4KRPB

Nanobody/vhh domain 9g8 in complex with the extracellular region of egfr
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
116
Chain Sequence
EVQLVESGGGLLSCAASGRTFSSYAMGWFRQAPGKEREFVVAINWSSGSTYYADSVKGRFTISRDNAKNTMYLQMNSLKPEDTAVYYCAAGYQINSGNYNFKDYEYDYWGQGTQVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epidermal growth factor receptor
publication title Structural Evaluation of EGFR Inhibition Mechanisms for Nanobodies/VHH Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/immune system
total genus 17
structure length 116
sequence length 124
ec nomenclature
pdb deposition date 2013-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4krpB00
1UM4H 3A0OA 3U46A 3QIWA 1MLBA 4U7KA 3HE6C 4YXKL 4LEXH 3TNMA 1LEGB 4NZRH 3N1GC 3MUJA 1U8QA 2J5LB 5IROA 4KPHL 3CVHB 3PWPA 1G9NC 3ZE1E 5IB2A 4EKXA 4PUBH 5H2BA 5IEHB 3D87B 3O2WL 4HAGA 1QLFA 3VI3F 3MGTA 4LSTH 1J1OH 1K5NA 1ZEAH 4PJ7A 3EUUA 3C9NA 1GGBH 2ZPKL 1F45A 4BSVB 1CFBA 5F7DB 4I3SL 2Q3AA 1T4KB 3FAXA 5DRXA 1BFVH 1HILA 1JRHH 4FTVD 2GCYB 3LPWA 4XC3L 1JJUA 1HWHB 1NCUA 5EC2B 3QSKB 3JWOC 4MXVF 1Q0YH 4YHPA 4Z7NF 2VZ1A 3BGMA 2FHBA 5DRWA 3DVNB 4I48A 3ILPB 2DYPD 4O4YH 3O3UN 2ARJA 5D1XA 1UCBH 4PGEA 2NX5D 2CUIA 4OV6F 3P4NA 3CDGB 3KR3L 2DLFH 1I7RB 3O3DA 3V6FB 2CDEA 2EDRA 4U6YB 4ZNEA 1U36A 2VLRB 5F96L 3CAFA 3L5WA 1A4KB 4YBQD 2YZ1A 5E1AA 1NGQL 4WU5A 4NO3B 3OKDB 4MWFB 5E6ZA 4J3SA 4W70A 3MRFA 2FR4A 3QRGL 4EN3B 3AS1A 4JFFB 5BOPA 2F5AL 4P5KA 4QRRB 1MCJA 1FNHA 4G8GA 5F9OH 2ICEA 5IW6B 4ODUA 5TF1L 3TFKC 4JFEB 4NRXA 4JFDA 4FRWA 1DLFL 3FFDB 1B6DA 1R3IL 1RFDH 3GIVA 2JK5B 3IF1B 5J13B 1BIIB 3VXUE 2J3SA 12E8H 4XMLH 4BQ6A 5A3ID 2FECL 2AGJL 3EDJA 4LCWE 3UTTB 3ZE2E 4O9HL 3MUZ1 4PJCF 4L1HA 2BZDA 5JW4Q 4WNQB 3QIBD 1MEXL 2D7NA 5MEOA 4MDJB 3Q0HA 1LNUA 4P2QA 1TVHA 3QQ9C 3UYRL 2FH6A 4NWUH 1OGTB 2VL5B 3QQ4B 4WUKL 2DIAA 3PE9A 4S1SH 4B5EA 1JV5B 4ZS6C 3CFCH 2AK4A 4WW2A 5GGUA 2ADGB 1CGSL 3IRZA 2R8SL 1A7OL 4NZJA 2Y6SC 1F02I 4PJEE 1FZOB 3Q2CA 3MV8B 2CH8A 4LASL 4M6ML 1FFOA 3IKCA 3AY4A 2NY5C 4HX1A 4GG8B 2JCCA 4M7ZC 1P7QB 4R4ND 4UBDD 3NACL 5I16A 4X9GA 3D39A 4M48L 1YMME 3RUGF 3F12B 1HE7A 1N6QL 3FTGA 3WIIH 3MBED 4H25A 3P0VH 5FYKH 1R5WA 4QHLA 3BZ4B 1ZE3C 4M3KB 4WIQA 4LVOC 2GK2A 5FA4A 1I1FB 1KCUH 3JVGC 3SJVE 3DSFH 4JRWA 4AEHL 1IEBA 3NN8A 4PV9A 5KS9B 2NY5L 1NH6A 4I18C 4MNQE 3VFOA 3GEWB 5I8CB 3EYQC 4PGZA 5TDNB 1AHWB 4I2XA 3SDCC 2ADJB 4MGXA 1SEQH 1S7QA 1X5KA 4X5XB 4YHYC 5JLZA 2IFFH 4U1IB 4LOUC 2NW3B 5CWSB 1S9VB 2W9EL 5B38A 3DVGA 5DEZA 4WWKA 4MXQD 1KB9K 3RPKA 4FXGA 1UZ8B 3IB4A 4PJGF 2BSSB 4TUJA 3LS4L 4TRPL 3B9VA 2APBA 3TBYB 3T0VA 1TCRB 1M6OB 5ACMA 5HHVH 3U9PL 5IMKA 1UCTA 3B3IB 4HWUA 4YDJB 1W0WA 2J4WL 1H5BC 5D6CB 3B9KD 4K3DH 3QAZB 3ULUE 5I18L 3X13A 4LP4A 2CLRB 2B39A 2SEBB 1H8OA 4BKLB 5L8KB 4TOYH 2OLDA 3ARFA 1XF4A 3LN4A 7FABL 2DAVA 5ALCH 3HNVH 3IDXH 4GKNB 1Z2KA 5EH1A 2OL3B 5T33H 3QDMA 1MPAL 4M02A 3QFJA 4FQXA 2HT4C 2EDOA 1N8ZA 1YECL 1T20B 3IFOA 3JV6B 5C0CA 2G5BB 3GKWL 4KI5F 1U8MB 4UT7H 2J8UE 1G6RH 1OM3L 3LN9A 3KPOA 4PJ5A 2VLKB 1DQJA 4OAWB 4LVOB 4E9LA 4J4PA 4PRPB 4TULL 4BQ9A 2BERA 3JWDH 2HVJB 3B2UC 2UVFA 1HIML 4GSDH 4F7TA 3ZKSD 4JQVA 2K7QA 3HRPA 5AG9A 1DQQA 1RSFA 3RZCA 1U58A 2H2PD 1CXKA 1WT5C 2EZ0D 5F72S 2ICES 2H2SC 3VH8G 1CLCA 4XVSH 3QHFL 3RIAF 1HH9A 5CBAB 1T2QH 2VLRD 4ZAKC 2GITB 3BDYL 4FTVE 3TO4A 4UT9H 4RA3A 1QSEB 2CO6B 2XWBB 5KVDH 3SPVA 3UJJL 2XYCA 3J8F7 5DMGC 5LBSH 1ZAGA 4D0BB 5D96C 1LEIB 4JFFD 1NAMA 1H5BB 1ES0A 3MJ7A 4KKAC 1JFQL 4YE4H 2NX5E 5FEBA 2Z93B 5CBEA 3L7EB 1T0PB 4JFED 1AGFA 3J7HA 1DUYA 2X7LB 5IVOA 4HK0B 1RZKH 3LEVH 3T4YA 3UTTD 4R4BB 1N64H 3U4BH 2K7PA 1DVFB 1KJMA 1W8OA 3U0WL 4BFIA 3GHBH 4PRDA 4XNUL 2Y5TA 4XP4L 5FUOL 1T22B 3RVTD 1KULA 4HMEA 3SDXE 4L8BA 5FAAA 3TYGH 3L3OB 1X5JA 3VRLF 1BD2A 4PRBA 4YR6A 2H9GB 3L3HB 5ITFA 2YN5A 1VFAA 3GMPA 1ZT7A 1MIMH 5FGSA 3ZDZE 3DIFA 1JZ4A 2EIBA 1V7NL 1RHFA 1PG7H 1WWAX 2D4DA 1FAIH 5IVXA 3L1OH 1T21B 1I85A 2O5ZH 2A6JA 4HIHA 1P7QD 4TUKH 3VFPA 2VAJA 3OAUH 4HFWA 5ISZB 5E2VH 1AXTH 4NDMB 4OLYH 4JY6B 2EE9A 5JQHC 1C1EH 1QYGH 2FBJL 3KPSE 5E5UB 2A6DB 3JSSA 3OJ2C 3MO1A 1WZLA 1GC1C 2DQDL 4M5ZH 3WUWG 2BP3A 4X9FA 1TJIL 2W0FB 3QG7H 1EBPA 4FNLL 4Y1AB 1I4FB 1MJJB 2GKIA 1K4DA 4OFIA 2I5YL 4X4YA 1U3ZA 1VEPA 4R97C 5BQ7B 2AJ3B 4H5SB 4HUWB 5J8OA 1VPOL 4UDTB 3LKQA 2CSPA 4X6CE 4RWYL 1LD9B 4HLZH 1RZ8B 3EO1A 1KB5H 4XPBH 5T5NG 1A3QA 4RNRA 3R1GL 4OZFG 1A22B 5D2LA 5CP7A 5JIHA 2X4PA 4MJIA 4V1DE 5ICXA 4POUB 3U0PB 2B0SH 5J11B 3WUZA 4M43L 4C83A 5J12C 1ZA3B 4ZFOL 3FQUA 1D5BB 2NY4B 1CFVH 3GBLA 3H9SA 3WFBH 2CDGB 3LQAH 1HXYB 2YK1L 4F7CA 1HKLL 1S9YA 5LAXA 4PV8A 2A9NH 3KWWA 3F7YA 2GJZB 1OTUC 5GGVL 1BQHA 2HKFH 5HYQA 4PB0L 5F9JB 2ZUQC 3EOBA 5KSUB 1DBKL 1HSBA 1HZHH 4LCUA 2RIKA 2Y6SD 5GSRB 1NUDA 1NFDE 3PWLA 3QCTL 4DWHA 1JF6A 2YD3A 4KK6C 5JPMB 3G6JE 5D93B 2HJKB 3RAJL 3TA3B 4L8CB 2IPKB 3SKJH 3NFNB 2EE2A 4PJCB 5CJBA 4UMGA 3WFDL 4IBLT 5I1DA 2R9HC 2I60L 4W4OA 4L3AA 3MLVL 1ETZB 1JWMB 5HGDA 1INDH 4DFHA 1T03H 1A0QH 3KYMB 5FFLA 3TVMC 1T2XA 1CK0H 1KIQB 2VLKD 3ESVF 1G7LA 1GHFL 2OJEB 5B3NA 5HHOA 1KENL 2JJUA 4ZFOB 4APQC 4Q9QH 3DYPA 4PRPD 2BVOA 3MBXL 4WJ5B 4WENB 