5FM4A

Structure of the c-terminally extended domain my4 of human myomesin (space group p21)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
STPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MYOMESIN-1
publication title Binding of Myomesin to Obscurin-Like-1 at the Muscle M-Band Provides a Strategy for Isoform-Specific Mechanical Protection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 13
structure length 101
sequence length 101
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fm4A01
1IKNA 1ZE3C 4OB5H 4V1DB 2NX5E 3HB3D 4JRYB 2X4PA 3PHOB 1ZGLM 1GRWA 4IHOA 5SWZB 4HULB 4WNQB 5K9KB 2XY2A 3QI9A 3NCJL 4PTUA 4XTRC 5F72S 1T2JA 4XRCA 4J4PC 3GGWA 4BK4A 4JGJA 4ZYKA 1J0KA 1U3ZA 4UDTA 5F8QC 2OI9C 2J6EH 5HVHC 3T08A 4NDMA 3G6DL 1WZKA 2D2OA 1IKNC 5F1SA 4DUXA 3QUMA 2PXYD 2P1YA 1NFDF 1UXSA 4H8WL 3K7UA 4LEOB 1T1YA 3QI9C 3WO3B 1KPUB 1W72A 2G9HA 4JO1L 3NZHH 1T2QH 1BFTA 2W0FA 2LVCA 1LQSR 1BQLH 3HNVH 4KKBC 3QIWA 5FA3B 4Q9QH 1D6EA 3X13B 5CMAA 5L2KD 2DQCL 3SDAB 2VDLH 5B22A 4N0FB 1G7JA 4XPHL 3O9WC 4J7RA 4PJBA 3RIAK 4MDIA 4P2RB 1RZJL 2E7MA 1KJ2L 2OZ4L 2J4WH 5JR1H 1YECH 1P5UA 1Q38A 4LLQB 1GGCL 1VFOA 2VXQL 3AAZB 3L7EB 5DVMA 2J8UE 1NBYB 3QIWC 2ZKHH 3U9UB 5H2BB 3BKCL 2A73A 1HCVA 3OKNB 1LK3H 1QLEH 2GUOB 1YJDL 1OSPH 4URTB 2OJZL 5DURB 1PY4A 4EIZC 4XNUH 4EN3B 5I66B 4NWTL 5TPWL 1QFPA 3IFLL 4M6MH 4IMKA 5ICYA 2ESVE 1R3JB 4P9HC 1T20B 4U1LA 1IE5A 5E95B 4N5ED 2W9EL 5I1KL 3QUXD 5J12C 1S9VB 3ARDC 4IJ3B 2ZUTA 2ATKB 1CD8A 4KKAC 4J3XA 3DROA 5BW7A 3QDJB 4Y16B 3ZMRA 1QLRA 6CGTA 3SGJA 2ICWJ 4WDIB 3VD7A 4L4JA 5B3NA 2P24B 4G42A 4IMKC 1H5BA 1D5XB 4OZIE 2XV6B 5C6WH 3SJVD 1WSST 5IF0B 3Q0HA 4H88L 3X12A 3BJLA 1TZIB 1K4DA 3ARGC 1IAII 4KDVA 3VGHA 1FLRL 3C08L 3LN9A 4YAQB 3R0NA 3QUKA 4Y8DC 2Q76B 4FABL 4NCC1 2F19L 3BKJH 1MPAL 3B5GA 1YYLL 5T3ZE 4HIHB 3PGCB 4ORZC 3VRLE 5D1XD 2I9LA 1AY1L 1L0XA 3LQZA 1N0XH 4OCYL 2CO7B 4P4KA 4NNPL 3IDYB 3BO8A 1MRDL 4MNQA 4NKOB 4NQSA 1X7QB 4OF6A 3L5IA 4O58H 3VH8B 4KK8D 3VA6A 3EDKA 3MGOA 3OBAA 4KRNA 2GITA 5F1NA 3WXWL 3C8HA 4PRHD 3I50H 2AVGA 1UQSA 2I60H 4LCIL 5F70A 4ENEC 1YY9C 2NXZD 5DO2C 1UM4L 5C08A 3O81A 4RZCB 1DQLH 2L0DA 1ZEAH 1FGVL 2JB5L 3D2UA 4X7TA 4Y4HD 2B0SH 2FIKB 2WBJD 4YX2L 2HT4C 4XCEB 1BJ1H 4NUGH 4UU9A 1F4YL 5J56B 1HEZA 5IBLC 3TBTA 1OY3B 5FYJD 2MHAB 3EYQD 2Y07L 1OAQH 1TQCC 3EGSA 3QG6B 3RIAF 3PWLB 1QFWI 5M7QA 5FYLD 1Z6JT 1FG9C 2FJGA 2BRRH 3KDMA 2V17L 4QHKI 5JXAH 1X5JA 5I73C 4HHAA 1MHHA 4LNRB 1DLFL 2FECI 4UTBH 3GMLA 3QQNA 4H20H 4JJ5B 2W38A 4YHMH 2O5XH 4N8VG 4XP5L 4HJJH 3DUUA 3D85A 2VLRB 3V0AC 5FECB 2YD2A 1FNSL 1CCZA 4ODVL 1Y18B 1U8NA 4BJLA 2EH7H 1KIRB 1J9CT 1KN4L 1NCBH 4OCXL 4LVNB 3TYFB 1K3IA 3MCKA 1JGDA 1JHLH 4FTVD 4GRWE 4XCCH 3UTSE 4X8JA 1DUYA 4ZSOB 5DMKB 2R15A 4XNXH 3DSNA 3OF6D 1Y0LB 1EPFA 3GHBH 4MNQE 4Y0GA 4C56B 1CLZH 4ZUUA 1MY7A 5BZWA 1CS6A 2FO4A 5BRZB 2IJ0C 5I17B 1FZOA 4NZJA 5B39A 5ITBL 1KB5H 5GGVY 2QQKH 1FORH 1BZ7A 4MAYD 1Q9OB 3GSXA 4XWGL 4YDVA 4RX4A 4S10A 3OMZA 2VWEC 2EDXA 3ARTA 4QXGL 4LOUC 5L9DH 3EUUA 1FBIH 3PGFH 4HXAH 1I1RA 1AKJD 1U8PB 5IB2B 2YKLH 4YHOH 5EG6C 4PTTB 1UXWB 3LB6D 1RD6A 3IF1A 2VDNH 4N8VB 1Z2KA 4N9GB 3FMGL 3N9GL 1FDLH 5EC2A 1ONQA 3CVIL 1I8MB 2VDKL 4G7VL 4LK4A 3KR3H 3GKWH 2XTJD 1EMTH 3QXWA 3QRGL 3NIDF 1RUQL 5FHAH 4PRAB 3UC0H 2PYEB 1JNJA 3NOIA 1FAKT 2NXYD 4TUKH 2F54B 1RIUL 5D71L 5TE7L 4ZMAT 4G9FA 4KY1H 3ULSB 2W91A 25C8H 2R8SL 2VWEE 3UJIL 3V95A 1I3GH 3Q6GL 4Y5VA 4PJHB 2CDFA 3IFOA 5JHDA 3NA4A 4K7PH 1IGYB 3KG5A 4P2QB 3IKCA 1XF2A 4PG9B 4QHUB 3SKOB 4HJ0D 4WW2F 5MEPA 4IRSB 4Q74A 3L5JA 3FQTA 1NCWL 4JPWH 3DYMA 1I8LA 4PD4J 1AD9B 1G6RB 4CMHB 4B53A 2G2RA 5EBGA 2UZYB 3FONA 3JXAA 5GZOD 2C1PB 1YEHH 2DD8H 1VA9A 4PGEA 1HYSC 1D9KA 2ORBL 4TOYH 4FFYH 1RZKL 4Y5VC 3CLEH 3O6FD 2Y9RT 4GBXA 2VLLB 2Y06H 1MIML 2Y36H 4MA8H 2RGSA 4J8RA 3MNWB 3B2UC 1F00I 1S7VA 2V7NB 4N1EA 4JFQA 4CUCA 2D9QB 1IGCH 3MLSL 1BD2D 4BQCA 1LVEA 1FG2A 3BDYL 5MEQB 3FOLA 1P7QD 4JFZL 1IGIH 4MJ5B 5TDPB 3WXVL 1D9KC 3T1FB 3ZKXC 3BPCA 1GC1C 1FO0H 4L8BA 3R8BB 5I1CH 1VESA 1JGEA 5LXGL 4YIQB 1HILA 5FB8B 3VW3L 3HNTH 3JV5A 3VXSB 2AXFA 1RJCA 3REWA 3KYMB 4FQJH 4Y5XA 3VFNA 1N3NB 2OTPA 2WBWB 2ZUSA 4G9FE 5JW4Q 2YS4A 4FQQA 4YE4L 4NBYB 3T0EC 4X6FB 4G6FB 5JHDE 5DEFA 4ZPTA 3MRHB 2NTSP 5EU5B 3QQ3B 2XFXB 3MV8B 4ONHB 5J9PA 5FYJU 2J5LB 4CU8A 2APVA 5LJYH 2KBGA 4DGYH 2ICWI 4X6CB 1HI6B 1FFOB 2C3XA 4Y5XC 5DHVB 2AJYL 1EAPB 1J86A 3HC4L 4Y4FA 2PTTB 1NJ9A 3OKLB 1R3HB 4GMSH 5LAXA 1KLGB 1OP3H 1G7QA 2GK2A 4PGCB 4Y1AA 2RIKA 1JE6A 1CE6A 2X10A 2A6IA 3E6HA 4YFEA 4OZGE 5KSBB 2W65B 3WSQL 3TNMA 2BJMH 3KXFB 1C16A 3DURA 4HC1H 3T0EE 5CJ5A 4Y4FC 3MRMB 2NY4D 1GGUA 4KQ3L 4G6MH 1BM3H 2AGJL 2APBA 1FNGB 1NGYB 4U1JB 4W6XB 1E28B 3AY4A 3F7YA 3HRZA 4DAGL 1WBXB 5IB4B 1B0RA 4DN3H 4L8SA 2BSSA 4I5BA 4U1HB 2R39A 3R1GL 4XVUC 2EIDA 4JFFE 5MI0C 1G9NL 2X6MA 4QRTA 5E0QA 2FLBT 4OAWA 2XA8L 1QR1A 4KK5D 1JF6A 2ZJSL 1QSED 3V7AE 4Z8FH 5B3JF 4UOW1 2A83A 3SN6N 1J1XH 3A6OA 4S2SB 1BF2A 1FLTX 3ILQD 3MRGA 1MCIA 2YWYA 4RFNB 3H3KA 2BNRD 1T1XA 4U6YA 3THML 5BOZG 4H0IA 3FT2B 1OAYH 5JO5A 2Z8VC 5JIPA 4G8EB 5TDOB 5LGKA 1OAUH 5HYEA 3BKMH 5J6HA 4WWID 3FRUA 