1I8AA

Family 9 carbohydrate-binding module from thermotoga maritima xylanase 10a with glucose
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
189
Chain Sequence
MVATAKYGTPVIDGEIDEIWNTTEEIETKAVAMGSLDKNATAKVRVLWDENYLYVLAIVKDPVLNKDNSNPWEQDSVEIFIDENNHKTGYYEDDDAQFRVNYMNEQTFGTGGSPARFKTAVKLIEGGYIVEAAIKWKTIKPTPNTVIGFNIQVNDANEKGQRVGIISWSDPTNNSWRDPSKFGNLRLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE A
publication title Crystal structures of the family 9 carbohydrate-binding module from Thermotoga maritima xylanase 10A in native and ligand-bound forms.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 56
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06452 CBM9_1 Carbohydrate family 9 binding domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1190 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1i8aA00
4JPQA 1I8AA 1ULVA 1UG9A 1I82A 1I8UA 2IVFC
chains in the Genus database with same CATH superfamily
2V5TA 1X7QB 1CO1A 3LHPL 4LKCB 3WO4B 1WAEA 4KK6C 1T5KA 3GKZA 1CK0H 1T5WA 3WXVL 1INDH 1L9QA 2Y2YA 1FG9C 3UGUA 4WI5A 4G6AC 4LCUA 1NGXA 1XCXA 3KE0A 1I8AA 2HVJB 2XWBB 4I0PD 4OF7A 3TBTB 4Q9QL 3MDJA 4X9FA 4HT1L 1M7DA 4GH7B 4WO4A 3WN5B 4KXZI 4C54A 4KXBA 1P1ZA 1R34A 1JPSH 3IDUA 1A3LL 4OZHA 4I3GA 1JZDC 2AK4E 5CEZH 1A4JA 1NC2D 2AQ1A 3DBSA 4ODWB 3V4VL 3DIDA 3VM7A 1DJSA 3Q3GA 5CP3H 4KNUA 2KL6A 1J1PL 5TD4A 3HAEH 4YK4C 4LOEA 4E9SA 3WNNA 5IBTH 3LEVL 1UKSA 3P0VL 5D2NA 1TVDA 5J12C 1XVSA 3AQYA 3JV5A 1BJMA 3VXRA 4JQIL 3L13A 1U8CB 2VXUL 1OB1A 2BS8A 2ISDA 5IR1B 1R5WB 4UV7L 3IDXL 2OMTB 4RVBA 2VISB 5DMJB 1A6UH 4AM0Q 2Y25A 2LW3A 2APBA 3R1GL 4GKLA 4OFDA 1OEZW 1QFWH 3TBSB 1LE9A 3VXPA 1YNKL 4DK6A 4FXGA 3RDTC 1C5DA 4HFWA 2A77H 5DJ2A 3CVHA 3GI9H 1KIPB 4UAHA 4JDEB 2VDPB 5AYTA 1NBZB 1CR9L 3T4YA 5F88A 3B37A 3IDYC 4P2QA 5MEND 1RZ8B 3MJWA 1SEQL 4NN5C 4GP8B 1R24A 5GSVB 3GBDA 1D9KD 5L2KD 5LCVH 1PKQB 2IEPA 3MAWA 4QXUL 3BE1H 4WUUA 1HJCA 4OM1L 4R97B 4KTEH 1NGWB 4PJFA 1R5VB 1FIEA 2DYSB 2KS0A 2VLKA 4E0RA 1BP3B 1ID2A 4JFEA 4HWUA 1YO4A 3MGAA 4KK9C 2E5EA 1G7IA 4GI8A 5E94B 4HKBB 5EU4B 4XMPL 4GW5A 1H8OA 4QXTA 3W5NA 3MU3A 4YGAB 5FW6A 1K6QH 2E27L 3ZDXE 1CD9B 2YSTA 2EO7A 2CBPA 3O6KH 2BVTA 4UUJB 4YHOH 4DQOH 1U92A 2VQTA 4TNEA 5DD5H 4FLSA 5DJDA 3LDBB 4G8GE 4ZAKD 1QABA 3TGXA 4NPJA 1AE6H 1FO0L 3T6VA 1Q9KB 4OCLC 1TQWA 3L9EA 4NC1E 3ASWA 3RVVC 1MRDL 3S98A 1XD0A 4U1LB 2WXPA 3SKNB 5DFAA 1THAA 1SHWA 5IJDC 5IVXA 1S9YB 1QEWB 4L8SC 4Q0XH 3CMGA 5DVKA 5L7XL 2VDKB 3H56A 4BSWA 1LEGB 4X98A 3BVNA 1CXHA 2H2SD 4I1NB 5D1QA 5KUKA 4F8LA 4LMQE 4JFHD 4UTAA 3GRBA 3HLKA 1A2YA 3TO4D 4JKWA 1E4WH 4U49A 5DJ0B 1CICD 3EJCA 3ZLQC 1CDIA 2QKSA 4P49A 4XBEL 2J2ZA 3OGCA 2VLRE 2Z31B 3U4KA 4XOEA 3PAZA 1OVZA 2CR3A 3SKUD 1MF2L 4JFVA 1RQ5A 2C3GA 4KTDH 4G8FA 4ZFGL 1A22B 5EC1A 3SKJH 4Z3FA 3RPBA 5IJVB 1XGQB 3MCLL 2UYLB 4R26L 1T80A 4O4YL 3UTSB 1K4CB 1ID5I 3BJ91 4QDGA 4U1HB 4NO3A 3QUKB 1KGUA 2Z9TA 1IL1A 1X5MA 4NUPA 4PJAE 3WLBB 3SYQA 2O5ZL 3HE7D 4YC2C 2K7PA 3PGFH 3D9AL 3APCA 2VC2H 3A6BL 3QJUB 4YDIH 4JANA 4WU5B 4FNSA 3X12A 4NOFA 4K07A 3S0PA 3SE4C 2GITA 2CRMA 1GS6X 2UZIH 4DF9A 1BDYA 4JCLA 1KULA 4XPGH 3CC5A 5BO0D 4P3DB 5CJXA 5JHLL 5F93C 3HPLB 5EU6A 1OARL 2IAND 1R3JB 2VDQH 4N2HA 1N4XH 3KS0J 1SOKA 5LNDA 1UCTA 2X4NB 1DYZA 4NRZB 3U0TB 4I48A 1E42A 1LP9A 2G2RA 5I18L 1S7TA 4ZW5A 1J18A 3SBWA 1MY5A 5JXEA 3FBQA 3LIZA 4XPTL 1M7XA 4Z1PA 1KY6A 1T1WA 2FDBP 1BVNT 3O9WB 3F00A 3FT0A 2HUHA 1G6RH 2HH0L 3ECQA 3LN5A 5LXGL 2ICEA 4PJBE 1T03L 3GMNB 1MRCL 1LXMA 4YWGL 2FH8A 5TQ2H 2Q86B 3KHOA 2CHZA 5GRVK 3ZHNA 4IKJA 5TDPB 3OAZH 3U7YH 3EH5B 4LQFH 3VTMA 1RUAH 1CUOA 1JP5A 3HG1E 4HMEA 4Y88A 1JWMA 4HFUH 1GZPB 4A68A 3NABH 4MYPA 5E23A 4B9PA 4FOMA 4B27A 2ZOKA 5FKPB 3EGDB 3DROB 3MUZ1 2OYPA 5FO8A 1CFTA 1KCBA 1JZ3A 3RFZA 1F90H 3HRZA 3QZBA 4OD3L 5GPRA 4JY5L 1P2CB 5DS8A 3W0WE 4DH2A 1PLGL 3DV4B 4QRTB 4DKEH 4JO1L 5J7CC 3QUYC 2RQEA 2CO3A 3DX3A 3TV3H 4FJZA 1HSBB 3D50A 1F42A 5CJQL 3PDOA 4NZTL 4BYHA 2LVEA 4L4TB 4JFPB 4A2GA 3BWZA 2UWEB 2MQCA 4L37A 2O5YL 4FQJH 1HKFA 5I82A 4DGWC 4LCCC 2QGBA 3GSQA 1U8JB 3FHEA 4YLCA 4CU7A 1C08A 4IJ3B 3NDZE 3LRKA 4PJ8D 5I6XB 5JYMA 1RH8A 1IC7H 1MQ8A 1OAQH 1CJYA 3T6WA 4AYID 4BM7A 2F19H 3HKFA 1LM8V 2GJ6B 4M7ZC 4IMLB 1KLFA 2NW3A 3FFCB 2FGWL 2WO4A 4JRXE 3PXLA 3KH3A 3F3HA 2NOYA 3LY6A 4LL4A 1WE5A 3WELA 5DJAB 3G6AA 1OCZB 1OQXA 3NTCL 2BRRH 5BRZD 3ZU8A 2EE2A 3FJTA 1KFAL 4PJCF 1CBJA 2LTQB 2HXAA 3HAEA 3QHFL 2ADGA 4XMLH 3KXFA 3SO5A 2B20A 5D70H 3CZFB 3AREA 3N85H 2LHAA 5JW4R 3OAZK 4HGMA 4PWJA 5DD3H 4ANXA 2DWDA 1JMZA 3G5WA 4BKLB 6CGTA 1MJUH 3V0IA 3NPSC 3ZQXA 4UOW1 2D8KA 4DP5X 1F56A 1Z0MA 4ODXB 3DSNB 3QUXD 5SWZD 4AENB 3Q1EA 4WWNA 4Z77B 3P4OB 5AB1A 3F64A 3HA0A 4H44C 4V1DE 2IJ0C 4NHUB 4QHMB 4WWPA 5JW3H 3U9PH 3ULVL 1B4TA 4NZRL 3ECWA 5DHVB 3H0TA 3FT2A 3QE5A 1H5BB 3TFKD 3MFFA 4LASL 5KS9B 3Q5OA 4HKZB 3TYFA 1BAGA 4PGCB 4G6MH 5EOQH 4HISA 1PD6A 1U8QB 2CBOA 1JK9A 1JZEA 1U3HB 1Y0LA 1UD6A 4RMBA 1GMIA 1Q94A 2BCKA 1SNRA 4CJ1A 3QCUH 3HR5A 2WBWB 3ARGA 5I66B 4XPHH 5DEFA 4L8BB 4XPFH 4YE0A 4I77H 3ILPB 3PQYE 3AUWB 2R4RH 3QNXA 5IEKA 2YD5A 3OBAA 1BOGA 3WFHB 4NGHL 1S2EA 4CRPA 2AAVA 4MSWA 2OYLA 2FD6L 3DTDA 