1DEEB

Structure of s. aureus protein a bound to a human igm fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
223
structure length
223
Chain Sequence
QVQLVESGGGVVQPGKSLRLSCAASGFTFSGYGMHWVRQAPGKGLEWVALISYDESNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKVKFYDPTAPNDYWGQGTLVTVSSGSASAPTLFPLVSCENSNPSSTVAVGCLAQDFLPDSITFSWKYKNNSDISSTRGFPSVLRGGKYAATSQVLLPSKDVAQGTNEHVVCKVQHPNGNKEKDVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Staphylococcus aureus protein A domain complexed with the Fab fragment of a human IgM antibody: structural basis for recognition of B-cell receptors and superantigen activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords IGM RF 2A2
total genus 43
structure length 223
sequence length 223
chains with identical sequence D, F
ec nomenclature
pdb deposition date 1999-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1deeB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1deeB02
2D03H 4OKDA 1RK1B 2XZAH 3WUWB 2M8XA 1XT5A 4X6CA 2BNRB 1H5BC 4JHBA 5SWZD 2EECA 5JORB 3SE9L 4I18C 1SEBB 3QDMD 1JHKL 2YN3A 5KSVA 1JHLH 3QYCA 3MRJA 2VE6B 4NQEB 4LVOC 4WW2B 1LVEA 5EUOB 5A2JH 4I13B 5L2KB 5EWIH 3IDNB 2J88H 4IDJL 3UJIH 3LZFL 5GGTL 5FCSH 3NFSL 2XXCB 4KK9C 1IAOA 3IS1X 1H3XA 4KDTA 1FO0H 1QRNA 5HDOA 3Q3GA 1G7LA 3OV6A 3QBTB 2XTJD 3W39A 5EBWB 2Q8AL 1MH5A 3BPCB 5FCUL 2HRLA 4KJQD 4PJAE 2VXVL 3RBGA 2EDLA 4RAVA 4U7SA 5ITFB 3DHMA 3NA4A 4DVBB 5F9DC 5E2UL 3OAYK 2FYYB 1BAFH 1MWAH 3WNLA 3FO2B 2VUOA 1IMHC 2Z8RA 1UEYA 2RR3A 5CMAA 1B0RA 1P7QD 2ADIA 3C2SA 5D5MB 1CLCA 1FYTA 2DJ4A 3IFNH 3KPLA 5IMLB 3AS0A 4X8JA 2KL6A 4ZTOH 2H32B 5MENE 2PR4L 3MROA 1BFTA 2A6DA 4Z7WA 3NZHL 4RMRA 4X4XB 5C0AE 2CDGA 3PL6B 5EWIL 1I8IA 2UYLA 4KKBD 3MREB 5CP3H 1ZT1B 3IAGC 3TIEB 1RVFL 1T04A 4YUEH 1Q0XL 4PYHA 4S11A 2R9HD 1CFSA 4G9FD 2LVEA 5BS0E 1YEFL 4KRMB 1PYWA 2FEDD 3P9MA 1UXWA 3QHZH 1WBXB 3ZO0A 4JQVC 4YEFA 4JFHD 3T4AB 1NFIA 4W68A 4D9RD 1TNMA 2NZ9C 5JW3L 4NO0B 4I4WB 5FO9A 1I9RH 5GGUA 2NY0B 1TFHA 4KY1H 1YJDC 2R2CA 5KOVC 3NTCH 4FZ8L 2HN7B 4JKMA 1CFVL 2PXYC 5BZWB 5I18L 4L3AA 2PXYB 4CBPA 5L0QB 2ZSVB 2XN9A 3UJIL 1C8PA 1QFHA 1S9YA 4J23A 3GSNA 4S1DC 1IEBA 1KG0A 3VXSA 4XBEL 3GJEB 4ZOAA 1P4BL 2X09A 4YHKH 2VR4A 1QFOA 3FMGH 4PJDF 1WZMA 3KLHC 3WNKA 4MCYA 2DQTL 3HS0A 3MACL 4MSWB 4K3EL 4XNUH 3O9WB 5GPRA 4OZIF 5EZOL 1U3YA 2O5XL 4FP8H 4O51B 1YYLL 2YRZA 5ANME 4WTZG 4ETQA 3MUZ1 4ODXB 1R5WB 5ESQA 2DLFL 3DO3A 4CU8A 3PWJB 4DZBB 2Y07L 1T1YB 4RFEA 1A6AA 5KSBA 4UT9H 4CJ1A 2D0GA 4M48L 3OL2A 1KBGH 1YC7A 1KCKA 3QDJD 4MDJA 2I07B 5CEYA 1NDGB 5F7UA 5KSAD 2NY1C 4G8EB 4JVWA 3SGEI 4LF3A 5MEOB 1HWHB 3K8KA 3QIUA 1BBDH 1BIIA 2VR9A 5HTSA 2VLME 4Y5YB 2AGJH 2APBA 4JFQB 3F5WA 5KSAB 4OF0A 3QEQD 4NZJA 4YXHH 4WHYG 5AUMB 5IUSA 4X4MA 3M17B 4MCZB 1DBMH 5TQ2L 1JNNL 4XNUL 1QLEH 1PLGH 2W9EL 2IADB 5F7DA 3LEXB 3K4DA 2J8UB 3UTQA 1IC5H 1A47A 3MRJB 2VJXA 3BEVA 1K8IB 2BDNH 2P8PB 5T3XE 5GRUL 5JORA 2H2SC 3LS5H 4UBDD 1IFHL 3SDCB 4G7VH 1ACYL 1MCNA 1PQZB 1B0RB 2AK4E 5IEKA 3Q6FA 1MCEA 3O6FD 4YDJB 1EJ6A 1MCCA 4GRLB 2AXHA 4GLRI 3SCMD 4EUPA 4JQXC 1IT9L 3MXWL 1H3WM 4XZUA 2G75A 3QFJE 1JGEB 1CXKA 2FCBA 3CFDB 5HHOE 4R90L 2ARJA 1WWWX 2NY0C 2WW8A 3GMPB 5FXCH 3S36X 4U49A 3SDAB 2DM3A 5HY9B 4HIHA 4YHYB 3MRGB 4PGDB 4KRNA 1HSAA 2ZUVA 3L5XH 1OAUL 5LCVL 1QSFB 1RZ7H 1S5IH 1U41A 3IVKA 2FSEA 4OZIA 4LGRB 1U8KA 3RKDC 3BH8A 4WEBL 1AHWC 3GI9H 5I19H 1WTLA 5J6GB 5AYQA 3NN8B 3DX6A 3KYKL 1RPQA 1GAFL 5ILTL 3RVUC 4X5WB 5T1KB 1YN6B 4P2QB 1WCQA 4YXKH 4YFEA 5TE6L 2JCCA 5CP7B 3ZTJG 2HT4C 2V2TB 2OTWA 5TQ0H 1E4XI 4QRUA 4EQ3A 3S5LB 2YD9A 4LDLB 5DHVH 5C9KA 2VDRL 5LGHL 1ITBB 1S7WA 4DKDC 3FZUD 4LCWB 3HTLX 3EFDH 1I3VA 2EEDA 5DK3A 3V0WL 4PY8I 4NQXB 3HPLA 2K9UA 3BIKA 3EYSL 1NBYA 4XAKE 4OM1H 1LP9B 2WANA 5DEZA 1NEZG 2R1YB 4WI5A 2G9HB 5FGRA 4L8SA 3SCMA 1ZEAH 1FFRA 4DN3L 3WBDA 4KUCD 4OLUL 4I1NB 4L4TA 1UJTA 3BIAX 4NRZA 3REWB 3LQAC 4OGYH 4NP4H 4PRHA 1CDBA 2P5EA 3G08A 3CDCA 3ZSTA 2VDOH 2GUOB 2ZUSA 5L9DL 1BOGA 4OD2A 2FHFA 3TBVA 4G8EA 3L3DA 3BIKB 4NSKA 4FQCL 5JDJA 4WHTA 2JIXA 3MYZA 1PY4A 1FVEB 4PJ9D 4ZOCA 1X5KA 1OD9A 3FO0L 5HI3D 2A0LC 3VG9C 4MGXA 1MREH 3MLYL 4H1LB 5HYSA 3FT3A 3VRJB 4WHYH 3S37L 4K7PX 3SO3B 5BS0B 3BRGC 3EFDL 2V7HA 3NFNA 4PJCE 3ZL4L 3SGJA 1HIMH 1V5JA 5D2LB 1C1EL 2NY3D 3ZT5A 1EFXA 4MCZA 3TJEL 3HRZB 5BQ7A 3ZE0E 4JFEE 2JB6A 4GW5B 4ALAH 1AI1H 4OF3A 5F7LB 3CXHK 3QXAB 3OJDB 1CICC 4KJYA 5IQ9B 3UMTA 1XGUA 3TN0C 2WMPA 4IMKC 5KVFH 5IFJA 2C3VA 4MS8C 3IAQA 4UNTA 1GGBH 3AREA 2YPVL 1O5DT 3GSUB 5EBLA 1QYGL 3WFEL 4RDQG 3T0BA 1IM3A 2AJUH 1SVCP 1KB5B 4JFXA 3L3IB 2EIZA 4P5TC 3MV7D 4YC2C 4XVJL 1CDUA 2OSLA 3I50L 2XY2A 4HBCL 4QHMB 4UINL 1ZE3C 4S2SB 2FR4A 1OCWL 4P2RD 1FFOB 1YEDB 2QTEA 4GRMA 1KPUB 1HKLL 1NC2A 3C5SB 1U8MA 2B2XL 2F5BH 1KFAL 4MWFA 3OBAA 3KXFB 5DEFA 4RQQB 2GTWA 5INDA 5JO5A 2XYCA 4NQDD 3QWOB 4ZD3L 2V5RA 5EZJB 3DURA 4O5LH 4AK1A 4JR9L 2NNAA 4R2GD 2Q86A 1D6VH 1LO0L 2YKLH 3BH9B 4WV1B 3G9VA 2IALA 5CMAB 5D1ZA 2IJ0C 4GSDH 3TNMA 2W92A 3G6DH 1RJLA 5L2JB 3M17A 2ZKHH 4OQTH 3DXAA 1EHAA 3FN3A 1EHLH 4UTAL 3MLZL 3WFHA 3BO8B 3WN5A 2IBZY 5KSUB 4GG6E 4WVRA 5FKAA 1S7RA 1WFTA 4NNYB 3ULVF 4WFED 3OKYA 1U6AH 4LRNH 5E8NA 