB 4ZMNA 2F5AH 5AOLA 3EHBC 1KYOJ 3FO2A 3T3MB 2GTZA 3BESR 1XO8A 4NHCH 1P7QA 1I31A 2J8OA 2X7LA 5J1TC 5DC9B 2E5EA 2A83B 3KCPA 2VXTL 2DWSA 3W5MA 2MCPL 1FNAA 5EOCH 4LHJB 3FYIB 3NCBB 3FYEB 5LBSH 3DVNA 3ZW3A 1HJCA 2FECI 3MOAH 3BAIA 1KYOK 3FHQA 1J1OH 5EPMA 5FUOL 1DFXA 5C07D 3QEHB 2NQCA 3RKDC 1R47A 2VM3A 4EXPX 2Y2TA 2A4CA 4NQDA 4J8QA 1IAOB 4A04A 1G1YA 2W92A 2XG5B 4J3XA 1ZDQA 1HH9A 4G59C 1A7RL 1JIBA 3MODL 4NQVB 3WJLC 4XPFH 5KSVB 3P4OB 3IDYB 1T5WA 1YEIL 3LIZH 1IUZA 4WI7A 4MA7L 5EIVA 5FM5O 1OWRM 4CSZA 1U30A 1WHPA 4PY8J 1TQWA 4L4TD 1YYCA 5GJTL 1N2RB 4YHMH 3O41B 1B88A 3GB7B 1F6AA 1ZS2A 4GO8A 1CVSC 2BSCA 5F7DA 4GSRA 5T3XH 1T03L 1E6JL 4HCRL 4PP2B 2I9TB 1W8OA 1HINL 2I32A 3I6GA 4QHLA 2EDYA 2COVD 3OR7A 1QYGL 4M7LL 5DD3H 4XCCL 1KEGH 1GS6X 2P5ED 3CMOH 1ZA6B 2N7BA 2WBJB 3MBXL 2QV2A 3QIBC 3KPLB 3QUMB 4BZ1H 3KXFB 4KGJA 3RHWK 1TEYA 1T1YB 1GGUA 2J6WA 4LOVA 1TJGL 1EWHA 4P46B 3AMLA 5FWRA 2ADJA 5IQ9B 1INDH 3H56A 3L3HA 5IEHB 3FQWA 4G3YL 1JXGA 3EOAA 2BP0A 1I7TA 4XI5C 4X98B 3TYFB 4FS0A 4JPKH 4ZUSA 4KVNL 3OAZK 3GUTA 2OSLB 1F6FB 3VFPB 1UJ3B 3MRQB 2O5XL 1HHIB 4N2FA 3DXAD 3B2XA 3L6FA 2JIXD 5C0JB 2HLFD 1IRAY 3KPRE 4DGIH 5HHQA 1CURA 1P5VA 1OV8A 2JCCF 1U3JA 3DWTA 5DVNA 2J3SA 4CU6A 4HWUA 2IQ9H 4I48B 1QBLL 3GRWH 4AVJA 4HFWB 3VXSB 1A1MA 5L7XH 1TZGL 2VW6A 3KPSD 2ZJSL 5K9QG 3O3AA 3V2AR 5I18L 4OD1H 2VDMB 2XDHA 2YXVA 1E5YA 1QASA 4ZUWB 1RKRA 4D8OA 3DHPA 3TV3H 4K9EC 2X6CA 4ZAKB 5CZVH 2E7DA 3G6JA 4S2SB 4X5QA 1WH0A 5IFJA 5C6TL 4UB0H 1PSKL 4ELMB 2VR8A 2W0FB 2YQ3A 1E9OA 4Z7NF 5BW7C 1OM9A 3O6ML 1U58B 1WT5A 1TQBB 4YLQT 3MA9L 3KBPA 1FZJA 1ZS8B 5SWZD 2OMXA 1BVNT 5H4YA 3EYOB 5HVHB 1LQSR 1MCLA 2FJHB 3JV5A 3CFBB 5CIPB 5AW7B 3MLZL 1OSYA 4M93C 3OAUH 4CJ1A 1GRWA 2VLJE 4NO0B 3D3VD 4KHXH 1Q94A 3OF6A 3MCLL 3ZE1F 3VI4B 1H3TA 3GGWA 3ZT5A 5INCA 2XYBA 3LH2L 43CAA 5B38A 5HHPB 4JUSA 1O75A 3V8OA 3V95A 4KGLA 1NZRA 5ISZE 5AWNH 1PGRB 2WMPB 1HJBC 3EHBB 2VSMB 4H1LG 1A7QL 4M6ML 4XOBA 3LZNA 2VO5A 1W15A 2OJZL 5AAPA 1E9PB 3E8UH 4NUQA 1AO7B 3DX6B 5LDSA 4X5RA 3KE0A 5IVNA 5D1QD 1G7HA 2EDRA 2WUCH 2XXFA 4XPGH 4YSOA 4MD4B 1BA9A 5EF2A 3IU3A 3FU5A 3C5ZA 2QSVA 3HG2A 3MLWH 3ZGIA 3GTVA 2FQFA 4YR6B 2VLRB 4L8SA 5C0NC 5IGXH 4KAQL 5C08D 4ES9A 1BIIB 1GIGL 1QSFB 4MJ6A 3HAEA 1HHGB 2DJUA 4M7KH 1F4YL 4LPVA 3AXHA 4LLVA 3VFVB 2L7UA 4AGLA 1Z1WA 2BW4A 2EXSA 3RL1A 4E9XA 3X12A 5IW1B 3MJGX 4PLJC 4EN3B 2J73A 1E9QA 3EDDA 1OXYA 4M48H 4OB5H 4PTUB 43C9A 5IR1A 3ZTNH 2IH3B 3F00A 2K4WA 3AT9A 3FB7A 5KSUA 4POZC 1DLHB 4UTAL 5CFHA 1BIHA 5MEND 1INEH 2BNUB 2DIJA 5SV4A 2PCPA 3RU8L 3H0TA 2YC1A 1TXKA 1XCQB 3IDMA 4DPRA 5AL8A 2DQTH 3INUL 3RTLA 3G04B 3H7BB 2ZAIA 5MEQB 1MCNA 3L5WA 1IGJA 4FQIL 4Y2DB 4ACPA 3RGVD 2DQJH 2YUVA 2YEZA 1RJZB 3D2UB 4ZYKB 3QIBB 5D93C 5J1AB 4PJDF 3PIQB 1IEAB 1JI2A 1T2QH 1OP5H 4F57H 2PYEB 3WLBA 1J8HE 4YAQB 4I77H 1BOYA 3OG6B 4FABH 1VFMA 3Q7JA 2ED8A 2HT4D 2Z65C 4MNHA 5DFVC 4J6RL 1HI6B 4J3OD 1YUKB 1H5BC 4XPAL 4JUTA 4L2LA 1LMKA 2WOBA 4FGMA 4P3CH 