4KRPB

Nanobody/vhh domain 9g8 in complex with the extracellular region of egfr
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
116
Chain Sequence
b'EVQLVESGGGLLSCAASGRTFSSYAMGWFRQAPGKEREFVVAINWSSGSTYYADSVKGRFTISRDNAKNTMYLQMNSLKPEDTAVYYCAAGYQINSGNYNFKDYEYDYWGQGTQVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epidermal growth factor receptor
molecule tags Transferase/immune system
source organism Homo sapiens
publication title Structural Evaluation of EGFR Inhibition Mechanisms for Nanobodies/VHH Domains.
pubmed doi rcsb
total genus 17
structure length 116
sequence length 124
ec nomenclature
pdb deposition date 2013-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4krpB00
3PWUB 1M7DA 3QIUB 4IHOA 2HVKA 4X98A 4J6RH 2BSTB 1MRFL 5C0GA 5MI0C 4E41E 4LLYB 5JA8B 4X5XA 1I1CA 5EC2B 1KF9B 4XP5H 4G8FA 3IRZA 1K2DB 1FVCB 3OKEA 4NGHL 3WXVL 1UYWL 2I25N 4NUJA 2ZKHH 2DTMH 2XFXA 3BIKB 3KYNB 4ZPVA 3VXOA 1AE6L 4LFHG 4IIQC 4PJFB 1AIFB 4QRQB 5C0CD 3H42L 3F12A 4POUB 1BWWA 4DKDC 4YGVB 3VI4F 3L1OL 3NIDF 5C71A 1WCQA 3G08B 1CGUA 1YNLH 4OQTH 4NQUA 3DYMA 2VXVL 4N90E 4TQEL 1WIPA 3X14B 4BZYA 4JFDE 3CUPB 3QUZC 2Q7NA 1N59B 4JDVA 2R29L 3V6BR 1Q0YH 1ZHKA 4ERSH 3RA7H 1ITCA 4EEEA 4JRYE 1SMAA 3STLB 3QFJB 2G5RA 1P4BH 2F19L 1G7HB 1RZ7H 1YC7A 4BQ8A 3VGDA 1A4KB 2GK0A 4NSKB 3QFJD 3FQXA 3TO2B 3CVIL 4P2RB 4N5ED 1MJ7L 3MRMA 3GB7B 3VXRB 1UWEL 2VLRE 4M61A 4YHPA 4KJQD 3GGWB 3QIWA 3IXAB 4MQ7A 2H9GA 3T0AA 5IVXE 2QBWA 4PJXF 2B5IB 5JMOC 2LE9A 2CUMA 1LK2A 3WIHL 2XIDA 3MV9E 3QNXA 4CUCA 3QUKA 3DGCR 4KJYB 4HLZH 2H41A 1TJIH 2AV1A 5MEOA 3OMZA 5B38B 4U1KB 5E03A 2H6PB 5EOCL 1V7ML 5KAQF 3T2NL 4KRPC 4ZAKD 1NPUA 1NFDE 3IJSB 3SDDA 4M93C 5DZNA 2H3NA 5TFSH 1X5FA 2AK4D 2R2HA 3PQYD 3O6FD 2ZUQC 4K3HA 1L6XA 2ZG2A 2IAND 4F7CB 5KVGL 3P11L 4N8CH 32C2A 3I75B 3QNZB 1DCLA 3WN5A 4ODVH 4M7JH 4RAUB 1BF8A 2CIKB 1MHEA 3TBTB 1I1AC 3BX7C 5D71L 1X5AA 5C0AD 2IJ0C 4ACPA 4LAQH 3R4DA 2FR4A 4FNLL 5C0JA 2NW3B 1I85A 1A3RH 3FT4A 3SHSA 2F54E 1OSZB 2DIBA 4UV4L 4UOW0 3P0YL 3AS2A 4WJ5A 3T3PF 3WFBL 3B2VL 1PAMA 3LD8C 3QDGA 1DBKL 5HHNA 3QQ4A 4AEEA 5CJXC 3DVFA 3QPQC 4HKXB 3GSNB 2EDBA 5HBBA 1DQQA 3T0ED 4QXTB 2EIEA 1ZTXL 1YEDB 5I75C 1RU9H 4W4OC 3DMMB 1BQUA 3HHRB 1PYWB 2VLJA 4PJCA 4I5BB 5D4QA 1RQ5A 5C0FA 1OAXL 4QRRB 4NQXA 1Y6KR 1QRNE 2AK1H 3IF1B 3MJ9A 1P69B 3HI6H 3OJDA 1IGIL 3GUTA 1HH6B 3EYVA 1I9RH 1YEFL 5TGBB 1RJLA 3U7WH 3QWOA 3FJTA 4BH8B 4Z7NE 4EDWH 1DLHB 2GJ6A 3O41B 5C9JA 1WWBX 3ROLB 1EJOH 4UNUA 3I50H 1MJJB 2C1PB 1GIGL 4FQJH 3HUJB 3RPIB 4WO4B 3L95A 4R6UA 2F54B 6FABL 2X5PA 5BOPA 2V5TA 5ITFA 3MLZH 1CE1H 1FN4A 2XFXB 3ARZA 3LKRB 3WO4B 1F4XL 4HC1H 1IBGL 4C57C 1DQQB 1ZLUK 2CRYA 3GSVB 2FBJL 3DGGA 1QHOA 3HNSL 1G7QB 3CSPA 5C08E 3QUZA 1WC7A 4GG6A 5E7BA 2VSDA 3V52L 43C9A 1FVDB 1MCNA 2IANE 1IGML 5D1QB 4HUNB 2UY6A 4KMLB 3VRIB 3KLAA 5A16B 1NFDB 5DFVD 4XWGH 4Z0BL 3O3UN 1KCSH 1LO0H 1G7JA 1V7NH 4F57H 1EFXD 3D18A 4HG4K 5DJ6A 4EI5B 3EW3B 3U6RB 3L3JB 3U7AA 2APFA 1EXUB 1RFDH 4Q9RL 3SJVA 4HUVB 4TUKH 2XA8L 5EU4A 1KEGH 4JFQA 3HLAA 3GO1H 2HJLA 3G6DH 5D7LE 3AROA 3VWKC 4GBXB 1AJ7L 3WV0A 2OTUB 3D39E 4MA1C 3V6OC 1BOYA 2FX7H 1A64A 4KV5F 2FSEB 2PW2B 1V3LA 4MJ5A 3UTSE 4OLZH 1LD9A 1OAZH 4TSCL 1PJ9A 1CXEA 2NX5E 5E94B 5EO0B 2R9HC 3TJHC 3GK8L 3MRJB 3RVTC 1CQKA 4HKJA 2FEEL 5HGGS 4MAYB 4NO5A 5GJTH 3S36H 3KXFB 2DWDA 4M62L 5IV2A 1OL0A 2PKDA 1FNHA 4N90D 3T09A 1CLOH 2VKWA 5HHXL 4Z7QE 4LLDA 5EOQH 4Z6AT 3O4OC 3U9PH 4Y5VB 3EYUL 5T5NF 4P3CH 1KJ2H 4QHNB 3HPJA 2IG2L 1Z3GH 1WBXB 4OAWA 5DHYB 4AT6B 4PREB 2M8XA 1U3ZA 4M7ZC 1KJMA 3CH1A 1D5IL 4OI9A 4P5KB 4H20L 4KDVA 1CDJA 2VMFA 3RA7L 4BFBD 4TUKL 3AS0A 2I9LA 4F7EA 2D7PA 1DL7H 2D9QB 4LU5H 2R56L 4MMZC 4NQSA 2H2PC 3RWEA 2P45B 3EFDH 1A1NB 2D9CA 12E8H 3ZKNC 4U1HB 3PXJA 2EYRB 4YHOL 5DRZB 1MLCB 4JFPA 3T3ME 2DQEH 3SGKC 4CVZA 1RJZB 4NRYA 5IP4A 4WFHE 3EYQD 5C0NC 4F9PA 5ID0B 2EDXA 4XMKL 2F53E 4DN4H 3O8XB 1CFTA 3EYOA 3OR6B 3RIFF 1X7QA 5GS0C 3P77B 4KPHL 3QEHA 3TYFB 3VRLF 2NQCA 2DQTL 4PJ8D 3D25B 1TITA 4WRLA 3ARTA 3DRTA 1R24B 1FIGL 4ZNCD 1EGJL 5HJ3B 1FJ1A 3X11A 4Z7WF 3RI5K 1CK0L 2DI8A 1N0LA 2XZCL 2FWOB 3CSYA 5D1QC 2PO6D 4JO1H 2FX8H 4KK5D 4JPIA 4WY7L 4F7PB 4WJ5B 1QFOA 2YD7A 2VXVH 5D7LB 4FP8H 3D0LB 1DANT 1JZ5A 2P5EE 1L7IH 4LPYA 4AMKH 5CEXB 5L2KD 2ZJSL 3MRNA 4JDTH 1N8ZA 5EUKB 3QUXA 2KQMA 1I1FA 3PV7A 2YHGA 3E6HB 1ZVYA 3W9EB 5L9DH 3UTTA 3L6FA 4OTXL 5HGBA 2YS4A 3D3VA 4HAGA 3WL9A 1U93B 3D18B 5CJOL 1KB9K 3N85L 5F9AC 4OGYH 5BCAA 3T3PE 5MERA 3Q6FA 4HS3B 3P11H 3DBXA 2JELL 5MEQA 1J05A 2I07A 4O2EA 2Z31B 1EEQA 2AABL 4R7NB 4ODBD 4Z7OF 1Y6NR 4HH9A 2FJFA 4O58L 2XWBB 4MNHB 4XAWL 3GIVB 1CD0A 2VZ1A 1RULL 4HPOH 3OGCB 3GMMB 5E8NA 2IALB 1GZQA 4P2RA 4N8CL 1NGYA 1S5HA 5GJSL 3VWJA 5I8KL 3KJ4B 1IC5H 3UO1H 2ITDA 5E24E 2GCYA 1IGJA 3DX6B 4OZHE 3VW3H 3RWCB 1RUAH 3O2WL 4X9BA 3NGBC 4WUKL 5JOPE 5IJKC 4Z7VB 2VZVA 3D39D 4LKXB 5IB2B 4HZLB 2BY3A 2XZCH 2ESVD 2YD6A 3CVHH 3VXQA 4XH2A 5SWQB 2C3XA 4LAJH 2HFEB 1T04B 4UT7L 2WLYA 3SKOA 3FOLB 5LGKA 2HT3D 3HE6B 4JDZA 5HDQH 5IJVB 2Y72A 2ORBL 1EO8H 1N8ZB 1JUFB 1Y0LA 1U6AL 1QNZH 3PGDA 4TNVF 4XX1G 1YJDH 4XNYL 4W6YB 1QVOB 1U3YA 4IOIB 4PRIB 4KROB 4MAUH 