3QR2A 4EUPB 4OV5A 2EZ0C 4LSRL 1BQUA 3BUTA 1QTYT 2HFEB 4G80B 1BF8A 4QRSB 1G7IA 2GT9A 1AD9A 3HMXA 3L3HA 5CZVL 3P3YA 4KH2A 3MFFB 4X8XA 1L4IA 2CDGB 2DI7A 5D70L 5B39G 1J0YA 5BJTB 5BV7L 1I1YA 2ZNXA 4KJWD 4MJ4A 2DOCA 1CE1H 4HC1H 1E6OL 2EYTA 3VFUB 3MLSL 1FLTX 4JKWA 4K7PY 5E95B 4LEOB 3S36H 5I66B 5JW5A 1TNNA 1FRGH 3EJYC 3PHQB 4XPAH 4FQ2L 5JNYA 4U6HA 4YO0A 2DBLH 4KK5C 2NXZD 5IW6B 4RDQF 2NR6C 2B4CC 2ARJQ 4UV4L 4R4FH 4KI5E 5BV7C 3TNNA 2O5ZL 4HF5L 3U82B 1NL0H 1A7NH 1MCDA 1AFVL 5F9JB 1AQDB 3H9HB 5K9QG 1ZGLA 4MDIA 4L3CA 4DGVH 3GSWA 1OP3H 1FFPB 5I1EH 1UKQA 1ZGLB 3ZKND 1UC6A 1YEIL 3IJHA 2QR0B 5FK9B 1NJ9A 2FEEL 5D7JB 4LCIL 5TE6H 1BGXH 3LN4B 4MA7L 3MA9L 3SDDA 3GUTA 4PJGE 4H5SB 4X5XA 4QCIB 3TYGL 5JPMA 4DEPC 5A43C 1AE6H 1HHKA 1N4XH 3FHQA 4TRPH 3I9GH 3QUZC 3VGBA 3CCHA 4HUMB 3UJJH 1OAQL 5IOPB 1MOEA 2CO6B 4OLWL 1U93B 1QBLL 5EZIL 3JV4A 5LXGH 3BN9D 2DDQL 5ALBH 3QRGH 4X0KA 1YEHH 5C0IA 2ZG2A 3L5JA 4HX1B 4YQXL 1IC1A 1AD9B 3FRPA 4MD5A 1RU9L 5ABDE 2QJDA 1QA9A 2JIXD 2X4UB 3L6FA 4XMKL 3GHBH 2XTJE 4ZS6D 3GMNB 4JDZB 2FH6A 4YFLF 4G6FD 2ZSVA 2VXSH 2YPLE 5J89A 3QDGB 5EU6A 4JCLA 1SM3H 4P23D 4ZG1A 5CEZH 4JN1L 4JM2B 3BWUC 4PJAB 2NY5H 5I2IA 1NUGA 2YMXL 1A4JB 3TN0D 3NABH 1AQDA 4DKFL 1XFPA 5ACLA 4Z18A 4R26H 2I27N 3CSGA 1BQHA 1YEJH 4K23L 2P45B 3HAEA 1KJVB 4CVWA 4PLJD 3NCCB 1A4KB 4JREC 2UY7A 3I6KB 3QIWD 2Z4QB 4LLVB 3STLB 4G6JL 2Z35A 4F3FA 4LHJB 1XF1A 4LLUB 5JDSA 2VDKL 4I3SH 4PJGA 5SWQB 3BZ4B 4HUUB 4POZC 3QHFL 3ARED 4OQTA 4ZXBA 1RZKC 2Q8BH 3ECBA 1DCLA 5TJWK 4XRCA 4KY1L 4YE4L 3SQBA 2IGFH 4R7DB 1TXKA 2PUQT 4J3SA 2QSVA 5B3JE 5FGBC 3I3EA 2Q1EA 4P49A 3T2QA 1T2XA 5SV3A 5CZXC 5I16B 4Y4FA 4OCYH 3QNYA 5ITBH 2BNQA 4U6VL 3GSVB 4OB5L 4PJ9C 4KUZL 3BP4A 3UPRB 3LN5A 5AZEL 5FA4B 4C83A 5EBLB 4ZTOL 3V4PH 4M7JH 4NKOA 5A2KH 2JJWA 3I6LD 3JTSA 3KPOB 4CNIB 1SBBA 2NY5L 1FDLH 2XRAL 1MLBB 3FT2A 4HIXL 1F5WA 4NYLA 1KB5H 1S7RB 1LEIA 4U1IB 4QHNB 7CGTA 1MCLA 4L9LB 3B8YA 1KIPB 3KPMB 3U0TB 1SJEB 2ZOKA 4XAWL 1T21A 2ADJA 1WIPA 4NNXB 2X2YA 1N3NB 3PHQA 3QSKB 1H0DA 1SM3L 4OZGB 1ETZB 5DVMA 3O2VH 3DSNA 2PYFA 43CAB 1T03H 5CLTA 1BFVL 4PJ5D 4TUKH 3DXAD 5JZ7C 1BBJB 5T1DL 4YR6B 1VGEH 3QG6B 4N9GB 3WJJC 3HI1B 2CR3A 4LCCB 3TBWB 1QHPA 2VLJE 2EC9T 2Y6SD 7FABH 2NY4B 5GHWL 3W0WD 3SDDB 3GUTB 1TJIL 4B0MM 2A6IB 3SY0B 2GAZB 3MLZH 3QJFB 4WJ5B 4XNYH 1LK3H 1JF5A 3ZE1E 2P49B 2FJGB 1RZKL 2QQNH 1AGFB 1E6OH 1WT5C 5J6GA 4KDWA 1Q9OA 3VXSD 3FB7A 1RZJC 1U2HA 3V6ZA 4M8VA 4HS8L 3RKDD 1KEGH 1ORSA 4NN7C 2ESVB 5DLMH 3GBNL 4U3CA 5I15H 4WENB 3OKKA 3DYOA 5B38G 5LJYH 1QSEA 3DSFH 1AC6A 3T0VA 5I0ZA 5T1KD 5HYQB 3GSXB 2VIRB 5IHUH 5JHDB 1I7UA 2DKUA 4FG6D 4Y2DA 3NCFB 2R56H 3MLXL 5I1LB 3D2UB 3PGCB 5BMFH 4LIQH 4X6BB 4C4KT 3PWPD 3CZFB 1H15A 3VFUA 2YD8A 3GIZH 4LAQL 2OR9H 2DICA 5FEBA 1TVHB 2PO6C 5DZLA 4PJIB 4X7DC 3S36L 3L3KB 2X1WL 1J1OL 4EN3A 4Z8FH 5GJTH 4KFZC 5JO5B 1MJ8H 3IU3A 1I1AB 5EUOF 3VGDA 1XR8B 3O2DH 3U9UA 4UBDC 4WNQA 4ZTPH 4AL8H 1K3ZA 1EBPA 1N2RA 1JWMB 2NYYD 1WQVT 1CIDA 4YEEA 5L88H 3N9GL 4S1RH 1MEXL 3QQ9D 1AH1A 3K2UH 2MKLC 1NKRA 2Z93B 3D39A 3LKRB 4BJLA 4NN7B 4OUUB 4RFOL 1TTGA 4ALAL 5IVOA 5BXFA 4JVPA 4GRWE 1EO8L 3LSOB 4JY5H 3QDJE 3B9DA 3H3KA 5C0BD 3T3PE 4UT7L 2Z31B 3AAZB 1GYAA 3VJ6A 4Y5YA 4XHQA 4KJYB 2VL4A 1H3GA 3NVQA 4U6YA 5KVFL 2BSTA 1WZ1L 5CP3A 3OF6A 5EOQH 5F7EL 2G9HA 3SE8H 1AIFA 2AJUL 4QXTA 4UQ2A 3JZ7A 2K7PA 4XCCL 5T3ZH 1OWWA 4GRLA 1FGVL 1CT8B 2CRMA 2V7HB 1N7MH 3BE1L 5C0AB 3O2DL 2VDLL 2P8MB 3K4ZA 1I8KB 1RUPH 3DJ9A 3BRDA 3CSPA 3X11B 4XVSH 4LLYB 1YEDA 5ELIA 2EXYC 4FFYL 1J05B 1GGUA 3S35H 2F5BL 3VDAA 3LEVH 4HULB 3CK0L 1JI1A 4NZRH 1ORQB 2DQDL 2EYSB 4P9MH 2Y4SA 3LRSB 1OARL 5MI0B 4E42A 1ZHLA 2W9LA 4Z78B 2CLVA 3WUZA 1F45A 4NNXA 4BM7A 3RZCC 1INDH 1NC2D 3E8UL 1ZSDA 3SGDI 3TZVB 3FN0H 3LN9A 4G8FA 3CVIL 1CXLA 4P2RA 2DQJL 4GSDL 3GMOB 4Y5VA 1ZXQA 5GGRA 4APQB 4L4TB 3VFOB 2OCFD 2F54E 3CU1A 1JRHI 1LEIB 3BESR 5F9WC 4Y5VB 5E08H 2YR3A 4HWBH 4DKAA 3KPPB 3QEHB 5ERWA 5EOQL 2D7NA 4OFDA 4Z7OF 5BXFB 2YWZA 1AP2B 4DN4H 3I75A 4N5ED 3PV6A 5CEYB 1XIWB 5D2NB 4JHAH 1EUTA 2OMNA 2NZ9D 2V2WB 1TENA 4NQDB 4LCWA 1FJ1B 4ZS6C 4F9LC 1XF3B 4HH8A 5HYSB 1CFSB 3D1MC 4XVSL 2EYRB 1R3LA 3GMRA 4UUJB 4EEEA 5DFVD 4DN3H 1CBVH 3LS5L 3WNPA 4MMZC 3G5ZB 5FUZL 5ICXB 3VXNA 4OD3H 5FYJD 5B21A 1GZPB 3WDHA 3ZLQC 3HE6D 4LLAA 4R6UA 1RK0A 4X6CE 2R8SH 2Z35B 2YPVH 4PJXB 3GSNH 5T1LD 3K1DA 2J8UA 4PRPE 4F9LA 3D85B 3OWEA 3PGDB 3M8OH 1P84K 3GIVA 4M4PA 4ZAKB 1IQDB 4FFYH 5J6HB 3VE0B 4KWUA 4MQ7B 3T2OA 5I2IB 4LSTH 5ESVA 2CDEA 1QZ1A 3KJ6H 4XPFL 3X13B 4L8DA 2R1WB 3MOQA 1VSCA 1G7QA 2C1OB 3ZT6A 5FYKD 4QRPE 3VA2C 4NUGL 2QSQA 4YFDB 3L95A 4OFYD 3EO1B 4X99A 4YBQC 1UT9A 2Z8VC 2PYED 5DD1H 4JFOA 2DQJH 2FLRT 1J88A 4KJQC 1S7WB 1T6WA 2XTJC 3ESVF 5E8DL 3ELAT 4MDJB 4XVTH 2NR6D 4C57C 1PEZA 4D9RE 2W0FA 2HMIC 2CIKB 1HXYA 4I9WD 2AEPL 4YHZH 2XFXA 4K9EL 1RUKL 5JW5B 4L1DA 4P5KB 1SQ2N 4NT6B 1RZKH 2QQNL 4RWYL 2W9DL 2LE9A 2MQ3A 4KC3B 4HS8H 1KEGL 4CU7A 3GI8L 5DEGB 5MEQA 2DI8A 3MLVH 3M8OL 3C5ZD 2AV7A 2YPLB 2ATPA 1CDJA 4Z95H 1IGTA 3ES6B 3STLA 3GSXA 3DRTB 3UBXB 3G6JA 3P9WB 4HIHB 5GGTA 3WL9A 2X4SB 5EIIA 5IKCB 3B9KC 3MYJA 1OAYL 3FRPG 3S96B 4LCYA 1E27B 1MAMH 2OX5A 2Y23A 3MLWL 4R4BA 4F2MB 3V7AG 1ZA3A 2IF7A 