3AY2A 4CU8A 5KVDE 4LPUA 4ZDHA 3BUIA 4EDWH 4PV1C 4JFOA 2XQYG 2YHGA 3T0WA 4ZFOL 1MCBA 4AZUA 1OHZA 3HFML 4OJFL 3FQRB 5JHBA 2E0PA 5F9DC 5EEWA 3MV7B 4YHIB 4PGZA 5TE7L 5C0CE 4PWKA 1QWUA 3SCMD 2VJ0A 3AWGA 3OKNA 2VDKH 5C0DA 5DJ0A 3TZVC 4NKMA 1FO0H 3SE3A 3BHBB 1J48A 2YPKA 2Q8AL 5F9JB 4XPTL 4KJWC 4MA3A 1WSST 5E2TL 4AIEA 5ICZB 1NBVL 5JW3L 3GSUB 3FB8B 3NPSC 4E42B 5I0DA 3IGUA 4AC4A 1RAMA 2AQ3A 3FUMA 1OPGH 1MCIA 2DI9A 4O02H 3TN0B 2ISDA 2C9RA 5IREA 3KGSA 1XX9C 4A2EA 2GFBB 4K2UL 3T6VA 3D85D 3V4PB 5E00A 5DVKA 3EAKA 2YPVA 1EO8L 3T77A 2Q7YB 5T5FH 5JHDA 1NEPA 1PLAA 1SN2A 4HYTB 3UZEC 2P80D 2XVGA 5DHMC 3KHQA 4PY7B 4DOHB 2EECA 2R27A 4NKQB 1EDYA 1E8ZA 2AJZB 3L3GB 3EZ8A 4MDJB 2W07B 3T0ED 3KPMB 3IKKA 4Y19A 4DGYL 2WM0A 2GHWB 4JW3A 2VN7A 3MLXH 2HB0A 2AXJA 4L2YA 3ZKXC 2E7HA 3GMMB 2ERJC 4K5PA 3BLKA 1GSKA 1NPNA 4D8PA 4PWEA 5H2BA 3DGGB 4ODXA 3NUKA 2C3VB 2NTFB 2OW7A 1YPZA 2IOIA 5I16B 5E9NA 3V6ZA 2MHAA 4F33B 2ZG2A 3OPUA 1G7MB 2YO3A 1TJIH 4LL4A 5D5ME 3HRPA 4AJWA 1EFXB 1PZ5A 4YSEA 3V4UL 4JREC 1I1CA 3U6RA 5KUKA 2IDTA 2D8KA 4HOZA 5BOZG 1RK0B 4MQ7A 1K2DA 3CVBA 1EZSA 4XP4L 3TNNB 1SHSA 2FZ3B 2JF1A 3LOWA 5D7IA 3VFWA 4JFEB 2CQVA 3UABA 3EYQD 4L1TA 5KTEH 5EEXA 2JMRA 1BOGB 2RGSA 4HQQL 2AEPL 3MLYH 2LV4A 1K6QL 1PX8A 1P1ZB 3EIFA 4GEJA 5E23A 1B0RA 1QQDA 4KRPC 1E5CA 3FRPA 4H8QA 5CZXC 2ZZUT 2DYPB 3F6JA 3ARFC 1OE2A 5CD3B 1YQVH 3PPSA 2DQEL 2V7HA 3I75B 2VL5B 3M7FB 4WU7A 3KWUA 2R69L 2FECL 1IGYA 1XGQB 4OVVA 2DI8A 1EEYA 1YEFL 4OV5B 1T7ZA 2GJ6A 2VH5H 4M61B 3RFZB 4OLYL 4PJ8C 3A4FA 3PWPD 3PS6A 5D2LE 5F0MB 1T04A 1Y6NR 2BLFA 4PCKA 1CBVL 1D3CA 4H0HB 1N5AA 1BLNA 4PSPA 1JHLL 2WBJD 3K91A 4FFYH 4OCYH 1VFAA 1G9NH 1TYRA 3KXFD 4MJ4A 1G7PB 4AYBA 3LN4A 1NDMA 4X9BA 4NZJA 3T3PF 4IS6A 4QXVA 4P46D 5T33L 1QWNA 1FF5A 1T1WB 5KS9A 3KPQA 4HC1H 4KK9C 4FXGA 4QGTA 5HI3D 4J4PC 1DUZA 1JDDA 1QSVA 1RSYA 3BPLC 1LEGB 3OLIA 3TWCH 4ERSH 5J11B 2M1KA 3SPCA 2PMZA 3OKKA 5E1AB 3ABZA 4GQRA 5DK2A 4DNLA 2TSBA 2KHAA 4M8QB 4YLCA 2X4TB 2GJPA 1G0YR 4RVBA 5JXAH 3W3BA 1B3JA 4AXWB 3WU1A 1IE4A 3QHFH 4FCAA 1FUNA 2Z91A 2R2BB 4YEEA 25C8H 4HKZB 1E50A 4TNVK 3VXSD 2FJUB 3MRIA 3W0WE 3UEQA 3FB5A 1T3FA 2L7JA 2XIDA 5BVJA 1OSZA 2B5IC 3E6FB 2QJDA 3O9WA 1ILUA 2XFGB 1BQHB 2FIKA 4QYAA 4ZAKD 4KKNA 4KI5F 1NA8A 2MPAH 2YSTA 3JZYA 5EZPA 4BFBD 5CGMA 2WD0A 3HRZB 4IU3B 3CSGA 3ZE0B 2HWZH 5AW9B 2HPOA 4OV6F 2RD0A 2OL3H 1ESOA 3FFDB 2HP4A 3L7EA 3NZUA 3CVHA 5DHYA 5CU9A 3G6DH 4APXB 4IRJC 1KXTA 2FNBA 4L3CA 4LASL 5JW5A 5EF1A 4E9LA 4JFHE 3M17B 4IGBD 4JCMA 4URTB 1P4LA 4WKZA 1KJ2L 2A0LD 3HA0A 3Q8CA 3RWFB 1U6AL 3WXWH 4AQ1A 4NNYB 3DARA 1O5DT 1BZDA 3B7UX 4I1RA 1HILB 4NO0D 2NNFA 2XI9A 2RA1A 5H94A 3ZKXB 4ZMPA 1Q0YL 4QF1A 1R4XA 4JFZH 4G43B 2VDQB 1HHKA 5AKSA 3SBQA 5ERWB 3QFJB 4ZBJA 3DJRA 4WNJA 4J3SA 1U8PA 1SDAB 4FQCL 4Z77A 4W4OC 4XXWC 5EORH 1HWWA 5B3NA 3FTGB 2Z8RA 2Y7MA 4DP7X 4EAEA 1AO7D 1MFCL 4QJ5B 1BECA 3MLTA 3FUJA 1XSKA 3D07A 4ZZKA 3DUSB 2WQRA 4YDMA 5EOQH 1W0WB 2HZHA 5GS1C 4NQDE 