1DEEB

Structure of s. aureus protein a bound to a human igm fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
223
structure length
223
Chain Sequence
QVQLVESGGGVVQPGKSLRLSCAASGFTFSGYGMHWVRQAPGKGLEWVALISYDESNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKVKFYDPTAPNDYWGQGTLVTVSSGSASAPTLFPLVSCENSNPSSTVAVGCLAQDFLPDSITFSWKYKNNSDISSTRGFPSVLRGGKYAATSQVLLPSKDVAQGTNEHVVCKVQHPNGNKEKDVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Staphylococcus aureus protein A domain complexed with the Fab fragment of a human IgM antibody: structural basis for recognition of B-cell receptors and superantigen activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords IGM RF 2A2
total genus 43
structure length 223
sequence length 223
chains with identical sequence D, F
ec nomenclature
pdb deposition date 1999-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1deeB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1deeB02
1M7IB 5FUOH 2VAJA 3BQUA 3ZKSD 1CR9L 1FYTA 2ADGB 4YIQB 1OP3K 3I3BA 3W9DA 1PG7X 3QCTL 3ECBB 2R2EB 2VZVA 1Z0NA 2DD8H 4LAQL 1YEDB 5CJOL 4YZFF 3VMOA 4MQXD 3KLAA 3BFOA 4PJHF 1ORSB 3ZKNC 4HC1A 5D2NC 5LVEA 3X11A 3RWFA 4ZTPL 1PLGL 1LP9F 3UJJH 5IGXH 4GUPB 4FFZH 4HIXH 1FDLH 1OGTA 4OF6A 3IF1B 4OCMC 1T21B 3SCMD 3D0VB 3QHZH 4PJ9C 1H3TA 1U2HA 5HY9A 5F72S 3Q5OA 5C2UB 1QNZL 1WICA 3KG5A 1AO7A 4OT1H 2BVEA 4M8QB 4NZJA 3HLAB 5JIHA 1A6AB 4Y4FB 3LMJL 3WEXB 3WJLC 3P30L 2YEZA 4QTIL 1OTTC 1CFVL 2AEPL 4OLYH 1MRCH 1ULVA 2KQNA 3BKML 4Y89A 4AIZB 2VISB 2RIKA 5BZWB 4EJ1C 1FNHA 1NEZA 3VWKB 2GT9A 1A7OL 2RCSH 2OR9L 4ZNEE 1LEIA 2GHWB 2VLJD 4F2MA 4NJAL 1A4KB 2PW2A 4RFEA 1TETL 3LDBB 3QO1A 4EEEA 1G7LA 2IANE 4OLXL 4NBYB 4JDVB 5AZ2H 4PGDA 5J4MA 5F9OL 1RI8A 2ATKA 4WFGD 1QKZH 1XF1A 1EVTC 4JCLA 3O8XD 5C0AD 3H3PH 1NFDE 3KS0H 5GS0D 1QR4A 5I1EH 4TTDD 5L2KB 4NO3A 4PRBA 2R9HC 3O9WB 4DN3H 4KJPD 4M4PA 4V1DA 1NCAL 5KVEH 5GRZA 1YZZA 4MNGB 4OLZL 2E5EA 4R96A 3F58L 5ANME 5DRZB 1D5BA 5I1DB 2YZ1A 4TUOA 3TV3H 2B0SL 1X5AA 5BVPH 1X6LA 4RQQA 2JTDA 1U3YA 2QSTA 4OZFH 4Y16A 4XPTH 3EFDH 4YGVA 2YRZA 4S1QH 4NO5B 1JTOA 1U8IB 2UWEB 4KXZI 4UT7H 3QJFB 5A2IH 3N0PB 3BN9D 4Z7UF 1QRKA 1JGUL 1DVFB 1HOCA 1W8NA 2FX9L 1KIUA 2R0LL 2QL1A 4WEBL 5GIRA 2YC1B 3KLDA 4K23H 1JNHB 2KQMA 3TM6A 1UM5L 3F7RA 4JFQA 3V52H 3RZCD 1BEYH 1QRNE 4KK5D 4P2QB 1ES0B 4JRXD 4EDWH 1T20B 4YHPA 2NY7H 1YN6A 2NCMA 4Z7VE 1FH5H 4M9OA 5CBEB 5ICYA 2YPLD 3GMLA 4M61A 2PCPB 1OGAD 2M8XA 4GBXC 5CWSA 4HWEH 3QRFM 4JKPH 3RX5A 2IQAB 1NCBL 2V7HA 1IFHL 3H0TB 4CJ1A 2IGFL 1AHWC 5ISZE 3VXQA 3CFCH 2DQDL 4D0BA 4YPGB 3RVTC 4PLJD 1FL5A 2L0DA 3ZDXE 2FEDC 3BP7B 1YY8A 5C08D 5E94A 3TVMB 4LCWB 1TZHA 3VFMA 4CNIB 3O11A 4GG8A 5D2NE 4YK4B 3TIDA 3RBSA 3DX7B 5HYQA 2GIYA 1KBGH 2GQHA 3RKDC 1OT1A 1SJHB 1Y6NR 2VE6B 3X13A 5TFSL 3BJ91 5DI8A 3HA0A 4HGWA 3SPVA 4L9LC 2DQGH 4E0RB 2EH8H 3LKOA 3ZYOA 4PG2C 2E9IA 4KKCD 3IAGC 4F3FA 1RAMA 2BOCB 2DQCL 4CJ0A 3SDAA 2E7LC 1NAKL 1U8JA 1TITA 3PNWA 4UMGA 5D6DA 4OZ4B 4YZFE 1IZJA 3NPZB 2DYPD 1W0WB 1AH1A 3AROA 4HUXA 4PJBE 2IANB 5ERWA 5ESAB 2W9DL 2AV1B 1OGTB 4EVNB 3SKMB 1AQDA 3HCVB 1BIIA 3BW9B 5IW1A 4Y19B 5E8PB 2CKNA 3O45A 5BV7L 2V9RA 1J0KA 1RZFH 4JFPB 4GG6E 2X70A 3P11L 5EBWB 4RX4D 5FK9B 2MWCA 1MQKL 1OP5K 2CKBH 2FH6A 1JMZA 4NQXA 4LDOB 2V2XA 3CFJA 4OFKA 4KJPC 4XXDA 3MCLL 1G9EA 4U6XB 5I2IB 3B2VL 3RA7H 2Q76B 5GS0C 1T66D 2BCKA 4XHJD 2HN7B 3O8XB 3BP6A 4PRIA 4PR5B 3U2SA 3U7YL 3HAEB 3U0TB 4GRLC 4MCYA 4UBDD 2WP3T 4XAKD 3SE4A 4J4PA 1OB1A 4QXTB 3PHOA 5DVMA 1AGEB 4WY7H 4U33A 5T1MB 4X80L 5D1QB 2XZQH 2Z0BA 4K94H 5SWZA 2VLJB 4AENA 4JHWL 3LN4A 5E8OA 1DBBH 4KTEH 4JY5H 2BC4B 3AM8A 4RNRA 5H94B 2HWZL 1JNJA 2D4FA 3VFMB 5GISL 3NCCB 4LNRB 3PG2A 5T33H 4NUGH 1DN0B 1UM4H 3GI8H 1HZHH 2HT4D 4G6MH 4U1SA 4PJ8C 5CGYD 3KPRE 3VFPA 4XNZB 4XP1H 5CJXA 4Z7WF 3DURA 5FA4A 2Q1EA 1J05A 4NNYA 3MFFA 2VUYA 3MV11 5JXEC 1BFSA 3ARBD 4KRNA 1FGVL 1MJ8H 2OL3L 4I13B 4EKXA 1DBAH 1GVIA 5GZOC 3UBXA 3TA3A 4J3OC 1U92B 5TDOA 2QQQA 4NQEB 3ARDC 3R0MA 4PTTA 3PGFH 4ZUWB 2DQUL 4XNYL 4G7YL 2OXHA 2R0ZL 2GITB 5B8CC 1JNHA 1UWXH 4C83B 2B4CH 5BZWA 3FFDB 4Z7OF 3V5HB 5IFJA 1INDL 5JXEA 3MV8B 4DZBB 1FFPA 1JZ6A 1SBBA 4XNUL 2HFEB 2R56H 5CEZL 3AUVA 4Q7DA 4BQBA 4P2QD 4Z7NF 1NJ9B 5HXMA 1RJYB 3D69B 3VH8G 3VXNA 2VZSA 5DD1H 4LARH 3BP5A 4OV5A 3AB0C 1P1ZA 4D9RD 1KIPA 3VD3A 4YO0A 3FOMA 4P5TC 4UINL 5GSVA 5L2JA 4JKWA 3ILQD 4S2SB 4ZOAA 3PL6C 3HC3H 3PJSB 5FKPB 1I1YB 5HHOD 4S0SD 2QQKH 1N0XL 1A5FL 4I0PD 1SQ2N 4Y4FD 3MACL 1YMHB 1U3HC 2WIMA 5ETUB 2A9MH 2APBA 2APWA 3BPOC 4X7DC 1G6RA 4L8DB 1K4DB 3V5KB 4WUUD 1MCRA 1HCFX 4NQCB 1MFNA 1AP2B 4Y0GA 3BHBA 3D5OF 1KJMA 5D93B 2BSED 2X1OA 3TZVC 2YPVH 5EO9B 4PJXE 2FJFA 4M4RA 4X4YB 3F7YB 2WLZA 3DWTA 3MOBH 3REWA 4DTGH 1L7IH 4JG0H 4S10A 4OLUH 4QCIA 1BX2A 3SGEI 5IB1A 2J4WH 5CBEA 5ICYB 1HH9A 4G8EA 3WFEH 4XAKE 4JM2F 4CKVX 4MXVF 3BN9C 4TYUA 4JFPA 5D7LB 5DQDL 4NHUB 1BOGB 1CL7L 3VXRB 4EXPX 4ZOBA 3MREA 1G6RH 1DQTA 1HSAB 1FP5A 5J3HC 3WN5A 1FRGH 3ETBF 3R0NA 5TF1L 5BRZB 2P1YA 1BF8A 2XTLA 2QSCL 4MA1B 1BIHA 4XPHL 1BFOA 4IDJL 3FONB 1RULL 4NQDB 1A3QA 3TN0C 4DFHA 3KAAA 3PGDA 3GSNL 1AGCA 1AXSA 4NC1C 4PR5A 5GGTL 3U2SB 5HDLA 2A1WH 4LCWA 2ICES 