1DEEB

Structure of s. aureus protein a bound to a human igm fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
223
structure length
223
Chain Sequence
b'QVQLVESGGGVVQPGKSLRLSCAASGFTFSGYGMHWVRQAPGKGLEWVALISYDESNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKVKFYDPTAPNDYWGQGTLVTVSSGSASAPTLFPLVSCENSNPSSTVAVGCLAQDFLPDSITFSWKYKNNSDISSTRGFPSVLRGGKYAATSQVLLPSKDVAQGTNEHVVCKVQHPNGNKEKDVPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGM RF 2A2
publication title Crystal structure of a Staphylococcus aureus protein A domain complexed with the Fab fragment of a human IgM antibody: structural basis for recognition of B-cell receptors and superantigen activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 43
structure length 223
sequence length 223
chains with identical sequence D, F
ec nomenclature
pdb deposition date 1999-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1deeB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1deeB02
2JIXA 3VFVB 3GSNH 1I3GH 3O2DL 4XCFH 3FFCE 5J13B 2Q7YB 1IAIH 2XPGA 2X7LA 5FKPB 3NA4A 4KJQD 3LV3B 4U05A 2ID5A 2O5ZH 4N9GA 4GLRH 2APTA 3F62A 3AS2A 2ITDB 5E9DA 2RHEA 4LKCA 3W39A 3V4VL 4Y5VB 5FYJH 1BGXH 1Q9WB 2ENYA 4MWFB 1KB5A 4G7YH 4M8QA 4X99B 4HS6A 3WNMA 1NUFA 3O11A 3S34H 1X5FA 1NDMB 1CD0A 5EZIL 4JQXA 1RSFA 1MRCH 1YEFH 4UB0H 2XTJD 1YMMD 1VERA 2BOCB 2NLJA 2YPKB 5HY9B 2FYYB 5C9JB 2R1XA 1XIWA 2C3VB 3IJHB 4IIQA 4U1KB 4NQTA 5F9JB 3HZMA 2EC9U 2X1XR 4LPTA 5DMJB 3HZVB 1G7JB 3NABH 3BXNB 2GEEA 1P84J 3SOBL 1T2QH 5DLML 1RHFA 1Z0NA 1K4CB 4NM8L 3TO4B 2ZPKH 2Y1VA 4LDLB 5DI8B 5GISL 1TENA 1YEKH 2UWEA 2VDMH 3I6LE 3ALXA 1ORSA 3SGDH 4YXKL 4R4ND 4MJ6A 4AL8H 2N4IA 3KVQA 3GBNH 2XQYK 4QRPA 5KJRL 1IC1A 2HLAA 2HMIC 1TQBC 4WI9A 3V7MA 2R1WA 5FYKL 1QNZH 43C9A 1MSPA 2G5RA 4QHNA 5GRUH 4U2YA 3RWDA 1VFBA 5LGHH 5L2KB 3MZGB 1V3KA 4PREA 2BVTA 4JN1H 5DC4B 5HBBA 1FNGA 1CIUA 4OV5A 3NFSH 4NHCL 5LWYH 3MOBH 3BPCA 3B3IA 4XNXL 3L3DA 5IHBA 4XP6H 2GJ6E 4HV8A 2CUIA 4BQBA 4LLYB 4OFYD 3BZDA 3X13B 1YN7B 1MCJA 1IM3A 4LLWA 3K80A 1XGPA 4N1CA 2ZP0T 5FM5O 5DJYB 2DL9A 1OAKH 3W2DH 1PG7H 5C3TA 3T4AB 4UU9B 1BF2A 4YHPB 2YD2A 4X6FB 3MRCB 1JZ2A 2DKSA 3FFCB 1YYLH 3RVUC 2W9EH 1TZHA 4NRYB 4OLUH 4PP2B 1QFOA 1WFUA 4ELKB 1BAFL 2XN9A 5DQJA 1DSFL 3QHZH 4DFIA 1BECA 2QKIA 2YMXH 1QSFE 4JB9L 3BWAB 1NLDL 3MRDB 4KHTL 4F7PB 3WXVL 3OKOA 3W5MA 4X7DC 1FFRA 4WV1B 5EBLB 1IEHA 2AV7A 1HWGB 4L4JA 4NDMA 5DS8A 1A2YB 4ONGH 3MV7A 1I8KA 4FABL 4G7VH 4XAWL 2HFGH 5D1ZB 4ERSH 4R96A 1A02N 4M8VA 5EN2A 4NRZA 4ZPVA 3GMLA 4ZO8A 1XR9B 5DJ6B 2OJEB 3MCKA 2LAAA 4HFUL 2G5BB 5KAQG 4S0SD 1A7OH 1MUJA 2XNAB 1BVLB 3RZCB 4RGNC 1H3UA 4UQ2A 3LH2H 3MLZH 4HIEA 1ES0B 4P4KB 3HE6D 4DGVL 4MX7B 4JFXB 3D0VA 1LE9A 3TJHC 4JLRB 1W0YT 2IADB 1FE8L 5F1OB 3OF6D 5FKPA 4NZTH 1R5WA 4RQQB 2NY3C 2Y72A 5SWZB 5TE6H 1AGFA 4Y5XB 4HZLB 4LCIH 4Z7VE 5SV3A 5T5FH 1ZSDB 4FFYL 5L6YH 4M62H 2APBA 1QFHA 3QQ9D 5DMIL 2KZWA 3LKQB 1RUPL 3F6IA 2DTML 2KKQA 2VQUA 4XC1H 4MWFA 1BIHA 4O02L 2Q3AA 4HJ0C 1YNKL 4X99A 5FHAL 1T20B 4U0QB 1EJ6A 1VFAB 3FMGL 3IFPA 1XF2B 5EOCH 1IVLA 4JKKA 5I76B 5FGBC 1A47A 2BOBA 4MS8C 2BOCA 2YPKA 4HJJL 4OCWL 3CVHB 4FXLA 3QUYB 4KROD 4KAQH 3M17B 5EU5A 3D9AL 3RU8H 2C3VA 5KSBB 2CD0A 1DVFC 2WK2A 1M7XA 5IBTL 5F9JA 4EN3C 4WEBH 1T1YB 1PLGH 4WFHE 1F2QA 1SHMA 1TDQA 2P48B 3BXNA 1PJ9A 4J4PD 3C8HA 1OM3H 5L0QC 3RZWA 4DW2H 1ZVHA 3IFOB 4HXAL 4MXWH 2VR5A 