2CJ3A 2HMID 3S3JA 2X44D 4WY7H 3OWRA 4Y89A 4A04A 4H8PA 2I7SA 1A47A 1O5DT 2N7BA 2VMCA 2WO2B 3NGBB 4KI1A 4ZS7L 1DVFD 4K4KA 5BOPA 1UWGH 3FS9A 3WKMH 1UFUA 4WEMB 3PWPB 5CUSL 2YRBA 1VKXB 5ESVB 4IIQB 1CD1A 4Q2ZA 3O3BB 3CZEA 3DUUA 4NQCE 1LK3L 1PY0A 1NBYA 3SE9H 3TWCH 1OPGL 4ZFOA 1NDGB 4J3WA 1E90A 1RZPA 1I8MB 1MFEL 4YE4H 1UUNA 1KYUA 5A16B 3LKNA 3QNZA 4ZO6A 3FAWA 4NRXA 1XBRA 4WHDA 2I7OA 3GDCA 1E28A 1RCYA 1QSED 3BGMA 5C08A 2XFXB 4YX2L 4ZYKA 4L4VB 5JNYB 1M05A 2JXMB 3H8NA 4IHOB 2CDFA 3DX8A 3QJQB 4MQXC 1Z7JA 3A67H 4E5XA 5HVFB 1WLHA 3GRWA 5HGBB 5T1JA 3B2VH 1L7TH 1INDL 3BPLC 3AG3B 5K93A 2WANA 3NN8B 3H55A 1IC5H 4G7QB 1BZ9A 3ZE1E 5IREA 1NCHA 3VFTA 1M3JA 2EACA 3KD4A 5D5MB 5KZCD 4EZKA 2V2XB 4M6AA 4MAYD 2YK1H 2JKTM 4AJWA 3O41B 4DZ8A 1TCRB 4N22A 5C0AD 3V5HB 2A6IA 3L45A 3OLDA 4XVUC 4Y4HC 3FUHA 3MRFA 1PZDA 5C0CD 2HLFC 4OV5A 1OGPA 4CADB 4MB1A 4MNHA 1T0MB 5CEZL 2DWSA 1NMAL 2GCYB 3HG3A 3K5SA 4PBWD 2O5XH 2DQHH 1EAPB 4FFVC 2H3NA 5TFSL 4Z5RB 4GXFA 3ABLB 5ANME 3BLKA 2NLJA 1KTJA 2UZXB 5IBTL 3UXFA 1IFHH 2D2CC 5DRZB 4AQ1A 3AFLA 1R3KB 4KK5D 5TDNA 3QIBA 3W37A 5T1MB 4B95C 1TJIH 5I8EB 1WAAA 3A5VA 3UEZA 1OGAA 3DURA 1R1CA 2BO0A 2JMRA 5FCUH 2NNXA 3QIWD 1CC3A 4PVLA 4P4KA 3NIGE 1ZHNB 5ISZA 1A6UL 2P5WE 4KO7A 2NX5E 4I0KA 2NCEA 5CEXA 1G7PA 1NBVL 1G6RA 3MSPA 3C12A 1UH3A 4HKXA 2GJZB 3P73B 2HTKD 3N1MC 3GI9L 1MCWM 4DCQA 3MA7A 2IAMC 5DD0H 2ALWA 3UTTE 2YAFA 4NUJB 1KEGH 1IEBA 1WBXB 5IQLA 3FT4B 5JW4Q 3AM8C 7CGTA 2PR9A 1DP0A 3W9EB 5F6IB 5LCVL 1NTDA 1KJVA 2YQ2A 3FUDA 2PPEA 1LO0H 2TAAA 3IETA 4U1IA 3BE1L 2XETA 4KTEL 4MMZC 3C6LA 1BEYH 4B9KC 2HVKA 3JWNH 2WBJD 4N2GA 1G0DA 2WZPA 1P69B 1YEEH 4TXVB 4XMTA 3I85A 2WLZA 3JV6A 3MRJA 4A67A 3MLVL 1H6FA 4TULH 3KPRA 1TQTA 2B08A 2VN7A 3S36H 1EHLH 3JVFC 4Y5VA 2DQJH 3T8XB 4KKAC 4LNRA 3T3PB 3CFDA 3TF7C 3O6KL 1YNTB 4YHOL 4DQOL 4MD0B 3OWEA 1F1AA 1FFQA 5DD5L 3GXTA 4KROC 4QY8A 2YEQA 1NQBA 2VXTH 3WUWA 3HC4H 1AE6L 5I6MA 1J8HB 1TPXC 4LXFA 1EUTA 1EBAA 3DXAE 5IWLC 3BH4A 3L3JA 2WXGA 3IJEB 4QGTA 3WMPA 2XY2A 5D2LA 2LV4A 4JPVL 5A7BA 5CIPB 4DP0X 1AD0A 1MPAH 3TC9A 1D6EB 2ADJA 1OWRM 2EXYD 3S2CA 1PYWB 2XIBA 3ZUNC 1B9ZA 2NNCA 1H3TA 4Q0XL 3CLWA 4ZMXA 2AXWA 4MBRA 5E4OA 3T8MA 3ARUA 4GFTB 4CNIA 5JA9A 4XVOA 1T2XA 4GRMA 2FJHB 2XTJC 3IMBA 3UMTA 5F7UA 4KDVA 3Q01A 3FK3A 5IFJB 1T1YB 1I9RH 1E4WL 1AHKA 2OJEB 4YZFF 3D52A 4F7TB 1NGZB 3QDGD 3VXMD 2ZYHA 4ELMA 1NOAA 3W9DA 5J1TC 3KWWB 1IIKA 2YQBA 5GRVL 4KTDL 4XBMA 3Q2LA 4PJEA 4KY1H 1HH9B 4APXA 4TF4A 1JWUB 1BQLH 5IBLC 3DUSA 4D9RD 2V2TB 2DDQL 2GUOA 2YAMA 3NCCB 3MV11 4AEFA 3CPLB 4MJ2A 1D5XB 3GMPB 3RKPA 4BRVA 2ZT9C 2ZYIA 1B0WA 2XG5A 1K3IA 3PGFL 2VC2L 3VFMB 1UVQB 4ANWA 5L0QB 3IFNH 4YDIL 4K7PH 4XCNA 2ZUWA 5DJYA 5C3TA 5L4FA 4PRAA 3ATBA 2VDRH 3GBML 1LL1A 3K72B 2NNAA 3RX8A 2UZIL 2VWEE 2GKIA 2JKRM 3DIFB 1H3VA 1Q9OB 1FYTE 2C4FT 3IJYA 3FT3A 4LLUB 2V7NB 2IV9A 2VDQL 5KSAD 2GT9A 4V33A 2AEIT 3GXNA 2OMYB 1XGYH 3QAQA 4WFHE 2IWEA 3VI3B 1CYWA 1UFGA 4G8IB 4PJ9A 1KXTB 2WQWA 4QT5A 1ZRUA 4CC0A 2PP9A 5GZOC 1AC6A 3FFDA 3MHZA 2IOIA 1JPGA 4NKIL 4V1DD 4ERSH 1DUZB 3KPLB 5CWSA 3S48A 4HD5A 4DP4X 1KCLA 1JF5A 4JRFA 5FUCC 1JZ4A 4MJ6A 2Z92A 5JIDA 2VXVH 3O6FD 5TQ2L 1R3HA 4HV8B 4ELDA 3U7YL 3QULB 3CH1A 4WI4A 4LQFL 1G4MA 1S9WA 2OX5A 2V17H 2ZXBA 1PX8A 5D4JA 4HFUL 3WUWG 3NABL 3H9SA 4UQDA 1JNHB 5MEOA 1Z6JT 3PRZA 3AABA 3JVGA 3FB5B 3ULUD 3ZZSA 2WXQA 1H3XA 2MPAH 2VE6B 4NENA 1F90L 3T1FA 4QJ3B 3O81A 4PW3A 3UGEA 2I9TA 5HHVH 1HH6A 1MFDL 4QO1B 3F7KA 1XGPB 3T0EC 4XNZB 3VD4A 3GTNA 1RZKH 3TIDB 4DKEL 4MCNA 5CU5A 1AYRA 1F02I 2WOBA 2A38A 3MN8A 3TV3L 3TL5A 4J3VA 1A7BA 2PCXA 5DJ6B 1YG9A 1TVHA 5JDSB 1XL6A 4Z7UE 4M3HA 2GTZA 2P43B 4JFYB 5CBEA 4I0PA 5HYQB 5ID0B 1TO5A 4FQJL 2VKXA 3E2HB 1ZK5A 4JKNA 4GUOA 2WINB 2MTPA 4JO4L 3CFCL 4K5MA 2WYIA 4BFKA 3IT8D 5DRWB 2DQFA 1IC7L 4ISVA 1E9PB 2VABA 5DVMA 2XWDA 2F19L 3NFNA 2H0FA 4NQCD 3CLEL 5BNXD 2WQ8A 2NSMA 3M1BB 5KBDA 5DA4A 1YCSA 2DH3A 3SQRA 1KG0B 1E5CA 4GO8A 5I74B 3BQUB 1NM9A 2BRRL 2DI8A 1AS6A 4N8CH 4BINA 5CLTA 4XMLL 4OFQA 3D25B 1GKEA 5HY9A 1XX9C 4X8JA 5D70L 2J5WA 3N85L 5JZ7C 4PJ5D 4ZPTB 1UH4A 1BLIA 4IBLT 5DD3L 1MJUL 3ABGA 1C16B 1RPQA 2LU4A 3TA4D 1J0IA 2RR3A 5BVPH 1V8HA 2H6UA 2KHAA 3G04B 4AXWA 3EOAA 2A83B 2ZXEB 1PDKA 3NRPA 4F33B 4PTUB 2VR4A 1T0PB 2OQJA 3O3AA 4XT1C 3FMGH 3U9PL 5JW3L 1NLBH 4C4BA 5A2KH 5L4JA 1FIGH 4JFDE 4KQ0A 2EXSA 2NY3C 1AAJA 1RZIB 2WLYA 2BVYA 2VSCA 3RIKA 3C5ZD 3KGUA 4LP8A 1D5MA 4O58H 4OI9A 3WBDA 3G5ZA 3KPPA 3NJIA 3D0AA 4JFFE 2C9VA 5EOQL 4XXCC 2ZSWA 1D9KA 1DQDH 3SO3B 4AGQA 5L2KA 1LWHA 2JKXA 3FKUS 3QCUL 2F15A 1KB9K 4HC1H 4XPHL 1N2RB 5KUMA 4I77L 3QJZA 2ZX5A 5KVGH 3PXJA 3F7LA 4R96B 4FNLL 4HAKA 3W1ZA 3AGWA 4RSVA 2WCGA 2I07B 3DTXB 2WZ6A 3WIHH 5KSBA 3ECBB 2CKBB 2MEJB 3VFWB 2EUVA 4WY7L 4MQ7A 2V5SA 5GHWH 4EEEA 1T4KA 4OZGF 5FF6A 5I1LA 5D1ZB 4NQXB 1UWGL 4HKJA 4KMTH 3WKML 2J43A 2NY1D 4MMYA 1F00I 4ZAKA 4EI5D 3G6JF 2IG2H 1SDYA 3ZDZF 4ZMTA 3SE9L 3TWCL 2JFCA 3RTQD 2Y06H 5E8PB 3B2UD 5BZWB 4YE4L 3L3HB 2BNRB 2DS4A 3WY4A 2FJGA 5DC9B 3G5VB 3KJ4C 2XKSA 3ZW3A 4HJSA 1XR8B 2F1EA 4QXVA 2LVCA 4X9IA 3I9GH 3SDCB 1CGUA 1WFNA 2Y4SA 5DHYB 1G7QB 3PV6B 4HIIB 2IGFL 3A67L 3AT8A 4GRWB 1EZVY 3CN1A 1FJ1B 3G5YA 2EO9A 2YPKA 