4NFDA 3QFJE 2RQ8A 4P3WA 3NFPA 4MD5A 3TH2T 5I8CA 4X98B 5E8OA 3G6DL 2J8UF 2HT4D 1BZ9A 5T3ZH 3VI4E 3FT4B 2JIXD 5DVMA 1DEDA 2YKLH 4DW2H 5B39A 2Y23A 5E5MB 3L1OH 3QSKB 2IMMA 2OMNA 1EH9A 4KC3B 2QQNL 3FKUS 1BF2A 2CJUH 5EUOF 2G75B 4ZS7L 1C1EH 4JG1H 1UZ8B 1D5ZA 4JHBA 3MNVA 4NO3B 2C3GA 1FAIL 2VXSH 4FTVD 5IG7A 4NRYB 2CXGA 2JCCB 3F7QA 5DHXB 1MAML 2FCBA 2P24A 1F4HA 3BKML 3U36A 4KGLA 4YXKL 5L6YH 3MBEA 4I0KA 2QEJA 4KGJA 4DCQA 3L3HA 3RY5A 1HCFX 1X5IA 1AJ7H 4P3CL 4F8QA 3PABA 1EX0A 3PV6B 4HMEA 4ZFZA 3DX9A 1MOEA 1O0VA 2R0ZH 4O00A 2JJWA 1J8HE 2X7LA 5EU7C 3V5HA 1T1XA 1YUHA 1IEHA 3N1FC 4UNTA 3LKSA 4F7TA 2QKIA 4PBXA 3TBWB 5EBWA 5D7LA 4FFYL 2J6EA 3GEWB 4HHAA 1DR9A 3TBSA 2GJJA 5GRXG 4XVTH 4H1LB 1KV3A 4AH2A 2XWTA 2VDKH 5C86A 5IKCB 5DJ0B 5L8JB 3MUJA 1KCVH 3MXWH 5BRZD 4X6FB 4JR9L 5EZOL 4GKZA 4LSTL 1QO3A 1TPXC 1OSPL 5D96B 1JHTB 5DJ2B 5DZLA 1J86A 4Y2DB 3LKPB 2CMRL 3LKOA 4WI2A 3ZHDA 3LHPH 4LQ1A 3G5ZA 4JFYB 2Z31A 5IF0B 3PWPD 3IDGA 3RX5A 5IMKB 2YUZA 1T0MA 1I1AD 3CDGA 5K9OA 4TTGA 4UV7L 1BLNB 4TOYH 4OZFG 2V7HB 1NEZB 1L0QA 1XCQB 4K55A 4WTZG 2UYLA 2B1AL 1S7RB 2R0ZL 3TWCH 4PLKD 2P5WA 5DSCB 1J0ZA 5ILTH 5DTFA 3CMGA 1I1FB 5TH2B 1CICB 2XWJA 1QSFE 4B7IA 5IKCA 4R8WH 2DRUA 3D6GA 2P8MB 5E2UL 2IAMD 3HB3C 4LSRH 5K9JH 3QCVH 2EEBA 1BVLB 4RZCA 2EYSA 4HXAH 4LCIH 3S36X 2O93L 4UTAL 4NN6C 4NQDE 4YEFA 1JE6A 5A2IH 5CSZB 4EDXB 1NDGB 4MJIA 4OCSL 4ZYKB 3SDXA 5AWNH 3SE9H 3V5HB 4QF1A 3OV6A 1UCBH 1HCVA 1IILE 3MRRB 4XZUB 4NQCE 1MQKH 1IZKA 1AO7E 3L5XL 2PW2A 5IBUB 4K07A 3JWDL 3ILQC 4Y89A 3BRGC 1RJZA 4EUPG 5HGAA 1KNOA 3LIZH 2DQTH 4ZUSB 1T03L 1R5WA 3WHE0 1O5DT 2AXGB 1PGRB 1CDIA 3V7MA 3GI9H 3B5HA 2X9YA 5SX5K 2B4CH 4O4YH 4DGYH 1FRGH 2NY0B 4OGAC 1HXMA 2GSGA 1G9NH 1ZSDB 2BC4A 3BD3A 3CLEH 1DQDH 4NM8H 1FH5H 4POYA 4U0QB 4OFKA 1YY9C 3VJ6A 4DUWA 1GOHA 1LO0L 2BNRD 5FYJL 3FTGA 2AEQL 2G9HB 4WUKH 4F9PC 5C70A 3QIBC 5D70H 3LKOB 4UT9H 3LV3A 2CK2A 4FOMA 3QNXB 5DUMH 2YPVL 4JFEA 4M1CC 5BVPL 3DRTB 4ODVL 3NZHL 2NY1C 1F02I 3TYGL 1AKJB 4P46A 4XXDB 3QIWB 1H5BB 2H26B 5ENWB 3SDYL 1TJIL 3ZYJA 1UJ3B 1XF1A 2EEDA 4FQ2H 1C5BL 5ESQA 4H1LA 1BECA 1RIHL 5I2IA 3C6SA 3SE8H 4ZUWA 1S3KH 2FYYB 5E6ZA 1CDYA 4LMQI 1HKLL 3TBWA 3SKMB 4P4KB 4PJIA 4CN1A 1C8PA 4ZFOL 2OR9L 1DANU 1I3GL 3ARQA 3I6LD 5CCKL 4PJEF 2XG5A 4NO2A 4EKXA 3UJIH 2XXMB 4OZHA 2N1KA 1UEYA 1PG7H 3KPSE 4PRBA 1VACB 5EIVA 1A7QH 4I8DA 1M6OB 4LVHC 4X9HA 2LFGA 3ZTNH 2JB6B 4QHNA 3QIWC 5MEND 5KG9A 2HMID 2NR6D 3GIVA 1K6QH 1UKTA 4U1NA 1T6VN 2HFGH 2FLBT 1AQKH 4OT1L 1U8OB 4B53A 1U2CA 3MZGB 4JG0L 1CFQB 4I9WD 8FABB 2GSIB 5FGRA 1CFVH 4NDMB 3U83A 1KJ2A 4YXLL 4GH7B 2BCKB 2E8YA 5HI3D 2XACC 2VLRD 4YDJA 3O4LE 1KPVA 5JORA 4E0RA 5AUMB 4JZJA 3QFJA 4UQ2A 5FK9A 1JFQH 2HRPL 3BH8B 4M5ZL 3VFNA 2RHEA 3QAZB 2C1PA 3O8XC 4KPHH 3QAZC 2OJZL 2XPGA 2XI9A 5C9JB 1Z0NA 3BEVB 3B9AA 5MEPA 4U6TA 2B7DT 4X9GA 4HIIA 3QUMH 2XTJE 1QSEE 2J8HA 4TUOB 5DXWA 4ELMB 4K7FA 3GJFB 5HI4D 3ZLQC 4OF3A 3T4YA 2AJYH 4R97B 1FGVL 1LE9A 1AGFA 4LBEB 3ARFA 5E4EC 2GTZA 2D0HA 5ENWA 1AH1A 5FM8A 1H3PL 1CBVL 1KJ2B 4RMRA 1RUMH 4CU6A 5D1QA 4XXDA 3SDAB 4QXTA 3MRKA 5KANG 4D0DB 2OL3H 1FBIH 4G6ML 4LVHB 2VB5A 3V5KB 4HF5L 5EZJB 2FIRT 4RAVA 1B88A 1MAJA 2Q7YA 1J1OL 2P8MA 4OZGF 1NBYB 3BISA 3N1QC 4HIJB 4J3SA 4QRTA 2B1HH 2SEBA 4BFGA 3VGAC 3PWJB 2Y5TB 2YC1A 4P5TA 4WEMB 4ERSL 2PCPB 1A6VH 5C09A 4KVNL 3W11D 5EU7E 5D72H 2AJVH 4WI7A 3FRUB 4D0BA 1Z9MA 3PV6A 4LSRL 5K9JL 2EDOA 1D5XA 5T3XE 3NCCB 4KKLD 2RJMA 4M5YL 2BVQA 3UTTD 4XP1H 3D9AH 5GRUH 5T1MA 2P8PB 2DBLH 4L29B 4Q2ZB 1HHHA 3ZE2F 3L3KB 3DIFB 4JZOA 2ZG1A 2IADB 5C7XH 1SJEB 2Y6SC 4HV8B 3FL7A 3MLPA 3TO4A 5L8KB 3SGJA 2QHRL 3DVIA 3L5HA 2EIBA 4P46D 3H7BA 3ILQD 3ZSSA 5C08A 2O5ZL 1KEML 1UWGH 3ZZ1A 1QR1A 4BM7A 4L3ED 3RUGB 3CCHB 1HYSD 4JQVA 5D2NE 5DYOA 4FQXD 3QUML 1QP1A 3KPNA 1U8HB 3WDHA 1OGTA 3PWLB 5IBLC 1VACA 2LTQC 3FQRA 5D93C 5B4MD 1BPVA 3H9SE 1N4XL 5IROC 3OG4B 1JGEA 2OQJB 3ECBA 4UB0L 4ZPTA 2ICWA 3GI8L 5T33H 3LAFA 4RBPK 3X3GH 3EFFA 3TT3H 1YJDL 5K59F 4WI3A 4ODUB 4S1RL 1WT5A 4P2OA 1IAIM 3F58L 1GHFL 1YN6B 3TV3H 4WNQB 1V7MH 4HLJA 4MJIE 1AFVL 2VYRE 4NKOA 1ZK9A 3E8UH 3O45B 4CVZB 5I1KH 5FO7A 1KPVB 5T5FL 1RZJL 2XN9B 1ZHNB 5F7UA 3PQYE 5ISZB 1T0NA 5CEZD 4TVPE 4Y1AB 5JO5B 1F4YH 5EORL 2EH8L 3N1MC 5TPWH 1NDMA 3EO1A 4LRNL 2V2TA 1TCRB 2AEIT 4D0BB 5EUOB 1IGIH 5E5MA 3O3AA 3UC0H 2QJDA 2NY6C 4XC3H 5GRJL 4G9FD 4JFFE 4K7PX 4Y4FB 2HVKB 3AMLA 4PP2B 4ZOBA 3CH1B 3QHZH 2VNCA 1S9YA 2JF1A 5J6HB 2FX9H 2GEEA 2CLRB 1NCTA 3MREB 3U4AA 1ORSA 3FQWB 4X4YA 1GPOL 1A7PH 3GKWL 3LS5L 5LKNA 2BP3A 1XF2A 4XWGL 4DN3L 4J3WA 3RAJL 5J9PA 1UH4A 3MBEC 5IESL 1OB1A 5EC1B 1ZHNA 1NKOA 4YHLH 2R4SH 3O6MH 3E8UL 5F8RC 1I85C 5EO0A 4HUUA 2J8UB 4HMDA 4XPBL 3KPQB 2V5YA 1QSEB 2WWMC 5BVPH 4GMSL 1R3JB 1JTTA 2Z8WC 1G0DA 3UBXA 1NGWB 1TZIA 3VGAB 2IBGA 4RNRA 5CCKH 4CU8A 3QDMB 3WIFB 2C7UB 4Z5RB 5DEFA 2VDQL 2XA8H 1SEBA 4NQDA 3MGTA 4ZDHA 4RWYL 4JY6A 1NGYB 1EUUA 3K0WA 4PJEE 3TESA 1QO3B 4CGTA 3D1MC 4XBGB 2EO9A 3ARED 2G9HA 2K9UA 4WI4A 4IMLA 4I2XB 3ZTJH 4PRHA 4CMHC 4HIEA 5D93B 1Q8MA 2PYEE 3QULB 5HYEA 1F90L 1GOGA 3HKFA 1J5OH 4ODHL 4Y8DC 4LPTA 3MODL 1AKJD 3OKOB 4NYLB 3MR9B 4PGEA 3BPNC 4CMMB 1FSKC 4KTYA 2X09A 5HI3C 4PRAA 