5D7IA 3TO4A 5DI8A 4CU6A 4Y2OA 1PW3A 3GBLA 3P2TA 4JJ5B 3RBSA 5GGTL 3ZYOA 5EUKB 3S88H 4ZNEE 1IAIL 3RPKA 3K2MC 2O5ZL 3NFPB 4GBXD 4DN3L 3PG2A 1QSFB 4C59B 1FG2B 3DYPA 2Z92A 4NC1E 4HKBB 2AEPL 3SE3A 1BGXL 3TT3L 3ARBD 2Y4SA 3PV6B 2X70B 4HMCA 4G7YL 3SDAA 2XQYG 3EYUH 1WITA 3S34L 2O93L 2HRPL 4UZGA 3GMNB 1YY9D 3GSWB 4K9EC 3X13A 1YN7A 4ZG1A 2Z8RA 5F7WC 3AY4A 4N8VG 1IGMH 1W8OA 1TCRB 5HDOA 1JPTH 3OXSA 1EEYB 1ED3B 2R56L 3CX2A 5IMOA 2K7QA 1CG9B 1QEWB 3T4AA 5IBUB 4UU9A 5CBAA 3HR5B 3GM8A 3A6BL 2GCYB 4CVUA 1JMZA 1GJIA 1AP2B 1IC7H 2Z8SA 1DTUA 1T2QL 4KGLA 1A7NH 1NFIA 4K3DL 4ELKA 3SCMB 2ZPKL 1YEKL 5C0GB 4Z7VB 1CCZA 5B3NA 3MRDA 4AL8L 4F58H 3D87B 1RZFH 4F7PA 3HC4L 3GBNL 3GK8H 3DYMA 1KXVC 1KTLB 5EBLA 2BMKB 3KLHD 1LEGB 4JQVA 1A2YA 4I3RH 4JM2B 1F5WA 1T1WB 3CFKB 4ZXBC 4W4OC 4NSKB 3VFNB 5D1ZA 5MI0C 1T66C 3OV6A 4JN1L 1XR9A 3NFSL 5DJ6A 4AIOA 4HIJB 5LWYL 3MOBL 1NBZB 5D70H 2EO1A 2V5TA 3QEHB 4LIQL 1ZLWH 1HH9B 2X41A 5C0DA 1OL0A 4NNYB 2IFGA 3RZCA 5KVMC 4ZUWB 1Q0XH 4MX7A 4JLRA 2FZ3A 2PXYA 1GXEA 2IADA 2XOTA 3KPNB 4PJ9B 4OLEA 5DUPH 3EJJX 4L1HA 4YC2B 2Y06H 4RQQA 4KKAC 1UZ6E 4PJFF 3W2DL 5E8EA 1EEZB 5ACZB 4N8CH 1EHLH 5DK0B 2IJ0C 2XQBH 5IW3A 3F7QA 3LY6A 2FIRT 5ILTH 2C26A 3LKQA 1YYLL 2W9EL 1JRHI 1K2DB 5CP3A 5C07D 3QXAB 5GGSY 1PX4A 4OLUL 2GTWA 5HYIA 3QHZL 3T3PF 3O3EB 3NTCL 1XF2A 3TO2A 5DQDL 1RUKL 3WNKA 4TYUA 4MXQC 1DANT 5DEGA 5I76A 5JR1H 2IF7A 5FYLE 2MHAB 1JGEB 5C0IB 3JSSA 2HA1A 4ONGL 3RWHB 4RAUB 3DROB 2OMBA 3CVHA 3QUYA 3M17A 3TBTB 4OD1L 2GJ6A 4K3EH 4ERSL 4NQUA 2HVJB 1RHHB 1WIUA 3Q3GB 4S1DC 3ZDXF 5AWNH 3BIAX 3KPRD 4OZFG 4EDXB 3IFOA 5K93A 4K94L 3QQ4B 4QRRE 4J3WA 1IBGH 3KYKH 4JJ5A 4JDZA 5EUKA 4NM4H 4NZTL 5BV7H 4XC3H 3N85L 5TE6L 2X4TB 2KPNA 1U8HB 1UH4A 1QSFA 5T5FL 3WKMH 3UMTA 1K6QH 1EDQA 4HKBA 4M62L 4DAGH 5LGKA 3L1OL 4EI6B 1DBJH 4JKPL 3MFGB 1P5UA 4XC1L 3NPSB 5KVGH 3MLYH 1OP3H 5EU6E 3I6KA 3NCFB 4I4WA 3TZVD 4M02A 3V8CA 1QRND 5EOCL 4JPKH 5DO2D 2BC4B 3GMNA 2R15A 3U7WH 3GSWA 4CNIB 2V5MA 1WBZB 3MRLB 2IC2A 2X9WA 1N5YL 4G3YH 3KPMB 3GMRB 5EBGA 3P77B 2CK2A 1TCRA 3BT2H 5FCUH 1EEYA 4KAQL 4R2GB 1Y6KR 3HC3L 3H7LA 3RU8L 1QEWA 1SY6A 1REIA 3ZDZE 4NGHL 1FN4B 4OD3H 4WTZG 3STLB 3HR5A 4EIZC 1PLGL 4RAVB 2V9RA 2YPVL 1NCBH 4OKVB 4HW6A 1OM3L 4LSRH 4PJIE 4WI3A 15C8H 4MXWL 1B6UA 4OJFL 3SCMA 3MLRL 5HGDB 3JWOL 5C0GA 3OTTA 4Z7VA 4X4YA 2VOTA 5JW4Q 4JG1H 1EFQA 4N0YH 3ZE0E 4E42B 3KDMA 1ZGLP 4PLOB 2D7OA 2DM7A 1L0YA 1U95A 2BMKA 1LEGA 3EYSH 4XCCH 2N7AA 2OK0H 2YUVA 3TT1H 3TEUA 4KUZL 4OZGF 4G9DA 2F58L 1KN2L 3CFKA 2WWMC 1DL7H 4Z76A 3FB5B 3WV0A 2VN4A 2UWEF 3QEGL 2UY6A 3VE0B 1RUMH 4JY4A 4BM7A 4JHBA 1NBZA 3EYUL 3QEHA 1JNJA 5F89B 2GUOA 2Q76A 1HSBB 2W60B 3MJ7A 4O2EA 4OV6F 5F44A 4DQOH 2ZOLA 1KLGB 1CDYA 5I66B 2C9AA 4HDIB 3ZHLA 3AU1B 1OTUD 4JANB 1IGML 2R23B 3KPNA 5I75C 5EU7C 5GRXG 1YNLL 1JPTL 3RNQB 1J0JA 1A6ZB 2B1AH 4JFQB 4FG6D 5L88H 1EXUA 5ACZA 1KJ2B 4P9HL 3NIFF 5DK0A 1FFPB 3FHQA 4XHJD 4OFIA 1QZ1A 1T7WA 1S78C 1U3JA 5DUBB 1WFNA 3HMXA 4ZNEA 2XG5A 3ARUA 3MV01 5CGTA 3QXAA 3EAKA 2GSGB 3OKKA 4K55A 1A4KB 3U46B 4F58L 3LDBC 3RIFK 4MA3A 2F54E 3GK8L 3K0WA 5GJTH 1JZ5A 3EYOB 3IKKA 3U9PH 5HVHC 1I8LC 1Q1JH 3E8UL 1ZXQA 5EU6B 4YWGH 1SM3L 4X9IA 4I3RL 1IGCH 2QADD 1QACA 3DROA 2DQDH 2FNBA 3BKML 1A6AB 3TBTA 2X44D 1LMKA 1EZVY 2HVJA 5C9KA 5LG1A 3ESUF 1RHHA 4ENED 4R8WL 5FHBH 1N7MH 5D70L 4UIMB 3HI6L 3LZFL 4X98B 5H35A 2B2XL 1UADC 1DFBL 2AK4D 2FHBA 4P3DB 5F9AC 1IC5H 2BVOB 