2P5WA 3CFDB 4CDHA 2LAAA 3KLSA 5DWUH 5EO1A 5GGSB 1U8JB 2FWOB 5MERA 3NAAH 2HLAA 4FQXD 4Y1AE 5D1QD 1S5IL 2YRLA 5ENWA 3O3EA 5KBNC 4PP1C 1DVFD 2DOCA 1D5MA 2ADJB 2YXFA 1NFIB 5CZXD 3SE3A 4DVBB 2GCYB 5E8OA 1PG7H 3CX5K 5E4EC 3ZT5A 5IG7B 4M6NH 1WC7B 2C1OA 4Q58C 1T83A 3VXNB 4LPXA 3C09B 1UM5L 4U1MA 5IB1A 3QDMD 2DI7A 4YXHL 1RURH 2CH8A 4QHMB 4Z6AT 4LLUB 1EHAA 3I9GH 5HSFA 2W0KA 1B4RA 1JFQH 3U46A 3BH8A 1OM3H 3AS2A 1NDMB 4X7EC 4DGVL 5GSRA 2BOBB 5DJ0A 2BHZA 3ROLB 4JFDD 1HZHL 5GGUB 1T83C 3D0VB 2VXVL 1PD6A 2J1KA 5EUKA 4XWOC 2UYLB 2DQGH 3IDGA 4F7MB 3K2UL 1S7UB 4X9HA 1LK2A 5KJRH 3KLAB 4CAGA 4MJID 4FZ8H 4GQ9L 3UPRA 2WP3O 5J1TC 5E2WH 1P2CB 4NFCA 5LCVH 1NCNA 5DRWA 1FVDB 4PY8I 1INEL 3HG1A 3D39D 1CGTA 5TE4H 3UBXB 3C5JA 5K9JL 5DDHA 3EOTL 2HN7A 4CADA 4OCSH 5I9QB 3B9AA 3NPSC 3NTCH 3U82B 2A6DA 1JIBA 1UCBL 3LEYH 2VDML 4YHPB 3E3QC 4F7PB 3MRDA 1PYWA 4HD9A 1CLOL 1G7IB 3CXDH 4PLJC 5GISH 1F6FB 3CH8A 1Z5LB 4UIMA 5C0RH 2E7HA 1X44A 4MX7A 2FEEI 2NPLX 3IAQA 3TNNA 1AGFB 1F13A 4NQED 1OW0C 3D25B 2IEPA 1BPVA 3HZYA 4NO5A 1YEEL 1UACL 4PJ8B 2D03L 2P8MA 2APXA 2NY1B 5EOCJ 3RGHA 3EO0A 1WT5A 3RWJA 5TDNB 5E2TH 5FO8B 2V2WA 2P44B 2R1WA 3UTPE 4LCWB 4JO4H 2X4NA 3V6FB 3EKCA 4XP9H 1S7SA 2X7LA 4R4BA 5E03A 3W39B 1PBYA 3H3PH 3IDXH 3U1SH 1KTDA 2CIKA 3FO0H 2IQAA 4OD3L 4L4TE 2V2TB 3VFPB 3E3QE 2X4TB 4Y89A 5FXCH 1WT5C 2DLGA 5DFTA 1IAIM 1XCTA 3IETB 3S36L 1VPOH 2P7TA 3FQUB 3U48A 4LLDA 5F3BB 3OR7A 5IW3A 3MODH 5FYKH 3GIZL 5EBMB 4PPTA 2HLFC 4RNRA 1JUFB 5EZIH 1T66D 5L0QB 4ISVB 3ILPB 3W11D 3NFSL 3U36B 2NYYC 5CBAB 5I1AA 4OKVA 1JPGA 3BHBA 3DX8A 3T2PA 4KI5F 1H0DA 2G5RA 1T0MB 2XKNA 5H35A 3P30L 5K9QG 1ES0A 5CCKH 1SM3H 4R6UA 5EU6D 3MNZA 2G60L 3KJ6L 4BH8A 3SKMA 1C08A 4NUJB 2FL5B 3ZYZA 2HJLA 2FLRT 5T1MB 4D9RE 4Z7VA 4X4MA 3TFKD 2DQUL 1JZ6A 1M71B 3BZFB 3GBNH 4LLMA 5FKPA 2AJZB 4MJ6A 3S88L 4YDJB 4ZNCD 3FHQA 1I8KA 5K93A 1B2WH 1BBDL 3CSYA 2I24N 4JN1H 4P3DB 3VI3E 1KB5B 2FX7H 1BF8A 3OXRA 2HG5A 4R26L 2VISB 4R9HA 3HCVA 3DUSA 3B2VL 3F6LA 4KUZH 3FQRA 1DQJB 5HI4C 4DK6A 1CL7H 1U3HD 1T04B 4FZEL 4UILL 1KCRL 1WTLA 2NX5D 3UMTA 3D0LA 1HSBA 3CDCA 3VFUB 3WD5L 4Z7NE 3FAWA 4YWGH 2H32H 2VLKA 2FB4H 2WM0A 3N1GC 5GZND 4HWBL 1HKFA 3BQUA 1YEKL 2FH6A 1HH6B 1RMFL 2BVQB 5EBLA 4PJIA 2HTLD 3L3GA 3HMWH 2AV1A 4YBLC 3CMGA 4CW1B 2QSQA 1W8NA 4J3UA 1OARH 1TJIH 2IFFH 2M2DA 5HHQB 1JI2A 1SJEA 5C0DB 1DQMH 3ZKMD 2O5YL 5LWYL 1FH5H 1E6OL 2XIDA 3MLXH 2R2EA 4KU1A 4YK4C 2ZCHH 5AZEH 5I75B 5TE6L 4G9DB 4EXPX 3V8CA 4LLYA 2PW1B 3EJYC 1PZ5A 1MVUA 1QOKA 2BNUA 4Z7VE 4X4ME 3MO1B 3RWIB 1MFNA 1F58L 4U1NA 4S1RL 4ZUTB 4NOBA 2V9RA 1P84K 1LNUB 2YC1A 4XTRD 1WICA 1OCWL 3WO4C 2HFFA 2X1QA 4J4PD 2J7LA 3V5KB 1QR4A 2Z35B 1FP5A 1PKQB 4ZUVA 3D3VA 1J18A 2VABA 3C8KA 5DUPL 4KRPC 2B4CH 4C58B 1EGJL 2VLJE 4PJGA 4HDIA 3U0WH 3RY5A 1P4BL 5ETUA 2ESVD 2VLKE 4FQIL 4L3EB 4XHQA 2V7HA 5HY9A 5F7WC 1UZ6E 4IEFB 1JPST 3RVXC 3EO9H 1W0VB 4PJIE 1UVQA 1YPZA 4EI5C 5F96L 5C0BE 1CFNB 5CJ8A 4KKBD 1NCAH 4OF5A 2FEDC 5SWQA 1KCKA 3LMJH 4UI2A 1E4KA 1GPOH 1PQZA 1YNKL 4YDKH 3RWHA 4JHAL 1M7IA 3HZMA 1IAOB 2H1PH 3KS0J 3QEQE 3VGDA 4RMWA 4S11A 1A21A 3LDBB 3O9WD 3ALPA 1RIVL 1S7XA 3RTQB 2GEEA 3F7VB 4OT1L 1XR9B 3ARFB 3G08B 5IB5B 3VXQB 1J8HB 4EUPB 4LIQH 2NLJA 4D3CH 4W70A 1E4KC 4FNLL 1JF1A 1DEEA 5T3ZD 2XN9B 2ZOLB 1NBVH 2UZIL 3A6CH 1CT8A 3IDIA 2D7TL 4M1GH 3S4SA 4FXKB 3VXOA 4WHDA 3ARDD 3BAEH 2Z31C 4I77L 5DJXB 1MI5D 3D3VE 4PP2B 4D9LH 5BO1H 1RUMH 4GXVH 4LSUH 5DFVD 4YLQT 5ID0A 3ETBF 4F58L 1LO0L 4G5ZL 2ZSVB 1JGUH 1TVBA 5IVXB 3MRRB 5DVNA 4P23B 4XC1L 1WITA 5DJAB 3ARGD 4KHXH 4C57C 1UA6L 2A9NL 2P49B 2L4OA 4MSWB 3MLTA 2VITB 4I0KA 5J06A 3BUYA 1BWWA 1Q9WA 4YH6A 1NGWB 1TFHA 4YQXH 1I3VA 1FZJA 5DTFB 4E9LA 4I48B 1EEZB 5EOTB 1OPGL 5FUCC 5MHSE 5FGRA 4QEGA 1WCBA 1U95B 3SOBL 1TDQA 1U8KA 2ARWA 3RNQB 3G04B 5L6YH 3EYSL 4ENED 2CLRA 2KUTA 5DO2D 1DN0B 5F7DB 1G6RL 2NY5L 5IBUG 5ACMA 4M5YH 4XC3H 4ACPA 4ELMB 3UTSD 1MCEA 3PQYB 1N6QH 3CK0L 5E7FA 4PJHF 4XPGL 2HT4D 4MNQD 3CPLB 4NGHL 4UT7L 3VGBA 1RULH 3OKKA 3U7WH 2HT3C 4TSAH 1ORQB 4OM0L 3SDXE 5GQBA 1N26A 4F8QA 2ZWLT 4KVCL 4AIZB 4M03A 2DQIL 3GSVB 3HAEA 3MJ8A 3GEWB 5IEKA 5SV3A 1AE6L 2R9HC 3AREB 4JZOB 3NCYP 1VACB 1D6VH 4HX1B 1MJUL 3ZHDA 2FHBA 1N4XL 5FUCE 1FRGL 1NAMA 1CFQA 3QUZD 3GI8H 2N4IA 2VR5A 5L8KB 5DJ8A 5IT2H 3QHFL 1Z9SA 1AD0A 4M93B 2Z8SA 4QXTA 4APQA 1BVKB 4MD4A 3W9EB 5HGBA 1X5GA 3QDGA 5ICXA 2CLVB 1UB5A 4NQVA 5KZCD 2YUXA 5BMFL 1UWGH 3DXAD 2Z91B 1JTTA 4K94C 4FQLH 4FXGA 5CEXA 5TF1H 4OGXH 4APQC 3TA3B 3TP4A 1SEBB 2N56A 4LCYB 3DIFA 1QA9A 3DV6B 3LZFH 4LOUD 1RZ8B 2F58H 3MBXL 2YD5A 2WWMC 3C5ZD 4TULH 3PWUA 3FQWA 3UYOD 1OGTA 1H3VA 4ZO7A 4X6CF 1GZPA 1J0YA 5FM4A 5HYSG 5I8EA 4RX4D 2R69H 4ZFFA 5DMIH 3MA9L 1LEKB 5GRVL 1XAUA 1F97A 2E9WA 2MQ0A 4RFEA 1UCTA 4PUBL 1HHJB 4HS3A 3JV4B 1MWAA 2YZ1A 4NJ9L 5JUEH 4U1IA 2IADA 3KYOB 1K85A 1I7ZB 4I3SH 4PJXB 2A6KB 1T4KB 5KSBF 4HIIB 1FPTL 2X4QB 1K5NA 5C0EA 1MQ8A 2EYSB 3QDGE 4PRIE 5D70L 4ONFL 4R4FL 3T3PF 1EUTA 4LSQH 4DKEH 1N7MH 3DGGB 3BKYL 4HF5H 3QG7L 2LU4A 5F7HA 3S5LB 4PY7A 1C5CH 4OB5L 1YN6B 1QSFA 4LKXA 2YPLE 4GXUM 3L95B 3QULA 1S9XB 3TN0B 1VDGA 3PWNA 4G9FD 4LCUA 5HYSB 1FV1B 4F33A 1IKFH 4LRIA 