4OJFH 2OSLB 1FDLL 1W72A 5DDHB 5E4EB 4KPHH 1DFBL 4R97B 4PJHE 1M71B 4YWGL 3ROLB 3HAEB 1RZGB 4KHTL 3EYQD 3O2WH 3VGGA 5EZLB 3EBAA 4F9LC 2OTPA 4OIAA 3UPAA 4XBPA 3UTOA 1BAFL 5DJ6B 5T1LB 3RUGB 4JFQB 3RU8H 3H7LA 5E1HB 4MX7B 4NUJB 3D0VA 4RGNE 3S97C 4HWEH 5BS0E 1GJIA 4ZS7L 4RAUA 3CZFB 4AENB 1G9MC 3SDYL 1CWVA 3P9MA 2FL5B 1QSED 3WS6C 3DETD 4F58H 1Y0LB 4Y19A 1ADQL 1A9EA 3UYOD 1JE6A 4GQPH 1Z3GH 1WAAE 5F96H 1VFUA 1G9NH 3DXAE 3TCLA 5ICZA 3IAPA 3LVEA 1H8NA 3QUML 3MLWH 1X5AA 4Z7UF 2NLJA 1MRDH 3QJFA 4HUUA 1J05B 3SE4A 4YGAB 2VLRE 4LSQL 1JWSA 1T80A 3T0EC 1DSFL 2PYFA 1DR9A 3GSQA 2F5AH 2Y4SA 2QQLL 3OXSB 4RFOL 3UTPD 2ICCA 2JELL 3IDYC 3HZVB 4ZUTB 1H8SA 3QXDA 1DVFD 1QR1A 5T5FL 3JWOH 4LHUD 4PJGB 3RHWK 1JCKA 2HT4D 1G9ML 4HDIB 4LK4A 4ISVB 2FX8L 4JFEE 4XT1C 1LO0L 3G04A 1KN4L 3ZDXF 4ESKA 3CDCA 3NCCB 1WBZB 1BOGB 3U7YL 1MEXH 1JF1A 4CMHC 1J0IA 3TGXA 4CBPA 1I3VA 1G1CA 3GUTA 2B2XL 3V4UL 2AXFA 3ES6A 4KH2A 3UTTE 3UYRH 2IWGA 5C6TH 4KHXL 4WUKH 5IBUG 4M7JH 3P4MA 3VXSB 1YN6B 1RJLA 2UZIL 4QXGL 1CICA 4F15C 1OAUL 3BAEL 4J3OC 1Z5LB 1Z0MA 4LCCC 1C12B 1A7OH 3EJJX 3IETA 3QHZL 3QUMB 5IW1A 1NL0L 5LJYH 5ISZD 1IEHA 4MA3A 3OKMA 5HY9A 4PJ8A 3BUYA 2D7TL 1BZ7B 2H2SD 4LSVH 5I1HL 5JQ6L 2HG5B 4LASH 1I8LC 4M6MH 3SDAA 4XXCC 4JREB 2ZOKA 5EZOL 2BVEA 4N5UA 4ZFFB 1I7UB 3NZ8A 1U8IB 5DVOA 1U95B 1J18A 3QG6A 1N26A 4Z7WF 3T3ME 1E6JL 2FJHA 4Y1AD 1EEYA 3VXOB 1GAFL 1UXWA 4O5LL 5KSAA 1LO3H 5F89B 2NTFB 4X7TB 3WNMA 3C5SA 2W1NA 1BQLL 4YHZH 3VFVB 4EI5B 1AQDB 1NBZB 5DWUL 3STLA 4JDVA 1RZIB 3W9EA 2E6QA 5BW7A 4XX1G 4XP9L 1FHGA 1MCFA 2NY5H 3FB5A 4JGMA 4OZIA 3GKZA 3QUYA 4NM4H 2EDDA 4HXAL 2DF3A 3GJFB 5CJQL 5DI8B 1F4HA 5KZCB 1UM5L 4OD2B 3KGRA 3RL1B 5KS9E 5A16A 2NY4D 1LE5B 2YR3A 1D5IL 3U0TA 1D7FA 1GGCH 1T7XA 1AJ7L 4JPIB 3CXDH 1QFWL 4XCCH 1Y6NR 2YA0A 3RJDA 4EOWL 1J5OL 2GUOA 4JR9L 3BH8A 2UY6A 1XR8B 2AAVA 1NPUA 1A7RL 4YFLF 5I8EA 1JPSL 2PKDA 1IC7L 1OF2B 4JFPA 1F4WL 1HHKA 5EUOA 1T04A 3TBVB 5JXAL 1C5DA 4HXBH 4RZCA 3DX7A 4KY1L 3U9PH 3EKCA 4F15B 4NO5B 5B38G 2V5TA 3ARTA 3GI9L 4P46B 4PJ7F 3S36L 3TA3D 4D0CA 4QT5B 1AXIB 5HYFA 2ZSVA 5LQBL 4LIQL 1G7MA 1ZHKA 1A1OA 3UAJD 4WUUB 2CK2A 2VE6A 1KPUA 4YDKL 4ETYA 5JPNB 2Y36H 3X12A 2PO6A 3WFHB 3QWRD 1KTRL 2VXQL 2DQHL 2IEPA 4HIXL 3AUVA 4KKLC 5C08A 4FMFA 4NYLB 5CD5C 1FZMB 3VRJB 4TNVF 4GW5A 3QUZC 1YECH 3SY0B 1I3GL 3JZ7A 3CSGA 4DKFH 1XMWA 3PHOB 4NOBA 1OM3H 2YS4A 3PHQA 1V05A 2DQEL 2V2WB 3VXNB 4FXLA 3SE9H 1PYWB 4YUEL 3QNZB 3BHBB 1YJDL 4OFYA 3FN0L 3V4PL 2EXWC 2KZ1B 1O5DT 1JNNL 4KGLA 5T1LD 4LMQE 1D5MB 1NCWH 1FNLA 4PRPE 2Q7NA 5CILH 1EV2E 5T1MA 4OKVA 3OBAA 1MCKA 2RHEA 1UB5A 3D9AH 3DLQR 3NMEA 4N0CC 5HVFB 2XKNA 3TC9A 3MRNB 4TSCL 4YHML 3D2UA 3IVKA 5DF0A 3VXQB 5T1DH 1YEDA 5E9DD 5AUMA 1P5UA 3QHFH 1JRHI 4MJ6B 3IFPB 1CF8H 1UWEH 2NNAA 4JKWA 3GB7B 3IXTB 2WBKA 3ZKMC 1MFBH 4RMRA 5L7XH 3BDYH 1KJVB 4WW2F 1N3NA 3ZL4H 4JGJA 4KK6D 5D2NA 2BOCB 1YEEH 5GXBB 3MLTA 1RQ5A 2OM5A 3WLWC 2DICA 4NO0B 3HB3C 3T2QA 1N4XH 1QSEE 1HK6A 5I66A 2WLZA 5IF0B 3BP6A 4I4WA 2K3TA 1TPXC 4KMTH 2JCCF 3Q5TA 3UPCA 2V7HA 1BX2B 1WSST 5HD8D 1UWXH 3MJ9A 4KJPC 1Q9KA 4Z8FL 1CL7H 3PQYB 1OB1A 4GFTB 2C3WA 5IBTL 1UEMA 3UTPE 4C56A 5DJAB 2VXSL 4HEME 3ILQC 2H6PA 2ZUVA 4XNUH 3VXSD 4XP4H 3ZHLA 5DTFB 3U1SL 2N7BA 4LP5A 3WDIA 1AR1D 1P84J 4XNQA 1MCOL 4JPVL 1FCGA 2PYEB 3VWJC 3DI2B 2A6IB 3RIFK 1AE6H 1EGJL 3CMOL 2X1WL 3CVIH 5BZWA 4WFHD 2F5BH 1T5WA 2DI7A 2FH8A 1MJ7L 1V7NH 2DDQL 1D5ZB 1OW0C 2VABA 3S96A 4KI5D 1J1PL 2A0LD 3UPRA 1TZIA 1QLEL 5CZXD 4PREA 5EU6B 2R0KL 3L3GA 5IP4A 4GXUM 3VXMB 5IVZA 3HMXL 2R1XB 2X4OA 2YD4A 4S11A 3IAGC 1X4ZA 1JYWA 1ZVSA 3RWHA 5JO5B 4WTZA 2G9HA 2APFA 3QJHB 2AJYL 5ISZE 1C5CH 2FIKB 2HH0L 4F7MA 2XPGA 2DQDH 3V6OE 2L0DA 1EFQA 1TJIH 4FFVD 4UAOB 5E5MA 1EBAA 3EDKA 5ANMB 2I9LA 2APVA 2R1YA 4EI5D 4BH8B 4DW2L 1RPQA 3RWDB 2ESVA 4ETQA 1ZS8B 4U4BA 1BPVA 2DQTH 2I5YH 2MMXA 4ODHL 1BHGA 1NDGB 4XP1L 5JXEC 5I8KL 1OTSC 3HLAB 1U92B 5HHNA 5J6HA 2MQCA 4RWYH 4LEOA 5KZCD 5JR1H 1ZSDB 3DURB 1TNNA 5DQ9A 2J6EL 2XY2A 1X6NA 3HFMH 4YEFA 1JZ7A 3WXWL 3CDFA 3L3DA 2BNQA 5FK9B 1EAJA 1LEKB 4CMMB 5IV2B 4DKEH 2CKBA 3E6HA 1OTTD 3LDBC 1GC1H 4P5TB 4HCRA 5HGBA 3GSNA 4GRWH 5JW4N 4FQQA 3FT2A 4DKAA 2IH3B 4DOHE 1EUUA 5ACZB 4Z7UB 3U83A 2AEQL 2DQJH 2OTUA 2MQ0A 1JTTA 3MNZB 4MZ2A 2VAAA 1WQVT 1HKLH 2MJWA 5HGAA 4P46D 1VGKA 5I75B 1KT2A 4HGMA 5GGVH 2X70A 3FO0H 3JBG7 4MCYB 1N5AA 4PB0H 5GGTL 4K07A 1EH9A 3I2CL 4WUUD 1Z9OA 3IDJA 1IC1A 3VG9B 4WV1C 3O45B 3RAJH 4JY4B 4EDXA 4CVZB 5I0ZA 2V17H 3SN6N 4N68A 2MHAB 4FQ2L 4UIKL 3WFDH 4OLWL 3QIWC 1QR4A 2O5XL 1FAKT 4R7NA 2A77L 3MLVH 1SM3L 3RX5A 5IROC 4DN3L 5KN5B 5C9JA 3HI6L 3KHQA 4PJCE 4LNVA 4U1KA 4GAYB 1FIGH 5T3XH 1QBLH 4HV8A 4OB5H 1GHFH 2VDML 3QEQD 5L8JB 3IJHA 3E3QE 8FABB 1KENH 1DUZA 2W65A 5A43C 3NIFF 4I77L 5C3TA 1G9EA 3MBXH 5C0BA 2B1HH 5L2KE 1CDHA 1DCLA 4GAGL 4QGYA 1BVKA 1RUPH 3BP4B 1VEMA 3RVUD 4GAFB 5HDLA 3NPSB 3V52L 4IOSD 2AV1B 5F3BB 2X4UB 3GNML 5D1XC 3CCHB 1Y6MR 1IM3B 2V7NA 2FSEB 5DUBB 2QSTA 4Z7WB 4GXUN 2DWDA 2VISB 1T3FA 2XWJA 2R4SL 4KTYA 3CIQA 3KXFA 5FYJE 2RCSL 5GSVB 3WNKA 4XPHL 5K59E 4FS0A 4HIIB 4K8RC 1ZGLP 5TQ0H 1LQSR 4C59B 1UA6L 3MGAA 4G9FB 1IEAB 4RBPH 1HHGB 1ZT4B 3RUGE 3ELAT 