4NGHH 4AEIH 4HS8H 2DQEH 1QP1A 1Q38A 4Z7UA 3E0GA 3FB8B 5IJVB 3DO7B 3M17B 4QRPA 1T6VN 2FL5A 1DDHB 5JXAH 1SY6L 4BFIA 3WNLA 1X5ZA 4HUWA 2RJMA 4QOKB 2B20A 43C9B 3PXHA 4NKIH 4XI5C 1N64H 3L3IB 4Z7WB 3DTXB 5MP6L 4WUUA 1LO0L 5SWZE 2V5RA 2X4QB 1JUFA 4A6YA 4OZ4A 5I1HH 2IMNA 4H0GA 3WBDA 2YZ8A 3WFDH 1YMHA 3G6JF 3V52L 4KRPD 3QIUA 2IG2H 2W9EH 1ODAA 1T6WA 1WIPA 3MRNB 1TJGH 1U8PB 1S9YA 1CT8B 4JHAH 4PRIE 4TSAL 4NNXB 1XR8A 5CLTA 4KHXL 3FQTB 4Y16B 1LP9E 3QWRD 4FTVA 4FQXB 2YD2A 3U6RA 4DQOH 4OZIB 2CK0H 3KJ4C 2KZWA 2MFNA 4HKZB 5F7UA 1JTTA 2CRYA 5IFHL 3ARBB 2VDRH 3L3DB 4IRSA 4NQXB 5KJRH 4YEEA 4JZOA 4RWYH 1NUGA 1FNEA 2YPKB 2NXYB 1I8IA 1AI1L 1PEWA 3T3MF 3LKPA 5DD5H 3WIFB 1C5DA 2VZUA 4EDWL 3BJLA 1MWAL 1OP5H 1I7TB 4KWUA 1KLFA 2NY3C 32C2B 3S7GA 1JMXA 3TT1L 2ILLA 1LD9A 4YHLH 2YKLL 4I0CC 3D3VD 4RMWA 4CVWA 1XF2A 3G6DL 2NZ9D 3KYNB 1JL8A 1P53A 3GKZA 3S96A 1J1XH 1FORH 2HRPL 1ZV5A 5T1KB 1QFUL 4HH9B 2CUMA 2YRLA 3JTSB 1HHJA 4Y1AD 3RWJA 3SE9L 4QRTA 4PD4K 5DHYA 3O6LH 3LRSA 4N8VB 4WI5A 4PJ5A 4JR9H 4I77H 2O61B 5EO1B 4IJ3C 2PYEE 2OI9B 1FL5B 5IESL 2GJ6A 1AFVH 3T0WA 2FLBT 1SBSH 4XVUC 3SDCC 4K7PH 3MLRH 4P5TD 4OLYL 4GBXB 3ZSSA 3SO3C 3ARZA 4BZ1H 1MHCB 3HC4H 1CGYA 4EOWL 2AKRA 3C5ZB 1U6AH 4YO0B 5DRWB 2XN9D 2AJUL 1D5MA 1N0XH 3IFOA 1BWWA 1EBAA 1GCFA 2BY2A 5EC1B 4HXAH 1NANI 4OF8A 1X6NA 1CL7I 3THMH 1H8OA 4H8WC 4KK9D 4N90E 2H9GA 1HXMB 1CXHA 5EORH 1BQLH 3Q0HA 1HHKB 4HGMA 4QHUA 4U7MA 2EE3A 5EBGA 3VXUD 3TA3C 2VZ3A 1XIWD 2P5EB 5FYJH 4LRNL 4APQD 2X4RB 3EYOB 3K8MA 4OZIA 1FFQA 4UTAL 4LSTL 3VXTB 1RZ8B 1T22A 1FFRA 4U1KB 3FHQA 5MEQA 4JGJA 4MNQE 5DRXA 4DVRL 3HUJA 5KSUB 5E6YA 3IKKA 1F5WA 3IDMB 2P8LB 3HPJA 2CXKA 1DUYA 3M8OH 3TCLB 1P7HL 4BKLB 3L5HA 3RUGF 3MRHA 1S9WA 2DYPA 3I50L 5EUOF 1LE5B 5E08H 2WUBL 5SWQB 5CHNA 4WO4B 4YAQB 3TGXA 1XIWA 1NDGB 3ZDZE 3ILPB 3MGTA 4HSQA 5F8RC 4EN3D 1MHEA 1PG7H 1QO3A 3GI8L 1NQBA 4EUPA 5FYKE 5GHWH 5AWNH 4Q6IA 1N6QH 2QHLA 3HNTH 3D6GA 2QADD 3GMNB 4LPVA 5D7IA 4HK0B 2J4WL 3DGGB 3C6SA 4LRNH 2XTJC 4R2GD 3VXMB 4F2MB 4LVOC 2ITCA 5D96C 3BAEL 1U42A 1D7FA 4PJAA 3MLTB 3GNML 3RJDA 2NX5D 3RDTA 1UM5H 4Z0XA 4HMEA 5HGAB 3GIVA 4P46D 3BVNB 5GZNC 3WUWB 5FB8B 1N7MH 1P4LB 1ORQA 2NR6D 4HUUA 4GMSL 1NBZB 1GGCH 2OJEB 2APVA 3QSKB 5SX4I 1WTGT 3FFCD 1DN0A 3LN5B 3CJJA 2OXGA 1ZLUH 2YSSB 2JK5A 1MLCB 2JKXA 5D1ZB 4PJXA 2B5IB 3SDDD 3C8HA 1LHZA 1YPZB 3VFPB 4EXKA 3PQYB 1R3KA 3PWJA 3RAJH 4M1DH 3PDDA 1MRFL 4PJ9D 2NY6D 2DLEA 3PV7A 3B43A 1XGRB 3JTTA 4R4BA 1D5IL 4FQXA 1GYAA 3CXDL 1VGKB 3RL2A 3D3VB 5EUOA 1QBLL 3IFLL 4GRWB 2BNQA 2GEEA 3RY4A 4U1KA 3QUZD 3DI3B 3QXAB 1B9ZA 3M1BA 1NFDB 1GJIA 3ZZ1A 4QGYA 4MQXC 4PIRF 1OLZA 2CH8A 1E4WH 3F7VB 4LCWE 1Z9LA 1G7IB 1V3KA 2C26A 1ES0A 4K3JL 1YYLL 5ISZD 1I9EA 2BP3A 3CCHB 1TQBB 4NJ9L 3EDJA 4NFBA 3UYPA 4PJAF 4P23D 4PJ7E 5M94B 3QQ9D 3BRFA 4M62L 4YR6B 4NDMB 4WHYH 1AO7B 3S96B 1XGQB 4QRUB 2J8UB 3CDGA 2VL5B 4TRPL 3FCTA 4OV5B 4Y4KC 5HJ3A 1IAMA 3FAWA 4UAOB 4I0PA 4UQ3B 1CDBA 1GGCL 1N0LA 3OJMB 3LRSB 1F13A 4ZUTB 4MGXA 4GKNB 1F97A 2NY0B 5JA9A 1OSZA 1K6QL 2H6PA 1TVHA 2C3VA 5L6YH 1OSPH 3VFRB 1I8LC 3OHXB 5DGRA 4UT9L 4YDKL 4MNHB 1B0RA 2CK2A 1K5NA 3ALPA 5B21A 4KJYB 1BD2B 2Y9RT 3S36H 1D5ZA 2VDRL 5C8JA 2OYPA 3FZUC 3VMNA 3AMLA 2VE6A 2APXA 4X5WA 5E5UB 4LBEB 3GJFK 2DQTL 2VXTL 3GDBA 3ULVE 4XXCA 3MLXH 3MRRA 5DT1L 4OZIF 4X6EA 5CSBA 4LQFH 3KPPA 1WZ1L 3L9RB 5E8NB 2BNRA 3N85H 4P4RA 3T0DA 3MRJA 5HHOA 2NZ9C 1KPUB 1YA5A 4FFWD 4GW4B 4L5FH 4PJFA 2BNQD 4GXVL 2IFFL 1K8IA 3UAJC 4K7FB 4QXUL 5DJCA 3F12A 2EEDA 4F33A 1FZKB 4MNGE 5E8EA 3UTSA 4LKCB 5FYLL 5JQ6L 3AVEA 5KS9F 1WCQA 3ORJA 1K4CA 2EC9U 2LTQB 3Q6GH 1W0YT 5FA3A 2VDKL 4M62H 3G9VA 5A3IC 3JBG7 1JK8B 1RURH 4JFFA 1EVUA 5D7KE 2VC2L 1LNUA 4ZFOA 3TN0D 3TZVB 5JW4R 5E2TH 2NPLX 4X6BB 1PJ9A 3IDMA 5IV2A 2OL3B 3BPNB 3BYYA 4RGNB 4NDMA 1D6EA 1OCWH 3INUH 1AGFA 1ZSDA 4F7MA 1ZHLB 3HI5H 5EIVA 2CD0A 3WEXA 5HYJD 1JRHH 3BKJL 3BT2H 3QFDB 4S1QL 3W0WD 1S7VB 4M5ZH 3K4ZA 2J8OA 4LEOB 4K3HA 5AEAA 5F3HB 4U0RC 1GGBL 2HTKC 4BFIB 2VOTA 1DBJL 4FQQA 4XC1L 3AAZB 4EIGB 2BZDA 3A6BL 5D9SA 3C2AL 5F6HI 5J1TC 3HUJF 1I7RB 3EO1B 1NCUA 3U9PL 3RZWA 4BK4A 2H9GB 1AE6H 1FGNL 1N5AA 1LVEA 5LG1A 2EIDA 3VFNA 1PFCA 2AXGB 4X99B 5JXED 4ODXB 3RWFB 4I18C 3V95A 4P2OC 2ZUQB 1EO5A 1JWSA 3ZT6A 5D2NB 3MRMB 4Q9CA 2BY1A 1H3PL 3NCJL 4KUZL 5TE4H 3KPPB 1ONQA 5FYLH 3CPLA 1J05B 3MUGB 3PL6A 2NY2D 4XPBH 4BELD 5IIEA 3WIHA 3U6RB 5GGUA 3QUYC 3GK8L 5AZEL 2FX8H 1AI1H 3RTQC 2XXCB 4HPOL 4PJ9B 1TNMA 3QPXH 1RUAL 1RZIA 5DJ0B 4F33B 5ILTL 4HEPG 4WI3A 3HE7B 1MNUH 4M8VA 4PTTB 1OHQA 4HWZB 4B53A 5K9QG 3LKPB 3SDAB 3O6KH 1XGPA 2EKSA 4AMKH 4OGAC 5C3TA 5I30H 3BWAB 3WNPA 2FIRT 3BUYA 2UYLA 4Z7VB 2OSLA 3EKCA 4HDIA 4JFDA 4JFHD 1R3JB 4FTVD 1M6OA 5HHPB 5IBUB 1VEOA 2CR3A 3U9UA 1SEBB 1JI2A 4TSAH 3KPQA 2CIIB 5CMAB 2G5BA 4LIQE 2AJUH 4PD4J 1YN7B 3GSQA 4Z7VF 4F80A 4NC1E 2NLJB 1CDJA 4NKMB 4S11A 5JW3H 2FGWL 1GIGH 5ICXA 2P47B 3C60A 5F3BB 2EDBA 1KN2L 4ACPA 5FM5O 4LSUH 3MQIA 4KRMB 3O2DL 5F9JA 4XMKH 4U1JB 1CXFA 4S0TD 3TT3H 1YN6B 1H3VA 2APFA 3N50A 4OIBA 2UZYB 1QUNA 1J1OL 1QOKA 2X44D 4ONHB 3RZCA 2VLJA 3AREC 5INDA 2ESVB 1F4XH 4RRPG 2DB8A 1EUTA 2N4IA 4OJFL 4YPJA 4QKXB 1F42A 3ZYZA 5F7DB 5JIIA 3L5WB 3FL7A 5EOCH 1JZ5A 3S35L 