1W72L 1S9WB 4G7YH 4GW4B 2B4CL 3TNNB 1LDSA 5F7HA 4OFIA 3BAEH 4FQXB 2H8PB 4H8WH 3F8UB 1NFIB 1WBYA 4C56A 1YYML 5H94B 4GXVL 2ZNWA 3X14B 2Y06H 1LNUB 2DI9A 1G1YA 5FHAL 5LGKA 8FABB 5BOPA 5DJ0A 4H25A 3MRPA 1V7MH 5DGQA 4NRYA 1NMAL 3PWPE 3DV4A 3MV8D 3I02A 4NIKB 3OGOE 4JO3H 4Z5RB 1D5BB 3F7YB 2XN9E 5SWQA 4RGMB 4EUPH 2BSSA 5DVKA 2OR8A 5IGXL 1BEYL 5I73C 3RZCA 5CBAA 4Z7NE 2D4DA 4LLQA 5ISZE 4ZQKB 3G5YA 3RVWC 1CGXA 4J3TA 3EUUA 1QSZA 1INQB 5K59E 4DFHA 5JUEH 5IEHA 2H8PA 3HUJE 2VLKB 2ITDB 5IR1B 5I1IH 5EORL 3GRWL 2NX5A 5IF0A 3IU4H 4QTIH 1NJ9B 1T80A 5D7JA 4M6ML 3TFKD 5HD8C 1D5IL 5IVZA 1N7ML 3JSSA 5KBNC 4OGAD 4NHCH 4WU7A 4XWOD 3MC0A 1RJLB 3T8XA 1VADB 2IANB 1VFOA 3HKFA 3MV01 4DGIH 4HK3N 4WFEE 4FQ2H 5IBUB 5CSGA 3P0VH 4M48H 2F8XC 3UZEA 3OXRA 4HIJA 1T1XA 2PETA 3V5DA 4R7DA 2VLRA 2XWTA 2I5YL 4CVUA 5IB5B 1MCPH 2IBGA 3GMQB 1TQCC 1ZHLB 1A9BB 1BFVH 2OQJA 1J0KA 2NY3C 5C86A 2VLLA 2CKBH 5B4MD 3HZMB 3IDNA 4PJFF 3MRHB 5EOCH 2AEQL 2EDKA 5BW7A 2D2OA 4KTEH 4WHDA 3BFOA 3T0ED 3INUL 1N64H 1FVCB 1W0WA 2P8MA 2VDML 4KROD 2GSGA 3TPKA 4AENB 4YHKL 1JRHH 1HXYB 4X4ZA 4UZGA 1J10A 3FQXA 4XBEH 5H2BA 3WO4B 2J7LA 4WFFE 3ULVD 3WO4C 1T3FA 3QEGH 1NAMA 5DI8A 3HR5A 5J12C 2NTFA 4OZFG 1ZLUH 4P5TA 1B4RA 2YXMA 1FORH 4NHCL 4D9QE 3CH1B 2BSTB 4YHYC 4JPWL 2EH7L 3ISWA 5LXGL 3NTCL 4V1DB 4Z0XB 3U46A 4V2CB 1MELA 4PJ5B 2FWOA 3ARGD 3TA3C 5IVNA 4JG0L 2X4UA 3L6FB 3C60B 4JJ5A 4HWEH 4BKLA 4UDTA 4U1HB 3MBED 3TYGH 5DO2C 1X6NA 2NY3B 1T04B 2H1PH 5KVDL 3N85L 4MD0A 2HLFC 3JXAA 5TDNB 1DLHB 4Q74A 3REVB 1JPTL 3BDBA 3NFNB 3VWJB 2DQTH 5CGYC 4K8RD 2A74B 5D1XA 2N7BA 3FB6B 3VD7A 2QHLA 5ACZB 2D0FA 5EC1B 4F7PA 5GZNC 1YA5A 4E41B 2DL9A 4H1LA 3SE3A 4HIXH 4WNQB 4GUPB 1K85A 1YEJL 4OCSL 2PW2B 4QRQA 1IGJA 4W6YB 4M3KB 1XF2A 1UJ3B 4Y19A 5EDXA 3ARBD 4WCYH 3HE7A 1MI5B 3TBTB 3RWHB 5FYJE 1GRWA 4S2SA 4CMHB 3VXMB 1ZLUK 3CZFA 4BQ8A 4NUGH 3R8QA 4NZUH 3T4YA 3BIBX 2M2DA 3D3VB 4PP2B 5E2UH 3TN0A 4XMLH 1UVQB 4PR5A 2E7BA 2V5YA 2Q7YA 5L8LB 3QPQD 3CU7A 4KTEL 1OPGH 3DVGB 4O4YH 5D7LB 2EKSB 3T04D 3CVHH 2GY7B 3FB7B 4PD4K 3BDYH 4U1NB 3BP6A 1PZ5B 4BQ9A 5C08B 3CSYA 1WT5A 3K7UA 2D9CA 4QOKB 3VFVA 1FDLL 3LOWA 3WIFB 4LMQI 2WNGA 1GL4B 3C6SA 4ZNCD 2CLRB 2X42A 4JCMA 4RX4D 4YQXH 2HTLC 1FZJA 2VMFA 4MAYA 2XQYG 3WE6B 3ILPA 4YLQT 4L29A 2APXA 3UTSE 1N0LA 5I75B 3A6BH 1T4KB 3VA6A 3LRHA 3X11A 1CLZH 4OB5H 5LQBH 5D1XC 2HT2C 4U1NA 2EIBA 5SV4A 1KCVL 1IARB 5ID1A 2DMBA 1WK0A 4OZIB 4WFGE 4TOYL 4D9LH 4PV8A 4YFLI 1IGYA 1KCUL 3Q5YA 3QXWA 1G7JB 2E9IA 1KULA 4GQPH 3IYLW 1Z9OA 2R2BB 2VB5A 1H3PL 3MRMB 4FFVC 1MRCH 1BD2A 4GXUN 4F9PA 3B3IA 1A1MA 3L7EA 3RUGA 4HEME 2VDQL 2F74A 2Y1VA 3RTQA 5TFSL 4FTVB 4YXLH 2FJGA 2HKHL 1OF2B 3FOMB 4LGSB 1RZGB 1JTPA 1LD9A 2NY1D 3BKCH 4XVJH 5TH2B 5IB4B 5HHVL 1I7ZB 1BVLA 4YDJA 1U8PB 3FQXB 5H2BB 2R2HB 1MJJA 4LKXB 2PW2A 4QRQB 3SKJL 2OTUB 2B1AL 5IVXF 2Q76A 1LE5A 3U7AA 1S7XB 3QG6A 1U95A 1YPZE 3U7WH 1P9MC 5DDHA 5HXMA 1GC1H 1CBVL 3BI9X 3FOLB 2DQEL 1RZIA 1A6VH 3MRHA 4X7FC 5ISZB 1OQXA 3QQ4B 4JFYB 4ACPA 3CX2A 1LO2L 4U1SB 4UOW0 3T0DA 2HJLA 1KPRB 4WGVB 5KOMC 3WD5H 1U2CA 4XPAL 4NJAL 3V5DB 3NIFF 1G1CA 4WI2A 1ZA6B 4U7KA 3CFJA 3RWJB 3G6DL 4Q2ZB 3B6SA 4S1DD 4GMSL 3PABB 5D7LA 5JOPE 3DSFL 2DJSA 2C1PB 2DQUH 2VAJA 1QSEB 1AGEA 1Y18B 2OS7A 1LEGA 1YY8A 3D18A 3HC4L 2AEIT 3V52H 3UPRA 3B2VL 4UU9B 3THML 1HIML 5IMKA 4NDMB 4R8WH 1U0QA 1AI1L 3MJ9A 3BJLA 4JFEA 4IDLA 1U8NB 2FECI 3QUZA 2AXGB 5BVPL 1F58L 4X98A 1J8KA 4MX7A 4Y4FC 2FEDC 2CLZB 2IBZX 2R9HC 5EU3A 1KB9J 1U3JA 3O8XB 5GQBA 3MGOB 1KLUA 1J1PL 1B6DA 4XCYA 4L4VE 2AJYH 4N8CL 3QUXC 5EOCJ 5TQ2H 5CSZA 3BT2L 4XC3H 3B2UC 4D8PA 4L8BB 2N1KA 4GS7C 8CGTA 1YQ2A 4LQ1A 4OF7A 4P59L 5FUOL 2CO7B 5TDNA 1R5IB 3R0MA 4BQ6A 4KKLD 1WBYB 4EDXB 1I7UB 2BCKA 5I15L 4YX2H 2AXFA 4PRDA 3KXFD 3EKCA 3W9DB 3MRGA 2Y7QA 3KPMA 1FZMA 2CMRL 4L4TE 4DVBA 5E1HB 5J7CC 1P84J 3KHQA 2KPNA 3HZVA 4BUGA 4GBXA 2PW1B 3MYJB 5K93A 3QJHA 5J3HC 5C3TA 4LSQL 1IE5A 5E2TL 3QFDA 4ZQKA 1HHHA 1E4JA 4OCSH 1A2YB 3PWNB 4NJAH 3VRIB 4ZFOL 4MJIE 2DJUA 2C26A 5HGDA 3HG1D 4PRIA 2YPLD 5IEKB 1UWXK 3GSVA 4R96A 4WFFD 5SX4H 4OZHA 5HHMD 3KWWA 4X4XA 5CJOL 1JPSL 4JLRA 5TF1H 4H20L 5E4IA 2DIBA 5GS3A 3DUHA 5D1QB 4RA3A 4K94H 1UADC 3B5TA 4X6CB 3MQIA 4XMLL 1CF8L 1N5YH 3CVIH 4P9HL 4NJ9L 3HNTL 5FIEA 4I48B 2HFEA 2Y36H 4G80A 5C09E 35C8H 4N90E 1OP5H 3S97C 4AIZB 5A3IC 3U0WH 4ONOA 1HHHB 4NPYB 5E8NB 1EHNA 5ICYB 4FQLH 3EJZD 3IF1B 5DHXB 5IVXE 1UGNA 4RAHA 3UEZA 4FQIH 3V0AC 1HN1A 3R4DA 2DLEA 3T0AA 4I8DA 3CPLB 5F1NA 3OHXA 4LSUH 3WFZA 4OIAA 1XF5A 5DMGC 2NX5B 1S9XA 3UBXA 2AKRA 2FB4L 1NGWA 3DXAB 3N1MC 3C8DA 4JGMA 4ESKA 4N0UB 1TCRA 1XIWC 4WUUE 4YO0B 2NPLX 2GSGB 3OG4B 4Y4FB 2QQLH 4G42B 4LLQB 4EIGB 1WBXA 2NX5D 1IKNA 4JM2F 4OI7A 4JFHE 1CLZL 2K1MA 3QWOA 3HI6H 3HUJF 2ESVD 3JTTB 4JDTL 3QWRA 2OQJB 1YEKL 3DETC 4LCCC 3OKLA 2BDNL 4GG8B 4W6WB 5D6CB 4DGYH 5JHDD 3NCEB 5A16A 2ZP0T 1A3QA 1PG7L 5GHWH 2GQHA 3MUJA 5DRNA 4ZODA 2WWMD 1FIGH 1IEBB 4G42A 3P11H 1CICA 4R7NB 3SKOB 1G9MH 3MACH 3H9YA 1KEML 3FO1A 4J1UB 1TCRB 4XXDA 3VXOA 2F8OA 4FQPA 4JFZH 4BFIB 2BVTA 1FV1A 3SGKA 1RU9H 1C5DB 4JPVL 4D3CL 1M7IB 3DV6B 4DEPB 3O45B 4U31A 4J4PC 1DP0A 3BGMB 4M1DL 4YZFF 1T5XB 4WO4C 1N4XL 4PLKC 3FRUB 3CXDH 2XOTA 4UTBL 