4ZS7H 3GK8L 5J1SC 5FHBL 4ZUVB 2VWEC 3K2UH 5EFIA 4P57B 2BNUB 3GFUA 5JZ7D 2G2RA 4HWBH 2EE3A 2IMNA 5FO9A 2AKRA 1NANH 3PNWB 1FVDA 4MAYB 4NKQB 4DFIA 4NO0D 4K9EH 2EDTA 4MNGA 5E9DE 4PTTB 5IVXF 1PEZA 2LABA 3BT2H 4HW6A 1QACA 2FEEL 1QG3A 4DN4H 1MAJA 2BVQB 4WV1B 2D4FA 3U46B 2AJXL 3HG1A 1I7TA 3PQYD 4WW1B 5CUSH 1ZWIA 3QIWB 1MLBB 1SYVB 2IBGA 2IANA 1G9MH 3MRJA 5A2LH 4OLXL 4QRUA 3MACL 1Z9MA 5IB2B 2FX8H 5INCA 5H2BB 1VDGA 2P8LB 2DIJA 1CU4L 4WU7B 1LO0H 3MGTB 4PJGE 4JHAL 5CAYB 1KN4H 1K5NB 3MXWH 4PJ7B 1X5HA 4HD9A 3C9NB 4R26L 1L4IA 3P9WB 2PYED 4ZXBA 4U1MA 1U0QA 2VDOL 3AY4C 1HILB 5IW3A 1ZGLM 5HI5C 4MDIA 3CFBB 3QPXH 1SVZA 2UZIH 2OX5A 3BWAA 3QZWA 5DVLA 3V8CA 4YHPB 3DTXA 5E94A 3BGMB 5DRWB 3BAEH 4I48B 3BRDA 5EU6D 1LVEA 4PGEB 5D1XB 1WFTA 3QEHA 4L5FL 5D2LF 3VXMD 2HTKC 1PX4A 3GJFH 2Q76A 5LKNA 3O3DB 5I1HH 3RWJA 5JQ6H 2P49B 1K4CA 1UH4A 3L5WB 2N7AA 3VFRB 5EZOH 5EU3B 3V9FA 3OJDB 4U1SB 5E1AB 4WU5B 2QLVB 1FZJA 4WFHE 4F8QA 2Q86A 4I0KA 4Z77B 3OKNA 4AQOA 4KI5E 5E2WH 4BK4A 3NFPA 2A38A 4P5KB 2ICEB 4R2GB 5H35A 3QEUA 4NRXB 2XQYK 3WLWD 3V0VA 1SBSL 5C0NC 5GRWA 3SOBL 2F74B 5IBUB 4DAGL 4S1QL 1JPFB 1CG9A 3DYMA 4UINH 4OKDA 3UTSB 5DJ0A 1EEUA 3W11D 1PJ9A 2X4RA 5J1TC 4KRLB 1GXEA 3BMWA 5MEOB 4MS8D 1M05A 5AYUL 1LNUB 4P2QB 1HOCA 4EJ1C 4G6FB 4C4KO 5FM8A 4P5TD 1UM5H 3MQIA 3JV4A 2AJZB 5E8DL 2AK4B 2FJFA 4WW2B 5GGUB 4XWOD 1IGYA 1QFWH 4EOWH 1J5OH 4KZDH 3FO9B 3IFNH 1ODAA 4NQED 4HAFA 2IQ9H 4BZ1L 4Y8AA 1EJOH 1FFOB 3NABL 3ARFC 3IKCB 1F4WH 3PJSA 1UH2A 3BIAX 2H32A 5JXAH 1DANT 2JCCB 4KY1H 5I16B 4ELME 3MZTA 3K4DA 1M7IA 4LKCA 1G7QB 5IBLC 2LU7A 3VD5A 4FQXC 3BKMH 4IRZL 4HPOH 5SX4H 5LQBH 5E4IA 4X9HA 3O3BA 2YKLL 3FTGB 5KSBA 1BF8A 4H25B 2G75A 1R5WB 3BGFC 1OP3H 5IVNA 5E2TL 2YA2A 4KROB 4M8QB 4MCZB 2Z0BA 4J4PC 5FA4B 2IADA 3RWEB 2VXQH 4HIXH 1CFSA 1SJEB 2ZG3A 4PJXA 3MXVH 4Z18A 3VXPB 4GBXA 2VITA 1IEBB 4QRPE 1I3GH 4JQVC 1JUFB 3VFOB 2VQ1A 3BZEA 4K3GA 4PP1C 1FV1A 3RZCC 4LCYA 2DQEH 4I2XB 2AEPH 1S7QB 4NQVA 1OTSD 5DFVC 3P9LB 3BX7C 3BRFA 1WTLA 1QFUH 4HG4K 1JNNH 4RRPA 2QQNL 4WWKB 3KPRA 2X4SA 3QEQE 1VB9A 1KJ3L 3FB7A 2CGRL 2H1PH 2P8PB 4G9FD 2O5YH 5E8NB 2R2BA 3TO4C 2UYLB 1A6UH 3QO0B 1A7PH 5IMKB 3VMOA 1L7TH 1J8KA 2Q7YA 5GIRB 1T0MA 4JO4L 1W0WB 5F6IC 4LIQE 1TJHL 3TT1L 3RTQA 3BQUA 4MAYD 3QIUB 1NMCB 2L7UA 3DRTA 1BM3H 3QDGA 2W0LA 3ARFB 1XF4B 3LN4B 2RFXA 4G9DB 5TE4L 2ATPB 3QDMB 3QCVL 2OR7A 2FBOJ 4FQXB 1LO5A 4Z0BL 3IFOB 1EUTA 4NQSB 3MA9H 3BIKA 2ZCKL 1A6AA 3KPOB 3LS5H 1OWRM 4PJ5B 1IM9A 1WWWX 1DQJB 3W0WA 1CFTB 1FO0H 3O11B 3PV7A 3SQOH 4I0PA 2HTLC 2AXGB 1SJXA 3MMEA 4U33A 5DEFA 1MCSA 5GGQH 4P4RA 5DR5H 4FZEH 1I85C 3ARSA 1PKQB 3PQYE 4KRMB 1DQQB 2FECI 1URLA 3LEYH 2OR9H 5FDWB 3W2DL 3PABA 3GIZL 1UM6H 2I9TA 3DWTA 4FN0A 5IB5A 4YBLC 3T2PA 1TLKA 1OCWL 3TH3T 3UO1L 3HPLB 3SQBA 1LO4L 3ALWA 1PSKH 1J1PH 1WZKA 2J1KA 1D3CA 1MSPA 3TO4B 5EBWA 1HXMA 1VHPA 3SPVB 3HMXH 3CSYA 3DJ9A 1WBYB 1E4JA 1J0JA 2EE6A 3MJ7B 4GAJL 3TZVA 4BFGA 2NY3C 3FT3A 2NW2A 1FNFA 5F1IA 4R2GD 5CBEB 1X5IA 4RGOL 3IDMA 2D03H 3MLSL 1DUYB 4M4RA 1ACYL 2DJUA 4ONFL 4LRIA 3ZKND 4YXHL 4OV5A 1U42A 2YMXH 1B3JA 1EVTC 4NGHL 3UTSD 3T4YB 1Q9WA 3WXVH 4WTZG 5LWYH 1KJMB 5B39A 3RWFB 4MVBC 5D9SA 5FUZH 1GZQA 4XP1H 4JKMA 4P2QD 4F37K 1QFOA 5I8KH 2JE8A 1P4IL 4NKMA 4G6FD 1T5XA 3RHWF 3OKKA 1CR9L 3VXUA 1N6UA 4NOFA 4OZFH 5CHNA 4L8BB 2AK4D 4LCWA 3DSNA 4WO4A 1BD2B 4PRBB 5DHVH 3X17A 3WXWH 5ITFB 3BN9C 1VFAB 4WTXA 1U8JB 2C1PB 5DSCA 2V9QA 3MRBA 3DIFB 3RVVC 2WWKT 4D9LL 5IVXB 1DQLL 1U3JA 3NCEB 4X99A 5DJXA 2WUBL 2AEQH 1QP1A 1AY1L 4HUNB 3T0XA 4HFWB 4M9OA 5FOBA 1YQ2A 4KTEL 3OR7A 4W4OC 4YBLB 4PJEA 4P3CH 5E7BA 4XAWL 2HTKD 1UB6B 3FZUC 5GGTH 3S4SA 4P2RD 4ZDHA 1YNTA 3QYCA 5MP6L 2X4TB 3MO1B 2KKQA 4KJWD 4NQEE 1FVEA 4KROD 5D7SH 5E2UL 5JDJA 5GGRY 1EHLL 1YMMA 2WWMD 4V2BA 1RIHL 3AMKA 4FQ2H 3NZHH 1K4DB 3VRIA 3ZT6A 4OLWH 1NC4A 3EYOA 3NCJH 3MRMA 5C3LD 4X4YB 2A77H 3NGBC 4DN3H 5EIQA 2NY3B 3HI6H 4ZD3L 5BRZA 3JTTA 3ZDXE 4FG6C 3GSUA 3LKQB 4J12A 4LSRH 5C07B 2VDMH 2Q8BH 3EO1B 4XPTH 3SJVA 4RNRB 4I77H 4G5ZL 5D2LB 5CP7B 1FL3B 4O2CA 1T66C 4GAGH 4MJIB 5C71A 4GMSH 4WWKD 2B20A 2UWEF 4MNQA 3K1KC 1F3DH 4C83B 5DJCA 1FYHB 4A2MA 3FQUB 4P23A 3V52H 4JFXB 3H9SB 3PL6A 4QNPF 5FA3A 1U6AH 1W72L 1V3MA 4LLUA 4F7CB 4HJ0C 3CNKA 3DMMA 2WBJA 5LAXB 2C3HA 2RCSH 4YLQT 3KWWB 1MJ8H 3F7YB 4M1GH 5F97E 1BQHB 1SVCP 2Q20A 5HYQB 3PGDB 3EOBB 1UA6H 1HSBB 4Z7WE 3QBTB 2G60L 4OFDA 4HBCL 4PRIB 3QIUD 1BFTA 3SE4C 5KW9H 3X14A 1EHAA 4O51A 3ARFD 1AKJA 1A7QL 4G9FE 5DJ2A 5IWLA 3QWQB 3T4AA 3HMWH 4W6YB 4WFFD 4ORGA 3QDMD 1MWAL 5I1DB 4FQXD 3RWGB 4LGSB 2FD6H 2Z31B 1BFOA 4WDIA 4PJ5D 3VU2A 1T83C 4X8JA 1G7LB 5KVEL 3VI4E 1YMHA 4PRAA 4J4PD 2ARWA 4K8RH 2AJXH 4XXDA 4EXKA 4YGVA 3N85H 3NAAL 1W72B 1MI5B 4YFDB 4L29A 5TPWL 3DX6B 2J8UA 3HE7C 5E7FA 1CICC 4XGZB 2R4RH 1OSPH 2Z35A 4EXPX 3MACH 1OSZB 4QHKJ 1T2JA 4AT6A 1CL7I 1CU4H 2HLFC 2VYRE 4XBPB 3ULVC 4PJ8C 1RZFH 3NH7H 2Z8WC 1GZPA 2ZG1A 5FECA 5JA8B 3SDAC 1RIUH 2VDOH 1ITCA 1UZ6E 4P9HL 1NMAL 3CX5J 2E7CA 2ZUYA 4QEGA 1MWAB 3V5HB 3U30C 1IKNA 3B9EA 3P3YA 3WIHA 3ARGA 3P9MB 2PCPA 5DZLA 4L5FH 5FYJU 2ZOLB 5KSAC 1KPVB 1YY9C 4G8IA 4KRPB 1MCRA 3TCLB 5ICZB 3QZWG 4G3YL 4J3WA 4JG0L 1MAML 4L3CB 