4OQ1A 3T0AA 4WHDA 1FG2A 4QT5B 3QDHA 4YFLI 5C0RL 1V7MH 1ZT7B 2DLTA 1RULH 5HHOE 1JHKH 4BM7A 3GSNB 4M48H 5F1NA 4TN9A 5EBLA 4GSDH 2VDQH 2IANA 4PY7B 4CUCA 2X4PA 3DUUB 2W07A 4M43L 4MB3A 4K55A 1PD6A 3MNVB 3BPLC 4JM4H 1H3PH 3NCJH 4MQ7B 2HJLA 4ZFGH 4YC2C 3DX7A 5DMKB 3QQ9C 4YXLH 1M05A 4KMTH 4NRZB 3HMXH 5J12C 3EIFA 3DSFH 1TLKA 4X6CE 4PJFB 3VRLE 1QYGL 5BXFB 1QSEA 2ICWI 5I19H 1Q0XH 1HHHA 4J3SA 2XY1A 4JG0L 2WLYA 4PG9A 1MFBH 1VADA 1KB5H 3O0RL 4MZ2A 1MJUL 4WTXA 3G6AA 1UZ6F 1UB5B 4NKOA 5FGSA 5C6PB 1K4CB 3MBEC 1KOAA 1UKSA 2GITA 5GRJH 1MFEH 3VI4F 3QUXA 3F12B 3HE6A 4XPGH 4NQCE 5D71H 2YWZA 1T4KB 2CPCA 5BRZA 2DMBA 1J5OH 2HKHL 2GYSA 3DYMA 3ZKXB 3T4AA 1VGEH 2VWEE 1BZ7A 1LO3H 2DQJL 2F53A 5DJXA 3DYOA 1GAFH 1P84J 1HCVA 1T83A 5ANMA 3OXRB 4AENB 1N8ZA 3BAEH 5FO8A 3PV6B 4LARL 4NQVB 2AEQL 5D1XC 3K3QA 4MHHI 5LKNA 4FRWA 4YDLC 4XH2B 2N7BA 1MFDL 1E4XI 3TVMC 1UA6H 5E7FA 4WI2A 3T77B 4HW6A 2ZSVB 3JWOL 1CFSA 2CDEA 4UIKL 3BD4A 4KQ3H 4P2RD 5IQ7H 4OZIE 3FRUB 1DEEB 4G7YH 3PHOB 1DZBA 5DEFA 2IQ9H 2Z92A 3UTQB 1ZHNB 1KBGL 1G9ML 3I6LE 4TUJB 3QEQB 1L6XA 3MA7B 4GG6B 5GRXG 5F1OB 3ZL4L 4XXCC 1IEAB 1NGPH 1LO3L 4AQOA 3PJSA 2XICA 3HRZB 3TBYB 4WW2B 3MRMA 2E6PA 1EEUA 2ARJQ 4BZYA 4DGYH 1OAUH 3T0ED 2R4RL 1FVCA 2VN7A 4MDJB 4NN5C 5F88B 4PYHA 5CEZD 5EU5A 3IJYB 5BQ7B 1MAMH 3IJSB 4J8RA 1G6RB 4HWUA 1OTUC 3MODL 4LPCA 3MFGB 4X9GA 2VDMH 2R29H 1NH6A 1UWEL 4FQLH 4FA8A 4NSKA 1IAIH 4PJ7F 4W6YB 1RSFA 3JUYA 3NOIA 1E4XH 2YA1A 1FVEA 4ODTL 3D3VE 4O5LL 3DPBA 3HZMB 2QV2A 4G6AC 5IG7A 5K9OB 5J56B 3ZT7A 1P2CA 3RI5K 4M3KB 2AABL 4J3XA 1CZ8L 1F3DJ 1X5GA 5IESH 2JB5L 4O4YH 1QTYT 3MV9A 2J6EA 5IB1B 2YK1L 5T1LB 3BWAA 1JGUH 1AGDA 3JWOH 3WLWC 5EBMB 3MNZA 4UT6H 4HDIB 3VWJD 1Z9OA 1LP9A 4LKXB 4J3WA 3N1FC 4M5YH 3C60B 4KHTL 3DMMB 4YXHH 1TTGA 3DXAA 1OQOA 4CMHC 2UZIH 4RMVA 2VZOA 4CADB 2XN9E 3QUMA 4OFPA 1T1ZB 2Q87A 2F58H 3GB7B 2WBJB 2FBOJ 3WFHA 3WS3B 3ULVF 4A2MA 3ZO0A 3SCMC 5IVNA 2VXQL 1BVLB 3C8KA 4BZ1L 3QQNA 1B2WH 5DRNB 3HB3C 2AJSL 1LE9A 4OZGF 3GGWB 4WEMB 3MV9D 3WSQL 5JR1H 5LGHL 5F7HA 1RD6A 5KAQG 3HRPA 3DHMA 4C55A 1I7ZA 3RWGB 1FYTB 2ADGA 3VW3H 1NGXB 3IVKB 5CEZH 2A6IA 2E9JA 4JFOB 4OCNC 5MENB 2DF3A 3QIWB 2X4UA 1WBZB 1K2DB 3QG6A 4OD2A 1FCCA 4LCYA 5KS9A 2IAMB 3GJFH 5I75C 4TVPH 4K7FA 1WZ1H 3GBMH 4JFFD 3SDYL 2A6KA 3WLBB 5I1GH 2HLFD 3FZUD 5JO5A 3DSFL 3C09C 5I66A 3FT3A 2AABH 1DL7L 4JDTL 4O2EA 4NQCA 1CE1H 4WDIB 3TCLA 4M43H 4NSKB 2ZWLT 4HGKC 1ZHKB 2HVKB 4KZDL 2R0WL 3P30H 3QA3A 4YBQC 3CFCL 4Z7OE 1PY9A 2VXVH 1MI5A 1NAKH 2P7TA 1NCDH 5DS8A 5F3BA 5ID1A 4YBLB 1T3FA 2EC9T 3GMQB 2B2XL 1FNGA 4X6BA 3SDDC 5E4IA 4DCQB 5CEZE 3MLVH 1T1XA 3DETC 4Y4KA 3EZ8A 3U30C 2ZG3A 4P4KC 4JEGB 3QDGD 4HS6B 2VLRA 3KYOA 5DK0B 3PQYE 4OFVA 2LTQC 4N1HB 5IEHB 3U46A 4QOKE 1HHJB 3RWJB 2XWBA 3MREB 3OAYK 3E6FA 1IRAY 5FYLE 4OZFA 3KWWA 5CZVL 2XIDA 4TTDC 4DN4H 2FIKB 1T0PB 3EOYG 3GK8H 5F89B 2VYRE 4XWOC 1DSFL 5EO1A 5SX5H 3QUZA 2BY0A 5C71A 1WBXA 5J0BA 3WFHB 3PV6A 2BSTA 5LGJA 3BPNC 2CDEB 2QADC 4D9QE 4HJ0D 4RFOL 4HLZG 5I71B 4GBXA 3JV4B 4YDIH 5LGHH 4KGJA 2NY6C 3H2WA 1QBLH 3AS0A 3GBML 3IFLH 3SDYH 5IOPA 4Z5RB 4J6RL 4MJIB 1IGTA 5C07E 3BZEA 5BOZG 5C92A 1AE6L 1FGNH 3L7FA 5KSBA 1R3LA 4APQB 3MRFB 4X6DB 1R3KB 3DVGB 3EFDL 1L0YA 1RMFH 5CGYC 4AIOA 4NZRL 4PB0L 2XYCA 1TCRA 4ESKA 1WWAX 4R90L 4YGVB 5SWSD 4I18A 1T89C 4ZUUB 5C0BD 5J3HD 5MI0C 3SDXB 4DGIH 2HFTA 1KIRB 1DBJH 32C2A 5D6CB 4PRDB 3MO1A 4CDHA 2GFBB 5IMLB 1P7KB 1EERB 1FRGL 5I66B 3MRIA 4PJHB 4CBPA 2FYYB 5FV1L 3QXAA 2KH2B 2O5YL 1XF3A 5KSUA 3ROLA 1W8OA 4KI5C 4KMQA 4E5XB 1HHKA 3W11D 2VQ1B 4PJDB 2YC1A 3O6MH 5TH2B 2RAMA 1LO2H 3F7VA 3QA3B 1ZVSB 4HKZA 5K9OA 2M1KA 3KVQA 4XZUA 5ID1B 1QBAA 4WWKC 2W0FA 2EDNA 1R5IA 2CMRL 1A64A 3CFDA 3NBNA 4U1IA 4BZ2H 1BBJB 1DQJB 1EJOL 4BYHA 4LDLB 4RSVA 4F57L 3CZFB 3HNTL 5DDHA 1FZOB 2NX5B 2PCPA 2XZAL 3OSKA 1CDHA 1X5LA 2DLIA 4HUNB 1SMOA 5MEOA 2BMKA 4ZFGL 2ZPKL 4L29B 4LSSL 3ARED 4R6UA 1JCKA 2V2TA 2L7JA 1JUFB 4A6YB 1DLHA 4G9FA 5GGQL 2C3VB 2WBJA 4PPTA 4NQSB 4YGAB 2I9LB 1V7ML 5F7WC 3ELAT 1P4IH 3GIVB 3PL6D 1W2KT 4PRHB 4D0CB 4M03A 1U36A 1A4KA 2NXZB 2PW2B 4PJAB 4RFEB 1LO0H 1CBVH 4X7FC 4XNYH 1G7LB 2P5EA 1C7SA 2EEAA 4GMTL 2IC2A 3NH7L 5DQ9A 3AC0A 4ONOA 2GJ6B 4YDVB 3L9RA 5E8NA 3MA9L 4ODWA 4XNXL 1AGBA 1YUHA 5MENA 3VFGL 3GRWH 3FOLA 2F8XC 1KUMA 4QF1A 2BSSA 5KVFH 2ZSWA 3W11C 3FO1B 1IGCH 4LK4A 1ZVYA 3NIDE 4A6YL 2D31A 2UVEA 5DHVA 2C1OB 3QAZC 3MRHB 4LCIL 1KEGL 3EAKA 4TOYH 4XPFH 25C8H 5IR1A 35C8L 3JVGA 1UWXK 3G6AB 1XF2B 5EG6C 2PO6D 2FBJL 3GBLA 1BM3H 3HZYA 4XBEL 3U36B 2EDQA 4JAMA 5T1LA 5E4EB 5FYJE 2DM2A 2GSGB 5EU7E 4AIZA 3HFML 3RGHA 3U79A 5J12B 3RY6A 2RQ8A 3DXAE 3L3JB 1YYLH 4TVPL 1IGIL 1FZMA 4I2XE 2OCFD 3BDBA 5GGTA 3U0WL 5HDOA 1FNGB 2FZ3A 1T80A 1UB6B 4P48A 3UEZA 2EICA 3E1F1 1J1PL 3QZWB 1WC7A 1OGAE 3MYZA 4WY7L 1E4WL 4AEFA 4Y4HD 5DZNA 5FO9A 5DS8B 5DHVH 1JPST 2BHUA 4GAGL 5DJYB 3QNYA 5GRYA 2Q6WA 4DCQA 5DQDH 4XWOD 5D1QA 4R0LA 1OPGH 1KYOK 2ZSVA 2ZCKH 3OR6B 2GK2A 3IFOB 2VLRB 4RAHA 5I16A 5JDSA 4B7IA 3VFUA 3V4VL 3O2VL 5EU4A 3QH3B 1FLRL 1T5WA 2R1YA 3MGOB 1NCAH 1I9RL 4ONFL 1DBBL 2CLRB 4KTEL 5C7XL 3NCYS 1C16B 4P9HH 3IDYC 2ITDB 5DO2C 3W0WE 5ITFB 1ACYH 3NN8A 5LJYH 5IHZA 4ELMF 5JO5B 3FFCB 3GBNL 4FXKB 