5FM4A

Structure of the c-terminally extended domain my4 of human myomesin (space group p21)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
STPAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords MYOMESIN-1
publication title Binding of Myomesin to Obscurin-Like-1 at the Muscle M-Band Provides a Strategy for Isoform-Specific Mechanical Protection.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 101
sequence length 101
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fm4A01
1LEKA 3VXUA 4OB5H 4P4KC 1U8KB 3FOMB 4MDIA 5DMKB 4LF3A 2MCG1 4OF5A 4MWFB 5IGXH 4LSUH 4O9HL 2GTWB 3DGGB 3KYOB 4GQPH 3SKOB 4PS4L 4XP9L 2MNUA 2CDGA 4LSTL 4F57L 3O6KL 1MCSA 2VIRB 4QCIA 1AP2B 4YFLF 4IRSA 4X8JB 2E6PA 4OGZA 3K3QA 5D1XA 5D71L 5IMKB 1AXTL 3OKNB 1MQKL 4Q2ZB 4R7DA 3BW9B 5EZOH 4OQTL 1SBBA 4EQ3A 5IQ7H 3D3VE 2FSEB 2XQBL 1TFHA 3HCVA 2E7CA 1A7RL 1NL0L 1F4YH 2BSRA 3WV0A 1JPTH 1MCLA 3D6GA 3ABZA 3BKCH 2W92A 5C0NC 1IGCH 2BNRD 4LARL 4PGDA 2XNAB 4EQ2A 4JHWL 2CKBL 1CGVA 3QDHA 4D3CL 5I75B 2VDKL 4PJXB 4YJZL 5C07B 4DK3A 1S5IL 3S96A 3V6ZA 3HE6D 5T33H 4JKWA 5TE6L 5DYOB 5A2FA 4XMLL 1EHLL 2GT9B 4RGOH 4HS8L 2DQEL 2AV7B 4XVSL 3MNWA 3S88L 1TVDA 2OTPA 2X40A 1BQUA 1EFXD 4FFYH 4PLKC 4R97C 2HTKD 5JXAH 3I75B 2P42B 4W4NA 1P7QA 3R06B 4Z7VF 5D72L 3TO4A 3Q3GA 5KVMC 1I8MB 5D1QD 2PXYB 1GPOH 1R3IL 3MR9A 4G7YL 4ODTH 5FDYA 5FO8B 2NY2C 2X09A 3UTSB 5CLTA 2IPTH 4LKXB 1FL3B 4O2FA 5IW3A 1WWCA 3AY4A 3EYFB 1YMMD 3OG6B 5EIIA 1WWBX 1X5FA 2NYYD 3SBWA 1E4XH 1RZIB 5E8OB 2CKNA 4KXZH 4YR6B 4QNPF 2R1YB 3VXOA 4JKMA 2FGWH 4YUEH 1FV1A 4C83A 5C09A 1IBGL 1F00I 1A3LH 4JM2B 3BT2H 4CAGA 1I1FB 1F3JA 5ITBH 2VQTA 3JWOL 5CEZE 3O8XD 4HIJB 4NQCE 1D6EA 3VRIA 4YHZH 2VDPH 5C0CA 3ZYOA 2Y06L 5FIEA 2ZSWB 2VLJB 5JOFB 5K9JH 3LN5B 5E2TL 1WZ1L 4HW6A 3MLTB 2NXZB 4HWBH 4AQ1B 3UX9B 4WFHE 4QRPA 4TVPL 1LK2B 1FGVH 3T2NH 3UBXA 2WBJB 3E8UH 1NSNH 3IFPA 4MXVE 1MELA 4KJWD 3QI9C 4L3ED 1H8SA 4YPGA 5E95B 3S4SA 4DKAA 4EOWL 4YNYA 5DHXB 4PR5A 3DXAA 3LEVH 5CSZA 4BSVB 1QQDB 1E4WL 1QBBA 1XGTA 4NO2B 4F9PA 3KPQA 2G5BB 4ODBD 1ZHLB 3TBSA 3MV8E 4IMLB 3QPQD 3QFJE 3IDJB 3GRWA 4OQTA 2AABL 3GHEH 4GRWE 2QSCL 4TUJA 4MXQC 3QEUB 4U1JA 1IKFL 4YIQA 5DQJB 2IFGA 4MAUH 1UZ6E 4OCSH 3VWKB 4ZFFB 1D7FA 3RTQD 3QXTA 4I3GA 5GS0L 3QHZH 1RFDL 4XNXH 2EC8A 2NY7H 1K4CA 4OKVA 2HT4D 2RCSH 4G43A 5EZLA 1TQBC 3FT2B 2NY3D 5DMGD 1TPXB 2JJSA 1TVHB 4JN2A 4ZXBC 4PTUB 1QZ1A 3D39D 3B5TA 1N4XL 1CLCA 3S35X 4N8VA 4LQFL 4NRYB 5L2KD 1G84A 4U1MB 2R2BB 4EDWH 3GSWA 2MJWA 2IANA 2HLAA 2AJ3A 5TJWK 3VFNB 1LD9A 3VRJA 1N5YL 4RDQG 5JXEC 3I3BA 3L7EA 1U8NA 3K4AA 4KGLA 4TSCH 3RPKA 3V0AC 1KLUA 3IFLH 4FFZH 4Q9RL 2YN3A 4JGUA 1NFDA 5BV7B 3QEGL 4KK6C 4PV8B 4ENED 3RWDA 3IB4A 1BQLH 3W9DA 1AGFA 4GG6A 5D6CA 2R2EA 1E6JH 4G6AC 3ZMRA 4GBXD 1CFSB 4TQEH 1MUJB 2V17L 5IT2H 3MREB 2A6KB 4Y1AB 3CSGA 3L6FB 3N9GH 4XNUL 3MNVB 3X13A 2FX7L 5KSAA 2X4SA 1N64H 1MI5A 1GIGL 1NFIB 1UWXH 4M9OA 3SDDD 4UV4H 2MPAL 3ARTA 4I2XA 3HG1E 5J3HD 4U1LA 3BKMH 4JRYE 3U79A 1I3RA 5EWIL 3V5DB 1XMWA 4XMKL 4IIQA 2BVYA 1PG7L 5T5NF 4PJ8A 1XF4B 2X05A 4TYUA 2Q1EA 2ADJB 3FRPA 5I8OH 1NAKH 3QUKB 2NTFA 1X5ZA 1KPVB 4HUMB 4F7TB 1FZKB 4PJXF 4N90D 3BKJL 3EFFB 2BRRH 2DYPD 1MAML 2BHYA 2ZCHL 4LQ1A 4OCMC 3TBVA 3VXRA 3FKUS 4IOFC 4AL8L 4OGYH 5F96H 3F7RA 2R0WH 3LKOA 1AY1L 5JR1L 3BQUC 3BJLA 1EZVY 5E2UH 1AD0A 4ZFOA 3F6LA 4U1HB 1GZQA 4DWHA 1LEGB 2FJGA 4GKSB 1F11A 3HNSL 1KEGL 3IXTA 1NGYA 5FGBC 2ICWJ 1ORQB 4KTDL 4PJ9B 5DK3A 4E0RA 4LLWA 4F7CB 4XWOD 5AUMB 3QH3A 3RZCC 3SOBH 1HNGA 2GY5A 4KROC 1T0MB 1KPRA 4B53A 4YH6A 5CLWA 4MNQA 1A7QH 1DVFC 2ZUQC 1AGCB 1D9KA 3KHOA 4P2OB 3QXWA 3M8OH 3H9SE 5IR1A 1CXKA 2W91A 5IMLB 2DQIL 5MEPB 2E9WA 2GI7A 5T3ZL 1NLBH 3DX7B 3MFFB 1DQML 2Y36L 4G5ZL 1FL5A 4AEEA 3QAZC 4LMQI 5IMOA 4YHNB 4JM2F 1CVRA 2IBZX 4JY6B 3RL2B 4ZDHB 4XNZB 1L7IH 5DURB 4HZLA 4PB0H 1MFAL 4OZFA 3SEPA 4U1GC 4GRMB 3ARFC 3KPPB 3GJEB 1XZ0A 1VGKA 1QEWB 2NX5D 4LCIL 1KJ2B 4HH9A 4IRJA 1JI1A 2DQDL 1QRNA 3HTLX 3D3VB 4I0PA 2W60B 2XTJD 3DWTA 2Q8AH 3NAAH 2OP4L 2F19L 5FUCE 5DJ6B 5MEQB 3PWJA 5I1AA 1C5DB 1QR1A 1YEIL 2BNQA 3O2VH 4IJ3C 4M1CD 4CVZA 5TDNB 1JYNA 2Y4SA 1EGJL 1FE8L 5HI3D 32C2A 4NN5C 3VD7A 5FKAA 5K9QG 1RIHH 1M6OB 5LGHH 3EUUA 2DQTL 1INQB 2HVKA 1UB6A 3U7AA 1LDPL 3PGDB 1LQSR 4PJ7A 2BSED 3T0EC 3S5LG 1NBYB 1F4WH 5TDOA 3U30B 4F8TA 4QRRE 5HHVL 3LQZB 1AHWA 3TN0D 3HMXH 3U7YH 4YXHL 1MRFL 2F54A 5JNYA 5FHBL 2DQJL 5H94A 1H15B 4OLEA 4Z0XA 3U2SB 4LPYA 3LN9A 3MBED 2ADIB 3G9AB 2EEBA 4K3EH 1RULL 2OR7A 4Y8DC 3MV9A 1F42A 5DJ8B 5TE7H 2VXVH 4BKLA 5DTFA 1HI6B 12E8L 5C3LD 3KPLB 5EZIL 5JW5B 3HI6L 4X7FC 2X2YA 4NQEE 1ADQL 4DEPB 3BP6B 1IILE 2ESVE 3QA3B 3MRJB 2XZQH 1DBAH 2EZ0D 2FD6L 4KUZL 3ULUL 3QG6B 1ZA6A 3B9KA 2X4PA 5F9AC 1GGBL 4G6JH 1J9CT 1ZLUH 3PF2A 3QWRA 2J6EH 2ZSVA 4S1QL 2EE3A 4EN3A 1NEZG 2YK1L 4NQCB 2E6QA 2B4CH 2DF3A 3JWDC 4OFVA 1HKLL 3VE0B 4Q97A 5TE4H 4XH2A 2FZ3A 2JB5L 4PB9H 1FYHB 3PDGA 4LSRL 1UM6H 1J0JA 3NGBC 3IDXH 4PV9A 1V7NL 5I1EH 4PY8I 3K2MC 5SWQB 4AEFA 5BVJB 5J6HB 3VGAC 5EO0A 3CVIH 3W0WA 2GJZB 1NANI 5CWSA 1TCRB 2BDNH 1VESA 4RFEA 3BPLC 1XEDA 4ODSL 3MV8B 3DTXB 1HEZA 2O5ZL 5FYLE 3QFJB 5L8KB 4JFDA 