3MV9D 4ONOA 1FNEB 2Y06L 4FTVD 3N0PB 4PJIB 1ZLUH 1PKQA 2X4TA 4WW1B 4N8CL 1U8HA 2XQBL 1ITCA 3VD4A 5ILTL 2VLJB 2APWA 3S35H 3ZDYF 3GBMH 3EYVA 3QCTH 3FOLB 1JZ8A 2BP3A 5KSAC 1UM6H 2Z31A 1J7VR 5IW6B 1IM9D 4GUPB 4Y0GA 3ZE2E 5C0JA 4ZUSB 2BC4A 3MRLA 5IIEB 4I0PC 5ITBL 1YECL 1QBML 4LU5H 4KK6C 5H8DA 2VKXA 1IILE 4NRXB 5I1JH 4K3EL 2P5WB 2OJZH 5F93C 1C5BH 3MJ9A 3VRIA 2KZ1B 1FN4A 4X4XA 3STLA 3T0EA 3O2VH 3T8XB 1OTSC 3HAEB 3M1BB 5AWNL 4OGZA 4U49A 1YPZE 1G1CA 1OARL 3RIAK 3STZB 4M7JH 1DE4A 5ANME 4XH2A 1IBGL 3KYKL 4X6BA 3ES6A 2I07B 4NM4L 2EE9A 3HB3C 4EVNA 1Y18B 3C5SB 1FVCB 1BX2B 5BV7L 2JJVA 2R0KH 3EOAA 2EEAA 1U8NB 5FA4A 2ADFH 2IANE 4XTRC 4X8JB 5TJWK 1K6QL 3WKML 1JTOA 3CJJA 4DAGL 2F54B 1DBJL 5D7IF 3GJEA 2W07A 3QDJE 1CWVA 3DNKA 3HC0A 5JUEL 1SJHB 1YN6B 2OR9H 2BSRB 1OWRM 2W60A 1OP5H 2DLIA 3U7WL 1KLGA 1IKFH 1UJ3B 5I66A 1EGJH 4MHHI 4LCCC 5EPMB 5HPMA 1G6RH 3AU1A 4JANA 2P7TA 1A9BB 2ZUXA 3BT2L 1UCBL 3DX7B 3RNQA 4JFDA 5D7SH 2H32B 4F7TB 4JFQA 2Z91B 4MVBC 1KJ2A 2YS4A 4QRRA 4OD3L 1UM4L 1VA9A 2PO6C 3S36H 1CI5A 3T04D 1LO4H 1NCBL 2UYLB 4RFOL 3BKYH 4R3SB 2XZCH 4LSRL 15C8L 1MREH 1S7SA 3TP4A 4ZAKC 1RK1A 1S9KC 1A4KA 4WO4B 4OUUA 2H6PB 4JG1L 1RZIB 3U46A 3W9DA 2NY0B 4X5WA 4F3FB 3LEVH 3EYSL 4XCCL 4XPFL 3IRZA 2IAMC 2CR6A 2OK0L 5C09E 4U4BA 3TT1L 3BP7B 1A6AA 1DL7L 1RZ7H 1F3DH 4KZEL 2ZSVB 5MEND 3CFCH 4IRSD 4DK6A 4DKFL 1ZVSB 3VH8G 4NFBA 1EEUA 4JZJB 2QLVB 3PWJA 3QR2A 3GMPB 1DQTA 1SVZA 3PHOA 4X98A 2P46B 1KXTB 4TSAH 2HTLD 3TIDB 5K9QG 4DQOL 2FR4B 4ONHB 5SWQB 2VDQH 1KSRA 5CHNA 3D6GA 3LAFA 1CICD 1N0XL 2CO7B 3OJDB 4IJ3C 5GGVL 4UDTA 1YPZB 3EJYD 5A16B 2D2OA 1JF1A 1NCNA 4LASH 4D0DB 4FA8A 5FUOH 2MQ0A 5ANMB 3RY5A 5CEXA 3LS4H 3TNMB 3A67H 4NT6B 2R2HB 4FN0A 3QDME 4IEFB 2DOCA 1TITA 5ISZE 2OCFD 1KYOJ 3PIQB 3NCJH 1M4KA 3ULUE 1F90L 1YEGL 3FOLA 3QHTC 2V2XB 5IW6A 2IANB 3SE4C 3QUZC 5E1AA 2VUYA 4L8CB 2EH7L 4K3HA 1I75A 1R5IB 4ZUSA 5J7CC 4BSVB 2E7HA 5GJTL 4K3JH 3CIQA 4PD4J 5IIEA 3U9PL 3ILQD 1Q1JL 1AQKH 1GGIH 3QDJB 4YWGL 2DQDL 4G80A 3OAYH 3RVXC 4CU7A 3DUSA 2J1KA 1HHJB 5J1AA 4QGYA 5FHBL 3KHOA 4YO0B 3HAEA 3N1QC 1N7ML 3M1BA 1T1ZA 2FX9H 3STZA 4HKZB 1A7QH 3OB0H 4O9HL 1EFXB 2VXQH 4O51A 3VG0L 8FABB 3B8SA 5FXCH 3OWEA 1OQXA 2W0FB 1IC5L 1WLHA 1ULVA 2VISB 5LAXB 2X89D 4ZQKA 2VWEE 3C5SA 3DV4A 2BRRH 2DWDB 4LPYA 2ZUSA 1U8NA 3B9KB 2EH8H 1NC2D 5AZEH 4K3GA 4Q9RL 4PJ8C 3LKOB 2A83A 4F8QA 1CXKA 1QA9B 1ZLWK 1ZT1B 2F54A 5BV7C 3GBML 5FYJE 4MNHB 3UTSE 4DZ8B 5CSZB 4ZXBB 5F1IB 2X1PA 4H1LH 4ZS6D 5MI0B 3Q6GH 5C09B 3DARA 3G6JA 1OT1A 4URTB 5EORH 1SJHA 1YN6A 2W65A 4KHXH 1E6JH 4GRLB 4PYGA 1Z5LB 2Q8BL 3H7BB 3GSVA 1LP9E 1UKQA 2OTUA 2A2QT 1A9BA 5DJCB 4LU5L 3DX7A 2X4NB 3IXAA 2H32A 5I1JL 5SX5K 2OJZL 2Z91A 3B8YA 4RZCA 1C5BL 1MJ8L 4R9HA 1WTGT 1M71A 4P59H 3EFDH 2IH1B 1TIUA 4WFFE 5I8EA 2UYLA 2VZ1A 4C57C 4XZUA 1BBJB 4TUKL 4WTZA 2Q87A 3C6SB 1VESA 1IGTA 4M7JL 4Y16C 2E9WA 3DETC 4WO4A 2H6PA 1RZIA 3QPXH 2HT3C 5ISZB 2VH5H 1IFHH 1P4IH 2R0KL 1TVBB 2ADFL 3IDNB 4YZFE 1NGPH 4OKDA 4P9MH 3BP7A 5FGBA 1TETL 3PQYD 3SDYH 1OAQH 1DJSA 1J5OH 5ACMA 2ZSVA 3FN9A 1ZVSA 5DJXB 4YXLH 3V5HB 1FYHB 4HH9B 3CX5J 4LAQH 4PLJD 3JWDH 2DQGH 4EN3A 3MA9H 4DZBB 2XRAH 5I1CL 5EU7E 1BD2D 4ONHA 5SWQA 3QULB 3BGFC 1G6RL 4H88H 2EKJA 4G6KH 1LNUB 3VXOA 1YPZA 4RX4D 5A16A 1QYGL 5IMLB 1X5LA 2NR6C 2DLEA 4XMPH 3OL2A 5ANMA 2BNQE 5HHMD 2MCPL 3MXWH 1E6OL 3TNMA 5DHVB 5KS9E 3S36L 2VZUA 3LD8B 4NT6A 2R2HA 4KK5C 3ZKQD 3B5HA 1LO4L 