5DJAB 1PG7W 1YEIH 4F15C 1RZ8A 1AJ7L 2AEWA 3KNBA 3DNKA 4UOJA 3NABL 5D7IF 3BOVA 1MSPA 1E4JA 3TIEB 2NY4B 2JB5H 3QDMB 1T2QH 1KEML 1Q0YL 3OKDA 3JWDH 4JHAL 1BJ8A 4R4NC 1IC4H 3PABB 1RFDH 3VJ6B 1MI5B 2JLLA 3QNZB 5C08E 2ZUXA 1Q94B 4YIQA 3VA6A 5CBAA 2A77L 4UILH 1MUJA 5C0BB 1U92A 1ZGLA 4O51A 3W81A 1QRNA 3MXWL 5HHOB 4XVTL 1EHAA 1RUQH 1TJHL 4FFWC 5BZDA 1SY6H 3C6LC 1N59A 4DKEH 3IDJB 1EEYB 1G9NC 3BISA 4LDEB 1EAPB 2ADJA 4JQVC 2DQUH 3EOAA 3B2UC 1IM3A 3KWWB 3MRIB 3HC0A 2BOBA 4DGYL 1OW0A 2FIKA 1DE4B 4NO0D 1HEZA 2NW3A 3FO0L 1OWWA 4FOMA 2OTUA 2ZKHH 4QEGA 5IMKA 5JOPD 4P23B 3IETB 4Y19D 2D0HA 2XG5A 4NT6B 1SYSB 4MMXC 1QLRB 1TZGH 5KZCB 4X5WB 1MIEH 3EYVB 2DQGL 1ZLSH 3GI9H 3SEPA 4JPKL 2GJZA 1DQLH 2VKWA 3W9EB 1BPVA 2V5SA 1U58B 4PP1D 5F71A 2J8UA 1QSFB 4IRZL 1OARH 5GJSH 3EJZD 4K8RH 3W9DB 4CVZA 3I02B 1TJHH 2EDXA 3H3KA 4LHUD 1ZAGA 3BQUC 1FLRH 2Y23A 1LEKA 5HHXH 2MJWA 4IRJB 3V9FA 1CCZA 3RQ3A 4PY8J 1YQVL 4CVXB 3CU1A 4ODHH 3P4OB 5L0QC 3H9SE 3FFCA 3D3VA 4FXKA 1AIFA 4EVNA 1NANH 1WF5A 1PW3A 4HD9A 1S7WA 5FGCE 3OKNA 2PW1A 4CN6A 4X80H 4HHAA 3RVWD 1VFBA 4XPTL 1SBSL 2XQYK 4L1DA 2ESVD 4NO3B 4PRBB 3ARFB 3VGEA 1F6AA 2YD1A 4K3EL 4ZFFB 4U1SB 5EBWA 5HHMB 1IAKA 3B6SA 2OBGA 1BX2B 2MHAA 4I2XA 2OL3A 3HNVL 1JNNH 1TPXC 3QI9C 4NRXA 3T1FA 1WVZA 3IU4H 3A6CL 1BD2E 1T7ZA 3VRIA 3H3PL 4BFBD 5E9DB 5IMOB 1EEYA 2P5EE 3O3AA 5TPWH 1GC1L 1MCPL 4UV4H 3B9VA 4RISH 5E8EB 1QFWL 3HE7A 1IILE 3MLRL 5GGRA 5FOBB 3NACH 3FRPA 1V7NL 1A3RH 4K9EL 3B4NA 2IPTH 1CU4H 2ZOLA 3QUKA 3TNMA 5JNYA 3K0WA 4ZAKC 4QRSB 4J3TA 4NYLB 2X4NA 1S7UB 1R3JA 2J8UF 3QDJE 1ZA6B 2X89D 5DMYA 2P4AB 4B50A 1NCCH 5H2BA 3VFGH 3LRHA 4GW5A 4K3EH 4YBLC 2YOCA 4H88H 4YHYB 1GOHA 1OOAA 4WI9A 5F70A 2ID5A 4C56E 2CK0L 4HIJB 5I16B 1I85C 5DVOA 3U30B 4X6EB 4X9BA 4LU5H 1OD7A 3MLWH 4I3RH 5KOMC 3DURB 3VCLA 3L3HB 2CLZB 2W9EL 3WD5H 3D85A 3RI5F 2HKFL 2F19L 4G8GA 5FYKU 2H26A 5DTFB 1G7HA 1NMCC 4M93C 4IMLB 2I27N 4EDXB 2P43B 4G8GD 5HVFB 3SE8L 3S35H 1LK3L 5EZJB 1ZT4A 1S9VB 4TPRL 2GK0A 3QDMA 5DMKA 4M1CD 4JO4H 3VXOB 1QEWB 3OMZA 3E2HB 4N8PA 1CICB 2D0GA 3K4AA 1RZ7H 3U4BH 2DICA 3FFDA 4KTDH 5IHZB 1TFHA 2BVQA 1BBDH 5C3LD 4KHXH 1DQQB 2UZXB 3B6SB 4JFZH 2AXFA 4PJCF 1P5UA 3AMKA 3PL6B 2VLRD 2VQ1A 3A6BH 3EYSL 4GG6F 3OKDB 5TQ0H 1NJ9A 1KJMB 5IBTH 1A4JA 4IBLT 4YQXH 5I15L 1QNZH 3WD5L 4NKMA 1L9MA 4NQDD 2F19H 2CKBA 4HQQH 4IOSD 2ATPB 1S7QB 1FL3B 3O3AB 3FB6A 4LSRL 1NGZA 1JF1A 5HD8D 1EH9A 3MRKB 2HKHH 4PUBL 3BPOB 4NC2B 1U9KA 1MHHA 1ZTXH 2ZPKH 1FO0H 5TE7H 5B4MC 5L9DL 3OR7A 4K9EC 4QXWA 2C7UB 5ANMB 5FAAA 2NY4D 3BSZL 1YY8B 4CU6A 3JTSA 5HHPA 1R6VA 2PXYD 5D93C 5FK9A 4UB0L 2CKBL 1KJVB 1NCCL 4IRJD 3FAXA 3EJJX 5IBLC 1RUAH 1BZ7B 3HC3L 3D25B 1HEZB 2NW3B 2OTPA 3JWDL 4K94L 4PRAA 5I17A 5ITBH 2IFGA 1QFOA 1OLLA 2XY2A 1N8ZB 1NLBH 2FX9H 1MELA 2YMXL 4U6HB 1LE9B 3MR9A 5CJQL 5E2VH 3P0YL 5C0IB 5SX5K 3UX9B 3JV5A 1JGVL 3MUGA 2YKLH 3VG0L 1A9BB 3UTOA 4XTRD 3NTCH 2R8SH 5DVLA 1Q1JL 1IEBB 3HMWH 3T0VA 1PGRB 1R3IH 4HBCL 4G9FD 3C60D 3WNMA 3K74B 2F5AL 4JFDE 1OAZH 1HINL 1AGBB 1YUHB 5KTEH 2K3TA 3QDGA 5EIIA 4NO0B 3X14A 1RVFL 4O51B 4ZQKB 5L7XL 2YA0A 5F6HJ 4WUUE 3OAUL 4KMLB 5AWNL 5BS0B 1MAML 5DJ8A 3EOTL 1JZ3A 2NXZC 4AIXA 2I5YH 5B39B 3N9GH 3P73B 4XVUD 5FGRA 5C09A 2BSRB 2WAHA 5A2LH 2MNUA 2Y72A 3RVUD 1JF5A 5DRXB 1HKFA 4XVJH 2YWYA 1U2CA 3JV0A 5T3XD 1YJDL 2IG2L 4UBDC 3BP6B 1F6AB 4ZFFA 5IK3A 4ZYKB 4I3SH 4LCUA 3LOWA 3DV6A 1CGXA 4YHPB 2GY7B 3DO3A 1F2QA 1T1XB 3HFMH 4I9WE 2P44B 1J7VR 4WIQA 3SKJL 2PO6A 5DJZB 3LZFH 2DQHL 4XCEA 4C59B 3KPOB 2COQA 3GMNA 4GLRH 4CVZB 1BQUA 1DEEA 1R5WA 2DI9A 4L4TB 4RNRB 4JJ5A 3DIFB 3QEQD 3UYRL 2CLVA 1Z9SA 1WEJH 1J18A 1LEKB 1RZJC 2AV7B 5DA0B 4HCRA 4LLAA 4WFGE 5B3JF 4FXGA 1ZMYA 3TLRA 4ALAL 4E41B 1XGUA 4D9QD 3OR6A 4W4OC 4X9FA 4OCRH 4D3CH 3HE6D 4LSDA 4PGDB 1FIGH 4JM2A 4HLJA 3SOBH 4HIJA 3MLSH 1CU4L 5JHLL 5JOEA 3S9DB 5EPMA 4ZUSA 3GFUA 3RIAK 2MSPA 3S35X 5C0BE 4P4KD 1NFDF 1T1ZA 2XTJE 4J23A 4LHJB 2VITA 2JJVA 3TBVB 3LEYH 4H1LG 3VFWA 1YPZA 1W72H 3LKQB 1KLGB 3LKSA 2OZ4L 5I1AA 1MLBA 1T66C 1T7YA 3QHFH 3T3PE 5CAYB 3VGBA 3PQYA 4JZOB 2VLMD 4WNQB 3BEWB 3BEVA 3Q6FA 5EO0B 4I77L 2J2ZA 1C1EL 4RGNE 3OKKA 2BJMH 1R24A 2GW5A 2KKQA 1GL4B 2VDPL 4PLKD 4L8CA 4NWUH 1QLFB 5DFTA 1MREH 4L8BB 1P7KA 2XZQL 1NCWL 3CMGA 5GGVH 4DN3L 4K7PL 3SKMA 2IJ0C 2P45B 3CUPA 1JRHL 1C08A 2P24B 3BKJH 1MCNA 2AK4E 4F57H 4O2EB 4OD3H 1PQZA 3MLZL 3KYNA 4DVBB 1NFDA 5EFIB 5EU6B 3TPKA 2VDOL 4JPWH 3P77A 5MERB 2X4NB 1UXWB 3T1WA 4Q9QH 3MRLA 1DVFC 3C2AH 4RFNC 2QR0B 3O81A 4XMLH 2EYSB 3U9PH 4M6NL 1CD1B 3GMQA 5CJ8A 1T20A 1WAAF 3MV7A 3OX8A 4WDIA 4P5KA 2F54E 3MUHL 5D1XB 4HKXA 2YUXA 1DQJA 1YEHH 4N8CL 1C5BH 1E27B 1Y0LB 4MAYB 4LSVL 5CJBA 1FL3A 3CSGA 2V2TB 1WIUA 1BHGA 3EO0A 5CINL 1MHHB 4PG2A 4OCXL 3QEGH 4LSRH 4WO4D 2P5WA 4ZS7H 5FUZH 1NAMH 3EW3B 2QHRH 4JFXA 1UZ8A 3HUJE 3KPSE 2FX7L 1T7XA 1URLA 2DQFA 1ED3A 4FNLH 1RK0A 3P2TA 3RL1A 3V6OE 1ACZA 4QHUB 3TZVD 3EFFB 1OARL 2UUDH 4PV9B 1B0WA 4QHNB 1GGUA 3L3OB 4UIMB 3MJ8A 2BRRL 1PSKL 3VI3F 1ZHBA 5KSVB 1BM3L 5ICZA 5EORL 4HIIB 4NN5B 2RGSA 2Y7QB 2WIIB 4JKKA 4X5LA 1U8MB 1KCRL 2OJEA 4MDIB 1P6FA 3L5XH 4RGND 5EO0A 3FJTA 2PF6A 1I7ZB 1N5YH 2R15A 1TMCB 4W6WB 2R0KH 3VFTA 5E8DL 5D72H 3QIWA 1KJ2H 1NGYA 