3FU3A 4FNLL 5F7BA 4ABVA 1U91B 2H6OA 2JJSC 2VLRD 4OSUH 5CGYD 1UXSB 4ODUA 1QSFD 3HG1A 2HT2C 2YKLH 4LXFA 3KYKL 1ZA3A 2UWEB 4WWKC 4CVUA 1RSFA 4G1EB 1Q9KA 4OF6A 1I8MA 2ZP9A 4B9FA 3OMIB 3PCYA 1ZV9A 4HK0B 1AC6A 2R83A 4EN3D 1JL8A 2QGDA 1NEZG 1ASOA 2E3VA 3F7VA 4FFZL 4B9CA 3FO9B 4X80L 2GTWA 3OJDB 3GMNB 3CDFA 3P40A 4LPXA 1EERB 2CO6B 4Y5YA 3G5ZA 5TQ0H 5EU5A 3Q05A 2NW3A 4JE0A 1C7SA 5D7LB 1T5KA 2ICWA 1TTGA 1BXVA 3C2AH 2QSCL 4NDMB 3T2QA 4IK7A 3NIFE 2VR5A 1J9SA 1CGVA 2NY3C 3ATBA 3CN2A 4I85A 3P54A 1XAKA 3C6LC 3FKUS 3WS3B 5I1HL 1E67A 4URKA 3L4TA 4Y2DD 3B5GA 1UFGA 3D2UD 3QHTC 3VXRB 5ABZA 4M02A 3QIBD 4M7JL 4AGNA 1E28A 1KIRB 3SGJC 3F7KA 1XR8B 2PYED 3O0RL 3IGKA 1F90H 2MKLC 4MDRA 2XWBB 2TAAA 2E9GA 2PP9A 2KZ1B 1LP9F 4XT1C 3W9EA 2ZXGA 3ZYJA 2CHZA 5EUKA 4LDLB 4XNQB 4GG6A 1GZHA 2IPKB 4NQEB 5HDRA 5B39A 4GMTL 1UD4A 3K2UH 1JNLL 4BGLA 2OXHB 3N91A 1WCBB 3U7WH 4GAYA 1FZMA 3MNMA 1ET7A 3MNZA 2O4EA 3I6LE 4H8WC 4U2ZA 3EF7A 5F7HA 1XF2A 1U8CA 3FT4A 2P26A 1BVKA 3GBNH 4Z7UF 1CK0H 4NKDB 3HJEA 3V5HA 1FCGA 1R33A 1MJJA 3G6JE 1CDHA 3MV7D 2CUIA 5DUBB 4Z7QB 3NCMA 4NN5C 5DJ6A 3T2NH 4E5XA 1B0WA 1QI5A 1M7IA 2NY4C 4PVBA 4Y8DC 3ABLB 3RWGB 2DW5A 1WD9A 2CKBH 3HFFA 1QLEB 1RCYA 4ZTPH 1KN4L 5LXVA 1BX2A 1ZE3H 3BVNA 3PF2A 5EIQA 4JLRB 2OMZA 2CPUA 4KX8A 5AYQA 5BO1L 4ODTL 1JZ5A 4NUGH 5T1MB 1OAKH 3O4OC 3TN0D 1MIEH 2BJMH 3QJHB 5K69A 3TO2B 3X13B 1P5UA 5HGDA 4PRHA 2OFQA 1DBMH 3BYTA 1IGIL 4QEGA 3IRZA 2VOTA 1THCA 4PGCB 4JFFB 4X83A 5JIPA 3O6KH 3BZEA 1BEYL 3A4EA 1SLXA 1RLBA 5T1LB 4UQ3A 1F3JB 3HMXA 2HKHH 3CHQA 1EA9C 3FTVA 5KJ7E 5LGKA 1A14H 4G9FB 4U1KB 1D7DA 1L6XA 1M71B 3JV0A 5KVMC 1U2YA 3OMNB 4DZ8A 4QO1B 3DA0A 1OF2A 1S7SA 3US9A 1N6QL 1CFQB 5ACZA 5HI5C 5LAPA 4GKZA 4OD2B 3BVXA 5TDPB 2B2XL 1QKZH 1JGUH 1MKFA 1CG9A 3MRLB 2Y9RT 2ZF9A 3IXAB 5AB2A 5LNEA 4FFWD 2CCWA 4J6IA 1UCTA 1K8DB 4MAYB 4HEPA 1XD1A 1SVZA 1TIUA 2GY7B 5FF6A 2JWYA 1EFXD 4P2OA 3MJ8A 2VRKA 4JM2A 4BQ6A 2R4RL 3LMJH 1X5ZA 5EO0A 1OAZL 4CBPA 2P9RA 2BOBA 1U92A 4JFED 1AD9A 4QHNB 4NQSB 5IBTH 2DJMA 2IH1A 1S7RA 3DYMA 3ES6B 1BLIA 4FNUA 4S1QL 2HSIA 3S3BB 1PS3A 3GRGA 4UIKH 2IPTH 4MRBA 3PJNA 4JRXE 4FRWA 1S7QA 4FXKC 1MVUA 4GW4B 4HDIB 4XXCA 1AMXA 3HKZA 5FUZL 1JG9A 5IVXB 2D7TH 2DYPD 4MZRA 1HOEA 4K5MA 1RY7B 4AL8C 3AG4B 3I6KB 4HCIA 2CK0L 1BZOA 3CG8A 1QVOB 5CINH 1L9PA 2FBJH 4LEXL 5D7JB 3O2DH 1QFWI 4TUOB 3V5DB 2XACC 1NCOA 2YAQA 4DP2X 5HGBB 1FHNA 3ZL2A 1U93A 1VA9A 2WCPA 3GI8L 2WUBH 2P7TA 3HEIB 3TBCA 1E5ZA 2Y25A 3TH2T 3DJ9A 4F15C 2HN7B 4TUJB 2FT8A 3ARUA 5L88L 2OMNA 5E8OA 2Z4QB 1KULA 2IQAA 2XWDA 4Z0BH 5J6HB 2PW1A 3G08B 3DX9B 3LKSA 3FUDA 3Q2CA 2V2TA 4JFPA 3LIZA 5CN3A 5CCGE 4HMEA 5DURB 1NFKA 2Z9TA 4MWFA 1ICTA 1CD1B 1SJMA 2KH2B 3ETTA 4I5BB 3D06A 3DOSA 2OX5A 3ARBC 3D8MA 3RTQC 1WFTA 4Z3HA 3LPWA 1IB5A 4AT6A 4NN5B 4HXBL 5DFTA 1JVLA 4QRSA 4GXVH 5HVWA 3C8DA 4MRCA 3MLUH 1S3KL 2NY4B 4JG1L 5E2UL 4DVBB 4QY8B 3MRHB 1ASQA 3DO7B 3WJMB 5DUJA 2OJEA 5D1XA 3W82A 2VZ1A 4NP4H 4UTBH 1KC5H 5JHDE 