2NLJB 4FTVA 4HUUB 3GO1L 3ECBB 4CU6A 3MX0A 1UG9A 1RHHA 2E9BA 1JWSB 5BW7C 4KQ4H 2PYFB 3T0AA 1CE6B 3GSQB 4IOIA 2ZUSA 2DYPA 3QUYC 3LIZL 1CD9B 3QXDB 2NX5A 5DRZA 4AH2A 1KCKA 2NY6B 1SBSH 1EEQA 3OF6D 4AIOA 2HFTA 5EZJB 4F2MA 1GRWA 4S1QH 1MRCH 1WEJL 2WV3A 4BZYA 3M17B 3OJVC 3OAYH 2IAMC 3GBMH 1BD2D 3RQ3A 1JIBA 1IE5A 1IILE 3MRCB 1F90L 3VGFA 2FLBT 3BN3B 1LDPH 2AXFB 2R0ZL 3UTSE 3T0BA 4NPYB 3RVWD 5IB3B 1RJLB 4LARL 3B43A 1CICB 3S3SA 5JMOC 1TDQA 5KG9A 4AL8H 1I1CA 4Z5RB 3SDXA 3TN0D 1FL6B 1GL4B 4GQ9L 2F19H 1FORL 3TLRA 3IETB 5EPMA 5IW1B 1KC5L 4MA3B 3OKMB 4PJ8B 3BUYB 3EYFA 1CD1A 1ZV5A 3RIFF 4S10A 5F7MC 2FYYA 4BZ1H 1GYAA 3GMMA 2ZOKB 3MV9E 2PO6C 4V2CB 1OPGL 4H26A 4EUPG 5C0FA 1QEWA 1HHHA 2FJHB 1AI1L 3X3FH 1J87A 1U8HA 1UXWB 1XGYH 1TQCB 3MRQB 5KSAB 3KPSA 4JO2L 2O61B 2JB5L 4R90L 4ZUSA 4YIQB 3C5SB 5K9KB 1QFWM 3I02B 1P7KA 4P2RE 3C09B 5C07D 4N9GA 4A6YA 4JDVB 3NIGF 3FB5B 4MJID 1K9TA 1R3HA 2NXZB 2KUTA 3SO3B 2Z9TA 5EOCL 1JGUL 5EBMA 3MLZL 1Y18B 3MBEA 2CK0H 4X6CA 3BPCA 2HFGL 3H9SD 2BVYA 1RUKL 3SKNB 2GUOB 4M1DH 2CLVA 2QQNH 4ZMAT 3L3KA 1A21A 4V1DA 1XGUB 3LRHA 3MOBL 4MD5B 3ZE0E 2CGRH 3AU1A 1XT5A 3GRWA 4HUKB 3V0WL 3ALPA 5CIPA 1HHKB 1R3LA 4F3FA 3KG5A 1T04B 3C5ZA 4XPGL 3BOVA 5D2NC 4PRID 4RZCB 4I5BA 4XMKH 4N0UB 2GIYA 3BW9B 3ORJA 4HLJA 3EHBD 4OGAD 4RRPG 1UKSA 2FEDC 2GYSA 4D0CB 3CFEA 5IGXL 2ZSVB 4P9MH 5DVMA 1P53A 1VKXA 2HT2D 1ZHKB 1NGYB 1A1OB 1K85A 1NFDA 4R4FH 3SE3C 2VE6B 1FSKB 5HI4C 1KPUB 2BY3A 1VFMA 1JZ2A 3G6JA 4S2SA 2Z31D 5I19H 2PO6B 5K9JH 3GM8A 4HWNA 1MFAL 5FUCC 3FQRB 5C08B 3W5NA 2LTQC 5FHAH 2LU4A 2R39A 5EORH 4QHUB 3LKNA 4Z0BH 3MOQA 4MXWL 3P0YH 3MCLH 1IGIL 3PWUB 4WFFE 3B9KA 1WGOA 5TJWK 1IT9L 1MI5D 2ZCKH 6FABL 1RUMH 1BREA 2BOBA 2BRQA 3ZT5A 2V5RA 1NAMH 1CDBA 2D7PA 4WHTA 5DK0A 2WANA 3X3GL 2E7HA 1YEKH 3PUCA 1NGPL 4J8RA 4JFZL 3I6LE 3QQ3A 2Y7QA 4WFGD 1G7PA 5T1MB 3TO2B 3BUTA 3MJ9L 1G7JA 3TBWB 4PJHA 1XZ0A 2AJUH 1G7IB 2HRLA 1UB5B 1H9VA 4CU8A 1WWCA 3QFDB 1JGEA 1LEGA 3WEXA 1FLRH 3IVKB 3THML 4W6WB 1PKQE 1OCWH 3UO1H 1YEDB 4PY8I 2EIEA 5AUMB 3WD5L 2XTJD 2RGSA 5IEHA 4YHLL 1MCNA 1VADA 4I1NB 2NNAB 1OVZA 5BS0A 4KRPD 5D5ME 4NQXA 2P44B 4BSVA 5A2KH 3ULSB 4FQJL 2Q87A 3CFKA 1HEZB 3CPLA 5F9WC 5EC2A 4QHMA 3B5TA 2ZG2A 4D3CH 1DEEB 1XH3A 3DVNA 3U4AA 1WAAA 2UWEB 1UKQA 3DXAA 3FMGL 3QUXB 2NY1C 3EJYC 3MLSH 3BP6B 2NY6D 4I4WB 2V7HB 5K33A 4E41E 4P2YA 3V6FA 4U6YA 2VLRA 4OCYH 4LLDA 1KELL 1Q9KB 3MUY1 2HYMA 3O4OC 3OKDA 1OB1B 4MWFA 5IQ7H 2LTQB 3G5VB 5KSBF 5DD1H 2HJLB 1P4IH 1P4LB 2H6PB 4ZTOL 1JZ6A 3G08B 1BJMA 5IW6A 1CICD 4JFEA 2MKLC 4OTXH 4YDLC 2FO4A 4PJXF 2DL9A 4XNQB 4TSBH 5B39G 2EO9A 2R0LL 2V6HA 1RAMA 4RQQA 5E6IA 4PB9H 3STZB 2IPUK 4D9RD 4NJAL 4I9WE 5HDOA 1T5WB 3UTTA 4XP5L 4D9LH 3ZTNL 3S96B 1DQLH 3JWNC 3S3PA 3UPRB 1QFWI 3ARXA 4MDJA 1TZIB 1JNHB 4PREB 1KPRB 4JDTL 3L3GB 3OR6A 1AY1H 5IVZB 5DS8A 2CKBL 3QQ4A 1IQDA 1JTOA 1ZVYA 5KJRL 4HCRL 1JV5A 1ZVSB 3GSNL 3RWHB 1ITBB 1JPGA 1RURH 4WY7L 1TQBC 5KSAD 2H41A 1YY9D 4F7MB 2ITCA 2XPGB 3I50L 3VW3L 1FZOA 4M5YH 2KL6A 5DA0B 4BELD 2HWZL 5D7KD 1EHLH 5E5MB 2R2EA 1RIHH 5KBNC 2R1YB 4GG8A 4ETQB 4RDQG 3BVNB 5C0DA 3S4SG 4H20H 5LG1A 4OD1H 2QSCL 4PRHB 2P43B 2NXZD 3RA7H 4XNZC 1NCCH 4U0QB 1YN7A 2VDNH 1A7NL 3V6ZB 5J6HB 4LEOB 4HH8A 3OB0H 5ID1B 5TF0A 4G5ZH 2D9QB 5AWNH 2BNQB 3GSOB 5C07E 2ZKHL 3QT2A 2CKBB 3E6HB 1ZLWH 3O0RL 5HGBB 3FQWB 1IC5L 3K46A 4QHNA 4LLMB 2P7TA 4XHJD 5KS9A 1DL7L 4PLKD 4JHBA 4LLWB 4S1DC 2OTUB 4NN7C 5E03A 2VAAB 5TDNA 5F7FA 4S1RL 5HGAB 4YPJA 5ADPL 2E27H 3BSZL 4X5XA 4KK5C 4U1IA 2WQRA 1N5AB 1QFHA 2AQ2A 2NW3A 2H3NA 4XBGA 2IPTL 3LH2L 3O2DA 4JDZA 4EEEA 1S9VA 1RZJC 3NTCH 1FNEB 5E0QA 3IS0X 1UZ8A 2NY2C 5GS3A 3R8BB 1DANU 9CGTA 3BWUC 2BSSA 1A7QH 4K3JH 2NR6C 2ENSA 4DCQA 3CFDB 3C5JB 4PRIE 5C08D 1INEL 1SHMA 3KVQA 2MCPL 5IEKB 1BLNA 5AZ2H 4KVNH 2ED7A 4H88L 1U8KA 1I3UA 4YDJA 1KTDA 1BEYL 3WHE1 4DZBB 1TQBB 3G6DL 2M26A 4YAQB 5FDYA 4U1KB 4Z6AT 4X6EA 5F7EL 4HV8B 3HC3H 1ED3B 4UUJA 4BKLA 3IJHB 4U6XA 5KVEH 1NLDL 5J3HD 3QEGL 3MROA 2W65B 4OFYD 3O81A 4YX2H 4GLRH 2ZP0T 1YYMH 1RZJL 3MV7B 3OB8A 3PXHA 3NAAH 5HPMB 2OL3A 1VEOA 2DL2A 1G1YA 1I1YA 5B8CB 4XNZB 4UTBH 4LSSL 4O2FA 2VH5L 3JV6A 2G5BA 4X6DE 5DUPH 2X41A 1MI5E 1U8MA 2V7NB 2PW2B 4X80L 2DWDB 1T3FB 2XWJB 5F1NA 4H0HB 4XWGL 5AZEL 1QO3A 2DM2A 1DBML 1F00I 3DX9B 3B8SA 1U3YA 2BHUA 4PRPA 1AQKL 1KLUB 3L6FA 3DUSA 2YD8A 2IG2H 5CFHA 3BRGC 2Y07H 2DN7A 2Y06L 5GPRA 3ZE2F 2X4QB 4W6XB 4FMKA 1U3HC 1LGVA 4NN7B 2X2YA 4DGVL 2AKRB 1X4XA 2DQUH 1SY6H 4OM1H 2WIMA 3U9UA 1QVOB 2D0GA 2XTJE 1QZ1A 3QUXD 1MAMH 3HRZA 2CLZB 5F7YC 2AQ3A 3QI9B 3ULVH 5FYLD 2NY2B 2AJSH 5JUEL 1IZJA 3TBTB 4C57C 5L2JA 3SKOB 3PHSA 2GITA 5BVPL 3HG1B 1QBML 1I7TB 4RDQF 1QSEA 4JZJA 3RI5K 4DK3A 4E5XA 2VKXA 4RMTA 2W0KA 2IANB 1LEIA 1CDGA 3MRJB 3VDAA 3H9HA 3I3DA 1OP5H 1V7MH 1BGXL 2CR6A 2VDKL 2B4CL 2X7LA 3BJ91 3MRDA 2AW2A 1J0ZA 4WI3A 2ED9A 5I30L 5I73B 3WKMH 4ZXBB 4U1MB 2JB6A 3O41A 4R4BA 1KBGL 2F8XC 4JM4L 4MDIB 2BK8A 1DVFA 1B0RA 3BWAB 3QZWB 4IMLA 5C1MB 4LHUA 3NCYP 3DTXB 5E94B 1Z6JT 3OZ9L 4GQ9H 1FORH 3DI3B 1T89A 3QEHB 3MRKB 2QJDA 2Q76B 1KC5H 1T22A 1N59B 1S7UA 3D3VB 1JPTL 4BUGA 3MUHL 2AABL 5B4MC 2ILLA 3L3HA 1HCVA 4YO0B 2DQCL 1FFRA 4D9RE 