3VFPA 1MRDH 2FJFB 3K8MA 3GSNB 3IS0X 4LAJH 4YDLB 3BKYL 3MRIA 4IOFC 4LPWA 5FOJA 2DQEH 1DP0A 4CAGA 1M1SA 2IANA 1ORQB 3D2UD 5E2UL 1I1AD 2HFFB 4L8CA 1RJCA 3ZLQC 5CZXD 4M1CD 4BSVA 3L5HA 3UTSB 3JV0A 3KJ6H 4O2CB 2V7HB 3QDJA 1N5AB 4HWBL 2I26N 2NXZD 2JCCF 4NO0B 1BBDH 3K7UA 1RZ7L 1KCLA 1LP9B 3CFCL 2EE6A 1HHJA 5KSUB 5F1NA 2HKHH 4HCRL 4YEEA 5INCB 1FVDA 4R7NA 5M94B 2MQCA 2WUCH 5CSBA 4FFVC 4HKZA 3UZQA 3RJDA 4M1DH 4G42B 4TSAL 5D6DC 1J1PL 4FQ1H 1Z2KA 1PG7W 2VDQL 5T1DH 2W0FA 5KANG 1LEIB 3T09A 1A6TB 2VISA 4PJAA 3DVNB 3UYOD 4XP1L 2IH3A 3DRTA 1ACYL 3MCLH 1UEYA 3QH3B 4WFGE 3UROR 2DWDA 2NXYC 4NHUA 4UV7H 4X5XA 1IC4L 5C0NC 3LKOA 3C2SA 1K3IA 1QA9A 1U8JB 1RZ8B 4LDEB 4MNHA 4PFEA 1I8IB 4ZXBA 5HYJE 4W4OA 3VD9A 3CSYB 5KAQF 1BREA 3ZKSD 4BUGA 4LARL 4NWTH 5ALBL 4X5LA 1T7YA 3AMLA 5FB8B 4F33B 1CXFA 3I3EA 3VFSB 1FAIL 3O6KH 1AQKL 4JRYE 5GS1C 5F9WB 1CR9L 5DJCA 2J6EH 4L3EA 4BQ6A 1JK8B 1T0MB 4LHUG 3SQOH 2CIKB 1BZ9A 1KEGL 1AO7D 4QYOA 4WW2F 5IOPB 3QUXB 5EA0H 1FORH 4V2BA 3BP4B 2OX5A 2IH1A 5FECB 2I24N 3RGVD 1EA9C 2IPTL 3WFZA 1AQDB 2C4FT 1BBJA 3EHBD 1LHZA 3C6SA 3GB7A 3TM6A 1A7QL 3TN0B 3HCVB 3QIWD 5BS0E 2BNQB 1CD1B 5KS9B 1JF5A 1L4IA 3QDMA 2MTPA 5F7YC 3V6FB 2OSLB 3DRQB 4ESKA 2EH8L 3F5WB 4P57B 4D3CH 1UZ6F 5C6TL 4MZ2A 4PLKD 4KQ3H 4NKIH 5DJXA 1JNNH 1OWWA 4HH9A 1E4KC 5EORL 3MRRB 1T5WA 5K9KA 1E6JL 2B8OT 1LDSA 1F97A 3GSQB 4N0RA 4EIGB 1KEMH 3MBED 2YPLE 2XFXB 2X4UA 5LGJB 4RGOH 2ITCA 2Z93B 3QIBC 3QWRA 3TJEL 2OL3B 3FT4B 2MWCA 3SE8H 3L95A 1G0YR 3BN9C 5GJSL 4HT1H 3MROB 3HG1E 2PTTA 4P23D 1C12A 4BKLA 5CJOH 2BDNL 4EUPB 3EFDL 3MACH 5JPNB 2FJFA 3GSNA 2AJ3A 3IDJA 4APQB 1HIMH 4AIXA 1IAOB 1NUNB 4EI5B 1PEZA 2HFFA 4YGVB 5T1LB 2VZ3A 5TH2B 3TF7C 1DQML 2JJTA 4Z7NF 1ZE3C 5BZWB 2HTKD 1IFHL 5I6XC 5DSCB 4E41E 1P4IL 3B5TA 2V7HA 5HYJB 4KKCC 3B5GA 5D5ME 5T1KB 1NGPL 4KI5C 1EJOL 4F37K 1BVZA 4MCYB 1OAQL 1TTUA 1KELH 5F6IB 2D3VA 2NY2D 4RWYH 1K8IA 1LP9A 3OKYA 4JRYB 5E2TH 3O41B 5INCA 2VSDA 2XA8H 4HLJA 4N9OB 2DQGL 2FECI 3V9FA 3MA9L 3O8XB 2JJSA 5B39G 2XRAL 4K7PY 3PWPE 2KUTA 1GC1L 4LFHG 4WUUA 3BD3A 4HWZA 2OM5A 1CF8L 2HT4D 3L3GB 4KJQC 4H88L 4JFED 1LEIA 3EO1B 1A6TA 3OX8B 3LMJH 3DVNA 5C0EB 1UYWH 3QH3A 4G9FB 4MQXD 5BS0B 2CH8A 5FV1L 2ERJC 3MXWL 4OM1H 2BNUA 3DO7B 1U8JA 1WZLA 4DEPC 1RZ8A 3EDJA 1MRDL 4Z0BH 2AJVL 1OP5K 3ZDZF 4YDJB 3KJ4B 3RWGA 4BFGA 5GSVB 2DQEL 3CSYA 3GRWH 2R1YA 5FB8A 4PRID 4ZUTA 3T0VA 3IYLW 2XTJC 3VFSA 2F8VA 2Q7NA 3GMMA 2DJ4A 3EKCA 2BVPB 5T3ZD 4CN1A 2XKUA 3KJ6L 3QCVL 1GZQB 1CT8B 1RD6A 1FL3B 5JHDD 3GMQB 1JK8A 4JFHD 5JA9A 4A6YB 4F9LC 3T4YB 2DKUA 5IOPA 3QUXA 4OLZL 3HNTL 4TTDD 4XVSH 2YPLB 2MKLC 4P5TB 2QHRH 2GITB 2HKHL 4XX1G 4Y4FC 1L7TL 5FECA 2AEQL 3H9SE 2DQTH 4YBHA 2WUCL 3O4LD 4L29B 4R4NC 3TN0A 4UT6H 4FQ1L 3RTQD 3HG1B 5T1DL 1CD1A 5KS9A 3MJ8B 1Q72L 1SEBA 3D85B 4AEHH 4LHJB 3CXHK 4U1IA 4ZAKB 1RUAH 4XP4L 5HYQB 3NAAH 2VLKD 4U1JB 1S9XA 4P57A 2G9HA 5JOFB 4JZOA 3K8KA 3FQWA 1OAXH 3ZTNL 4FNLH 1CGXA 1YNTB 1HHIB 4U1HA 2FX7L 1HINH 5F70A 1DN0A 3PDOB 4E41B 1ODAA 5GIRA 4NWTL 3QHFH 4X4ME 1AY1H 5D5MB 3MRRA 1BWMA 5CJQL 3WFDH 5DGRA 3GHBH 5KVEL 1MCFA 4NQEE 5D4QA 2JB6B 2DMBA 5LGJA 3VI4E 1MQKH 5HHPB 4HQQH 3CK0H 2Z93A 3SQOL 5CUSL 2OL3A 3FT4A 1RIVL 2H9GB 1IGFL 3PWPB 1KGCD 1W72H 4FQ2L 2X05A 3MROA 4NBXB 4C83B 4MSWA 4UINH 5C8JB 2RR3A 3G6JF 5HI5C 3IS1X 5HHXH 5EC2B 5JPNA 3TYGH 1EH9A 4POUB 5HYSG 1DQDL 3S6CA 2H1PL 1JFQH 1X5XA 3W82A 5E8OB 5T1LA 4R0LB 5TH2A 5KSAA 