3DO4A 2IPUK 2XQBL 1D2PA 1MCSA 1FGNL 1QHOA 3BCFA 4GQZA 3QVAA 1LK2A 3RB5A 1T1ZA 5HYIA 1Q9LA 3TNMA 2B08A 1OB1A 3VD7A 3CDZA 3SOBH 3G5YA 1RUAL 3ZZQA 4Y19E 1F0LA 2J57A 3A21A 4O2CB 4X8JA 1VEOA 1MCFA 4WEUD 3SDCB 4NQTA 2EIZA 4MJ2A 3H4FA 4KQ3L 5DHEA 3VXQA 3QO1A 3QZWB 4IBQA 4OZ4B 2QLYA 4JK0D 3SO3B 4FFVD 1YPZE 4HEMA 2Y7LA 3RB7A 1FWXA 3NZHL 1P2CB 2VITB 5GJSL 2XN9D 4QMEA 4U3CA 4LHUG 3SKJL 3PGFH 2V37A 3ZDXE 4BFOA 2BOCB 1FFNA 3CZLA 3QFJD 3PWLA 4U1JB 1JZEA 5SX4I 4AQOA 4JKNA 3BH4A 3IVKB 2AJ3A 3ARGC 2K9UA 3PHAA 3P73A 1MFEH 4JFXB 5D7IE 4CMMB 1ZV5A 4HG4J 1JPFA 1FFOB 5DXWA 1KTDB 4BK8A 5TF1H 3OR6A 3MPCA 3OBAA 3BZ4A 4GRWH 4UV4H 5KG9A 3BWAB 3SBRA 4JZJC 3MR9B 5K93A 3L1OL 1USZA 2B1HH 2WZ6A 4TM9A 3FTUA 3U4EB 3VX1A 1KMGA 4DGVL 1UZ8B 4BA8A 2F2HA 2BS8A 4A55A 4JHWH 4H20H 4MLIA 3VRLE 3APNA 1U2CA 3L2LA 4HG4K 1TZIA 1I7UB 2QPFA 3T2LA 3ZSTA 4JG0L 4DP9X 4IBSA 4ENEC 2DBLL 4D9QD 1U8OA 2GJ6E 3CAFA 4JKPL 1OAYL 4BFFA 1ZHKA 4RAUA 4PR5A 3ROLB 1CLOL 4F9LC 4WTZG 4PPTA 3EFOA 3CUPA 2XTSA 4DO4A 3EO1A 1TYJA 4OLVL 2H3XC 5D7LD 4X2UA 3WNOA 2ZPKL 3BGFC 3L9RB 5I15L 1WUNT 1IFHH 1NGQH 3WG7B 3HS0A 5C86A 3VJ6A 4E9QA 4RFEA 3GSNL 1CXKA 4PJEE 1USQA 2WLHA 5IW6B 5F9OL 4KZCA 3L4WA 4R4FH 5KS9E 1PFOA 4U1IB 3QDJA 3QRLA 3VXRD 2A4EA 3OX8B 4AZ8B 2WKLA 1G9MH 2Y7OA 1LO0H 3KLLA 3P2BA 4FQ1H 3QUXC 4RGOH 4U1NA 3TH4T 5H4ZA 1ODAA 5CN1A 4LLYB 1WGVA 2X28A 1EO5A 1RMFL 3C9NA 5DMIH 3ZR5A 5CBAA 5JYLA 3UYPA 4XPBL 3ARXA 1KYDA 1XGTB 3FQ4A 1AKJB 2NNAB 4IQHA 4RMBA 2VQ4A 2PF6A 1TVDA 1ZDSA 3RTQB 1A3QA 3TA3A 3CBJB 3GMOA 4BZ2L 5DJCA 2FLBT 2DIAA 3BQUB 1JZDC 1HXKA 3GMRA 4CC0A 3WFCL 4FULA 4A7UA 3PAVA 3KR3H 5A2IH 4R8WL 4J3BA 1A9BB 2BVPB 3HHSB 1B4JH 4P07A 1RZQA 4JO4H 4IJTA 2PO6C 3ARPA 2ENSA 4GO6B 2OMWA 3HLKA 5HYFA 4M6NL 4EF3A 4KK6C 3LRSA 2BDNH 5DZOA 3TJHC 4AMWA 4M8RA 3RZCC 5CEZL 1DUYB 2VAAB 5IB1A 4CNIA 4KV5F 2HRPH 5JA8B 1BMGA 1ETB1 5C9KA 1BZ7A 3O8XC 3ZE2E 5DHVA 1KLGA 3L54A 2WC7A 3BH9B 3VFNB 1RIUH 3NN8A 3ABKB 3M1BB 2W65B 1S7VA 2EEBA 1NFDA 2F9BT 3BIKA 4Z7NB 1QW8A 4K8RH 1A5FL 4QRQB 1R5WB 2NXZB 4FG6C 1KY7A 4KNQA 2NOYA 1P9MC 2C3WA 4A7GA 4JFFD 1RPQA 3DYPA 1HCZA 4HS8L 3JQOB 5T1LD 1AG6A 1JOIA 2V2WA 4QOKA 3ZT7A 1HU8A 5BPPA 4P5MA 2NY5H 4G9FD 3H9SA 5KN5A 3DV4B 4GO9A 4XXDA 3SE9L 1X9QA 5BZWB 5DQ9A 5F2FA 2CXKA 3I2CH 3ZKNC 3ARGB 3DBXA 3N41B 3W37A 4OFKA 2FEJA 4NBZB 4DK5A 1JUFB 2R7EB 3ZDZF 4FN0A 2QKIB 4KOCA 5AZEL 1DBAH 2QVFB 3DOIA 1FV1A 1DFBL 1ZWIB 3OWRA 3MRNB 4K7PX 1CE1L 4JO2L 3QRFM 4UT9H 1U2HA 4N8CL 3X14A 4XE0A 4NUJB 1I75A 2X38A 3G9VA 5C0AB 2QV4A 4MAYD 2OMUA 4QAMB 5SWSA 3LEVL 1FNSH 4UV7L 2P52A 3B2DC 5JXEA 5FKAA 1A02N 2CU9A 2N0MA 1Z5LB 4D0CB 2X42A 2JJWA 1YNLL 3SPVB 3NRPA 3F58L 2VXQH 1Z7JA 5INDA 2Z7ZA 4G7RB 4JE4B 1U8KA 4QTIL 3ZZ1A 3HVNA 4JO1H 3WE6B 1VGEH 4MJIB 4KHTL 5GRZA 1BFOA 4Y4FB 1KBBA 4YSTA 2WOYA 4O5LH 4M1DH 4W9JC 4YDLB 5BVPL 2X6VA 4AC2A 3NEOA 5FYLH 1OZUA 1NEZB 5FGCB 5IMKA 3SJVB 5LUMA 2WIIB 4X4ZA 4Z7VB 4QWWD 1C7TA 3NJKA 1Q90A 4JZNA 3KLQA 2MWCA 