1PD6A 1XF2B 3V7MA 2Q86B 5T3XE 1KXVC 4QKXB 5CZKA 2EIDA 1AI1H 3NFPB 2BMKA 4GBXC 5LGJA 3WE6B 5I1EL 1QSZA 5EWIL 1ZLVH 4Z7OE 2X1XR 4XTRC 3ZMRA 5BZDA 3P11L 2VTFA 4JE4B 3STBA 5ISZA 2JB5H 3MCG1 1S7VB 4PRHD 4R90H 4NDMA 4HS6B 4U05A 3ROOA 3V0VB 3WKNA 3V6OA 3EJYD 1SJHA 4TPRL 1WVZA 3ULUF 3AS2A 2X4RB 5TE6H 1OAYL 4ONHA 2CIKB 1IGCH 2BNQD 3R8QA 5LGKA 4Z7QE 1HOCB 1I4FA 4X6FB 5GHWL 2R29L 2HT3C 1RULL 1NEZA 4F37F 5I6XB 4KKBD 5FCUL 2OMNA 4JO1L 1MHPL 4I3RL 4M7LL 3HNSL 2FJFB 4XC1H 1IGYB 4CAGA 1RUKH 4H5SA 3WNOA 3BQUC 4UDTA 3M45A 1LD9A 3FQTA 1A1NA 4JG1L 2XG5A 2J8UF 4U6VH 4P2OA 5C0IA 4NCC2 2ZCLL 2H8PB 4XPGH 2H32B 1PX3A 3P30L 4JCLA 4YFLI 3H3KA 5IFAL 4RAVB 3DO7A 1M7IB 2X9XA 2DM7A 3H2WA 1G6VK 1D5BA 5IGXH 1XF5B 4LSUL 3P4LA 3O3BB 1LHZA 4N0UE 2CDGA 3IU3B 4GXVL 5KSBB 5GGRB 5HHXH 2YC1B 1Z0NA 3WSQL 4LPVA 3HC0B 1FBIL 5EUKA 4F57H 5KSUA 2IADB 3VGDA 3F7RA 4NKDA 1DBAH 1UWGL 4PJXB 2VITB 3IDIB 1IGIH 3TA3A 4M8VA 4L8CA 3NFNA 5D1ZB 3MV7D 1NBYA 3ZYIA 2VQ1B 3NA9L 4PJCA 4D8PA 1FV1B 2XNAB 4LCYB 4LAJH 2M8XA 1PFCA 4NQVB 1ETZA 2VXVL 4DTGL 3MOAH 3I9GH 3CSBA 4RX4D 3QWRA 5L2KA 2X4SB 1NGPH 4OSUL 1KIQA 5IESL 1OAQH 5AD0B 4JAMB 1HN1A 3MGOA 3FB7B 1IKFH 1A47A 2R2BB 3MV01 4K2UL 4K71C 5HDBE 3W39A 1RUQH 1T0MB 3THMH 4H1LB 3TZVC 4S1DD 3WD5H 3RTQB 4M61A 1JHKL 1TZGL 4YHLH 3BQUB 5I1GH 2XXCB 4XBEL 4M93B 3ARBA 1FN4A 2ICWA 3CLEL 3T77B 4YC2C 3RUGA 3DRTB 1RJYB 3QDGB 4JFQA 5K93A 4K3EH 3ZHKA 4RMQA 5F3HA 2BNRE 3SDXF 4MX7A 2RFXB 4NUJA 3DV4A 3QI9D 3IJYA 2NY2D 2YUVA 4K7PX 2X42A 5C0AE 2X89A 3RNKA 2QR0B 1I8IA 4LL9A 3CZFA 4AENA 1L9NA 1LO5B 1OGAE 3HG1D 4CNIA 2FL5A 5E9DA 1NUGA 4JM2F 1Y0LA 4WGVB 5DZOA 1SBBA 2DTSA 4WO4C 2UWEE 3E2HC 3FN9A 1KTKE 1JHTB 4HZAA 3QB7C 5FYLE 3MJ6A 4I0PB 1J05A 1L0YA 4Q0XH 3SKMB 4LPWA 3S34H 4ZXBD 4P4RB 3GSRB 5I1IL 2OP4L 4ZTOH 1A1MA 4LRNH 4JQIL 4DUWA 1JMZA 2VOTA 2I9TB 2GAZA 4PBXA 4PJGA 5MHSE 5IB5B 2R0LH 3D25B 4WEBH 5F7HA 3BD5A 1QKZH 4XI5C 4KDWA 3PP4L 4MQTB 3D3VD 3ZTNH 3UJTL 4E0RB 1RMFL 1CGXA 1LP9E 1O0VA 4X6CF 5GS0L 3RY4A 4JDTH 5EBWB 1HXMB 4K71B 5DJDB 4HF5H 4AZ8A 1YN6A 4P4KA 4X4ME 3HNTH 3SCMA 3CSYB 3GSNH 4D0DA 4TVPD 3FT3B 3OX8B 4F9PA 4XNXL 1C12A 2L4OA 3QUMA 3LD8C 2CXGA 2LVCA 5JA9A 4YC2B 2HG5A 2HWZH 3AB0C 4NBZB 4CADA 5KOMC 1BZ9A 1KV3A 4ZFFA 1Q9WB 3W81A 1H3UA 1U8IA 4G6AC 2EIZA 1NFDF 2QHLA 4XCYB 4P23C 4NKMB 2VDLL 4L4TE 3PL6C 1A7NH 3VXUB 4XB7A 1MFDH 2W60B 4TSAH 2CRIA 4PRHE 1BBJA 3HTLX 4WO4B 3DMMC 2WBJC 4PY8J 5F89A 4X7TA 2R69L 3BKCL 4NKIL 4EI5A 4YPGB 1NBZA 1N5YL 2ZKHH 4UOW1 5DSCB 5T3ZD 3MRBB 2BDNL 5E08H 4KJYA 1I9IL 2XA8H 1RZIA 2H26B 1IC5H 5FGBC 4HKBA 5DJXB 3U2SA 5IWLC 3GMQB 2YHGA 3ULUC 2E7LA 5EIVA 3RJQB 5C2BH 1ZA6A 5E2JA 5DI8A 1EMTL 4QWWC 2E9WA 5FOBB 3BSZH 3OR7B 4QXUH 3RL1A 4RISH 5BJTA 2WNGA 4YH6A 4I13B 2EDBA 1L6ZA 4EBQL 2IPTH 4DQOH 4ZDHB 5JIIA 5C6PB 4OCRH 2VR5A 4PJHF 4MA7L 3MLXL 2EKJA 4POZC 1FVEB 3CU1A 4ELMA 1YMMB 1YC8A 2ZCHH 1OF2A 3KNBB 1CFNA 3ZO0A 5DD0L 1NC4B 3EFDL 5TFSL 3S36X 3O3AB 4G6ML 4YHOH 4P46A 1IAOB 5D1ZD 3G6DH 2KZWA 3JTTB 3U7WL 3GSUB 4P59H 3ULUL 4O2EA 4PP2A 3SJVB 5JPNA 5JW5B 4OIIL 4DGYH 5GRZA 4QRPA 1RZJH 1WAAF 1MF2L 3RDTA 1JZ5A 4MNQB 1Q9OB 3V5KB 3QDHA 1NBVH 1IKNC 1FZMA 3VRJA 4P23B 3ARGC 3MV7E 3B2VH 1OAXL 3PXJA 2IGFL 4ZQKB 4LLUB 5IJKC 3DMMB 2Q1EA 2V2WA 2WBJB 3QEQA 4XWGH 1K2DB 3CUPA 1PYWA 4MD4A 3TESA 3BHBA 1DBMH 3M8OL 2IPUG 3RTQD 1AQKH 1E4WH 5ESQA 5HYJB 3BQUD 4JY5L 1RJCA 4UV7H 4LQFH 2GTWB 3VWKA 4JKPH 4X8XA 3QDGD 3WJLA 3X14B 2EXYD 4O51B 1T7YA 4HMDA 3T04D 5JOPD 2EECA 3BPOB 2IQAA 1EX0A 1BIHA 1MY7A 5CJXA 3RZWA 4IJ3B 1HHJA 3VG0L 1A5FH 1ZTXH 3MRNA 3WIHL 3QXUA 2FGWL 2FIRT 4IHOA 1A8JH 3NIGE 4NM8H 1BFOB 4MJ6A 3IFPA 4YBQC 4OCXL 3K0WA 4WDIB 3NOIA 2GJJA 1CDUA 3C08L 3GB7A 3ZKXB 3IXTA 5HVWA 1YEGL 1YMHB 2VR9A 1AO7E 3INUH 5BVPH 3GDBA 4XXDB 2AI0L 1PLGH 3MRPB 4D2NA 5HHMB 4I0PD 4YGVB 1KN2L 1KLFA 1OY3B 4UQ3B 1IGJA 3KLAA 4L29B 2J8UB 5GRJL 1TXKA 3IS1X 3EYUH 2Z35B 1R6VA 1A14H 4NO0A 1X5LA 2C7UA 1BGXH 2ENYA 4HK3J 1YY8A 4AT6B 5IHZA 3T3MF 4X0KB 2VDKH 4IS6A 5T1KD 4NNXA 4JZNA 3AC0A 3R0MA 1GZPB 3FRUB 5FECB 1KFAL 3QIBC 4KV5F 1CT8A 1JNLL 4NJ9H 3MTRA 1KBGH 4JM4H 3PQYA 3Q6FB 3BD4A 3UZEA 3FHQA 1S3KH 1WK0A 4K7PY 3ARGB 4Y2OA 2PCPB 3UCRA 2BVUA 2PUQT 1S9XA 4F80A 5BV7C 4G8IB 1I9JL 4EUPH 5D8JL 4NNYA 4LHUG 5AAWA 2HMID 4Y4HD 3VE0B 5FB8A 3D3VE 3FOMA 5SWZB 4R4NC 1TTGA 3N0PB 5LGHH 1RHHB 1HYSC 2B1AL 4IOIB 2XN9E 2LU3A 2V2XB 5D72H 2H32H 5DRZB 5I9QB 4AH2B 4LU5L 3UJIL 1T6VN 3MBEC 4UTAH 3KLDA 2GY5A 4TVPE 3VGBA 5JO5A 4PTUA 4IDJH 2BC4B 3VXUD 3QJHA 3I6GB 3LB6D 4ORZC 4WO4D 2WP3T 1OAYH 2AS5M 3GHEL 1U8LA 3MRRB 5GS0D 1CN4A 2EEBA 5GHWH 3NCMA 3RWDA 2V5YA 1J1XL 3C5ZC 1ZS8A 3KPPA 5JHLL 4A6YL 3HZYA 1MHPH 4I3RH 5KG9B 3HNSH 4ODVH 4LQ1A 3SDXB 1NDGA 1BFSA 5HDQL 3L9RB 1QQDB 4XHQA 1U92A 5EPMB 4YHKL 1RJZA 25C8H 1BBDL 3NPZB 1CD1B 3DURA 2Y1VA 1A6PA 2FYYB 1NEZG 1Y6KR 2ZCLH 4JM2B 4XI5D 5T3ZE 4GS7C 4OFPA 1LEKA 4CMMA 3KAAA 4H26B 1FH5L 3P30H 4PGBA 1VCAA 2EYTB 5IFAH 1QEWB 5EBLA 1HHHB 1YMMD 2DLGA 4LSUH 2IH3A 5ACZA 3GRWL 8CGTA 1U8HB 3B9KC 1NC4D 2VMFA 3KPSB 4GXVH 3MNZA 4GKZB 4KTDL 2NZ9D 4NQEA 1G6RA 1V3KA 3CH8A 2Y23A 4TN9A 5EZIL 3BKJL 4N1HB 2EH8L 4CDGC 4HGWB 5C6WH 5DJYB 4NN5C 3IRPX 3SJVD 