2ZCKL 1S7QB 5F6HI 5BZWA 4HWEH 2N1KA 5DSCA 3OAUH 5HYJA 3ABZA 3BUYB 5T1KA 3I84A 4I0PA 2J5LC 4D3CL 2NY1D 4MCYA 2XWTB 3OB0K 4KQ3L 1U8MA 4JRYA 4NKIL 4NN6C 3RWJA 1SEQL 1H0DB 3G5XB 3HE6C 3MV8D 5IFJB 2VDKH 2GFBA 3O8XA 1D5XB 1GAFH 4HC1H 4QOKE 5J89A 3L3GA 4BUHA 2LV4A 5D1QB 5I19H 3OMZA 1MCNA 5FDWA 2K7PA 5SWSE 2ED9A 1FZKB 2Q20A 3H9SB 3JWDC 3OX8A 1KPUB 5C0EA 4RGOL 3BUTA 4PP1D 3B2VH 3SE8L 2DQIH 3AM8C 3QQ9C 4XX1E 5J56B 3QB7C 4HT1L 5DEZA 5HXMA 1UB6B 1KF9B 3K46A 3E1F1 3MACL 3VXQB 5IM7B 3C5ZB 3WXWH 5I8OH 4N0FB 5DMYA 4J2XA 1UKSA 2VLMD 4YDJA 2COQA 2VUOA 4POZD 5GSVA 1BZQK 5EOQH 3VW3H 4LLQA 2DDQH 4ELME 1HIML 4LBEB 3I6GA 5DTFB 4CJ0A 4GRMA 4YHNA 3BPNC 1J86A 3CGTA 2BVPA 4KROC 1GZQA 1CT8A 2XKNA 4EKXA 1FL3A 3WN5B 3GMQA 3REVB 1IAKA 3ARDD 4LCCA 1NBVH 3WFHB 3T4YA 3U9UB 2BZDA 4J4PC 2YPLA 2D7PA 3LN5B 5CIPH 2GITA 2P5ED 5E2TL 5GS2D 1HSAA 3OBAA 2FBJH 2VZTA 1FRGH 3L5WA 1RZKH 3WDHA 4Z78B 4L29A 4HF5L 1KCUH 3ULSA 4XNMB 3IXTB 3Q48A 1KLUB 3D85A 3BISA 4I18C 1ZS8B 4U0RB 4GBXC 4YFDB 4JRXE 1ETZA 3H3BC 5F7DB 4ZAKA 5HYQA 1UM5H 4PRNB 2QQLH 1A7PL 5GGRA 3ARGD 2V5SA 4OM1L 5JOFA 3ARBC 2YK1H 4L5FH 2Y5TB 4MNQE 2HRLA 1YNTA 1B4JH 4L4TD 4YHIB 4Z0BL 3JXAA 2CKNA 4JZNA 3PDOA 4NBYB 4P2QE 3GRWL 4MD5B 1NCCL 4K8RD 1HXMB 3QNZA 5D5MA 3GGWB 4PJAF 4FQCH 3FQRB 2B5IB 5C7XH 4LF3A 3DV6A 3HTLX 4GRWE 1K85A 4Q9QH 3TPUB 1WK0A 4NQDD 2C3GA 4G8GE 4P2RE 2B7DT 5C0AA 5HHPA 4WHTB 1ZK9A 4Y4KB 4Z6AT 3FJTA 5K33A 5TPWH 4XB7A 3S97C 1LGVA 2H9GA 5LQBL 5C08D 3I3BA 4QOKB 1IGYB 3LS5H 4LHUA 4XNZC 3DGCR 1J8HE 2QHRL 3EFFB 4U6VH 3SHSA 3TBWB 2HJFB 1R0AL 5SWSB 4MDIA 2CDFB 2DQTL 2NY7H 3VGAB 3V5KB 2MNUA 4JKMA 1I3UA 2GHWB 2DL2A 4UT6L 4Z5RA 1I9EA 3VXTA 4X6DE 2YXFA 4AEHL 3KLHC 4R0LA 4WU5B 1PX3A 1S7QA 3QUZA 1RUAL 2VR4A 5CZKA 1TXKA 4ELMB 3BUYA 4MJID 1FNLA 4N68A 3S3JA 1OAXL 4S1SL 3WFCH 2XWTA 5GRYA 1HINL 2QHLA 3TNNB 3MC0A 1H3TA 3U30C 3UJJH 1UWGH 5GGRY 4WI5A 2CO6B 1H0DA 4OGXH 3QHFL 3G5XA 5IFJA 2ZCHH 2B4CH 1LK2A 3VMNA 4LLDB 3DECA 2LTQC 4OCNC 5DVMA 3DI2B 5D1QA 1HNFA 1JZ4A 3H9SA 1FZKA 1MQKL 4FQLL 5I18H 4HQQL 1KPUA 1KB9J 4MYWB 2MJWA 1IZJA 1WC7B 1W72L 3NCCB 1D5ZB 4HIIB 4UINL 1P7QB 2CDGB 3L3HA 2RIKA 1KN4L 2C7UB 3BSZH 4TULH 4KUCD 2JELH 2NXYB 4YHMH 3VXQA 5IM7A 4JRXB 2VYRE 1GOGA 4N0FA 4PJ8A 4PBXA 4NN7B 5DJAB 4V1DB 4Z7QE 2OTWB 3NMEA 4D9RD 4A6YL 1JFQL 3UBXG 4MA1B 1VACB 4LBEA 3BQUD 3KWWB 1F4WL 2FL5B 5J11B 4MNQB 4U31A 5JQ6H 1YEIL 4H1LG 3D39A 3RWEB 3ZKXC 4KVCL 3VWKB 1HHKB 4P2QB 5ETUB 4KQ4L 4PY8I 3REVA 3RVWD 2R0WL 4ODTL 4PV8B 1M7IB 1OW0A 3MRHB 1OTTD 4MAYB 5DJDA 5CBEA 1MHCA 1U42A 1JHTB 1ZWIB 4GRWB 5IEHA 4NYLB 4YDVB 4LL9A 1F4AA 4QXGL 3FT3B 4S10A 4G8GB 3LN5A 4NQEA 1N4XL 3QPQD 5K9JH 4DTGH 4MJ2A 2VDKL 3ISWA 1G7QB 3GKWH 1S7RB 1GAFL 4NWUH 4X4ZA 3E3QC 5EC1B 1MFBL 4HC1L 4P2OD 3IXTA 3UTOA 3P30H 5D9SA 1J8HB 5C6WH 5B39A 1ZS8A 2Z8VC 3WSQH 1KJVB 3AS1A 5F7DA 1NCDH 3JUZA 3KPTA 4PRNA 3NIGE 4ISVA 2NY5H 3L7FB 4NJAH 4RAHA 4D9LH 2VXTH 4X6DB 1P9MC 1K5NB 2A77L 2Y5TA 5D1XB 2ESVD 4XXDB 3WXWL 4M4PA 3TZVC 5I8OL 3RIFF 4OBRA 3PWVB 3T2OA 5HHOD 4MZ3A 4MD5A 1HXMA 1YMME 1FVEB 3KPPB 5EOQL 1F6LL 4JPWH 3FQRA 4H25B 3UXFA 2AERT 1Q9OB 3TPUA 4MCZA 4AH2B 4Y5YB 3BZEB 2PYEE 5DRZA 3LOWA 4M7ZC 4WHTA 4Y4KA 3QO1B 3F7VA 1NBVL 5T3XD 4JDVA 2Q8AH 9CGTA 5JDSA 3MGTB 3MCG1 4QWWC 1UH2A 3QIBB 1IGYA 4LPVA 4Y1AA 3SKNB 4YZFF 3AMKA 5TDPB 1PZ5B 2HJFA 3P9WB 2CDFA 1CK0H 4M5ZH 4L8SC 3ARFB 1RZKL 3S36X 1UT9A 2P43B 4PJ5E 1HCFX 3S7GA 3IJYA 