1AR1D 4DVRH 3R8QA 5EO1A 2HKHH 2EYRA 3FQUA 3LS4H 3RDTC 1NCNA 5BZDB 4PRBB 4KK5C 3VWKD 1HQ4B 4RMWA 2AK4A 4Z77A 1NUNB 2ARWA 4ZS6D 1UZ6F 1DFBL 4XMLH 1CFVL 1SVCP 2E9BA 5HYQB 4M6NL 1CXFA 4RFOL 2BRRH 1HH9B 2YUWA 2OS7A 1CDCA 3UTOA 3IDIA 4FXLA 3VD3A 5CSZA 4BA8A 4RWYH 3FO0H 3VXRA 1N0XH 4H20H 4M1DL 4MA8L 1QKZH 1NC2D 5B39B 4ZO6A 5E0QA 4DKFL 1R5IA 3WDJA 4JO4H 1JZ6A 4O51A 4U1LB 2XKNB 2EDHA 4GQ9H 4I5BA 5CKGA 2EZ0D 1CLOL 5HHXH 3DVNA 3U0TB 4GXUM 4OCYH 4X99B 4NN6B 1E4XI 3UDWC 4QHKJ 3DETC 5IHZA 4NZUH 3V2AR 1MCBA 1QTYT 3V4PL 4MCYA 1G1CA 3VFTA 2UVEA 4M7LL 4Y1AA 2BY2A 4RGNE 1AY1L 5SWSD 5F9JB 2FEEI 2NY4C 1K3IA 3BZFB 1UWXK 4WW1B 1YPZB 4RFEA 5E2TH 4G8FB 3MXWL 3QCUH 2VQ1A 3I2CH 4C83A 4LGPB 3VFOA 1KIRA 1U8KA 1KLUB 5JZ7C 4F7EB 3MR9A 4WNQA 4D9QE 5JNYA 3GBLA 1NANH 5F70A 2NY5H 3VGFA 3VXUB 4GG6E 4X83A 4XP5L 1E27B 1IGJB 2ICES 4KKCC 5DJ0A 2BK8A 2W9DH 2XWTB 4JKPL 3FZUD 4P2RD 2OR8A 3MLRL 3PL6C 3S34H 4RDQG 2XY1A 3R0NA 1QQDA 5B3JE 3TN0C 4UNVA 3RL2B 1NEUA 1MFBL 4MVBC 3O3BA 4ZMAT 1A9EA 5HYJD 1JF1A 5I1KL 1IVLA 1JNHB 1IKNC 2EXWD 3RZCD 4OFPA 3LSOA 3PWVA 1IQDB 2PO6C 3WIFA 4G6FB 4PJ7E 3ETBF 4X7CC 5BXFA 4LSSH 5ID1B 4WW2B 4JN2B 3VFSB 1FV1A 4XCNB 4HGMA 5DD1L 3UX9B 3TIEB 4TULL 4XH2B 4Z8FL 5C0CB 3D39B 3I02B 2VIRB 1X5JA 3TVMD 4GXUN 5DD0L 2WQ8A 4LGRB 5IVXA 2APVA 4JDTL 4X7DC 5TH2A 5E99L 5FOJA 3C08L 5J12B 5J9PB 1NCDH 3LKNB 3NCEB 4UQ3B 4X8XA 1KT2A 2BVEA 1INEH 3RFZC 4NN5B 15C8H 2AI0H 4HBCH 4F15B 1K5NB 3FB5B 4PJ5E 5E8PB 4FA8A 1GC1L 1RZFL 4ALAL 4HXAL 4LCIL 2VZOA 3PHQB 4NO0A 3WUWB 4JAMA 1JYXA 4JPIB 4F7PA 2DQGH 2FWOA 5KN5B 1KIPA 1OAUL 3DXAE 1JWUA 5GS2D 3WFEL 4HBQA 5CJ5A 5HVWA 2C7UA 4WWKD 4IBLT 3BPLB 3K3QA 2R2BA 3SKJH 1CU4H 1OT2A 4PJFF 3CXDL 4KUCF 4LSVH 2IH3A 4DN3H 1PKQB 2DJSA 4QRPE 3LS5H 4M7KH 3U82B 4JFOA 5HI5D 6CGTA 4YLQT 3VD7A 1MH5A 1MFEL 3H8NA 3EHBD 4FQCL 4U1HA 3T0EC 4Y2DD 4DKEL 2VWEC 3W2DL 2GCYB 1T1XB 1YUHB 3F6LA 1DBAL 3H9HA 4IS6A 2NW2A 2NY2D 2NTSP 3W5MA 2X89D 3ARFC 3IF1A 5T1KB 1G7LA 1WAAE 4S11A 1MI5D 3BKCL 3QJHB 4E5XB 3MYJA 5BZWB 5IM7A 3O11B 3P0VL 4RMSA 4Q7DA 2B8OT 3PWNB 4YEEA 5DI8A 5JIHA 4YQXL 3X11B 5JR1H 3NCJH 1S7TA 4ZO9A 3RRQA 2YD8A 2IQ9H 2VO5A 3LQMA 3TJEH 4EXKA 2P5EA 3ZE1F 1H9VA 5D7IB 1NCDL 5SWZB 2XWBA 1B4JH 4GRWH 4I3RL 1XIWA 3O2DH 4PGDA 1BBDH 3SQBA 2HKFL 1FNSH 1J0YA 1VFBB 1AD0B 4JVPA 3CK0H 4R7DA 1GGCH 5EN2A 3GSXB 2Q86A 5JW3L 3D3VE 3A6BL 3JTTB 1NGQH 1MJUL 5DC0A 4PJBF 2Q76B 4CJ1A 1I1AB 1KEGL 1DBKH 1KB5H 3HAEG 3JTSA 3X14A 1V05A 3QCTL 5CWSB 5F7EL 4K2UL 1U58A 2D7QA 4HWBL 4GRMB 4LDLB 4JFDD 2ATPA 4GAJL 2YC1B 4P5TB 1JGEB 2OQJA 3ULSA 4EJ1C 1X5YA 1UJTA 4S2SA 3BZ4A 5EU4B 3QPXH 4QCIA 1MCEA 3UYRH 3MV9B 1HH6A 1A6TA 2R0WL 5ISZD 4HDIA 1FAKT 3K7UA 1WBYB 3KPNB 4XWOD 2GK2A 2V9QA 4RGOH 2E7MA 4DKFH 1D9KB 1T1WA 3DSFL 1QLFA 3BDBA 1BREA 2WWKT 4OJFH 2A6JB 4XAKE 4MZ3A 5GGRY 3BRDA 1BEYH 4RIRA 1HXYB 2R69L 2N56A 2NZ9C 1EPFA 3P9WB 1XGRA 2YSSB 2DMKA 3TBSB 2MCPL 2HT4C 3VG9B 4RA0C 4RMUA 2FL5A 3NFSH 5HD8C 5CD5C 1NBVL 5JW4Q 3VFWB 2OTWA 1NSNH 5GS1A 5SWZA 2ICEB 5SWSB 1MCWW 2BC4B 4I4WA 4W68A 2GSGB 2RR3A 5ALBL 1LEKA 5FUOL 3SQOL 3C09B 1RZ7L 2OK0L 2JJSC 2DLFL 3CK0L 1T7VA 3SOBL 1A2YB 1BFVL 3HFML 4XVSH 2KBGA 2X41A 4B5EA 1U8NA 3IRPX 3WUWG 1CFBA 1L6ZA 1NCWL 2W92A 1RZGA 3L6FB 5C8JB 2CLVB 2XQYK 4HK0B 1HINL 5E4EB 1CF8L 2IAMC 5TQ0L 4LU5L 3EOTH 1I8KA 5F7NC 4EVNB 4RBPH 4Z7VE 4KJWD 2OZ4H 2F54D 4JM4H 1IAOA 4PS4L 1W8NA 3HC4H 5GRVK 4KKBD 2E27L 5FYKH 4B0MM 4IRJB 3OTTA 5DDHB 3T8XA 5IVZB 1JHLL 3BSZH 3LQAL 4D9LH 2Y36H 1MCWM 4OKDA 5IFHH 4UILH 4NUGH 1U0QA 2NW2B 2NXZC 3FB8A 1KC5L 3LZFH 3Q1SH 5IQ9B 4XPFL 5AYQA 5LWYL 1RSFA 1JHKL 3S5LG 3MV8A 3NN8A 1S9KC 5CEZH 2DS4A 7CGTA 4HLZG 2YD1A 2MQ3A 1T7ZA 3AXLB 2X1PA 3P73B 4ZTPL 1KLUA 3JSSA 3L3JA 5KS9E 1OCWH 2YUXA 4YFDB 4OZIE 1PKQA 2HH0H 35C8L 5E6YA 1OGAA 3IS0X 4IDJL 1HYSC 5GS0D 5FCSH 4N0YL 1FYTE 3DV4B 2DQHL 1OPGL 5DVNA 3WIHA 1CIDA 2BVOA 3MV8D 4KJPC 3VGBA 1PG7L 3GMOB 3TZVC 3OQ3B 1VESA 4L8BB 1L9MA 2CDEB 1CXKA 2M26A 3IDNA 4D94A 3ULUH 4U1JA 4O2FA 4JM4L 4M1GH 4MD4B 5BV7B 5K33A 4OB5H 2F54A 2NXYB 4N1CA 3TT1H 4Q0XL 4P9HH 3HPJB 5CINH 5ITBL 3GMQA 4P48A 3U7WL 4JO1L 1RHFA 3BEWA 5KSVA 2VZ3A 4BH7B 3ZT6A 1PFCA 2FATL 1HINH 2J7LA 5D1XA 3ZHKA 3BUTA 1F3JB 1G0YR 1DQLL 2P5WE 5HI4C 3WLWD 3HC0A 2LU7A 4R4BB 1JYWA 2J6EH 2VLJE 3N0PB 4ZNEA 3DX9B 5CBAA 2DQGL 4PS4H 5DJZB 3T0DA 3BPOC 4MQXC 4IRSC 1UJ3A 4NT6B 3T08A 5MEOB 1U8QA 4JM2B 3OF6D 1PYWA 4OIBA 1N4XH 5B39G 3RVXC 5ALCL 5AZEL 3U0PA 3W9DB 4B7LA 4XNMB 2OBGA 2ZJSH 4PYHA 4I0PC 2DYPB 5DUBA 3Q3GB 1YEHH 3HZKA 4JQVC 4X5LA 2P44B 4HFUL 4JRYB 2VN4A 4MAYD 1MY5A 2BSSA 2ZOKB 2OJZH 3PWUA 1YNTA 2X1QA 3GHEH 4NQCA 4X7EC 5F1SA 4PJ7A 5KVDL 2ZZUT 1LWRA 1QFWM 3L5WB 1ZLUH 4GKSB 1HILA 1N7MH 3D25A 3UZEA 4LEXL 3D85D 4XNQA 2FX7L 4FMFA 3ILPB 4LVNC 1EO8L 1G6RL 2ORBH 4NQVA 1MHPL 1UH2A 3U9PL 3M17B 5F93C 4OZIB 3AREA 1J12A 2IPTH 3X13B 1RZKL 1SJEA 5HYFA 3U4EA 1F6AA 5MP6H 5GZND 3E1F1 4DZBB 3UBXB 3MJ8A 3QPQD 2XKSA 3TF7C 2ZPKH 3QXWA 1INQB 3TT1L 3LKPA 4QXGH 5TQ2H 1M1SA 1ZWIA 3IU4L 4EIGB 5IB2A 5J56B 1OQXA 1JZ3A 1M05A 3QDMD 1GOFA 2AQ1A 3RVVC 4M4PA 3LN4B 3MPCA 2B2XL 5D2LA 1AD9A 1FAIH 2VXSL 3UXFA 3OL2A 2DD8L 3BP6A 4YIQA 1NBVH 3JV0A 4K7PY 1FFPA 