3RDTA 1XGPA 2O5YL 5D2LA 5I8KL 2UVFA 4QRRE 4QHKJ 3ULUF 5E8OB 5DEFB 1ORQA 2BNRD 2EYSA 4MCYB 4FABL 5K9QI 5C0BB 3B9EA 4WU5A 4QXUH 1AXSA 1MI5E 5IWLA 1OGTB 5BS0D 5EZLB 3RL1B 4YUEL 1KCRL 1SJHA 3QWRD 4NT6A 1IKNC 4W81A 1JUFB 4PJEF 1FAKT 4ETYA 1G9ML 2OJEA 5BVJA 3QUYD 2IH1A 2V7NA 1DVFD 1DUYB 1MF2H 4M8QB 1NL0L 3MX0A 5IBUG 2DM4A 2YS4A 2C9AA 1OOAA 1YY8B 5C09D 3QHFH 4MVBD 1TTUA 2FATL 4UQ2B 5GGUB 4OCRH 5C3LD 3IJHB 1L7IL 1ES0A 2XG4A 1G7MB 2DQFA 1ZHKB 1TLKA 3RUGB 4I0PC 5E9DE 3VWJD 5F3BA 1BEYH 4BFGA 4IRSD 4IS6B 3OXSA 1DJSA 3GKZA 3LCYA 1TJGL 5J12B 5BW7C 4JRYA 2ADGA 4AEIH 2FNBA 5HHOA 4NKDB 3WJJA 2Y7QB 4JZJA 3NABL 1AXIB 5DC0A 2FL5B 3BZEB 3AB0C 4Y4HA 4GXUM 5J6HA 5IV2B 3MV7B 3AB0B 1EEYA 5DSCB 3T77A 2FHCA 2RHEA 4Y19E 1BM3L 5GISH 3PG2A 3QQNA 3ARBB 1ROWA 4JFED 1TETH 3FOLA 1OGAB 5B22A 2VQUA 3AXLA 1OHQA 3ALXA 2NLJA 1NCTA 5CD5C 1X4YA 4APQD 4AH2A 4AZ8A 1S9VB 1RK0B 4LRIA 1RQ5A 2AP2A 2HG5B 3U2SA 1ZLWK 5H37G 4MJ6B 5C0AA 2OBGA 3PWPA 3C6SB 2I24N 2I5YH 4M4RA 4I2XE 1I7ZA 1BQHG 3L3DB 4G5ZH 2VQTA 1PKQA 3S37X 1DBBL 4GFTB 2BOBA 1FJ1A 3RTQB 2BVPA 4P46D 4UTBH 4GLRH 5KG9B 4Y1AB 3VFGH 4QRPB 1NGZB 1YEIH 2MMXA 5C08D 2NY4D 3PNWB 3QG7H 1IZKA 1DBML 2IALB 5D1ZB 1O7VA 5KS9B 1DANT 1NBZB 1HCVA 1B0WA 2D7QA 2EEAA 4JFDB 2BVQB 4K2UH 1MCPL 4NWTH 5EUOA 2ORBL 1QRNE 1YDPB 4G8IA 1FBIH 1VHPA 1ZVSB 3ZL4H 3EJJX 5D1ZD 5DRWB 2X4PB 1OSPL 1JWUB 4P4KD 4NZUL 4N8VA 1NGYA 5IMOB 1T1ZA 3U9UB 5DT1H 3GB7B 3P30L 1EVUA 1HKLH 3EGSA 2F19H 2OP4L 1I3UA 3QEUA 1KSRA 1YNLH 4ZAKD 1ITCA 2H2PD 1FNAA 1X6LA 3GM8A 4ODVL 3AXLB 4CDHA 3RI5K 3PV7A 1XGQB 5TH2A 1WSST 3Q5TA 5SX4I 1RMFH 4IRSA 5HYJD 3E6FB 4JKPH 3MRRA 1W72B 1KIQA 3UDWC 1I1AD 3EOBA 3Q1SH 4RMTA 1PSKL 1I7RB 2BNUB 3C9NA 3H0TA 3PP4H 3MXVH 1HYRC 4Q2ZA 2GJZB 1DBKL 4HXBH 1Q9OB 4NGHH 5M7QA 3QEQB 1X3DA 3LKOB 4JDTH 5I1JL 1HINL 4DK3A 3MMEB 4E9LA 5ID0A 5BO1H 2W60A 5T3XD 4BH8B 3LRGA 3KG5A 1NKOA 3O9WC 1YZZA 5E8EA 4NN6C 3PDDA 2J8UE 1IGCL 4Y2DC 3PWJA 3F58H 3NIDF 1RZ8B 3H7BA 2P5WA 5DK0B 4DVRH 1KXVC 5TQ0L 4QRTA 3MZTA 1OM3L 1S7VB 3ARTA 3U4EA 4X6DB 1QPPA 5F7EH 3HMXH 1EAPA 1MJJB 4LKXA 5IIEA 2JIXB 1IAIM 3PWUB 5IJKA 3GI8H 3JWNC 4Y7MA 5IB5A 1F4XL 3I50H 1TZGL 2X6MA 3HHRB 4WI4A 5EO0A 3DUSB 3HAEB 4LFHD 4MA1B 3G08B 3HR6A 1DLFH 3IDGB 2AJ3A 5FUZH 5FDWA 2VZSA 5D71H 5GZOC 3DECA 4JY4B 5KS9F 2JE8A 1DN0A 2MSPA 3QIBB 4PG2C 1ZLSH 5DA4A 2KH2B 4HGMA 2B0SL 1KENH 1W72A 1L7IH 3TN0B 3ARUA 3UTZA 5INCB 2IBBA 1WC7B 4LHUG 2GJ6D 3QWQB 5F3HA 4ONFL 1FG9C 2VR5A 1ZS8A 3PE9A 2OJEB 3AS3A 3O3BB 3ARRA 4LP5A 1FGNH 1G7PB 5CBAB 1F4WH 1R3HB 5HI5D 5E08L 4H0GA 3Q6FB 5EU4A 5IW1A 2J8HA 3DYPA 5MI0C 5E94A 3JWDH 4KMQA 1XCTB 3V0VB 3LEVL 3G6JF 2VZVA 1JGUL 3MRFA 2FGWH 3PL6A 1F3JB 2X4NB 4RMWA 1MFDH 5C09B 3RDTB 5ALBL 2ZPKH 2Z4QA 1DQLL 4S0SD 3BPOC 4FQXC 2GITB 2A74A 1AR1D 3B2VH 5D1XB 1CCZA 4XNQB 3LEXA 3BPOB 3CD4A 4CMHC 4JRXD 2DTSA 4M1CC 1MPAH 3U30B 1MLCB 1DE4B 3WO3B 1HHIB 5SWSA 1T83A 2X7LB 4RWYH 3C2AH 2KZ1B 4ZXBD 1JTTA 2SEBA 3CFKA 5IF0B 1QYGH 3WFEH 5FO9B 5FA3A 5BRZD 3V7MA 1HHJB 2HT3C 1QLFA 1X5IA 2QADB 4WUUA 3OZ9L 4R3SA 4XZUB 2VRAA 4PJ8C 1WFUA 2WIIB 4JO1L 5E9DD 3FB5A 3QAZB 5DJAA 1TZGH 3Q3GB 4LOUC 1MHEA 1Y0LB 4Z8FL 4QO1A 1MLCA 1BWWA 3IXTB 3OKMA 4OUOA 5E1AB 5E6ID 1PQZA 5HDLA 2W65B 2BNQB 4ODHL 1NLBH 5F8QC 2D3VA 2X89A 32C2A 1QR1A 5CJBA 1YNKL 4YHMH 1QNZL 3H9SE 3B9KA 1KENL 4M1GH 4XBPB 1YJDH 1J9CT 3L9RA 5ILTH 1P4LA 2DB8A 4QXWA 1F3RB 4PGJA 3X3FH 3HAEH 4BSVB 2VISA 1EAJA 2QKIB 3E3QE 4LP4A 3V6OE 3NCBB 3ZSSA 1L0XA 1T5XA 1FYHB 4ZOBA 1KG0B 2A2QT 3VXSB 3PL6C 1RIUL 4JRYB 3LPWA 5DQJB 3V6BR 5HDBF 3D3VE 1KN4L 2XN9B 5TE4H 3RVTC 4GBXB 3AC0A 4Q6IC 4HT1H 5BV7B 1F2QA 2XV6B 1U6AL 2AK4B 3VI3E 1MHPH 2XA8H 1JF1B 1QOKA 1AGCA 4JDVB 1T2QH 4KXZH 1AY1H 1QACA 3U6RA 2X7LA 1NEUA 4RBPH 4M8QA 2OL3B 3MCLH 5ESAA 3DOSA 3LIZH 2BK8A 4MLSA 3TC9A 4A2MA 5DJ8B 1L7TL 3KLSA 3DX8B 3C5JA 5D7KE 3WS6A 1A1OA 3T3PF 1WAAF 1QA9B 3PP3K 4YDKH 3RGVD 2CKBL 2YEZA 1VCAA 1WV7T 2DQEH 4UAOB 1PVHA 1FL5B 1R3JA 2XKUA 2XXMB 1CL7I 3ZDYF 2I9TA 1UENA 3IJYB 4YWGH 3S4SG 4X6FB 4HJ0D 1EAPB 1FL5A 4MSWA 3FQWA 1LDPH 2GIYA 3TPUB 3O8XA 1CD1A 1M1SA 4LQFH 4QHUB 4DVRL 3KPTA 4IIQC 4JKLA 1PSKH 3KYNB 4Z0BH 3U30C 1TZIB 2P24A 4WI3A 1MAJA 5FM5O 1M4KA 4YHNB 4HIIA 1FYTB 4IM8A 5HYIA 5HBBA 2EKJA 5I8CA 1HHJA 4HG4J 3WNMA 3W11D 4X4YB 1J1XL 1GZQB 1L0QA 1QLEL 5E03A 3QDMB 1PD6A 4LKCA 4X4YA 5DLML 5MERA 3CVHA 2Q87A 1DN0B 4XGZA 4CW1A 4R8WL 1ZLVK 3QAZC 5DQJA 4NO3A 1BZQK 4BFEA 2OZ4H 5D96B 4FTVE 2Z0BA 4Z7WE 7FABL 1I7RA 1DQJA 1T22B 2YPKB 5MEND 2PR4H 1ACYH 1SEQL 3RHWF 4PJFA 3CFIC 5I74C 5C0AD 2NQCA 3GIZL 4F58L 1JPFB 4JVUA 2H9GA 1DVFB 4DTGL 1VGKA 2BVUA 2QHRL 1IGML 2YD2A 3MRPB 1A6TB 1K2DA 3X12A 2A6DB 5EZOH 2XWJA 3CJJA 1FNLA 3QUKB 1A1OB 3F62A 1T0MB 5EUOE 1U8NA 3VWKB 2DLFH 1AJ7H 3MUGB 2ZCLH 4GKNB 3HMWH 5E1AA 2R0ZL 1XR9B 3VD5A 2BY3A 3VD9A 5T5FH 1NGWB 1JI2A 4UT6L 3QT2A 4CN1A 1LO4L 5GRJL 2DD8L 1AGCB 2X4RA 4R0LC 4R4BB 1KIRB 1QSEE 3SDAC 5EOCL 5FOBA 1XGTB 4ONFH 4HLZH 1JNLL 5J57B 2YA2A 3VFOA 4FABH 5C9JB 1DDHB 3PL6D 4NPYA 4Q58C 1NCWL 3QO0B 1JRHL 1FC2D 3A6OA 4R26L 4XP9L 3FQRB 4XNYL 1YQVL 2YD3A 5H37H 4KMTH 3F7VA 1T20A 4QY8B 2R23B 5TPWL 2X9WA 5JA9A 4K2UL 4DZ8A 4I9WE 4K7PH 3GIVB 1I8MB 1KYOJ 2EE2A 4E0RB 