2DLTA 3QFDB 5DJDA 5GJTH 1SBSH 3VFTA 1K8IA 4G3YH 5JHDD 3E0GA 3FFDB 4JFPA 1JYWA 3QJHB 3VD4A 3EO1B 1A9BA 4DKDC 1QRKA 1NUGA 3HLAB 43CAB 4HUUB 2ZUQB 5JW3H 1MCPH 4WWKA 3ZDZF 3S96A 1DBJH 3FB7B 4MJ4A 2B5IC 2XNAA 2EIZA 5EIIA 4DFIA 4MB5A 2D0FA 3LQAH 3KPRA 4CVZA 1D9KD 3BP4B 4JE4B 4LRIC 3NZHL 2UVFA 1T2QL 5CJBA 4XX1G 1BQLL 3HNVL 5HYQA 3NIGF 4Q9QL 2CR6A 5JIHA 1A3RH 3L3IA 1JRHH 1GYAA 1SJHA 2VDLL 4WWKC 5C0CE 3JVGC 1M05B 1J1OH 3IXTA 2VAAA 2FJFA 3MGTA 1MI5B 5BOPA 1X5XA 3FAXA 3O8XD 4HKBA 1MELA 4JKLA 3T0ED 4W68A 1X5AA 5BV7C 1KBGH 1MCSA 3G5YB 2J4WL 4X6BA 5JR1L 1YECL 2IPTH 4ZXBB 1XZ0B 5HTSA 3RDTA 3I02B 4MQSB 3GSNA 1G7PB 2XXCB 2ZKHL 4QHNB 3O41A 1UADC 3PNWB 4K3HA 4UAOC 1LK3L 1QLEL 3D48R 3ESVF 1OSPL 1QSFE 4XNUL 4RMVA 5BVJA 3RGVA 4NT6A 4M6ML 4JFFD 3SO3B 4P0DA 4WV1B 1IGJA 4OIBA 3G5ZB 3QUYB 5E1AB 3QEUA 5JPNA 2NR6D 2JK5B 5HDLA 1WIPA 3FO9B 2UVEA 4XB8A 1G7MA 4ODHH 3TO4B 4KROC 4LHUG 3IKKA 3O6KH 5FCSH 5DJCB 5DR5H 1R3IH 3RGVC 2IPKB 2H32B 5DHYA 3CFIC 3WJLA 4L29B 3JTTA 5DD0H 4PRPD 1W0WA 3LN4A 1CICB 4HUMB 3NCBB 3BPNC 1ZA3A 1GZQB 3K8LA 5C92A 5C09A 2R1XB 1NMCB 3IJYA 5EZLA 4LCCA 1AHWB 4Y1AD 4PBVC 2AJUH 3BFOA 1K3ZA 5SV4A 3BKJL 3QSKB 3QWRD 3MRNB 1YMMA 3DGCR 1A1NA 4AY0A 4EDXB 4N90E 1N0XL 2OCFD 3WJLC 1TTGA 4OGZA 2JCCA 4ZAKA 4JPVH 4O58L 3FCTB 3SQOH 1YN7A 3UXFA 2ED8A 4Z7UA 3I50L 2YEZB 2I60L 2UWEB 2C3WA 4LCCC 4TVPD 5ACLA 4AG4L 4IS6B 4RCAA 4BKLA 4C83A 3H0TA 5E5MA 4UDUA 1FL3B 4LHUB 1DQLL 2JKXA 4JVUA 1HHIB 3LHPH 4X5WB 3FT4A 2HAZA 3G9AB 5JOEA 1F3RB 2B0SL 1IM9A 4LNVA 3PDOB 4RRPA 1U3JA 4ZAKC 3DSFH 2APFA 5ID1B 4R0LA 3MRJA 1OAQL 4YHIA 2ZUUA 4GG6E 1U8HB 5CSZB 3DXAB 4L3CA 5E2VH 3GFUA 2BRRL 3GMPA 3BD4A 3VXRB 5JXAL 3IFPB 1FVEB 2CIIB 2J88H 1MUJA 1SMOA 4OZHA 1KTKE 4H20L 3KPPB 3VWKA 4MNHB 5DZOA 2O5XL 4YHML 4HJJL 1LP9E 4R0LC 1N64H 1K4CB 5AZ2H 5C09E 5D7LA 1G6VK 2VXUH 2EH7L 1NCBL 5BS0D 4K3JH 3DNKA 1JHLL 1YMME 4XCCL 3NVQA 2VQUA 4XNXL 4X4XA 3GHBL 2EDTA 1CLZL 4FFWC 5F9WB 3VWKC 2R23B 1XCQA 2VIRA 4KV5F 4NKQB 3UYRH 1KB5L 1T5WB 2QQKL 4IRJB 1FORL 1QEWA 4H8WC 5ACZA 5GIRB 4UB0L 2X05A 3FT3A 3QWOA 3C60C 4MWFB 4JY5H 3FFCE 1BEYL 1FBIL 3PGFL 2I9TA 4HXAL 5I16B 3V6OC 2YKLL 4YHOL 4QHLB 1BAFH 2VDNL 3KPLA 1NFDE 5JQHC 1U36A 4GRMA 5ESVB 3VRIB 4F37K 1EH9A 4Y19A 1AC0A 2K9UA 4L4TD 1KXVC 1P7KA 4RDQG 1FYTA 3MRQB 3ZTJH 1ZLVH 2YR3A 1XGRA 3KR3L 2Y7QB 3GKWL 3GJFH 4MB4A 1EMTL 3N1QC 4PLJD 3LKNB 3WBDA 2PF6A 4P2OA 5FHAL 4G43B 1XR8B 2BSRB 3UC0L 4NQDD 1UEMA 3T4AA 2GFBB 5IHZA 3Q5YA 4M5ZH 1J0IA 1V8HA 2YD7A 3B9KB 4TUKL 5JDSB 4F9PA 3VG9C 3QXAA 4P46B 1B3JA 2JB6A 3U4EA 3C6LB 3RY4A 4KY1L 5SX5H 5DRNB 5DD1H 2VSDA 3MA7B 2NW2A 2X89A 3HE6A 2BNQA 2ZUXA 3L3JA 4K7PL 3V6OE 5DFWH 2CKBH 4I0CC 5MEOA 5F1OB 3DX6A 4JPWL 1RJZA 3MUJA 1DDHB 4F9PC 4D9RD 3GDBA 2AK1H 1YEHL 4ZFOB 1R3KB 2DD8L 1MQKL 1MCWM 4PGDA 1U8LB 2VR9A 4TOYL 4FFYL 1RAMA 2VR4A 3CLEL 2DQHH 1LE9B 5DYOA 4KMTH 2Y06L 3JBG7 2Y36L 3QNYA 2LU3A 2R2BA 3CFBA 2D0HA 4ZS6C 4YGVB 1KNOA 4HEME 1JNHB 4NRYB 1A6ZA 3MBED 2HLFD 4Q9RL 3P0YH 1U93A 1ZWIB 2XXMB 3QPXH 4OUUB 1IGCL 1EEYA 1T03H 3B8SA 4XNZC 4PJAA 2C3HA 4PRNB 5B38A 1KEGH 2VQ1B 4Y19E 2IH3A 1WWAX 4KGJA 1IGIL 5KN5A 1FE8H 1FYTE 3GM8A 5JORB 1YY8A 5FOBA 2CPCA 1MJ8H 1FO0L 2Y5TB 4JO3H 5I1CL 4PD4K 4AQ1B 4ODUA 4XBGB 4HUWA 1XF3B 2NY6C 2EC9U 5IV2A 4JKMA 4FQPA 4FQJL 3FB8B 2BNQE 3CFEA 1G7HA 1SJXA 4HCRA 2R4RH 2Y6SD 3IJHA 1GGTA 3H9SA 5A2FA 4G8GA 4OM1L 4PRPB 1X5IA 3X3GH 1EHNA 4UV4H 1A64A 5CP7B 1KENH 5IJVA 1VGEH 5T1DH 2E7BA 3BWAB 4HKZB 3QO1A 5IFJA 1OSZB 3VFWB 5I71C 3WIFA 5HHNA 2JJVA 3GSRB 1YQVH 4GMSL 5IGXH 1U3YA 4WU5A 3JTSA 4ORGB 1ZHKA 2BSED 4JEGB 3RFZC 5A2KH 3PHQA 2F53B 5BZDB 3IB4A 3V5DB 2QR0A 3IS0X 5JOFA 1T7YA 3WJJC 4PYHA 1ZT1A 2BJML 3T8XB 3FQNA 3GKZA 3CFJA 4HZLA 2Z4QA 3W9DA 1EJOH 2BVPA 5C07B 1Y6NR 2VLJD 4HC1L 1SYSA 4N1HB 5IKCA 5CEYA 1R5WA 5GGQH 1NUDA 4ZD3H 4NSKA 5FO7A 1EJ6A 5E00A 5I1GH 4JY6A 2A2QT 4DN3L 3X14B 5C0BD 2BVUA 3QPQC 4U05A 3MACH 1DSFH 3HI1A 1QBML 3TBVB 2ZOKA 3UTQA 5F1KC 1RJLA 2CRIA 3TIDA 3BPLB 5CILH 4RMQA 4N0UA 4W6YB 5DS8B 3QEQD 3DRTB 4Z8FL 2YUWA 4CVWA 1J1XL 4PJ9B 1JGLH 3H9SE 3B9VA 4NN7C 3QEGH 2CLZA 5A40E 1OAYL 4D0DB 4GJTB 3JSSA 4KRPD 4NM4H 3ZT7A 4ELKA 5L8LB 3I3EA 4WW2C 1OAUL 1T22B 5JLZB 1IC1A 3BKML 4ELMF 4HIEB 1MH5A 3GBML 5DWUL 5GS0C 3MUGB 4BFIB 3REVB 3NAAL 4Y5YB 4GKSB 1ETZB 3BP5A 5EO0A 1ZXQA 2BDNH 4EI5D 1U58A 4HFWA 2IH1A 4E42A 1K2DB 3BVNB 3D3VD 3VXMA 4NO0A 3NIDE 3X17A 4IIQB 1PG7L 3HC0B 2RB8A 1FL6B 1NDGA 2B20A 4LVEA 4POYA 2ZCKH 1R5VA 4M6NL 5DJYB 4GUPB 5DEZA 4UUJB 3T0VA 1A2YB 1EDQA 3L6FA 1X5YA 4RGNC 1DBBH 2ARJQ 1RURL 4EQ3A 5D2NA 3TZVA 1A6AB 1BJ8A 3I9GL 4MMXC 5IEHB 1JFQL 2VOTA 1RZKC 4OSUH 1OM3L 3HHRB 1FZKA 4UBDC 1RZ7H 4ZOEA 1JHTB 4WO4D 5E9DD 5C0AA 1QRNE 5IFHH 3U30C 4PBXA 1EX0A 4JFYA 4TQEH 1UJ3B 5D7IB 5D2NC 5MHSD 2DQGL 3RWDB 4GW1A 5T1LA 2WIMA 3AS1A 2BC4A 4B5EA 2Z31D 4OZFA 3F5WB 5KJRL 1EXUB 4FZ8L 4S0SD 4K71B 1AC6A 2DKMA 3LKRB 1VADA 1I9RH 5E2WL 5LCVL 2ARJA 3MJ7A 2VC2H 1E4XH 2GTWB 5IW1A 1GH7A 1NBZB 2GT9A 3O4LE 3PGDB 1YUHA 2GY7B 2WMPA 4KTDH 4TUJA 5TE4L 1IEBB 3MC0A 2PYFB 4RA3A 5C6TH 1D5BA 3U6RB 1CTOA 1GOGA 4OCSL 4R4NC 1NEZG 3NTCL 1CDIA 2Z92B 4DZ8B 3LEYL 5EUOB 1NLBH 