5KVDH 1CWVA 2NZ9C 3QDMD 4GRWB 4JY4A 3DARA 3G9VA 4G3YL 3U9UA 3BGFB 4NM4L 3Q5OA 3AVEA 1L0QA 1Y0LB 4S1SL 2WUCL 3FO1A 1BZ9A 4ZQKA 5F9OL 3VG9B 1T6VN 2Y72A 4KJYB 1A7OL 1MPAH 3QIBA 4LNRA 2EIZB 2C1OB 4LLUB 1HXMA 1CU4L 3BP7B 1PQZB 1S7SB 3MUHL 4NZUL 4OFDA 4K3JH 1JTOA 1ZHNB 4KZEH 3MACL 4NCC2 2ZUYA 1SJHA 1WBZA 2R56L 1VPOL 1SVCP 4MZ3A 4UT7L 5ANMA 1CFQA 4KVCL 3ULVD 4KY1H 1I1AA 1N59A 5BW7C 1T7YA 1AO7A 2B7DT 4PG9B 2FO1A 1A4KA 3PUCA 5I1IH 3LOWA 4PRPD 4PYGA 4OQ1A 2R2HB 4GKZB 4HKBB 5IF0B 5HHPB 3WJJA 4NJ9L 3ILQC 1S8DA 1ED3A 4K23H 3S5LB 2GY7B 1VACA 5EO1B 1MRDH 3REWA 2IAMC 3BZ4B 1BEYH 2A1WL 3HAEA 7FABH 3LRSB 4GAJL 1G6RL 3AC0A 1YEDA 1WITA 1OAZH 3NZ8A 1SEBB 2PTUA 1NLDH 5GRVK 2J2ZA 3ARGB 3CXHK 4LHUD 3BMVA 1RJLB 4YDJB 2I5YH 1LO4H 3QXDB 1QSVA 3C8DA 3OXRA 4P5KA 4S1RL 2APFA 2FBJL 5FGSA 5DD6B 4OIIH 3HG1B 4JRYB 5D96C 1T1YA 1G9MH 5E5UB 1UJ3B 5IHZA 2HVJA 4RDQF 2DLIA 4KZDL 2DQGL 3WLWD 1NMAH 4ZOCA 3MOBH 2C4XA 4WNQB 5EU7E 1A6TB 4I9WD 4BK5A 1I8LA 3SDCC 3KLHC 3NCEB 1NEZB 3WNLA 4G6FD 4KHXH 3OPZL 5FV2A 4G8IB 2F15A 4OFPA 5JHDA 2AXHA 1CGUA 3D5OF 2P24A 1AGEA 4POZC 3CFBB 4LLAA 3QUYD 2HH0H 4WHTA 5HHOA 1QSEA 1R5VA 1D6VH 3L3JA 3NABL 2P5WD 2AJYH 4MNGE 2QL1A 4OAWB 3QUMH 3U1SH 2XWBB 1MHPL 1P4BH 2CLRB 3BXNA 5DSCB 3RWJB 4FG6D 2CDFA 3QXUA 5HPOA 4PRHA 5GRJL 3QNZB 2DJ4A 1EDQA 3TA3B 4X7CC 1FQ9C 2H2SD 3O9WD 3RWFA 2COQA 4PRIE 3WS6A 4NM8L 5HHXH 4DUVA 4LDEB 3H9SB 4ERSH 2NY5C 4YHOL 1FJ1B 3TCLA 3ARBD 3NACH 2XN9B 4FS0A 3SCMD 3C6LA 4IBLT 4P5TB 5E94B 5FHAH 3UTZB 1RURL 2ZKHL 4FQCL 1ZMYA 4O2EA 2LAAA 4ZS6D 35C8H 5T5FH 4RA3A 5E6IB 2ZPKL 4Z0BL 3TJHC 1MVUB 3MJ6A 4XCCL 1HYSC 1MWAB 3VXUE 3GB7B 2EYTA 1Q38A 4Z77B 4L3CA 3VXSE 3MLWL 4F33B 1ZHKB 4ELKA 4R7NB 1OSPL 4QRQB 1BZ7B 4QXGH 2X9YA 1N6VA 5MEOB 1KV3A 5FUOL 1X4ZA 3Q6GL 2ZUUA 5DD5L 1INDL 4MXVF 5HYSG 3FOLB 1IGIL 3MUGB 5F7EH 1CDIA 1GGCL 2AP2A 3LKNB 1AGDA 1FCCA 1UQSA 5D7JB 3D85B 1G6RA 1CXEA 2VDLL 4ONGL 1FFQA 4ZAKB 1TNNA 3RVTC 2YPVL 2X4TA 3R8BB 3ALXA 2DQHL 4M1GL 2D0GA 2V5RA 5CJBA 5EA0H 1S7XA 1BBJA 4GRWF 1WAAA 4JFXB 3T09A 3EJJX 2MWCA 4OV5A 2APBA 3IDNA 3MRBA 3WYRA 1JUFB 4QRRB 2ORBL 1UZ6F 4L4JA 1C16B 3G04B 2YBRA 4H26B 4PY8J 4R3SA 5IESL 3E3QC 3VFWB 2EDNA 3FMGH 5F7DB 3IVKB 2DLFH 4ODUB 1KCLA 4QRSA 2WIMA 1NAMB 1OT1A 2C4FU 3S35H 3W5MA 1G7PA 4NQVB 1OGAE 4NQEB 1NDMA 2DM2A 5E5RB 3KPNA 4JM4L 4JQIL 4E9LA 4ODHL 2ESVB 1CD1A 4Y7MA 4WWKC 4XZUA 4PY7A 1Q1JL 5M7QA 2W07A 1I8IB 3KYAA 3RL1B 1F6AA 5C0GA 5GSVB 2QKIA 3CK0H 3GBLA 5A3ID 4L5FL 2Y5EA 5J12C 4XC1L 4RNRA 3L3OA 2XG5A 2VLMD 1UXWA 4L8SC 4I48A 4KRPC 3WHE1 4GAYB 1F90H 2JJWA 1TQCB 5C09E 3C60A 4GRLD 4Y5YA 4G42A 3TVMA 5HVHB 4XP6L 3ULSA 2P49B 1DSFH 1BIIA 1FO0H 3MLVH 4MAYC 3X3FL 1IEBA 4QRPE 5DHVB 5B21A 4TOYH 1ZKAA 1OW0A 5IFHH 4KK5C 3QNXA 4CKVX 5K93A 4YGVA 2B2XH 4WCYL 2OK0H 4NJAH 2YXFA 2HT3C 1FAIH 4JKPH 1J0HA 4X4ME 1ZGLP 4GMTH 4NCDA 2G75A 4AM0B 2BVTA 1T04B 5HGAB 1BHGA 3Q2CA 3VFSA 3MC0A 3VXTA 4LVOC 4YLQT 4NP4H 4LDOB 2G9HB 5KS9E 5HYSB 1Z9SA 4D9LH 5F1IB 1ACYL 1OGTB 1VEPA 2UWEA 3WS3B 4J6RH 3CLEL 2QQKH 1R3HA 4TRPL 5C0DB 4X7EC 2V2TA 5ALCL 4ODVL 1P1ZB 1D5MB 3EIFA 5HPMA 1KUMA 2ZG2A 4XBPB 1CDBA 4LPTA 1A5FL 1BVKB 3FQUA 1IC5L 3ZDYE 1PEWA 3LMJH 3BUTA 5EUKB 1Q72H 3STBA 5DK2B 4QHNB 2LTQB 4U6HB 1FSKB 2IANE 3ZT6A 3EHBD 3VXNB 1UM5L 2J88H 1ZHBB 5BCAA 3HS0B 3CDGA 4K2UL 3THML 3CGTA 2FYYB 4M6NL 1ZVSA 4NQDA 2A9NL 1FNSL 4R9HA 5I1GL 4YHLH 3IDMA 1NFDE 3UO1L 3W9EA 3SO3B 3KPRE 4M8VA 5F1SA 1QO3A 2CDEB 4ACPA 4DW2H 1NC4B 4YE4H 3ROOA 4D9RE 3K8LA 3ARUA 3HNVL 4RMQA 1C8PA 1J18A 1G9NL 1AIFB 5IFAH 3C9NA 4PBXA 4L8BB 3OV6A 4WI7A 4K8RL 5EU5A 2YPLA 1Z9LA 3GNMH 1MI5E 3BD4A 1JZ8A 5FO9A 3RVVD 3VXMA 3JV6B 4RFOL 2VC2L 5E6YA 4ZUUB 3CDFA 1I7ZA 2ICEB 4FTVD 4I2XE 4QYOB 3OSKA 4KPHL 5EZJA 4FQ1L 3OHXA 4ELMA 4KJQC 3FT3B 4LRNL 1DQQB 1JGDA 4HWZB 4WO4C 1ZGLA 2Q7YB 2P8MB 3LCYA 1KIQA 4ZUVA 1LO2H 4WHCA 3TIEA 4MNGB 1FZMB 2IGFH 4JZJB 1MFDL 4ZFGH 1AH1A 3C6SB 2A74A 5INCB 2A6IA 5JLZA 5CBEA 5SX5H 4F7MB 3QUZA 3IFOB 3KYNA 1KPUA 1MCFA 1GOHA 4HT1L 1SYSA 3CCHB 4BUHA 3BZDA 4PRIB 2X4NA 4JDTH 1FYTA 1GJIA 1SM3L 1SYVB 1UM4H 1CLZH 1V7ML 2R69L 5CGYC 5IWLA 3RIFK 5JW4R 5EBLA 3UBXG 4CVXA 5I30H 1OAYH 3E6HA 1L7TL 4OI7A 4F2MA 3S4SG 1C5BH 1ZVYA 3KWWB 5JO5B 4R4NC 3QDGD 4DKFH 4IOIA 1U8LB 3BZEA 3OR7B 5B8CA 2WIIB 3RWHB 1LEKB 3MJ7A 4HFWA 3VXUB 4TSBH 4DGIL 5HDQL 5JPNA 4MDIB 4MB5A 3RA7L 1G7HA 4LVEA 3VXSB 1CE6A 3DLQR 1OTSD 4YBQC 1KGCE 1RJYB 5EBMA 3RWIA 5I1CH 4GXUM 2CDGB 2NY5H 4YWGL 3OJ2C 4NZTH 3MXVH 4TVSa 3JTTA 4WW2B 4QHKJ 4WHYG 2CIKB 3SKJL 2DOCA 3BFOA 4IRSB 4OFIA 3Q48A 4MCYB 5F89A 1DFBH 5JIIA 4ONFH 1Z3GL 5F71A 4LSPH 1MFEH 2D0FA 4LGRB 1TZGL 5HYJD 4XHJC 2K7QA 2Q8BL 3NFNB 4R7DB 2KH2B 3EBAA 4OF8A 1HILA 4JPIA 2AK1H 1QRNE 4CMMA 1NCWL 4GS7C 3HCVB 4N8VG 4P59H 4M3KB 2R0KH 1I9IL 3UTOA 2BSRB 4Y16A 3NCJL 4XTRC 1NGXA 2IMNA 3LAFA 4DKDC 1KCVH 3O3AA 5I15L 4P46B 2BNQE 4BSWA 1REIA 1WJ3A 1T83A 4PGDB 2B1AH 4GG8B 2VTFA 4AYFA 2VE6A 4O5LL 5CUSH 3CSYA 5C07D 3V6ZB 1KCSL 4PJ7E 4WJ5A 4OF3A 4YHYB 1BMGA 4HXAL 1C08A 1OGAB 2X9XA 4WUKH 3FQRA 4S2SA 1N8ZB 3O2DA 1J1OL 5F1NA 3HE6A 5BQ7A 3MNWB 1YEJL 4M7JH 3O4LE 3MJGX 3L5IA 4NZDA 4EDXB 2FLBT 3MV9E 2AQ1A 