3MNVA 1CICA 1I9EA 4YSCA 4IS6B 2O6PA 3ZGIA 1KXVC 1IEAB 3B2VL 1L7TL 1MAMH 3QUHA 4XN9A 3WEXA 2W80C 1M1XB 4NPYA 3I9IA 4ZQKA 2X1QA 4O2EB 3BSHA 1QLFA 5ESAB 2YK1L 3CXDH 2JJSA 3IRCA 3Q2NA 4YPGB 5EIQA 2QQKH 2BVOA 5SX4H 1ETJA 4B60A 4TRPH 1HFUA 1HTYA 2H26A 3IXAA 4P59H 1X9LA 3JWOC 2OMWB 4FQIL 4ZO7A 4G80B 5C0JA 5EFIA 3IF1A 3HE7A 2EIEA 2G75A 1EEQA 1IBZA 3MNDA 3JTTB 2GI0A 2WOYA 2Y7QB 2ZKWA 3CZUB 4QHNB 5KW9H 3DXAD 1N9PA 2DTSA 3IS1X 3KL0A 4PMFA 5EO0A 2O5XL 2DQHL 4J4PA 4WU7A 3KLHD 3VXUD 3FPYA 2UY7B 4ZX5A 1BX2B 2R2HB 3JT2A 1IX2A 4E9YA 1QPPA 2E7BA 3U6RB 1J5OH 3KPSB 4ZOEA 2R1YA 5DO8A 2P49B 1EZLA 3U9UA 2J88L 2IANA 3ML8A 1TJIL 1J1XH 1X44A 1P7KA 4H13C 3U46A 3VYPA 3ARRA 2A9AA 4FJ6A 2WKGA 4OW6A 1OLZA 4U3SA 2JIXD 1JYVA 3TN0D 2B39A 1N26A 1X5XA 1UEMA 4OZHF 3QFDA 4U1KB 2VMEA 1A7OH 5F7AA 5CXPA 3RX7A 4KJQC 4LVNC 4F8NA 4XP5H 4N5EC 4BFIA 2YA2A 2WWNA 4YHPA 5KN5A 3RIAF 4ENEC 4DAGH 1G9NC 3SBRA 1AHWA 1OAUL 3D2UD 5D93B 1NGQH 1OE1A 2JLLA 5MP6H 3SGDH 5D1XC 4K8RH 5DD0L 1OV8A 3PWNB 3QO0B 5TH2B 3MRHA 5D7IB 3I02A 1KEGL 5D72L 2YAOA 3HHSA 4LLMA 1OTUD 3GS0A 3HZMB 2VDMB 3W38A 1LO0L 3VA6A 3JWDL 1UD2A 5FCSH 3S3PA 4KKQA 4M8RA 5SWQA 1BEYL 2JJWA 5D7JA 1FVDA 1SXBA 2VO8A 5TPWL 1DLFH 3FQUB 3WNMA 1YEEL 4KDTA 3BDBA 2CLZA 2YD0A 2N1KA 4TULL 3VFRA 1EHLL 1P5UC 2K6ZA 4PVMA 5JIKA 1IGTB 1QFPA 3WTVA 4NP4H 4ZTOH 2DQJL 2X2JA 1EWHA 1ZIBA 4YFDB 4WFHD 3IDMA 4XXDA 2Q3XA 4X4ZA 4HEPA 2EC9T 3FYIB 3QDHA 4PCYA 2VXTL 1I1YA 3HC4L 4BFEA 4TLKA 1SLUA 4PJ8A 2E7DA 4Y9EA 3X11A 5M7QA 1RZFH 5LXVA 2EDEA 4Z7OE 2OAAA 4YK4B 7PAZA 1ILUA 4RA0C 4WEEA 3C9NA 5EN2A 4QRRB 4MNGE 1J5HA 5BRZA 1RHHB 2H6OA 4YXKH 2DD8H 5SV4A 2E6JA 4PY8I 1JSYA 3EYFA 1YDPB 4ZXBD 1P7QD 1I9RL 4W9IC 3WE6A 3DBXA 2XPZA 4KKPA 4KQ3H 4JUTA 2AKRB 4DFIA 3EYSH 3R8BB 3IJHA 4H0GA 1M9SA 3QUXA 3B4NA 3VDCA 5EG6C 4K94C 4L29B 5DCCA 2M2DA 3LTVA 4KY1L 1LD9B 1BQLL 1RJYB 1WSST 3BP7A 5I76B 2VLJD 3IDYB 4TL5A 1YEDA 4NO2A 1U3JA 1WFOA 1XEUA 4PGEA 2Q7NA 5AVQB 3HZ3A 5CFHA 2CM6A 4A7GF 1EHKB 2YUWA 4DEPC 1F18A 3IFNL 2OL3L 2E8YA 4K7PL 1SVBA 1SFDA 3VE0A 4DZBB 6FABH 4OZ4A 2FB4L 5FHAH 2VDRL 3SDAC 3EJQA 4K9EC 2VDLB 5DD6A 5F1SA 3VFNA 5IROC 32C2B 4LLWA 1JCVA 2AXHA 3RNQB 3FU6A 5EF3A 4QXGH 1CD0A 2WYHA 1MZZA 3ME0B 2Y9RT 3CTTA 3MCKA 1H3UA 3ZY7A 2YEZA 1GRWA 2ZUQB 4JJHA 3O4LD 2Q3ZA 3ULVF 4DO5A 3CFBA 2FZ3A 3OJ2C 1XGYL 3CX2A 4OCMC 2F8IA 1TO4A 1D7DA 3ECUA 4NERA 3IK2A 4XRCB 4PJIF 4G5ZH 5IMMB 4I18C 3RJOA 1KB3A 1DVFA 1W80A 1R3LA 2F7PA 2A1WH 4E42B 4OF5A 3TZVC 2XV2A 1JZJA 2AFNA 1SN5A 4ERSL 3VXNA 2UVFA 5AZUA 1D7BA 5IFAH 4L8SB 3VWKC 5JW4M 5GZNC 2OKMA 3GK8H 4KGLA 4Q89A 5FDYA 3UTOA 3VWJD 3ZYZA 4KKCC 5LG6A 2VXVL 4N85A 4ZFQA 3HC3H 4HH8A 5DFVC 3NFSH 2P24B 3QW9A 4P9MH 4GG6E 4ZK8A 2DYRB 1NAMA 4HEPG 5DJCB 2V17L 4ZSOB 1QSEA 2Z7ZA 3IAPA 3ILEA 3UMNA 4MXWH 2PO6B 3PU7A 3U1PA 4XNYL 4XOAA 4PJHA 2NNRA 5EU7C 3O0LA 4ADJA 2MPAL 4JKPL 5DUBB 1AO7E 5HHVL 2V9RA 2V8LA 1AGEA 1RZKL 5GSRB 3HUJF 2VQ1A 2BH0A 2FL5B 1I7ZA 4OKVB 5I1EH 4FG0A 1A1NA 4MAYA 4W70A 4YC2B 2V7HB 3L95B 1RPKA 2YPLB 1JGEA 4HSCX 1SXAA 5E4EB 3S97C 2QQLH 5C0AA 2P8LA 3N40P 4JO2H 1JL8A 1XEDA 2VO5A 3ISRA 4JE0A 3VXNB 2QEJA 3WS6A 1FAIL 4I3SH 1DCEA 3GSWB 1KT2B 1AS8A 4G8GA 1I8UA 2ICES 2YFNA 3GEWB 1A3RH 4O51A 2YJLA 2G3XA 3COOA 4UZUA 1YMME 3INUH 5HHPB 4GG8B 1YUHA 1JFQH 5HHNB 1A4BA 1XR9A 2PW1B 3QJRB 3CHQA 5IVOA 2A9MH 2B3IA 4N8CL 2D4DA 5C09D 4KKBD 4R5XA 4BWUA 3STLA 1EANA 1AG6A 2YO3A 3NCXA 1QHQA 5ERWA 3J2PA 5BVPL 4XP1H 4AGLA 2VRAA 2YC1A 1KXQE 4P57A 4PRIE 2Q7YA 1NPNA 2YQGA 3G7TA 4NAMA 1LJMA 1DO5A 4DPAX 4QRUB 1GYWA 3FMGL 1NLBL 3RZCB 1MJJA 3BN9C 3VFSB 1CTNA 5FM5M 3X3GH 4FA7B 4CC4A 4O58L 3X1BA 3NCJH 1AKJB 4OZIE 3A4FA 5CJOH 5C0DB 1SYVB 2HRLA 1DQDL 4FTVB 4OV6F 5E8EB 3DO7B 1A6ZA 1CFQB 3OKKA 3QUYB 3EYQC 2X4SB 2ZXWB 4HC1L 1FGNH 3FSOA 4LOFA 5KVGL 3SDXF 3MUHL 2WBJA 4JCWA 1TLMA 1HXYB 4AH2B 1PZ2A 1EEZA 3VDAA 1TOXA 2Y2TA 4LCCB 3WIHL 2BSBA 43C9A 2ICWI 3G9VA 5GHWL 1TNMA 3C5SA 1MLCB 4U3CA 3S37X 3GC3A 1S9KC 3SPIA 1U93A 5F0PB 4ZW3A 4Y2OA 1ANUA 3ET9F 4PJBA 2Y06L 4HHGA 3BHBA 4ALAL 2FO4A 3OR6A 5SWSE 1VFAB 4AL8H 1JZGA 3ALXA 3BWSA 2X4PA 2P8MB 2YGOA 5F3HB 3OKOB 1CLOH 3I9GL 3NPSB 4XXWC 1PKQE 4GSRA 1S7XB 1KN4H 2ZOOA 4XCYA 5E8OB 3GZQA 4PS4H 3IAQA 3MX0B 1FFOB 2J1KA 4EQ3A 2E76C 1OF2A 2WLLB 5AYQA 4AYGA 3QDGA 3VXMA 1NGPH 1OE2A 1MAML 3NJLA 4LPWA 4G72B 4LPVA 4RISH 3P3RA 5LAPA 1K85A 1CIUA 5I1JH 3PHQB 4U6VH 2FJFB 3DX7B 1U2YA 2QQKL 4CILA 4RBPH 4TRPL 4P59L 1ITBB 4LPTA 4GIPD 2YD1A 2YQ3A 4WW2A 1KBGL 4XWGH 4RH4A 5EA0L 1NDMB 4HUUB 2HFGL 3ZJAA 5LKNA 2VAAA 1P1VA 5KW9L 2JCCE 3LNGA 4GXUM 1BWMA 3BVWA 2FBRA 2QVKA 3WEOA 1IGMH 5DS1A 1DL7H 1ZY9A 4NZDA 3HE6C 3LCYA 1I1RA 5GRZA 4IRSD 4ODUA 4E41D 2IPUG 4ZUWA 4IU2B 1J1XL 3LN4A 5KSAA 4Y5XA 1Q9LA 1QVOB 1BQSA 4GRLD 3DVGB 2W5PA 5EBGA 4JGMA 1I8KB 1HXMA 4XGZB 3O3DA 1U8HA 2G5RA 4FTDA 3GJEB 1A7OL 1L3WA 4KRPC 4I1PA 1MHCA 5JLZA 1E7VA 4M6OH 4XP5L 3SN6N 5AB2A 1T0NB 1NFDA 1IGJB 4X7SH 1JZHA 4V1DA 4AGOA 5FYJD 2Q7AA 3UTSE 3ETBJ 3MZTA 4A6YA 4DAGL 5D2NB 5MP6L 2LFGA 1NGQL 3SY6A 2VKWA 5F7DA 5IJKC 4OBRA 2BXYA 4K8RL 3HIZA 3O6FA 1S3RA 2OXHB 1DQTA 1T1XA 5HI3C 3U25A 4UQBA 1CDGA 2J1YA 2XV3A 3B9DA 1J9TA 1RUPH 3H4FA 2W60A 1F4AA 1Y6MR 1GOFA 4PG2C 4RBPK 