1UWEH 4FQLL 2VLKD 4E5XA 1Q9KA 2CUIA 3AS1A 2HG5B 5F96H 1SYVB 1MAKA 5EFIA 5EU6A 3LQMA 4EBQL 3TPUA 4D8PB 1TNNA 2BNUA 2A6JB 1X4XA 2DLFL 1FJ1B 4FZ8H 5DGQA 4HK0A 1IQDB 1X7QB 4C57C 3QCTH 5F9WC 4RMSA 3VWJA 4PJEF 4M6NH 2KL6A 2X4TA 1WCBB 3DO7A 1J8HA 3VXSE 5JNYB 3FB5B 1RFDL 3QEUB 5HGAA 1N2RA 5EOTA 4NPYB 2ZZUT 5FCUL 2OK0H 2H8PA 1ZEAH 3NPSC 1XF4B 3MR9B 3FFCE 5E99L 3DTXA 2GCYB 1P1ZB 2XWTA 1NUFA 2CLVB 2NY1C 2XPGA 1H3UA 4ZTOH 2AI0L 3NABH 5FUCE 4S2SA 4BZ2L 4UT7L 1DANU 1XGQA 3VFUB 1A22B 3KPSD 4N0FB 4XCFL 3MRFA 4K3JH 3EO1A 1S9YB 2YD7A 1KB5L 2NX5E 4UQ3A 4GO6B 1RK0B 2ZUSA 1HDMA 4NN7C 1BQHA 1Z5LB 4X99A 2QQKL 5IKCB 1CDIA 5DTFA 2H32A 1S5IH 2VIRA 4JPVL 4PV9A 2VITB 1KB9K 1Q9OB 2E3VA 5C0DB 1CD8A 3CK0L 3CXHK 4IIQC 1A1NB 1QG3A 4OAWA 2EDYA 3HI5L 5HHQA 1UH4A 2R69L 4HJJL 5FECB 2NY5C 3FN9A 5JHLH 4PJ8B 1WLHA 3HG1B 4FP8H 4JB9H 1Q8MA 4CL7A 3KHOA 2DWEA 2BVQB 3KPRB 2VLKA 5C0FB 3BKCL 4RGMB 2NY0C 2OZ4A 4LMQI 1AKJA 5F97E 2EXWC 5IHUH 2XZZA 5HHXL 4JDZA 1XFPA 2EKSB 1XIWC 1C08B 2P24A 3QCUH 1OGAA 1AXTL 1J1OH 4HMDA 2WM0A 1F4XL 3IYLW 2IPKA 4G9DA 4FQIH 2F15A 3O6KL 5DHYB 1HSAA 5IFJB 4P4KB 1CICC 4Y4HB 5KN5A 2Q7YB 3H7BB 3DHJA 4I0KA 4UQ2B 4FXGB 1WAAE 1CFQA 4QYOA 5F44A 1TDQA 2EECA 4HKXB 2JJSC 3FB7B 2VB5A 3H8NA 3W5NA 5KVDL 4M6AA 5C07B 3P4MA 1N64L 4L1HA 2DQCH 2FEDD 4F7EB 4XB8A 4ZUSB 1IGFH 3IU3A 3KPSA 1FL6A 3OTTA 1F90H 1NMAH 5DR5H 1NDGA 5IFHH 3DECA 4L3CA 4U0QB 4Y5YA 5HHVH 4LSTH 4M7KH 1ETZA 1G6VK 1YEEL 1FBIH 1KCVL 3CXHJ 4APQA 2F5BL 3L3IA 1XF5B 2CIKA 5E2JA 4U2ZA 5CP7A 3VXMA 4W68A 1DQDH 3DUSA 4I1NB 4Y19E 3JWDC 4JZJB 4APQC 4QT5A 3I6GB 4X8JA 5KTEL 4IRJA 1V05A 2DTMH 2I60H 4OZHA 4JB9L 3MV7E 2ITDA 4BA8A 3OPZH 3TO4B 3QHZL 3TWCH 1G9NL 1QFWM 1VGEL 4N0UB 2LAAA 2IH1A 2OTWB 1UM6H 4H88L 1H9VA 1MCPH 4UV4L 1C16A 5I73B 4LLVB 2VN4A 2GTZB 1UENA 2ICWA 1EDQA 3IRZA 1G7JB 1OP9A 2A38A 1BAFL 1LNUB 1OWRM 4PJBF 3WFCH 2OX5A 4CU7A 1HWHB 3G5YA 4XCNA 3S8WA 2ZJSL 3BGFB 2UZIL 1H8NA 5JZ7C 5BW7A 3MOBL 4RA3A 1A6UH 1MFBL 1MQKH 1WC7B 4YHZH 5KVEL 1FZOA 3IRPX 4XHJC 3JV6A 1B2WL 4WCYH 1GGBH 4OIAA 1HKLL 1TIUA 1EGJL 1HH6B 2ZUUA 4M1GH 1OCWL 3INUL 4KRPB 3M1BB 4P5TB 4AZ8A 1K3IA 5DJZA 5J89A 3T8XB 3FB7A 2GT9B 5GGSY 4FHBD 4M1DL 4HH9A 2DJUA 3U9UB 5DO2D 1XR9A 4M7ZB 3QO1B 2VXSH 2DLFH 4FZ8L 1MHPL 4R4FL 1JVKA 2FSEB 2FD6L 3FO9B 2ATKB 1YEEH 1F4WL 2OR7A 3FRUA 3DARA 4ZTOL 3QIBA 5KG9B 2V5TA 2BY3A 5J1SC 3KNBB 3VCLB 5E9DE 3T3PF 4PTUA 4JO3H 2A6DB 2XFXA 3OKYA 1CLYH 1WWWX 2X4QA 2J8HA 3I6GA 3EUUA 3EGSA 3JUZA 4ONHA 2BVOB 3RNKA 3ZE2E 2ENSA 1QFWI 5CD3A 1K8DB 4PJEA 1VCAA 3N85L 5JUEL 4XNUH 1CXKA 5A3ID 3CMOL 3QNXB 3LPWA 5IVZB 3I6KA 2PW1B 4N1CA 3UBXI 2R9HD 2O5XL 3BDYH 3C9NA 4Y5YC 3UTTE 3SO5A 1KTLA 2XWJB 3VXSB 5F1NB 2GTZA 1KLUB 1TJIH 4LEXL 2AGJL 1T22B 2R0ZH 4HUKB 35C8H 3VXRE 4MXWL 5D70L 3L3DA 2HWZH 2CQVA 3MBED 4NQDE 1DBAL 4X6CB 4HHAB 3ULUH 1J0YA 3RWIB 2XI9A 2D3VA 3IS1X 3GMLB 1ZWIA 4AEHL 3BKYL 4EQ3A 4QXUH 1KNOA 5GRVL 5IUSA 4C58B 1G0DA 3HZMA 4WFED 1S9WB 2DYPB 2IPKB 1NGZB 3S4SB 4DUVA 1KTKE 3BW9A 3WSQH 4LASH 3EYVA 4LHQB 1YDPA 4R4FH 5ACLA 3OR7B 5AG9A 1T83C 3KPNA 3RZCB 1RIHL 3UCRA 5MENE 3DI2B 3N9GL 4MAYA 1S7UA 4X6FA 1F4AA 3O11B 3TZVA 3ALWA 2M26A 5TE6L 4YHOL 4G8GE 3GSXB 4UILL 4QXGH 2LFGA 1E28B 2ZCKL 4FP8L 4PRIB 2J5LB 3UROR 2XQBL 4NQVA 3BVNA 4OCXH 5C0IA 4RGOL 3N1MC 5D5MF 1JPTH 5DEGB 3RNQB 2O5YH 1U8JB 1IEBA 3UAJD 1JN6A 2PUQT 1UWGL 1EUUA 1F11B 4X8JB 3TH3T 1W0WA 2C3XA 4GQ9L 4N8VG 5HYFA 5FV2A 3CFEA 1MWAH 4QRPD 3U7YH 2VXUL 1JZ7A 4R7NA 2R2HA 4X5XA 5T5NF 4K3DL 2H2SC 4UDTB 3VRLF 1NC4D 4Z18A 5F6IB 2BXZA 4OF7A 2C9AA 1SY6A 3UYOD 5FO7A 2RCSL 3H3BC 5FYKL 4OCWL 8FABB 2EH7H 3FKUS 3D18B 1ROWA 3F5WA 1SJXA 3I3EA 3C5JA 4F9LC 2AJYH 4ONGL 3ARFD 5ALCH 4WFFD 4I9WD 1II4E 3OPZL 3TBTA 5E24E 3BD5A 3GHBL 4H0HB 2P8LA 4HXBH 4OKVA 3K8LA 4N5ED 4U7KA 1FNAA 3ARFA 5FM4A 5IMKB 3LS5H 3QIUC 4AEHH 4H1LH 3GZKA 5GS2H 3QHFL 2X1PA 4XMPL 5EC2B 1T3FB 4XXDB 3CCHA 5D1ZD 4JKLA 2DKMA 4GQPH 4TVPD 2GJ6E 4BH7A 5ID0A 3GKWH 1U8QA 3U0TA 5IP4A 3NH7H 4JREC 4QRUA 1VSCA 5IMMA 4XBEH 1KN2H 4BQ6A 2FHFA 5K9KA 1UVQB 1HQ4B 4ZTPH 5JDJA 3ES6B 1AGEA 5KOVC 1EEQA 3SO3B 4Y8DC 2LV4A 4M7LL 1VERA 2ZUWA 4DZ8B 1OSZB 2GAZA 2KPNA 1EJ6A 3K2UH 4IRSD 3EO9L 3O41B 5ADPL 1C8PA 1MPAH 4ZFZB 3GHBH 4EDXA 4PJHE 2ICEA 4CNIA 1MCWW 1A3LH 2I24N 3LQAL 1FVCB 5I74B 5F9JB 2B1HL 3KGRA 1QD0A 1QEWA 2XFXB 3V2AR 1UCBL 4JQXC 2FH8A 2AXJA 2VR4A 3F7QA 1Q9OA 1ZS8B 2ESVA 4P9HL 3QIBB 5DFVC 1YMME 3MXVH 4AEIL 2BNRB 5L7XH 1AHWB 5DUBA 1A9BA 4FABH 1F4YH 3BH8A 4M6OL 1CF8L 2QHRL 1Q0XL 3EGSB 2MCPL 4PJEE 5IHBA 1PZ5B 4ORGA 3MRDB 5FKAA 3UTSB 4WW1A 3D18A 3F5WB 5EUOB 3MO1B 4NQEA 4WO4C 2HMIC 4OLEA 2FRGP 5A43C 4JLRB 1A3RL 5DVNA 2YMXH 3V6OC 5IHLB 5AG8A 1U8NB 5EBMA 4O58L 4MYWB 3EOTH 4HFUH 1ZVSA 3PWPE 5IVOA 5D7JD 2DLHA 4C56B 1BGXH 5DD5L 3NFPA 3L5IA 3V4VH 2NNAB 1KF9B 4OD1H 1KTRL 5I1KH 1RPQA 1CXEA 3PP4H 3WS6C 5EOQL 1OAZL 2N7AA 2BCKB 4MA8L 4AQ1B 5ENWA 4O00A 4TULH 4KI5E 4YWGL 4XCEB 4EI6A 4MCYB 5T3XL 4QTHB 5GXBB 5FDYA 2V2WB 3KDMB 2ADIA 1EZVY 2A0LC 1WJ3A 3NMEA 3T0XA 4JM2C 2X9WA 3OKMB 4D3CL 1W72B 1DCLA 4HH8A 2PO6B 4LVNB 5KSAB 5J6HB 1CK0H 1J86A 5C2BH 3UP1A 1R5WB 5JA8B 5TDPB 1DJSA 3UYRH 4LVEA 2B0SH 1RZFL 5FM5M 2AXGA 1JTPA 5HTSA 1BGXL 1EFQA 4U3XA 