4H5SA 5DD0L 1YECL 3TO4B 3Q3GB 3V2AR 3ULVH 2PXYD 1RZKL 1MCCA 2ZCLL 3HUJA 3C5ZB 1NUGA 3UTSD 1ZLUK 1QVOB 3RZWA 2IH3A 4HC1H 5CJQH 3MOAL 5D1QA 5FA3A 5DVLA 3VXOB 1J5OH 1WIPA 3FRPG 3HB3D 3T2OA 1OP5H 1SMOA 1FV1B 4XPHH 4C83B 5C09B 3V6OA 3WLBB 1PFCA 5MI0B 4UT9H 2O5XL 1D6EB 1MLBA 3VRIB 3CLFL 1BAFH 1JGEA 2VLJD 1HSAB 4D94A 3K8MA 3DO3A 4XBEH 3O8XA 1KEMH 5EC1A 4QRPB 5GXBB 3UBXB 2WBJD 4V2BA 1PAMA 1OD9A 1M71A 4PG2C 1B2WL 3W0WE 3S4SB 3FQTA 4MXQD 2A6JB 3ECBA 2R0ZL 1NJ9A 4YNYB 2D7TL 1QYGL 4PR5B 3PABA 5CSZB 1VDGA 1UKSA 5HD8C 4AEIH 4UBDC 2HKHH 1XF5B 5IB1A 1RZJL 4OF0A 4L3EA 2VDML 4LLDA 1N6QL 2HT2C 1DEEA 2DKUA 5I0DA 4MJ5A 3RGVC 3WFCL 4MA8H 4JFDE 5CGTA 2CMRL 4Z7NE 2Z8WC 2OL3A 5KVGL 1CZ8L 5FO7A 4TUJB 1S9XA 5KS9B 5TQ2L 3EJYD 4L3AA 3OB8A 4YIQB 5ALBL 2PR4H 1INEH 4O2CA 4KTEH 3ALPA 1MFBH 2VERN 1OAQH 2B1HL 43C9A 4OKVB 1K4CB 5AWNL 1F3DH 4PJAE 1H5BA 4G43B 5DQDH 2KPNA 1AQDA 2YR3A 3CC5A 2R2CA 4OLXH 2YD5A 3MV7D 3RY6C 4RMTA 4N8VB 1JRHI 3MLYL 4Q9QL 5ANME 1A3RL 1F2XK 5FYKU 1QA9A 3GSWB 2IANB 1AO7E 4DN3H 3I9GH 1NCBL 2AJ3B 1LD9B 3VRJB 5A2KH 1CCZA 3MO1A 4MD0A 4IMKA 4C56A 3L7EB 5FUZH 5L2KA 2NY6D 5DLMH 5T3XE 1AXSB 4MA1C 1JBJA 4ZNEA 4X4YA 4RFNC 4I3SH 3O3UN 1KLUB 3K4ZA 3PGFL 3UJJL 1DL7L 3WUWG 1NFDB 1MIMH 3CMOL 2FDBP 3KPRB 5JPMA 3GBNL 4WW2F 5E1AA 3T3ME 3ULUE 4I3RL 3W9DB 3T2PA 4P4RA 5D6CB 5MERA 1JHLH 1NMBH 5F44A 2YUXA 3N85H 1FVCA 3X13B 5FF6A 3GO1H 2X4SB 1MI5B 4XPBL 2DICA 2GAZA 4RAVA 4JO2L 2AI0H 1QBML 3RU8L 5BVPH 1UWEH 2ICWB 4I2XB 2BVPA 2HFEA 4U1LB 1J8KA 4E42B 5JW3L 4NPYA 3V4PL 4IIQB 4XPAL 2R23A 4PJ8B 1RV6X 3DMMD 2NTFB 3FL7A 3EDJA 4IDJL 5FDWA 2A0LD 5I76A 1JRHL 5F1OB 4FP8L 4XVTL 1PLGL 1NBVL 1WF5A 5T1KD 5L88L 3LKOB 5E9DA 3L9RA 4KROD 3V52H 1TJIH 4NYLA 3UZQA 1Q0XL 1AD0B 4XVUC 4ZFOB 5M94B 2EIDA 2YMXH 1QSEE 1K3ZA 1GZQB 3JUZA 2FJGB 4HPOL 3GHBH 2VSDA 3O6LL 4U6VH 2V7NA 4F7EA 4E0RB 5I17A 1W2KT 4WV1C 5I1LA 4PRHE 4HFUL 4HKZB 4LEXL 4M62L 5F6IB 3ARDD 3QCUH 1BOGA 5F7UA 1KPRB 4R0LB 4KAQL 3SKNA 4CJ1A 1D9KB 2AGJL 1MREL 1FGNL 1NGQL 4RQQA 3VFUB 4JM2C 1KTDA 5C8JA 4PLJD 3VFVB 2F5BH 4MQ7A 2WBWB 4KH2A 1Q94A 4HUUA 1I3UA 1XF3A 1LO5B 3M17A 3UYRL 5GS0C 5GGTH 1A7NL 4N0UA 4EIGB 3FQWB 3IETB 2Q76B 1FL5B 4D0CB 4E5XB 2WWMD 3HZMA 5IMOB 3IDIA 3MUZ1 1D5XA 2NXZC 3WJLC 1CXLA 5JOPD 3U9PH 3N1MC 4HZLB 5DURD 5C0AA 3LV3A 3P0YH 3WIHL 2LU7A 1VGKB 2EDBA 1HH6A 5HDLA 4HH9B 4W6WB 4ZTOL 4IRJB 1YJDL 1QRNB 3NZHL 4P48A 5DMYA 4I0PB 1N7ML 3E2HB 1L0YA 2NX5A 5I1AB 3ZL4L 2E7HA 1AC6A 4EI6A 4HSQA 4I5BA 2BNQB 3HHRB 2K3TA 2XZAL 4CVZB 4QXTA 3O0RH 32C2B 4NZRH 1BWWA 1GHFH 2VO5A 1OD7A 4JO1H 3DI3B 4GKNB 1KJ3H 4F9LA 4Y2DC 1A3QA 5EIQA 3VWKC 3WUWB 4GJTB 5IBTH 3C09B 2E3VA 2IQ9L 4GW1A 4YXLL 1EHNA 5KS9F 3D2UA 5IB5A 5TDOB 2VZVA 5FEBA 4B7LA 4YAQA 2YC1A 1I4FA 1EO7A 3MNZB 1CDHA 3HAEG 1T03H 5JNYB 3O4LB 4Z0XB 1AI1H 2KBGA 1TMCB 1BP3B 1SY6A 1PX3A 4FNLL 1A1NA 5JQHC 3MV9B 4BKLB 5DTFB 2GSIB 5C0BD 1RZ8A 3ZDYF 3GM0A 2JELL 4O58H 4M3JA 4UQ2A 4WW1A 5AYUH 3EYUL 1B0GB 1T80A 4MJID 1SBSL 5DS8A 5L6YL 4KK8C 4PGBA 3RNQB 3IT8D 1MCHA 2IFFL 2X4PB 2B8OT 3OAYK 1UVQA 2YZ8A 5F8RC 3OR6A 1KOAA 1A4JA 5J11C 5ADPL 1MLCB 1Q9OA 4EN3B 1YNKL 4UMGA 2NY4C 3H7BA 5CEZD 2N1KA 3EJZD 3WFBH 1NFDF 1DQTA 1J1PH 1R5IA 2CGRH 3RNKB 4MZ2A 5CSBA 1JPGA 2W9EH 4RISH 4WFHD 4PV9B 2PF6A 3QJFB 2V2WA 4I8DA 4X7TA 4FXGB 5E5MA 4WFED 3OF6A 1YEGL 1QFUL 5JHLH 5EO0B 5EDXA 1J11A 3W0WB 1WZLA 4UNTA 5J13C 2E7LC 3FO0L 1GL4B 1GSMA 5CWSB 4X99B 4Q58C 1JF5A 4TUOB 1HCFX 5FYKL 3BEVA 1FNEA 1GVIA 4LPUA 3WIHA 1HEZB 3D1MC 4JFDB 3QFJD 4PJIA 4JY4B 2PYFA 3DVNA 3VFMA 5GGUA 4Y4HA 3GSQA 1SHMA 3MRKB 1MCPL 4Y4KD 1NCCH 2BSTA 3B9AA 1DJSA 2VXTL 3KG5A 1OB1A 4MNHA 1MNUH 3FO1B 1BZ9B 4Z95L 1DP0A 3UDWA 5IGXL 4LSUL 3G5ZB 4XCNB 3QIBB 5HBBA 4LNRB 2VAJA 5ISZA 3MLXH 3VGGA 4Q6IA 4MQTB 2Z92B 4PJAB 5DD3H 1HXMB 3WXWL 2OTUB 4UNUA 3L3IB 4ORGA 4PJ9C 5B22A 4PJGA 3WEXA 1XF2A 4RA0C 5EG6C 1ZOXA 1IMHC 5L2JA 3DYMA 1URLA 1WBZB 1E4XI 1T1XA 2AKRA 5IHBA 2EYRA 4KXZI 4ZUWA 1CFQB 4M8QB 1I1AB 4XXCC 1AO7B 3VMPA 4UINH 3FQXA 4WEBH 5EZOL 4P2OC 5DMIH 5GRYA 5IQ7L 4X6EA 3NTCH 1F6LL 3QEHA 4W4OC 2VL5A 3KLAA 1HHKA 3SGKC 1F4YL 4JFOB 1JPTL 1S8DB 1E0OB 3BKCL 5ESQB 1VACB 4NUGL 5EPMA 3T04D 1IGCL 1IAMA 4WI6A 1A6ZA 1XGQB 1HXYA 4E41A 3HAEB 1NFKA 2ZUXA 3LKSA 1YEDB 2DQFA 3NZ8B 4JKKA 3KJ6H 4K7PY 3BEWA 1PY4A 4RMUA 5T33L 3ARGD 1CE1H 3GI8L 3VDBA 5D7LA 3V79C 4FFWC 4NQDE 2RR3A 4F7PA 3ZO0A 4RGOL 4CW1A 2ZOLA 2KDGA 4FFYL 3B3IA 4G6MH 4NWUH 5C9JA 2DIAA 3HG1D 2QHLA 2H26A 4JRYD 4XPTH 5GS2D 1T1YB 3DVIA 4KQ4H 3BN9D 5JXAL 1JHTA 1IAIM 2M1KA 3K2UH 5IHZB 2HVJB 3MGOB 3V9FA 3BESR 3PL6C 1GPOL 5CJXA 2YPLE 4IS6B 1VSCA 2WUBH 3F12A 1V3LA 3U30C 5C0JA 4YHIA 3VXME 1EVTC 2AEWA 5GRXG 4GMSH 3IDGA 4NSKA 4GAFB 4HX1A 5F7MC 5BJTB 4JHBA 2FGWL 4ELME 2P5EA 1BD2A 1UYWH 1A3LL 3BT2L 5ITBL 4WHTB 4NQTA 5IM7A 5DEFA 4HJGA 1QSEB 1MCDA 1R5VB 4YHZL 2VDPL 4NKOA 5K9JL 2AXGA 5BS0A 3QRFM 3DUSA 3I6LE 3QUYA 3LD8C 1U58A 4HWBL 2OR9L 4AH2A 1BOYA 2CDFB 1JGVH 4PRHB 3ILPA 3EDFA 4LSSH 4LSDA 4YHKH 5E8PA 1EO5A 3RWFB 2IPUK 3E8UL 5D2LE 4JG0H 3LDBC 1MF2H 1ZT4B 3QP3A 4JDVA 4ZYKB 1FYTE 3H9SD 3TCLB 2GITA 5CJOL 5ADOH 3C6LB 2QV2A 4Z7UE 3PP4L 5ACLA 5E6ID 5C1MB 2XZZA 