4X5LA 2R51A 4QRSB 5DLML 2ATPB 2HJFB 4KV5E 4Y7MA 5DUPL 5ICZA 5DJ8B 4Z8FH 4LSTH 5EOCJ 4L48A 4PJGE 2BIQA 2FO8A 3VQ1C 1HAUA 1AZRA 3DI3B 3CX5K 1DLFL 3UC0H 4PLJD 3CVHB 3REVB 3KH4A 3U4EA 5EUOA 4L9DA 2Y6SD 1KYOJ 2NUTB 1IAMA 4TKWA 3AS0A 3LEXB 4NP4L 4ZTOL 4GBXC 3CDCA 1CXLA 2KPNA 1TEYA 5D4QA 2H1PH 1ZWIB 3OM3B 3C5XA 2EDTA 3AWFA 5JIHA 2D3JA 3ILQC 4XAKE 1ZGLM 1T7XA 1RZFL 2VLKB 3EFFA 1WQVT 4LEOA 4E0RB 1ADQL 1W6LA 3WV0A 4PLNC 1MFMA 1SQ2N 4NQCA 1GYUA 4L3CA 3CZNA 4EAEA 2QT6A 1MWAL 4S10A 4QJ4B 2A6DA 3IGFA 4N87A 2WZAA 5KBNC 4P23C 2DD8L 5L2JA 3T3ME 4OGAC 4KU1A 1MVUA 2VAJA 4KK8D 1K2DA 4WSJA 1F3JA 3MRLA 1XGZA 3MBED 2FE0A 3I50H 5CGMA 4KQ3L 1CE1H 5B7EA 1S46A 4M5SA 2ZNXA 3EYSL 1T20A 3OKYA 4FQQA 4P2RB 1SYSA 2KI6A 4WTZA 1M2VB 2IAMB 1DN2A 1ASPA 1OGTA 4L4TE 5IVXB 3RKDD 3TU6A 4CJ0A 4PJDB 3FUIA 2A9DA 2OI9C 1XB6A 4X98B 5BJTA 4CDHA 1BIIA 2APTA 1A2YB 4IGBC 4A37A 4EDXB 1QSFB 4F80A 1VA9A 4GI9A 2BSSB 3C5ZA 4JKMA 3MR9A 3OGCB 5CKGA 6FABL 4J3XA 2HAZA 1YVLA 4RMSA 2EVGA 1LDPH 3LQZA 3FFCE 3K1DA 3RDJA 4ELMF 5LG1A 4WWID 1JWSB 3HZVA 4NJAH 4BWWA 1TJMA 4NQTA 4BELD 1HYSC 4OZFH 4EDWH 1L0YA 4OIAA 4U6YB 2HLAA 5CMAA 3NJFA 4QXGL 1NCDH 1ET8A 2YBGA 4NO3B 1U8OA 4YHMH 1K8IB 1IGYA 4HJGA 3HBPA 3SYCA 4KROB 3DX0A 5HVWA 3V6OA 1TPXB 3BISA 1IGIH 3IE4A 2WJ7A 3EJSA 4G5ZL 3S9DB 2EUZA 1A7NH 3WSQH 5EPMB 1GVIA 2W9EH 2R7EA 1WD8A 3R4RA 1BBDH 2A1WL 3KPOB 2P5WA 4EI5A 3C8KB 5HXMA 3OKMA 2Q87A 1X5FA 3BIKA 3E3QC 4MAZA 5IFAL 2YGVA 5BOJA 1V54B 3RTQA 2M1KA 3GK8L 4GFXA 1KJ3H 3NIFF 1EZSA 2ZE0A 2W0LA 3HC3L 5KS9E 3VMPA 4MA1C 4A2LA 3NFSL 1NWPA 2XZAH 4P9ML 5HHOB 2G2PA 1OL0A 5L6YH 1S7TB 4KJPD 1EVUA 4Z7VB 3GHPA 2CGRH 4W9ZA 3UTTA 5DF0A 4MXWL 2A5UA 4AW7A 1D5ZB 4JNXA 3OQRA 2AEOA 2OSWA 4X7TB 5DYOB 5HHMD 1UZ8B 1AZUA 4RZCB 4BV1A 1OM3H 4FYRA 2RACA 3HMWL 4JPIA 1WA1X 3BH9A 4YDVA 1TJXA 4FD0A 3ZVVA 4NX0A 3VD1A 4LKXB 5I1EL 4LHQB 4PJ7E 4J27A 4XX5A 5HGDB 1G84A 2X0VA 1JZ8A 3RX9A 5F8RC 3QWRD 1YNLL 2XA3A 3SZKC 5ES4B 4Z7AA 4KHXH 3MRIA 2VR8A 3ASNB 3D85B 4X0NA 3PWPE 2BS71 4TUJA 4YO0B 2OZ4A 2VR5A 1ZHLA 3KYMA 2GSMB 1U91A 4I3SL 3V4PA 4HYTB 1FORL 4WTQA 4C57C 4TOYH 3Q44A 1A3RL 1ND0B 5B8CC 3PWJA 3DXAA 3INUL 3EDEA 4P2OC 2JSFA 2B59A 5CN1A 4AK2A 3QIUC 5SX4I 4OY9A 5B38A 1JFQL 4AEHH 4F2MA 4FQXA 4QNPF 3MLSH 5IHBA 4IMKC 3I6SA 1HDMA 5DZLA 1FGVH 1FNLA 2A9ML 4L0YA 4NNYB 3FU7B 4L4VE 4X0KB 1QR1A 1PLBA 2ZD0A 4F1SA 4AM0B 1B3JA 4RESB 2XWRA 2RTTA 3WJJA 3WO3B 5HJ3A 3C2SA 4R4BA 1VFBA 2N0KA 2PCPA 4YXHL 5KJ7E 5IV2A 3QWNA 4DN3H 5FEBA 1DE4A 1S4IA 1T22A 4KI5F 4X2UA 4FMVA 4HUWB 3BAJA 5AVXB 5AB9A 5I75C 5BUGA 2JIXA 4GEJA 4R2GC 3PL6A 1L9OA 4IOIA 4XP1L 3TN0A 4EMZA 2XICA 3EFDH 3HMXH 2GUYA 2PWDA 5DGRA 1TENA 4XAWH 1PU0A 4YXLL 2HVBA 2NZ9C 1DDHA 3PNWB 4I3RH 4UTBL 4CU6A 1QRKA 4NKMB 1RZQA 3UTQB 1VGEH 2HRHA 2Z93A 1EBPA 3EG9A 5EF0A 2ADGB 1JXJA 2WTPA 3D2UA 4GSQA 4K2UH 2VLME 4OJYA 1X5HA 3X3GL 4ZFZB 3K6DA 3VGEA 2DWDB 1N6VA 1UA7A 4OQTH 1QD0A 4UDUA 3CHRA 3L3DB 3NCJL 5MERB 4F24A 1YEHL 1VIWA 5CJOL 3T0EB 5IIEA 1E9OB 3BPOC 3TCTA 3IFOB 5IKCB 4EUPG 3H3BC 5E6YA 1FGNL 2PXYB 2NTFB 3NG5A 3MRBB 4PRNA 1L3NA 3MV01 4MVBC 1KPUB 4ZMWA 4RAUB 3K8KA 3H0TB 1H8LA 5CM1A 1DTUA 2EEAA 4P5TB 2ITCB 3FT2B 2A6KB 3WS3B 4PG9B 5GGVH 1C7SA 3TBYB 1Q90A 3VH8G 3S5ZA 3NRQA 4G6JH 4YSQA 4NZJA 2P48B 2Z31D 1JD7A 1M42A 3HI1B 3KM1A 3RPIA 4AYFA 4CU8A 2B16A 1GZHA 1Y0LB 2A4EA 4FG6D 4BA0A 1DBJH 1YPZE 3FTGB 4RGNC 2MNWA 2PYEE 4UU9B 5DEFB 4YHKH 4LRIA 5CGYC 3B34A 1MLBA 1CQKA 3N42B 5H37A 3OZKA 1QWUA 4G9FE 4HH9B 2WB7A 1XMEB 3EOTH 4CSPA 5I5IA 1PZUB 3SBPA 3EYVA 4AKOA 2WMPA 1O9ZA 1XF2A 1NOFA 3QQXA 1CLOL 5KSBF 2EDHA 3L3IA 1I53A 2DBJA 2HKAA 2JK5A 3JUYA 5FK9A 2F1BA 3CSTA 4PGDA 3RWDB 2HX7A 4ZXBA 1JZ5A 1KN4L 1LNUA 5F21B 2OYKA 4HLZG 4HIPA 3QPQC 4PB9H 1GCYA 4PS4L 3K6IA 4Q2ZB 2I9LA 3B7RL 1NBYB 5AAPA 3R7RA 2LLNA 4WWOA 4ZDHB 4MD5A 2EP6A 4RMQA 4KUZH 5GIRB 3ZE2F 5J6HB 4RISL 1WS8A 3LKNB 3QNZB 4HHAB 3S3SA 3UZVB 3CK0H 5I1JL 3CZSA 1ED3A 1F3DJ 2NY3B 4U6VL 4ZTEA 3TCLB 4OD1H 5AD0B 2G4EA 1QMUA 3T3PE 1TFHA 4ZYKB 2RD0A 1MHPH 3BGAA 4P04A 4LNVA 2VLJA 4JAMB 5DVNA 1BJ1J 1ZVSB 1ZT4B 5E9DE 2H7WA 3O9WD 1AP2A 2X7LB 3EJZC 3KLLA 1OP9A 4MA7H 1MH5A 2YKLH 4XWGL 3SKMB 1J05A 3AAZB 1E2VA 4L0ZA 1I3UA 4JM2D 4MCZA 4UAOB 4LSRH 3EW3B 2XI9A 5I1HH 4TS6A 2R23A 2AQNA 3AACA 1DL7L 1Q1PA 2QSTA 5BZXA 2GFBA 5JPMC 1L9PA 1JPTH 4HCRA 2WWMD 4OZFA 1SBBA 1F97A 2Z91A 3SBQA 1YEKH 2EKJA 1U8KB 3N1GC 1I31A 3QR0A 4XI5C 5IB5B 4AX3A 2BP5M 2HKHH 3FZUD 3P69A 4MX7A 2F5BL 3TBBA 2UZYB 2WXRA 3O4LA 4RMVA 3BO8B 1FRGH 1PLAA 1Y18A 3NCBB 2QTEA 4F5CA 5KYYB 1KJ2A 3FTUA 3ARBD 3L1GA 3BKJH 4MA8H 5E5MB 2YA1A 4ONFH 3MUGA 3MCG1 4I9WD 3KJ4B 4X7SL 1ZT1B 2NY5C 1TZIA 1AOHA 2EYSA 2BSCA 4EO5A 4R90H 3IMRA 2DB8A 3GSOA 3MRNB 1RUPL 2OMUA 4ANVA 3UAAA 3T8VA 2GJ6D 4J3OG 4Z8FL 2K3TA 3K3QA 3MYJA 4LSTL 3G08B 1FL6B 4OJFL 2I25N 3FH7A 4HKXB 1L6PA 2V0AA 1I85A 3I2CH 2IXQB 1GAFH 2R27A 3PGCB 1LE5A 5C8JB 3UC0L 1N10A 3CFKA 1UA3A 4ATWA 4GW4B 3ZTDC 2Q2LA 3DDGA 2R69A 4OAWB 4WLCA 4PN6A 5DQ9B 3FQ4A 1RU9H 3N06B 3Q9QA 4ZUUA 5I2IB 4P5RA 1CN4A 4HEMA 1IEBB 5I1GL 3L16A 3IM1A 5CSGA 1FV1B 2H1PL 3FO1B 3GIZH 3NA9H 2XPGA 2CMRH 1EDYA 4W81A 2EDOA 4M5ZH 1J0JA 3FQTB 1N7MH 1MXGA 3MROA 5EBWA 1IRAY 3O8XD 