4HWNA 1KLGB 1PVHA 2IQAA 2DWEB 1NBZA 1WITA 2DOCA 4W4OA 5GGQH 3FN3A 5F71A 5L7XH 4I48A 5J3HD 2FGZA 3HI5H 4N0UA 1ZHBA 5FECA 3U48A 3QDAA 4HQQL 1W8OA 4EUPB 4JFXB 3B2UD 2PTVA 2YEZB 1BQHG 5FKPA 1MFAL 1YYML 2WAHA 3NIFF 3ARRA 3DARA 2ZOLB 3KPLA 4LF3A 1V5JA 1I9IL 2HVJB 1WTLA 5ISZA 3SQOH 3DBXB 3AU1B 5C9KA 4JY5L 4G6MH 4ETYA 2W60B 5LJYH 2CLZA 2V9TA 4JFDA 1X9QA 5DVKA 4F8TA 3NA4A 3DUSA 2RFXB 4PR5B 2IC2A 5ETUA 4EN3B 4P3DA 3ULVE 2Z4QB 3ARBC 1DBML 4AH2B 2KUTA 1OARH 1UQSA 4XTRC 1FZKB 1KEMH 2V6HA 4ZTOH 3PXHA 5ANME 5A2LH 4FHBD 1TZHB 1VPOH 2QKIB 3LPGA 2OK0H 1MCOL 4YJZL 4TVPH 1R5VB 4YFLI 3RKDD 5IHLB 3WE6A 4QWWD 2PYEB 4GOSA 4X6DA 4JR9H 2P5ED 1I4FB 4ONOA 1Q38A 2D2OA 2AV7B 3P77A 3QIUD 2WIIA 1IL1B 2PYED 1XCTB 3I85A 1G6VK 3LY6A 2WBJC 1QSEA 3TFKC 3FFCE 3O81A 2EIDA 5CIPH 2C5DC 4L9LB 1FDLL 4PJCF 2EO1A 2HA1A 4O02H 3TO4D 1X5HA 1F5WA 4H5SB 2BY0A 4AIZB 3MOBL 3AREC 4KAQH 1BX2B 1PBYA 4KTDH 5CKAA 5L9DL 2P49B 3ZDZE 3SDCC 5AG8A 2Z35B 2JJSA 1HNGA 1JTOA 3MV8E 1CYGA 3MNZA 1MREH 1QYGL 2PO6B 3CFDB 2W9EH 3L5XH 2ZWLT 3CNKA 1NLBL 4ODXB 1PDKA 4OCRH 4CU7A 3HS0A 1ETZB 4OZIA 5HVHC 4JFHE 5DC9B 1W72A 1P7HL 3MRPA 1BVKA 3QQ9C 4NQEE 4F33B 4NKIL 5I6XB 5M94B 3VFVA 2BSTA 3FB8B 2HLFD 3CLEL 1OP9A 2EDTA 3PNWA 1OSZA 2VXTL 1J0HA 1M7XA 4EI5C 4IRJD 3M8OL 4FNLH 4TULH 4K9EL 1N64H 2F53B 2VDNH 1GC1H 1QRNA 1FZJB 1RZFH 1U8MB 2EDDA 2YMXL 4X6CB 2EH7H 2Q8AH 1VGKA 3E6HA 1KB5A 1NLDL 3IAPA 1LDPL 1IEBA 3BT2H 3EJZD 1DQTA 4LARL 2BXZA 4YHLL 1BJ1H 5DJYB 4U1MB 5F96H 1A14H 5C2BH 4KROD 3D5OF 2IBZX 4RWHA 1F2XK 1KUMA 4FXKB 4AG4L 1XR8B 4NPYB 4Y5YA 1TZGH 4G6JL 3KPRA 1DUZB 4QTIL 1J18A 4TTDD 2FGWH 3MYZA 3VI3F 1H3GA 2VN7A 5F1KC 3G04B 4TNVK 4DEPC 3BD4A 4KKAD 4MQ7B 5L8LB 2E7HA 4QLRA 1EBAA 1K4DB 4LASL 4ZSOA 2FO1A 5C09B 1KN4L 3CX2A 1A6ZA 5HYJA 4HS6B 3SGEI 2VTFA 2IPKA 3RY6C 1MF2H 5E6ID 1A4KA 4L8DB 4PRPA 3L3OA 5J4MA 4WWID 4LOUD 1UEMA 4OIAA 2QQNH 3DXAD 4P4RA 5FYJH 2X9WA 3WLBA 4MD0A 1A1OB 1FFPB 5DRXB 3FO0L 5T1MB 1TNNA 4HS8L 4KRPD 3BP4B 3G5VB 1KTDA 5D7IF 4J3VA 4U49A 3MLUH 3HI1B 4LCUB 3TJEL 4DQOH 5AZ2L 1KXTB 5TE6H 5GGSA 2D7TH 2ENSA 2X4OB 2DJ4A 4OFDA 3BP5A 4PRID 3IJHA 2IMNA 5LGJA 4U1GB 3IJYB 2VE6B 2NY3D 3UTSA 2NY6D 3HG1B 4JFZL 1KGCD 4GRWE 1N64L 2VDNL 2W07A 4XMPL 2VC2L 3QUYC 1UJ3C 1JPTH 1S5IH 2NY2B 3MJ8B 4NCC2 2VZTA 5KJRH 4LSQL 5JHLL 3F7YA 4CNIA 1JI1A 1QHPA 4PJHB 1OW0C 5DJYA 1F11B 2ZCLH 3M17A 4XP4L 5FGBC 3ILPA 2EKSA 2XZZA 1Q9WA 2OZ4A 3DV6B 4WFGE 1BOGA 3L7EB 4LBEA 1FNGA 1QRNB 1U8MA 2YRLA 1R3LA 2ADJA 4UU9A 2D4FA 2UUDK 1DLFL 4K3JL 3K2UL 4PJ5B 5I8EA 2GSIA 4W70A 1QEWA 3BGMB 3VXRD 2AEPL 4ODWB 1S7VA 1PX3A 5CWSA 3L3HB 1FIEA 2IFGA 3H3KA 4XPGH 4M7LH 2QHLA 4N0UE 4P5KA 4EI5A 4RGND 4N9GA 4WU5B 4MXVF 1A0QL 4OB5L 4J1UA 5I8OL 3NAAL 3EGSA 1HHIA 3SE9L 3EO0B 4TSBH 4LCYA 4I0PB 1AXSB 3BW9B 5CJBA 5BVJA 3KYOA 2DQDH 5T1KD 3S8WA 4APQD 3K4ZA 1N2RB 1ACYH 3DGGB 4LPVA 2X4RA 5DD0H 4PJAA 1TFHA 2HFFB 2ZUYA 3PIQB 4ALAH 1JPFB 3KPPA 4R8WL 3DROA 2UZYB 3TLRA 1QSFA 4JFOB 1NMBL 4MXVE 5DJXB 2FJGB 1ONQA 5E2TL 4PRHD 5IW3A 1ZS8A 1IM9A 1QFWL 3GM0A 3O3DB 1F3RB 5E8OB 5GZOD 1MIML 5IVNA 1VA9A 2BHYA 2XTJB 3W11C 3WFCL 2YR3A 4LLUA 1BIIB 1MCFA 3L3GA 3VFVB 1QFUH 3T1FA 4X6BA 3HRPA 1CF8H 3VA2C 4NZTH 4YWGH 4PB0H 2Z93B 3VFPA 3LH2H 4JDVB 1CXHA 1YY9D 3MRGA 4EN3C 3ULVC 3DUHA 4I3SH 4ONGL 2OI9C 1JZ7A 1DL7L 2IAMB 4R4FL 1GJIA 2XG4A 1OAUH 1U8JA 2OJEA 3MA7B 4F9LA 4Q9CA 4XPTH 2AXHA 4P2QB 1NGZB 1I7TA 3WD5L 4TVSa 5HHPB 1T5WA 5CGTA 4MDJA 1ZLWK 3DPBA 2CGRH 3OB8A 2H2SD 3GKZA 1QPXA 4U7MA 1R5WB 1RK1B 4HCRL 4HPOL 5I1GL 3WLBB 3VFRA 1ZGLB 2APXA 3RWJA 3C2AL 1MIEL 1GXEA 5FGSA 5J8OA 1CLYH 3QA3A 3QWRA 3RTQA 3LQAC 1SY6A 2DDQH 3EBAA 4U33A 1UFUA 2VXUL 3QRFM 5E08H 1YEFH 3UBXG 4HWZA 1A3LH 2AVGA 1S9WB 4U0RB 3G04A 3O41A 3V52H 3BPNB 2EXYC 3VXUE 1I3GH 2F8VA 1FGNL 2CIIA 4XCCH 3U1SH 1R3IL 4ELKB 5JPMB 2X89A 3KYOB 4X7TA 3P9MB 1CVRA 1FVEA 3RVWD 2R4SL 1LMKA 2AJ3A 3MLZL 3CVHL 2HG5B 2Q3ZA 2BNQB 3WS6A 5CLWA 2R2CA 2HMIC 4WEUD 2WQRA 2V17H 3V5DB 3TIDA 1A7PL 4GG8B 5CD5D 1LK3H 1ZA6B 4OLEA 1YEEH 5F7FA 1U92B 3GMLB 2Y9RT 5LAXB 5A3IC 2FO4A 3OKMB 2NLJA 4G6AD 4MA1B 4R2GC 3JUYA 4NZJA 5HHOA 2DQIH 1EERB 4JM2F 3Q5OA 1B90A 1WJ3A 5C0BD 2HN7B 3PNWB 4FQCH 3G6AA 3UTQB 1IBGH 1RFDL 1LO5A 4QRSA 1Z5LA 5JIPA 3QEUB 5FKAA 5I9QB 1CTOA 1OTUC 1CICD 5KVEH 3MLYH 3S37X 2N4IA 5EORH 2YPLD 5KN5A 3ULUC 5D1QD 4YXLH 3MGOA 1PLGH 4L3EA 4OD1L 1KTLB 3LN5B 1F11A 4QT5A 3UEZA 4HH8A 4DKAA 2IFFH 3ZT5A 4Z95L 1F00I 3MRHA 3IFNH 3HCVA 3MGAA 2R0LL 1OAZL 4TSCH 3A6BH 5GHWH 2Z35A 1PKQE 1MRDL 4JKMA 4KKBC 3BFOA 3GRWA 2PXYD 1B3JA 2G60H 5F1IB 1DBBL 4JFZH 3BPOB 5FOBA 4HT1H 2F58H 1KIQA 4ODHH 1ND0A 2VZUA 1LNUB 1KJ2L 5ACLA 1JN6B 1MI5B 5EOQL 1DLFH 1XEDA 2NYYD 4Y4KC 2BY1A 3NFSL 3ARPA 5IB3B 3CU1A 5E9DA 3JWDC 2YN3A 1FL3A 3BI9X 2ZCLL 2G2RA 1T80A 4JKKA 5CZKA 1FORL 4RISL 3H9SD 4BZ1L 4KI1A 5EH1A 3DRQA 1M4KA 4OFYD 4ZNEE 4OGZA 4YBLC 4CADB 2BNRE 2WUCH 4HKJB 4PJ5D 4U3HA 3DMMC 1J87A 3LVEA 4M8QA 2CQVA 5T3ZD 3IYLW 1WCBB 4KMTL 2BMKB 4GW1A 5I16A 3SCMB 4Q6IA 3GMRA 2A1WH 1F4AA 3ARFD 2Y6SD 5F7LB 1F4WL 1H15A 3BKJL 3IAGC 1WF5A 1I7ZB 5FIEA 3D69B 4OZ4B 3Q6FB 4HUWB 3SBWC 5KVFL 1JN6A 1MCLA 1P9MC 1FG2A 3W5NA 4BQCA 2B0SL 5I71B 4K3GA 4FTVB 