5DUPH 5HYQA 3UTQA 4GKOA 2HWZH 2EYTB 5AZEL 2VITB 2WM0A 1ZLWH 1BQHA 1IGMH 4FQPA 4L3CB 4OCSL 3RVTD 1ZLSH 1RVFH 3P4LA 4UAOC 2A73A 5IVXA 2NY7L 4AIZA 2I9TA 1OPGH 1U3HB 4J3XA 3RHWK 1AGDB 3CFEB 5D7JD 5ACZB 4ALAH 5GS1C 5CINH 3VW3L 4U1SB 3GSRA 4YDVA 2X4TB 1YUHB 5KSBA 1FVEA 1GC1H 5JMOC 4EDWL 3PDOB 4Y4FC 3VRLE 4Z7NF 3VG9C 3U7WH 3L7FA 2AJZA 4LIQE 4V2CB 2DQUH 4TSCL 1CTNA 3IFLL 4P0DA 3TBYA 4X9GA 4FFZL 4JJHA 3I6GA 5FAAA 3GMPA 2VSCA 3QO1B 4PJAF 4QRSB 2AJUH 3OB0H 3QUXC 2I27N 3HE7A 3D9AL 1E6JL 2BNRE 1G7PB 1S7UB 1G1CA 5IT2L 4D0DB 5I8CA 4K7FA 1NDMB 2X4QB 4MQSB 5CFHA 3KPNB 1I3VA 1KULA 3N9GL 3NFPA 1CD1B 3C8HA 2BXYA 2WV3A 3DV6A 4WUUA 3T8XB 3TH4T 4L8CA 1N64L 4I0CC 4PY7B 4JPVH 1IL1A 4MVBD 3RVUD 1AJ7H 1K5NB 4UV4L 1O7VA 3RKDC 1F6AB 1NUDA 2CUMA 4N9GA 2OJEB 2QKIB 1WEJH 4JR9H 5DT1H 5ITFA 1EEUA 5E8EA 3HUJE 1H3TA 1O0VA 1RJZA 2GSGA 3BYYA 2CK2A 3W11C 3DSFH 5I8OL 4RNRB 3L3OB 4OJFH 3WIFA 2BHUA 1FZOA 2X4RA 2NQCA 1UXWB 4Q7DA 4X5LA 3T3MF 3FZUD 3ULUF 4PJFB 2LU3A 4I48B 6FABH 4LCWA 2BRRL 4DZ8A 4S0TD 4KKCC 3QISA 5GSRA 4OGYL 3ARPA 2C26A 5F96L 5BV7H 3V6OE 3C60B 3ISWA 2R0WL 5IB4B 3TVMB 2WW8A 4Z7WA 4LAJH 5E2UL 1BIIB 3DO7A 4FQIH 1UJ3C 1DBBL 3TGXA 5JORB 4XXDA 4J4PA 3TF7C 3QFDA 1IEBB 5FYLD 1T3FA 1IJ9A 2KZWA 4R90H 4X6DA 3QNXB 3Q6FA 4KC3B 4YGVB 3MJ8A 3SOBL 5C2BH 1G0DA 1I9JH 2NXYC 2XI9A 4H0GA 5I1HL 4AENB 4L3EE 1I7RB 3QWOA 3FAWA 5GJSH 3HMWH 3VFSB 1CGYA 4YDLC 5FB8A 1KLGA 4PB0L 3B4NA 3TA3C 3OX8A 1IT9H 2F53D 4L4TD 3C5SB 4HCRA 4R8WH 4GXVH 2VISB 4DCQB 1R3HB 2ID5A 3G5YA 3ARYA 3P4NA 1RUMH 2WLZA 4G8FA 1N0XH 5HPMB 2C3VA 3QQ4B 4IM8A 3NAAL 2DI7A 4P5TC 1DQJA 3KVQA 5GGSY 4EJ1C 2HTLD 2LVEA 3P9WB 1M05A 1CICD 3O2VL 4G9DA 2R8SH 5DO2C 1P4LB 4JFHD 5DJDA 3RBSA 1RIHL 3D39E 1IAOA 5IEHB 4C56E 1S7VB 5L2KE 4ISVA 4L9LA 2CR6A 1Q0YH 3CDGB 4ZNEE 1F4WL 4F37K 1X9QA 1ZVSB 4NQDB 5EU6A 5FUCC 3BDXA 3UC0H 4NT6B 3TWCH 3HMXL 1QO3B 2LE9A 3PNWB 1NC4D 4ZAKC 4HWEH 3TZVA 4K3EL 1JPST 3C9NB 3MBXH 25C8L 5TE7L 3HKFA 1KJ2H 3HC4H 5F7LB 4MA3A 4XI5C 2AW2A 5FO9B 3VXMB 3NH7H 2H3NA 4H88H 4BYHA 3S3PA 3PXJA 4QGYA 5EZJB 3RAJH 4G6JL 4ELMB 5LWYL 1JGDB 2J6EL 2R29H 2NR6D 4CU8A 1JNHA 4FTVA 4ZUVB 2B4CL 4PJDB 1EO8H 2JE8A 1A6VH 5TE4L 2IADB 1QSFD 5E56A 2A74B 2A6IB 4PB9L 4HJ0D 5JLZB 5CBEB 4A2MA 1UM6L 3ES6A 3IJSA 3BO8A 3QUZB 5EOCL 3IDXL 4YFEA 1RI8A 3KYNB 4YEEA 5IOPA 1KPUB 1LMKA 5I1EL 1WWAX 5D2LB 1SYSB 5E9DE 3NN8B 1A1OA 3CVIL 4N90E 1FYTB 3ZLQC 5EBLB 2BDNL 4CVXB 2BVQB 3VFRA 3E6HB 3MQIA 2X41A 4GT7A 4F2MB 1RUAH 3INUH 4G7VH 1V5JA 4Z7UB 5H2BA 3RIFF 3FTGA 5GZOD 3SDAD 4P4KA 4UDUA 5CZKA 1WFTA 3ZYZA 1MCWW 3QIWB 4IOIB 5KVDL 5T1MB 3BZEB 1AE6H 5J0BA 3MJ7B 4HFWB 4PRBA 1HOCA 2F74A 3P73A 4QXUH 5JPNB 2R1XA 4OLVH 5I74C 1G7HB 3RWEA 1CE6B 3NIDE 4J1UA 1VFAB 2CLVA 5AEAA 1HHIA 3U4EB 4PJFF 3VI3E 3KPTA 5EBMB 2FR4A 4HG4J 2QSQA 4Q6YA 2Z4QB 5DVNA 5CEZH 4G8GA 4N0UE 1MPAL 3G6DH 1VHPA 3JTTB 4KDTC 5DRZA 1U2CA 4NUJA 1TJHH 2X5PA 1HWHB 2AJVH 4K3JL 4JO3H 4KRNA 5C0AE 5CEYA 5CBAA 4XTRD 5J56B 5D1XD 3LZFL 5SWZA 5I1DA 5EBWA 2XKNA 4LL9A 2MHAB 2QBWA 3EGSA 4H0IA 1HILB 4NQSA 4LASH 3WE6A 3TLRA 4N5EC 4JPIB 5JTWA 1P84J 4I18A 1JIBA 3IU3A 5FECA 4RGNC 2NX5E 1FVDB 4P2CG 1NGXB 1WLHA 4RGMB 5H35A 5FYJD 4BSWB 1EK3A 4BZYA 3WO4B 4K23L 4OCNC 1MRDL 4GRWH 2Y25A 2J4WH 4RRPG 1BEYL 2JF1A 2ZNWA 4BSJA 3CSYB 4HGMA 1Z5LA 4WJ5B 3KS0J 5IB3B 2BNRB 1UB5A 1OAZL 4I77L 1G9NC 1NLDL 2YRPA 3FRUB 1PVHA 3FQRB 4PP2A 4JY5H 3FCTB 2G5RA 3GIZL 4U6YA 5F1NB 5I8EA 4B5EA 2I5YL 1LO4L 3BKYH 3T0XA 4MA7H 3HE6B 5BQ7B 5GQBA 4WU5B 5FK9B 4LPWA 4OIIL 1FG2A 2DTMH 1P9MC 3X14A 1P7QD 1G9ML 3TO4D 4FXLA 5T1LA 1EFXB 1VERA 2D9CA 4Y2OA 3ARWA 2OX5A 5DK0B 3MOBL 3QG7H 2IH3B 1AR1D 1T66D 5D1QB 2Z8RA 5FA3B 1G7LB 4KHXL 4IHOA 4NNPH 3KLSA 4JDZA 3MUY1 3EOAB 4LBEA 3IRPX 3ESVF 1A0QH 3EDEA 1BVLA 2HH0L 1HHGA 5C0CD 3VFPA 1OL0A 1T2XA 1D6VL 3ARVA 5MP6H 2AJYL 3A6OA 4UDTA 5FKPA 3QUML 3G6AA 3ORJA 3O8XB 3U1SL 1P4BL 2QJDA 5MEND 5EC1B 4UOW0 3QI9A 4QRPD 3QT2A 1WTLA 2VDQH 3O4OC 4NKDB 1KJMB 1TNMA 5EOCJ 4GSDH 1HDMA 3MPCA 3FQTB 3ECBB 1NJ9B 3H42H 3PABB 3DXAD 2L7UA 2VLRD 3AREC 4ERSL 1OTTD 1LDSA 2DBLH 2GUOA 1E6OH 1S5HA 5IB1B 3NACL 4L3EB 4LLDB 1DEEB 4CADA 4MJ5B 1IAKA 4ELMF 5FHAL 5INDA 3WD5H 1DN2A 3CH8A 4PJIE 2FEDD 5T5FL 1I7TB 35C8L 2OL3B 3OAZH 4OD1H 5FO7B 1S9XB 1A2YB 4PJDF 4HXBH 5KSUA 2FWOA 2FNBA 3NCYP 4QOKD 3BDBA 3WFEL 5CHNB 1KCRH 4R26H 5SWSA 43C9B 2BSSB 4XCFL 4ZXBA 5ISZE 2VKXA 4QXGL 1H5BB 3QHTC 4ZO8A 5D2LF 1AQDB 1U8MA 3CC5B 1EV2E 1MHEA 1UCBH 2ED8A 5F7EL 5J1AA 4PJGE 3ZTNH 2XQYK 2VR9A 4P23C 3SE9L 1PKQE 4AG4H 5JXEA 2Y07H 1P84K 2APWA 4ZTPL 4X0KA 1QA9B 4WVRA 4Z7UF 4HUWA 1U93A 3D39B 3GMLA 5EA0L 5L2KB 2HJKB 1TETH 5JDSA 3F7VA 3KDMB 1T2JA 4X4YB 4ETYA 4WW2C 1PYWB 4PRPE 3L3GA 4J2XA 2CIIA 3BX7C 1A1MA 1C5CH 4HMCA 5JPMB 4D9RD 1PDKA 4IRZH 1T21A 3MTRA 4E41E 4NNXA 5CEXB 2DLFL 1MWAH 4P4RB 5MERB 4HWNA 2FEEI 3S35L 2NW2B 1FVCB 4WI3A 2VAAA 1MY7A 5D7LE 5FF6B 5KSAD 2YD8A 2YRZA 2VZOA 3GSXA 5ILTL 1ZWIB 3VRLF 5DJZA 4P46C 4AT6A 1MJ8H 4K9EH 2BVPB 2HFEB 4NPYB 3QZWA 2EEAA 2XWTA 4NBZB 2VR4A 5E4IA 5DZOA 4FQHA 2IPUG 4TVPD 3GSNB 2R23B 3CK0L 4TNVK 3SDDB 3VD4A 3TNNA 3WNOA 4YHYC 3NPSC 5E08H 2BJMH 1RZ7H 4FQLH 3UTPE 1FNGA 