3SN6N 3VFNB 4QHNA 2XRAL 2AERT 4X4MA 4D0DB 2ERJB 4KK8D 5HHME 3FT2A 2WQRA 2EDTA 1AR2A 3H9HB 4KTDL 4Y4KD 5ICZB 2J6EL 1DQQA 2EDKA 1S7TB 5BJTA 3IGAA 2Y36L 4N0UA 3ULVD 1U41A 3U4AA 4K71C 3BIBX 4MA3B 3GSVB 1AHWA 5DUBB 5CUSL 2BSSB 4J2XA 4PBWD 4WU5B 5A40E 3H6JA 4JZJC 1MVUB 1ZXQA 2YS4A 4P46C 5KSBB 1FN4B 2UWEF 2R2HB 3TP4A 3OL2A 1TQCC 1TQBC 2A83A 3CC5B 3B5HA 3PIQB 4GKOA 4HLZH 1YEDA 5DT1H 4MS8D 1INEH 3ARDD 1CBVL 2FD6H 3PDOB 1VB9A 3SDXA 1OTUD 1FJ1A 1WGOA 1IE5A 3FQNA 3MLVL 4JO1L 4NUGL 3D48R 3MRLB 1RZGB 4XP4L 1EO8H 2EC8A 3C87A 1NGPL 1I8IB 4WU7A 3ARGA 3MV7B 1NAMB 3PWNA 5I8CB 3V4PL 4NGHL 2DQDH 1F2XK 1WBXB 2V17H 3P9MA 1VPOL 1JPFA 1OAQL 4JKMA 3ARYA 1WBYB 1E6OH 4M1GL 5IEKB 5LQBL 4HS3A 3KYMB 4L3EA 5EPMB 3SDCA 4NZUH 1IFHH 3G08B 1Q0YH 1A1OB 3S34L 3FQRA 3ET9F 2PYFB 4LLQA 5AAWA 4J4PC 3SE4C 5IVXB 1T2XA 3B9KC 4Z5RA 2D7MA 1CLZH 1L9NA 3CXDH 5IBUG 5J13C 2QJDA 1I3RB 4QOKA 4Y2DB 1UZ8B 2CDGA 4JRXE 1MLBB 1MHPH 4R90H 1B88A 5KSBE 3DIFA 3L5WA 4JPVH 2UV3A 2C3WA 4GG8B 5L88H 1RUML 4YHKL 3BKCH 2H32B 1REIA 3EDDA 4FTVB 4Y5VA 1PX4A 5EBLB 5DJ8B 4XHQA 2HFFA 4ODVH 1T2QL 4Q9BA 1UZ6E 4L8DA 4XP9L 4KK8C 2ED9A 5HHQB 3IGAB 5DC0A 1T21A 3IDIB 4N0RA 3FQWA 2HJFB 1C5DB 2HJKA 1S8DB 3QULB 1JYXA 3SQOH 4G6JL 2VLKB 2C4XA 1NCNA 3PUCA 2K7QA 4LCUB 2QR0A 4DAGH 3KXFB 1ZLVH 3KLSA 1CWVA 1DQDL 3GJEB 3ZTJG 1CGTA 1UC6A 3ZYJA 4QCIB 5J06A 2AGJH 3D39B 4KVCL 2D9CA 4WI6A 1CXIA 1Z6JT 4RGNC 3H9SB 1BVKA 3Q3GB 2D03L 1RUKL 5IB4A 2YPVL 1IKNA 4PB9L 4TNWF 2YD8A 2BX5A 1PVHA 1NMAL 5DR5L 4Z7UE 2P5ED 2HT3C 2F74B 5CGMA 4OCSL 4LVHB 4N8VA 4DKAA 3CFBB 4PP2A 5C09E 1X9QA 3LHPH 3QUMB 3F62A 4MD0A 4NO2B 1EEZA 1IGYB 3PWNB 1VFOA 1BFOB 1IL1B 2QBWA 3CIQA 2YN5A 4D8PA 1C1EH 1BVLA 4QXGL 1GPOL 3OG6B 3GMOA 3C5ZD 4WGVB 4KY1H 1FZJA 4IRZH 4JY4A 5GJSL 1UGNA 5KVGH 4GOSA 3UTSD 1JPGB 3D2UD 4FFZL 2A2QT 1N2RB 5EOTB 2YA2A 4KVCH 2E7HA 2VH5H 1CD9B 3B5TA 4LIQH 2IQAA 3ZE2F 2HAZA 3NFSH 3OB8A 4HKBA 4J12A 1NBVL 2WMPA 1JN6B 5JW3L 5C2BL 1M7IA 1RZKH 5T3ZE 3FO1A 3SQOL 2Q3ZA 3M45A 4KROB 2YUVA 5DUML 2XA8L 2OP4L 4GBXD 1KENH 3P0VH 4NKIL 4XPHH 3S5LG 3MNVA 2BXYA 4LLYA 4H20L 1KXVC 4HJJH 2EDEA 3OGCB 1S7WB 3NIGE 1ITCA 3GKWL 1OAKL 3OWEA 4XP5H 5JHDE 5F21B 4GUPA 3IJYA 3HNSH 1J0JA 2NY3D 1OW0C 3U7AA 4AL8H 1IC1A 2AJZB 4IRSB 1IAKB 1CLOH 3BE1L 5IHUL 4Y1AB 3HPJB 4OV6F 3S98A 1BP3B 3O0RH 4HPYL 4FQ2L 4QNPE 5DLMH 4JO2H 3QDMD 5F6IC 4QRQA 5JR1L 4UT6L 5DK3A 1IARB 2UY6A 5DJ6B 4X4ME 2IPTL 1A9EB 3WFBL 3UPRA 4UI2A 4U6YB 1ZK9A 3STLA 1R0AH 4GRWH 4D9LH 2XA8H 2E9BA 4MAYC 4F15B 2F58L 3B3IA 4BH7B 2BNRD 1I1RA 3E6HA 5DF0A 4LLDB 1NC2A 3IFNH 1CGUA 2WV3A 1N59B 3AU1A 3MV7D 2MQ0A 1UVQA 1WBYA 1HHIB 1EBPA 1IQDA 1X7QA 3RIAF 3QDAA 4BQCA 5GS3A 5ESQB 4HAGA 1LEGA 1VHPA 43CAB 2XKNA 3LH2L 3ARGB 1I1FB 1GOFA 5IOPB 1CTOA 5E2UH 3WS3A 1DFBL 1JPGA 1NSNH 3B9EA 3AREA 4R2GB 3ULUE 2DBJA 4FQJH 1UKQA 3CSPA 3MRQB 4LOUC 4UTBL 3B8YA 4S1SH 2JCCF 2ZG2A 4WVRA 1OAQH 2AKRB 4HZLB 3FQRB 3S6CA 2PXYA 1JP5A 5F9OH 1E0OB 2NTFA 3DGCR 5BRZE 4Y5XA 1YEJH 2Z8SA 1TVHB 5KZCD 4ELKA 1MCOL 1Q94A 3LSOB 2RFXB 4YHNA 3T0EB 4FABL 4IMLA 3LN4B 4ALAH 4TNVF 1G7MB 1U91A 5GS0H 4OCRL 4PJ5E 1QSFE 1P9MC 3BE1H 3K46A 2OR9H 5C8JB 1ZGLB 1MFAH 2AVGA 1MCIA 3EYFA 1A6PA 1QVOB 4DUWA 1IQWH 1KCRH 2WW8A 2ED7A 1G7QB 4NIKB 4DOHB 1CICA 3DVIA 1J8HE 3VXSA 5B8CA 2OI9C 4HX1A 2R4RH 4EBQH 1LK3H 1GC1C 4PRNB 2BDNL 1I9JH 4FN0A 2EIZB 1D6VL 5D2LB 2Q7YA 1MCLA 3ZL4H 1KJ2L 1K9TA 2DJSA 1P5VA 5GIRB 3QIBC 3B9KD 4MJ6B 1UJ3B 5IFAL 2HVKA 2D7PA 3RTQA 3I50H 3BDXA 5I1HL 3KLHC 4JFYB 1A9EA 3UPRB 4KUZH 5TE4L 3TYGH 1JV5B 1X4YA 3VXSD 1VEMA 4LPUA 4G9FB 1OAXH 4YR6A 3KPNB 5TGBA 1DN2A 4RA0C 1BVKB 2R2BB 3BESR 3Q3GA 5L2KE 2V9QA 2O5ZH 2H45A 2NY7L 2V2WA 5E9DA 4H25B 5EU6E 3PP4L 1A02N 1IAIM 3QPXL 1AXIB 4U1HB 4M6MH 1QR1B 1MNUL 1KV3A 2DIAA 1GPOH 4LRIA 5IKCA 3FT4A 5IV2B 3AFLA 4CVXA 4K23L 2AI0H 3WL9A 3QZWA 1FGVH 1MJ8L 2OL3H 3WHXA 4U05A 3B5GA 5ELIA 3FO9A 4KXZH 3BD3A 1Q1JH 4PJGE 1GC1H 2B4CC 3EHBD 3MLYH 3NIFE 5FB8A 1A7RH 1E6JL 1H5BC 4PTUB 1U95A 4FQIL 4YBHA 3TT1H 4F7PA 3B9DA 1K8IB 3P0YH 4HGWB 2Z93B 4OM1H 5D1ZA 3SPVB 3UTPD 5ABDE 1WZMA 2VDNL 1CICD 4PLNC 4X4XB 5J9PA 4OZGE 4XCNB 2FDBP 2XXMB 4LVOB 4RWYL 2X6MA 3PHQA 5KSAC 1CFNB 2ZOKB 3BZ4A 3SGKC 3O6LL 1N4XL 3H9SA 2WWKT 4XC1H 2Z8WC 4LCCB 5IJKA 3C5JB 5IF0B 3NA4A 4KMTL 1MRCL 1FZKA 5CD3B 2B8OT 4OB5L 8CGTA 3JVGC 4Y4HA 1S78D 5E2VL 1U8KB 2QSVA 4UQ2A 1H5BA 3QUYD 5E1AB 1LDPL 3GHEH 4X98A 3OAYH 2Y5EA 5I1JL 4ORZC 4FQHB 1VACA 3IDGA 2B5IC 1JHKL 1IAII 3WO3B 3SOBL 1G7JA 1TETH 1QSED 3MJ7B 2WUCH 1C5CH 1RUPL 2JJTC 4YDJA 4LQ1A 2VNCA 4F7EA 3QBTB 4JZNB 4EN3C 2HA1A 2W0FB 1IC5L 2DAVA 3SKUD 3FO2A 3CH8A 4M93B 1TQCB 5GSVB 5L2JB 4FQQB 1A8JH 1UACH 1FV1A 3U48A 5JORA 1BBDL 4HWBA 3AU1B 1EAPA 4WI4A 1I1YA 3MJ9A 4QXTA 4TUKH 2Z31C 4UDUA 1UQSA 2GJ6D 4JY6A 4LCIH 4JZJA 2H1PH 4LFHD 4ZODA 2C4FU 4XPFL 3QDJD 2H6PB 1MWAB 5SWZB 4P5TA 3MLUL 4GKNA 2DIJA 4X4ZA 5IB3B 4DEPC 1JFQH 3DBXB 5GJTH 3MV01 2C7UA 4NQSA 1X5IA 3KYKH 4PJ5D 4P3CH 4DN4L 1WEJL 2BC4A 4M6OH 2HKFH 3DX9A 1BJ1J 2VDML 5EZOL 1ZLWH 4MD5A 3OGCA 1KYOJ 5ESQA 4EN3A 5CZXD 2ZCHH 5T1DL 2Y1VA 4PJCB 1DANT 4LF3A 4MA8H 5SV3A 3QWOA 2KUTA 4GS7C 4WRLA 1PG7L 2CDFA 4XPAH 3B9KB 1RIUL 2BK8A 2B2XH 3U4EB 3RWIA 1J0ZA 5E6ZA 