4MMYB 4NYLB 5JR1L 3H8NA 5D7JD 3J8F7 3MDJA 5CUSL 3QNZA 4R26L 2X4QB 4GG6E 1CDBA 1IAIL 4ICWA 1UKSA 4XAKD 2DD8L 3WTUA 3MV11 2WW8A 4LP8A 4QHPA 1M3JA 2ITCA 2EKSB 5CEYB 1TVBB 1L3NA 4N0UB 5C92A 1CGYA 3IDNA 1OAQH 3X11B 3PAYA 3JBG7 4YHZH 4PJDB 3QAQA 3QJVB 4DN4L 3F5WA 3ROOB 3HE7D 4M7LT 3FAXA 3J07A 3QJXA 1JPSL 3KH4A 3FTXA 4WRLA 5EOTB 2GJJA 3EFDH 1QFWL 5ANMA 1MXDA 4HFUL 4BEIA 3AS3A 5DURD 3CZEA 1W9XA 4ZNEA 1E2ZA 1AI1L 1UACL 3GXUB 4NQUA 3NIDF 4OT1L 1NOFA 2GI0A 4APQB 4BSVA 3R0MA 5A6MA 4Z78A 4OIFA 5I26A 4H13C 4XNYL 4XP5H 3ZDWA 3ESVF 5CNHA 2BERA 3QWOB 5C97A 3MJ6A 5DT1H 4D3CL 1GJWA 4NSKA 5CSBA 5KSBB 3UTTA 4U6YA 3RZCB 3DX8B 4PRHE 3TBTB 3MLSH 3WIHL 1JMXA 2FEDC 4HC1A 5KVGE 5I73B 1F97A 1I3VA 1K8IA 3OGOE 5KZCB 5JYMA 5DR5H 4MA8H 4EQ3A 2WQWA 4MSWA 5JIDA 4W70A 2JB5L 1MN4A 2EXTA 1CXHA 1MWAH 3CFEA 3FN0L 4QCIB 3WN5B 3M1OA 2BSDA 4LLQB 4S1DD 1B9ZA 5A40E 4ATTA 5I30L 3BAEH 2FE0A 1BFVL 1EO7A 5AKRA 4L0PB 4JFQB 4UDTB 2WXKA 2IDFA 3SDCD 2R0KL 2WPGA 4H8VA 4Q2ZA 4L1HA 1F4XL 3FMGH 4H8WL 3AS0A 1KF9B 3BZ5A 2WLMA 1EHLH 2ED6A 3QIWB 1SF5A 4M8VA 4X6CA 2OTUB 3SDXE 5T1KB 5E5LA 1SYVB 3WKPA 3GS0A 1GGBL 1HIML 3LNIA 4GKSB 3GIZH 3LSOB 3T08A 1PZBA 4U0RB 1NDGA 1YAIA 2E75C 5AW4B 1TOXA 2RCSH 1ZLWK 4PY8I 4RGNB 5T5NF 2XWTB 4JDEB 1L9TA 4X6DB 4HPYH 1G0XA 5GSRB 4N9OB 2OL3A 4TUUA 1AHMA 1UWEH 1EAPB 4P2RA 4G8FB 5K1NA 5GGQH 3WGUB 2X0WA 5IMMA 1P7HL 1A3LL 3CXFA 1NCDH 3LB6C 4OLXH 1FL6A 4IMLB 5KVFE 5EG6C 3FQTB 3T1FB 4HJUA 3CN0A 4MTMA 4L1BA 4GJTB 4HW6A 5BMFH 5C71A 1DYZA 3QPQD 4KK8C 4Y9CA 1A7OL 3LNDA 3AAZA 4QD2E 4I18A 3RIAF 4UTCA 1WLHA 1D9KB 1U8JB 4DQAA 1X5GA 2OBGA 4CA4A 1MZZA 1SYSA 4F9PA 5E08H 4HWBL 1OEZW 3M1CA 5DQDH 2WAHA 3L3DA 1IKFH 4TVPH 3M8OH 3WMPA 4J3UA 1CWVA 1QFWM 2NZ9D 2VDNH 5IEKA 3GIVA 5EZOL 1R75A 3VYOA 3WUWA 5IF0A 3FF8A 2VDOH 4TVUA 5T8IA 1EJOL 3JUYA 4HJGA 1UM5L 5I71C 1GGCH 3PRZA 1JAEA 3AFLA 1HYSC 5AW6B 5TGBA 1A21A 2EDDA 3GQFA 4U3XA 3SE6A 1VADA 4G5ZH 2RALA 2WQ8A 2AJYL 1OTUD 1ADQL 1NBZA 3SKUD 5HDLA 2H32A 3QUKA 4PW9A 4PP1D 2IDQA 5I1AB 1QR1A 3WY4A 4PG2A 2AXHA 2GW5A 4HJTA 1FVEB 2L04A 2ZCLH 3VXMA 3EYFB 1HHHB 2OI9B 1DQML 4G8GA 3V52L 5DD0L 3OKOA 2J4WL 1H8LA 2B77A 3MJ9A 1AE6L 1EMTH 1SUHA 3GT6A 1GZPB 1U9KA 3MA7B 4GBXA 5GGTH 4BWWA 3PGDA 4HPOH 4M5TA 2JKWA 3BAJA 4TSAL 2PN5A 2WN3A 3VFUA 5I75B 4QYOA 3QQ4B 1AKJD 4TSCL 1F56A 5I5MA 3MXVH 5GGVY 1ORQB 4HF5L 5DO2D 4ZI8A 5ID1A 4OZHA 1WZ1H 2AERT 1XXFC 1L7IH 3RTQD 3NFNB 2J88H 4JFYA 2ADFL 5EUOF 1S9WB 1J5CA 3APCA 5D1XE 1S7XA 3CH1B 4NJ9H 3IF1A 1D5XA 1XCTA 3BQUD 4LSUL 2XIBA 1XBRA 1MPAL 1W72L 2DYRB 4AL8L 4P23B 1KJ3L 1PD6A 4XB7A 2P5WA 3B8SA 4RNRB 1IC5L 2ARJB 4NM8L 4V1DA 3LCYA 2PPDA 1EDHA 4YHOH 3KW7A 2W81C 4GQPH 4MLSA 5EDXA 2LVCA 2P44B 2R29L 4X7EC 2R4SH 4LEOB 5CP7B 2XKNB 3L3IA 4Y88A 3WDJA 4MNQD 2OK0L 4X4XA 2HYMA 4NWUL 4P3DA 1LK3H 1N7ML 3SBWC 2FLMA 3ARED 3KPRB 5CEXB 3GSVB 4NN7C 3FHEA 3EDJA 2XY1A 3OSKA 1A64A 3P9MA 4LRIC 4RISL 5C8JB 2NY2B 2VERN 1YEHH 4AE1A 3FSZA 1HC1A 5F21B 3V0FA 2ZSWB 