1GGIL 3VXRD 4G80A 3BISA 4EI5C 3GZKA 5EC2B 1H3VA 4Z7QE 2P5EE 1F90L 1BD2E 5BO1H 4FXKB 5FGBA 5EB9A 4W6XB 3VH8A 1DSFL 1FO0L 5T1KA 5C70A 1CDUA 1NAMH 1TITA 3C5ZC 3MLVL 1HIML 3RZCA 2X4UA 3NOIA 2V7NB 4F7EB 5I17B 5FOBA 2OQJA 2R9HD 4M7ZB 5I1LB 1DVFA 4TOYL 2AJXL 1NCAH 5IFHL 4P3DA 1BOGB 2EIEA 2FX8H 2B2XL 5CZVH 4ZSOE 4MNQD 2FEEL 3BOVA 1U2HA 2OK0L 3X12A 4NJAL 1KTDB 5C8JB 2DM4A 4MQ7B 1CBVH 1KGCD 1Q94B 5MI0C 3ARDA 4HUUB 1AR2A 3M17B 2XWJA 3N1FC 2H32A 1QLFA 4GMTL 4N0UB 4TUKL 1GRWA 2OZ4H 2FHCA 1R6VA 3IDIB 3ARFA 1D5XB 2JIXA 1S78C 1F5WA 4APQC 2P8PA 1YC7A 5C0AB 3LV3B 2AV1B 1MFNA 2XXMB 5FA4A 4POYA 1M4KA 4D9LL 1S9YA 4Y5XC 3TBWB 4XAKE 4J6RL 4K3HA 1G0YR 3HRPA 3PQYA 4IRJD 2QQKL 1QRND 5IVXE 1KB5H 1A7PH 3KJ4B 2NX5B 2MTPA 3DBXA 5IVZA 4XX1E 4I5BB 4P9HH 2BNQD 4QXTB 2ITDA 5FYLH 3LMJL 5DHVH 3RDTC 1JZ2A 1Q72L 1GGTA 3T0EA 5KSBE 2VN7A 1WBXA 2L4OA 1P5UA 2J88L 4GW1B 3D2UB 2AEQH 2ITCA 3MROA 3GIVA 1OF2A 4XAWH 1I4FB 4RWYH 4D2NA 1A64A 1JHKL 2F54D 4YHLL 2AQ2A 5FCSH 1OHQA 4DTGH 4UB0H 4DW2L 4YE4L 4RCAA 4H1LA 2Z8VC 3FFDA 3MV9D 2WINA 1J0KA 2UY7A 2VL4A 2VZUA 1KYOJ 4HJJH 1A9EA 3QPXL 1VCAA 4UQ2B 3B2VL 5KZCD 5HI4C 3BDYH 3GNML 2DD8H 5E99L 3W2DH 4S1DC 3B9KD 4N68A 1FO0A 4D9QD 1UVQB 3BH8B 3QWRD 2YD9A 4JFFD 1A4JB 4MJIA 5CCKH 3V4UL 3WDHA 3QNYA 5CKAA 4M7LH 4EN3D 3BUYA 2PTTA 4UTAH 3FO9A 1LO2L 4AIOA 1DCLA 3G5XB 1MH5A 2FATL 4KHTL 3QQ9D 4QGTA 2IGFL 3KPOB 2X70A 3AXLA 5FXCH 4DN4H 5BOPA 4GW5A 1B6UA 4X7TB 5E5MB 4QHLB 4LCUA 1TIUA 3UPRA 2V5TA 4CBPA 3W5NA 2HMIC 2VLME 3BHBA 4Z7WE 3W0WD 1G7IA 2MQ0A 1K4DB 1EAPA 1RUPL 3PDDA 1UM4L 1CLZL 1MJJA 3BD3A 4CJ0A 1FNEB 4QWWC 3X11B 1A7BA 4WTWA 5I30L 3HRZB 1OAYL 3CDCA 3RRQA 4DVRH 3FN0H 1PSKH 1R3JB 1C5BL 4PJIB 4ODXA 4X6DE 2VLKA 4HF5H 5K33A 3VFMB 4DKFL 4R4BA 5GGUB 4FQQA 4Y4HB 3GSQB 4XGZA 3IAPA 4JO4H 5F3BA 1BFOB 3GDBA 3L5WA 5KVEH 4TSBL 3WNNA 2GK0A 1OB1B 4MNHB 3QDMB 5LGJA 1UH2A 5IFJA 1QTYT 2E9JA 3QIBD 5ISZB 2UVFA 2NY5L 4NZTL 2EDOA 1YJDC 1BQHG 4PGZA 2AEPH 2P47B 3O6FC 4PJGB 4MS8C 1U8IA 3WEXB 5DVOA 1ZANH 5BW7A 5L2JB 5B38A 1DFBL 1PKQB 2AKRB 2EYRB 4FHBD 4LSPL 4ZUWB 1FLRL 5F6IC 1KG0A 3BIKA 2Y6SD 4NRXA 5ERWA 1I1AD 4R0LC 3GSUA 1JWUA 3FQXB 1J10A 5H8DA 4XX1G 4Z18A 5BOZG 2AK1L 4X6EB 5DFVD 3BI9X 4N0CC 5T3XD 2X42A 2VL5B 2R0KL 2IAMA 1HHKB 3KLAB 3R1GH 2CK0H 4BH8A 1EHXA 2FL5A 3BWAA 1YN6A 3NIDF 4PRPB 3VI3F 1KCVL 1CK0H 1NCDH 3NFSH 5E6ZA 4FFWD 5EPMB 2EYSA 3GMQA 3U4AA 2B1AL 3FFCA 1A6ZB 4G6KL 3ZHKA 1YYMH 3CVHA 1HXYB 4E41B 3ULUD 5CUSL 5AZ2L 3LKSB 2DQFB 4Q9BA 1PY9A 2YWZA 4OCXH 5HI5C 1EZVX 3L95A 4WUKL 1RHHA 4C54A 5EU6E 15C8H 3E2HC 5L9DH 4QEGA 4QKXB 4F7PB 4UTBH 4CW1B 3G6JA 3QB7C 5DRXA 2ZOLB 4M7JL 3B3IB 3WHXA 3H9HB 1FCGA 5DFTA 4HKJB 1M7IB 1WWWX 1D5BB 1JHTB 3BPOC 7CGTA 3SDCA 2Q6WA 3MLRH 3JTSB 3ULVL 1ZLVK 5GHWH 1CD0A 4NO0A 1P6FA 4M93B 3F12B 1XIWC 1M7DA 4YHIB 3TPKA 1XGYL 4HC1L 3VJ6B 1EVUA 5JHDD 4HDIB 1J5OL 1U8PA 2P5EB 4Q0XH 3DIFB 1BD2B 4XPHL 1YQVH 1JV5A 1IQDA 2GIYA 3WO3B 5IM7B 4FTVE 4UT9L 1OTUD 4ZG1A 5HHOD 1QSED 3BD5A 1ND0A 4JAMB 4JHAH 4NKOB 3H3KA 2AXGB 3QO0A 1SEQH 3QUYB 1U58B 2EEDA 4XBEL 1LO3H 3VXPB 5GGVH 2P5WB 5E8PB 4X9HA 4JDVB 2QQNH 5F3HB 3WIIH 2CRMA 3SE8H 4ZSOB 3EOTH 3IS0X 1IFHH 4OCRL 3V0WH 3S3SA 2EDRA 1QFWM 3FO2A 4AEIL 4YC2B 2GITB 2HKHL 3C6LD 3LQAH 3ROLB 5D70H 3U0WH 1S7WB 3ZKXB 2CD0A 5IIEB 3SCMB 5BXFB 5LGKA 3UTQB 1KT2A 2J1KA 4OUOA 4RBPH 1BQHB 3HZVA 2PR4L 1INEL 3QDGE 3QYCA 1MFBL 5F70A 1OAQL 1OARH 4A6YA 1KBGH 1RZGA 3KYMB 2A73B 4KWUA 2HFTA 4FQ2H 5IVXB 4Y4FD 1HHJB 4AIZB 2PO6D 4Z78B 2I9TB 5DQDL 2ZG1A 2ATPB 4HGWA 3MRPA 5IK3A 4OLXL 3RHWF 1SQ2N 5SWZE 4O51B 4NZJA 4PS4H 5KSBB 1FVEB 1JZ3A 1UACH 1HQRA 1NUFA 5KSVB 4J3WA 3EO1B 5HGDA 1RK1B 5F7WC 4OZGE 5D7IA 3Q5TA 3I9GL 3IDYB 4DN3L 2MMXA 4PJIF 2XA8L 3GMOA 5ID1B 3L7FB 5HYJE 1JWSA 4UQ3A 5DLML 2WLYA 5IHUH 3BH9A 1AXTH 4I3SL 4P99A 1CQKA 3TBYB 5DI8A 2X1QA 4KDWA 3GRWH 3MV11 5EOTB 1MIML 4OQTH 3GMPB 3BGMA 3T0WA 2XQBH 2X6MA 4L29B 2EXWD 3P30H 3HE7B 4ESKA 5IB2A 4RMVA 3OKOB 4WHYH 4PJGF 1JHLL 1Z0NA 4WWKA 1NMBL 1T5WB 5I8CB 4K7FB 1SVZA 5I1KH 2FO4A 2BX5A 2R1WA 2PW2A 4R4FH 3NFPB 4XRCA 4L8CB 2ERJB 1IKNC 3GO1L 5DQ9A 3W11D 2GHWB 3TC9A 1JZ5A 5D5MA 4D3CH 1JF1A 5HHQA 5J1SC 5BVPL 1UWEL 2YUVA 4QY8B 1QHOA 4H20H 2OSLA 5ITFB 1JPSH 4U33A 5E8EB 1RJZB 4AMKH 3SKMA 4L8SA 5BMFH 4XVSH 3RWGA 2W65A 3S88H 1MCJA 1T2QH 3WIFB 2W9DH 4YFLI 1RZFH 2HA1A 3A67L 4DZ8B 3TCXA 2VZ1A 3LSOB 5GSRB 1Z9MA 3HZKB 5I9QC 3C60D 3IDUA 4Z7WB 4LSVL 4MAYA 1B88A 1JNNL 3OKDA 1EAJA 3P3YA 2APXA 5F88B 3V52L 1D3CA 1TJIL 2ZUWA 2HRLA 1HH9A 4WFFD 3TIDA 2QQLH 5JIHA 3GHBL 1J05A 4XXDB 4PGCA 1T3FB 1MCOH 1BVZA 4X6DB 4YHML 3OKMA 3Q6FB 1D5IH 2HP4A 2XY1A 3C87A 3MJ8B 5E2TH 5E8NA 1WZ1H 4YBLC 3FB8A 1UGNA 2F5BL 3WSQH 1XCTA 3T1FA 5GGTL 2NY1D 1BBDH 4Z7QF 3QWOB 5TF1L 3P9LA 4X6FA 3U9PL 1KLGB 3MRIA 4M9PA 5CJ5A 3AS2A 2Q7NA 3OX8B 1RJCA 3ARZA 3P0YL 2HJLB 5SWSE 2C4FT 4W70A 5ICZB 3G5YB 3GMRA 1A22B 3E0GA 3CX5J 2C3VB 3JV0A 4PP1C 3QR2A 4XPFH 1DLHB 1RU9H 5JZ7C 5TGBA 5I1JH 4PUBH 3MODH 5HYFA 2YA1A 1H0DA 1FC2D 1M05B 3LN4A 5LJYH 4G9DB 3ARSA 5K9KA 2XFXB 1GHFL 1FLTX 5DJDB 5HHMD 3REVA 3MV7E 2V9QA 1IAOB 3WL9A 3ZTJG 5IBTL 3TO2B 4ISVB 1RK0B 1AFVH 2WSKA 1QBLH 4KFZC 