3NMEA 3BD5A 1QBAA 2EYTB 3U4EB 2FATH 3V0WH 3FB8A 4V1DD 3QRFM 3MO1B 2BFVH 3OAZH 1RUQL 2IPTL 4YE4H 3HE6B 1DBJH 4LU5L 2BJMH 4U6VH 3PWLA 1IAMA 3HCVB 5D6DA 2LFGA 4KHXL 1G7IB 1YNLL 3DUUA 3MJ9L 4XMPH 4J2XA 1JPTH 2GSIB 3CFBB 3EFFA 4G6ML 4L8CB 4OAWA 2GUOA 2BVQA 1QSED 1S7UB 5AZEH 3CX5J 1BM3H 3LDBB 1S7QA 2R0KL 1A1MB 2WINA 5C0CB 2GCYA 4U4BA 1T20B 4QY8A 3VG9B 4D94A 5E24E 1RUAH 2XRAH 3DMMB 4XHJC 4OCLC 3SBWA 3SPVA 1OTTC 1S5HA 3AS2A 1QUNA 1IZJA 4MD4B 4N0YH 4RIRA 5B8CB 5I0DA 3MLTB 5C0CD 5IB3A 2H32H 3W9EA 4ZAKA 4CADB 5IVXA 3B6SB 5CJOH 2MKWA 3SKUD 3HPLB 1LO4H 3QCTH 1ONQA 1A7NL 2V5MA 5DGRA 5C0BE 1KLFA 2H1PL 5F6IB 5KVDH 2BNQE 4OGZA 1U92B 4OAWB 2EIDA 4X7TB 3VFNA 5C6TL 3LZFH 1AY1L 1FNGA 5D7SL 1DUYA 1WTGT 4P9HC 2OTWB 3MUGA 4TSBL 4FFWD 1VDGA 3PQYB 2AV1B 1E4KA 3TWCH 4E41A 3QCUH 4GXVH 2X9YA 2E8YA 1ZVSA 3NZHH 4XP1H 3PHOA 4H26B 1G0YR 4NO5A 3WXVL 5F3HB 5EZIH 3TO2A 2IPUK 5IVXB 5EORH 4C58B 1QG3A 3IJSA 5T33L 4PJFB 2EDXA 2BMKB 5FV1L 4F33B 4KVNH 3CSBA 1KELL 4J8RA 5DQDH 4KKCD 3U9PH 1D9KC 1YY9C 4PY7A 4OD3L 1KNOA 3SOBL 4U1IA 1JYWA 4KJPD 2VXSL 3OJDA 4PJGF 3MLRH 1G7MA 3MCKB 1A7QH 1MAKA 2YOCA 1ZANL 4L3EA 1A6UH 1PFCA 2FBJL 3K0WA 2WZPD 3WNOA 4DGYL 4EI6B 4M5ZL 5J4MA 4KKAC 4F15C 1T66C 3FONA 1D9KA 5F72S 2NW3B 3VH8G 2HVJA 1B90A 4K9EH 4K3JL 2WBJB 3BP7A 4L4VA 1NFDB 4O9HL 4HGWB 4MAYB 3WE6A 3OJ2C 4BZ1H 5C6TH 4YPJA 1IEAB 1T7WA 4JY6B 2CUMA 1NPUA 3STBA 2O5XH 3NFPB 3CNKA 4P4RA 1J1XH 4F3FB 3SDDD 1T5WB 4U1JA 1HK6A 4OD2B 3WKMH 3FQRA 5FUOH 2ADJB 2UWEA 3H3BC 4MZ3A 4RRPA 5I1CL 2D03L 2ICWI 4X6DF 2E7MA 4QTHA 3G5VA 4GT7A 4M93B 3D87B 5C8JA 3K1KC 4PP1D 3UC0L 4P4KA 2VC2H 1X5GA 1IKFH 1C08B 3QNXB 5E0QA 3MV11 1U8OA 4OIIL 3C6LA 4RZCB 5D7LE 4KK8C 1FGVH 5DZNA 2Z93A 3D39B 3MV9B 1G0XA 3H9SD 4PGCA 3UTSB 1IEHA 3BAEL 5DVOA 4QRRB 1FL3B 4F9PC 1PKQB 5J0BA 4XH2B 4WJ5A 3VXQB 3OB0H 3L5HA 3HNVL 4OKVA 1SYSB 4EI5D 1UM6L 4OLVL 4J6RH 3G5XA 3EDKA 1AFVH 2XA3A 3S34L 5DMKB 1ZT1A 3GBMH 3DWTA 1QFPA 2VLLB 2DQUL 1YN7B 5KVEL 4NP4L 2F5AH 4PJEB 3L9RB 1CWVA 1K4CA 5IJVA 2NW2A 2GK2A 2XWTB 1NFKA 4PRIE 3GZKA 1INDL 4MJIB 2H26A 4JN2A 1ZTXL 4RX4A 2OI9B 3SQOH 1FG2A 4P9HH 5I9QB 1AO7E 1IVLA 1NEZB 1Q1JL 4JQXA 5AEAA 5EFIA 2VLMD 3N0PB 1UWGH 1OTTD 3IVKB 4KK6D 4TTGA 1T21B 2X41A 1ZV5A 2ZUYA 1GIGL 5DJAB 2FO1A 4IRJD 5TE4L 5E5MB 1HHGB 3AU1A 4M7LH 3EOTL 1JZ2A 3QH3A 4WFGD 3QI9D 4MNGE 1C12B 5FHAH 5CSBA 3PXJA 5D7KD 4X6CF 3KR3L 4L8SC 4AEHH 5C0EB 3T4AA 2MQCA 1IC4H 2FX7L 3HC4H 3H9HA 5D96C 1AGFA 15C8L 1CS6A 4IRJB 2NTFB 1TVBB 2YUXA 4Z7VB 1UXWB 4OZHF 2G5BB 3HE7B 2RBLA 4P3CL 4PLOB 2NY7H 2QKIA 5BVPH 3HCVA 2OJZH 25C8L 4FQ1L 1XF2B 1NFDF 4FQLL 1RY7B 4AENA 4BH7B 2KKQA 1IAIL 4ZS7L 4ONHA 2HG5A 4J3UA 4LCCA 1R3JB 3HE7D 4IRZL 1KFAH 5JQHC 4QEGA 4PRBA 3DVNB 3UTPE 5I17A 1KTRL 3ULUL 2VH5H 4TPRH 5E2WL 5FKPA 4NC1E 1SEBA 4NKIH 1F4YH 3VWKC 2VN4A 1MRDL 3IDMB 4F80A 4A2LA 1EEYB 4ZYKB 3MRKB 2OL3A 5ESAB 2E27H 2EXWC 3QCVL 4LVHB 4OCWL 4U05A 1JZ3A 1RULH 5KAQG 3RWEA 2LABA 3WHE1 4LHQB 1BQHB 4NO2B 5M94B 4HMDA 5L2KE 2W9DH 4JFEB 1UZ6F 1VKXA 2Q3AA 1QRND 4XWGL 4UU9A 5KN5A 3QULA 1OP3K 4Z7UE 3GSRB 3V8OA 3RNKB 1A5FL 2EIEA 4EIZC 5DD1L 2A6JA 5GGRY 3RWFB 5HPMA 2C4FT 5I8EB 4LPWA 3CC5A 3L3JA 1HH9A 2BC4B 1OLZA 1TZIA 5LWYL 1RIVH 4AMKL 5D1QA 4XNQA 1PY9A 3O2WL 3OPZL 3EDEA 2VAAB 4OF6A 4JO4L 2BRRL 4QHUA 1I3RA 5FM4A 4P99A 5C92A 1V05A 4G6KH 4WWID 4Q6IA 3O11B 4NKIL 2FGZA 2H9GB 4YBLC 5JDSB 4L3ED 4LVNC 4NQUA 5C0DB 3W82A 3ROLB 3WYRA 3ILQC 5IBLD 3F12B 3QQ3B 3C5SA 5I30L 4PUBH 3GMMB 4NUJB 4ZDHA 5AD0A 1V8HA 3ARFB 3U1SH 2FR4B 5MHSE 2BC4A 4ZPVA 5K9JL 4R3SB 4FQ1H 1UWEL 4PB0H 3I6GB 2ZUQB 1VADA 2F9BT 2YD1A 4F57H 2YBRB 5EUKA 1C5CH 3N1QC 4NZRL 4QHLB 1ZANH 5INCA 5KSUA 3EYFB 1FV1B 1GOHA 1GCFA 1HDMB 1VGEL 1ZA3B 4M62L 4Z7VF 1IL1B 3GKWL 4YK4C 4LCWE 4ORZC 5JXED 3MJ7A 2AK1H 2E6JA 2YRLA 3VFRA 4KHTL 4S1SL 1NBQA 1JV5A 3HFMH 5T3XL 4WV1A 2KQNA 3NACH 2UZIL 5JMOC 5E00B 3PXHA 5D2LF 1D7FA 1J11A 1P5VA 4HZLB 4ODUA 1IKFL 3MRRB 1YQVH 5IJKC 1F3JA 3WSQH 4HJ0C 2LTQC 3ZKSD 4E5XB 1D6EA 5CD3B 1LK3L 1OAXL 1D5BA 2EDBA 1TDQA 3UJJL 4ELMF 3TJEH 3O4LA 4TUKL 5LBSL 4DUXA 5IB2B 4YDVA 2WSKA 4KAQL 5CJ5A 1IRAY 5EPMB 4B7IA 1IGIH 5IFAH 2MTPA 5CKAA 1S7XA 2VAAA 5IK3A 1MWAL 1QR1B 3UC0H 4ISVA 1P2CA 3MV9A 3NIDE 4K7FA 5DK2A 5DUMH 3VXPB 4MQSB 2AKRB 3ARDA 4O4YL 1EJOH 1U8OB 5DMGD 4LIQL 4RCAA 3FQTA 3K74B 3O6ML 4FTVA 5F1NB 2ATKB 3QDHA 1K8DA 4NWUH 5L2KD 2EDNA 1K5NA 1KV3A 3TBYA 1RVFH 2CKBB 4JPIB 1ZAGA 2IMNA 3MA7B 1CXFA 4XBGA 1ZA6A 1MFNA 2IAMA 1DQQB 4NC0B 4EI5B 4HSQA 4M1DH 4Z7NF 1IQDA 3O3EA 4P2YA 4ZFOA 2F58H 5ISZA 3FO9B 3N50A 5F7NC 1JNNH 3NAAH 5E8PB 3O8XD 5CEZL 1EO8H 1UKSA 2AEQH 3Q48A 4JJHA 4OGXH 1RZ8A 2AV1A 5IG7B 3QISA 4QKXB 3WLBB 2Y9RT 2Z9TA 4TVPE 4PGBB 1HILA 4LPTA 2XWBB 4BQBA 4WW1A 1NCDL 5IROC 4PGEA 3P4NB 2RB8A 3ROOA 4XP1L 1A9EA 1MCIA 2DM2A 3D9AL 2Q8AH 1DZBA 4XVUD 1HCFX 3BP6B 5LBSH 4LLWB 4FXGA 4JQIH 1U9KA 1ZS8B 4JFFA 1IM3B 1OAXH 3BKYL 3LKPA 2EKSA 5I1LA 2C1OA 4QWWC 4LPCA 4MB3A 3VRLF 1BAFL 3AREB 3KLAA 2ERJB 4KUCF 1T1WA 1I1FB 2FZ3A 3BRFA 5TGBB 1MHHB 4POUB 4KRPC 1JGVH 1CD8A 3DX9B 1KPVA 2P7TB 3T4YB 4BQCA 1AR1C 3D85A 4G5ZL 3NAAL 3B2UD 3TCXA 2HKFL 5EU7C 1AD0A 2HJKA 5LG1A 3TVMC 4HD9A 5FDYA 3VXUE 3H42H 1Q94A 2NXYB 4J4PA 4W6XB 