1JGVL 3QHFL 3V8OA 4CMMA 4XCYB 5KW9H 5LAXA 4LLYA 3Q3GA 3GBML 4ODWA 4Y1AD 1JUFA 1Y0LB 3PGDB 1IAII 2ATKB 3D3VD 5IFHL 4GXVH 2QR0B 4ENED 1XH3A 2VSCA 4ZOAA 5T3XD 1I8IB 2ADGB 2UWEE 2RCSH 1J1XL 2X4PB 3QDHA 4J3UA 3ZKXB 5IFAL 1R3LB 1MWAA 4OCWH 3D0LA 2PETA 2YMXH 2JIXB 1PQZB 3GSUB 2C4XA 3FB7B 1W72H 1OAYL 5F3HB 3BO8B 3MGTB 3HC0B 1WC7B 4K3EL 4N1EA 4PJ9A 4YPGA 5TDNB 5E95B 5DVLA 4R4FH 4X4ME 4NZUL 3O6KL 2ZSWA 5JDJA 5E4IA 4G6FD 5E6IB 2E6JA 2UZIL 4JO3L 5B4MC 2K3TA 5C0EA 1ONQB 1JHKH 3L5JA 4JFPB 4UILL 4S1RH 2WMPA 3K4AA 4AEHH 1YPZE 1J0IA 1IFHH 1C5DA 3B9DA 1BP3B 1KFAH 3ALWA 4M02A 4ISVA 2YUVA 5CIPB 1C12A 4XNUH 2C1OA 3W0WA 1KLFA 1MNUH 2BHZA 4DGVH 1MHCA 3LOWA 3MXVH 4ZXBB 15C8L 1BVZA 3ARGB 2Y06H 2I9LB 1RJYA 2HJFA 5GIRA 5AYUL 5T5NG 2ZCHH 1T66D 3HCVB 2LVEA 3VWJC 3O9WA 5TPWL 1U93A 1H0DA 4WCYL 1AXIB 4HS6A 5HGBB 4H0IA 1E4JA 3AREB 5KSUB 2ADIB 3G9AB 1A4JA 4RGMC 4YR6A 5DEGA 2W0LA 3TN0D 1U42A 1WK0A 2NYYC 1RUAL 4LL9A 1INDL 4JE4B 1S7VB 1BIIA 4R7NA 3ULVH 1CICC 2J5LC 1CDBA 3ULUL 1H8SA 2QQKH 2V2XB 4M7JL 4CDGC 4NCC1 4ZUTB 3QXTA 3RTQD 3FQRB 4G6KL 1VEPA 1PZUB 5IK3B 4FQXB 3T2QA 5IMOA 5HJ3A 2DI9A 2X4PA 3FONB 3NACH 1HKLH 4G9DB 5FF6B 1WZKA 2R2EA 2PN5A 2P5WD 5I1IH 1N6UA 5ETUB 3EOBB 1VEOA 5I0ZA 4DUXA 1S7WA 3WMSA 3C60D 5CEXA 5C8JA 4YHIB 4DW2L 3A67L 1RZGB 4OD1H 5ALCH 1MREL 3EAKA 4PV8B 4F2MA 1FVEB 3GM8A 1MCPL 4Y4HA 4NC1C 5EC1A 2DQJH 3NCYS 3HC3L 2ARJA 3P2TA 1AXTL 4OZGB 3KPLB 4H26A 4Y4KD 5I15L 5L0QB 5D2NC 5HGDB 3QUYB 3S35X 1U6AH 1ZANH 2ILLA 4XNZC 1IC1A 4YX2H 3FFCA 4G6AC 1X7QB 1ODAA 4KKNA 1JPGA 4PJEA 3MRIA 4G9FA 4D3CL 2ED8A 3QA3B 4WWKC 5F9OH 4NSKA 1AQDB 1BFOB 4AM0B 2L0DA 1CVSC 4NNXA 1WEJL 1GGUA 1S7QA 3O3EB 1P84J 1UCTA 4YC2B 4L8CA 5I75B 5FYKE 4FS0A 5JIIA 1FYTA 3SGDH 1UYWH 4I0PA 3QG6B 4TTDC 2EZ0C 4XX1E 1DBBH 1QLRB 5F6IB 3KVQA 4M1DH 4MA8H 4UINL 2L4OA 4BQ9A 1KCVL 1TIUA 2VZSA 2GJ6D 2A9NL 2QL1A 4G80A 1E6JH 3ARGD 1S9XB 3MUZ1 2Z93A 1IT9L 4S0SD 4FXKA 3DX8A 4X6DB 2JLLA 4D9QD 4F3FB 2XPGB 1SEQH 3MJ6A 3U2SB 1M71B 1XF5B 3ZTNL 3UPAA 1U91B 5CHNB 4Z7UB 1MJ7H 3C8DA 4NKDB 2CXKA 5JOEA 5EWIL 4CKVX 4IRJC 4WHDA 4H0GA 3CZJA 4P4RB 2ADFH 1FHGA 3PWPE 3KJ4C 2PTTA 2ZCKL 2W0FB 5C3TA 3QDME 4HIIB 4PJHF 4RGOL 4DVBA 3WNKA 4H0HB 4F37F 1OAKH 3PL6D 4GBXD 3IXTB 2R29H 4QRUB 5LXGH 1NAKL 3HUJF 1A6PA 2I27N 1UWXH 5DMIH 3MRPB 4HD9A 3S34L 1FP5A 4KI5C 2ZUVA 5GJTL 5I30L 2OXHA 1UKSA 3BYYA 2R69H 3FN0H 3DOSA 3GSQA 3LHPL 1K85A 3O4OB 4NJAH 1KYOK 4XBEH 3V6ZA 5A2KH 4PJGE 4YZFE 5JQ6L 1E6OL 3BJ91 1E4XL 5I1AA 1Z3GL 1IAKA 1D5MB 4ISVB 5CIPA 1L0XA 4XVUD 1K8DB 1QYGH 1MFAH 1YYMH 2VOTA 3CFKB 4LVOB 5EU3A 4UTBL 4GS7C 1AC6A 1CQYA 3RWGB 3N9GL 3OKLB 4Z0XB 5LGHL 4S1QL 3L3OB 4U2ZA 1IARB 3MOBH 1JRHI 5DMKB 4PRPE 5E5UB 3VMNA 3TNMA 5E56A 2W91A 3L95B 3H9SA 1DQJB 3SY0A 3G5XA 4D0DA 2X4SA 4WY7H 5GGRA 4FQ1L 3EOYG 2E5EA 3WCYA 3TM6A 4YFLF 3SKMA 1P53A 1LE5B 2GY5A 3OXSB 5ERWA 3BDYL 1NUGA 3CVHB 1T0PB 3UP1A 5EIIA 3KPOA 4G80B 5FUZH 4NPYA 4Y5YB 2YRPA 3C5SB 5EULV 2NW3A 3ZE0F 2CR3A 3Q2CA 1EEZA 3D9AL 5GRUL 2FR4B 1AGBA 4TSBL 1XF3B 5AD0B 1E27A 1QSZA 4R3SB 4KFZC 4WI6A 1YQVL 2BJML 5E9DE 3O6KH 2OSLA 1EA9C 2R9HD 4XRCB 1FNFA 5C07B 4MAYC 5K59E 4JGJA 4S1DD 1II4E 1HILB 4NNXB 2MCG1 4YHNB 4QRPB 3VWJD 5JUEL 4KZEH 4PJ5A 2PTTB 4ODTH 3HAEA 3KLHD 1F4XH 4HC1L 2Y1VA 4PD4J 4NBZB 3W2DH 5HDLA 3WFEH 4NC0B 3S88L 3QI9B 2WLZA 4UB0H 4PUBH 5GSRB 4CN4A 1UG9A 2Y07L 5FCUH 3F5WA 5IHUL 4KHTH 5DF0A 1XF5A 3NIDE 5GZNC 3EOTL 2DIJA 1A3QA 5KSAA 3H3PL 3MROA 1MVFA 3TO2A 5E00B 2ZUUA 4LCYB 4HFWA 3TGXA 1WIUA 1EAPB 4R4NC 5SX4I 3DIFA 4XZUA 4PJAE 1X4ZA 1AD9B 4LPWA 4P59H 5HDOA 1C5DB 2BVPB 1LK2B 5JIKA 3OG6B 5I8KH 4IRSB 1DBAH 2CRMA 2VAAA 2H9GB 2UYLB 3LQZA 1CT8B 5B8CA 3UJJH 2WP3O 2DQJL 1F13A 3F12B 2Q1EA 2FH6A 4HGWB 2DQCH 2OYPA 3A6OA 2Y4SA 5JXAL 5DK3A 2BVUA 1FGVH 5F7DB 3LEVH 2NMSA 1NBYA 2PYEA 2F15A 5FKPB 2E7LA 3AGVA 5KOMC 4OCMC 3UZQA 5CINL 1R3KA 2HLFC 1FZMA 4X5XB 5EC2A 3RDTB 4KRNA 3QWRD 1Q9LA 2D03H 4LKCB 4JVWA 1TJHL 3GNML 3SE4C 2CGRL 2CKNA 5CJQL 2VLRB 1PY4A 4FABH 1BWMA 5BRZB 3K1DA 5AD0A 3SJVE 1N3NB 4ZUVB 5KJRL 1AIFA 4OLZL 2EKJA 3EJYC 4OF5A 2J6EL 5ABDE 1NGXB 2VISA 1WWWX 4QXGL 1A6WL 5TQ2L 3E3QE 3A6CL 1AGEA 3AAZA 5H2BA 5HHVH 2FO4B 4MX7B 5E5RB 2MPAL 3SKNA 5CUSL 3KYMA 3QISA 5IVXB 1U8LB 2OTPA 2L7JA 3RVXD 2WZPD 1RZKH 3V7AG 3WS3A 1IC7H 3BH8A 4Q97A 3HMWH 4WWKB 2EE6A 4EQ2A 5BZDA 2P8LB 4XP6L 43CAB 2OCFD 1VSCA 3MACL 1PW3A 5ID1A 2APBA 4MDIB 4PRPB 3BE1H 1BFOA 2ZKHL 4ENEC 1LO4L 5EWIH 3VFMA 1AD0A 4R7DB 2CIIB 5F97E 4QWWC 3WJJA 2DQUH 1IFHL 5EU3B 1HZHH 2OL3L 3BGFC 1XIWB 5FV2A 3BGFB 5D7IA 1H5BC 2PXYC 3M45A 1ZXQA 5JQ6H 1NC4B 3P4OA 5INCB 1L4IA 4YHOH 4NQTA 3WHE1 2A6IB 5DQJB 1L7IL 2KH2B 3BP7B 4ZQKB 5JQHC 5C0ND 3TO4C 5HGHA 1OF2B 1AO7B 1FNLA 3IU3B 1AE6H 5CP3A 1KCKA 3FO1A 4Z9KB 3KLSA 1QRKA 2HJFB 1LEGB 3VRJA 2DTML 3BWAA 4P2YA 3PWPA 5D7KD 5BMFL 1MIMH 2KZWA 1RURH 3VXNB 2D31A 2Z31D 4FQQB 2JJTA 3QDMA 3HE6D 5D9SA 4KJWC 1Z9SA 2ADFL 3ZMRA 3SEPA 5IB4B 1HI6B 3ULUF 2DBLL 3TZVB 2O61B 1CFNB 1UM6L 2JJUA 1KIUA 1IEAB 5SWQA 3VXQB 1P5UA 1AQDA 4IEFB 1WFTA 1OWWA 4PB0L 4UDUB 2V2WB 1BOGB 4WV1B 2HRLA 4MLIA 1MFCH 4YAQB 2Q3AA 4O58H 3DI3B 3DRQB 4P49A 1W2KT 3BQUA 2BX5A 4PJHA 5JPNB 4ZFGL 1D6EA 