4HKXA 3U48A 3DV4A 1U3HC 5EU6B 1RIUH 4NQDD 3O45A 4J3OC 3PHOA 1T03L 4F37F 3GGWB 1N5YH 5IVXF 1AI1L 1WICA 3A6CH 3QQ3B 4OZFH 2J8OA 4JRXD 2EDLA 4JVWA 1YNLH 4JFZH 2OI9B 2YPLD 4O58L 4L4VA 3VDCA 5KSBF 5AYUL 4OSUL 2PETA 2YZ1A 4HD9A 3SHSA 3VXMD 4WO4A 2H3NB 3LH2H 5DEGA 2Q20A 3BSZH 2V17H 1LEIB 1YQ2A 4R2GD 4NC2B 2AVGA 4TPRH 1F58H 4PRNA 2OTWA 3PV7A 1JNHB 4FTVB 3TFKD 4XC3L 3MYJA 2IALB 4DUWA 3WFBL 1GIGH 4XBGA 4QRTB 1J1PL 1ZS8A 2ZZUT 1WFUA 2BMKB 1OP3K 2W9EL 4RISL 1JPFA 5A16B 3IJSB 3QUZD 5IOPB 2V5YA 4WGWB 4OT1H 1QSFA 5JHLL 1MJ7H 2BOCA 4LHQB 1FYTD 5IG7B 2D7OA 2NY0C 1UADC 4KRMB 3VFRB 3BKJH 2ZCHH 5F9DC 2RAMA 4HV8A 5DXWA 1X5YA 5H2BB 3FTGB 4P4KB 4UDUB 2AK4A 3MRDB 4NO3A 3R0NA 3PGCA 4BZ2L 5HVWA 3T08A 3F6IA 2LU4A 3SDAA 1NCCL 3RWEB 1VADA 4LEOA 4J1UB 3QDGB 3TVMC 1I7UA 3RWCB 1HHIB 1MNUL 4PTTA 4KTDH 2FR4B 1AKJD 1T7ZA 2CH8A 2VABA 4NCC1 2VZSA 4X80H 1HK6A 4N5ED 3MLXL 3R8QA 1FIGH 3CXDL 1E27A 3OWEA 4NUJB 5DD3L 4Z7WF 3ZKND 5TFSH 4Y19D 4GLRH 2DQCH 2DIJA 5CBAB 4OD2A 3AUVA 5SWZB 4YK4C 3F62A 4CL7A 5I1DB 1ZEAH 5EBWB 2XKNB 4GW4A 1IQWH 4EVNA 3CX5K 4HK3N 5JOPE 3DETD 1T6WA 5IBLC 3QRGH 1MCBA 4WGVB 4OZGB 4G5ZH 4UZGA 3PQYE 2UZYB 4WEBL 3S36X 4X6DF 2BY0A 4I18B 3UAJC 3IU3B 3DRTA 3SGEH 2RFXA 5HYJB 3P11H 4QTHA 5FECB 1MFAH 3NTCL 4X7SL 1W72A 4Y16D 3DSNA 2QADD 3MRNA 1MHHA 4RZCB 2ICES 2AS5M 3SJVD 4K8RD 4B41A 2PYEA 1QLEH 4YDKL 3O6MH 3BZFA 1Z5LB 3U0PB 3OKKB 3V6FA 3KJ6L 5IQ9A 1CE1L 3OGCB 4LU5H 1JYWA 3O3DA 2QQQA 1FE8H 4OZIE 3IXAA 3VDAA 5I73B 1IM9A 2GJ6A 4N0RA 4G6ML 4NWUL 2H2PD 4ZNCD 1T0NA 5DC9B 4XPTL 2WWKT 3VA2C 4OCYH 4KQ4L 1UXSA 5T1LB 5AAMA 3K2UL 3J8F7 3RQ3A 4R96B 1WISA 1XGRA 2E27H 1CLYH 5BZWA 2J3SA 1TZIA 2B4CC 4JFYB 4JGMA 5C0BE 3UPAA 5T3XH 2OBGA 1RULH 3OXSA 5C0FA 4H25A 4IHOB 4FFVD 2X9WA 12E8H 4MJIE 5EZIH 1AD9B 4Z7OE 1CT8B 5GGSB 3W82A 1P7HL 1AQKH 2DTSA 1UYWL 4X5WA 1HHGB 3U82B 3HA0A 3ULUH 3HAEH 2DI8A 3VFPB 3WN5B 5CZXC 3OKEA 4UDTB 3FHAA 3O3EA 3CZJA 4PG2A 3QI9B 4YDIH 1CFNA 1QLRA 4JB9H 3VH8G 1JGVL 1S7TB 4LSSL 2PCPA 4YHKL 4X4XA 1HDMB 1HKLH 2LQRA 5F9WB 4JG0L 1MF2L 2DLTA 1ORSB 5MENA 3U46B 5CSGA 3FB7A 3QDJD 4NBYB 2X44D 3UTTA 3RGVA 4WFEE 1A47A 3TESA 5A43C 1G7MA 5ICXA 1EEYA 3LHPL 2A6DA 1CF8L 3D0LA 3P4MA 4QO1A 5GRUH 5ADOL 1IAKB 1T5XA 2I07A 1Y6KR 5INDB 2VLRA 5HGHA 2CO7B 2PTVA 3ARQA 5KSUB 3QCTH 3H3PH 1HE7A 5FGCE 5E00B 2HWZL 4NWTH 4P23D 4UU9A 2D7PA 1IGML 1XGPB 1FAKT 4DZBA 1P4IL 5SWSB 1KN2H 5IW1A 1ZLSL 1KIUA 2W1NA 2VZTA 1MRCH 3DI2B 3RY6A 4QOKA 3BMWA 1CDJA 1T1ZA 3MJ9L 3I50L 1OPGL 4CNIA 1MHEB 4Z5RA 1G7JA 4NHCL 5J1AB 1UFUA 4NM4H 5LAXA 1L6ZA 4M48H 4ALAL 2XY2A 5CINL 4CUCA 3IFNH 3QIWC 5DMKA 2CKBA 4MWFA 4X0KB 3DGGA 4KQ3H 4TNWK 5B3JE 3SKOA 2GTZB 3B2UD 1U93B 3MV7B 2VIRA 2VH5H 4JRWA 4C56D 4M5YH 1H9VA 2Z31C 3Q5YA 5D1ZC 5JDSB 3U7WL 3F7VB 2AJSH 4X8JA 4UIMA 1FFPB 4IDLA 4ZPVB 2W59A 5IMKA 2XICA 3PV6B 1A6AB 2CIIB 3OKNA 4X83A 1A1MB 4K3GA 2MCPH 2NY6B 4QF1B 3BW9A 3FFCE 3U4BH 1ROWA 1BFSA 4H8WC 4NNXB 5F7YC 2RJMA 4ZOAA 4ETQB 2AJUL 3S8WA 3SN6N 1G9MC 2IC2A 4MD4A 2YRLA 4H1LG 3GSXB 4DQOL 2CO6B 4OZGF 4OF6A 3G6JE 1JCKA 4JPVL 5DJZB 1S3KH 4AT6B 3LPFA 4ORZC 4NKQB 4K3DH 1AJ7L 1GZPA 4GUPA 2XWTB 2WK2A 4FQHB 5DYOA 1JWMB 2B20A 1WEJL 4JR9L 5DT1L 4F58L 4NQXA 3T77B 4U7KA 2FBOJ 2AV7A 3L5HA 4TNVF 3X3GH 4OJFL 3I2CH 5I8KH 4O00A 1KACB 3DMMB 4G80B 3WUZA 6FABL 2I26N 5D2NC 1KF9B 3I75A 3EYQD 3EW3B 4TN9A 3DHMA 4OCWL 4XCYA 5E9DD 5BV7L 2YKLL 2EXYD 3EYFA 3TT3H 4KKAD 5DJ2B 2DWEB 1P7KA 1IEHA 1RZIA 4WV1A 5T1KB 1NH6A 3HC0A 4FQIL 2HTKC 3RZCB 2X4UB 3I6KA 4KROB 4TTDD 5B4MD 4OFYA 1VFOA 5FOBB 3PWPA 3J7HA 2OQJB 2ARWA 2ZUQB 1VGEH 1MAJA 3FONA 4P3DB 4JM2A 1OAKH 1BPVA 1FHGA 5IJKA 1I9JL 3MJ9A 2NYYC 3Q1SH 4OM0H 2ZSWA 3GJFA 4Y0GA 5JOFA 3FB5A 3QAZB 1BJMA 2N7BA 2MOVA 3MLTA 3ARDB 4XP5H 4MXWH 2H32B 4OLUH 4RBPK 4R6UA 3ARFB 3O8XC 1EEZA 3HMWL 2P8PB 5C0AD 5IMMA 5FA4B 1XH3B 1QQDA 1OM3L 1S9YB 1IT9L 2G5BA 4W81A 1ZHLA 4CMHB 2E7BA 2ZKHH 4GXVL 4LGPB 3QJHA 1ZTXH 4S11A 5EOQH 5B38G 1T22B 1BM3H 1RUML 1IC4H 1N0XL 4KJWC 4XCCH 4LFHG 5E2VH 1N2RB 4J3VA 1MCIA 4Y2DA 3VWKA 4ZFFA 2ZWLT 1YY9C 2E9BA 3GMMA 4M6OH 5TQ0H 2Y5TA 1WBXB 3QPQC 3Q6GH 5D7IE 5DD5H 1INDH 4NFBA 1IEAA 3FT2A 1GGCH 2VJXA 3D2UD 3MROB 4PTUA 1CIUA 3EZJB 1Q0YL 1OF2B 3GIVB 1HWGB 1FP5A 4OZIB 1H5BC 1R24A 3RTQC 4M1GH 3UC0L 3TWCL 3C5JB 2I60H 1Q9WA 4TULH 1S7QB 2HT4C 3VFNA 2NY3C 4H1LB 4HWEL 5K9OA 3FFDB 5DMGC 1YY8A 3F58H 2WINB 3MBXL 5CILH 1U92A 1BFTA 3DURA 1TZHA 2NNAA 1A9EB 1KJ2L 1G6VK 3P77A 3HC4L 4X5XA 3VD9A 3OJDA 1ZT1B 5DC4B 5C0BB 3MRGB 5D5ME 3NH7L 3S34H 4H88L 1YEKL 4HMDA 5CD3B 1CFSA 4MJIB 3CPLA 3RAJL 5C86A 3QNYB 1MUJA 4TSAH 4Y1AA 3JV4B 5IW6A 2R29L 3BUYB 2PTTB 2C1PA 3FO9B 5DZLA 3CFKA 4ENEC 4JFFA 1EO8L 1NFIA 1MH5B 3O81A 3VGAB 3CZFB 1DBJH 4KK9D 1GYAA 2X70B 3VXQA 3AXLB 4GBXC 3V5DA 3PHSA 2E7LA 1WTGT 3MLSH 4LCUB 3OF6D 3EZ8A 3BHBB 3BPLB 2Z8SA 4V1DD 3MRHA 1XF4A 3ETBF 1X7QA 4UV7H 1EAPB 3GSVA 1WSST 1MJJB 2D7QA 2GYSA 3SDDC 2XZCH 1FZKA 2WANA 3EFFA 5J3HC 5AYQA 5LXGH 1RUAL 2DB8A 3INUL 1XGUB 3VFGH 1HKFA 4MGXA 5IV2B 1IAIH 4R4BB 5DVMA 1AE6L 4FQQB 3T0AA 4Y4HD 4XGZB 2D03L 1NMCB 5JIKA 1F8TL 3Q0HA 4KRLB 4QXUL 4LRIC 2GK0B 4OLVL 2GCYA 5LGJB 4QHUB 4EXKA 5IFJB 