2MHAB 4M6NL 5F6HJ 1MIEL 2E5EA 3PWLB 3NPSB 4F8QA 1P69B 3AGVA 1CK0L 5IW1B 1W0YT 4JRXB 4WEMB 1AE6L 1OP5K 3VFVB 1U8LA 4ZUWB 3T1WA 4F37F 1FFOA 2F58L 5IHLB 3R06B 5F71A 2NY2B 1WLHA 3X17A 2VL5B 3T2PA 1JGDB 5HGBB 4NQVA 5JW3H 3REVA 4E5XA 1WC7A 4HBQA 1XGPB 5FYKH 5E6ZA 1UZ8B 1IJ9A 4MNQD 1IGFH 5JMRA 1T1XB 1OSPH 4PJ7F 5GXBB 1A14H 1E4KC 4GAJH 4PJ9A 1A3RL 2HAZA 2P43B 1A7PL 3QA3B 3GHBL 4AMKH 4PRNB 1MCFA 5HJ3B 3QA3A 4Y19D 1X44A 5DUBB 5C0GB 1LHZA 5TDPA 1EO5A 5FOBB 1KYOK 4OSUH 5GSRA 3DUSA 4CUCA 2I60H 2GSIA 3RY5A 4P0DA 3RWHA 4DW2H 4NBZB 3LN5B 4C83B 5CGMA 3KJ4B 2ITDA 4HBCH 2GHWB 4K7FB 1QBBA 2A6IA 5IW3A 3ZDXE 3WEXA 1IGMH 3TLRA 1RZIB 1NGPL 3VGFA 4PTTB 3STZB 1G6RL 3O3DA 3NACL 4X80H 1QBMH 3MBXH 1H9VA 5ACZA 1EHLL 2DL2A 5IP4A 1AXSB 2QSCL 5F8RC 1CD1B 1EXUB 2DAVA 5J1AA 4Y0GA 5DYOA 1L6XA 4R4NC 4U3XA 1YMMD 2IMMA 2ZJSL 1U8PA 5T5FL 4M62H 2VNCA 4N8VB 1F02I 1ED3B 4C56E 2H6PB 5E5RB 5A40E 4ELME 2HFTA 3P9LA 3EHBC 4BKLB 5GSRB 4IOFC 1MI5D 1PX3A 1NAML 1JV5B 4HWNA 4OLYL 4HPOH 2EDDA 1ZT7A 1FNSL 3O6LL 5D2LE 4D0BB 3FMGL 4Y4KA 3FT2B 2VXVH 1MCRA 3ZDZF 3SPVB 1ADQL 3FFDA 4LCUA 4PGDA 4IHOB 4QT5A 3QDAA 5EU6B 3E6FA 1EPFA 1URLA 5CLWA 2EO1A 3ZKXB 3MLSH 1HKFA 3BMVA 4MZ2A 4JPWH 3RQ3A 4TNVK 5TF1L 4AEHL 2XZCL 4HKJB 4JO1H 1EFQA 5KG9A 4CMMB 3WUWG 2XQYK 4LHUA 2VLKE 5CS7A 4KAQH 4RGNE 4Q9RL 1SJHB 3D0LB 5F89A 1BX2B 1A6TA 3X12B 1UJ3A 1JHKH 2IAMD 4HX1A 4RAUB 2YPLA 3IKCB 4HW6A 2E7HA 5BV7H 1CN4A 1ZLSL 4P4KC 2I9TB 1FNGB 5D70H 3WCYA 5T3ZD 2XZQH 4AG4H 3FRUA 1MNUH 4X7SH 2X4TB 2XZZA 5DURB 3WD5L 5I17B 4AM0B 3EO9L 4X9GA 5ETUB 5F1SA 4ZFOB 2XFXB 3M45A 1FRGL 1E0OB 5AYUL 3U36A 3K2MC 1EH9A 4XP9H 3QHTC 5FECA 2JJUA 3BYTA 1RJCA 5L8JB 3UZVB 4WDIB 4JJ5B 5EO9A 3SGJC 3BMWA 2VXQH 3ME0A 4GW4A 1QFUL 2JKXA 3C09B 5IBTH 1GZQA 4BK4A 5HYJE 4PRPB 3PHSA 4TN9A 4HFUL 2H45A 1MLBA 2X1QA 5C0ND 2O61B 3V52L 4CAGA 3E3QC 3HPJB 3TVMA 1ZMYA 1V3JA 1HILB 3MJ8A 3E1F1 2NY1B 4GKNA 4XNZC 4RGNC 1HH6A 1U58B 2BRRH 5HDQH 2AEPH 4YHZL 4YIQB 2ENSA 5A2LH 1R5WA 5CD5D 4XBPA 2GTZA 1E28A 5I8KH 43C9B 3ULUD 1CGYA 1HYSC 1Q72H 3EDDA 3BUYA 3HB3D 4JO3L 4U1LA 3IDUA 2GJ6A 4G6AD 1F6AB 3IFLL 4N5UA 4MA8L 4X6EB 1P7KA 4ZUVB 1N0XH 5E7FA 4F37K 3OF6D 5D1QC 4X98B 5E00A 5DD6A 1DQJB 3F7RA 4Y16A 1CFQA 2Q6WA 1NC4B 4PJIF 4LSTL 4QHNA 4XB8A 3S96A 1B3JA 5CFHA 5FKAB 4LSSH 1HEZB 3WIHA 1IL1A 5K9KA 2SEBB 1Y6NR 5J8OA 1IC5L 3ULVC 5CAYB 4XPTL 3WFBH 5CCKL 1BZ7B 1YJDL 3KS0J 1T7XA 3FFCD 1CVRA 1NBVH 4YPGB 4HKXB 4G9DA 4BYHA 3B5HA 2ZOLA 3KPQA 1YUHB 1FGNL 2EO9A 35C8L 2CIIA 2ATPB 1NEZA 4Y16C 3BSZL 2XPGA 5HHME 3ZMRA 4NZTL 4HUXA 5DRNB 5L88L 1CTOA 1UG9A 1MCKA 3QUKA 3ARPA 3MR9A 3CMGA 4I3RL 3O6FA 5EULV 2DQIL 3S37H 4RFOH 4P4RB 5L0QC 4PJ8A 4R97C 4JRXE 4AIXA 4EBQL 1UYWH 4LASH 4XPGH 3OXRB 4HIJB 5C07A 1Q1JH 1BPVA 2W59A 1TZHA 5F9OL 1M7DB 5H94A 3ZHLA 3RU8H 4NDMA 3WEXB 3L3IA 2W60B 5L9DH 1GIGH 2ZOLB 3F7QA 3ZT7A 3X3GH 4P2CG 4M93C 3HMXL 5DA0B 4S1QH 2F53B 4FQIL 1XF5B 2UZYB 2G2RB 3FFDB 2XA8L 1T7YA 2MFNA 1KTLA 1VA9A 4Y4KB 2GJ6E 1OAUH 5LCVH 3WHXB 5IQ9A 2NY6C 3SKOA 1YEFH 3KYMB 3FT4B 1P4IL 3C5ZB 4N1HB 1AGDA 2H26B 4JN2B 5CGTA 2XKSA 4ODSH 2CLVB 5D9SB 5DC4B 4ZYKA 1PW3A 3MV8E 4X9IA 3TO4A 1NUFA 2YN5A 1ED3A 2HTKD 3PWUA 1X5HA 2HRPL 4U1LB 4UI2A 5I1HH 3E2HB 3E8UH 4Q6YA 1TJGH 1DQLH 3DI2B 3FKUS 3VRJA 1JMZA 3THMH 5F97E 4FZ8H 1EIBA 1U91A 4Z77A 5BJTA 1IFHH 1CL7L 3MNVA 3BHBA 1G6RB 3KPRB 1TJIH 4QRRA 1BLNB 4Y16D 1CDYA 4TULH 2JJVA 4Q0XH 5EU5A 4HK3J 5L8KB 4ELMB 5DJXB 3AMLA 1A2YA 2R15A 3BX7C 1PZ5A 3LKQB 3QJHB 3GBNH 4ODWA 1EERB 5DQ9A 3S4SA 3L5XL 2F19L 5E5UB 2G5RA 1VACB 4UIKL 2WLZA 5JXEA 1BQLH 1G7LB 1NCAH 3O6KL 1ACZA 4F33A 3HRZA 2OXGA 1DUZB 4ODVH 4RNRB 4PR5B 1JWSB 4XP5L 1YMME 3U0PB 4ODTH 1FFQA 3KPSB 3PDOB 1CQKA 2AQ2A 3BQUB 1UM4L 5I6XB 5IIEB 2R0KH 5F70A 5FKPB 1JJUA 3O2DA 3UJTL 3ULUC 5DFWH 1MNUL 4WW2A 3DURB 2L7JA 2BY1A 1E28B 2CR6A 4M6MH 5J1SC 2J12B 3MV8B 2OR7A 2AJSH 5CILH 1SHMA 1LE5B 1LP9F 4XNXL 1U58A 3NH7L 3NCYS 5FV2A 4R96B 3VMOA 3TO4D 2DWEB 3RWGB 3G5ZA 1OM3H 1A02N 1MF2L 5HGDB 1BX2A 3RWDA 3VXRE 3EYOA 2I9LB 1PLGL 2W9EH 2WIIA 3BKCL 4E41E 2C4XA 3UTPD 1OWRM 1AO7B 4AT6A 4PD4J 3UTSD 4A6YH 3O2VL 4NNYA 2QQKL 4HQQH 4IIQA 3B3IB 1OL0A 1TTFA 1HINH 4P2OA 5FYKL 1FZMB 2VITA 1G9NH 4RIRB 3Q0HA 1EEQA 5HGHB 1N6VA 2V9RA 5CHNB 3FCTB 1U8IB 4OLXH 5I1AA 5F7MC 5J9PA 5IHUL 5GGRB 4JFFB 5GISL 3WS3A 4LCWD 2CJUH 1GSMA 3FQTB 1Z9LA 4M7JL 4G43A 2VSCA 4UIMB 3UP1A 1W72H 1T5WA 3MOBL 1UA6H 3HE6C 5SWSD 3JVGA 5AG8A 3QRGL 1FZJB 2AJXH 5CP7A 3CLEH 3WN5C 4A6YB 4YHPA 1OGTA 2AERT 3QCTL 1REIA 5E2JA 3K8MA 4K8RH 4PJCF 3LKNB 5JOFA 1KGCD 3OKEB 3RWCB 2IH3B 4HK0A 4U1HA 1JNLH 2DLIA 5EB9A 5FYKU 1OAZH 4I77L 1R5VA 2EE3A 2CUHA 3IRPX 4CVZA 3T8XB 3WFCH 4IOFD 5KVMC 5AG9A 5JXEC 5JR1L 1DBAL 3EHBD 4BFIA 4O2FB 4JFZL 3QJFA 1I3GH 3BKMH 1MFBH 4PGZA 1CDGA 3MRQB 5GGSY 3ZTJH 3QO1B 4R4ND 5BVJB 2QQQA 5I18H 4XMKH 1IILE 4HH9A 3QUXA 1MUJB 3KJ4C 4UV4H 4ZUWA 3QZWB 4QF1B 3UO1L 4PB0L 3KJ6L 2A9NH 4XPFH 2XWJB 3QUXB 3F12A 4B41A 5L6YH 2XZAL 1TPXC 3ILQD 4MD5B 4Y5XB 3LB6C 3IJYA 1VEMA 3M1BB 2HRPH 2WUBH 4YGVB 1KF9B 3MLWH 4UT6H 1CI5A 1JL8A 1OF2A 1BOGB 3WMSA 4R0LA 3R8BB 3MSPA 1KCRH 2R0LH 3GJEA 1OTUC 4U6YB 2VDPL 2FWOB 4NO3B 4D0CA 4JFQA 5KSAA 3O4OB 1GJIA 1Q0YL 2CUIA 