3E9TA 2PTUA 4HEME 5DFWH 4NRXA 1A9EB 4MZIA 1BWWA 1Y1DA 3S0PA 3FFCA 5E8EA 4DQOL 3D69B 2WJ7A 3WJJC 4GT7A 4WNSA 2GK2A 4LSSH 4OF7A 5J1SC 3ARYA 2NXZD 4GKNB 3ARSA 1A6AB 1JNHA 3LS4L 4U6HB 5DI8A 3U82B 4AYFB 1MHPL 1R46A 1BPLB 4JB9H 1X7QB 4DJMA 5EBGA 4X7SL 3C2SA 1KCRH 2CKBA 1AGBA 3O2WL 5H35A 2E7LC 4XHJD 3U1SL 2FX9L 1OGTB 4ZXBC 3IEAA 3IFNH 3CBKB 4JANB 3ARGD 3BUYA 3HC0B 4ODWB 4OIIH 3GTNA 1IGFH 2M83A 3QPXH 5T3ZH 2VLJB 4PRNB 3RGHA 5BV7H 4L3FA 1MFVA 2GQHA 2X2IA 1G6VK 4F27A 1SDDB 4N2CA 2XKSA 5AOZA 3UPRA 4ZPTB 2CMRL 1DZ0A 3VD4A 4W9FC 3MBWA 4DEWA 4PJXA 5C0AD 3ZYZA 1YUHB 2XPGB 2BINA 4FHKA 3QNYA 4EI5A 1C5DB 2Y1VA 3EOBA 4KKQA 1I8AA 1M56B 3FTYA 2CJSA 3BKMH 4MMZA 4WQOA 1Q1JH 2DV6A 4RIRA 4A7SA 5I0YA 2DQGH 3TF7C 5HJ3B 2CIIB 5JPNB 2QQKL 5CCHE 3RKPA 4MJID 12E8H 4XE5B 1H0DA 3UP6A 4MHHI 4Y4FD 3SKOA 3QDJE 4YHYB 1ZSDA 3EO9H 2OYPA 5HYEA 5I6PA 3HI6H 1MHHA 5EC1A 4HETA 2F5AL 3GLAA 4OJYA 3SJVD 2G0KA 3N3EA 1X5HA 2A6IB 2EO9A 1S7TB 2O72A 5F7UA 3MGOB 2CHWA 3MTXA 1C5BL 2OP4H 2BSTA 1R3IH 3SOTA 5KYWB 2C3HA 1A1NA 1WDAA 3T0XA 3CHPA 2P8PB 3LJ3A 2UZIL 5LBSL 4X42A 4FZEH 4PRAB 4CC1A 1GHFH 3QH3A 4HWEH 2ZONA 2EE6A 5JDSB 2D7MA 2XFXB 5MP6H 1WFJA 5TPWL 4TYUA 5BXFA 1I8KB 2AV7A 2ZICA 4MXVE 1XDTT 1DQIA 4QNPF 4GAJH 1J8HB 1SM3L 4W4NA 2CGRL 3ASOB 4K9JA 3J2PA 4DKEH 2P48B 5ETUB 3QDMA 3O2DA 3IDIB 3RVUD 2EVIA 1MLBB 2RB8A 3C87A 1MVFA 2J44A 4APQD 3QCUH 4XMVA 1WWCA 2FJFB 3BO8B 3IGFA 5FO8B 1EGJA 2GUOA 4NZRL 4P4KA 3V9FA 1Q38A 1DJZA 3B8YA 2P8MB 4OGYH 4G80A 3E2HB 4F7MA 4FLQA 3BT0A 1PD1A 1NFDE 1NWPA 1MW1A 4YVUA 2RH0A 3MN8A 5DD3L 4GUOA 5HYSB 5F9WC 5C0CB 4BZ1L 2VN5A 1J12A 4HKJA 4JN1H 4HUXA 4ZZFA 2B8OT 2YIHA 2VDPL 3SDDB 5KZCD 1JJUA 3GMPB 1VEMA 1RPUA 2WWOA 3M7OA 1I1AD 2PTTB 1AQMA 2YUWA 2AV1B 2OAAA 1NLBH 1EJ6A 4YXLL 3H9SE 1OY3B 2YXFA 3EYSL 4WSGA 3HI5H 4ANVA 4ODVL 1Z3GH 5E5UB 2LLNA 3QUZC 4M6OL 5GIRB 3JXAA 3OWEA 5FHAH 3T71A 4MZ3A 5IVZB 3BSZA 3GJFB 4P9MH 3K6NA 2ZOWA 5IHWA 1E6OL 2EAEA 1OIOA 2VXSH 3QIWD 4NGHH 3PYCA 3MAWA 1BZ9B 2X2UA 3IKCA 5T1KD 5A2KH 2IQ9L 3U1PA 3GRWL 3D33A 5T5NG 1SMOA 1D7FA 4F7EB 1KGUA 3BSGA 5B7EA 1YEWA 2DWXA 3MGAA 1S4IA 3QE5A 4MXWH 2APTA 4RGND 1PD0A 2YRZA 4Z5RA 2ZX9A 2KDGA 1K3IA 2QFPA 1QZ1A 4KKBD 4LBEA 4NBYB 4UB0L 4UQ2A 3LRLA 4A6YA 1Z5YD 1SY6L 2EYRB 4NWTH 3FS9A 3VWJB 1HNYA 1SEQH 3EGXA 5DRXB 5A2FA 2ZAGA 3C60C 1II4E 2WLLA 4TXVB 2AK4D 5LG1A 5ADOL 5IESL 1MAML 1HQ4B 1WBYB 5E94A 4HH9A 4QRUB 1D9KD 1UD5A 2ZTBA 4K3DL 5D2NC 5C07A 2XRAH 4OCXL 4JY5H 3OAUL 3MNWA 4KHXL 5D5MB 1HXMB 2EDOA 4QRPA 1VF5C 3DGCR 2FBRA 3KPNA 5AYUL 3NP3A 1AD0B 2X4UA 3E1F1 4PAZA 4HS6B 4PJ7A 4XVSH 5AWNL 3LKOA 1ZLUK 1JHKH 3H9HB 5EDSA 2QADC 4BHUI 1T20B 3O11B 1RULH 2VQTA 5DYOB 4N2LA 4R0LA 4I13B 1BBJB 5LGHL 1RJLB 3RJDA 3WUZA 3MREB 3I3BA 3AABA 3RL2B 4XMKL 3RJOA 3K71A 4IDJH 4X4YA 1INQB 5ANME 3AQZA 1K85A 3QQ3B 4X7TB 2P5EA 4Q6IC 3I85A 3IFPB 4ZNEE 3B56A 1AS7A 1PLGL 4MJJA 5L6YH 4TTDC 3TGXA 1NFIA 1A6VL 4HSQA 3DSFL 1TZOA 3VFOA 1NCAH 3S3DB 4DPCX 1JTPA 