1SVCP 1EVUA 3VXME 2IANE 5IQ7H 3P4OB 1MSPA 2O5ZH 3CXDL 1FSKC 3BEVA 3PWPE 5GISL 3NACH 5FGBC 3T2NH 1HXMA 4FQHB 5C0RL 3N85L 4IOSD 4JM2B 4PJCA 4ODTH 3QFJB 4XPTH 1ZGLA 4LRNH 3FOMB 1SBBA 5D2NE 2DKUA 1GXEA 4PJXF 4QGTA 1IVLA 2W59A 4CVXB 5E2TL 3S37H 3UTTB 5GS1A 4JO4L 3S35H 3LSOB 5DSCA 1KPVA 4XP9L 2YPKA 4A6YA 4Q2ZA 3H3PL 3WDIA 1BMGA 1CYGA 4RGOH 4TNVK 3IDXL 3LY6A 4OCMC 3P77B 2QJDA 5J11B 3U1SL 3FO0L 2W92A 2QBWA 3B6SB 3Q3GA 1ZLUH 5DD6B 2XACC 5EU7C 4D0CA 1JWMA 3MLVH 4LLAA 1NEZB 5MENA 1BGXH 4RWYH 3ARVA 5GS1C 4JRXB 1VPOL 3WFDH 4OV5A 5EH1A 1IFHH 2XPGA 3MODL 2QLVB 5FYKL 3OKMA 5TQ2H 3FKUS 5EZIL 1ACYH 3I85A 3RZCD 2RFXB 4P5TB 1G9NC 4XB7A 3X11A 4PJ5E 3LRSA 3SDCA 4MHHI 5FDWB 2WIIA 3VFSA 3OQ3B 5CCKL 1SM3L 1HXYB 3AM8A 3RKDC 5IMLA 4MVBC 3QO0B 3WDJA 4JPIA 4LEXL 2ADIA 3SO5A 4X7CC 4K9EH 5FIEA 3QIUA 2HVJB 2YBRB 3F12A 5F89A 1TCRA 4G80B 5BQ7A 1WTGT 1P1ZA 3MOQA 4Y4KA 3TBSB 3MRIB 5KVMC 1A14H 4YHLH 5EU7E 3SDCC 1I3UA 1LEGA 3GBNL 1KN2H 4APQD 4AT6B 1B2WL 5B3JE 4GKZB 1NC4B 2DYPA 3PP3K 3VFVB 3QDGD 3DMMD 4PRID 4JN1L 2H3NB 2FX7L 3QUMH 1ADQA 4K3GA 1QBBA 1DP0A 1LD9B 4PREB 5DZLA 3QIUC 1T0PB 4KUZL 2SEBA 1D3CA 4Y4KC 2A6JA 2WWMD 4JRWA 1CL7L 3HZKB 4JB9H 1W72H 4G8FB 3I2CH 1QYGH 2BMKB 2YPLD 1DLHA 3MZGB 5MENE 2JIXB 4YWGL 4PLOB 2FB4L 3K4AA 4OGYL 3SY0A 3BZ4B 4R90H 4JFEA 1L6ZA 2Y5EA 1LWRA 3HMWL 4ZTPH 1S7TA 1OARL 1TJIL 2IFFL 2RHEA 3GMNB 4MD0B 2FJHB 4OQ1A 1DQML 4TNVF 3GJFB 1FH5L 2GJ6B 2F74B 3MRBB 1RZGA 3AB0B 3MLXL 5IM7B 1PEWA 5FK9B 5A16A 2ZCHL 3PJSA 4ZQKB 5AZEL 1C8PA 4FFZH 3O4OB 4I0PA 3O0RH 4F57H 4IOFD 1U6AH 1KXTB 2E8ZA 4P4RB 1NMBH 1MFCH 5C0CD 4JFOA 4QNPF 3P9MA 4O9HH 4WUUA 2CKBB 5C1MB 4EBQH 4WENB 4PV9B 3C9NA 4F15B 4WHYH 2XG5A 4I0PC 3L3HA 4V1DA 4JRYA 2DWEB 2UWEF 3FTGB 1FJ1B 1QSFD 2B4CL 3GJEB 3QXDA 4LGSB 4ESKA 5CKGA 1XT5A 4ZFZA 5ERWA 1V7MH 3MRLA 4I2XA 3U0WL 5L2JB 1KIQA 1X5KA 3MXWH 2CDGA 2EE6A 5KG9B 4QWWC 2QKIB 2ZP0T 2GI7A 1F45A 5HGHB 3TT3H 3EO9L 5KVFH 2CGRH 2PKDA 3S9DB 2FBJH 4PJEB 3BXNA 4O2EB 3RY6C 4LEOA 4Q7DA 3SKNB 3IS1X 3QEHA 3LMJL 4XBEH 1GPOL 4YDKL 5DUMH 1VKXB 4KUCD 1BQUA 4WU7A 3BYYA 4Z0XB 4QRPA 4KJWC 4P3CH 4KKLC 3V6ZA 5ISZB 1A6TA 1FZMA 2IAMB 4ALAH 2GSGA 5HYJD 2E5EA 4KI5C 4QRRE 5EOQH 1DBMH 1FGNH 4LIQL 4RA0C 5HHXH 4D3CL 1CBVH 3BKCH 1ULVA 5GGSY 5F97E 1OTTC 1NBVL 3IAPA 4N90D 3A6CL 4WUUE 3U9UA 1JI1A 3H7BA 2VAJA 4M1GL 2GUOA 2OYPA 3Q5TA 3SDAC 4EN3A 3BAEL 3IDNA 1MIEH 4V1DE 1CG9A 1RQ5A 4HJGB 5AG9A 3BDBA 4U1KA 4JRYE 3DVNB 1HDMA 5E7BA 4IRZH 4KROD 5BO1L 1NGZA 5SWZE 4D9LL 1RUML 1HQ4B 4GXVL 4LSUL 5FV1L 5KSAB 1BZ9A 1BQHG 5J4MA 4J6RH 1S7QA 3TC9A 1JGUL 4G8IB 2XQYG 1MEXH 5H94A 4Y16A 4KI5E 3PIQA 4Z7WB 5D7KD 4EN3C 1MY5A 4KHXL 4WDIA 3QZWG 4J3WA 4AIXA 3C08H 1REIA 2BY0A 1H3GA 5IF0A 3O2VH 3I3BA 4TNWK 4KJPC 3TBYB 4BSWA 1WVZA 3DETD 3Q1SH 4IJ3C 2F8OA 3NGBC 1AY1H 1J8KA 1T3FB 2Q76A 4HKXA 5C0FB 4TUOB 4Y16C 1B6DA 5L6YL 1F4XH 4X5XA 5C09D 3DI3B 4HIHA 3JWDH 5IMKA 5E56A 3BW9B 4M5YL 4QOKB 4XC3L 1YMMD 5CINH 4TSBH 3GHEH 3STLB 1N6QL 2PO6A 1FFPA 1N5AB 3K2MC 1ZLSH 5DJ2B 4NOFA 4HFUH 4PGBA 4ZAKD 3RVTD 1RULL 4U6HA 5J1AB 5M95B 3U7WL 3T3MF 1MAKA 2IBZY 4TSAL 4X6DA 1CQYA 4RZCA 3WKMH 1TZGH 4JLRB 3IDMA 3O2WH 4GG8B 2QADC 2GJZA 3PL6B 1OP9A 3FFCD 2BRQA 1D6VL 4DZBB 4RDQF 1OF2A 2YA0A 4PIRF 4RIRB 3WNKA 4WFEE 5HHMB 3SPVB 1MHCA 3ZT6A 2P5EA 1DLFH 3UJJH 4PYGA 3GI8L 3QDJE 3VXUB 5CEZH 1JZ3A 1IM3B 5IT2L 4JPKH 3MV9B 3OL2A 2E8YA 4UINH 1T2XA 4LNRA 1FNSH 3DVGA 3K8MA 1ORSB 1NKOA 3BGFB 5SX4I 5I8OH 2X4UB 4GMTH 2NY0B 3VFOB 3D69A 1IQWH 4K2UH 1UWGL 1H3PH 1JWUA 1UB6B 3DTXB 2OQJB 4FFWD 3RIFF 3VWKD 1KIRA 4FQLL 4PRBB 3HE7A 1G7LA 1Q94A 3TYFA 5DRZA 4TTDC 5TF1L 4OGXL 3E1F1 4ZSOA 3WN5A 5FCUH 3BIAX 3DYOA 1Y0LA 4HGWA 1KFAH 4C56A 4Z76B 3C60D 3LZFL 2C7UA 3S8WA 2D4DA 3QQ9C 2EC8A 5D93B 2F58L 1UYWH 2EDEA 2HJFB 5JQ6H 3MRPB 3ZE2F 4E0RA 4NQUA 2R1YB 3VE0A 4TULL 2CJUH 5DK0B 3HE7C 3G9VA 4LVNC 1AO7B 1EEQA 4YJZL 5C0GA 1CGXA 2BHUA 2R69L 5DMIL 1U8PA 5C9KA 3TVMB 1KC5H 1H9VA 4N8VA 1J0HA 1NGXB 1G0YR 4G7VH 1MJJB 5ITFB 1I4FA 5T1KA 3N1FC 5I18H 1MLCA 5JUEL 3IGAB 2HVKB 2GAZB 3FZUC 4I3SL 1OVZA 2IPUG 5IK3B 2D0GA 1TITA 4QCIB 3SDDB 1F2XK 3RPKA 2B8OT 1FYTD 4ONOA 4Y2DB 1Z9LA 3OHXA 3ARBD 3LKQB 1HNGA 2YUVA 4BA8A 2ATPA 1BREA 2VLRE 1BOGA 4GQPH 5FM8A 4LSQL 4DKEL 3ES6A 4HF5L 3I6KA 3ZKSD 1C5CL 4QRUB 4IM8A 4JG0H 1S5HB 4M8QB 2R2CA 1Z0NA 5FHBH 4ZSOE 2PXYA 5INCB 1X4YA 4JREC 5EA0H 4PG9A 4QHUA 1PAMA 4R96B 4C56E 1IKFL 4WY7H 5GJTL 5BRZE 4IRSA 4G3YL 5JW5A 4ZUWB 4LMQE 3LKPA 2I07B 3SEPA 4M3KB 2E7LC 3GSQB 4PG2A 1I7RB 2C1PA 5JW3L 5L2KA 1MCPL 5HYJB 2F8VA 1DBJL 3RI5K 3GMOB 3MJ9L 4PRDB 2VH5L 1AIFA 3RVWC 1OP5H 3MNWA 3LQAL 4I4WB 4IRSC 2V7NA 1P4LB 4YC2C 4OLWH 4QRSA 2BSTA 4PG2C 2GK0A 5DJ6B 4CMHC 1A3RL 4HBCH 4K7PY 2MJWA 3RWFB 3C5SB 3O6MH 1PX3A 2R2HA 1JRHL 2VO5A 1T0NA 4GXUN 1LHZA 2J8UB 2M8XA 2IMNA 3W5MA 2NY6D 4DOHB 5HVHB 3T1FA 1J1OL 2P46B 4U3HA 5FUOH 4JDVB 3TH2T 4YIQA 1KBGL 1N2RA 2PYEE 5HDBF 5C70A 2IPTL 3PF2A 3QI9B 4PTUB 4P99A 2F54E 4XRCB 4S1QH 5IMOA 4D0BB 3GGWB 4ZYKB 3SGEH 4UDTB 4X6FA 5I2IA 3V52H 4MCYA 4NDMB 1NC2D 3HMXL 4OD1H 4PJHE 5E1HB 1RU9H 3ZSTA 1Y6KR 2EIEA 4P2QE 4GLRI 2VDPH 3QUMB 5EU5A 1DQDH 3QQ3A 4N9OB 2K7QA 4RWHA 