1X3DA 2NY5C 1I9JH 2ADIA 3HZMB 3X12B 1OSPH 2NY4B 3IFOB 4FFZH 5E2WL 3WJLA 4WTXA 3ME0A 4XPFH 4MD4A 1UACL 1XF4A 3HNVL 3QXAA 5EU6A 3U9UB 2DQHH 3GMLA 5K93A 1HSAA 4KTEH 3OSKA 5EOCJ 4N8VB 1WZ1H 3C9NB 2VDLL 4GG8A 2F19H 2C9AA 4ONGH 4R4ND 3ZL4H 1JMZA 3CFJB 3EZJB 5JUEH 4XHJC 5I66B 3ULUD 2GKIA 1WISA 3I6GA 4CBPA 4JPWL 1F8TH 5I71C 5GGVH 5IMOB 2A9MH 4FTVA 5F21B 5JOPD 1URLA 4HFWB 4JKLA 4WU5A 5J06A 4YNYA 3GMMA 4WUUA 2BVQB 3W9EA 1HK6A 2VUOA 4QNPE 2ZSWB 3DXAA 4ELMF 3MRRA 4GLRH 4LPXA 5MENB 5EUKA 4TSAL 1T1ZA 3LMJH 3IXTA 2BFVL 2VR9A 5LVEA 1IAMA 1UXWA 3Q6GH 1BZ7B 3IDJA 4UBDD 2F53D 3C8KA 5I1HL 1CGSL 1RUQH 3QYCA 5F3BB 2ZOKA 4QRPA 4PB9H 3B5TA 5I6XC 1YQVH 2BJMH 2EYSB 3PP3H 3RZCB 43CAA 4JRWA 3NTCL 4OIIL 1U8HA 2P4AB 1A9BA 4EBQH 2C1OB 1B0WA 1GPOH 5CHNA 4OGXL 4MHHG 1FC2D 4XVUC 4J8RA 3LEVL 4H25A 2QR0A 4M9PA 5JZ7D 5F96L 4WFFE 1TJGH 1F3DH 4NNPH 3O8XD 3BOVA 2WANA 5ANMB 1IGCL 4RCAA 5FHAH 2H1PL 5DJ8A 1FZJA 3SDCB 1T83C 2IADA 1H3WM 4IRSD 1NGXA 3RKPA 4LHUD 4Q2ZA 2QLVB 3RWCA 1ZA3A 2R2BB 4M6MH 6FABH 4PFEA 1MRFH 4PJ9C 3SE8L 2E6QA 1K6QL 3H9ZA 3B2VH 5FYLD 4EZMA 5H35B 3VH8B 5E8DH 4PRPD 1DZBA 4N0RA 4JY4B 2GW5A 4HJJH 3RKDC 5EZLB 1LP9E 1FL6A 4DEPB 2HLAA 4IOSD 5HXMA 1IGMH 3LCYA 4PJDA 4JJ5B 3IS1X 4QYOB 3S37H 4B50A 1A7BA 4C56B 3B9EA 5D2NB 3UJIL 4YO0B 3KAAA 5ADOH 4MNHA 5D9SB 5SX5H 1EAJA 4LNVA 3GO1L 1XGTA 4Q9RH 3LDBC 3P9LA 4GLRI 1OGAB 4S1SH 1I7TB 1U36A 5FYJE 3AC0A 3AMKA 4LPUA 3FB6B 3SE3A 4L9LA 5DO2D 1FORH 4RISH 4BZ1H 1P7QA 5C07D 4MXWH 2EDLA 2A6DA 5C0CA 3MTRA 3BP7A 4JREB 3IKKA 1O7SA 2VL5B 1T4KB 4J2XA 5CZVL 2YZ8A 1UM4H 4P2OB 4OV6F 5EO1B 5BS0E 2A1WL 1WFNA 2F5BH 1A7QL 3IDMA 4AENB 4XP9H 3MBXL 5TDNA 5DLMH 1GZPB 4TUJA 2HJLB 3WSQL 2IPUK 4ORZC 3OKOA 1LO4H 3INUL 4PG2C 2X4QA 5IVZA 5C6WH 4LVEA 1MQKL 2FJHB 3QUYD 1AP2A 3BIAX 1W0YT 1FBIL 5L2JB 1P5VA 3QJFB 2VUYA 4AL8L 4GXVL 5F7WC 1FYHB 2HN7A 4X6DF 3IGAA 4QTIH 4NQCB 4U31A 2O5XL 5IBUG 3E3QC 5FFLA 3A0OA 3QFDB 2NY4D 4OCSH 5H37G 4WI8A 1FL5B 3F7RA 1U3JA 1FRGL 2XQBH 5CBEA 3W39A 5FOBB 1KTRL 3KS0H 5DEGB 5I76A 5F1IA 1KACB 1MJ8L 1YEGH 2NY1B 4HZAA 1OT1A 1S9VB 4PGCB 5DR5H 2I9TA 3FOMB 1S5IL 3OXRB 4X9FA 1VPOL 3P40A 1TVHA 3E0GA 1E4WH 2EYTB 4L1HA 4NKMB 3E2HC 4YE4L 3DVNB 4P23D 3RDTA 3RUGF 4M43H 4U1IA 2UWEF 5DHYA 4BH7A 5AAMA 3MRCA 1N6VA 2CDFB 1RZIA 4MQSB 3SO5A 1HKFA 1NAMA 2VLJB 4OKVB 1XMWA 3LQAH 1W0VA 1JPSH 2CDGB 4R26L 4ZAKC 4CRPA 3WJJC 3PIQA 2PF6A 4L9DA 3S96A 2COQA 1ACYL 5HHQA 2G5BB 1ZTXH 2DM4A 1RJLB 4YBQD 2NXYC 3RL2A 4F2MB 4PJHE 3VDAA 3C6LB 2VLLB 1SM3H 1PZ5A 4S2SB 1HHIB 3NCMA 4JZNA 2W65B 3GHBH 4FQHB 2N7BA 4NKIH 3IKCB 1T7YA 4H1LG 1NCWH 3IJHB 4KK8D 1G1YA 1MHEB 5C0AB 1HIML 5J0BA 3JWOH 3UAJD 1IEBB 2JELH 5LG1A 4HUVA 1YQ2A 1JWSA 5DS8A 4Z7NF 4WFEE 3MXVL 1T20A 4Y16A 3QEUA 4OUOA 2R0KL 1CLZL 5FUZL 1KNOB 2DICA 3D0VA 5IMKA 3RWDB 4KROC 3GSXA 3MV7D 3D87B 5FM4A 3HR5A 5GSVB 1UENA 4NJ9H 1ZLVK 4GRLB 4DK6A 4DOHE 2R8SL 1JPFA 3NTCH 2Z91A 4OT1H 1T7XA 5CD3A 2XQYG 4YXHH 3HS0B 1NANI 2F5AH 4XCFH 4OM0L 1QBLH 2R2HB 1QFUL 1AGBB 1R3JA 4O51B 4U1LA 1VFAB 4S1QH 4E5XA 4NO0D 1MEXH 3RNQA 3DX8B 2FZ3B 2OJEB 3MA7A 2ZNXA 3ALPA 4E9LA 3O2WH 1G6RB 4XPHH 2EEAA 1BBJA 1AHWC 1A6TB 2DKUA 4QRRD 4G7YH 2J8OA 3RHWF 3S35H 3QWQB 4MNQB 2EICA 2XA3A 3ULVL 2H1PH 4M62H 1KB5B 1FFOA 3DSNA 3O6LH 5IW1A 1FNSL 5I2IB 5ESQB 4UAOC 4GQPH 1IGYA 5DD6B 3BN9C 2H26A 3N1GC 4OZFA 1KB5L 4GMTL 3B9KB 4A2MA 4QTHB 3K81A 4X8JB 1WICA 1BEYL 4L8BA 3MLWL 1JHTA 1D9KC 3NIFE 2FX9L 3CFBB 1CI5A 4DUVA 5FO8B 4PLKC 2MWCA 3LPWA 4LASH 1Q94A 1Q1JL 5DVOA 4S0TD 2P5EB 5FUCE 5FKAB 3FOMA 2R39A 4XP9L 4LLAA 4TN9A 5HD8D 5CLTA 1FNAA 1LO5B 2PTUA 2VJXA 2R0LH 2F5BL 1YMMB 5L2JA 1RIVH 2R15A 1RVFH 1BZ9B 4Y4HC 5FGCE 3X3FL 2ATKA 2RFXA 1ZVSB 4ONFH 4XP4H 4U6XA 1LO3H 3SDDD 4MXWL 4ZAKA 3BMWA 4LIQE 4PRIA 3W39B 1KG0B 4D0CB 2ENYA 4LHJB 3MV8B 3NN8B 5F7EH 3WNNA 25C8H 4U3CA 1YPZF 2VLKD 1I9EA 5IROA 3JTSB 1MHPH 2WK2A 1MH5B 2CKBH 4LLVA 1XFPA 5JHLH 5A3ID 4JRXA 2DM3A 3JBG7 1E28A 1YEIL 4JZJB 5J13B 3HMXH 5SX4H 4DAGH 1KJVB 2MHAB 3RGHA 1DJSA 5D72L 4IMKA 4U6YA 1QR1B 4OLYL 3RWFB 1EZVX 3PDOB 3TCLA 1WZLA 5BS0A 1F8TL 4NHCL 1QG3A 4FQLH 3DO7B 2FECL 4ZODA 1CGTA 1M6OA 3HE7A 3TA3C 4L29A 4JRXD 3MO1B 1MCSA 3V6OE 3RJDA 4WHTA 1T2JA 5JNYB 3Q1SL 5A40E 1A47A 2FBJH 3CDYA 3QXDA 3BDYH 3BJLA 4ZXBA 1MJJA 5L2KE 3T2OA 3TT3L 3SKNB 3VXPB 3ELAT 5DQDL 3G6JA 5J3HC 3HI1A 3VFWA 4G7VH 3QH3A 3G5VA 3F62A 1QEWB 4M7LT 4MS8D 4UZGA 2FLRT 5JXEA 1X4XA 4L9LC 3DO3A 2WM0A 2FYYA 3VFTB 2E3VA 1FL6B 3SDXE 4WHYH 2X4NA 3VFGH 3VXME 2DQFB 3NCYP 3O6FB 4PPTA 2QSVA 4UBDC 5ANMA 1KC5H 3LZFL 3KXFD 2YWYA 1RJCA 2BNQE 4JHZA 2AJSH 3GJFK 4C54A 1UWGL 4GKZB 4KQ4H 3V8CA 2B4CC 1IJ9A 2CH8A 3RX8A 4ELME 4KKCD 5DURD 4F3FA 1XF2B 5IMMB 1C7TA 3MRNB 4XPAL 3F7YB 1OTUD 5HSFA 4LSSL 3UTQA 3T65B 5LBSL 5HHNB 5CJXA 3JV4A 3MV7A 1NCBL 2ED7A 4JPKH 1IAOB 4K9EC 5BV7H 1P4BL 4Y8AA 3PP4L 5DYOB 2FATH 2YXFA 4TPRH 1ZA6A 2BVPA 3U0PB 5C08B 1SM3L 32C2B 3I75A 3QNZA 1JGVH 3QHFH 4XCEB 3S7GA 5KW9L 1A9BB 2VR4A 3GI9L 5MEQB 3FQUB 4UT6L 4DZBA 3C5ZC 1UM6H 3Q5TA 4F15C 2GITB 1MFDH 2JCCA 5M7QA 2VIRA 4N9GB 4Z7UE 3RVVD 2YBRA 4U05A 5KZCD 5IGXH 5HYJB 5HDQL 4QGTA 1IL1A 4WW2A 2YPVH 1LQSR 5DD5L 4XNQB 3QO0B 2X4UB 3L3DB 5FDWB 