4A6YB 2VUYA 1UYWL 2VZUA 3O45A 1IAIL 1R3HB 2MHAA 3NA9H 4MNQD 5EBMB 4TNVK 1GPOL 4OCWH 3MBEB 4HFUL 5BXFB 5CEYA 4X6CB 3PGFL 2J5LC 4GLRI 3KPNB 4KVCL 3O6FD 2VXVH 5I1CL 4PYHA 4I3GA 1R3KA 4GAYA 1A4JA 1S8DA 2CLVB 1CZ8H 3CFIC 1NMBL 4OSUH 3HC4H 4V1DB 3DMMD 2WBJD 4RGNC 1NCAL 2A83B 2E8ZA 5TE7H 3HUJE 5DJZA 1UC6A 2K1MA 4Y2DA 5HYJD 3IDGB 3IU4H 4K2UH 1BMGA 5CIPB 1R3LB 5J7CC 3C5ZB 2H2PC 4HC1A 5I1AA 2EZ0C 1WCBA 4PLOB 2ATKB 1JN6B 3CFEB 4PJIE 1JHKH 3ULUD 1CLOH 3K1DA 3MV11 4QWWD 2FSEA 5DUBA 3S98A 4Z7WA 1LDSA 1NFDB 1J0KA 2YSSA 5C09E 5CMAA 4YNYB 3FT4B 3B6SA 3M07A 3U4EA 4FQHB 4GS7B 4G9FA 1IEAA 1HHGA 4MAUL 1ZT4A 3FFCE 3HAEG 4HS3B 3S9DB 4ZUVA 5E56A 2A74B 4HH9B 5DQDH 4P57A 5HHMD 1FL5A 1ND0A 4JRYE 4HQQH 4MAYA 1E4KA 1IGFL 1I7ZB 4OZ4B 4PTTA 4XPFL 2YRLA 2ZWLT 5J13C 5E6IC 5KTEH 5GS2H 1EZVX 4J8RB 2Z4QA 5C86A 1Q38A 2ZSWB 3AM8A 5I8OL 1G7JB 3B9DA 4PJHB 1XZ0B 15C8L 3FQXB 4WW1A 4UOJA 3O6KL 4JQIH 3DVFA 3TYFB 4LVNB 1SYVA 1JGEB 3LMJH 4X7EC 5D7IF 3RVTC 3WEXB 1OHQA 4YQXL 5ERWB 2GY7B 35C8H 5AG8A 3ARGD 1X44A 5BMFH 2AV7B 1F13A 3FOLB 4MA8L 2P8LA 5HHQA 5M7QA 4WU7A 3PP4H 1VADB 2BFVL 4RGNB 2R2CA 3MLYL 5BS0B 2OJZH 4NQXB 3HN3A 1RMFH 5CEZH 2O26U 1G7HB 4MD0B 5D71H 2FX9H 3CFKB 5SWZD 1KYOK 3CPLB 3CFBA 4N0YL 1KCSL 1IC4L 4ZFZA 4QHMB 4BUHA 1XH3B 4P5MA 4GOSA 4AQ1B 4MB5A 2BVPB 3A6BH 2XRAL 4XNXH 3VJ6A 3DXAB 1HQ4A 1LK3H 1L9MA 1RVFH 3PP3H 3VFTB 3T8XB 2I27N 2V5SA 4LLDB 4G8EA 1DBBL 1D6EB 3VFRA 1MCWM 5EU3A 3OJDA 4U1SA 4GKSB 5EU7E 2DKSA 4M6OL 3V6BR 4Z77A 3VD4A 3LOWA 2RB8A 1DQDL 2BJML 2C4FT 3RI5F 1F4XL 5L9DH 3MRGB 1AHWC 4GUPB 2FO4B 4KRNA 3CMGA 1I75A 3OKEB 2F74A 2R69H 1JPFA 4NKIH 4RQQB 2WUCH 5E6IB 4NZDA 3UTSA 4U3CA 5I1KL 3L3JA 5I2IA 3BFOA 1EFXD 4IDLA 5DLML 4JM2D 3OR6B 1WLHA 5DS8B 5KAQF 5L8LB 1IQDB 2YXFA 1OAKL 1FC1A 2A2QT 1IBGH 1CDCA 2AJZA 3LQZB 2VLMD 4C58B 2MPAL 1MCIA 4NQUA 1NGZB 4XP6H 2YA1A 1JPGB 4EBQH 3QAZC 4LLAA 5C0JB 1MRFH 3FO9A 3KPSD 3MV9A 2ITCB 3MLXH 3LHPL 1WIOA 4X7SL 3KYNA 4BSJA 5ENWB 2R2EB 3O2DL 5IMMA 3T1WA 5GZND 3VGAB 2AERT 1HYSD 5C0DB 5K59F 3QHTC 1Q1JL 1A6VL 5DD5H 4G6MH 1CDYA 2CR3A 1G7QA 3V8OA 1YN7B 4JPWH 5L88L 1GGIL 3EDDA 4AEIL 4P2RA 3PDOA 5F70A 4UILL 2XZAL 5DUML 4M8QA 5M94B 3ZSSA 4MCZA 3F7QA 5IJVA 4ACPA 3RY6A 3RWEA 3G5XA 2Q8AH 4JANB 4XVJL 2W92A 3KPLB 4V1DD 4EQ2A 4WEUD 1SJEA 5E8OA 4Y4FA 2B5IB 4QHNB 3VXPA 2P7TB 1K6QH 3C5ZD 1JUFA 4ZUWB 1FG9C 1BQUA 2JJTC 1MQKH 4N5EC 1AGEB 3A67L 4RFNC 2OL3L 4YK4B 1IL1B 2GJ6E 2HRPL 4YXLL 1RD6A 1DQMH 3UEZA 4XH2A 1T0NB 3P9LA 4FQLL 4AIXA 2H3NB 4XBGB 4JDZB 4LAQH 5CJ8A 3VFNA 3PWJA 4NC1E 1ZGLA 2GFBB 1A6WH 2R15A 2XY1A 4M62L 1GVIA 5HYJE 3HR5A 2P8PA 4DCQB 3F8UB 5E8NA 2UYLA 4Y5VB 4CW1A 5MEND 3QO0A 3DETC 4JZJC 5FM5M 5K9QG 2PTTA 1BLNB 5GIRA 1XAUA 2JJWA 1FFQA 1U8KB 3WIHH 1KTDB 3SO5A 4X6EB 3DYOA 2OZ4H 1AD0A 1KCRH 3BMVA 3V4VH 2BY2A 5E6YA 4PGJA 1N7ML 4UUJB 3QIUA 4U6XB 1NFIA 2W0PA 1YEGH 3MROB 5BCAA 4ODTL 2VN4A 1JGVL 5I15L 4FP8L 5HVGB 4DVRL 2AI0H 3EO9L 4G9DA 4OCSL 1KN2H 2EH7H 4NHUA 1DVFC 2MCG1 5HSFA 4IRJB 5GRJH 2ATPA 4M7KL 1I1YB 2VXUL 1MQ8A 4PJ9A 3IGAA 5HHME 4O2FB 3ARQA 2FX7L 4NQSA 1T89C 3MZGB 5F1NB 3QCUL 3TF7C 3GMLB 1QO3B 1CFTA 3O11A 3L6FB 1DP0A 1T1YA 3DUSB 4RGND 5BS0D 2AXGA 1FGVL 2CMRH 3F58L 5SX5H 3SKUD 4XPAL 4ERSH 4F7EB 3BEVA 3K3QA 1U91A 1NSNH 1PKQA 5CCKH 5FDWA 3MFFA 4RFNB 1FPTH 1QRKA 3U9UB 1D9KB 3VFGL 3V6OC 5D5MA 3HPLA 3DXAD 1AR2A 2FGZA 1YNLH 5K9OA 3HRZB 1IAKA 2D7OA 3W5MA 2HVKB 1BF2A 4G7YH 3ARUA 4U6TA 4L9LA 1D6VH 5L2JB 4U7SA 3OPZH 1EZVY 4K55A 5SWZE 4U0RB 4LU5H 1AFVH 4JZJB 5CP3A 4E5XB 1KNOA 3LKPB 3IFLH 2X6MA 1IGTA 1WBYA 1Q72L 3H9HB 1ZK9A 4E41A 4JO3L 4ELMF 4PJDE 5BV7H 3MRDB 5KOVC 1MREL 1QRNB 3VA2C 2IALA 5DD6B 4P2OC 5E6ID 2AVGA 1WJ3A 2JB6B 3MRHB 3O41B 1J1XH 5J11C 3K74B 2ZJSL 1FFPA 1KB9J 1LK2B 3WDJA 4A6YH 1B0RB 4G7VH 3REVB 4IMLB 3RWFA 4LHUB 3OF6A 4NZTL 2NY4C 4WHYG 1UQSA 2DTML 1I9EA 1V5JA 1RIVL 4U2ZA 5J0BA 4G6JH 4I18A 1S7UB 3NFSL 4Y16B 3SDCA 4OD3L 4Q9CA 4PLJC 1U8JA 2C1PA 2E3VA 2EC9T 3KYKL 4PGCB 4N8VA 2GSGB 1H15A 3C6LB 5E8EB 1IVLA 4ONOA 2XTLA 3UTQB 5D93C 1N0XL 3TN0A 2BMKB 4OFVA 5LGJB 3GRWH 3TA3C 5CIPH 5IB1A 5BZDB 1A3RH 3ROOB 2VLME 3UAJC 3DGCR 1ORSB 3E3QC 5EN2A 5TGBB 3FB6A 1UB6A 3S37L 4KZEH 1SJHB 5IKCB 5D7IB 2X4TA 1UYWH 4ONHB 4JZOB 1AGCA 2UZXB 1IAIH 1Z9LA 4HJJL 4NFBA 3BO8A 1I1AB 4UIMA 1MCLA 1NEZB 5L0QC 1GPOH 4HFUH 5DT1L 1FG2A 5E4EC 4KVCH 2NY7H 1CLYL 5I1CH 4OQTA 5GRUH 5F88B 1NMBH 3MNWA 4FQ1H 4UU9B 2MTPA 5C07A 2BY0A 3FQTB 3ARBC 1A1NB 1NCAH 1ZOXA 3BGAA 3MODL 4OM0H 5FXCH 3D18B 3C2AL 4P2OB 1AXSA 4BQBA 5C0IB 2EDFA 1FL3A 2Q6WB 4DOHB 1O7VA 3SBWA 3O6MH 1OL0A 3ULVE 2XZCL 3DO7B 1INQA 4RIRB 1RZ7L 3E8UL 1CLZL 1QHPA 2OI9C 4NIKB 1MIEH 4JFXA 2CD0A 1MCDA 3MLRL 4X6BB 3A6CL 1KCVL 1WT5A 1U8PB 2AK1L 2F54E 3CVHH 5EUKB 4JJ5A 4AIZB 5FYJL 2KBGA 3PGDA 4P3DA 2IC2A 3NIDF 4HPYL 4NKDB 5KVFL 3ESUF 4MAUH 2ZZUT 4PRIA 4F7PB 4M4PA 3VFUA 3LZFL 2HFEA 4POYA 1A7BA 1OWWA 1J11A 4ZAKA 1NBYB 1YC7A 4EDWL 5MENE 4M1CC 4D8PB 1HSAB 3UC0H 5GJSL 4IRJD 4X4XB 3MUGA 1MJUH 1IGFH 5F7KC 5ADOH 4FHBD 4BK5A 3RWGA 1U8OB 1MCPH 1P4BL 2P4AB 2Z31A 5HD8C 3Q1SH 3BPNC 2VDRL 4O00A 5FO7B 3Q6GH 5L2KB 3GSWA 1EVUA 4KMQA 4CGTA 3MGOB 3B9AA 2ADIA 2F58H 3ZSTA 5I8OH 4XVUD 