1NLBL 3RBSA 3Q6GH 2Z31A 3AAZA 1EVTC 5JHDA 3MJ7B 4Y1AD 1M71B 4XAWH 1T1WB 2FZ3B 3WSQL 2P5ED 3PNWA 12E8H 4L8SB 4HK0B 1Z0NA 3VXRD 1FIEA 2IQAB 1ZHBA 4X7CC 2GFBB 2DTMH 4TTDC 1S7UA 4KDVA 2B5IC 4PRAA 4I2XB 4LSQH 1T1YA 4IBLT 4RFEB 4HHAA 4KQ4L 3B43A 1MCWW 4I0CC 3U0WL 4JHWH 4YJZL 5DC9B 2Y36L 4A6YA 1HQRA 1RUQH 4HZAA 1O0VA 5E7BA 3IT8D 4PJCA 2HTLD 4M7LL 2C3WA 1GGBL 2QEJA 3MJGX 3IU3B 2Z92A 1K4DB 4PFEA 1F11B 1JZ6A 5FCUH 4HC1L 4GAYB 3O41A 3U48A 4AH2B 3VDBA 2GTZB 5DMIH 1P1ZB 1L9NA 4UINH 2BY2A 4P5MB 4NCDA 3DX8A 5I30H 1KPVB 3X14A 2J5LC 3D2UA 2R23A 4GKSA 2M1KA 1CQYA 3OKNA 4RNRA 1RHHB 1UWEH 2WIMA 5IMMB 5FF6B 2ADGB 1JMXA 1UH2A 2ZUWA 4P2OB 3J8F7 1Z9SA 3N1PC 5IWLC 4PJDA 4CVXB 2IC2A 2YKLL 4HWZB 2KQMA 2Q7NA 3EYOB 3QXTA 3V95A 4IRJC 4TVPD 1A7RH 1KLGA 5E6IA 5A16B 3AUVA 1NGXB 1EUUA 3CGTA 2AJVH 2QQLL 1P4LB 2EDHA 2UYLB 4I3RH 5HHOD 5IG7A 5GZND 1MJUH 4RISH 3KGRA 2CJUL 4PBWD 5BZDA 2CPCA 3VRLE 4MA3B 4ZUTB 1F90L 3LQZA 2C7UA 2VE6A 4NQEA 2JTDA 5FYJH 2NY2C 2XNAB 4MHHG 2ED7A 1P5UA 4XCYB 1ETZA 2GTWB 5INDB 2ADIB 2DQGH 2OZ4L 5D9SA 1AGBA 1JZ4A 2MQ0A 2R0WH 3V5HA 1T89C 4CL7A 4NM8L 4JDVA 5FO7B 4O02H 5EOTA 5IB1A 1F4AA 5C9JA 1J8HE 3I84A 5GRJH 1M7IA 3I6LE 3U79A 4ERSL 1FZOB 1WGOA 1BP3B 3PV6B 4P48A 3GJFK 4LKCB 4CNIA 3LQAL 3HC3L 1F4YL 1MRFL 1Q9LB 2F53A 3DVIA 3FFCE 2XQBL 1TIUA 3UTTA 1JFQH 5IW6A 2R4RL 4Z0BL 3VE0A 3QDGD 2BZDA 5GS0C 3L5IA 1RD6A 4D0CB 3RIFF 2ZUXA 2A83B 2EDTA 3ZKQD 4XXCC 3RWJA 3VG0L 1NUDA 1YNKH 5DEGA 5MEQB 1MWAA 2EDOA 2HWZH 2NNAB 3RRQA 2NW2B 1KXTB 3SDXA 5IQ7H 5D5ME 2ICWB 3QUML 2HTKC 1KCUH 1NCNA 4J7RA 2XICA 3BKJH 4LIQE 1B88A 1WZKA 3C8KA 3TCLA 1MVFA 3T2NH 3KDMA 3JV0A 5DD5L 1F8TL 2FX9L 4TVPH 4XH2A 4NM8H 3DI3B 3LHPL 2A83A 5L6YL 2NY6D 1HH9B 4PRAB 4WY7H 1CVSC 3QO1A 2HVKA 1RUKH 5KTEL 3DPBA 1HQ4B 4NSKB 3V4UH 1MHPL 3QIBC 4P23C 3VI4E 3LKOA 5FYLH 1AIFB 3EDFA 4QXTB 4F2MA 4L8DB 4ENEC 1JFQL 2VLKA 1DLFL 1JPGB 1JZ7A 3OKOB 5DJ2A 1LEKB 1D9KD 3SHSA 4N1EA 4ZTPL 2CQVA 4LPUA 2IPUG 5AD0B 2JB6B 3LKSB 2VXTH 4IOIB 3N85H 1IQWL 1BFSA 3TCLB 1EK3A 3FQWB 3HG1A 5DD3H 2BSSB 5FGBA 2E9JA 4YBLB 3QUMH 5DJ6B 4NQVB 5HHMB 4WEBH 3VFGL 2CH8A 4FNLL 3K8LA 4G9FA 1NQBA 4YXKL 4H0HB 3BZDA 5I74B 4ONGH 3CCHB 4BK5A 2A73B 5HHPB 1CD9B 1H3PH 4IMLB 4OI8A 1U8LB 2UZXB 3QEUB 2Z92B 1ZLWH 1JHTA 4O2CB 4Z7WF 2EEBA 1HXMA 2ZSWB 2VLRE 3V9FA 2YSSB 4WUKL 3GBML 3TVMB 4PG9B 4KZDH 4UV7L 3VXSE 5ALCL 5JXAL 3CPLA 2XTLA 3KR3H 1I8LA 2P8LB 2ERJC 3D25B 2NXZB 4KQ4H 2IEPA 4GG6B 3SKJH 1PG7X 1U8IA 5DS8A 1UYWL 4OJFL 1OGAE 4ZFZA 1YEGL 1QSFA 2J2ZA 3SGDH 3T2NL 3MPCA 4FS0A 2EXWD 4OGYL 1G7JA 4TNVF 3BGFB 3Q2CA 4QWWD 3RWIA 1N59B 4GRWF 4RGNB 3IFOB 2BNRE 1FAIL 1WEJH 4HJGB 1HYSD 2XACC 4KJWC 1I9JL 4XVUC 4PV9A 5FB8A 4MA3A 4ZUTA 1PG7W 3C87A 5C07D 5I1GH 4FP8L 3W2DL 1FE8H 4RGND 3PWPB 5ADOH 4Y89A 5DMKA 4YNYA 9CGTA 1NCBL 2BVYA 2NY7L 1RUMH 3NGBB 3U9PL 3BEVB 4BZ1L 4HAFA 2R0ZH 5MENA 3HMWL 5E4EB 4KI5C 4BSJA 3FB8B 3RI5F 5LVEA 5LQBL 4ZPTB 3O3BA 5CIPA 3P77A 1FYTE 3IFOA 1MCOH 2WP3T 4JFFD 1PZUB 1HNGA 1FHGA 4OZGA 1MIML 3WXWH 4GBXC 4OD1L 3SDCD 3TM6A 4QXGL 1CDHA 4XPHH 3FN9A 5TGBA 2R0WL 3QO0A 3NA9H 2A6KA 3VGGA 2CK0L 4MYWB 3O3UN 4RGOL 1SYVB 5EFIB 1WZ1H 1ZT7B 1KTDB 1M6OB 3WKNA 4LLMB 4N68A 4F7MB 2P8LA 3D25A 3B8SA 2QL1A 3WFCL 1ZT4B 4FMKA 2MJWA 1I8LC 3WKML 3SDAD 4LPXA 1MFBL 2X4TA 3CDGB 5MENB 4A6YL 3KPNA 4WV1C 3BZFB 3HI5L 4U1GB 1YN7A 1YPZF 3PGFL 2IAMC 1A7PH 2PTTA 4OF5A 1OTSD 4HKBB 3EGSB 3RWGA 3UCRA 1CGVA 2JCCB 4YH6A 3L1OH 5H8DA 1IGCH 1JUFA 1W0WB 3RPKA 3TA3B 2Z31D 4CDGC 3FT3B 3G9AB 4NNPL 4DAGH 1FNHA 4OTXH 5C6WH 2AXGA 5JIKA 2HH0L 1CGSL 4PV9B 4G6MH 1I8KA 5E8PA 5C0JB 4I2XA 1CIUA 3P4MB 5E8OA 3MJ9H 2DS4A 4PJ7A 2XTJB 4KK8D 2ID5A 2GFBA 1DBBH 2WM0A 1CE6A 3FQNB 5HVHB 2WLYA 3UJTH 1RZGA 1MJ8L 3DVGA 4NQTA 4M5YH 4Z7UF 4IHOA 5AYUH 1VFMA 4TSCL 1N5AA 4N0RA 3SE4A 4PJBF 1XGRA 3O45A 3E6HB 3Q1SL 4QRPA 3H2WA 1GGCH 4F7EB 4P57A 1XGRB 4U0RC 1QKZL 2I25N 4P2RB 1MFCL 4KGLA 5B8CC 2G75B 2E8ZA 4K3EH 1GGIL 2A9ML 5GGQL 3SDDC 4YHIB 2OTPA 3K2UL 1ADQA 3MRLB 4I3SL 3NFPA 5DJDB 1DEEA 4LSDA 3OR6A 3PIQA 3KXFE 3P4MA 1CICB 1F2XK 4R7NA 2WV3A 5MP6H 4GQ9L 4YDIL 1T0MA 1DEDA 5DT1L 1QFWM 2FLBT 2K7QA 1OAZL 3RX5A 2X89D 3QIWA 3ALPA 5HI3C 4XRCB 4KKAD 1RZJH 5SWZA 3ARZA 4G9FB 1NAKH 2I60L 3MV9E 4DK6A 1TCMA 1FFNA 3D9AH 2VSDA 3SJVD 4AYFA 1I9IL 3T77B 3T1FB 1EJOL 4WWKB 3I6KA 4UIMA 4K71B 3MROB 4IOIA 1R6VA 5GIRB 4JANA 3ULVH 5AUMA 5TDPB 3C5JB 3PF2A 4HUKB 2RCSL 3L7EB 3RIAF 2X70B 5IROA 4XNZB 4OI9A 1A14L 1XEDA 2PO6B 4L9LA 1SYVA 1KELH 1MHHA 2CRYA 1JWSA 1UCBL 3SDYL 1C7SA 2V2XB 4AEEA 2VZ3A 4PJAA 5HVFB 5HGHA 3N1FC 4ZFZB 4ZSOB 4IJ3C 4RGMC 2CGRH 1ODAA 3BPLC 5GSVB 1BZ9B 4KRLB 5ID1B 3EYVA 3V6ZB 1OAYH 1DQDL 4LLWA 3VI4F 1TQBC 4PJEE 1CL7H 5I16A 2LU7A 4IEFB 4NO2A 1JNHB 5F7YC 4MXWL 5M95B 2PCPA 3S9DB 2OK0L 1AKJA 4JFDE 5CJ8A 1AHWA 1J12A 4M6NH 1X9QA 4ODXA 5ESQB 3L5WB 1D5MB 2X9XA 5D2NE 3MA9H 3CIQA 2HT4D 1NCWH 3QFJD 1GOGA 4OLZL 1F6AA 3MRCB 3MREA 1LK2A 3U2SB 1G6RA 3KPRA 3RVUD 1K8IA 4PJGB 4X9FA 5GGVY 1V3LA 3I9GL 4NRYB 3TVMD 3IRZA 5DRWA 4MAYC 3FB6A 3R1GL 3LAFA 2ICCA 5D7IA 4QNPE 4JFDA 5FUCE 4NKMA 4E0RA 4JPVH 2RCSH 4D3CH 1HH6B 4DWHA 4KRPD 3DRQA 5BRZA 4LCIH 1RZFH 3W0WA 3QI9A 1U8KB 5DSCA 1NDMA 4NJ9H 4YAQB 3FO2A 5HDQL 