1UXSB 3SDYH 1V5JA 3SJVA 3VMOA 2H26A 1J05A 1T1YB 3H2WA 4XMKH 2G9HB 1W72B 1HI6A 4ODHL 1N8ZA 4P5MB 5D7IF 3H9SD 3O6KL 3MV7B 2W0FB 4NC0B 5L2KE 5DR5L 3QIWB 2QEJA 2PTTA 4OFIA 4OIIH 3W81A 1D6EB 5CMAB 1CF8H 4RBPK 4LLVA 2Y23A 1R5IA 3WSQH 5D1XA 5D6CA 2AI0H 5DD0L 4NBXB 2IBGA 4JQIL 1HNFA 2GKIA 4PJBB 4MDIB 5KOVC 5KSBA 4EI6A 1U9KA 1WWBX 3KYKH 4PRHA 2AJUL 2X2YA 4FXLA 2HH0H 2JELH 2BP3A 1CGVA 2C3VA 2QSCH 3R1GH 3QIBD 4MMZC 4Y4HA 1NGYA 4XMPL 1L7TH 4LDEB 5F6IC 5D1XC 1VSCA 1E28A 2WBJA 4JPVL 5ICYB 3SQOL 3RI5F 4PGJA 3VXSE 4JM2F 2FYYB 3WL9A 3GIVA 1QNZL 4Z77A 1A7QL 5F3HB 1HHGB 3LHPL 4BQ6A 4WCYH 3ULUH 2HTKC 3DROB 5FF6B 1IQDA 1QLRB 4WI3A 2GSIA 2BX5A 1IC4H 3MV8E 4XPAH 2VKWA 4S2SA 3DSFL 2EXWC 1QFUH 4G42B 1Q0XH 1QRND 1CD1B 1H5BB 1X6LA 12E8H 4X6CE 5AYUH 5E2VL 3X12B 1MCOH 1K4DB 3QDAA 3MLWH 2VE6A 1S5IH 2J88L 1A7BA 2XWTA 2J6EA 5GGSA 3JV6A 4O4YH 2EDBA 3OF6A 3IJSB 3O4LD 2OM5A 1N64L 4P4KB 5AZ2L 1YQ2A 3BO8B 4NQSB 4RFNC 2QQQA 5KSBE 2VXUL 3KXFE 3MGOB 4MAYA 2AAVA 2NY2B 5F1NB 3L3DA 4NRZA 3T3PE 5JZ7D 3KPSB 3O45A 3VXNA 4UBDD 3VXMD 2IAND 5C08B 2X9WA 3CC5A 3P9LA 3PWPD 5TF0A 4X7TB 3D2UB 4F8TA 3RL1A 1AKJA 3NIFF 3UYRL 3U0TA 1NDMA 2GYSA 3GMQA 5B39G 3QCUH 1HEZB 2X4SB 2OTUA 3TBTB 4MAYC 3EGSB 4NQXA 1QKZH 2HFEA 2EDNA 3D0VA 3C09C 3KDMB 3OX8A 4WW1A 5K9OB 4GQ9H 4WFGD 5GGVH 2EDKA 4HHAB 1BAFL 1MHHB 3C2SA 3GMLB 3PP4H 3ZDZE 1T6WA 1E4JA 3DUUB 3LEVH 3D85B 5T1LD 5K9JH 4WI6A 3P4LA 5F9JB 1U8NB 1JPSH 4QTIH 4QRQA 3NIGE 1M6OA 4OFVA 1CLOH 2XTJC 4KZDH 1JGDB 4I1NB 3EJJX 3CU1A 3J8F7 1RZFH 4M5ZL 1M1SA 4P49A 3S36X 3IAGC 3AVEA 1EFXD 2FO4B 2BXYA 5SWSD 4CN1A 3MJGX 1G7IA 4PJ5D 5B39B 3K81A 1P7HL 4XPFH 1BZ7B 5DD1L 1Z5LA 1PKOA 3GSXB 4YDVB 1GAFH 1KJ3H 4OTXH 3O6FA 5A2JH 4KDWA 2FO1A 2CKBL 3H42L 5I9QC 1VERA 4PJ8A 1A1MA 3LIZH 1BECA 3DV4B 1CIUA 2FR4B 5TDNA 4MNGA 5FO8A 4J1UB 4MA1B 2J12B 3QNXA 4YR6B 1BD2A 4XBPA 3IF1B 3O3DB 2AK1L 4LSTH 1TMCB 1P7QA 5DF0A 2X70A 4JZJB 5EC2B 3U9PH 1BX2A 1KLUB 3EYVA 4K7FB 1KIPA 2DQHL 3JWNC 2AEWA 5C2BH 1OLZA 4KMTL 3B9EA 1MCCA 3O6FC 1A0QH 2CRMA 3P4MA 4PJ8C 4NHCH 5HHOD 1BIIA 3P0YL 1CLYL 3QPXL 1GGIH 1A1OB 1T03L 2IWGA 1KEGL 1IMHC 1P5VA 3MQIA 1FE8L 3NFSH 4XH2A 5IW6A 3W2DH 5BJTB 2HFGH 3RKDD 2BOCA 1MJ8L 3HI5H 4MVBD 3P30H 4JO3L 5I74B 3ZYOA 3O6LH 2OLDA 5CBAA 3ULUD 5CZKA 3QH3B 2X1WL 5ICZA 2CDFB 2H6PB 4LSRH 3HS0A 3IKCB 1XF2B 1T0MA 3QXVA 4PJEF 4X9FA 3FB5A 5MEPB 3WDHA 3EZJB 5ALBH 2W0PA 3BESR 1ITCA 4BUGA 5DK3A 2G2RB 2XQYK 3FONB 5DRXA 1RK0A 4OLVH 4PGEB 5K59F 2R4RL 1DBKH 1XGPA 3QIUD 4GBXB 3X3GL 1OTUC 4UV4L 4R26H 3E2HC 1KENL 4J8RB 1VGEL 5T1DL 3AU1A 1S7VB 1BD2E 4JFQB 2PN5A 4LAJH 4P3DA 1DUZA 4O51A 1FG2B 2VISA 4F3FA 1YQVL 1ZA6A 3FOLB 1S3KH 4KVNH 5F7KC 1KCUH 3TBWA 5IGXL 2YHGA 4YPGB 1DQJA 1NPUA 2HT2D 4DWHA 3FQXB 3BPCB 4L8BB 3CU7A 2ICWA 3M1BB 4XNMB 1K6QL 4QF1A 3V0VA 4O2FA 4MA7H 2AXFB 4NIKB 3VGAB 2BHYA 3TV3H 2Q1EA 4ZD3L 4RFOH 1F6AB 2ED7A 3UZEA 3MLYL 2FGZA 3LPFA 4FQQB 5I1GL 3K74B 1QSEA 4ZPTB 4Z7WF 1CXLA 3MACL 1DSFL 1T7ZA 1EZVY 3CXHJ 1IAMA 1LO5A 5E08H 2V5MA 5CILL 5IIEA 3T2OA 4KV5E 4JGMA 3P11H 4G9DA 4E41D 4LDOB 3BEWA 5HPMA 1I75A 1NJ9B 1PX4A 2XWBB 1JGLL 1V3KA 4QRRD 5LAXB 4I0PD 4FQXA 2XOTA 1G7QB 3L3KB 3QEGL 4KZEL 3ILQC 1DVFA 3PHSA 4I18B 4JQXC 1S8DA 4NM4L 1D5IH 2A6IB 4O2CA 4U4BA 3OXSA 4LGPB 4WIQA 5I75C 3TNMB 3V5KA 2X4RB 1RPQA 4QWWD 3BPOC 4WUUD 3DURB 4P3WA 5B8CB 3QDMA 3EDJA 3MYJA 2OMNA 2BDNL 4QT5A 4V1DD 4FQXC 4JRYD 3RHWK 3HRZB 1B0RB 1DVFC 1F2QA 5SWZD 4L3EA 4L8SB 2BSSB 4I5BB 1A6UH 1A7NH 2WV3A 3KPTA 2ZCKL 2DLIA 1IGTA 4KGLA 4XXDA 1W0VA 5AUMA 5CBEA 2D7NA 3OAYK 3KYAA 2YN3A 4KJWD 4JFDA 1DBBL 4OAWB 4X7DC 1QR1B 3H6JA 4KI5D 2EZ0D 2WUBH 3VU2A 2OS7A 1VB9A 4OSUL 2UY6A 1FO0A 2ADFH 4HUKB 4N0RA 1RZ7L 4ODXA 1ZLUK 1ND0A 2CSPA 3KPQB 3HRPA 3EOBA 5IMMA 4U6YB 1YDPA 4HMCA 4JY4A 1UH4A 3BN9C 4WI9A 1OTTD 3E6FB 5JO5B 5IFHL 3NFPA 3WE6B 1XIWB 4LPCA 3VXQA 2IPUK 4JM4H 3HAEH 4LHQB 4TQEL 4DK3A 1EHXA 4B7IA 1DN2A 2P5WB 4YHYB 3SDAD 5MERB 5EU4B 2HLAB 2V5TA 1I9RL 3LDBC 5ENWB 1WZLA 2NY3B 2VC2L 4P2RD 1E4XL 5CWSA 2P42B 4FXKA 4KTDL 3WYRA 2IC2A 4HH9A 4ODWB 3ARFC 5E94A 5C6TL 2D31A 1NCCH 5DJXA 1PKQE 1DCLA 2MPAH 4ZPVB 4PP2A 4F58H 1FFNB 3QDME 4NQEA 4U1MB 2CUMA 4EN3D 5DURD 1CVRA 5CHNB 5IB1B 1NLBL 2F8XC 3VXTB 4PJFF 1AJ7H 1KULA 1BFOA 5E24E 1AQDA 2BK8A 4XMLL 5IQ7L 2O5ZL 4L3EE 3U46B 2FGWH 3BH8B 3NACL 3MRRA 2DM3A 3T2NL 4L8CA 1F3JB 2OXGA 2ERJB 4ODTL 4XPTL 4LSPH 4MLSA 4LRNL 4JFDE 4WFED 3LEXB 5GSRB 5DJ0B 3WCYA 4IMLA 2J3SA 2ZSWA 3QDJD 4HWEH 1X5ZA 5EUKB 5HGGS 3S37L 5CJQH 2O61B 3IDGB 3ARYA 4AH2B 2YD4A 3S35L 3MCG1 5GGRY 1C5DA 1LK2B 5GRXG 4OI7A 2DMKA 1UWXK 3RHWF 3K46A 1U95A 3X3FL 1RUAH 4RGOL 3B8YA 2V9QA 5GJSH 1J8HE 1DN0A 1E0OB 3HG1B 3QQ4A 1BBJA 3C5JB 3MLVL 4M4RA 4GKNA 1TZHA 2XN9E 1J12A 2HN7B 1UENA 3PQYA 2B7DT 1BGXL 3OKEA 4CADB 4RWYL 5C0IB 1MWAH 4BM7A 3WFDL 5E8EA 3T0XA 5EU6A 1IFHL 2DQIH 1PYWB 3MRDB 5D2LA 5TQ2L 5D9SB 3QCTH 4AEIL 3L7FB 1ACYL 2ITCA 3BMVA 2EYRA 2BVOB 4EXKA 2K7PA 3TPUB 3GSVA 3W11C 4MX7B 2BY1A 3AREA 4JZOA 5E8DH 1TETH 5HVWA 3HZYB 4NO5B 1NEUA 2AJ3A 2P8MB 1GGYA 5JW4M 3EO0B 3ISWA 2NTFB 1JP5A 4K9EL 3IDUA 2R1WB 5IWLA 4ZOCA 2X4NB 3L1OH 4UNUA 3U83A 3PV7A 5AAMA 1S7SB 3MGAA 4LMQI 