4QNPF 1UADC 2JIXD 2OSLB 4AEEA 2C1OA 2YN3A 4U49A 4ZUUA 3O3UN 1HYSC 1SEQL 4K3GA 3P4OA 4NHUA 3GSNH 3TNNA 4R7NB 1MFCL 1HIMH 4PRDA 4HWZA 1NLDL 4QOKD 4PJHA 1IBGH 4JAMB 2I9TB 1YN7A 2R1WA 4OUUA 4WTZG 1S78C 5E2UL 5B8CB 4KGLA 3P77B 5MERA 1JGDB 1N6VA 3RUGB 4OI8A 1VADB 5ITBL 1LE5A 4JRYD 1EMTL 5FUCC 1KB5B 1IGYA 2FZ3B 1UB5A 4OQTH 1NKRA 5FHBL 3P4NB 1H3WM 4FMKA 5ISZA 3D39E 3LS5L 3NVQA 4U1IB 1I4FA 1MY7A 4ETQA 1OTTD 1ZSDB 4LLWB 5FHAH 1QFHA 1NDMB 4CW1A 5KG9A 1H0DA 3HMWL 1J1XL 1FORL 3ARUA 3AB0B 1FZJB 4DKFL 1SJVA 3NAAL 5D7LD 3ILQC 5GGRB 1NKOA 2HFGL 4KI5D 4DW2L 3RHWF 1HIML 5AUMB 3N06B 5HGDB 4PRHD 5DEZA 1GGTA 2BVPA 5IT2L 1E4XL 1YMMA 4JFXB 3ULUL 4U31A 2RBLA 2YBRB 3TESA 3G5ZB 1YNLL 3I9GH 4G6FB 1D6VH 4JVWA 3RAJL 3EFFA 1KC5H 4NM8H 3MROB 3MGOA 3RX8A 1RURL 4ZD3H 3KS0J 4TVSa 1MJJB 1SM3L 5J11C 4JDVA 1K4DA 4UNUA 3V5KA 3WHE0 1JHTB 3CU7A 4P49A 4U7SA 3VXUE 5L8JB 3KJ6H 3WJLA 4P2CG 3VXPB 3VGHA 1R0AL 1T5XA 1P7QA 2JJUA 5E8DH 1A7BA 1U3HD 4HG4J 3ZE1F 5DRWA 3IDXH 4XI5D 1B6DA 1J88A 3V79C 4MX7A 1PKQA 4M9PA 3JTTB 5K9JL 1M7DA 2P49B 3ULSA 3LKQA 3MSPA 5IK3B 5F7NC 4HPYH 2X7LA 1UG9A 5T3XE 2P46B 1Q9WB 3OXSA 3NFSL 3T2NL 1MH5A 2ZNWA 3BUYB 5CCKH 2Z91A 4YLQT 2XZCL 3IXAB 3L7EA 1ZLVK 3U36A 3LEYL 2NTSP 1RJZB 1KPVA 3TPUB 1RIHH 4OF5A 5ID0B 3L3GA 2VISA 2D7TL 3UTTA 1KELL 5IF0A 3TBSA 1XCQB 4M7LT 4N9OB 1A7QH 1WWCA 5A2KH 2D7NA 4GLRI 2J1KA 5GSRB 5DC9B 2D7OA 3S3JA 4MJ5B 4PS4L 4G6KL 4HS8L 3MJ6A 3QEUA 4YHIA 1I4FB 1AY1H 2ARJA 3M8OL 4GH7B 3J8F7 1XF4A 2V7HB 4XNXH 5D7LE 1QLRA 2X1WL 4ODSL 4S1RL 3TH2T 1I1FA 4B0MM 1F3JA 3L1OL 3HR6A 3DROB 5AAMA 1AQKL 2NQCA 4XP1L 3TBVA 3QEQE 2EDJA 1EHXA 4MB5A 3W0WA 5D1XD 4EUPG 3QQ3A 1UM4L 4WNQA 3LV3A 1CD0A 5HDBF 2ZOKA 3EO0B 3O2VH 2DKUA 1KT2A 3QUXC 1R3IL 2CLRA 3QHTC 3QAZB 3IJSA 1V7NH 4J8RB 5FYJD 1NGQL 3F8UB 4MNQB 1B4JL 5DURB 1A1NA 1L0QA 3C8KB 2PTTA 3B9KA 5D5ME 3IDIA 1DUYB 2DMCA 5E4EC 5C86A 4MAUL 2FWOB 3RVVD 5BQ7A 1QBBA 3A6CH 3VJ6A 3ZE1E 1NL0L 2CKBB 2K1MA 4RAVB 1NUDA 2JIXB 1I7UA 4Q9RL 1IC7H 1WBZA 4G42B 3FO2B 5F9DC 2YD5A 5HY9B 4N0YL 4HCRL 5T3ZH 3GO1H 1QYGH 3TVMD 1VENA 5IB4B 2VL4A 1I7TA 2F54A 2I25N 5DD0H 4CDGC 5LWYL 5SWSA 2BRQA 5KVGL 1JK8A 4JFFB 4PV8B 3TBSB 4WW1B 4UINH 1E6JH 2JE8A 1MY5A 3LIZH 3TO4D 5EZLA 5C0CA 5GS1A 1T4KA 1CFVH 3LCYA 3ME0A 3CFJB 1DVFA 2FJHA 1ZHKA 2DTML 2I60L 3CDCA 3H9ZA 3VD4A 4WENB 3BWUC 1L6ZA 4PJCE 5ADPH 1RJCA 1U8HA 4ZFZA 2SEBA 3RGVA 5C07A 4KDTA 3DSNA 1A0QH 3C5SA 3GJFA 3NA9H 1U8LB 2IF7A 4WU7B 4IEFB 1A2YA 3P4NA 2NY5H 4LHUB 2YD6A 5JW4Q 3QWOB 2DQHH 1S9KC 3MTRA 2FR4A 1PY4A 1PBYA 4JPKH 4JFOA 4U2YA 3SDCB 5HPMA 4I5BA 3D85B 2FATL 2AQ3A 2R0KL 3N1QC 4HQQL 2EO9A 3NGBC 5FYJU 1P69B 3PQYD 5GRWA 5AZEH 3HZKB 5I1CH 4Q6IC 4KK9C 4PJ8D 5CP3A 5KVFL 4CRPA 1FN4A 5LGJB 3QT2A 1K85A 4X7CC 5IROA 1YYMH 3MYJA 1DUZB 4MXVE 15C8L 4A2LA 4JKPL 2GSIA 2FEEL 2GK0B 3NPSB 1R3HB 5HSFA 5IIEB 2FO4B 5JXAL 1VFBB 2R1WB 4OUUB 3PDOA 2VR5A 4PREB 3FT2B 4LLVA 4M7KL 4HKJA 1NFIB 2NY0D 1I1CA 4OLUL 3RUGA 2IBBA 3U82B 5JOPE 4ZOCA 3BXNA 4Q9RH 2VXSL 3HN3A 3TO2B 1W0VA 3GSWA 2QTEA 2WUCL 2CGRH 3WMSA 1BAFH 4G42A 3I84A 1UYWL 2D9QB 4BFEA 3I3DA 1FVEB 1K6QH 4NQED 5L6YL 5DK0A 1O7SA 3JV6B 5SWQA 1Z3GH 2XN9A 1BIIB 4F8TA 2AK4B 3PIQA 1JF1B 2W38A 3LIZL 4YK4C 5GS1B 2EH7L 3NFNB 1BQHG 4NWTH 4UNTA 5I76A 2BVPB 3DVNB 3HI6H 3QUYA 4BUHA 4QRRA 3HPLA 1AC0A 2J88H 5TQ2H 1SM3H 3MX0A 2D4DA 1I9IL 2HH0H 5BVJB 4AJ0A 3MOAH 1BZ9A 1ZE3C 1FE8H 4OTXL 1HI6A 4PJFF 5JZ7D 2ZJSH 5F7EL 3F6LA 4OLWL 1A7OH 3PGCB 3RVUC 4OGAD 4Y5VB 4NCC1 1VA9A 3Q48A 5DI8B 1RMFL 1UCTA 1TTFA 1D9KA 3IS0X 4HIEA 4M5ZL 4U6HA 3CLEH 1D6EB 1E27A 5BS0D 1T1YA 1P4LA 5IQ9A 3G04A 5DC4B 4Z77A 1R5VA 1IBGL 2BFVH 4N5UA 1AY1L 3TEUA 4KKNA 2PR4H 4QHKJ 5CFHA 1TXKA 1N7ML 5D1ZC 5BO1H 2RFXA 3IU4L 3KXFD 1NGXA 3LSOA 4KU1A 4R7DB 3T0EA 2PYEA 3OJVC 3BRGC 2DTSA 2CDGB 5TDOB 3V4PH 3SKOA 5EU3A 4CMHB 5CP7B 2Y36H 1INQA 4MQ7A 5C0GA 2MTPA 4DQOL 5JW4M 5J6GB 1H15B 1K2DA 2E9WA 2Y4SA 3EOBA 3GMRA 1AP2A 5CIPA 4ENEC 4HX1B 3UPCA 4L8SB 2VDLH 1QA9B 4ZG1A 2B1AL 4OZHE 4U1NB 2B1HH 1KLUA 3O8XC 1V5JA 2EIZA 3H9YA 4LLMB 1LO4H 4RIRA 4KKLD 2AJXL 4N0CD 1U8MA 3IJHA 4HPOH 4XAWL 4AM0A 4BH8B 1NAMA 3MCKA 1MFCH 1MCCA 4ZAKB 5F7FA 1YEGH 2VXVL 3WYRA 4G8EB 4GAJH 1YJDH 5HYSA 4CMMB 3EYSH 4UV7H 4AH2A 4LL9A 5DSCA 3VFTB 5CLWA 1KTDB 4JQIL 2BMKB 3HE6B 3DX6A 1S7QA 3G5YB 1GZQB 1S7SB 2R4SH 1JHLL 5HBBA 2W92A 5EU6D 4L3ED 4MJIE 3OJDA 3T4AB 4KTYA 1FAKT 2FJHB 3SGDI 3BDYL 2NY2B 4HS6A 4QRQB 5BRZD 1IAOA 5E8OB 5GQBA 1ZLSL 3IDNA 2SEBB 1UXSA 4PV8A 2A77H 2AW2A 1LILA 4IOIB 4XNZC 4PY8I 1MCJA 1BJ1H 1V3LA 4RZCA 3ALXA 1XGUB 5I6XB 4DAGL 3HE7D 1YNLH 4YH6A 3D25A 5D7SL 1S3KH 4G8IA 4N9GA 4O9HL 4HZAA 3T8XA 5K59F 3O6FA 1CE1L 4KZEH 1U93B 5E7BA 3A6OA 4IIQA 3HAEH 4QY8B 4NZTH 3ULVH 1XCTA 4PB9H 2XWTB 2WWMD 4HWEL 4Z77B 3FQWB 4KQ4H 3FB8A 2BFVL 1ZHNA 1ZVHA 2JB6A 1KGCD 2FWOA 4OB5H 3MJGX 5HGBB 2VRAA 3RVWC 2VDPH 5HVWA 3HR5B 1CDYA 3O3DB 1JHTA 3DOSA 3O3EB 3T4YA 3ZSTA 5JMOC 5AYUH 3GMPB 2G60L 1CI5A 4ZXBA 2F53E 1G1YA 3ISWA 3TBWA 4NNYB 3EBAA 3S88H 1WZKA 1HSBB 5F1SA 6FABH 2NZIA 4RBPH 5I0DA 1JWMB 4YXLL 3BSZH 5DJAA 5DD3L 2GFBA 4P57A 3HTLX 5IMLA 3P73A 2X2YA 3RIFK 3IAPA 1G7MA 1LDPH 5D6CA 3RPIA 1NCWH 4DZBA 1X5JA 3WE6A 2EO1A 4BSWB 4ODSH 1DBML 