5DJ8B 1JGDA 1WP6A 3CHRA 3OJ2C 4WI5A 2DICA 1CPUA 3ZTNL 3P77A 3H3PL 3MXWH 2NQ3A 4F37K 3IDGA 4O9HL 3UTTE 4AJ0A 3RIFF 3C6SA 4CVXA 4XMUA 1X4YA 5DTFB 3ECQA 1INEL 3IM1A 1Z9MA 4F8PA 2YZ8A 5D4QA 1CTOA 2FVNA 3VB8A 2YD3A 1MSPA 3TT1L 3X1EA 2DQTL 1D5IL 4P23D 1AIFB 3JT0A 4EUPB 4HIXL 5AB9A 1WE5A 4K94H 4DP4X 3M86A 2G5RA 3FRUA 1NPUA 2OXGB 2VLLA 2Y22A 5J8OA 2PWHA 4O58L 2E9BA 1T66D 4KROB 1NKOA 5T1JA 4JQXC 4I0PC 1XFPA 4TULL 4PREB 2YGQA 3WSQH 4P06A 4DO5A 4FABL 5J12B 5G4OA 3ZTDC 3KPRD 3NFPA 4NQCA 3WY3A 3BIAX 1LNUA 2NY2D 1AFVL 3CC1A 1XSIA 4M4RB 2EDQA 5AVTB 5SWZA 3EJUA 4HIIB 2CM6A 2P8LA 4U1LB 2R2EA 2R23B 4BE6A 3KL3A 4LAQH 4LSQH 1MY5A 2BFVH 3ALXA 3KYNA 1A7NH 4OKVB 4W6WB 1CFNB 3JUZA 4I9WE 3F04A 4Q6YA 5KVEH 5AFAA 4P2RE 3PHSA 1VRSA 3GXMA 3L3KB 4JN2B 4C59B 3NJNA 1FQ9C 2E6PA 4B5EA 1YN6B 1ZLDA 4R6UA 4NRYB 4N9GA 1TJHH 1FO0L 3TBBA 2ZXCA 3MJ7A 2DYSB 1DSFH 2EVFA 5JHLA 1HZLA 4JY6B 4KTDH 1A6TA 5IMLB 4JS7A 3ZUNC 4MGXA 4X9HA 3RNQA 3ZJAA 1EZVX 2VLJD 3FO2B 5E95B 2DQUH 2PNDA 1OWWA 2GTZB 2QVMA 3OTTA 1DDHA 4LHUD 3VQLA 4G6JL 1J0YA 1P7QB 4KFZC 4U3HA 2WO4A 1KT2A 2X7LB 4O02L 3KG5A 3KCPB 4LSVH 3LQZA 2E56A 1UWGH 1UC6A 2XICA 5TDOA 3DVNB 1UH3A 4UINL 1WAAA 3ET9F 1CYGA 3FULA 3LYRA 5EPMB 1N67A 3T0VA 4FQJL 5AW2B 1KBWA 4NQDB 2LGNA 4MS6A 2LQRA 3WIFA 1HH9B 2CR6A 5F0JB 4JHAH 2EDWA 5AALA 4LESA 3P9LA 3VXME 1WWWX 2XXGA 1XSJA 3MLXL 1UA3A 1MF2H 1T5WB 5I6NA 3VMNA 3AG1B 5ELIA 2IH8A 3ZRCC 3V0IA 5IBLC 1VZHA 3FFOA 2XWXA 2XV0A 1J88A 4XX1G 2NXYB 4GI6A 3BWZA 1F6AB 4YHLL 3BKCH 5HHMB 5F7DB 2H9GA 3U0WL 4CC4C 1XL6A 1LTXA 1TJIL 4YO0A 2NNRA 3N85H 4JPQA 1FP5A 1RZFL 3I6GB 4QHLB 4WY7H 3OR7B 2WZAA 4OZHE 5CZRA 5F70A 4HMDA 3UTQA 3TIDA 2Q1EA 4ZO8A 4OFPA 3SDAC 2H8PA 1JYVA 2ADJB 3TH3T 1A3RL 1TYEB 1ID2A 3UZQA 3L3HB 3OHXC 2P5WE 3FQWB 3ISWA 3EOAB 2BP0B 3MLYL 1I7TB 3O4LA 4V1DE 3UEZA 1JE6A 4TKWA 1RZIA 2IWEA 3AQYA 1U41A 3B9KC 3GINA 1EJFA 1J8HD 1N18A 1LDPH 3L7FA 4ZUSB 3SPHA 1GR7A 1NICA 4ONGL 1YQVL 3NCXA 4LSPH 4MXVF 2R8SL 3L6FB 5EU7E 3H53A 3QHZL 5HHQB 1P5VB 2WJ5A 4RAVA 5G2NA 3UAEA 3CDGA 1G9EA 1A1MB 2Q2LA 3C75A 1IBFA 2VH5L 4JJ5A 2EYSA 3D39E 3O3AB 4HA1A 3SE3C 4XNBA 1V54B 3FFCE 4TOYH 1BYPA 4P0DA 1NDTA 4LL1A 1QTSA 3JWNE 2I24N 3G6JB 3Q48A 4WFFE 4BFRA 3REWA 4LSDA 3FCGA 5IFJB 3SYPA 5C0CD 4FFYL 4W6YB 4OCYL 1SJVA 1E9OB 3E0GA 4JGMA 4LRNH 3ENEA 3SDDD 1BFTA 4UT6H 1FHGA 4XCEA 1FZJB 2OMXB 5I5RA 4LGRB 4JO5A 1FORL 4JAMA 4ZW6A 1EXHA 1PNDA 1L9MA 3V0AC 3TWCL 2ZYHA 2P80A 3F7PC 3QCTL 5J9PA 1KBGL 4A63A 1Q94B 3LX9A 3KHOA 4C47A 3GGWB 1HX0A 5INCB 2OR7A 2WCGA 43CAB 1NBYA 4PJBF 5B38B 1IQDA 3MCG1 4F2EA 2V7NA 2QPDB 3QHFL 3L2MA 3KBHE 1GGTA 4PJXE 5JQ6L 4EBQH 5KVDL 5D70H 4NC2B 5FFGA 3UPCA 3PQYD 1SHXA 3OD3A 1G7HB 4FTDA 3ZDZB 3IU3B 3C5ZB 2HWZL 1TZHA 4L8SB 4WTQA 2ZOOA 3VWJD 3QQ9D 3LZFH 4MJ6B 3HAEB 2JELL 2AITA 1B90A 4HLZG 1XZWA 2BMKA 5CLWA 4LLVB 3FOLA 3NCFB 3SN6N 3RL1B 3NSCA 4PGJA 3X12B 2PP8A 3CQPA 3WXWL 4QRRA 2GCYA 2X89D 5C0IA 4L05A 1L9OA 1E9QB 2NR6D 43C9B 1SXZA 