3DWTA 1B0GA 2NNAB 4N0UB 4QOKE 2VDRL 3WXWH 5IBTH 4LCCB 5AWNL 3BVNB 4PJXA 1OAQH 1IE5A 4NZRL 3SDYH 5EZIL 5IOPA 3OR7B 1RK1A 2YXMA 3L7EA 5D8JL 2P8LA 1G9NL 2DM2A 1DQML 2W9EL 2E9IA 1PD6A 1G7HA 3H9HB 3I6GB 4PJDF 4HULB 1U8LA 1IC4L 3C09C 3N1PC 4BELD 1EVTC 4KVCL 1I7RA 2Q20A 1SY6L 3OJVC 4PLJD 4XNXH 3ARFB 1NAML 4P59L 3L9RB 4M1CD 4XMLL 1A7NH 3CX5J 3JV5A 2D0FA 3IDGB 2LABA 2BVTA 2CO7B 4X6EA 5IF0A 2J4WH 3D2UB 1CR9L 3BKYH 4RRPA 2IQ9L 4PTUB 4FQ2L 4PY8J 4W4NA 4PJAF 1JI2A 1VDGA 5JPNA 3MLSL 3WNPA 1G7IA 4MS8C 2JKXA 2AJUH 3ECBB 1ORSB 1ZHBB 4JPVH 2HJKB 4NP4L 5IOPB 5IW6B 5H8DA 5HYSG 5HTSA 3WFDL 4OTXH 5T3XH 4JO4L 2EIZA 1T6WA 3EYQC 1H0DB 4TVPD 3CZFB 3OKDB 3NCBB 5AUMA 5I73C 5AG9A 3KPMA 1BFSA 4P9MH 4MVBD 3UPRA 3ZYIA 2I5YH 1F58H 4O9HH 1TCRA 1A6ZB 4XB7A 4JY6B 2D31B 3TCLB 1IC7L 5F7YC 2CLZB 1V7NL 2Y7QA 3AS3A 5I19L 1S3KL 4G9FE 4RMTA 4Z5RA 3RY4A 2X7LB 2GQHA 1U3HB 2GITA 4WUUE 4DAGL 4OV5A 4P4KC 4WFFD 1MF2L 5F1OB 3PG2A 1F3DJ 3O2DA 3RU8L 1L0YA 3EDDA 4Q6IB 4V2BA 3TIEA 4KKAC 5I17B 4MJ5B 3VXUD 1EAPA 2O5YL 1QA9B 1OVZA 2A38A 4JHAL 4LSPH 4LSQH 5CBAB 5ICXB 1GC1C 5JW3H 3E6FA 1MUJA 1B2WH 3WO4C 4OM1H 5CSBA 3QEQA 2YPLB 1A1MB 2XRAH 1BD2A 3VCLB 4PGEB 4R90H 4KV5E 2G75A 5E1HB 3ARBB 3QP3A 3IFLH 4QKXB 4XP6H 3UJTL 4RAHA 5KSBF 1JGLL 4LLVB 4X4XB 4ZUVA 3BAEH 3MC0A 4PJCE 1CD1A 5I1DB 4Y4FA 4EOWL 1D9KA 4Y1AE 1MCQA 1SEBB 2DLEA 4XBPB 4OSUH 1JWUB 2CUHA 5BW7A 3AAZB 4ZAKB 4OCWL 3INUH 2XKUA 3WS6C 4HDIB 4PTUA 1U8NB 5EUOE 3JZ7A 3L3KA 3SKOB 1T83A 4Y19A 5HHPA 4TUOA 5IR1B 1BZQK 2EC9T 3RBGA 1J1PH 3GIZH 4MJ4A 2AKRA 1A6AB 2YWZA 2AGJL 1X5XA 1UKQA 4K94C 1TVBB 2ICEA 2J8UE 5SWSA 1FZOB 1ZT4A 2VH5L 3RIFK 3QXDB 4ZOCA 3U0WL 3W81A 1I7UA 4X99A 3N50A 1OP3K 5DMIL 4LFHD 3VWKB 4S1SL 4LAQL 4Y0GA 4H88L 2FRGP 1NFKA 2W9DL 2UWEA 5BS0D 3IDXH 2LU3A 1UXSA 2BSRA 2BSSB 3HUJE 5HHOB 1VFOA 1ERNA 1EEYB 3OKNA 3OZ9H 1PEWA 3LKSB 4F7TB 4X7FC 3RWGA 2BOBB 3KR3H 3M8OH 1SYVB 2W9LA 4K8RH 2X4UA 3PDDA 5IIEB 5TJWK 2EH8H 3IXAA 3RGVD 1NJ9A 2DQDL 1FH5L 3HNTH 2C3VA 3HR5B 1MWAL 5LXGL 3T3MF 4NQED 3TO4B 4ELMA 5FA4B 1XR8A 1U3HD 4LARH 4LP5A 1A0QH 5D2LF 3ZL4L 1F6AB 4GKNB 4PJGF 5C0IB 4DTGH 2ICWI 1DN0B 1KCRL 2JCCF 1W0WB 1HEZA 3HE6C 3VWKA 1TMCB 4YHKL 3MNVB 4NO3A 3KHOA 3MLVH 3QG7H 2NXZB 5LBSH 3AXLA 3FCTB 1OPGH 1FO0B 1FFQA 2VQUA 5HPMA 2P43B 1JP5A 1G9NC 1GIGH 1MHHA 1VHPA 2C3WA 3MRBA 3P4MA 3PJSB 4FQJL 4JZJC 2FGWL 2R1WB 2LVCA 3WIIH 3V0VA 1N5AA 1EHLH 1T0MB 4KZEL 2Q86B 3QXUA 3LH2L 2H2PD 3NH7H 4QRPD 4YQXH 5JLZA 5JR1L 4Q0XH 4DFHA 3V4VL 4TOYL 5D5MB 3EJJX 3NACL 1NJ9B 5FDYA 2G5BA 2ITCA 1A7RL 4I77H 1A14L 5C2BL 5IMMA 3ZKXC 4LDOB 1RUQL 2NR6C 5HYIA 3NFNA 2AJZB 4YDLC 4L3CB 2EE9A 3KDMA 4CDHA 2HWZH 1NGQL 4LRIC 3IKCA 3H9SB 4FQHA 3MQIA 4WUUD 4PJ8C 3OAZH 4LDEB 4KK9C 4MA3B 4RGNB 4XC1L 3MRFA 4NO2B 1AXTH 1WLHA 4N8PA 4M9OA 3S6CA 2HRPH 1BQSA 2X42A 1YYLL 2C4FU 4IIQA 4JPVL 1WFUA 3VFPB 5T3ZE 2MKLC 1J8HB 2FB4L 4MNGA 4E42B 5GGTA 4D9RE 1D5MA 3VXMA 1KSRA 5EG6C 4HWZB 3PABB 5HHOE 3MJGX 1B0RA 1B4RA 3PQYB 5ISZE 3CDGB 3KLHC 1F58L 1TCMA 1A6AA 3CJJA 1GZQB 3FO9B 3QUMB 5GS1C 1JPTL 5GQBA 2J88H 3DHJA 3VU2A 3ULVF 1D5IH 5I15H 3VE0A 3RVUD 2ZUTA 3NBNA 4MAUL 3GDBA 1IC4H 3GSNA 3S97C 1F90H 3X13A 3SPVA 2O26U 3MCG1 1CFQA 8FABA 3WFDH 3QG7L 4WW2C 4KUZL 3AM8A 4NYLA 2BVOB 3TA3A 3M1BA 4XPBH 3VXSB 5KZCB 3S4SG 2ED9A 4HAFA 1WEJH 1BVLA 5CP7A 3OXRA 4Z95H 3FFCD 1C1EL 4JG1L 1S7TB 1WZMA 4PJ7B 3CSGA 2VDQH 4FN0A 4J4PC 4PGCA 4ZS7H 5KTEH 2IAMA 1DUZA 4XBGA 1MFNA 3O11A 3IFLL 2CIKA 1GGBL 1H3UA 1XT5A 4MA7L 5I18H 1A6WH 4NRZB 4LCWE 2J5LB 4ZDHB 2HT2C 3FQTA 5JXEC 4GAYB 3AS1A 4I4WB 4NNYA 5KAQG 1Q9KA 3IB4A 3O9WC 1TPXB 1B2WL 3KNBB 4G3YL 4JFQB 3RNKA 4P2OD 5FA4A 3DI2B 3HC4L 1I1AA 2BVYA 2VWEE 3BHBA 3KS0J 3BRFA 5F7HA 3TVMC 3ZDXE 1XR9B 3VDCA 2Z92A 1MELA 3UTPD 2V2XA 5FYJU 1AGCB 3U0TA 5C09E 1KPUA 5BQ7A 2CK0L 4U4BA 4CNIB 3QEQE 4GT7A 3LEXB 1BFVH 3HFMH 3N85H 4JJHA 1EK3A 3QNYA 3QZWB 1XGUB 5EZOH 4AM0A 4QCIB 4H88H 5IWLC 3MBXH 1B0RB 1QLRA 3GSRA 3RWEB 4JM2C 2NY1D 2ZPKL 1MHCB 3HTLX 3MZTA 5IW1B 2A83B 3FMGL 4XBEL 1FYTB 3STZB 5J11B 3S5LA 1KTDB 5GGQL 5I30H 3KYNA 4RFOH 2R1YB 2O5XH 5D1ZB 4YHMH 1QFWH 3U4EB 5DO2C 3BN3B 3SO3B 3MRFB 5EZJA 4HXBL 4LKXA 1JPGB 4PJEB 4R2GD 2BSED 1WUNT 1Q0XH 4PV9A 5ESVA 3ALXA 1XGYL 3VXTA 1ZE3C 1FCGA 3REWB 1ZV5A 3QUYA 2ICWB 3RPKA 4Y4KB 2VDOH 3O6ML 4FQXA 3JWOL 1YNTB 4JHWH 3FB7A 3G6JF 1NFIA 2JIXA 3FZUC 1OARL 1RY7B 1Z9LA 3BZ4B 1OLZA 3C60C 4IJ3B 4XB8A 3C60B 1FJ1B 2VL4A 5KS9A 1RZ8A 1S8DB 3NH7L 4P3DB 5DMJB 4YBLB 1MUJB 3CPLB 1KT2B 1P4LA 1G9MH 4NC2B 5DTFB 3MCLH 1W72L 1T4KA 1D3CA 1RUPL 5EBMB 4JANA 5FM5M 5KVGH 5DJZA 4MB5A 4WFHD 5IFAH 1CDUA 3H7LA 1A7RH 4I77L 4LSUH 3RX7A 2AI0L 1YEEL 3D3VB 5DEZA 3D39A 3I6KB 1J9CT 3F7VA 2OXGA 1J88A 5KSAD 1UCBL 3M1BB 4MB4A 3VXSA 2YA2A 3BESR 2VKXA 2VLME 3V79C 1V3MA 2NY7L 4M93B 3GSOB 5IESH 3KXFE 5IBLD 3GSRB 1GGTA 4Q9BA 5E99H 1NMAL 3MO1A 5D6DA 2YK1L 2JE8A 4C55A 3RWJB 5T1LB 5I8CB 1RZIB 1RU9L 2A73B 3V6OA 5FO9A 2CDEA 3QHTC 3T0EB 3T65A 4HHAB 1HDMB 4H1LH 5HVGB 1Q0XL 2GT9A 3MODH 4Y5XC 3DJ9A 1MFEH 2NTFB 4P4KA 4MDJB 3F7PC 1HOCB 2LAAA 4AEHL 4UI2A 2HFEA 1LNUA 4HS3A 5MERB 3O8XA 1XF4B 5EU6B 3V4VH 1K3ZA 4AG4H 4Z78A 3UJTH 3FFDA 3IETA 2ZCHL 2HTLC 5DA0B 4UIKH 