2LQRA 5DC2A 5F1OB 1DFXA 4F8QA 1DZBA 3AB0C 2E7CA 1BG1A 1HHJA 3V7MA 3VFVA 1HWWA 1Y6NR 3MLRH 1IM3B 2FEDD 4FI6A 4XMKL 3REWB 1BXAA 1CGWA 2DEWX 4YSRA 4LSVH 3CJJA 2QVIA 4KRLB 2Q1EA 4AW4A 4H25A 3QP3A 5AVRB 5AFAA 1MHEB 2PR4H 4FEMA 5C09A 4G7YL 4BFOA 2BHUA 2G0LA 3ZHKA 4UT9A 2ALAA 2BFGA 2WGNB 2NZIA 1U3HD 4QY8B 1RULH 4MKMA 4OR1A 5DMKA 4N68A 3WOVA 5CSZA 5IEHB 5MI0C 1CE1L 5IT2H 5F1NA 4LVNB 1R19A 4AGNA 2W65B 3F12A 4CN1A 4OIIL 4ORGB 4M61A 3HMXA 4N8PA 3QXAA 3IGAA 4HS6A 5D1XB 3GM0A 4DETA 1QWNA 1PZAA 3DOSA 1CURA 5GGQL 4CNIB 3Q5TA 3BEVB 3QUZA 4ES8A 1WA2X 3MCYA 4KKLD 3TJHD 4F8PA 1FFPA 1Q4NX 5DJZB 1HWGB 2BCMA 5T3ZE 3EYUH 5E5UB 4FFWD 2R0ZH 1GTFA 3W3BA 2HPOA 2OW6A 3OR7B 4NJAL 2Y7LA 3LKSB 3HI5H 4W6XB 4NI6A 4PJEB 4EDWL 3QEHA 4BH8A 4IEFA 5A3ID 2DMCA 3T0AA 3HZYA 5JHDD 5KJ4A 1NCDL 2JE8A 1KGCD 3DUSB 3T0WA 2CRIA 1EVTC 3BCDA 5I6OA 4ODTH 4RDQG 4YHML 4LAQH 5GS0D 4BQ9A 4MFHA 1P9MA 2E7LC 3ULVC 1XQ4A 2AV7A 2AMUA 5LGJB 3CIAA 1IGIL 4L0PB 2ENPA 3K4AA 5EIVA 3ZMRA 1P5VB 4U1SA 1A7NL 3WSQL 4G9DA 3V0DA 2W9EL 4JPSA 4FZ8H 3GNMH 1BBDL 3MV9B 1FNEB 4HJJH 4NAJA 4NCC2 3BUYA 1I1FA 3L1EA 1E5YA 3MJ8B 3IKCA 3QWOA 2OJZH 3L3OA 5C0BB 3HLAA 4JFOB 2OCJA 1KJ3L 4JFUA 3V0WH 2Z8WC 3CWGA 4PS8A 3RGBA 1IAII 5GS1A 2D7NA 2XZAL 3FSWA 5L6YL 3CFJB 1P84K 4QEGA 2CGRL 3E7JA 2VITA 1E4HA 1D5RA 5PCYA 1KCRL 1P4IH 1LHZA 1IKNA 1SQMA 1F13A 3IDNA 3ROOB 5JXEC 5G5DA 1UXLA 2SODB 3SDDD 2Z4QA 4LLVA 2ZIDA 1OM3L 3BWUF 4G43B 4WO0A 3VG9C 1ZA6A 1J0KA 3OG6B 1AIFA 3OJMB 1NCNA 3U4BH 5F89A 4LLAA 4CVXA 2E7MA 4N2AA 3IGLA 1GA2A 1TTFA 2B1AH 2QPEB 2OX5B 1OT2A 5H2BB 2MSPA 4W6WB 4J3SA 5CEYB 4DEPB 5EULV 1AS7A 1Z9SA 4KHXL 5ICXB 5K59E 2V5RA 5KYWA 4P5MA 4G7SB 5AAWA 3SDAB 5C7XH 5E8DH 2XN9E 4KKNA 3T1FB 5IMOA 1HH6B 4WHTA 5BS0D 1JYNA 4KTYA 2BNRE 2XWZA 3RFZC 3APNA 4BZ1A 1NCAL 3HRZC 1J87A 2CIKA 4AEHL 3MLSL 3O3EB 3EJYC 1ZA3B 1IEHA 1PZ5A 1V7MH 5FYKE 1KBPA 5I26A 1HEZA 3QJXA 3LB6D 4I0PB 4IRSA 4MNGA 3S8FB 4F93B 4E41A 4DN3L 4GRWE 4I18B 2AXFB 3UZEA 1HHHB 2DQFB 1DQMH 3ZDXF 4GRLA 1YECH 3H9HB 5IQ9A 2WQAA 4X7EC 3HMXL 1SM3H 3VWKB 1NC2B 3GWJA 2WW8A 4XAWL 5D8JH 4M6ML 5G4MA 4WJ5B 2YRLA 2ZCLH 1XGTB 4I3RL 5JW4N 3WAJA 1E8WA 3LAFA 4Z7WA 3MA9H 1UM5H 1KWGA 2YBRB 2GSIB 2HJLB 4K2UL 2FGZA 5J3HD 3WNJA 5HY9B 4HIJB 1RI8A 5GS2D 4BKSC 1HHGA 4FI7A 4HD9A 4DKFH 4OQTL 4TNGA 1J8HD 5DC4B 2AS5M 5LAXA 4ICXA 3ROLB 4UT7H 4BDVB 3GBEA 4XBPA 2QDVA 4HCIA 4WDIA 5E00B 3KPSE 3EOAB 4OUOA 1WBZA 2ZCZA 4JDVA 4TVSa 3CFNA 1FN4A 3O3AB 4HU2A 5IW3A 1FHGA 2NDFA 4C83A 4YOKA 1E4KC 3ZE0E 5EZOH 2A2QT 1HZLA 3Q1SH 5GGVL 3H6JA 1YJDH 1AIZA 4NZFA 3NSCA 2FVNA 2KC0A 3KPPB 5MENB 4G6JL 4LLQB 6TAAA 5H35A 1F1DA 1EIBA 1OP4A 4KRNA 2R83A 2A74C 2RCSL 4PJAF 3RWHA 4YBLC 1NKOA 5IBUG 2DJ4A 3GIVA 4YAQA 1DBJL 3FQNA 4JGUA 4PVNA 1JBJA 2WZ0A 2NY0C 4L8CB 1BPLB 3D0VB 3PJSA 5EEUA 2AXGA 8CGTA 2XZQH 3KGRA 3IN2A 3EOTL 4PJCB 5J11C 3WTYA 2HFEA 4RCAA 2XC8A 3P30H 4WJKB 5C6WH 3ARSA 3U0PA 2XLLA 1J5DA 4JPQA 4XN2A 4RFEA 1AZBA 1WWWX 4GG6A 4R6UA 3MJ9A 2ADIB 1JZFA 4L8DA 2YMOA 1NANH 3MBEA 1CBVH 3GLEA 3OJDA 4Y16B 4IM8A 1AMXA 2YD6A 5D71L 1ASQA 2P5EE 1VF5C 2EDFA 2WPGA 3WIIH 5IMLA 2YMTA 4ZUTB 4KUZL 4JY4B 3DMMD 3IJSB 4UBDC 4PJBF 5IB1B 4BQCA 3WFCH 1OW0C 1BM3H 3CK0L 1G7JA 2K70A 1A7RH 2FT7A 3O11B 4OD1L 5DWPA 3T1WA 1MHPL 1YN6A 1PW3A 1AXSA 2KQNA 3MOBH 4QRQA 1HL4A 3UZQB 3V0GA 3RWFB 5I1CH 4ES9A 3HB3D 5HJDA 3X17A 3CDGB 3SPVB 3NEOA 4N6RA 1TU2A 3PDDA 2RJMA 3TO4B 3PHAA 5KEZA 2YKLL 5IW6A 1MCSA 1N19A 3T04D 1RVFH 5EORL 4LSRL 2ZP8A 4I9XA 5I1HL 3ZIMA 3WMSA 3B3BA 3C87A 3MTRA 5FYLE 4QRRE 1U8IA 1H15A 1UM6H 4ZQKB 1JPTL 4U2YA 3PIQA 1YEKL 4H5SA 4HUVA 5ELIA 1FFNA 4A2FA 2D31A 2HKHL 3A6OA 1CG9B 3TFBA 4YSSA 4XB7A 2NR6C 3BVVA 4Z95H 2CUAA 4Y4FB 1WS7A 1X7QA 3MC0A 4LKCA 4WW2F 4MA8L 3ARPA 3X2QB 5ENWB 2KDYA 1TZGH 4OF3A 4MD4A 4L5FE 4WGWB 3Q7JA 3MRPB 4PR5B 3SE3A 2HVJA 2JI3A 1EZUA 4BK5C 4R90L 1QA9B 2FT8A 4W9KC 5ABAA 2X09A 4AQ1C 4JL2A 3QDJB 2LGNA 3WN5A 1EGJA 4X5RA 4F57H 1GS7A 5ECGA 3TM6A 1UT1A 2Z8RA 4LVEA 2DLGA 1JXGA 1WC7B 2Z8SA 3VD5A 3BSZA 4P4KC 1MVYA 1O6TA 3VXSB 1TQVA 2AERT 3BQUD 2ZAHA 3I2CL 4EZJA 5IB3B 1KTLB 1YY9D 3TEWA 4WHYG 4BUGA 3GB7A 1ZTXE 1J9SA 1HSAB 2MIZA 3TLRA 1U58B 3DSFL 3KCWA 5GJSH 3LJ3A 1RU9L 1B0GB 3A6CH 4PJ6A 1JDDA 1U8CA 3I02B 3P3UA 3HG2A 5BV7B 5IR1A 2I5YH 3IDJB 3GIZL 3QH3A 1ICTA 2PWHA 2CMRL 2Z64C 3OB0H 5LDUA 4GINA 4K7PX 2OMTA 4M5ZL 2VISA 4F7PB 3E9UA 1N7ML 1F58H 5AG8A 1UXMA 3EO1A 4GXUN 3TBSA 4J3UA 2PABA 2JJTA 4OLYH 3VGDA 2HN7B 3TONA 3MLRL 1FNAA 2J72A 4FQLH 4HDIA 4N0FB 3ESMA 3C6LC 2N7SA 4LSVL 4JDEA 3ARFD 1NBZA 1IM9B 3H3KA 4J7RA 2Y1VA 3V6FB 1RZ8A 2PR4L 1QFHA 3LQAH 5F96H 5J13B 2PP7A 3PWUB 5GSVA 4FABH 5IT2L 3VFOB 3X11B 3JZYA 2CLRB 1TTUA 1NGWA 2CDGB 3OX8A 1R5VA 4KJWD 1M9WA 2VL5B 1ETZA 3B9AA 4LBAA 3C9NB 4AYEC 5E94A 3QHTC 4HS3B 1R3IH 1QFOA 1N18A 1Z66A 4HKBA 1QPXA 3F7VB 5EU4A 5DK0B 4UMSA 1EV2E 1FI8C 1P6FA 1DZ0A 3NDYE 1ES0B 2Y5EA 4B3VA 2V6HA 3NBNA 5D1ZD 4UUJA 4DTGL 2Z34A 4UQ2B 3UGXA 5IFHH 1H6EA 5FECA 12E8H 2GHWB 5E8NB 4RAVA 3GXPA 3EYUL 5C0RH 5I8CB 1UCBH 1Q9KA 1PIFA 2R0ZL 5LBSH 2FJSA 3PPEA 5SWZB 3KYNB 3OB0K 4HLJA 4HSAC 2FX9H 3OF6D 5J6SA 1GHFH 4PW4A 4PLKC 2BNRD 3HI5L 2MFNA 2DYPD 3M17B 3EOBB 5F44A 4U1LA 1D2PA 3FQ2A 