2OR9L 4XPHH 5IR1B 3ULVH 1E8WA 2VRAA 3FB7B 1AQ8A 3EDKA 5KSUB 1RUQL 3DIFA 1G7LA 3OZ9H 2FWUA 1C5CH 1WF5A 3N9GL 1Q0XH 1FN4A 1TEGA 4H8HA 4S1SH 4BKSC 3QARA 1JPTH 2PCPB 2VTFA 3H0TB 1BGXL 5EORL 2YC1B 3MLRH 3UL4A 3D12B 3IDMB 1F11A 1Z5HA 2ZF8A 4WSJA 2WXQA 3T4YA 1TFPA 3L5WB 1IGJB 2GC4C 3M45A 3TCXA 2F54A 1OW0C 2YEZB 3POCA 5L0QC 3PWPA 4XNUH 4L18A 3VWKB 3VO0A 1PKQA 3WLBB 5JOPE 3D51A 3QYMA 2YAPA 2KPWA 1IL1A 3QDME 4MNHB 2F7OA 1Z9PA 1OCZB 4P05A 4IU2A 1JZJA 1PDKA 4RQQA 2R0LH 3WI9A 2YGNA 1HTYA 4WO4C 4NPJA 1CBJA 2A4ZA 3V0VA 1MEXL 4Z7WA 3CC5A 1CGSL 1ZVNA 2ZT9C 3NMEA 4ZDHB 1YMHA 3UTZA 1WZLA 3TCTA 4JFOB 4QHUA 3CFKA 4HJ0D 5F7LB 2PXYA 3V7MA 3TF4A 2HVJA 5TQ0L 2W0PA 4TLTA 1CXIA 2AI0H 3ALWA 2H2PC 4WUKH 3ULUE 4JQIH 1KWKA 1LD9A 1O6VA 1FG2A 3C2AL 2JLPA 1G1OA 2NNCA 3NIDB 2C9PA 3OKNB 4HHGA 1YC7A 1ZT1A 4N6RA 5DJ0B 5C0DB 4NKMB 5KBDA 2YPKB 2Q3ZA 3N44B 5AAMA 4BCYA 3UPAA 5I1IH 4MA3B 3ASWA 3L95A 1GW0A 1YEDA 2ID5A 1XB8A 3O3UN 2DMGA 1HNGA 2D3JA 3M07A 4CSSA 3NA9H 4KROD 4RGMC 3AY4C 5E9AA 3QA3A 4HXAH 1CS6A 1F90L 1XF1A 4U1MA 3VQ1C 4PBXA 2E74C 1CLVA 3ARDA 1NOLA 1UXWA 3CFCL 2G2RA 3K2UL 2BWQA 5E00B 3WMQA 4IGBA 3LRHA 3FN9A 3T77B 3JV6A 3U7WL 5JHDB 3CFQA 2CXGA 4OCNC 3AUWB 4HHAA 1WZMA 4GYBA 4X6CF 1L0QA 4ICXA 3SDYH 1WA0X 3L3OA 4AQ1C 4MB5A 2OTPA 4ZFQA 4UMSA 4OM0H 3FTZA 4HAFA 1DJGA 4Y19B 3VNYA 3T2NL 4N28A 4GRMA 1CB4A 3ZO9A 1LO3H 4D8PB 3DUHA 3ZL1A 3X1GA 5H2BB 3BN3B 3EH1A 4ODXB 4ZTPL 4RRPA 2YD9A 1HCFX 1RZ7L 4NEHB 4XP6H 3IGLA 4H25A 1UKQA 2J1KA 1YPZB 5C07E 1PTZA 1QOKA 5F1IA 3V6ZB 2B14A 2MHAB 3F2LA 1H8OA 4L1SA 1P7QD 4OLEA 4NUGL 2JE8A 1OAKL 4TNWK 1PZ5B 3ZDXB 1Z6JT 3U6RB 4QRPE 3LDBC 2OKMA 4ZOBA 2WXFA 5DVMA 2AQTA 4MQXC 4U0QB 3RY4A 4MQ7B 5I1GH 1K2DB 3E8VA 3TPKA 5D7IB 3VFWB 1ERNA 5EU6A 4GRWE 4LIQE 2B1OA 4AIOA 4QJ3B 1AHKA 5K9JL 4OGAC 4L4TE 1MFDH 4NQDD 5F3HA 3A6BH 5GZOC 4LCUA 1A14L 4XO5A 1S5IH 2APVA 2YBRA 1B0RB 1QQDB 2FSEA 4LLWA 3UJTH 3UO1H 2YFNA 1L0PA 3FRPB 2A9MH 1YJDH 4Y8AA 4F8LA 4J3WA 2P5EE 2IADA 4FQXC 2V7HB 3Q8FA 4WU7B 4ODHH 1IGYB 3HZMA 1BQKA 1EEYB 1UT1A 5L0QB 2XQ0A 1MCPH 2NXYD 3B2PA 2GJ6B 1JGUL 3ZIMA 1ZVYA 3GXPA 5HHMD 1QFHA 3MV8A 1NWOA 3D52A 2FB4H 4J27A 1T04B 2BNRA 4M56A 1N5AB 1BLNB 3SGKA 5D1ZA 5FHBL 4YSUA 1VFAB 5FAAA 3LMJL 3LN4B 4J3VA 1NDMB 3DXAE 3BJ91 2GI7A 1MQKH 4IS6B 1S7WA 3CFJA 5KS9B 3KPQB 5K5YA 4FXGB 2OSXA 2PETA 1TITA 4K73A 3KPSE 1DUZB 3U0TA 3FQ1A 1AZZC 1MHEA 1KB5H 5AVYB 1HKFA 3ZRSA 1CZ8H 4FMKA 4ZSOE 3OKKB 1NCWH 3VVVA 1JPST 5DK2B 1SVBA 4NQXA 1JWSA 2Y6SC 2DTMH 3DVIA 2E59A 3QORC 4NQCE 4N20A 2IAAC 2FSDA 1YEEH 2OPCA 2Z91B 2Y1YA 3GHBH 1QBMH 2HJLA 2XWEA 5SWZE 4K7PL 3MRIB 3RUGA 3VA2C 2WQUA 3FB5B 1T3FB 5BVJB 3I6LD 1OSZB 3QPKA 3O9WB 3H2WA 1R24A 2FIKB 3UBXG 3FU7A 1RZ8A 4O2EA 3QUGA 3QCVL 4F7PA 3D3VE 1PMYA 4Z0BL 2KI6A 5AL0A 5KSAA 1TTRA 2VXTH 4HGWA 2OZ4H 3L7EB 2MCPH 4I2XA 4QGYA 3CVHB 2G5UA 5DHYB 4AGMA 2C9QA 4L3CB 1KXTB 3QXVA 3TPUA 5JW5B 3RDJA 1SRDA 2DLGA 4FLOA 1P4LB 3L17A 4WKZB 3IAPA 4ETQA 3QB7C 5IJKA </