4WI7A 1A14L 4YHLL 4R4BB 4MAUL 3W9EA 3V4VH 4TTDD 4R7DA 1U3HA 3AREC 3TFKC 1A47A 4S1DD 2HRLA 1KN2L 1KTDB 2IQAB 2NX5A 2Z91A 3OAUH 3BD5A 3QUML 3QQ9D 2E6QA 1ZK9A 2VLRD 1XCTB 2R56L 4WI5A 5EZJA 4BFBD 4U0RB 4LLDB 3OR7B 5AD0A 3TA3A 4JB9L 2NY7H 1W72L 5LG1A 3I2CL 1QYGL 1CFTB 4OCLC 1U3HC 4ELME 2Z0BA 4P57A 3PQYE 5I1AB 1JPGB 3BHBB 3DX8B 4U6VL 2L7UA 5LGJA 2YSSA 3OKYA 1H0DB 1O0VA 4C56D 4R90L 5H35B 5BRZD 5DMYA 5GZNC 2W07A 1KG0A 3MNZB 4ZTPL 3UJTH 2NQCA 3WFZA 2HTLC 4BH8B 3O3AB 3ZDYF 3TA3C 5BVPH 2F15A 3SKMB 3BRFA 4CNIB 5LQBH 1C12A 2HJLB 3N06B 3GSNH 3G6JB 3EDEA 3UTZA 5D8JH 3RX8A 5FKPB 5GSVA 4HV8B 3PABA 1FFQA 2ITDB 1I8KB 4FFZL 3O0RL 1U41A 4PJBF 1MJ7H 4ZUSB 4F57L 1U6AL 3OXRB 4NC1C 1NMBL 1MFCL 3HCVB 1MNUH 3DUSB 3CZFA 3FQRB 1T7WA 3ULVH 2HYMA 4O9HL 5F7MC 3F62A 4PB0H 4EBQL 3T65B 2ESVA 3D0LB 1HSBB 2DM4A 2PYED 2AXGA 1YN6A 1DQQA 2VLKB 3MLUH 3BQUB 1Q72H 2F54D 1LO4H 3L95A 2IGFH 5EBLB 4PJIB 2FSEB 4H0GA 3C2AH 2FHCA 2AV1B 2A38A 1V7ML 3RVUC 2BZDA 3MXWL 4K8RH 3RVWD 4P2QD 3HI6H 2Q87A 1KELH 1HH9A 1SJEB 1BJ1J 4OZIA 3EO1A 3O9WA 3ZLQC 1A02N 3HLAA 1DE4B 4IRSD 4HUUA 43CAA 3TT3L 5KVFL 2CGRL 1UG9A 3DO3A 4LDLB 2FBJL 2DICA 1FCGA 3FB7A 3TN0C 4NC1E 2VZSA 5HI3C 2H9GA 4XBEL 5DUML 1PZ5B 4UQ3A 4Z78A 1MVUB 3BP4A 3IVKB 2BNUB 5EORH 1J87A 4P3CL 5D7JB 2MQ3A 4U1NB 4ALAL 3QXUA 4G6JH 4QLRA 1MCFA 5DLMH 4PJXE 2ZUQC 1LDPH 2YC1B 4KJYB 4DCQA 2CR3A 2HFFB 5EOQL 1DBML 1FGNL 3ARDA 2IBZX 5HHXL 3S98A 1MI5A 1CBVL 2Z8RA 1FFRA 4ZUVB 4LAQH 4RISH 3C8KB 5ESQA 5HGAA 2AK4B 3PNWA 4PJGB 3HFMH 4UV7L 3TCLA 1X4ZA 3ZL4H 5IFAH 3VH8G 4NN6B 5ETUB 3VXSD 1MIEL 5HY9B 3ARGA 2XKSA 4IRZL 5D5MF 2A0LC 1YPZB 3OR6A 4DN4H 3FL7A 1A4JA 4G6FD 5DFVC 4ZXBC 5SWQB 4J6RL 1F8TH 2YWZA 1PQZB 3RWHB 3MV8D 1MEXL 2VRAA 3HZMB 5DC9B 5DMGC 3WEXA 1JNLH 1CE1H 4P59H 1S7XB 5F21B 3SO3C 1ZV5A 3R8QA 5AAWA 1I8IA 1JK8B 5FYKE 4HS6A 2EXYC 3M07A 3QUYC 1RV6X 3O2VL 5IVZA 2IFGA 1Q9KA 3UTSA 3Q1SL 4JZNA 2R0WH 3VGGA 3LKOA 4WVRA 1DEEB 3TO4C 5GRWA 2CQVA 4K07A 1F4XL 4OLXH 3L9RB 4TYUA 3T4YA 3Q5OA 3T77B 3JWDL 4LPVA 3KXFD 1MI5E 1UZ8B 1IJ9A 1NGPH 4AG4H 5CINL 4TSBL 1G9MH 1CICC 3GHEL 2DTMH 2HTKD 5KOMC 3PE9A 1NMCC 1ZLSL 4HFUL 2OL3A 4DFHA 1AHWC 2EXWD 4HWZB 5ID0B 2ZG2A 3GSOA 3TO2A 3QUZA 3WKML 1TZGL 1HOCA 1TVBB 4X4YA 3O2WL 1F3DH 3PDOA 1QFOA 4ODSH 3HAEG 1CIDA 3BUYB 5CSZA 4XX1E 1A3LH 1MVFA 3DXAA 1Q9WB 3UJJL 3TH3T 2EIBA 2P43B 5CEZL 1FZJB 3IFPA 4JPKL 2LU7A 3QUZC 3QXTA 1A4KA 4MDJB 4Z7QF 4M6OH 4UINL 1WCBB 3ZKND 5I8OL 1VFBA 3KPPA 4GMTL 3GNMH 1IQWL 2CLRB 4K2UL 1H3PL 1HSAB 1KPRA 4N0CD 3V6BR 1OL0A 3F7PC 5A2LH 1UEYA 3D6GA 1INQB 2B4CC 1P6FA 3C5ZA 4RQQA 4QNPE 4YDIL 2OK0H 2WANA 3OKKB 3P2TA 5FCUL 4ETYA 1KFAL 1DL7H 4UB0H 1JNNH 4B7LA 2VZUA 2AV7A 1UYWL 4IRJA 1BEYH 5JQ6L 3HAEB 5IEKB 1SYVA 2CJUL 4PR5A 3C8DA 4M9OA 3RQ3A 3C5ZC 3ZE0F 4MWFA 4HG4J 4WEBH 1RFDH 2XQBL 4PLKD 3RWEB 4K7PX 2XZAH 1VEOA 4L8DB 3A0OA 3EDFA 1FNFA 4RSVA 1AGDA 5E8NB 5F9WC 1KT2A 1AD0B 3DO7B 3AXLA 4MXWH 2VKXA 4GH7B 3RPIA 3JV0A 1KC5L 5GGRA 3P73A 4MD4B 3PXJA 3V9FA 4IRJC 5HGBB 5DUBB 5ICXB 4NQVB 1OD9A 1UB5B 2V6HA 5I18L 3DXAE 1XGUA 2BCKA 3VXRE 1ODAA 1L0QA 2EEDA 4U7SA 4HCRH 5CP3A 4FXGB 1YEJL 1KGCE 3LKNA 1T1ZA 1C5BH 4H5SA 3BSZH 3JZ7A 4G43A 2BSRA 3CSGA 5CAYB 8FABA 2ADGB 2GFBA 2LTQC 3DIFB 1QA9B 3B9KA 1ZGLP 1IEHA 1A6VH 3G5XA 3HPLA 4OLZH 3C6LA 5I6XB 4JG0L 5DRNA 4OJFH 5FHBL 3PWUB 1QUNA 3FQWB 4JANA 5EA0L 1OGTB 3UTOA 3WFHA 2XKUA 4UT6H 4WY7L 1RUKH 1GZPB 1MQKH 1NGQH 1X9QA 6FABH 4ZFFB 3D9AH 3B9KC 4AMKH 5JMRA 4LIQE 4QYOA 3C6LC 4RFEB 4PJ8D 2NY1D 1VHPA 1U8LA 4Q9RH 1MWAB 3CJJA 5DMJB 4LCWD 4U1IB 2IADB 4OZGA 2KPNA 3B9DA 3K1KC 4YNYB 4YGVA 1JNHA 3O8XA 3T0EA 1K5NB 5C0EB 3IU3A 1FNHA 4OLWL 3NA9L 1GHFH 4HBCL 1RZIA 4FFVC 4I13B 3O6ML 4U2ZA 3SE4C 3KWWA 5FV2A 2JTDA 2OJEB 3ARQA 4LKCB 5GS0H 2Y5TA 3WV0A 5FUOL 3VRJA 1U92A 1URLA 4JFFA 2M26A 4M48H 1PSKH 4EQ2A 4EUPH 3I75A 3O8XC 2B5IB 4XBGA 3PWNB 1XF3A 4LCUB 4KMQA 5HXMA 4F33B 4HWNA 4WTXA 1A7OH 3FB8A 4S1QL 3VFTB 1K8IB 4LGRB 4QY8A 1OTUD 3WIIH 4JFPB 5I1LA 1C1EH 3V52L 3FO2A 4OM1H 3WS3A 1A9BB 4OD1L 3UYPA 1RU9L 1YEDA 2LE9A 4GT7A 2VDPL 4QTHA 1DQDL 5K9QI 3HUJB 4WWKB 2FBOJ 3SDYL 3T3ME 3S96B 2PCPA 4HW6A 5CJXA 3M17A 1WISA 4NO3A 4PRPA 2XNAB 5EIIB 5CP7A 4XMKL 2NR6C 3KPRB 5BV7B 3VJ6A 1H3XA 4CVZB 3PXHA 5HI5C 5HYQB 3BIKA 4UZGA 4OIIL 3GSRA 3SGKC 9CGTA 1CF8L 4J3TA 2ZUWA 4UAOB 3QWRA 3L3IB 4F7EA 3IFNH 3CZJA 2AI0L 1LEIA 2VB5A 5LVEA 4NZTL 5CJXC 3IXTB 2VAAB 5BZDA 3MGTB 4HKBB 4LP4A 5CZVH 3NFNA 3KYKL 3MZTA 3U0PA 3RDTB 2HH0L 1OTSC 1WFOA 2JELL 3GSNB 3WS6A 3O41B 5LBSH 2VYRE 2A9MH 2QSCL 3QJFA 4XAWH 3OKDA 5TJWK 3PG2A 1QBMH 1I7TA 1L7TL 5KSUA 1JVKA 3ECBB 4X98A 3SGDH 3RGVB 4NT6B 2DWDB 4OZFH 2KZ1B 3RX5A 2EDYA 3FHAA 1PLGH 3WUZA 2WUCH 2DQTH 3F7RA 3TBVA 5ILTH 4X7FC 2N7AA 5CD5C 3WS6C 4WCYL 1G7MB 3SCMB 3L5XH 1KJVA 3ULUL 2G75B 3ZE2E 1HE7A 1EA9C 2R0KH 5HYIA 1IC4L 1XGYH 1YNTA 4XPAL 2D7PA 5DHYB 3VMPA 1QFUL 1Q0XL 2BY3A 1WFUA 4PRPE 3LD8C 12E8L 2YRZA 3JTTB 5AYUL 3GBMH 1W0WB 3LN4B 1MCOL 3MLWL 5BS0A 3BPLC 3ULUF 1VFMA 3IJYB 1EBAA 5EZLB 4POZD 3RL2A 3MUGA 4O4YL 4Y5YA 5I8KL 1IT9H 2VNCA 2C5DC 2F53E 3D18A 3ARZA 4UOJA 1I7UA 3UBXG 3K3QA 1J10A 4RMRA 3BGMA 4BQ8A 1K2DA 2JCCB 3I6GB 