5IHWA 4W9EC 3SKNA 3L4VA 3BP7B 4JG0H 4Q9CA 4A2MA 1S9YA 1QEWA 1QR4A 3L4TA 1HILB 4AQEB 1LEGA 3SDCD 4ODTL 2LABA 4LAQL 3MV8B 1EHXA 3K2UL 2AC0A 1GGCL 4LIQE 5DJ0A 1O7DC 2Z31A 4OB5H 4ZMYA 1AGCA 4FZ8L 3GNML 2MCAA 4HJJL 1ZGLB 1RV6X 2R2CA 2OJZL 1BFSA 5IJVA 1WA0X 3V0WL 2UYLA 4A7VA 3UTSA 4DESA 1A7PH 1K4CA 5ILTH 4U1HA 3QUKA 2VZUA 5F0LB 3WLBA 3ABZA 5E95B 2OTPA 2Z7UA 3QRFM 1YSOA 2E59A 4YL9A 1N3NA 2NCMA 1P4IL 1WDAA 1T66C 3LNFA 1U41A 4WU5A 1DVFB 1FFRA 4AE1A 4CMMB 1QTSA 1I3RB 4Y5YA 3FPXA 4GKZB 4PJ9C 1ZLVH 4ZZFA 1HKLH 2OMZB 3KPSD 3PFQA 3QUMH 4DVRH 2ADYA 2VN6A 2H41A 1RK0B 3HPLA 1MFCH 1ZE3H 2R2BA 4UILH 3U4BL 5HYFA 1R3JA 4PQXA 5C07E 4DSYA 1NFAA 1L9SA 4IGBB 5B3SB 1NAMB 4GT7A 5DZPA 1PFCA 4WV1B 4R0LA 2IC2A 1FC1A 3GXFA 1KBBA 5K9KB 4XP9L 4PJHB 3O9WA 1T6WA 4FZEH 5C7XL 4YHZH 1Q9WB 2E7HA 2ZG3A 3Q5YA 4P46D 5ITBL 1AGEB 3MV7D 3GMNA 3NSDA 4JM2A 5DO2D 3QXDB 1U4EA 4NI3A 4N0CC 4FDWA 4GUQA 4PUBH 1A64A 2IO5A 3I6KB 1I7ZB 2Q86A 4V2CB 4YFLI 4D3CH 5EDXA 4N90D 4MAYB 4ZW8A 2EVFA 3NRFA 5LGYA 4PVBA 1V3LA 4X6CF 3K80A 4GLRH 4KK6D 5C0AB 4X7FC 2P8LB 3ZL1A 1II4E 4DOHB 5FKPA 2DJSA 4HK0B 4CBPA 3EGDA 4P3CH 4WNJA 1DQML 1W0WA 5AOIA 5C0CB 4G6AD 4B7IA 4KI5C 1U8LB 1TDQA 3QYMA 1NH6A 1PVHA 4IBZA 1YY8A 3VI4F 1SM3L 4L23A 1HZHH 1P2CA 1WFTA 2BM3A 5D8JL 4QRTA 3DV4A 1YUHB 2JB6B 3AQZA 3UJIL 3F7RA 3WN5C 1JF6A 1B4RA 1ZLVK 4MA1B 1NMCC 2EDKA 2X6MA 2XYCA 3MA9L 1CT8B 3CUPA 3FF7A 5HI4C 3CE1A 5L4IA 2ZOLB 2UWEA 2QSCH 2D7PA 2IH3A 4M7JH 2NUPA 4LZKA 4X4MA 3F7YB 1U8JA 3HFML 5D7SH 3STLB 4DKFL 5F7HA 3QIWB 3WTWA 2E56A 1JUFA 3RQ3A 4UT7L 2L04A 4MS6A 4W6YB 4KKZA 2GJ6A 5AW6B 4IMLA 3VD7A 4IRZH 4HIEB 2EKSB 3FFCA 1G7HB 3OQ3B 4KY2A 4BCXA 3WTUA 5DJAA 1NOLA 1T7YA 3C60C 4JO3H 4UDTB 5I15H 1AH1A 3SOBL 3MVSA 1MXDA 3TO2A 1MJJB 4UANA 1SN0A 2EEDA 1KMGA 3KLAB 4J8RB 3AGVA 3EYOB 3O6MH 5EZOL 3Q1SL 2ZOUA 3CZFA 1AC0A 1HU8A 2DWEB 4K94H 1NEZB 3ZKNC 3SZ6A 1MCQA 2GIXA 2VT0A 3RDTD 4ODXA 3DSNA 5AKTA 4AENA 3GMQA 4Z77A 3GSVB 3P4OA 5E9NA 4EN2A 1A6ZB 2ZF8A 4KO9A 4ABUA 1ZSDB 1IQWH 2GSGB 3CFEB 3HJEA 1RIHH 4NHUA 1J0ZA 4QHMA 4H8QA 4RX4D 5D2NE 3S3BB 4XE0A 4OBSA 4H1LH 1NC4B 5DHVA 2XZQL 1FF5A 3B9KC 5AOZA 3VXRE 2N3JA 1J0YA 3KBPA 3P30L 1A1MB 2C1OB 5HGAB 2W59A 3JWNC 5KS9A 4P4RB 1CXIA 2QVTA 4JHAH 1HQRB 4P0DA 1JI2A 4HKZA 3RG1C 2X38A 4M43L 4PGCA 1AQKL 5CN3A 1U8QA 1S3KH 4KZCA 1ESOA 1NINA 1CBVL 4MTMA 1U3HA 1K8DB 2GW5A 2GK2A 4KK9D 3WIIL 5I66A 4L8BA 1C8QA 3HZKB 4ZAKC 5AVWB 2EDYA 4CVZB 3DDFA 4Z7NB 2D03H 3WFCL 3WFHA 4N0UB 2E6QA 1BM3L 3V4VB 2EXTA 2FIRT 4R8WH 2ICWJ 1A7RL 3FN3A 4B9GA 1RZ7H 4NB7A 3MOBL 1S9VB 4FNUA 1CGTA 1ACXA 3RVVD 4PJFE 3BPOB 4NNPH 4WFED 3CH8A 1YYCA 4LSPH 1XCTB 2VLKE 1QHPA 1VKXA 4RMWA 3N1QC 4JFEE 1JRHH 1WG3A 1RVFL 2BXZA 4EVNB 1NDGA 2BOCB 1HEHC 1I8MA 3C08H 3RL2B 5C0GB 2AVGA 5A16A 3S88H 1EAOA 5DDHA 4UYPA 3LPFA 1Z9LA 4TLTA 3POCA 5MHSE 2XFXA 5B1AB 5TE4L 2NY2C 5JNYA 1IARB 2JXMA 4IHOA 4OZGB 4Z7UF 3EUUA 4Z95L 1IJNA 2GJRA 4N1EA 3US0A 1Q0XH 3IRPX 4RGNB 4P2RE 1QQDB 4QI3A 2YPVH 4AV5A 3HE7C 3ZDZB 1TZGL 3QR2A 3L08A 3SYAA 1X5GA 3IPFA 2AJYH 1MWOA 3II2A 5IVXE 4PJDE 5D5MA 4XOBA 4J4PC 1LWRA 5D1QE 5DQDL 3SOTA 3CBRA 2YPLD 3O41A 2BMKB 4AIOA 1G7MA 1QSFE 2HG0A 1TCRA 3V5HA 1R5IB 3X1EA 5EDSA 3M88A 4AIEA 4NN7B 2RBLA 4F57L 1WWCA 1RUKH 2L3BA 1N8ZB 1ZANH 4CADA 3OPZH 5T3ZH 3LZPA 4XO3A 3D0LB 4B9FA 1T0MA 4HU8A 1U8HB 1CTMA 1FCGA 4HWBH 1CGVA 4JHWH 2GCYA 1XGRA 3SDDA 1BFOB 1NFKA 1FO0B 4ELKB 4Z5RA 5I1AB 2FQGA 2Z8VC 5LGKA 3KDMB 5IY5B 2UZXA 4KNTA 4KXAA 1SGKA 5DRZA 3OD3A 3V7AG 1R3KA 2H1XA 3O6FB 5T1MA 3OKEB 5KVEE 5I8EA 1AHWC 2CHXA 2UX7A 3A6CL 2XWXA 1MUJB 2DBLH 5DMIH 4XHQA 2W60B 5EEYA 1NSNH 1ZD6A 2KZWA 2BY1A 1RLWA 1ZHNA 4WK4B 1CE6B 5E08H 3T77B 3UERA 5I8OH 3WHXA 1E5UI 2VERA 1IT9L 3OV6A 5H94B 2F7RA 2NW2A 4MJIB 4HMDA 4OLYL 2CG9X 4HJ0C 2CGYA 2GJZA 1USZA 2V2WB 5BS0A 3P73A 2R29H 43CAB 4FQLL 3GYRA 5FM5O 5IK3A 3UDWC 5HHOE 5D7JC 2AJVH 4Z7VE 3LV3B 5C0EB 2J3SA 1RZKC 1I8IB 3HS0C 3IMUA 2WQXA 4NUJA 5F96L 3EHBB 2B0SH 1WBXA 3P11H 3FT4A 1AOZA 1GY2A 3W9EA 3NCFB 1KIUB 2AP2A 3KHQA 4FTVD 4PY7A 5EBMB 1ZLWH 4FABL 2BJMH 3QUYD 1NCBH 1YEFL 3EFFB 4GT0A 2RH0A 4F15C 5B1JA 4OIBA 4L3CB 2Z3FA 1A1OA 3APFA 5FLUA 5KOVC 2IPKB 1R3IL 3ZK0A 3B56A 2A6DB 1GSKA 2CKBH 2FYVA 1Q72H 3DARA 4UT6H 2Q3AA 5L2JB 2CALA 3T8XA 1KFGA 3IVKA 1YNTA 1FAKT 4MD0A 3LSOB 3WTTA 1BMWA 4PJ5B 4S1DC 12E8L 3AU1B 1J8HA 2KZBA 5C0RL 3QQNA 3QVAA 1UCBL 3FB8B 4FQQB 5LBSL 3IJEA 2PN5A 2J8UB 2FX9L 4QTIH 1GHFL 5CIPA 4IHBA 4CW1A 2BK8A 4YBHA 5BW7C 3WFEL 1PYWA 4JG0L 2VW7A 1EAJA 4FNTA 1OSPH 4F37K 5FYKH 4S0SD 1HX0A 2JNZA 3DJTA 3HBQA 5INCA 2FJHA 4H2CA 1O75A 5IFJA 3K74B 4ILDA 1ZK9A 2OJEA 4F7TA 4LHUG 4A2DA 3VAEA 1NGZA 5HDQH 4OB5L 4B0MM 4UZGA 1ZT7B 2O6EA 3H2PA 3KWWA 5AZ2H 2MQGA 5BO1H 1A02N 1AR1C 1HH9A 3P4NA 4R83A 3WL9B 4XN8A 4BZ2A 3FQ1A 3KXFE 5I1IH 3QQDB 1A7PL 3S34L 5ILTL 2V2TA 2CJTA 1JE6A 4J3BA 4HJGB 5LNGA 3CPLA 2FNWA 1D5XA 2P7TB 4M5YH 4NNXB 4FKKA 3LKOB 4WUKH 2VDNL 3VFMA 1UVQA 2ROXA 4TTGA 3OGOE 4NQSA 2GYSA 1ZJAA 2R7EB 3WTSA 1GIGH 1R33A 2BNQB 5D96C 3A4EA 4LOVA 3K72A 4HUXB 1G9HA 3BIKB 1T1ZA 4D0CB 1HKLL 3FNKA 3QUML 3W39B 4DVRL 3DIFA 3RTQB 4EUPB 1N0XH 1Q9OA 2CO1A 3BWUC 1MFCL 3DMMA 1GCFA 1PSKH 4LLUA 2V7NA 3TBVB 2FX8H 