1NC2A 1P2CB 4PJ9A 1H8OA 5CIPA 1V05A 1FRGH 4Y4KB 5ISZD 1UT9A 5AUMA 3MA9H 3MGAA 3A6BH 5C6TH 4N8CH 3G6DL 2YD6A 5F7HA 1NUNB 1JYVA 1U8IB 4URTB 4XWGH 4XXCA 3WFHA 1EGJA 5B38B 4OUUA 5F9JA 5E4EC 1IGTA 4JO3L 1T7XA 1GOFA 5K9QI 3UMTA 1KG0B 3BIKB 4JREB 5IMLA 4NRXB 3S3JA 3GSUB 1JWUB 4XWOC 4YQXH 4W4OA 4LASL 3SGKA 5L7XH 4YHNA 5EU3B 3GJFK 3QULB 2F53E 3OKLA 3QIUC 4L4TE 3RL2A 3VGDA 5A2JH 4BH8B 2FRGP 2FL5B 4UNVA 3BWAB 1YN6B 4GRMA 2HLFD 3KYKH 2VWEE 2UYLA 1KTLB 5EBGA 2EYSB 3GMQB 3FFCB 2EDEA 1KELH 3P0GB 1KCUH 3CVHB 4UOJA 4BA8A 2VOTA 2BK8A 4E41D 3D3VA 5CP3H 2HJFA 1Q8MA 3D87B 5DJ6A 1ADQA 5B39A 1C5DA 4JFHE 1UG9A 3L95B 3E6FB 1X5AA 2XA3A 4JY5L 2EDWA 3VWJD 5TDNA 4JKLA 5D7LD 3KJ4C 3S36H 5HY9B 1PG7W 2EIBA 3G6JB 5FCUH 1M6OA 1CGSL 3WHXB 2XTJC 3PL6A 4JZNB 2DTML 5EFIB 2W38A 4H8WH 3RX7A 1XAUA 4YO0A 4M1CC 4NO0B 2A9NH 4QRUB 2O5YH 3WDJA 2EC9U 4BFEA 1X5GA 1M7DB 1H15A 4HS6A 4LIQH 1XR8B 5E8DH 3UTPD 4MLIA 1Y18A 4B50A 5FYKD 2F58H 1U8PB 5GZND 2XRAH 1OQXA 3DX9A 2P5ED 3IJHB 5DVKA 1HI6A 4K8RH 1PW3A 1BD2D 1JV5B 4OZIF 1IQDB 3TN0C 1I9EA 1DUZA 1A0QL 3BP6A 3OJVC 2EO1A 5J9PA 3MRQB 3MRJA 1ND0B 3I84A 3MBEC 3IJYB 3QO0B 5BS0D 5MP6L 4P49A 5HVGB 5HSFA 3O2DH 5HDBE 2VDQL 4FMKA 1QSFE 1X5KA 4NQCA 4GSDL 3EAKA 2A77L 2ZUSA 4ZS7H 1R5WA 2OLDA 3VE0A 2EZ0C 3M1BB 4LAQH 1QR4A 3H42L 3FO2B 3U83A 5D93B 2VDRH 2DBLL 4P3CH 1E6OL 2YD1A 2W0LA 4HT1H 1DQLH 4MQXD 4WU7A 4OD1L 3VFOA 1V7MH 1J1XH 4HXBL 1KN4H 1TCRA 4Y89A 4ZODA 1JNLH 1L7TH 1A6UH 4XAKD 4A6YB 3HNTL 2AXFA 3DTXA 4RIRB 4C57C 1O5DT 4FQJH 5IJVA 5GS1A 1FH5L 1W0YT 3GK8H 1LP9A 1B0RA 1UCBL 3LKQB 3MRPB 5ICYA 3ZTNL 4LK4A 3RA7H 1A14H 4Y4FA 3ZE0E 5KANG 2PO6A 5IHLB 1J7VR 5GGQH 4U2ZA 3QHFH 4AG4L 4IEFB 1HQRB 2R4SH 5HGDB 5D7IB 2EIZA 5KW9H 2C1OA 5I71C 1E4KC 4LLUA 3TV3H 1PQZA 1S7SA 1JWSB 4UQ3B 4PRDB 1TETL 1ZHNA 5LBSH 3BWUC 1ITCA 2IBGA 3FQNB 4NDMA 5DGQA 5DI8B 3QUXA 3CMGA 1C5CL 1Z0MA 2EDDA 2OL3H 2AAVA 3BGMB 1CIDA 2OCFD 2PYEE 5DJXA 4IRZL 5FYJE 2OXGA 2V9TA 3LRHA 2R2HA 5IB2B 3HE7D 1MWAL 2VXUH 1GGUA 2D7MA 4WEUD 5I15H 2XG4A 2Y1VA 3N50A 3V5HB 2FO4B 5D7KD 3ULVC 4XRCB 1ZVHA 5B3JF 4WUUD 3OAUH 3BZ4A 5D5MB 3GSOB 4OI8A 1A6WH 1JF1B 2GJ6E 3IF1B 5HHQB 5DRNA 4K9EL 3LRSA 2XKUA 1U95B 1JK8A 4HXAH 2XPGA 1SEBA 2OSLB 5J12B 5ENWA 2D31A 3ZSTA 3SKMB 5ETUB 3MFGB 3V0VA 4L8SB 4KRPB 1H3WM 5C9KA 1B3JA 3RWGB 2UZXB 3HFML 1L9MA 5E08L 2BJML 2R39A 3TT1L 4FQLL 1NKOA 2G60L 3P0VH 3F5WB 3OAYH 2EH8H 4LCWD 5JIPA 3UZVB 4KKLD 1RZKH 1YEHH 2ZCLH 1UJ3A 3DGCR 1BX2A 3RVWD 2EKJA 3CFCH 4MAYB 3OKDB 5BO1L 4NC0B 5C0RL 4DKEH 1A6TA 1OAUL 2PNDA 3G6JF 1KXQE 1HH9B 3BP5A 3DOSA 3TIDB 1NAML 5HYEA 1J05B 3NA9L 1CFVH 4J4PD 1L9NA 2A83B 1KB5B 1VFBA 1UZ8B 5C0CE 3OKMB 3CFBA 3WLWC 4Y5VB 1NCAL 2QEJA 1CI5A 2FX8L 3GM8A 2C7UB 5MENE 1WC7A 3ZKMD 5CZVL 4XP1L 4LPCA 5DFWH 5E8NB 1BJ8A 3UTTE 3BE1L 1CBVL 2WNGA 4D8PA 2CLRA 3GSNH 1PGRB 3BGAA 5DSCA 3VG0H 1XCTB 2OZ4L 3DXAE 3BAEH 1BECA 2VLRE 4K7PX 3TA3A 1U42A 3P9LB 5GRWA 3ZE2E 2XOTA 4LOUD 1U36A 2EDFA 3HR5A 3MRIB 4HLZG 3B8YA 4M00A 2A9ML 1QFPA 2XV6B 2XN9A 3EO0B 4XMPH 4FG6C 4NN6C 4P5TA 5E94A 5F7KC 3UTZA 2YEZA 43CAB 3MX0A 3SGJC 4WFGE 1FN4A 2H2SC 1OP9A 2F53B 3O9WC 1CZ8H 4QOKE 4YC2C 3PWUB 3S7GA 4L4TB 1A7PL 2LV4A 4LCCC 5TGBB 4KMTL 1MWAA 3GB7A 3LN4B 1H0DB 5EU4B 2D4FA 3ZKXC 3ARBC 5FYLL 3SCMC 3H6JA 5K9KB 4F33A 3BVNB 1ZHKA 4MJ6B 5TDPA 3SPVA 4LPXA 1BZ7A 4QHMA 4ZS6C 2F8OA 1CICB 3WL9B 4M61A 4EUPA 2E7MA 1N3NB 5EULV 1JVKA 2AEQL 4HKXB 2Z0BA 4XAWL 1A3RH 1NGZA 5EU6D 4K94H 4RWYL 3O45B 4O4YH 3PHOB 1MOEA 1NCBH 4KI5C 4DTGL 2G2RA 1TENA 4UB0L 1GOGA 1FFOA 3RX8A 3T65A 3TZVD 1X5JA 2GJJA 4Y8AA 5FM5O 1YDPA 2HAZA 5IUSA 1L0XA 3IDYC 3PGFH 1R0AH 1S9WA 3G04A 4H26A 1EHAA 4JRXA 4NC1C 4GG6E 2LVCA 4WHDA 3B6SB 1EERB 3DVFA 1F4AA 4N0YL 3RVXD 3BDYL 3GBNH 1U6AH 2DD8L 5D7IF 5F7DA 3W2DL 3IVKA 3PJSA 5DEGB 1UCTA 3P9MA 1DE4A 3IKCA 5D9SA 1NAMA 3K0WA 5AG9A 2NW3A 3FHQA 4PRNB 1YN7B 4M7LL 3U36B 5I19L 2R0LH 3MXWL 2P7TB 3MYJB 1XF1A 3DVGB 4UTAL 2CLZB 3MRLB 1KJVA 1EH9A 4TVPE 3NA4A 3PWNB 4ZUTB 4LVNC 3RL1A 2QHRH 2ERJC 3VGBA 2BHZA 4DN4L 1UA6H 1QSFB 4FQXD 2WWKO 3EFDH 4NKMA 2YPKA 1SY6H 3VXRE 2Q87A 2FH8A 4IDJH 5D5MF 1UKTA 3CSPA 1MCQA 2YXMA 1PLGH 4GAYA 4HV8B 2RIKA 4DVRL 4OBRA 1K8IA 2CUHA 3PWPE 3FN0L 5A1AA 5L88H 4P4KD 4NO3B 4DFIA 2DLEA 3AU1B 1YNTA 4KTYA 4RMWA 5KN5A 4HF5L 5A3IC 5J6GB 3STZA 2BP3A 3T4YA 3SDAB 4JO4L 4LEOB 3KPSA 3LKRB 2HN7B 5KVEL 4KDTA 5MHSE 1PZ5B 1ZA3B 3WFDH 1DLFH 4PTTB 1U8QB 2VABB 5IBLD 4G8GD 4MNQE 4HFUH 4GRLC 4LF3B 1E27B 4LEXH 4XPGH 3MRRA 3PP3K 4UIKL 3EYSH 3HZYA 3PXHA 2AEPL 5FM8A 3RY5A 3TYFA 1AKJA 3MLPA 2IWGA 1ZANL 4OD2B 4X7DC 1JE6A 4QCIB 1X5IA 5SWZD 5LCVH 4GW4B 4EVNB 1W8OA 3N1QC 5FV1L 3S37X 4Y19A 2BVOA 4AM0A 4DVBA 5D1XB 5HGAA 3DRTB 2RFXB 4QTHB 5C0ND 1DUYA 1W72B 2IBBA 3R1GL 2CK0L 1UEYA 5HYSA 3WIHH 3WS3A 1CK0L 1I1CA 3CFJA 4HWUA 1NCDL 2MFNA 3TJEH 5DC0A 5EORH 1YYML 1D5MA 1GCFA 3B5GA 3SJVA 2E8ZA 4U2YA 3V6FB 5HJ3A 4U05A 3KXFD 5JDJA 1BVKA 2DAVA 3K46A 4OCXL 5HTSA 5J7CC 3O3DB 4PLKD 4QXWA 3S96B 3CH1A 3IXAB 5EUKA 4CN6A 15C8L 5L9DL 1P9MA 4UTBL 4W6YB 4YXKH 1EMTH 1IM9B 2GJ6B 1YYLH 2ENSA 4L1HA 5IROC 2NY2D 3VXNA 1TTUA 1T0NB 3MV01 2DDQL 2F54E 5H37G 3HS0A 4EZMA 2APVA 5T1LD 