2EEBA 4A6YH 3MNVA 4UOW0 4TVPE 4Z7UB 5HJ3A 3NN8A 4H1LA 5E6IB 2B1HH 1IILE 2A74B 3EYOA 1CXEA 4HH8A 3QCVH 4L3ED 4C83B 3H0TB 5E5MB 4UDUB 2EICA 5AG8A 4Y5YC 3FT4B 3BN9D 4OLUH 5FGCE 5IEHA 1IM9B 3V8OA 1S9YB 3QCUL 2CK2A 4C59B 4MD5A 4Y88A 3WNOA 1AI1H 1II4E 1IC7H 3MRJB 4YHIB 1QKZL 4L4TA 3LN5A 4L3CB 4YHZH 2DB8A 4WTZG 4RGMC 1F4WH 4U6XA 5GGVL 1MUJB 2OSLA 3RWDA 5I1HH 3RTQD 4OZHB 4NRXA 4U33A 3PP4L 4NQDA 3ARFD 2V5YA 3MUY1 4FP8H 3CSPA 3LKRA 1J8HD 3TGXA 3LEVL 3WLBA 1WZMA 1OW0A 4QO1A 4Z95H 5BS0E 4FHBD 5D7LB 1XF4A 2XN9D 1JPSL 4QTIL 1OLLA 3ORJA 35C8H 3NABH 1TTFA 3U6RA 4G6AC 1UJ3C 4KZDL 2XZCH 2E9BA 4M1CC 1RZFL 5I76A 4X4XB 5FGSA 4KRMB 3N85H 3VFMA 4K71C 3HZVA 1ZS8B 2VIRB 2ICEA 1QG3A 2XT1B 1ADQH 3VXPB 1QEWB 4XPFL 5ACZB 4RAVA 5HDBE 4JM2A 1GAFL 3QFJA 3CH1B 1KJ3L 2CDEA 3D1MC 3FT3B 3G6JF 3QWOB 4OTXL 4P23D 1U2HA 4H26A 2I9TB 2HA1A 1KJMB 1AXTH 1WBZB 3LIZL 4HKJA 1H8OA 3MBEA 3WHXA 2NW3A 7CGTA 1OT2A 4MS8D 3KPLB 4LSTL 4TPRH 4GRMB 3GO1H 3U9PL 1JTOA 4Y19B 4JM2C 2QSVA 4U1GB 5C2BL 1F11A 2W60A 4HLJA 3P77A 3H7LA 1A0QL 2DAVA 2X42A 5D7IE 1XGRB 4GRLB 5JPMA 4NHCL 4DGIH 4OLEA 1GGIL 1NEZA 3N0PB 4NQDE 1HCFX 1IRAY 3MBEC 4P2OB 1ZHLA 2GW5A 5IHZB 4PJIF 1BP3B 5B38G 4P5KA 2YD1A 3W2DL 4H25A 1EZVX 5EFIB 1LO3H 2HFGL 1WGOA 3PQYD 3QXAB 3HI5L 3U4EB 4M61B 2HKFH 2EYTA 4HMEA 4KXZH 4UNVA 3O6LL 4LEXH 4EJ1C 4G7YH 3S3SA 2ZNXA 3HE6B 2BNQB 4BK5A 4X6EB 1G1CA 3L3JB 4LSRL 4NPYA 1BFVL 3EFFB 1HXYA 4RMSA 1J0JA 5MEOB 5ALBL 3AUVA 3DX6B 2MMXA 1RJZB 3ARED 3AFLA 4TTGA 3QYCA 2D3VA 3QFJE 3AS0A 4OLVL 2YD8A 4P5TC 1OGAD 5E2JA 3IXAA 1V05A 3DX7A 1JTPA 2YZ8A 1DBKL 5KW9H 5DYOB 2Y6SC 1X3DA 4M7LT 3QNYB 3CFBB 4AT6A 3VFVA 1NC4A 3WIHA 1U93B 4EDWH 2OX5A 3OJDA 4ZOAA 5KTEH 1V7NH 4PJAB 5C9JB 5B38B 3MFGB 1LD9A 4PREA 2VLJA 2IH3B 1S3KL 4KVNL 5KN5B 4HQQH 1KCUL 3WFCH 1HHHB 2MCPH 4OGYH 4PJGF 3HZKA 1YY8B 5FOBB 2XI9A 1JV5A 3CMOH 4XVTH 4A2MA 5GGTA 1SY6A 1XF5A 5GXBB 4ODUB 4MXVF 5C0BA 3TA3D 4WHCA 4JRXE 4MA7L 4HUWB 1YPZF 1MAJA 3TV3L 2W9LA 4W4OC 4RFOL 1A7RH 3QBTB 1LO2H 4JAMA 4LL9A 3FN0H 4E5XB 5HGDA 3QEQA 3WNNA 3BJ91 3CFEB 1G7HB 1I1YB 2GJ6A 3IJHB 2HFTA 4G8GB 5E08L 4YFLF 2AEQH 4ZDHA 4ETQA 4ZQKA 3NIFE 2EKSB 3P11L 4OQTA 5DD3H 3QO1B 5IFJB 4BSVA 2HKHH 3WIFB 2LV4A 5HHNB 1IEAA 4P4RA 2R0LH 1MCQA 1UFUA 1MCBA 4WU5B 1ZHKB 4EI5A 4M4PA 2BVYA 5J3HD 4EUPG 1Q8MA 3AB0C 1D5IL 3MUHL 1MHEB 2QR0B 3RVUD 1ZT1B 3CFJB 4HZLB 3W9DB 4JHWH 4HUXB 1R5WB 3CXHK 3B3IA 3KLHC 5FO7B 3OWEA 1JPFA 5E00B 1ZVHA 3O3UN 4JY6B 3TN0D 4OCNC 5HI3D 1A6UL 1A7NL 1FC2D 1MCHA 4M02A 5D7SL 1KYOK 3MMEA 3UTQB 3L5WA 4PJ7B 1AR2A 1RJLB 4F15C 1ZT7B 3TIDB 4OCRH 4WO4A 5E9DA 1TXKA 2HJKB 1MHPH 4PJEA 4N0UB 1NANH 3SKNA 4MQ7A 1BZQK 1CFSA 2WUBL 3TWCH 4L4VB 1T6VN 2ADFL 3WMSA 2GJ6E 2Z31A 4DW2H 4I9WD 5ISZA 5BXFA 5FYKD 43C9A 1S7WA 3UDWC 1Z9OA 2CLZB 5J13B 4JG1H 4WO4C 4NNXB 5ESAA 4JM4L 4HIJA 4B0MM 1CL7I 2Y25A 3R06B 1MH5B 4NP4H 4RGNB 3LS4H 1ZLWK 1RHHB 4R2GB 3TLRA 4HUNB 2A0LD 5EO0B 3SDXA 3NCMA 1CD9B 3CVHH 1HK6A 1U58B 4HFWB 3V5HB 4E42B 5IR1B 3KLDA 3OAZK 4NZUH 3SBWA 1ZAGA 4NO0B 4ZXBD 1NDGB 1NCCL 2MPAL 4NO2A 3BP6A 1R5VB 1ITBB 3DI2B 1P6AB 1HQ4A 2DLFH 1IL1A 3U30B 1KCLA 3L6FB 3QP3A 5DMGD 1WIUA 1AJ7L 5D2NB 3TZVB 1WZ1H 5KSAA 4LFHD 2WP3T 3LV3A 4JJHA 3EOYG 3RU8H 2NCMA 2FGWL 4D94A 2EXYD 3QUYD 1FZKB 3SBWC 3F65A 1QHPA 1H3TA 4Z7WA 4Z7OF 1N59A 5E9DE 4LSPL 1M7DB 1AQKH 4PJEE 4Q9BA 5DQJA 3TO4D 4YDLC 3FB6A 3ELAT 5C0AB 2Q6WA 4MGXA 4HWEL 4K3DH 1H3UA 5T33H 2V2XB 4JFYB 2MKLC 4X80H 3P0VH 5CJQL 5KSAC 2KDGA 1YYMH 5ISZE 5K59E 4OZFB 3KGRA 2AQ2A 1CICD 4TUOA 1UC6A 1BLNA 1VADB 2ARJB 3MJ7B 5T3XH 1RUAL 1RK1A 4XVSH 4BUHA 5GJSL 3RZCA 1YUHB 1MCJA 4TUJB 3H9HA 4QOKA 2I26N 4N1CA 3VWJB 1D5BB 2CUIA 5GRVK 3IDJB 2EDJA 1AGCA 1A6WH 1N5AA 3FO1A 5KS9B 1MWAL 2EDRA 2H8PB 1BQHA 4FMFA 4ZOBA 5DJ2A 5EWIH 1JL8A 4LPUA 3SE8H 2EDQA 3QCTL 3RUGB 3KPNA 1HKLH 3BEVB 5I1JH 3QZWA 2EE2A 3RZCC 1OGAB 3G6AA 3BYTA 4PJCB 3PL6A 5I1DA 5D6DA 5DK2A 4LHUD 3VD5A 1OB1A 5E8DL 1TETL 4DZBA 1YC7A 3VCLB 5F7UA 5LKNA 1ZSDB 4IOIB 4YZFF 2P47B 5HHPA 3SPVA 3GMMB 1T5XB 3DMMA 4PRIA 1U8MA 4XP1H 4Z7WE 1DZBA 1F02I 3MV9A 4AK1A 5DSCB 3L1OL 1A5FH 3OTTA 4NHUA 1PZUB 4A6YB 1QSZA 5EO9A 1ORSA 3GRWH 3V4VL 3VXRD 3PL6C 5D6DC 1J7VR 3VFOA 3Q3GB 3EIFA 2YPLA 1UB6A 3DTXA 4D0CB 3OAUL 2OQJA 4LVHC 1KGCD 1JWMB 5GRUH 2AJVL 5KSVA 5MENB 4PRBA 3DMMC 3MROA 3BP7A 2FDBP 2X4OA 5L8JB 1EO8H 5IHUL 2PNDA 4OV5B 2XPGB 4BFGA 1WFTA 2C9AA 2Q3ZA 2NY7L 2WWKO 3BGFC 3S5LG 5BV7L 4JKWA 3LVEA 4QOKE 5CSBA 3VD3A 3CNKA 4L9LB 1CLCA 3X11B 2AKRA 5EU3B 1FCCA 4Q6IB 2HJFA 2DM7A 2CKNA 1JCKA 2G5BA 3LRSB 4NNYA 5JW4N 2ENSA 5D1ZB 3SDCB 2WIIB 3HUJF 3VFSB 3TESA 1FL5A 2XYCA 3TIEB 3CFKA 5IQ9A 4JPIB 4IRJD 1AO7A 2R0ZH 4PJFA 4UNTA 3UJTL 4YPJA 2DN7A 3VGEA 2AEPH 5BVPL 1KIUA 1BVLA 1U8QA 1DFBH 3I3DA 5F7NC 3F12B 5F89B 1M7XA 5LQBL 5BQ7B 1P1ZB 1CDJA 2Q20A 4Y4KB 3TVMA 4X99B 3GSNL 5C0CA 5AYQA 5ITFA 4JDTL 5HHME 2W9DH 5D8JL 4A2LA 1LEGB 3IGAA 2HVKA 3VXUE 2DQFA 4YHNB 3N1MC 1EIBA 3MFFA 2DYPB 3MV9E 1I1FA 1MJ7L 1F90L 3PDGA 5IK3A 4QCIA 3SDDA 4IOFC 1MNUL 4L1DA 3RWCA 2A6JB 1JN6B 3TVMC 2E7CA 3ULVL 4AZ8A 3QA3A 5JOPE 4U0QB 5E8PA 1MRCH 4PB0L 2FHFA 5DZNA 3CD4A 2VERN 4HSQA 3SY0B 3MLUL 3B9KD 1TCMA 