3RJQB 1SZNA 3VW3H 1NANI 3VVWA 2OMYA 5GGTH 4HIHA 4MQTB 4TNWK 3VI3A 4KKRA 2ZX7A 1NZRA 5JW5B 3VH8B 5HGHB 1Y1DA 4G8IA 1KXTA 2O5NA 1WYJA 1XXDC 4FZEL 4YHZL 5KVDE 1JV5B 5F9WC 2D4FA 2QKIB 5I6LA 4N5UA 4N3TA 4NP9A 2B3RA 1IE5A 1AZZC 1DUZA 1LO5A 1S7RB 3KPLA 2J8OA 2AEWA 4PUBL 4XODA 4YFEA 1SF5A 4HPYL 4HV8A 3QULA 5DTFB 4AE0A 2DEYX 4MQXD 4WGVB 3LXUX 5EN3A 1Z0NA 3BAEH 2VDMH 3P0YL 2GG1A 2ZSVB 3KLSA 3U48A 1JNHA 1TYJA 1E4JA 5FWRA 4PJIB 2B4CC 3FB5A 4P3CL 1TG8A 3V4PB 4LDCA 1OGSA 2VE6A 2YKKA 3ARQA 4YFLF 1S7QB 2PTUA 4QO1A 3PWJB 1YC7A 1MJ8H 1UOKA 1ET5A 1HZHL 1YAIA 2YRZA 4S1RH 3FUMA 1NLDH 3TIDA 5I17B 3L6FB 3VXUB 4HSQA 4F2MB 4R84A 2RIKA 3BUDA 3UYRH 2ZUUA 2KPWA 1URZA 3IJ9A 2X2YA 4J6RH 5T33H 4Y4HD 4Z7OF 4HG4K 3L2NA 2HRGA 1TSHA 2QADC 1W72L 4NC1C 3OMAB 5JDSA 2F9BT 5FO9B 2HLFD 2Y5TB 5HYJB 3BMVA 5HYQA 3HVNA 5ID0A 2QSCL 3FQXB 2D7TL 2WINA 4M7JL 4A66A 3WHE0 5D7SL 1XZWA 4X4YA 5IOPA 5DRWA 1TVBB 2AEPH 2AV1B 1PG7H 1W0YT 2HUEA 4FFVD 4QCIB 1E9PA 4NXKA 2H45A 4MNQB 5FHBH 3F5WB 1PAMA 4IRZL 3VG9B 1ZHKB 5D6CB 4UQ3B 5FYLH 3M1BA 1FPTH 1KG0A 3HUJB 2NTSP 3K1KC 1HOCB 3BQUA 3FRPG 2XKNB 5I15L 4JO3L 3VNYA 3D39B 2NRDA 3DWTA 4JRWA 2DLEA 4MB5A 5ACLA 2FR4A 4WSKA 1OT1A 3T6ZA 4IBWA 3O6ML 3D25A 2HTKC 4ZX4A 5IGXH 4ZPTA 4A2HA 2WY3B 4K94L 3KPNB 4I2XA 1RSYA 3BGFC 3TNMB 5K33A 4BE6A 1CWVA 3APDA 4K8RC 4RLDA 3VSQA 4P2RD 2DJUA 1UXSB 4W9GC 3GKWH 4XNXH 4HUCA 3G04A 3JBG7 4JQXC 4KUCF 5KJRL 4J5VA 4RETB 4L5FH 2IAMD 2WNKA 1IQWL 4WRLA 1RIHL 5JQ6H 1DR9A 2A83A 1A14H 3L5IA 4APQC 2O61A 1WFJA 5IHLB 1WAAE 2IALB 5IW1B 3UTZB 3ARFA 3MOQA 4MLSA 5KSUB 1RZIA 1QSFD 4BQBA 4F20A 1H3WM 4XCEB 4JHAL 3L5WB 3O45B 5ISZE 4M9OA 2RFXB 4RMTA 5GRWA 4DP6X 3RWCA 3GXIA 3ZZLA 3S8GB 4GKNA 3BIAX 1S3KL 3SKOB 3UX9B 2LFEA 3OLGA 4CKVX 3QHZL 1FYHB 1KIRB 3K81A 5TGBA 3T65B 1NBCA 1FZKA 1N2RA 3F62A 3NCMA 3ARXA 3B6SB 4KKAD 1W91A 1N5YH 2D03L 2V4LA 4R96A 2QBWA 2AABL 1Z32X 1ZTXH 1H9DA 1F0LA 1BXVA 1BW8A 1QBAA 2KKQA 1XH3B 3BUQA 3L2MA 2FSEA 1BGXH 2I07A 5JOPE 3DTXA 4KROD 1XF2B 3ECBA 2CKBA 2ZXCA 1E40A 3VFWA 4MXQC 3ZKMC 4LLDA 1IFRA 1J9RA 1CXEA 2VW6A 3NZHL 5T5NF 4PM1A 2JK5B 4G2AA 5FK9B 4ZXBB 5D1ZA 4NQXA 1AD9B 3WJMB 1CDJA 1P7QB 1HE7A 1LNUB 3KR3L 4NNPL 4PI2A 5I8KL 4YNYB 3DTUB 4LSPL 5D6DA 4Q6IB 2DIJA 1HCVA 3EH4B 3VACA 1W2KT 4XMXA 2WTRA 3IU4H 5E8PA 3KPRE 3OF6A 5BZWA 1Q38A 3C08L 3L3HA 2BNRA 3S88L 1MW1A 2DYPA 2XTJD 3G5VA 3TEZA 1EUUA 5HHOD 1BFVL 1TLKA 1B6UA 1WH0A 3GJFA 4K5OA 4KZDH 2JJVA 1XR8A 2H8PB 2WWOA 3PP4H 2ROYA 2B1HH 3SDCA 1PX3A 3EZJB 2A74B 5K69A 5DHYA 1G7QA 1W9XA 3PV6A 4HIIA 4XVSH 4BK8A 1MH5B 3E9TA 4FKEA 4JDZB 1Q0XL 3W11C 1FJ1A 1KCUH 5D2LE 2ZCHH 4IS6A 4D9QD 2YPVL 1IEAA 3UAJC 4WW2C 2KLSA 5IBLD 3KS0H 3CNKA 3X14B 3KVPA 1M1XA 4P2CG 1WHPA 2XHNA 3W5MA 4O2EA 4P99A 5IHUH 4YPGA 5C6TH 1T04B 2WC7A 3D85D 1AZCA 1VJSA 2IWFA 4ZW7A 3O4LB 1XFPA 2OMWA 4G80A 5DHDA 1XF3A 1RUKL 2CK2A 2DMHA 1ZANL 4XC3H 2EIZB 2XQYK 3OPZL 4JN2B 3JTTA 1AI1H 4QHNA 4YHIB 4Y5XC 4HWBL 2C26A 3QO1B 4JHWL 4PJEE 2QZQA 3MUGB 4OGYH 2OZNA 3WKPA 4H7VA 2UY7A 2X4TB 2E47A 1BX2A 2MRYA 2R2HA 4J1UB 3ZTJH 1NCUA 3U6RA 5I6KA 1PZSA 3KPSA 4Z0BH 1KYFA 5C71A 3RAJH 3VWJB 3CBKB 1TMCB 3GSOB 4XP6H 4LIQH 3OAYH 2DBLL 2E46A 5DMIL 1NSNL 1AGBB 2FATH 5AW7B 2OMNA 3MV9E 5HDBB 3AY4C 3MYJB 3RB7A 3KLQA 5I8OL 1MG2C 4XC1L 1OP5H 5J56B 4X5WB 2GBTA 4OZIF 3PLYA 4NC2B 4X6DB 4P46A 3FAXA 3MV7A 5GRYA 2R29L 4GS7C 4G42B 3X1NA 1FL3A 3BX7C 2NY4C 3C8DA 2AJVL 2BZCA 3FCTB 3QO0A 3PWNA 4FX5A 5TH2A 3D5OF 2HT3C 1ONQB 4PI0A 5I6PA 5D7IA 2B0SL 3RYMA 3P11L 5LWYH 2BP8B 1E6OH 1XSKA 2K9FB 5B1KA 4K3DH 2FLMA 1RKRA 3T0ED 4AQAB 1E43A 3HZMA 3JUZA 4LPXA 5LJYH 4AI7A 4NKDB 4Z23A 2VC2B 2PXYD 1U36A 5FFGA 3B5TA 3VFVB 2WCSA 2IMNA 3CZJA 4ESKA 3FQUA 3WNLA 1FH2A 3OZ9H 3UG3A 4GLRI 4P5TD 2QQNL 3VRLE 2WXNA 4U0QB 5EUKB 1HAWA 2A73B 2WBXA 1Q72L 2Q9OA 1SY6A 1IGTA 4H25B 4UT6L 5HD8C 4U3HA 4HULB 5J06A 4LSSL 5C09B 1UGNA 1EMTL 1O0VA 2AMGA 5E6IC 5IHHA 2GTWB 4BUHA 3NZUA 3DC0A 1MAJA 5F1NB 3OAYK 2QJDA 2JQAA 2ZXDA 5HPMB 4Q14A 4AQ8A 3KGTA 4MAUH 1BREA 4QTIL 3KPQB 2ZXAA 3KPTA 4PRBB 3UAEA 1BBJB 2PP8A 1OP5K 3B9VA 2GK0B 2X9YA 4QRRA 3JQOB 4FP8L 1OT4A 5JZ7D 1OSPL 4HJUA 5FYKL 1MCDA 4MJ4A 1RHHA 3MRDB 2JV6A 2MHAB 1IBBA 4PV8B 1YDPA 1GGUA 5INDB 5LO7A 5HDQL 3NZSA 3UJTL 2GEEA 3BN3B 1VEOA 3RWJB 1MCCA 5AZ2L 3PYCA 3X3FH 4ZQTA 4YS4A 2G5BB 4L29A 3HKZA 5BO1L 1JNNL 1QBBA 3LHAA 3BDYH 2JCCF 2NY3D 1LD9A 2XIDA 2BVPB 3HZYB 4RX4A 1RJYA 3SJVB 5I1IL 5I76A 4YSDA 4DGYL 4LEXL 2IADB 4KX8A 1MFAH 5T1DH 4XO5A 4HPOH 1UWXH 3DGGB 2K45A 2BHFA 2D7OA 4M5YL 1UENA 5I5RA 1Z5LA 4WUKL 4UB0H 3LVEA 5TE6H 4ZMPA 2GY5A 3CV5A 4DZBA 2JKLA 2V5YA 5FO2A 1J9QA 2EILB 3AJ7A 3OKLB 4FYQA 4IOSD 3IKCB 1UD8A 2PWEA 4GP4B 2KH2B 3WNOA 3BRDA 32C2A 1FVCB 4OU3A 3IKKA 3RNQA 3O2DA 4BD4A 3ZGHA 1A7QH 4AG4H 1PSKL 4YLQT 5AW0B 3ME0A 3NH7H 2EAEA 3CIQA 3M07A 1OWWA 1UOWA 4HJEA 2FX8L 3TIEA 3UBHA 4PRPB 5MENE 5AAMC 2D3NA 5GGTL 3JT0A 4F92B 1D2OA 3RVXC 5EZIH 4NBYB 4XRCA 5I9QC 5K9QI 5L2KE 3FU8A 4AL8C 5IMMA 2QFRA 3QDMB 2NDGA 2Z4QB 5F2FA 3AT0A 1IC4H 4JM0A 4E42A 3OVUB 4NPKA 4W4NA 1FNHA 4XN7A 4K5LA 2AJ3B 4L8SA 2R0WH 4LO9A 3P77B 4PJGF 2A7BA 1XF4B 3FTYA 4N2NA 3RNKA 5EEXA 4JG9A 2KMWA 5AOMA 1KCWA 3A21A 4N24A 5KYXB 2P24A 4M9PA 3OKNB 