3AREA 4KDTA 3O6KH 5L0QB 4KK9D 4X6DA 4YXKH 1MI5A 5D7JA 4P4KC 3DX6A 3W39B 3SCMC 2OK0L 4XGZA 2VSCA 1AR1C 1OSZA 2V9RA 4M61B 4F9PC 1MY5A 2YPKB 4N5ED 3WLBB 2BFVH 1D9KD 3ARBB 1FN4B 2DQIL 2ICWB 1YEJL 2ZPKH 3S3JA 5DHYB 2F9BT 3KHOA 4OZGE 5LCVL 1K8IA 5F3HB 6CGTA 4I3SH 4KI5C 2A0LC 4JREC 1U41A 5CZXC 3ALXA 3DV4B 4XC3H 3IJYB 3QA3B 4CVXA 1MWAA 4K7PL 3RNKB 3V5HA 3CXHK 1I8IB 4X9IA 1JGLL 2OI9B 2A73A 4CNIB 4PYGA 3OAZK 5E9DB 2ZOLA 3SE8L 1BJ1J 4MNHB 5FOJA 4UNVA 3KR3H 1KPVA 3VGHA 3BI9X 2ZUXA 1FJ1B 4U2YA 4FFVC 5EU4B 3IJSA 1NGQH 3OL2A 2XFXB 4EI5C 4FA8A 3BE1L 4L3CA 4M6OH 5FGCE 3ECBA 1QRND 3QRGH 3VD9A 1CE6A 4QO1A 2DQGL 1F4XH 3O2VL 5DMIL 1PZUB 2WAHA 1R3JB 1A1MB 4MQSB 5TF1H 1NKRA 1REIA 1MAKA 1DLFH 2GAZB 5INDA 1KJ2L 3G5YA 1CBVL 1R3IH 5EZJA 4FFZL 5SV4A 1ZHNB 3BPNB 1HWGB 2AGJH 1H3PL 3M17A 4O9HH 1OTTC 2LVEA 4L3ED 4Y16D 4TTDD 4A2LA 3MRCA 3KLHD 3QPQD 4PJFF 3UZQA 4K94C 3F5WB 2DD8L 3MRIA 4OGXL 1T7VA 4NPYA 5FV1L 5JOEA 3C6LD 3BESR 5E70A 5IB3A 3WFCL 1OAKH 1DDHA 2BSRA 4P4KB 3SCMB 2D0FA 2XQBL 5HTSA 1G84A 4KI1A 4Z5RA 4D0DB 4P46C 1JTPA 3P4OB 1X6LA 1FL6A 1CGSH 2R8SH 2OQJB 5TDOB 1LWRA 1SYSB 4KQ3L 2W07A 2KH2B 4CADB 1BZ9B 4NP4L 3O2DH 4XNMA 1IGML 3D85A 3RDTC 4PJBE 3NACH 3FONA 2EIZB 4LLVA 4NN6B 4M48H 3V2AR 1KJ2B 4GW4B 4K94L 3HI5L 1QPPA 5C0RL 5IHUL 1GGIH 1N6QH 1I1AD 2XZQL 3RNQB 1UM4L 3MRQA 2O61A 2P1YA 1BBJB 4KV5E 2PETA 1HH6B 1FC2D 4LPXA 4YIQA 1M7XA 3E6FA 4NZRL 5K9KA 3I02A 1ZLSL 2QKIA 2LFGA 4PUBL 4KJYB 4R8WL 3VWKC 3TVMA 2DJ4A 3WJLC 4KUZL 32C2A 4AEHH 3DBXB 4P2OD 3RVUC 1J1OL 1ZEAL 4HKBB 4TNWK 3U2SB 1GGBL 5KVMC 4LPTA 2VC2L 3VI4F 5IIEA 2BHYA 3A67H 2OL3H 3H6JA 1Y18A 1ZA6B 2HRPH 5CJXC 5FM4A 1BFVL 1JRHL 4HWBA 5EB9A 3WHXA 2X10A 5BJTB 2C3XA 5ALBL 4FQLH 5TH2A 1Q0YL 4N8PA 5DK3A 2W9EH 2FNBA 3SKNA 3I84A 4O4YL 4EVNA 1UCBL 3L3IA 1XGUA 2WINA 4MD5A 4ELMB 3LS4H 4TRPH 4EI6B 4PLJD 2BCKA 1CFNB 4LKXB 4PD4K 5JZ7C 3BZFA 4N0UA 1UZ6F 1MHHA 3BW9A 4TUOB 1OP3K 4CN1A 1B6UA 5I1JL 2J4WH 4Y5XB 1YJDC 4NQCB 1B9ZA 4KUCF 5I18H 3Q48A 4O2EB 4NRZA 1NGYA 2LV4A 1N7MH 4PP2B 5F9OL 4PJAF 4ODTH 5I15H 1JGVH 5EOCJ 4J3VA 3EO9H 7FABH 2F15A 4QRPB 1RK1A 5L2KD 4OCSH 3RDTB 1MHCA 4OLUL 12E8L 2RQ8A 1L0XA 3FQRA 5TDPA 4XMLL 1MPAH 4QRQB 4QHUA 2VXUH 1KCLA 1VERA 3VCLA 3PWUA 3GKWH 3SGDH 4GRMA 1EAPB 3QCUH 2XICA 4RCAA 4NWUL 4W81A 3QEQB 4PR5B 3CUPB 4MD4B 5J9PA 5FYJD 4KGJA 4UI2A 3BXNB 3CFCL 5ESQB 4L4VE 4TULH 3ARBD 2DBLL 1FGVH 3VWKB 4YZFF 5SV3A 1HIMH 3QXWA 5F44A 5I74C 4BFEA 3TO2A 3TBWA 1QUNA 3PG2A 1G7IA 3RGVB 2IQAB 2YD2A 2X89D 3QFDA 4R7DA 1HHJB 3T2OA 4IHOB 4D9QE 2ED8A 2BNRA 3F6LA 3CFJA 3V5DB 5C0AA 4UAOC 3ULSA 1OGAA 5CD3A 3LRSA 1FNSL 1HEZA 2DS4A 3UJJH 1TETL 1IGJB 2NY0B 3KLAB 1PQZA 2NMSA 2M1KA 2YUXA 4X7CC 1XCQB 1DEEA 1Q72H 3UROR 3DSFL 5F7UA 1MCQA 1N2RA 4HIEA 2C7UB 1JFQH 1Q0XL 2UWEA 1CI5A 4M1CD 5IHZB 1YY8B 1H3XA 1R5VB 4ENEC 3QUXA 4JKLA 2P5ED 4IS6B 4NNXB 1MREH 3W11C 4JZNB 2QEJA 3L95A 1QTYT 3OKOB 4MS8C 1SEQL 2EKSA 1CT8B 4AEFA 2EYRA 2ZJSH 4XVTL 3U79A 1QRNE 4P5TC 3G5VA 3U0WH 2HJLA 1K3IA 2DM4A 3PIQA 4M3JA 1P4LA 3OKYA 4XWOC 1R5IA 3G08A 3BJLA 5FUOH 4KFZC 5LXGL 4P4KD 3QNYB 5CKGA 3SCMD 1YZZA 1S9XB 4U6HA 3OWEA 3QXAB 5I75C 2JTDA 5C0GA 4NNYB 1LP9A 1F8TL 2YBRB 4F8TA 2X1QA 3STZA 4K3DL 5FB8B 3FOMB 3I6KB 4LCIL 5MEPB 5D7LE 4L3EE 2A1WL 4X4MA 3ETBF 5I74B 3U6RA 5F21B 1FCCA 3VG9C 4NSKA 3HS0B 3RBSA 1JNHA 1KPRA 4TOYL 3ZE0F 5M95B 5ALCL 3HNVL 5IFJB 3IDXL 1SMAA 3PGCB 4N8VG 4MJ5A 4PTUB 5T33L 2X05A 2FBJH 4MA1C 2PN5A 4ELKB 1TZHA 4HUVB 3GZKA 4UT7L 1G6RL 1U8LB 4FNLH 5DO2C 5D7IE 1KGCE 4PFEA 4JN2B 2LAAA 4L4TA 3KPPB 4LPYA 1MNUL 2VQUA 3BVNA 1ULVA 3HZYB 3QWOA 5DT1H 1BOYA 4PRHA 4NBYB 3NPSC 1Q9LB 4GSDL 4MLSA 1VPOH 3V6ZA 4ZO8A 1RJZB 2CDFA 2NYYD 3R1GH 4KKCD 5ID1A 2WW8A 2YZ8A 3H0TA 4CU7A 3GSOA 4JPKL 2F53B 4PGBB 4XVSL 2NCMA 4M43H 3VFSA 2V9TA 5D6DA 1RZ7H 3E8UH 3FQWA 5EBLB 1FP5A 4LLMA 3ZZ1A 1T2QL 4LLWA 1S78D 4XZUB 4QHKI 2FO1A 1YDPB 2YK1H 3DGGB 3A6CH 3SGJC 4MAYC 4HC1L 1KCVH 1E4KC 4LFHG 1U8NB 5KVDL 4NQEB 1G6RB 3RP1A 1W0VB 2AK1H 4NQCD 1CQKA 5LBSL 2HA1A 2DLEA 4HZLA 2CUMA 1DBKH 4E42A 3HAEH 4FQCL 2R2HB 5SWQA 1FO0A 3QCTH 1FNEA 4IRSB 4MSWB 4PRNB 1PBYA 3EO0B 4FOMA 3S8WA 3EOAA 4GW1A 4QRPD 3CFDA 3C5JA 4Y4KD 4EDWH 5D5MF 3RDTD 7CGTA 1BQHG 1F6FB 1RZKL 1DN0A 1P6AB 4MQXD 5CEYB 4X7DC 2I60H 4PJFB 5IEKA 1N64L 3U4BL 1KEML 1XGTA 1AC6A 5D1QB 4DZBA 3RFZC 4YAQA 4MA1B 1R3KB 1VESA 1A4JB 1S8DB 4OF7A 3GHBL 3WO4C 1KG0B 5EIIB 1ED3A 1A02N 4WI4A 1T1ZB 2V2TB 5DJZB 1QFPA 3G5ZB 4Y2DB 4L8DB 3MV7A 3RKDC 3VWKD 1FDLH 5HPMA 3GJEB 1A3LL 5I1AB 2OK0H 1WCBB 1DFBH 4LDLB 5B8CA 1PG7L 1FAIL 4YWGH 4KHTH 3ARDB 3L1OL 3RGVD 4LHJB 2O5ZL 3DHJA 4ODXA 2PW2A 4RX4A 4ZPVA 1BAFH 2YSSB 2HN7A 5CMAB 5LCVH 1KSRA 2MKWA 3B6SB 3U4EB 1PEWA 2F8VA 3DX9A 4LNRB 4OLYL 3NCFB 1E0OB 1KLUA 4JRXD 2FHFA 1MHEA 1C1EL 3U82B 1QYGL 3KJ4C 4K7PH 3VXTA 3SDYH 4M5ZL 3AVEA 2X4QA 4HT1L 5DFWH 1FL5B 1ND0B 4LF3B 5DURD 4R2GC 2UZYB 2NY0D 5B22A 1ADQH 1TNMA 3ARZA 1QVOA 3LQAC 3ZKNC 2GK0A 2EEDA 5DHVA 1AO7A 3QUMH 3DX8B 1EO8L 3BE1H 1FVCA 1I8MA 2CLZA 3MNVA 3QI9A 4U1NB 1PVHA 2Z4QB 4LSQH 4M03A 1CGWA 3TBTA 5H37G 1DSFH 3SKOA 2QQKL 2QQLH 4RFOH 4XPBL 1KB5L 2DQGH 5CJOL 1XFPA 3ZT7A 2JELH 5DMIH 4QF1A 1JYXA 3FB8A 