1RD6A 5F9JA 5KSBB 2P24B 4A2LA 4PJIF 5TDPB 4XI5C 3QIBB 1LDPH 3LSOB 4WI5A 2CRIA 1JFQL 4GBXA 3ZTJG 2DN7A 1YECH 4LIQH 4L4TD 4HJJL 4MA7H 5I18L 1INDH 2YK1H 1WGOA 4UT6H 1OAQL 4NRXA 2QADD 5I1JH 3BPLC 4UQ2B 4Y2DC 3GMRB 3SCMA 2PO6A 2X9XA 3CXHJ 4J3OC 1JIBA 3MV11 3MRDA 4PJAB 1EJOL 5MENA 1AP2B 3ARBA 4C56D 5JW5A 3J8F7 1SYSA 1YMHB 4XCYA 2NY5L 5HHOD 3BT2L 2OI9B 1NFDF 2DD8H 1ZGLP 1T04A 3QUMA 1T22A 5FYKU 3T77A 5GJSH 5I66A 3RWHB 4ODUA 4QOKA 4LLMB 5CEYB 2OTUA 1CZ8L 1X6LA 3GBNH 1OB1B 3MLSH 5IVOA 4PJXE 1HOCA 1H8NA 1KCSL 2WP3T 2BXYA 4NNYB 5DFTA 2JB5L 5H2BB 3GMPB 1LVEA 2AJYL 4Q6IC 4QRRE 1V3JA 4HUKB 3FQWA 3IFOA 4CL7A 2Q7YB 1KELL 1FZKA 4P2RE 1JNNL 3KPTA 5TE4H 5T1DH 3JWOC 3GSWA 3LEYL 1K8IA 1OAYH 1CGXA 2ZCKH 5GGTL 4CVWA 5D2LB 5A16A 2DI7A 4NQDD 3SDAA 3QEHB 3VFRB 3R06B 3K2UH 1BM3H 1M05B 1SBSL 1R3HA 3ZE0E 2QQLH 2XZAL 3VA6A 2YD3A 3U30C 5F44A 1JRHH 3WKNA 4WW1A 3VFGL 5K9OB 2AJVL 1ED3B 2NY0C 1FDLH 3C87A 3HE6A 4C4KO 4ZPVB 3VXOB 4X6EB 3ULUE 4PJGA 3FO9A 4WO4A 3VD4A 1FVCA 3OKEB 4ZD3L 2OL3A 3KWWA 3FRUA 3WKML 2J3SA 2EDKA 4NN7C 2DKMA 5TDOB 4Z7VA 1LEGA 3BPCB 1NCBH 1K4CB 4M3JA 3FO1B 5DMGC 1C16A 1ZMYA 1AHWA 3QWOB 2E7CA 3GSWB 4FFZL 5DLML 1LEIA 3G6AB 2C4FT 3WDIA 1WIOA 1U8PA 2ZSVB 5CP7B 3KLAB 5J7CC 2YPLE 3KYKH 3T8XB 5C0FB 1PG7W 2X1OA 3NAAH 1EDQA 5DD3L 5KSAB 1WSST 5IB5A 4JN2A 4K71C 3IDIB 1EVUA 4TQEH 1IM9D 3PGFL 1KN2H 3V0WL 4HJ0D 1NDGA 1QSFD 2GFBB 4NFCA 5FYLH 3TNNA 5GSVA 5LWYH 4PLNC 1NAMB 5D5MA 3SN6N 5I17A 1YEKL 2OMBA 1BQHB 3THMH 3WFHA 4PRNA 2XN9A 5T1KA 4F58L 4MGXA 3BWUC 2HTLD 1SYSB 4NKOB 1P7KB 2DLGA 3STZA 4X7SH 3MRQA 1P2CA 2VISB 4NZRH 2QSQA 4JG0H 1YMME 1F4YL 1CU4L 4DFIA 2EDWA 1EEZB 2BERA 2F74A 2BZDA 4CW1B 3CZFA 4PJGB 1NFDA 3LRSB 1EJ6A 1XGQA 5CEZL 3QNYB 1Y18A 3QZWA 4OLXH 4XNXL 1UWEH 3CVHA 5ACZB 3QDJE 5EUOA 2DIAA 3OZ9L 5IIEA 2PW1A 4IRZH 4YHZL 1RZJC 5KG9B 4YFEA 5DWUL 3AB0C 2Y25A 1KN4H 1FL5A 4Q58C 1IGCH 3ZO0A 3HRZA 2WINA 2VDML 4ODXA 3QDGD 4UT7H 1NGZA 1DQJA 3SY0B 4U6VL 2QADB 4NT6A 4YK4B 1XAUA 2J8UA 2YA1A 5SWSE 3QUXC 3TP4A 2BNQD 3T0VA 3O9WD 5F9WB 3Q5YA 3MA9H 5BJTA 4EBQL 3GHBL 3FCTA 1MLCA 5FGBA 4GRWF 2X1XR 4S1DC 4JB9H 3OXSA 5I1JL 2VDRH 5MHSE 1BD2B 2B39A 2ESVA 1FNEA 4X6BB 4OJFL 3MBED 4HKBB 5JW4M 1YEJL 5TGBA 1BIHA 3VH8G 3ZHLA 2EYTA 3GUTB 5EU5B 1BBJB 4UINH 3B9KC 4I18A 2IGFL 4NRZA 5E00A 4JCLA 1P1ZB 1S7SA 2NY6B 3HG1D 5JHDB 2HP4A 2AV7A 5DMKA 2R0KH 2GFBA 3TNNB 3H0TA 2OX5A 5BXFB 3X17A 4Z18A 5HYJE 2BOBA 4PLOB 4JQIL 2QSCH 4NDMA 5ICYA 4XBPA 1K8DA 4KUCD 4PY8I 1J7VR 3CD4A 1JGLH 1G7QA 4TYUA 5JO5A 2H8PA 4YUEH 1IT9H 4NFBA 1MPAH 1QOKA 1LEIB 4MCZB 2Z8VC 3OKDA 4LLQB 1GGIH 4P9ML 4WIQA 4JCMA 4MWFB 1ZSDA 4XCEA 1YECL 3BKMH 4KQ3L 4OCXL 3P30L 1MCJA 4C58B 5DA4A 1QLEH 3TBYB 1I1RA 5D7SH 2DYPD 2ID5A 2WBJB 4ZS6C 4R0LA 5DFWH 4ZUUB 2W65A 5CILL 1QBLL 4WGVB 2IFFL 2R1XB 4PRNB 2VERN 4NUJB 3EDJA 3T0WA 3SJVB 4YZFF 4F57L 1E6JL 2A77L 1K2DA 1H3TA 1Q9OB 1NMCC 1RK0B 4JLRB 1NAKH 3IJYA 2RBLA 1HHGA 3N9GH 1YEDA 1EMTL 3HRZB 4UTBH 3TA3B 2F8OA 3H7BB 5SWZE 2IEPA 1VKXB 3U7YL 2BRQA 5DK2A 4YO0A 3LEYH 3NPSC 3T1WA 1U8PB 2ZSVA 4PJ8A 2GK0B 2AW2A 3BXNA 3MRCB 2HH0L 1E6OH 5H37H 3RL1A 2VLMD 3HG1A 1F97A 1JGDB 2JTDA 1KPRB 1T89C 3BGAA 2R23A 4P0DA 1T21B 2XQBL 3QBTB 4OBRA 5FB8A 4GG6F 1CS6A 1XCQA 5ICXA 1LP9F 3K8MA 2V7HA 2BNUB 5B22A 4L8CB 5CILH 3T0XA 4TVPL 3TBVA 1CFSA 1JV5B 1FE8L 3JTTA 4OQ1A 4MD0B 5DR5L 5DRXA 4ZUWB 4MCZA 4RGMB 1ED3A 2ARJQ 3MNWB 3EDFA 5ICZA 3CXHK 3ROOA 3O45A 1BAFL 2HTKD 4MNQD 1HXYA 5L2KA 3UTTB 3NOIA 1H3PH 1CBVH 4WFED 1KPUB 5CZXC 1HHJA 2H45A 4P57B 2B5IC 3NFNB 1CD1B 5I1DA 1OM3H 2FH8A 1CLYL 5GSRA 4QF1B 1FFNB 4C56E 2X70A 2A74A 12E8L 4OZGA 3RTQC 4BSWA 4X6CA 1GSMA 1NCAH 3BH9B 2FJHA 1Y18B 4JRYA 4PRHE 5ADPH 3CSYB 1MRCH 2DBJA 5GPRA 4PG9A 1QFWI 5BO1L 4KHXL 1OGAE 4LCWA 2NY3B 3WLWC 1BQLH 4YPJA 4LLMA 4QY8A 4IOFD 4JDZB 4H8WH 4ZFZB 4MHHI 4ZG1A 3DUSB 4PR5A 2VL5A 4M48L 3NPZB 1BD2E 4KTDL 1DBJL 4WV1A 3BD5A 5JMRA 1IGTB 4HV8A 1MFBH 5JW4N 5GS2H 4LLQA 1JGUH 4HIXH 1G7JB 4HWEL 4JO3H 2VXTH 5IG7B 3QR2A 1CE6B 3SJVD 2VLLA 4NJ9L 3VXRE 4PG2A 3VDBA 3K1KC 1MCDA 3BZDA 4M6AA 4OLUL 5HVFB 2HTKC 1KB9J 1YY8B 4JQXA 4ZFFB 1IZJA 1NLDH 2X40A 4MJID 2BFVH 3R06A 1TXKA 1CLZH 3I3DA 2CLRA 4JJ5A 4GSDL 4QYOA 4CAGA 2DLFH 4MJIB 5C0BE 5DWUH 5I73B 5ITFB 4YDVB 3FTGB 1JZ2A 5K9QG 5DRWB 4XPHL 2BOCA 4IRZL 3PP3K 1DVFD 2HJKA 4HBCL 4BZ2L 4PJBB 2VXQH 2V5MA 3UDWA 1D6EB 1MVUB 2P7TB 3C5JB 1JYNA 5DJDB 3NCJL 3REVB 1DE4B 3DNKA 1OM3L 1AGCA 3MFFA 4TPRL 5CEYA 3GRWH 3CLFH 3J7HA 3E6FB 4KUZH 2IBZY 1DTUA 3A6CH 1UQSB 1QUNA 4WHYG 4I13B 1IEAA 5DUPH 4FQIL 4OCNC 3VFSA 3NZHH 3UBXI 4KZDL 3G5ZB 4JFYA 4IM8A 1EHAA 4H25B 3FONA 3QXVA 4XNZB 1J8HD 4JFDB 4W6XB 1EFXA 3TBYA 1KG0A 4D0CA 5SV3A 3SDAD 3B9KD 4NQVB 4FQXC 5T1LA 2CO6B 1OCWL 5KANI 1FO0H 3WHXB 3LRSA 3TN0A 3FQNA 4KWUA 3NMEA 3WXWL 4ODSH 3D85A 1B0GB 2NNAA 3ET9F 4DZ8B 3QO0A 4JGMA 2AAVA 1U8OA 1A4JB 4H8WC 3TJHD 5F89B 2WBJD 4JVUA 4APQA 1W0WA 5IQ7H 3GJEB 4BFEA 5IEHB 1U2HA 1J1XH 2EC9U 4XNMA 4RFNC 1OQOA 4EUPH 1NGWA 1TZIB 5KSBA 1H15B 3C2SA 4RFNB 1I75A 5JHDA 1FLTX 5B3NA 4FXGB 3SKUD 3PQYA 3VG9C 3ARYA 3IDYC 1UM4L 3OBAA 4Y16C 3LN4A 4OLYH 5KSAC 1U3HA 3EKCA 2B1HL 1KOAA 1T21A 1AI1H 4K94H 5KS9B 1J1OH 4P5MB