4NN7B 5HYIA 3MLRL 3HR6A 5GHWL 4HULB 4NHUA 1CGTA 3AMKA 1P7QB 4OFKA 4O02H 3OGOE 3EHBC 3MR9B 4H25B 3C8KA 4O2FB 2W9LA 5EIIB 4JGJA 4Q0XL 1MCKA 1YQVL 5DA4A 3W81A 4D9QE 1CFTA 3UBXI 5JOEA 1K8DA 4JFFE 4PFEA 3NIFE 4JHAL 1RSFA 2OI9C 1F3JB 1I9RH 4A2LA 4KJPC 1SEQL 4QYOA 3QI9D 1CFNB 5C0CB 1LO3L 4K71B 3AB0C 4HWZA 3AREA 5GGVL 2Q7YA 4HIEA 2HFFA 2QQNL 1M7XA 5MENB 1Y6NR 3SE8L 3JUYA 3EOTL 1IFHL 2X1WL 4MNGA 3RGVB 5T3ZE 1FZMA 3V0WL 4QLRA 3IFPB 1CS6A 1G7MB 3C6SA 2C3XA 4YPGB 5CMAA 4HIXH 5D4QA 3T0BA 1T5XB 2I07B 3QDJA 4F7MA 3LQAL 1FPTH 3DXAB 3B5HA 2VLRB 3GUTA 3U0WL 1XGTB 3CCHA 3KPQB 3UJIL 3TBSB 3GBMH 3I85A 2X1XR 5E03A 2VXQL 4DZBB 2SEBA 4CN4A 5SWSD 4OM1H 1ZSDA 1OARL 2ED7A 5GISH 1KBGL 5HDBF 3KWWA 1JGUH 4U1JB 4ZXBD 4P23A 2E9IA 4QOKB 5LKNA 3H7LA 1A21A 4CNIB 2AERT 1G7JB 2Z31D 3RWHA 1MCPH 2VXTH 2ARJQ 3JZ7A 4X9IA 4OZFG 4Z95H 2CKBB 3VXSA 5EZLB 5JXED 3ZT7A 1RJYA 4JN2B 4MA1B 3T0VA 2F8VA 1UACL 4RFNB 3WXWH 3OMZA 4TNWF 4WW2A 5DUMH 1I3GH 3C08L 2CIKA 1OCWH 2X4OA 2HLAB 4KK6D 4MCYA 5GGRY 4UIMB 4WDIA 5IHUL 1OTSC 1U8NB 3NFNA 4FZ8H 4OGXH 4G6AD 2EE9A 3GRWL 5C7XL 2HRPH 2H45A 3LEYH 3CSBA 3EOYG 2Q86A 3P30L 3DROA 4LMQE 5DF0A 2H6PA 2ICWI 4XNMA 3RWDB 3ZE0F 3SE3C 4I18C 1F3RB 4P46A 5I1KL 1AGFB 4MD4B 4NUGH 4GG6B 2R2EB 4R4FL 2MKLC 4GG8A 4MLSA 4KI1A 4OTXH 2PKDA 4BFIA 5KSAB 4HK3J 1GZPB 1WFNA 1V3MA 4GUPB 3VMOA 2KZ1B 4NGHL 1YEEH 4H20L 1OGAA 3GI8H 1N8ZA 4U1NA 1JPSL 3AAZA 3RI5K 4NQXB 4XVJL 4AMKL 1LO0H 1C1EH 3HN3A 1I3RB 4ODWA 5BMFL 4IOFD 4HIHA 1B90A 1CGWA 4EI5A 1T2QL 1ZAGA 5I75C 2W9DL 2ZCKH 4CRPA 3P40A 4EDXA 1D5ZA 2GQHA 3BQUD 2FH6A 4PLNC 1RZFL 4BFBD 1TTFA 5I73C 2J7LA 4XCYB 3C5ZA 4MJ2A 5J8OA 4FRWA 5JHDE 3TBVB 3VXRB 1QVOA 4PREA 4OIAA 4PJEA 1P7KB 1NEUA 4WV1B 3HC0B 3MRFA 3RZCD 1BF2A 3I6KB 2QQLL 1QP1A 2UZIL 1JGLH 3MRMA 4AY0A 3PWPB 2FJHA 2FCBA 5HHOE 3FONB 1DVFD 2PXYC 1MCOL 1IC1A 3WLBA 1F11B 1D5IL 1ES0A 3IXTB 1NGYB 4YHPA 4LLWB 4EBQH 3GJFB 4KVNH 3QH3B 1HSAA 3FB5B 5LQBH 4WENB 3V95A 1IGFH 2OR9H 3HB3C 4APQA 2MSPA 4MNQB 3WSQL 3WN5C 3GKWH 1BBDL 3ARFD 5IR1B 2JIXD 1EEZB 4Y5XA 5EIVA 2A6JA 5IMMB 4I0KA 2BC4A 1KIRA 1LVEA 4PIRF 5F9WC 5CJOH 4X4MA 1XF5A 2FB4H 3MLZH 1YY9D 4OZFB 1MEXH 3PP4H 3PQYD 3QJHB 1GC1C 2DWDA 2WBJC 3ELAT 1XZ0B 3LS5H 2PW1A 4ZFOL 3RDTA 3T0DA 5E7BA 1LP9E 1EPFA 5KS9A 1QSZA 5AZEH 4XPFL 1RU9L 4U0QB 2H41A 5I1JL 4PUBL 3MODL 4Y2DB 1F02I 2L7JA 3O41A 3IRZA 4WY7H 1WFOA 2CXKA 4MD5A 4K7PH 3T0ED 1QACA 2DJUA 3GMMB 3PWJB 2AXJA 2Y5TB 1MFCH 1QR1B 4I1NB 1IEAB 1MY5A 3ZE2F 2JB6A 3BIBX 3SE4C 2J8HA 5FKAB 4Q9CA 4XHQA 3EJYC 1AFVL 3VW3H 1QBLL 2HVKB 1UB6B 3KLDA 1R24B 2BVEA 4PJ7B 1RIUL 1NDGA 1WAAE 5IBUG 4KUCF 1JP5A 4PGJA 1Q9WB 5B39G 2DMKA 2UUDK 1AHWB 3D48R 3A6CL 1B9ZA 1JTPA 5K9OB 1YY8B 1TPXC 5DGRA 2F54B 5H94B 1EXUA 1AXSA 1U92B 4DFHA 3DURB 5GRVL 1YNLL 5CD5C 4HCRH 1TZHB 2NNAB 3WMSA 4JFZL 3P77B 1BREA 4X5XB 5JW4N 3OJDB 4BQCA 3KPRA 2D2OA 5J11B 1PEZA 1HINH 2NY4B 3LH2L 2NY6C 3BPCA 3C2SA 3D9AH 5KZCB 3CPLB 3BSZL 1TVBA 4GLRI 4TPRL 1ZA6B 3B9KB 5IW6B 1F58L 2C1PB 5BV7C 3CFKB 5L0QB 4JFFB 2X1PA 2ZSVB 4X6BA 1GAFH 2ICWA 1CFBA 1DBKL 3VXQB 3SGEI 4DAGH 1BFVH 4E42A 4YPJA 5J13B 2QSVA 4XH2B 3SQBA 2WBKA 2FZ3B 4EXPX 5GGRA 1JFQL 4OT1L 3MRHB 2ADFH 4OKDA 4UILH 5SV4A 1MJ7L 4GG6F 1X7QB 3GSVB 2NZ9D 3G5VA 4V1DA 1BJ1J 4LKCA 5C0EA 2R4RL 4L8DA 4RFEB 8FABA 2BY3A 4WFFE 2VLKD 5E24E 2OS7A 1F4XH 3DMMC 4KV5E 3F7PC 4M7KH 1U9KA 2BY2A 2HKFH 4KKNA 1DBBH 5JA8B 1T20A 4OZHA 2A0LC 2GCYB 1NC2B 1OLZA 3O6FA 5CIPB 3U9UB 1EX0A 4X80L 4OB5L 1U3ZA 1FIGL 4HKZA 4ZQKB 1BZQK 5GIRA 5I6XB 3WFHB 3QIUD 4R0LA 5TFSL 4OUUB 5F9JB 1IGTB 2DQCL 4PPTA 5I1HH 1U8JA 1W0WA 1NCUA 2GFBA 2FGZA 3VFUA 3EOBA 3MCKA 3S97C 3VFVA 4LFHD 1ZEAL 2I24N 1IQWL 2XN9E 3CDYA 3MA7A 1LO5A 3QRGL 3FQWA 3IETA 1SJHB 3PIQA 2Q76A 3PWVA 4D0CA 4E5XA 3PHQA 2CJUH 5ANMB 3ILQD 4QTIH 3ARDC 3C2AH 4MDJA 4FZEH 4OLZH 3OKLB 2UWEE 1JZ6A 1N59B 3ZKQD 3P11L 1A4KB 2IAMD 2ICCA 3F7QA 4KU1A 3CUPA 4PLJC 2UYLB 1QFWH 3FFCD 1A8JH 2C5DC 2WWMC 2HJFB 5IBUB 1ED3B 1KC5H 1QLEL 3O6ML 1DANU 4XNZC 3REWB 4CMHC 2W0FA 5B39B 1NKRA 5HHME 3S37H 3ZDXE 1WT5C 4U7MA 4LU5L 3B83A 3BP4A 1J88A 2VB5A 4GKNA 3KS0H 4G8EA 3HI1A 3WUWA 3PL6B 3VWJA 1N5AA 4NOFA 1XIWA 3OXRB 4P5KB 5TPWH 4OCYL 3SDCD 4YO0B 3KLHD 2KUTA 2D0HA 4NO0D 1MVFA 3ARXA 3MNZA 2NPLX 1I8KA 4JRXE 3N1GC 2E27L 2ZG3A 3CXHJ 1CLYL 3QCVH 3O4LA 4HS6B 1EIBA 1J87A 4POZD 5T3XL 4ODTL 1Y18B 1ERNA 3K4DA 3DX8A 4XNYH 1X5HA 2IPTL 25C8H 3ZTJH 2GSIA 3DX9B 1E4XL 1ZGLM 2FJFA 5JHDB 1DUZB 1AQKL 4PJ7F 3LD8B 5J9PB 4BJLA 1B0GA 4B0MM 2P24B 1AGEB 3RNQA 3UYPA 4YUEL 3CNKA 1FC1A 4ONHA 1I1YA 3LDBB 1N0LA 5LWYH 5HHOB 1FIEA 4YDIL 3L3JB 4JB9L 1MLCA 3F7YA 4DEPC 1YEFH 1CLOH 3ZE1E 3UCRA 1R5WB 3BXNB 2ARJA 1FGVL 3T2NL 3RNKA 5C6PB 5L8JB 4P9MH 1NSNL 3ME0A 3TJHD 4JG1H 5EOCH 1HYSD 1KIPA 5GRUL 3QJFA 4FXGA 3LB6C 2VDNH 3LEVL 1NGPH 4WU7B 3EJZC 1NBZA 4L1DA 3VFOB 2L0DA 2X89A 4UAOB 1H8NA 3QCTL 3H3PL 4X99A 4BFGA 3NIFF 4O2EB 1ETZA 3KPSE 4NWTL 4TUOA 4K55A 3QXAA 3GHEL 2BFVH 2AXFB 1LE9A 1KN2L 4J3SA 2UVEA 3I3EA 3WXVH 5IJVB 5GS1B 4MAUL 1MRCL 2P46B 3VI4E 1CQYA 1LP9B 1B0RB 4ELKB 5ICYB 3MRKA 1DQDH 3QEQD 2ZJSH 3QHZL 4Y4FB 4M48L 4XNXL 2PO6B 2VKWA 2RCSL 3IFNL 4M6AA 1S9VA 4LLMA