1QSZA 1I1YB 5A2JH 2JE8A 1T22A 3WS3A 4WU5A 2YZ8A 5FDYA 1UM5L 4W6YB 1AKJD 1DBMH 4YBQD 4ELMA 3IJSA 2VL5A 1YMHB 1WICA 2YK1L 3PP3H 2X4RA 3RY6C 2Y07H 1K3ZA 4ZSOE 1B4JL 3DXAE 1H8OA 1MAML 3TNNA 3DX6B 2F5AH 1RY7B 4FQCL 2XZQH 5C7XL 4UT9H 4K07A 4Y4HD 1OTUC 5JIPA 1RVFH 4PB9H 4LLDA 2BX5A 3K74B 5IVXF 3V79C 5D6DA 1FC1A 4OQ1A 3O9WD 2Z8WC 3KPOA 3TA3D 3X3GH 4JREB 4XHJC 4HH8A 5TPWL 3PJSA 4YPGB 4PJCE 1ZANL 3F8UB 4PGBA 1XGQA 4QCIA 1D5ZA 4L3AA 5CJ8A 1RMFL 1PSKL 1SYSB 2EO9A 2CDGA 1BWWA 1G9NL 1YA5A 2CMRL 3WIHH 5GZND 4PTTB 4AEIH 3CSGA 4JRXA 5DJAA 4ZOAA 2OTWA 1WBYA 4IRZH 5JW5A 2C4FU 1MJ7H 4NUGH 1UXSB 5L9DH 1Q38A 2CKBH 4ALAH 3KWWA 5FK9B 5DVLA 4KVNH 2FL5A 3W0WD 5HYSA 1RFDL 4MNQA 4PGDB 2DQHH 2NY6B 3VJ6B 3RWEA 4MD0B 1HHKA 4P2QA 5ETUA 3VI3E 1YMMB 2QQQA 4PR5B 5KSVB 3LSOB 4G8IB 4X7SH 2E6PA 4PV8A 4MAYA 2HFEA 4ENEC 5GS1A 5HTSA 3WFCL 4UTBH 4YDVA 5FYKD 3FT3A 2CGRH 2O5XH 4G8GA 1TZGL 4P2RA 3UJJL 1UWGL 4LEXH 2BY3A 2PYEB 4OGXL 2NY4D 3GSRB 4M03A 3H9HA 4LLUB 2B4CL 2O61A 1G7QA 5TQ2H 1GHFH 5EC1A 1G7IA 4KPHH 3N50A 1J8HA 3UO1L 3B6SA 1OGTB 2D9QB 4CMMA 2RFXB 5I18L 1KJVA 5BW7C 2YBRB 4JFFD 4FOMA 4PJGE 4PJ5B 4YDKH 4X6DA 1QFWM 2HWZH 1E4WH 3CNKA 3U7YH 3VXUD 4YHML 4W70A 4XXDA 1HI6B 1S7XB 3V52L 3U0PB 1A3LH 2ZG3A 3U0TB 1P4BH 3IB4A 1FVEA 4ACPA 1XAUA 4HUWB 4QF1B 3QO0B 4X7FC 2DQUH 3U2SB 4H25A 1AI1H 1Q9OA 4ZSOB 4DGYL 3DXAB 3QEQD 5E2JA 12E8H 1M7DB 4OLXH 4Y5YA 4LGRB 3BZEA 3NH7H 5DQ9B 2R0ZL 5D7JB 3BMWA 4MQ7B 4GXVL 2QQKL 3QEUB 1HQ4A 1T03L 3SKNA 3QIBA 1NSNH 4YXHH 1MI5D 1JZ3A 1PZ5A 5F96L 2HKFL 1EGJA 3BEVA 5DYOB 3ARFA 3OR7B 3KXFD 1X6LA 5BJTB 5J4MA 4PJCB 4QXUL 2SEBB 1O5DT 1UC6A 3GKWL 4CADB 3ULVH 5ICYB 2IEPA 5F9OH 3P30L 3CFJB 1U91A 3C6LC 5ICXB 1RZKC 1JCKA 1NCDL 2CLVA 2OXGA 5CGYD 1VEMA 2X4PA 2NY5L 2F8XC 4NJAL 4U3XA 3WYRA 4D9LL 2BFVH 5M95B 1FP5A 3O4OC 4Z77B 5JNYB 2ARJB 2HJLB 1MCSA 5JW3L 4XNYL 2Q3ZA 3DX6A 4QNPF 1FIGH 1ZT4B 1SMAA 5IVNA 1TQCC 3EOBB 4P4RB 1GGUA 4JPWL 4RMVA 5FO7B 5IT2H 1A6VL 1T3FA 4OZHE 2ZUQC 1TNNA 3DIFA 3F7YB 2NTSP 4B50A 5EZJA 2AKRB 5ESAB 1QFPA 3FHAA 4DFHA 1U92B 3UTTD 4JM4H 2VZSA 4XGZB 5I71C 1WCBB 2DQFA 4Q2ZB 3CMOH 3RI5F 4XCYB 5CCKH 2Q8AL 4I8DA 2I5YL 1SYSA 2V9TA 5CJ5A 1KIRB 3QG6B 4PTTA 3ZYIA 2BJML 1CK0L 1OF2A 1NLBH 3MZTA 4ODWB 4QY8B 3RL2A 1VGKA 4AT6A 1U8LB 1Q9LB 4GAJH 1E27A 2ENSA 4NBZB 4OZIE 1UXSA 3L5IA 5FK9A 1NCUA 5E6IC 4C4KO 3WIIL 3VJ6A 5IB3B 4P5KB 4TSBH 4OZ4B 3QDHA 4MD0A 4OIIH 4QRUB 1ND0A 1SJEA 4I0KA 4Z7UE 5DDHB 1YMMA 4K23H 1U3HB 5KSVA 4YBLB 2BSTB 1NKOA 1MFEH 4IRSC 1EIBA 1VADA 4TOYH 3HN3A 3QI9D 1VDGA 4UIKH 3QXWA 3RDTD 5IQ7H 3NCBB 3N1MC 3Q6FB 4F9LA 2JB5H 2HTLC 1UA6L 3GSRA 4LLUA 4QO1A 4UT9L 3T2QA 1CICC 2DYPD 1FDLL 1RVFL 2F8OA 3MXVH 5DF0A 3MRGB 1E4XH 1C5DB 3EJYC 1FGNL 1H3WM 2IPUK 2EDLA 4PGJA 2B4CC 3C8DA 3EGSB 4PJXF 1N64L 4PJ5A 3QDAA 1XF4B 2OI9C 1AGCB 4GFTB 1HEZB 5T3ZH 3WIHL 3PGCB 1LD9B 4YK4C 1JGLL 3PL6B 1HI6A 4AEIL 1IQDB 1S7XA 1X5ZA 5MEQA 2P8MB 3U0PA 1VGEL 4NO3B 4JFPB 3U0TA 4IRZL 1I7ZB 3VXRE 4NUGL 3QO0A 5L9DL 2NW2A 3ILQC 3DBXA 3U2SA 4CMHB 3VD5A 4CRPA 5MP6L 1UH3A 4MB3A 4KVNL 3HS0B 1HN1A 4KFZC 1D6VH 2DQHL 4ZSOA 2ZCLH 3MV7D 3PP4H 5E95B 3DXAA 5I74B 4OFYA 3MRQB 3VXSD 2D4DA 1H3PH 4N90D 5DT1H 3S5LB 5DQ9A 4BZ1H 4EDWH 3CMGA 4X6CE 4GMSH 2WWMD 3CC5B 4X7SL 4OZHB 4R6UA 3P4NB 3FB7B 3WHE0 1EO5A 5EIQA 3THML 4J6RH 4OFVA 4UTBL 2ZJSH 1Z0MA 3GIVB 2CGRL 2O5XL 4MB4A 4XWGL 1K9TA 4M93C 1A64A 5GQBA 4F8TA 1MWAB 5I1KL 4PJ7F 1G0DA 2QR0B 