3Q06A 3E1F1 5DJCA 4ZSOA 4O5LH 3BAEL 1MCJA 3L4YA 2X2IA 1S9XB 2E0PA 1LO2H 1UWXK 2XDHA 2ZNWA 3ZKSD 1T89A 5DUBA 4BJLA 4WHTB 5C7ZA 1J0HA 2DMBA 4O02A 3CVHH 4S1RL 1HCFX 1NLDL 3BKCL 5GSRA 1G7LB 1C8PA 1MCPL 1O9VA 2FL5A 3BZDA 3UYRL 1VFOA 4OKVA 5T33L 1KF9B 1WVZA 2JH2A 4FLRA 4MS8C 4A7SA 4EZLA 4IRSB 4FQXC 3LXAA 5K5YA 3L95A 1IO4C 3PREA 4E41B 2YPLA 1W8NA 2CZNA 2C9SA 4X9BA 3L9BA 1B4LA 4GSDH 2ZKXA 4OVVA 1GYVA 4KJYB 5SX5H 4PAZA 3SE4A 4GRLB 1PG7L 3T3MF 3P4LA 3GSWA 4AC4A 4EKJA 5IQ9B 1RAMA 4MCYA 1C7TA 2F8VA 3EGSB 3F7PC 5FHBL 5HHPA 1IM3D 5FYLL 1R9FA 4N25A 3PL6C 1FPTL 4FERA 5HHNA 1ZTMA 1OCCB 1AQHA 3CX5J 4FGMA 3WEMA 2WUCL 2B15A 5C70A 1IKOP 1CDCA 3K91A 1HI6A 4KJQD 4N5ED 4QRPB 1L6ZA 3TNNB 1KENH 3WI9A 3GKWL 4XNXL 5F0MB 4WDIB 3ZMEA 4ENED 3EDKA 1XB8A 4OT1H 3UEQA 3RVWD 4L5FL 1WZKA 4A7QA 5LLIC 2JKIS 5D1XD 3VGAC 4N8VG 5JQ6L 3MUY1 3QXWA 1A14L 1E3ZA 4QHLB 4NN6B 3LD8C 2IANE 4QRUA 4WVRA 5I5JA 2KDGA 3RZCA 1RPUA 2WUBH 3FTSA 3VFSA 2VWEC 1DJIA 1IKFH 5LUMA 3UPRB 4C55A 2OR9H 4JG1L 3KWUA 1C1EH 1AKJA 4OLWH 2DL2A 5C0DA 1SYVA 5HBBA 4YAQB 4FTVA 3DO7A 1TQCC 4PCTA 5SX5K 4KGJA 1N5AB 1CFQA 3QUYA 4LCYA 4U0RC 1OTTC 2X4SA 3PV7A 4GP5B 4FHBD 4JZJC 5CILH 5AOJA 5AENA 2B14A 3QEQB 4QOKD 3D2TA 1HXYA 5KBKA 2WAQA 4AH2A 1U8NA 3ZYOA 3U0PB 2X6AA 2WXOA 4BH7B 1BGXL 5KVEH 4LCCA 3UAFA 3WLWC 3ELQA 3QXUA 1O5PA 5KS9F 4POZD 5IJCC 2WLKA 1IAKB 2ZUSA 1MLCA 2BVEA 1CB4A 3ENEA 1XSOA 2GBVA 3MV9D 3NSYA 4WKZB 3I6LE 4KDWA 5CFAA 1QUNB 2G3NA 5C0BD 1B2YA 1NWOA 4LPYA 3IU4L 5ESQB 5JYLA 2J12B 4L05A 4LOUC 3VFUB 4N9OB 1NGYB 2WXHA 3K6OA 5IQMA 1VFAA 5E9AA 2F8XC 4XHJD 2VR3A 4KZDL 3VB8A 1AXSB 4NFCA 5F3HA 3GINA 3ZL2A 3OKOA 3PP4L 3VD3A 2B1HL 4PJ7F 4M1GL 3MACH 3QZPA 5ANHA 2BIOA 2X6UA 4OLZH 4Y9FA 1S7XA 3DX9B 5E8OA 1ZHBB 4HIQA 2ZCHL 3MX0A 1FFOA 4FFZL 2WLLA 4XH2B 1A0QH 3Q2WA 3MRMA 4JFQB 1TKWB 2EUXA 4ZO8A 4PWEA 2WXFA 1MVFA 4ZMNA 1AY1H 1LYQA 2ICWB 3B9KB 4W4OC 5E2WH 3V5DB 1I4FB 3PIQB 4CUCA 4OFYD 3PHQA 1G9MH 2FJFA 3DX7A 1HL5A 1XIWC 4KVPA 4WZ9A 5C6TL 1FFNB 1N59B 5IHUL 2D31B 1JDAA 3C6SB 3VRIA 1WIUA 1DLHB 3SDAD 3O6LH 2LU7A 1M71B 3QCVH 1EO8H 4YDJB 5SWZE 4FXKC 1NDMA 4HUUA 4BCZA 1AI1L 5IROD 4KC3B 4XNQB 4DKTA 4MD4B 2C3HA 5CCKH 3TPUB 2Z65C 4OGYL 4W9FC 2XWEA 1OIOA 2MWCA 3ZE2B 3QQ4A 5I71C 2G9HB 1WAPA 4Z0BL 4LL9A 3NJNA 2TRHA 4M4PA 2C9QA 4YLBA 3RAJL 2CCLA 4DUWA 3MV8E 4EF3A 1BWWA 1LTXA 4QLRA 1K5WA 1BD2B 4IU2A 3S5YA 1EFXB 3SCMC 4XP6L 4LIQL 5A6IA 2VUYA 1QVOA 3DVGA 3TZVD 1CL7L 2EXWC 4MMXB 2FATL 1I8KA 2P52A 3C5JA 3P2TA 4XGZA 5T3XD 1UJ3B 4YBQD 3VWKD 3U82B 3CN3A 3BVUA 5GZND 3BPCB 3GJEA 4JVPA 3UO1H 3DYPA 4KKCD 5J1SC 5HHMB 4Z0XB 1T0NA 4N2MA 5DFVD 1IGJA 4AZ8B 5KSVA 1RUMH 1TITA 4Z78B 3QUGA 4Y9GA 3GB7B 1QTYT 1DQJB 3LRHA 4L3EB 1I85C 5I28A 4ADGA 2Q2EB 2OXHA 1IFGA 4NUMA 4Z3HA 1U3YA 3GSUB 4KNSA 1CI3M 1MFVA 3QI9C 4R7LA 2ODHA 4YZFE 5LWYL 1E6OL 3QH3B 5E5RB 4K3DL 1DJXA 4QRSA 2ATPA 1JF1B 2HJFA 5DJ8A 3EO1B 2DQTL 1FZOB 2OL3B 2VMDA 2PTTB 2QGDA 2ZP0T 4CVUA 5CZVH 1AKPA 2AQTA 4HDIB 1YPZF 3REVA 3T2NH 3OZ9L 1CLCA 3B7YA 2GJJA 2NUTA 4M7LH 2AVFA 5JA8B 1QSEE 1YYMH 2AQRA 5B21A 3LEXA 4K3EH 4Y4HA 4AQOA 4J2XA 3H6AA 3K0YA 4PJHE 4EQ2A 3TH2T 1ZWIA 3MLWL 1MELA 5KVDH 2PTVA 4G11A 1H0DA 1ZVHA 4G6FB 3OX8B 3MRKB 4F7EB 2AJXH 2XA8H 4MAUL 2P80D 4WEBH 1OB0A 1ETZB 4YVUA 3RVUC 5IJBC 4M1CC 1KWKA 4B96A 4EOWH 5DVPA 3TVMC 4E9XA 5C0AE 3RIFK 5L8KB 4GJTB 3S3DB 1A6VH 1O6SB 5C0CE 5A43C 1THCA 3CN4A 3H9YA 3QUZC 5F71A 5FECB 4RAVB 4Y16D 1EFQA 2HA1A 3IPBA 1KEMH 3LH8A 3BXNB 3LMJH 4NQEB 4R4NC 3EKCA 4P2RA 5D7HA 3X3FL 2PPAA 3BN9D 1M2VA 2BX5A 2IAMA 3BDYL 2Q20A 1BQ5A 5DRXB 2F6AA 2VN4A 4G8EB 4GQPH 4MJHA 3INOA 4M3JA 3HS0B 4PJDA 4X6FB 3ZX1A 5T1DL 1COBA 4FI8A 1HJBC 3AM8A 1K4DB 3M6DA 4HPOL 3VXOB 4EDXA 1JPEA 3FN9A 1QSFA 3GRWH 2BSSA 4TPRH 1A9BB 4UB0L 3EYQD 5TE6L 1J1OH 2NXZC 1WFIA 4A2EA 3RZWA 4MDRA 4MMZA 4DWHA 3N43F 1AGCB 1DBAH 1XZ0B 3MBXH 1JWSA 2XRAH 2BSTA 2D0GA 2X1WL 3E6HB 4U6YA 1SFHA 3R0MA 3WJLC 1A7QL 1J8RA 4AG4L 5T1KB 4X6EA 3NH7L 1IILE 2F74A 1K8IA 1RMFH 3LXCA 2MOVA 1QZNA 3DOIA 4Y4FD 3HVDA 1DQLL 1N3NB 5IWLA 1TXKA 4TQPA 3U9WA 2NY5L 4Y5YB 5EPMA 3CCHA 4JRYD 1AGDB 3KPOA 1JZ7A 2OP4H 5DVLA 3F6JA 4QLWA 3C8KA 3GSXB 4BFGA 3X1GA 2FHCA 2DH2A 1X9RA 4Z76B 4YDLC 2DI9A 1BF2A 3J07A 1MCIA 2R0WL 4HS8H 2ODIA 4WNQB 2R2BB 3BP4B 4RFNB 3ZQ9A 1DO6A 2K4WA 3QZMA 3QDJD 5HHOA 5FGCE 4Z7VA 3GSNA 4HLEA 2WIIA 4O5LL 4NEHB 1BG9A 4R0LB 1D5ZA 2ARJQ 4OLEA 2AW2A 4UF7C 4NT6A 4YUEH 3V4LA 4S1QH 2JI1A 5HVHC 1LO2L 2AF2A 4FQHB 5EH1A 4HOWA 5ID1B 4X7TA 5DYOA 1UZ8A 3VXSD 2F7OA 2RMNA 4RZCA 4B0MB 3EBHA 4JM2B 3CVHL 2QDWA 4Z7NE 2A9NH 4EKXA 2GC4C 2NY7H 3OXRB 2XQBH 3GBNL 1I75A 4LKXA 4WTWA 1PJ9A 2Z7YA 4WW1B 4EI6B 4RQQB 5HGDA 3EJPA 2Y1ZA 5JHBA 3RBGA 3MYZA 1ACYH 5G55A 1BZQK 4PP1C 4GW1B 3D85A 4YO0A 1MRFH 1JNLH 2X6CA 2OMVB 1W0WB 4GSDL 3QDGE 3VXME 4B3EA 5CBAB 5D96B 3HN8A 2DLFH 3HE6D 3ARBB 1YY8B 1GKOA 3I6LD 1ND0A 1OOAA 2ENYA 4ZUSA 4CC1A 3QORC 4IIZA 4JL1A 4XPBH 2ED6A 4F1ZA 3BQVA 2O6FA 5AKVA 1IM9D 4NNYA 3CUPB 3FU7A 4X0KA 4D9RE 5DSCB 3LZOA 2ZX6A 4AM0A 3EH1A 5DS2A 1EDHA 4Q8BA 1Y6KR 2IH3B 2CBMA 2NUPB 4U1MA 1NAKH 4R4FH 2BOLA 1JUFB 5F9WB 1FNGB 3BAXA 5EMYA 1JXKA 3LZRA 4HUWA 1X5JA 1E67A 4DIXA 4GSXA 4OT1L 2MH4A 3PNWA 4NQDB