2V6HA 5DTFB 3BPLB 5E70A 4XHJD 4F57L 2D31B 4WRLA 4JFOB 4MNQE 1LEKA 4TRPL 5DRZB 1RZJL 1LO3L 3IS0X 4NQED 1CGWA 2WINB 1QLFB 1JGEA 3CFDA 2X4SA 4L8CA 4XT1C 4ZOEA 1RFDH 1T3FB 4Y16B 4H8WL 1EEZA 1CDIA 2DYPB 2HJFA 3O6FC 3SY0A 1FSKB 1HQ4A 5CUSL 4PGBA 2AJXL 3U4AA 5IHBA 5JNYB 1N8ZB 2H2SD 2D7TL 2VXQL 2Y6SC 3B9AA 4GMSH 3SDCA 5LGJA 1L7TH 4N1CA 5ETUA 2FX8H 2DQIH 3QXUA 5L2KA 5EZLA 3O8XC 1WBZA 3NCMA 4ETQB 2OL3L 4FQXD 5AZ2H 4FTVD 2AS5M 1A1NA 2HFFB 4OT1H 1TPXB 5TDOA 1NANH 4OM1L 3FO9A 2C5DC 1XCTA 3V0VA 4Y5XC 5GS1A 2ICWA 4LSRH 1YEKH 3V6OC 3WUWA 3HAEG 4ODUB 3RIAK 1U8MB 1HZHH 2OJZL 3CMOL 4MAUL 2PKDA 3EIFA 4JZJB 3QUZB 1OY3B 3ZE0F 3L3GB 5F6IC 4JO2L 3MRBA 3QPXH 4J3OC 3GSNB 1KCLA 4OZFH 4F8TA 1WZLA 4JB9H 3OXSB 4FZEH 5GRZA 2D0HA 5ISZD 3U83A 4EDWH 1XGTA 3TZVD 4EBQH 2GJJA 1BZ7A 3TH3T 2V17L 5ICYA 4JM2A 3MRNA 3MBEA 4JQVA 4HDIB 5FA4A 1X5FA 1M7XA 2YSSA 3HI5H 3RGVA 4P59H 3CLFH 5HSFA 2ZCLL 5IFAL 4GKSB 1CTNA 2DQGL 4JDZA 4QYOA 5CZXD 2PO6A 1QO3A 1BLNA 1X5ZA 3IDGA 4P2QD 2PTVA 3L3GA 1DBKH 4L9DA 5DD6B 4N8PA 4KDTC 4R0LB 4X83A 2ICWJ 2CDFA 2VWEE 5FM8A 3GO1L 3EBAA 4ZUVA 2VLKD 3DXAE 2UUDH 2X4NA 3EOAA 1VEOA 4ZXBB 4X6FA 5IESH 4DOHE 3IDIB 3ETBF 4HS3B 2VLJA 4LNRB 4H0IA 5DJ6A 3VXTB 3EOAB 4HMEA 1AO7D 4X6DA 1RI8A 4M9OA 1NMCC 4PJCB 2OLDA 3GDBA 1X5JA 3QCVH 4OCWH 3ZE2E 3D0VA 1RFDL 2VZTA 1MY7A 1R3LB 4NO0D 4PREB 4GRWH 2EE9A 1AKJB 4K3JH 4Z76B 4I0KA 3A6CL 2UV3A 1T66D 4TQEH 4ZUUB 5FYKE 4FZEL 1B0GA 1DEEB 1KB5A 4JFXB 4G9DB 4HKXA 2PXYD 3U4BH 1KLGB 5E6IB 2IQAA 2L0DA 2HWZL 2ZCKH 4S0TD 5HHVH 2V9TA 1Q9LA 4ZSOA 1AXTL 3OHXB 1CDCA 4FHBD 4QHLA 5IFJB 4HEPG 5GJSH 5A2FA 4XPTH 3WFBL 5T1DH 2JJSC 2P46B 1JN6A 2NZIA 4G6FB 1NC4A 5MEPA 1GXEA 4KKCC 5GGSB 1WCBB 3SDYH 1QHOA 1Z2KA 2RAMA 4PJ9B 4G8FB 1F8TH 5BMFL 5JW4Q 4I48A 4D8PB 3QXDA 4JO2H 3IJSB 1P7KB 1DFBL 3C08L 3W0WB 3ZYZA 1KCVH 4R90H 1GGTA 4EDWL 3VXUD 2EDQA 3RGVC 3GSNL 1J05A 3IXAA 3LQZB 5GS0H 4MXWH 5DJ0B 4M7ZB 2UWEE 4JM4L 3DHJA 2YWYA 1YMMB 2Z31C 3EAKA 1LK2B 5JPMB 3C8HA 4QRUB 4JREB 4FFWC 4PTTA 2BNRA 3MJ8B 2VLJD 1U3ZA 5HYJA 4QRSA 2VDQH 5IB4A 3GI9L 5I19L 2AI0L 3TYFB 5CJQL 5IESL 5D1ZC 2J6EL 1AGEB 3MRNB 4J3XA 5SWSE 1YECL 1U92A 4LSSL 3PUCA 3FTGA 1EHXA 4HKJA 5IT2H 1FZOA 3UYPA 2QSTA 5GS2H 5ICZA 3WN5B 5HPOA 4LSPL 1CGUA 1CXHA 3G6JB 2NXZC 1E4WH 4HFWB 2NY4C 4J3WA 3OKNB 5F7WC 2YK1L 1UZ8A 2BVOA 3JVGC 4UDUA 3IDMA 4LLDA 3SDCC 3MNWA 3N06B 4LDEB 4GG6F 1QVOA 3VXMD 2O26U 5JTWA 2AAVA 4HFUH 2UY6A 4P46C 5I9QC 3P9LB 4KI5D 5T3ZL 1JWMA 4PJEA 1VFAA 1FLRL 4BH7A 4EOWH 1P53A 4NKQB 2V2TA 2ILLA 1IGJB 1XCQA 2Y25A 2PTTB 1DBJL 4LU5H 3PWVB 4KUZH 4NHUA 5DURD 1KC5H 5D7LD 4NQCB 4MX7B 1ZGLM 1J0JA 3MRDA 1EEZB 3JUZA 3TBVB 1OT1A 4HJJL 2WUBL 2K3TA 2VQ1B 3UTSA 2P5EB 3H42L 5C0EA 4EZMA 3NGBC 4JKPL 3O3AA 5DJYA 2BVOB 4CADA 2VABB 4FQHA 3O3EB 5GSVA 4O2FA 4WI7A 5DHVA 5F7FA 2QSCH 1N0XL 3RY6C 4M7KL 4KI5F 2B20A 1NDMB 2Y07H 3U36B 1QBML 3MBXL 3H7LA 4KTYA 3E6HA 4NGHL 2AJ3B 4FQQB 4POYA 3GMOA 4NBXB 3VI3F 3LKRA 4WCYL 4I0PD 1C1EH 3TT1L 5J13B 2GY5A 1CG9A 2OL3H 3T0XA 4MVBC 4NQCA 1MCOL 4U1SA 2ORBH 1NCCL 5DJXA 2FBJH 4I0PB 4RQQA 1ZOXA 2VERN 4YNYB 3T0WA 2E6QA 1OPGL 1S8DA 3DVFA 1NC2B 2JELH 1KJ2L 3I3BA 3F65A 5FYJU 3UTQB 4LSVH 3FONB 3ZHKA 1OAKH 4U3HA 1S9KC 2OTUA 2W07A 2EC9U 4EI6A 2EIZB 3HC0B 3RJQB 3IDXL 1RURH 1ZHBB 1J1OH 1KJ2A 1I9IH 3MRLA 2NCMA 1NGPH 2VKWA 5E99L 2BY0A 3VGAB 2VIRA 3FFCA 5I1DB 4PRHB 5HHOB 5GZOD 3IDYB 1ZEAL 3MNZB 2R56L 3MLXH 1KNOB 1KTDA 1M6OA 1S9YB 4GG6A 1CICD 1W8OA 2JLLA 2BP3A 4WUUD 4LPVA 3QUYB 3WIIH 1AQKL 1UCBH 3CFJB 1MJ7H 2F5AL 1YNTB 2VDKH 3VCLB 3LY6A 4ENED 1BWMA 4UT9L 3JV6B 3DX7B 1EEUA 1CD0A 3GKWH 3W11C 3LRSA 1UA6L 3S7GA 4YHNA 4DKFH 3KYOA 3G5YB 1MFEL 4WIQA 4Z76A 2WWMC 5GRVL 4OM0H 4ZDHB 2ADFL 4Y2DD 4JGUA 3S5LA 1K2DB 2A0LD 3VGHA 3ROLA 3DBXB 3LMJH 4AJ0A 1QLRA 1T0PB 2CLRA 5ADPH 1B6UA 5TFSH 1RJZB 4LRIC 4P23A 2BHZA 4I3GA 4DTGH 3V5KA 3I02B 4UB0L 3DX7A 1BJ1J 1YNTA 1U36A 2X4QA 1NFDE 5ANMA 1KOAA 2R1XA 3MNWB 2IGFL 4B53A 1S7SB 4JFFE 3KYMA 4NNPH 3PP3H 2CIIB 1F13A 1A4JA 2VXTL 3VDCA 1BD2B 5GS0D 1A3RH 3L1OL 3RX8A 5HYQA 5ITBL 4PJ5E 2JELL 3CZJA 3U6RB 3WJLC 4CRPA 3KLAB 4ELKA 4O58L 5HYSG 3GEWB 5HY9A 4NKOB 3RTQD 2XIDA 3ULSB 4ODTL 3T65A 3TZVC 2N4IA 3GMLA 5HGBA 3WIHH 4L4TD 5IKCA 5KS9E 2ATKA 4ZPVB 2EH7H 4ZAKC 1T4KA 3TYFA 3HN3A 4FA8A 1XZ0A 1U42A 4XPBH 2NX5E 3WIIL 1J5OH 5F1OB 1JVKA 4R2GB 4ISVB 5CEXB 5DHYA 4OTXL 4X0KB 2DD8H 3KPNB 5C7XL 5HVGB 4FFZH 5F9AC 4Z7WB 2NLJB 3AFLA 1CG9B 3AY4C 1WBZB 3PJSA 3EO0B 5KZCB 1PG7H 4LLMA 4F7MA 4UDUB 1K9TA 5KS9A 4ORGB 1XF4A 3F7VB 1SMAA 1KN2L 2A6JB 5E6IC 3T09A 1DQQA 3HLAB 4WTZA 5ACMA 1SJEA 2ZOKB 4CJ0A 5DS8B 2DBJA 2ESVA 4UNVA 4PJ5A 3BP5A 4S1QL 5DWUL 5K9KB 1EMTH 1FCGA 1I9JH 1UACH 4ODWB 4HT1L 3RHWK 4GKOA 1CGTA 1YEHL 5CIPB 3MOAH 3HUJB 3CFKB 1LDPL 1OSZB 4PUBL 2G60L 3MRDB 1D5IH 3GGWA 4XNMB 2VDNL 3DUUB 3OR7B 4LARL 3QHZL 2IH1B 4PJIE 5I71C 1UXSB 3MCLL 3L7FB 4DUWA 4O02L 3OG6B 3ARWA 3LQMA 2Y5TB 3CUPA 3VWKA 4ODSL 1Z5LA 1MFAH 2RFXA 3VH8B 4HGKC 5DD3L 4DZBA 3HG1E 3DIFB 5IOPA 5EA0H 3UBXG 2WWKO 3GO1H 4MAYD 3C09C 1A0QH 3O4LB 2WP3O 2R8SL 1HHKB 3OJMB 4IOSD 4BZ2H 4HPYL 1A22B 1B4JH 1IM9D 5LGJB 3GMQA 4C56B 4Q9BA 3RWIB 3UROR 5IV2A 4YHOH 1HI6A 3K46A 3H9SB 4H8WC 4K23H 2ZUQC 4TNWK 4Y4FD