3MPCA 4RMUA 5BJTA 2SEBA 5TQ2L 5ICYA 2B0SH 4KPHL 2A6KB 3K8LA 1I7RB 3VXMD 3BJ91 1HE7A 1FYTD 3MTRA 3RFZC 1V7MH 5J1SC 5JO5B 5ADPL 4WEUD 1U41A 1QRNE 1F4XH 4WI6A 3X11B 2ARJA 4X0KB 4OCRH 2HJLA 1E4WL 1MLBA 4ODSH 4PPTA 4ZS6C 4GMTH 3U7YL 2D0HA 1U8PB 2NY5C 3C8KB 5T5NG 4ZFFB 1I4FA 1KXQE 2Y9RT 3L3KB 4Z7UB 2XXMB 3QUKB 1CLYH 5FV2A 5DVOA 3EOBA 4HUMB 4I13B 4P4RA 2DQUL 5E5MB 4JN2B 1FZJB 1AI1L 2HH0H 1WCQA 2FH6A 3TBVB 2ADGB 4PRDB 2EC9T 5ESAA 3EZJB 4HUXB 1U92A 4OI9A 4F2MB 2FGWH 2IBBA 4N1HB 3NH7L 1XGYH 2VC2H 1ZTXL 3M07A 1VCAA 3OF6A 3ILPA 4X80L 3MLTA 5E00A 4A2LA 4JFOB 3FAXA 1NSNL 1VPOH 4OT1H 3C5JB 1BLNA 3QG6A 2WIIB 3SGEH 3AM8A 3BX7C 4C56E 1P7KB 2DF3A 4ODWA 4Q97A 4QY8A 1CBVH 3BDYL 4PJGA 3BRFA 5ITFA 3ULVL 4AM0B 5F9OL 2P42B 2R2BB 3WCYA 1DBAH 2GK2A 4PRAB 4OLYH 2VAAB 5IB3A 1TJHH 4QRUA 5L2KD 2FX8H 1FO0H 3VXRB 4JPVH 2BSTA 5ACLA 2BFVL 4ZFOL 4BQ8A 3GDBA 3QJFB 3GMOB 4ODXA 4PLJC 3Q6FA 4PTUA 4EQ2A 5BCAA 4OGYH 2ORBL 5DMKA 5DVKA 1WGOA 4X6CB 4OD2A 5BVPH 5L7XL 1IT9H 1QFWI 2R0LH 5DR5H 4H8WH 3MRGA 3VWJB 1NL0H 2W1NA 3OAZH 4JM4L 4XVUD 5MEPA 2I9LB 3U4EB 4AK1A 4K7FB 1ITBB 4QXWA 3FFCD 4GBXA 1XF4A 1AGCA 3HUJF 3EBAA 3PGCA 1LD9A 5B4MD 1BQHB 4JR9H 1QFUL 2IFFH 2IMNA 3PL6A 1FFNB 4Y19D 2EDRA 1NLBL 4LSTH 4J1UA 3ARBA 1D9KB 2P8MA 3SKJH 1I1AC 2FEDD 4NO3A 3P0YH 5CZXC 4M1CC 2VXVH 1I7ZA 1EO7A 1ZHLA 1OPGL 2BHYA 4M6AA 5IGXH 2OMNA 3HS0A 2R9HD 4DUVA 2XZZA 5GS2H 2NXZC 4B7IA 4TSBL 4MA8L 5E03A 1AFVL 3IT8D 4FZEH 2QSCL 5D1ZD 3SDDB 4L8DB 3S5LA 3RVTD 1WSST 1H8NA 4H20H 3CC5A 2N7BA 4PRHE 4OZHA 3P4NA 3WUZA 4TOYL 4RGMB 5CKGA 3JTTB 3SO3B 5A40E 4HKXB 4XNUH 3GIVA 3RP1A 1ZA3A 5IQ7L 2FO4A 2JB5L 3PXJA 3RZCD 1MWAA 3HRZB 3LRHA 4IM8A 3UJTH 4P4KD 1JNLH 4TQEL 2J6EA 4GAYB 5HHQB 2QR0A 3T77B 3BRGC 3GJFK 1BJ1H 2PTUA 3KNBA 3MXVL 1N6UA 5TQ0L 1R3KB 4LP4A 5SWZD 2A6KA 4C56B 2E9BA 3PP3K 5F3BB 2XWJB 4K8RH 1I7RA 3I6LD 2H8PB 4OCSH 2VJXA 4XCNB 2VKWA 5JO5A 4OCYL 1A1NB 4OZIA 3QRGL 4R97C 3X11A 4KTYA 4X0KA 1MHEA 2IGFH 3ROLB 1U8PA 1NC4B 3C8KA 3H42L 4DGIH 3L3KA 4Z7UA 5ESQB 1AJ7H 2QL1A 3VDBA 1NMCC 5E5MA 5DFWH 5DGQA 3KHQA 4Q6IC 5E2WH 1D6VL 4F37F 3IAGC 2ZCLL 3TBVA 2ADGA 4OF7A 4PRDA 2I60H 3KAAA 4HUXA 3QUYD 4F2MA 1H3PL 3U36B 5DT1L 5A2FA 1R24B 3W11D 4KKBD 1FPTL 32C2B 4L4VE 3RGVC 2PW2B 3O3DB 4ZYKB 1NFDE 4EBQL 3EHBC 1NMBH 1ADQL 3QIWC 3GSXA 2ZG2A 1TMCB 4D9QD 5ID1B 1DUZB 3KYOB 5B3JF 2B0SL 2OQJA 4P46C 4TPRH 1MLCA 3ORJA 1HHGA 4PRAA 1ZHBA 3MUJA 2EEBA 3ALWA 1QSFD 4NNPL 3ULVC 4G8FA 3TWCH 5E7BA 3VXRA 5SX4I 3WNOA 4YHKH 2D31A 4PLKC 2QADB 3PGDA 4UOW1 4OCRL 3QFJE 3QJFA 4XVTH 3U48A 4IBLT 3GMOA 2GQHA 5DK3A 1DDHB 4AENB 5I1DB 4X6CA 2A9NH 3KPRA 3OKMA 4GH7B 4PRHB 4TUOB 3MBEC 1MY7A 3GIZH 4RFEB 4ZOEA 3VWJA 2AJZA 2FGWL 3O6FB 1GRWA 4NP4H 4YFLF 1XGYL 4LVEA 4P23C 2I9LA 4BH8B 3T3PE 1MCLA 3U4EA 3NACH 4KI5F 4K7FA 4H5SB 1KT2B 5JOPD 4BZYA 1XR8B 1CDUA 3NBNA 1VPOL 4OT1L 5CFHA 3FB6B 1QVOA 1BQHA 3SCMD 1WFOA 1CBVL 3RA7L 5E56A 1D9KA 4LVOC 2FD6H 3MFFB 2VQ1A 4WJ5A 3EO9L 3TZVA 1U8OA 1UQSA 2FGZA 2HTKC 1FL5B 1QRNA 2X4OB 1DBAL 1RPQA 2AI0H 4H0GA 4OLYL 4HBQA 5I1AB 3CFIC 4G6JH 4JM2D 4FFZL 4J8RB 3VU2A 2ZUTA 3MUGB 5B8CC 5FM4A 2FX8L 3SDDA 1FO0L 4YIQB 5C0RH 2NY2C 4WUKH 1KG0A 2R4RH 3CLEH 3JTTA 3MRFA 3SKMA 5IESL 4HKXA 4AY0A 4W6XB 3I2CH 5CP7A 3UTPE 4O5LH 4F57H 1B2WH 1OAUH 2VDLH 3CH8A 4GAYA 4WFHD 1CFNB 4L4VB 3CDGB 4PJ9D 2R0LL 1DQLL 4YHLH 5DR5L 4H8WL 1NL0L 1CFSB 4U1GC 4ODHH 3MLXH 5DJ2B 4MQXC 4LCYA 5F3BA 4NFDA 4OF6A 