2VDQL 1GGYA 3X3GH 1BJMA 3W82A 2VXQH 1PQZB 3SJVB 3GMMA 4MJ6A 3ULVL 1RJZA 3D69A 3VXNB 4ZAKA 1QSZA 4K2UL 2X89A 4X9HA 1MVFA 1WV7T 1YQVH 5IB2A 5ICXB 4GRWF 3HS0B 3MRBA 3QXTA 4O5LH 3BMWA 4G6KH 5IG7B 3C5SB 3A67H 3P11H 4JY4B 3VA2C 1S7XA 1SVZA 3ARSA 1A2YB 2VC2H 1U3ZA 2Y5TA 4HF5L 4P2RE 2YK1H 3LB6D 4ZFOL 1LQSR 5BZDB 3G5VB 5EU7C 4MWFB 2ZCHL 5T1DH 4YFDB 3B2UD 5MEOB 1B3JA 1EO7A 2DOCA 3GM0A 2E27H 3V8CA 4YHLL 3D9AL 4G43B 2GJJA 3RUGE 4JO4L 2FGZA 1MJ7L 4R0LB 3QO0B 2X10A 4P3CL 5D72L 4DZ8A 5B3JE 3G5XA 5TGBB 2HYMA 1NC2B 4QRRB 5FKPA 4F9PC 4KKLC 4OT1L 3O4OC 4POUB 1U91B 2EIEA 2LU7A 2AJ3B 4LSSH 4JG1L 1FPTH 3D2UA 2ZUVA 1RV6X 5FECA 1WT5A 2FO4A 2QEJA 1X44A 3PABA 1DDHA 5L2KA 2VLME 3NN8B 1E28A 3K1KC 3L3OA 1ZA3A 4HIHA 1U58A 4TRPH 2VZTA 1NBYB 1HHHB 1PSKH 4OZFG 4P2OB 1JWSB 4Q97A 4KI1A 4XWGH 3BIAX 2CMRH 3K81A 1MCEA 5KBNC 1D5BB 4XP6H 3TO2A 5LAXB 1BQLL 4MAYD 2J7LA 2ZSWB 1IGJA 1UEYA 1MHCA 3TJHD 4QF1B 1H15A 4F9LA 2R0WH 4KDWA 4HULB 1ZWIB 3WKML 2JF1A 1MJ7H 4Z0BH 3F7PC 2DM7A 4IHOA 2G9HA 5ECJE 1X3DA 1I7UB 2OMBA 3WN5B 1Z9MA 4IMKA 1JPTL 1U8OB 3MLWL 3HE7C 2DM4A 1KGCE 1MREL 3NCBB 2F53B 5DJXB 1ZKAA 4ZD3L 2RB8A 4HF5H 3OG4B 4Q0XL 4BK5A 3CLEL 3VXRA 3P4MB 4JY5L 3X17A 5JOFB 3QR2A 2IBGA 3UJIH 3QJHB 5B39G 2BOBB 1FZMB 4XNMA 2O61A 2X4TB 4JQVA 5GS0L 1YJDC 4LLUB 3GHEL 1N6UA 5DYOA 3RWDB 4Z95L 4IDJH 1CVRA 1NC4A 4JRYE 3K80A 4POZC 3P3YA 5EWIH 1T04B 1TVDA 3R8BB 4DKFH 5C0EA 3ARGC 4NT6A 1A14L 2F54D 1I3GL 3DRTB 4K07A 2CSPA 1P2CB 2AK1H 3VFVA 4JFEB 1CG9B 4HZLA 3SBWA 3STZA 1XGYH 1S7RA 3HG1E 5EH1A 2IH3B 3VXMD 4MLIA 5F89A 4C56D 2AQ1A 3VE0B 4FQ1H 1KCKA 4NWUL 4D0BB 3CVHA 3KPMA 3EYQC 5HPMB 4ZS6C 2MCG1 2VQTA 2R1YB 5HI3D 1C12A 2C1PB 2CGRL 1NCTA 1CFNA 4F7CA 1ND0B 3MRPA 3QRGL 1OF2B 4LIQL 5JW5B 2P8MA 2KZ1B 3LN5A 2AK4D 1EFXD 3DYPA 5IB3A 4X9IA 4AT6A 1J87A 2BHYA 4KQ4L 2P48B 5JQ6H 4JQXA 3MRNA 4WWKD 5D8JH 3ULVC 3LKRA 2K9UA 3TH4T 2R8SL 3JWNC 1P6AB 3GMPA 3VXPA 1TZIB 5D96B 2VTFA 4MD5B 2A73B 3CVHH 4MA3A 4LSUL 4O9HH 4YC2B 4MJ2A 1JHLH 1U95B 1R3HA 4KZEL 1P4BH 1D5XB 2V17L 4W4OA 2IPUK 3CDYA 1MPAL 3WDHA 1FNLA 1UYWH 3OXSB 4WFHD 4PJIE 3RTQD 3MUJA 1RIUH 4OGZA 1AKJB 1S9VA 5TDNA 3OJDB 3MGTB 3V7MA 4NM4H 4ZDHA 4N68A 2IALB 4DKEL 2LAGB 3HKFA 3O45B 4KQ3L 1TJIL 2AEPH 1QLEL 2WP3O 1VGKA 1MCHA 4WHTA 4CAGA 4G9DB 2J3SA 2XN9B 3UO1L 2ITCB 2NY4C 2IAND 4MCZA 3IKCA 4ERSH 3QJHA 1MEXH 1OM3H 3RY6C 4J1UB 1DE4A 2ZKHL 3CX5K 5BO1L 2VABB 2I9TA 3P9MB 4FFYH 1CE6A 4HMCA 1Z0MA 5IB2B 1P4BL 5F7LB 3CLFH 2X40A 1NDMA 4CW1B 4HS3B 5E5RB 1ORQB 2NNAA 4HUUB 4WTWA 5JMRA 3G08A 2HFGH 3QDGE 2H2PD 3VFVB 4WUKH 4MD4A 1RHFA 1G6RL 1ETZB 4GMTH 1WWBX 3GUTB 4YFEA 1ZS8A 4ETQB 3MXWH 5GZND 1V8HA 2JJTA 1UA6L 5IQ9B 3KDMA 2C3HA 1XH3B 1BD2A 3THML 1FYTD 5DMGD 4NM8L 1I85A 3C5ZA 5F7YC 5JW5A 1OSPL 2X4RA 1CR9H 3AS3A 3HHRB 1LDSA 4HFWA 2J88L 5TQ2L 1EAJA 4NN7B 4P57B 2R0LH 3SKOB 4OI9A 1TZHB 1F3RB 2AXFB 3HUJB 4P2OD 5C07D 1ORSA 5DD0L 5LAXA 5LWYH 3MRJB 4G6ML 4PRPE 3V0WH 2WSKA 1ZLUK 4Y2DD 3QUXD 2Z4QB 1EX0A 4LF3B 2ESVE 3QULA 3LKNB 1QRND 3SCMA 3SBWC 1IAIL 4CGTA 4N0YH 5D4QA 4MJ4A 5IR1B 4WO4A 4YAQA 1EV2E 2XTJB 3D0VA 4I2XB 3U4EA 4QRRD 2B7DT 4Q9QL 1RUMH 4YHKH 2MHAB 4E9LA 4ZUVB 4RGMC 2FLRT 5BOPA 2F54B 3WFZA 1TVBB 2QQNH 3BGMA 3L7EB 3G5VA 3CDGB 1PKQB 2XA3A 2ATPA 3TT3L 4JPIB 2CO7B 2Q8BH 3MRGB 4UDUB 4GAGH 4KROD 5ALBL 4KPHL 2NY1B 1HHGA 3DX8A 2PYED 5KS9E 1YNTB 15C8H 4ODTH 3TJEH 1GIGL 1MWAA 3TCXA 2Z31B 3RDTB 4Y2OA 4BSVB 3WFDL 1HILB 1KPVB 1JFQL 4KKCC 1NEZB 4L4VD 5C9JA 1UXSB 1UH2A 2AS5M 2C5DC 3MODH 4PLOB 4M7LH 3D2UB 4OI7A 4OM0H 4ODBD 3JV4A 2VH5L 5EN2A 5EUKA 3L95A 4MJ5A 3M07A 3BKMH 2JK5B 1AQKH 4J7RA 4O02H 1IGTB 3SJVD 3Q1SH 1S9XB 2PKDA 4G8FB 4XVTH 1OAXL 4ETYA 4LLWA 5J8OA 2BHZA 5HPOA 3QDGB 5EIIB 1CGVA 2X05A 5CCKL 3QQ3B 5DUMH 3LEVH 4GKSA 4KKAC 1JPSL 4MB4A 4X83A 4ZO7A 1VKXA 1FNFA 2H26B 3BYTA 1S7RB 5IFAH 2A0LD 3EYUH 5I8EB 3K2UL 1V3JA 1WTLA 2DLGA 3W2DH 2FJGB 3RNKB 3TNNB 5I6XC 4Y2DA 4Z7WE 1RZKL 1WQVT 2X4UB 3IAQA 4G6AD 1TENA 4O2CA 2PTTB 2EXYC 1ZT1A 3VXOA 2F5BH 4X0KA 4R97B 4NCDA 3TO4C 4HWNA 1RUQL 5I75B 4HJ0C 1D5XA 5C70A 3QUZC 4AY0A 5AD0A 5B39A 4BFGA 3VFWB 3NCFB 2RR3A 4PJ9A 1TZIA 4K7PX 5GISH 4X6CA 3SQBA 5T33L 1NCDL 4ZXBD 4U1GB 4LLUA 3A67L 1YEFH 1FAIL 2FEEI 3QFJB 1M7DB 3ULSB 5C0EB 1KNOB 2QSCH 1UWGH 5SWSB 1BOGA 5H37G 3LB6C 3VI4E 4S1SL 1IEHA 4G7VH 4U6VH 3GIZL 1CFTA 3ROOA 4Z7NE 2AV7A 3NFNA 1YNTA 5C0AA 5TDNB 1NGQH 5IW6A 5T3ZL 2Z91B 2PNDA 3V5DA 2VAAA 1FE8L 1CE6B 3LH2H 4TSCH 3VFOA 1FYTE 2XWBB 4XGZB 4KRPC 1MRDL 4DTGL 3P9WB 3IFNL 4R26L 4Z7UB 3O6FC 1FNSL 4P5KB 5BS0E 2OZ4H 1N3NB 4Z78B 1ADQH 7FABH 1DQLL 4LSPL 1IVLA 2EDDA 4M7ZC 3Q6GL 3BZFA 2HLFC 4EIZC 4JFEE 2R2CA 3CFKB 5I71C 1YEKL 4YFLF 3MJ9H 5DEGA 4ODVL 5M95B 5TPWL 1DQMH 3V6FA 5I73C 1GZPB 4MA7L 5IVXF 4PJ7B 4L8CB 4ODHL 3LKOB 4PS4H 2VLLB 5FCUH 2OK0L 3C08H 3DVGA 1RZIB 4P3WA 5DJ0A 3UJIL 4QRRE 5EOQH 3QFJE 4M3JA 4UDTA 5J6GA 3ESVF 1QSVA 3O4OB 4ERSL 3OKKB 4XWGL 1ZLWK 2HRPH 1JZ2A 3VXRD 1QA9A 3H42L 3NIGF 4S1RH 5ESAA 5ERWB 4PRNA 3LKNA 4DK3A 1VFUA 4JANA 1GOGA 1M6OB 3L1OH 1HYRC 5JTWA 5D2NA 3MLZH 3CLFL 4H26B 4NZTL 3CUPB 1BWMA 4JGUA 3UTTD 3I75A 5GRVK 4WW2F 1VFAA 5I9QC 1B0GB 5D7JA 4OIIL 4Z0BL 2L4OA 2YPKA 3QXUA 2G2RA 4HBQA 4NRZA 5IWLA 1A3LL 3G6JB