3SDDA 5T5FH 4DGIL 4RFEB 2VQTA 4YDVB 2WZPD 4WW2C 4KJQD 2AXJA 1KXQE 3C8DA 3AXLB 2NTSP 5HHQB 1H3PH 3WO4B 2P5EE 5MI0C 1NLBL 5CSBA 1GSMA 3U7YH 1G0XA 3HZKA 3WFBL 4LSPL 4N1EA 3LQAL 3C2SA 4Q9BA 2B2XH 3V4UH 3N1QC 5GQBA 4OGXH 2A9NL 2R23B 4KHXH 4PJAB 1H3GA 2HKFL 4NQDB 1HZHL 4QXGH 5GS1B 3WIFA 4ZFZB 2XQBH 3BPLC 2A6KB 5GZOC 3WYRA 4U1GC 4P5MB 1OAUH 3QP3A 2WK2A 2VDQL 3QHZH 3VJ6B 1HQ4B 3MRKA 1NL0H 2VLJD 2VNCA 4KQ3H 4FFWD 3SKJL 1N59A 2D7TH 4RSVA 3D3VA 4KJWC 5J56B 5MEQA 4KROC 3BDBA 4G8EB 1KB5B 4JVPA 3D6GA 4YO0A 2WWMC 2XA3A 1BWMA 3RY6C 2EDNA 4ZSOE 1XF2A 2XN9A 1INDL 3KJ4B 4UV4L 1X5XA 5C0EA 1T03L 4Y4FC 1CK0L 1E6JH 4K94H 4G80B 4AY0A 5F8QC 4DZ8A 5C0RH 5IHUH 3WE6A 1GAFH 4Q9QL 4O5LH 3N9GL 2PF6A 1XR9A 2D0HA 4LLYB 3N1MC 2YD7A 1S7VA 3OAYK 4OJFL 4HS6A 4M9PA 1IAII 1BQLH 2XWTA 4ENED 5LVEA 1ZLSH 5DWUH 4WWKC 4R8WH 1F11B 1WISA 3ME0A 5JHDE 3L3JB 4KUZH 4JHWL 5I2IB 4ODWB 4XP9H 4NBXB 4YJZL 2CIKA 2VC2H 4X6FA 2ZNXA 3RU8L 4HXAH 2F53D 4D94A 5CJQH 5IB4B 1IRAY 4HWEL 4FXKB 1D5IH 5AEAA 5ALBH 1AJ7H 4U7MA 1X4YA 3MV9B 4Z7VE 4JR9H 5F8RC 5MI0B 4QXWA 4X6DF 4AEEA 2EC9U 3QIUC 4OI7A 1NMCC 1A7RH 1F2XK 3KYNB 4F58L 5BOZG 3LKRA 1JPSH 1IC7H 4N0FB 1Z3GL 4Q58C 3UMTA 2DKUA 2H8PA 5IMMB 1G9NL 5I71C 1B2WL 4IRSD 5IM7B 5DMYA 1UVQB 3BPLB 3MLWL 4RAVA 4U1GB 1MRDL 3GI9H 3TIEB 3S36H 3UBXA 5I1JH 4PJ9C 3D5OF 1XF5A 2ITDB 4LIQH 2EDQA 4P2RB 3IU3A 3PDOB 2P24B 5GGRA 1T1WA 1B0WA 2VZSA 2YC1A 3NVQA 3MSPA 3HC0A 4NQCE 4YDKH 5IQ9B 2GSIA 5D1QD 3JWOL 5F93C 5CLTA 5IJVB 3L5JA 3T65A 2R56L 3G5XB 2DQHH 4UDUB 1IAMA 4OLUH 5E8OB 3I3BA 4Y4FB 5DO2D 3D69A 4Y2DD 2XG4A 3IDIA 5DA4A 1AGBB 5CEZE 5D1ZA 1J8HE 2XNAA 5EDXA 5DYOA 5C6TL 3LKOA 3HE6B 4M7JL 4XH2B 4YUEH 2FLRT 1YJDH 1F5WA 3FN0H 3V4PH 3ARDD 1P5VA 3HUJA 3VFNB 2PNDA 2DBLH 3PWJB 3KDMA 4GRWF 3IYLW 5AD0A 1ZGLB 4JAMA 1P7HL 4L9LC 2QBWA 3HR5B 1NGXA 4LSVL 5DXWA 1P1ZB 5ITBL 5C92A 3AROA 1X5ZA 4PJIA 4CW1B 1KF9B 2W91A 2PTTB 5J89A 4TSCH 4YHMH 4H1LA 5C09A 3LRGA 4UNTA 2ORBL 1AD0B 1DLHB 4ZOAA 3VFMB 3T77A 4R3SB 1NFIB 3FFCA 1RJYA 4H8WC 1LO3L 2D2OA 2XIDA 4JRXE 2VUOA 4LVEA 5BRZE 5I71B 1FNSH 1TETH 4YHZL 1QNZL 4PBWD 4NHUB 3T0WA 3MYJA 4JRYA 3REWA 2QR0A 1KIRA 4L4JA 1Q0XH 4PJ9B 3IGAB 1NC2B 5HI3C 3VA6A 2P8MA 4IM8A 4JFYB 4BA8A 4XNYL 4NM4L 3HKFA 4Z7OF 3VD3A 3FKUS 5I0DA 5DQJB 1HHIB 1KACB 3P73A 1WIUA 1JHTA 4R6UA 4Z8FH 2DKMA 1T1YB 1A6ZA 1GGCL 4XVTH 1QBBA 4NO2A 3CXDL 4XCCL 1OD9A 4WHYH 3RVWC 3SKMA 4KUCD 5IBTH 4H8WL 3WO3B 1FGNL 3GSRA 2AP2A 3TN0C 1YEIL 2VXSH 3BEVB 1U91B 3RKDD 3TP4A 5SWSE 3QDJE 1J0YA 5LXGH 3MFFB 4NQDD 5JMRA 3U1SH 2B8OT 2GHWB 4Z7QF 5EO0A 4HXBL 3NIDE 5T1KA 3RX8A 3QULA 1MCOH 4JPVH 2OCFD 4HJGB 4URTB 5D5MB 4JLRB 1AP2A 1EGJH 1F8TH 3CMOH 3D25A 3D0LA 5I17A 5J06A 5K9OB 1IAKB 4LCIH 2JIXB 5DJ8A 1MJ7H 1RV6X 2DDQH 2A1WH 4L9LB 5FYKE 2IMMA 1QPXA 4E0RA 4FFYL 2C5DC 1QLEH 5IMOA 4MMZC 2R0KH 2J8HA 2BSTB 2XXMB 2Y36L 5DJDA 1KNOB 4ZOBA 4M7ZB 1IGTB 3OG6B 4QOKE 4E41B 3OX8A 2VLJE 2AJYH 4Y4HA 2HH0H 5BVJB 3V95A 4DKFL 2IALB 3G9VA 4UB0L 4DW2H 3SE9L 2ARJQ 2BXYA 1ONQA 4HG4J 1FFPB 3CJJA 1MNUH 3O6LL 3SBWC 4IOFC 1A64A 4J3UA 4ODHH 1JMXA 2OS7A 4BFBD 4XCYA 3O4LE 1UQSB 2VZVA 1NCWL 5F1KC 4DVBB 4KK8D 4S0TD 5CILL 5ESAA 4LPUA 1S7XA 2QADC 1WUNT 2VRAA 2W60A 4I18B 2EDHA 5ID0A 2J6EH 1F58L 3D9AL 3KPTA 3DRQA 3HI1A 3MYZA 3SDCB 1XF3A 5C70A 5DRNA 4YHYB 4OQTL 3Q3GB 4JPKH 3MV9D 4YPGA 5T1DL 4N8VB 1H15B 1DTUA 1G0DA 2H26A 1CF8L 1UWEL 4OGAC 3EHBC 3TN0B 4OFKA 2YPLB 2FWOB 3LSOB 2F53E 3GMQA 1MFBL 1XGPA 5BO1L 4GG6E 1YPZE 2DWEB 5IB1B 5L7XL 2HT2C 5GZOD 3ZL4L 4HC1H 1YEEL 5F7NC 4LMQI 1S7SA 4EN3D 5HDBF 5EN2B 3FB6B 1R24A 4LVHC 4FQCH 2Z31C 4QRRD 4RMUA 5B21A 1QSFB 3I2CH 1N4XL 3F7VA 3MR9B 4BH7B 1VENA 1AGCB 4GKOA 2HKHL 3VMNA 2IFGA 4KMTL 1VFBA 3LPGA 2P45B 3KNBA 3AREC 4UIKH 3BO8B 4KDTC 4UIMB 3UTZA 2O5XH 4Y4FD 5D7JC 1PKOA 2YD9A 3O3AA 1CL7L 3OB0K 3K7UA 1SM3H 1FG2B 1KEMH 3MLPA 1AD9A 1IAOA 5IMLA 2WIIA 4BQ8A 4O58L 3BIBX 3CLFL 3MNWB 4PJFE 1ZLWK 3OJMB 4G43A 3HE6D 1JBJA 4NWTL 1AXSB 5JW5A 5HHPB 3SGDI 1VACB 3ZTJG 1Q9OA 3V5KA 4TNWF 2J88L 1AE6L 1A3LH 3CVIL 5CGYC 1INQB 2F5BL 3LN5A 2GJ6A 3TT3L 3P40A 1HDMB 3MV8D 5J1AA 3GNMH 3O6FA 1E6OL 4ZQKA 2QADB 2XTJC 5ESVB 3G6AA 2BX5A 2VL4A 2R4SH 3FL7A 2CPCA 5E8PA 1K2DA 4KRPC 4JCMA 1WFNA 4JJ5B 4XPHH 4P3DB 4OUUA 4PGDA 4ZPTB 3TEUA 5HYJA 3ZLQC 1QLRA 5E5RB 2GTWA 3GK8H 4Q7DA 5FHBH 3VFUB 1C5CL 2WMPA 2HFEB 1DEDA 4HT1H 4ZAKB 3RY5A 4AYFA 1X5FA 1LP9F 2X1PA 2PTVA 1ORQB 1P2CB 2ADFL 3MUGB 2NY6C 1UGNA 1YQVL 2UUDH 3NCYS 4PJ9D 2DQTL 2DMCA 3GGWA 1NC2D 5D96B 4OZHE 4LVHB 2VDPL 1EO8H 1S7WA 4P9HC 3GSWB 3TFKD 3I6LD 4ZUUB 3V7AG 1L6XA 5JDSB 5JR1L 2ADIB 2QQKH 5CJOH 4Y5YA 5F7LB 3AREB 3MRPA 3HFML 4W4NA 4X6DB 4UQ3A 5D7JB 4DGIH 5CEXB 1HI6A 4DKEL 1SMOA 1GC1L 3BEWB 4OLXH 3K4ZA 4HBQA 3NBNA 3QQ9D 3G9AB 4X0KA 4JHAH 4NNPL 1NLBH 3EGSA 4ONGL 2DQJL 5JIPA 4R26H 3DPBA 4LSPH 4YHIA 4ZS6D 4ZG1A 3FRUA 1K8IB 1JI2A 5CS7A 4JKKA 4NCDA 3BDXA 2JIXD 3FO0L 3Q6FA 4CVXB 4RMSA 3LPFA 2A73B 2VDQH 1JF5A 4PJAE 4NQTA 2XTJB 4NQDE 2C3VA 1TQCC 2V17L 5CSZA 1JL8A 3LV3A 5DEGA 5TQ2L 3FO1B 4E41D 3RWIB 4PG2A 1F97A 1SEBA 3IJSB 2C1OA 1EO5A 3VE0A 1FLTX 3C09C 4WWID 4U1JB 5SWZA 4UV4H 3UYPA 5FKAB 1FIGL 1BJ8A 5T3XL 1QBLL 4OB5L 4Y89A 4B53A