1Q72L 1LO4L 3A67H 2IGFL 4P46D 5D4QA 1MAMH 3C6LD 3MR9A 4JFEB 4AEEA 2N7BA 2MOVA 5IROA 3SDDC 4XNQB 3C2AL 3ULVF 2HWZH 1S7TB 5F93C 1PDKA 4HXBH 5EC1B 4LFHG 4K8RL 3JVGA 3HI6L 3GSQA 5FA4A 1KELL 3MJ9H 4NFDA 2VH5H 2Q86A 5E5UB 5I8CB 1RY7B 1HQRA 1RZGB 1CQKA 4WI2A 2I5YH 1AO7E 1QBLH 2H2SC 5HYJA 4PJFE 3BH9B 3MRCA 1WAAF 5DJZB 3GMOA 3PJSB 4PGZA 2QV2A 4FFVD 4PRDA 4JKPH 4DQOH 5IROC 3O2DA 1H8NA 4J23A 1EO7A 1RHFA 4X4ZA 2NNAA 1CZ8H 1IAIH 5EORL 4KDTA 1L7IH 2ZZUT 3MCLH 5FYJH 3JWOH 4KK9C 5H37H 2HMID 5FYLH 4JFOB 5ECJE 3RWFA 2EDWA 4G6JL 3GB7A 1I3RA 3P9MB 5DLML 5F7FA 2DBJA 1LDPL 5F7LB 4HGMA 1S9WA 2JCCF 3UZQA 1KTLA 1SVZA 4CJ0A 3EBAA 3L3HB 4JDVA 4XAKE 1E27A 4RMTA 4Z7UF 1FNEB 3OGCB 4LAQL 3DVIA 1NCTA 4RISL 4MZ3A 3PWJB 4KDTC 1YMHB 3HMXH 3QXDB 1QBAA 5H8DA 5F9OL 3HFML 4ZFZB 4CDGC 5ERWB 4D0BA 3MRLB 4I2XB 5EB9A 3ZL4L 5IFAL 1KIQB 2CDGB 5IESH 1JZ5A 3CUPA 4HUVA 1YEIH 4YBQD 1NAKH 2YK1L 5HI5D 4GG6A 3CDFA 4K9EC 5DD5H 3EHBD 3BXNB 4DN4L 3U2SA 3CCHA 4C55A 2X1PA 5EULV 3QEHB 1QFWH 1F8TL 1OAZH 4BYHA 4WU7B 4P5MA 3GSWB 2VXSH 4MCZA 3MV7A 5ELIA 4QRPB 1JYVA 1ZHBA 4OZHF 1LP9A 1JJUA 3V6ZB 5HYJE 1A6TB 1JNLL 1CE1L 1FZMB 4JQIH 4P59L 2GSGB 4JN2A 1R0AH 3ARPA 1TVHA 5FKAB 1ZT4B 1OTSD 1HHKB 4POUB 4WJ5A 4S1SL 3CDGB 2BY2A 2R0WL 4F7CB 1Q9LA 3KHOA 4F2MA 1VGKB 3DETC 4XMPH 5A1AA 3U7YH 2F53D 5JXED 4OLXL 4DOHE 4JO2H 1AXIB 3H7BB 4GOSA 1HYRC 3DOSA 2GQHA 1QNZH 2VL4A 3IDNB 4R97C 5C07D 1BFSA 1A7QH 1CG9B 3RP1A 1NGPL 5CD5D 4U1KB 1G9ML 1HDMB 2DTML 1NGZB 4PV8A 5F9DC 3FFCA 4TN9A 1GGBH 1TPXC 2FYYA 3P4NB 3LH2H 4UQ2A 3BISA 1B6UA 1BZ9B 1S7QB 5EZOH 3NGBB 5F3HA 1HHGA 3RVTC 5D7KE 1MFBH 1NFDA 5H94B 1DBAL 5FF6A 3PIQB 1T1WA 1AGEA 5MP6H 1K8DA 4ODSL 1CD1A 3AGVA 2DIBA 1A3LL 3ZDYE 3KJ4C 4PJ9D 2XZQH 3RWGA 4BSWB 1JRHI 3MV7E 4PJDB 4M00A 5JIKA 4M7ZC 4M6OL 5BW7C 3NMEA 4HKXB 4BZ2H 4X5XB 5CUSH 3SGJC 3U7AA 4GAYA 4R7NA 3IJSA 3GNML 3FN9A 3C60A 1H5BC 1YNLH 1T21B 2QADB 5IMKB 4PJBE 4NQTA 3MLRH 3KVQA 4X9IA 4YO0A 3V6OA 1B88A 2PO6B 1FFPB 4JDZB 5FO9B 3KPSA 5C8JA 1A7PH 2OK0L 4PGBB 4U6HB 3MOBH 4KMLB 4WI4A 3ZSSA 4X6DB 1DL7L 1I1CA 1JNNL 3IDMB 1KJ2A 4D8PB 2OZ4A 1U8IA 3HC3H 3SKUD 1FVCA 4P4KC 2GJZB 3LRGA 2APTA 5D96B 3BRDA 5C0NC 5D5MA 4LPWA 2X4SA 2Z93A 4LVOB 2EDDA 1OF2B 2NY2C 1NUNB 4WEBL 1RFDL 1MHCB 3H9YA 5IB3A 2XZAL 2P5EB 3OKOB 2GIYA 3CVHB 4KK6C 5K9OA 2DDQL 5DI8A 4BZ1H 1ZHNA 4O02H 3BIBX 1RZJC 1QQDA 3B83A 2DF3A 4MXWL 4PJAF 4R3SB 4M9PA 3ARBA 3DVGB 4F7TA 1E4WH 2WWKT 2VXTH 1RUPH 3D69B 4G6AD 3VG0H 2QHRH 4M1CD 4W6WB 1JWUB 1YJDC 5FFLA 5F9JA 2IG2H 1AP2B 2VDOH 4HCRL 5F1IA 3HE7B 1G7LB 1Q94B 5DRZB 1C5BL 3BSZL 1CDHA 3O3BA 3QISA 3GUTA 3WN5B 1SEQH 4NKMB 3ARBC 3W82A 4HGWB 4HG4K 1A6VL 2C7UB 5KVGH 4OLZL 5IHLB 4XCYA 3H42H 4OJFL 3KPSE 4JFXA 4E0RB 3STZB 1CDCA 3VE0B 1CR9H 3OG4B 2CO6B 5C08E 2DS4A 1H15B 2DL2A 1OP3K 4UT6L 1RUKL 3RNKA 3VFRA 5FM5M 4JM2D 5C0GB 1NGQL 4AM0B 3QFJD 2VLME 3D9AL 3DV4A 6FABL 4AMKL 2FR4A 1R24A 4J1UA 5D5ME 4YR6A 4N8CH 3O3DA 3T04D 4N8PA 2MQCA 1I4FB 4JZJA 5T1KB 1KLUA 3UTTD 4K7FA 1CLYH 1MLCB 1QFHA 1U91A 1DANT 3OB8A 4X0KA 2IQ9H 3W0WD 1R3LB 2OR8A 4JREB 1A1OA 3JWDC 1XFPA 3OHXB 1AXSB 4MA1C 1GHFL 1OAKH 4PY8J 2ATPB 2DIAA 1BOGB 4MA3A 3TYGH 2FD6H 4C4KO 2Q8BH 4JZJC 3ES6B 3LKSA 5BJTA 3I6KB 4LLWA 5GS0L 3GI9H 4XI5C 7FABL 4JRXD 1NC2A 1LE5A 4M48L 4W81A 3QH3A 1PSKL 2PXYB 1Z3GH 2H6PA 4PJ7F 4P5TD 3C87A 4M1DH 1A7OL 3S34H 2HP4A 5E4IA 5JW5B 4G6KH 4YC2B 3LKPB 3WIIL 4NKIH 3GM0A 1C1EL 2A77H 3AROA 2V5RA 4PFEA 5I74C 3WJJA 5L2KB 4XP6H 4J3VA 1AIFB 1JWSA 4XGZA 4ZS7H 4GAFB 4WHTA 4BH7A 1IARB 4QRSB 2BSTB 1I8LC 2GK0B 4EVNA 2R2HB 3IFNL 1NC4D 1J0ZA 1T0NB 3QIBA 4YPGA 4CRPA 1K6QH 1IAKB 1N6UA 3FQXA 4GBXC 1OWWA 3M1BA 4XNMA 4Z7QE 4UIKH 4LSSH 5CZVL 5M94B 4Z5RA 1N2RB 3MLYH 5GS3A 3ZDXF 3QWQB 4KHTH 5IVXF 1RI8A 2Q3AA 4GS7C 3QUXB 2JIXD 5DQ9B 5LBSL 2A9ML 4XAWL 1JF5A 1F6AA 5IMOB 5FOJA 2WBKA 3QHTC 2DL9A 4OKDA 3QIBC 5IOPA 2UZXB 5CEZE 5I2IB 4MCYB 2PW2A 4N68A 4WW2A 5JMOC 3OJMB 3T0DA 1PLGL 2WUCL 2DQTL 3HR5B 1QRNA 5FUZH 5ILTL 4DKFH 3MREA 3SJVB 1JGVH 2H26B 2GTZA 2EH8L 1CDYA 1J05B 3VGAC 5H37G 3H9ZA 1FYHB 3L5XL 2GJ6D 1N8ZB 1A8JH 4F80A 2NZ9C 3M45A 4KZEH 5JTWA 2R0KL 1XGYL 4U7MA 2UV3A 2XWBA 3ZE0E 4NKDA 1ZTXH 4LLVB 1R5IB 5C3LD 3O4LA 5D1XB 4K3EH 3L3KA 1CWVA 3PV6B 5D6CB 5F6IB 4U1SA 4I18A 3KLHD 4AEHL 4EI6B 3UAJD 4OFYA 4PRHB 2X4RA 1FN4B 2NXZB 3MXVH 5KS9F 1FC1A 2IANA 5CS7A 5B8CA 3PUCA 1WV7T 2C3VB 3PWPA 3EYUH 1IT9L 2DQJH 2E6JA 3NPZB 1RJYA 4Y4HB 2GHWB 3RUGF 2P8PA 2WBJB 4I18C 4A6YL 4PJCF 4P2CG 3WL9B 3GIVB 4CMMA 2B1HL 4Z77B 1WQVT 3QCVL 4LBEB 5JZ7C 5JDJA 4OF0A 1SHMA 5B8CC 4J3OC 3DRQA 2H41A 2DRUA 4OLUL 1IQDB 3F58H 1MLBA 2GSIB 4HAFA 3RVVC 3AY4C 1ZVSA 2Y1VA 1J88A 4XXCA 2D7MA 1AI1L 1CGSH 4L8SC 1IC7L 5CD3B 2WSKA 3KPQA 4KKCD 4YHZL 3E6FA 3WE6A 1F4WL 1MFDH 1XIWA 1P4IH 5ISZD 2VE6B 2IAMD 2D9CA 5I1HL 4M6AA 4JKKA 3SQBA 3MYZA 2XWTB 3F8UB 5FGBA 3S37X 5F88A 4FTVB 3HPJA 3JV6B 4OD2A 5CGMA 3S35X 4HS8L 4FP8L 5EU4A 4XXCC 1EFXA 4Z95L 4RAUB 5SWSA 4PJ5A 32C2B 4NQCD 35C8L 2X9XA 3NABL 4MAYB 4ODWA 1XIWC 2OP4H 2WINA 3L3DB 2W1NA 4ZPVA 4NRZB 4XMLH 1FFNA 1QVOB 2XZCL 3GSUA 3O45B 4YXKH 4YHYC 2OTWB 5CHNA 3CC5B 4XCNB 1I1AD 3P9LB 1SMAA 3KYNB 3QHZH 3VXTA