3RBGA 2H8PA 3CSPA 3WDIA 4XCNA 2O5YH 2EECA 2G75B 3HMWH 4BZ2L 4JY5H 1QKZH 3E6FB 1I7TB 3CFBA 4PJDE 4JR9L 2IFFL 3QIUB 1CFQA 5C92A 1V3JA 1RQ5A 1NC4A 5I15L 4UI2A 4RA3A 4W81A 4Y16D 4LVHC 3P0YL 5T3XH 4FQJL 3BD4A 5IGXL 4NNXB 1XZ0B 4LEOA 2XYCA 1EVTC 3QFJB 5IF0B 2KDGA 2X9YA 3E6HB 1NAMB 2QQNL 4FZEL 3PUCA 3U36A 2KBGA 1A3QA 2WAHA 4H20L 3CU7A 4JFYB 4PG9A 3SKOB 1KJMA 2PW2A 3O3DA 4XNUL 4ZYKA 1OSPH 5E6ZA 2CK0H 3RTQC 3UJTL 4XI5D 4KRLB 1NBQA 4HBCL 1INQB 4OZGE 1DUZA 1CXEA 4G6AD 5EZOH 2UWEE 3LQAH 4X8XA 4UDUB 3ELAT 4K8RL 4M00A 4XMKH 5JW4R 1S7TA 5B38G 1NCTA 1QPPA 2IGFL 3P40A 4KRNA 4IOFD 4Y88A 1R6VA 1EEQA 5DJ0B 3QUMH 1XF5B 1DDHA 5EZIH 3GUTB 4OI8A 4AENA 5I1DA 2HT2D 4PRHA 4TUOA 2GIYA 4N8PA 1J18A 2AK4A 2VL4A 5E2WL 3NFNB 3P9MB 4RFEA 4LCWB 1QBLH 2BSSB 5IMKB 1CXLA 4R2GD 4LSVH 1I3RB 4FTVA 1A22B 4IRJB 3S4SG 1QLFB 2JK5B 3SOBH 1N2RB 4H5SA 1KT2A 3ET9F 4KZDH 5DLMH 1XR8A 4CVZB 5AUMB 5HHNB 4PRPD 2E7BA 5BW7A 4P0DA 4JCMA 4NM8H 1NMBL 2DI8A 5GISH 1XCTB 3FB6A 4M61B 1W0VB 4FFVD 3I3DA 5DFVD 1YY8B 2YRZA 3FQNA 2JIXB 2X7LB 1FL6B 4YK4B 5DWUL 1T6VN 3EYQD 5KJRH 1IM9A 3QJHA 5FUCE 4TPRL 5TF0A 1FL5A 2XN9E 2X4OA 1Z9MA 3HI5H 4PJDB 3PQYE 3HI1B 1DZBA 4EEEA 4M7KH 4OIAA 1CYGA 4J8RA 2WMPA 3EDKA 3GNML 3U4BH 2NY1C 3EOTH 4WHYH 1N6QH 4GW4A 2PYFB 1JN6B 4KKLD 4U33A 4YIQA 3FRPG 4YHKL 5IW1A 3V0WL 1MNUH 4HS6B 2VZVA 2QJDA 4XVTL 5FYLD 3O11B 4XNXH 4PJGF 4XP5H 4UNUA 1GGYA 1T89C 1KV3A 3SBWC 1MJJA 2A9NL 1QHOA 3IAPA 4F7CB 3RKPA 4PJEA 2NLJB 3V2AR 1CFNA 4L4VA 3CDGA 4P2CG 4LSDA 1AGBB 3GIZL 5JMRA 4GKSB 1XIWB 1CFSA 1NFDA 3FT2B 4DCQB 4IIQB 5HHVL 5DJ2A 2C1PB 1AGDB 3QAZB 43CAB 5I73C 3WNNA 4ORGB 4OZGB 4J3SA 4H8WC 1O7SA 2A6JB 5DRWA 2G75A 4KK9D 1EMTH 2DJUA 1DSFH 1BZ7B 4POZC 2UWEB 2BVYA 2XA3A 4JB9H 2H26A 3P0VL 4U7SA 5JQHC 1J8KA 3HHRB 1NLDH 3B9AA 2R29L 3SDXA 3WXVH 1HYSD 1Z6JT 3SGKC 4BSWB 5GRVL 4NNXA 1XZ0A 4QHNB 2AI0L 2DICA 3QFJA 3MV11 4FABH 2RGSA 5EU6D 4XAWH 3ARDC 3E6HA 5DVNA 4O58H 3STBA 4C58B 1NUGA 4PGCA 4PREB 4QTIH 5DD6B 2B1HH 3EO0B 1FNGB 2LVCA 5C0RL 1XF1A 4WUKL 4KMLB 4OV5B 1KULA 4KTEH 5EU3B 4HFUH 4NOBA 3BPCB 3CLEL 3ARQA 4XP9H 3SKOA 1EAJA 4CVWA 2WWKT 1HDMB 3J8F7 4NIKB 3WD5H 4O5LL 4DGVH 2EE2A 3BHBB 1B2WL 5CINL 3MQIA 3L7EA 5DHYB 4LLWB 2YA1A 2VDLL 1OSZB 3IDYB 1INQA 1HKLH 5DXWA 4HZAA 5HI3D 4YHLL 1KB5H 3UDWC 5D7IE 1JZ6A 4OZHF 5T1MB 5KN5A 4FFYH 4UDUA 5DMIH 3IF1A 1RUPH 2DTMH 2VLJD 1TZHB 2O5YL 4KH2A 4TVPL 1WZ1H 3HMWL 2EDBA 1QKZL 4JY5L 1R3IH 2XN9B 5C0CE 4K8RC 3PQYB 2J8OA 1A6WL 5F6HJ 4KRPB 5TGBB 3MLSH 5DJ0A 4IRSA 3OKOB 3SPVA 1XF5A 5JXEA 3GJFB 3KR3L 3HA0A 2AV7B 4NDMB 4OQTH 3AREB 4OCWH 3JVGC 3H3PH 4J3XA 1AO7E 3P9MA 3Q2CA 4ZO7A 1WWAX 4KKCD 4NO5B 5CD3A 3D9AH 4OZIF 2BSSA 5EN2B 1EPFA 1CICA 2P5WD 4NRZB 1NGXA 4ZPVB 2PKDA 4J3UA 1I3RA 2AQ1A 1NCWL 4IRJA 1QLFA 2JK5A 4Z7UF 2R69L 5I1HL 4CVZA 5AUMA 4ZOBA 5HHNA 2CR3A 1OSPL 4M48H 3VDCA 3EW3B 1HZHH 1XCTA 2CK0L 4UQ2B 4HIEB 1V8HA 4M61A 4LRNL 4F15B 1W0VA 1DBKL 5GGTH 5JW4N 3KPSE 1LE9B 4M9OA 5F7LB 3VRJB 1FL6A 1R5WB 3QCUH 1AGFB 3G5YA 2CUMA 5EZOL 4Y2DB 4PJDA 4DN3H 3LQAL 3HI1A 2AEPH 3UTZB 4XMKL 3VFOB 3TT3H 5ECJE 2F54D 3WEXB 2PYFA 1JN6A 1J05A 3WJJC 4GS7B 4RWHA 5FCSH 3DUHA 2ADJB 3IFPB 2HRPH 3QUML 3LRSB 2FH8A 2NCMA 1BOGB 3CX5K 4F7CA 2BOBB 4M1GH 5F7HA 4OF0A 3LIZL 2R56H 1AGBA 1NPUA 4MGXA 4GKSA 4Y7MA 5EU5B 1QBLL 1J1XL 4JO4H 3V6OC 3FT2A 4DCQA 2WP3O 1IL1A 1B0GA 2C1PA 2NQCA 4JO2H 4LSVL 3A6BH 4ONFL 2X89A 1AGDA 1A1OB 43CAA 4ORGA 4OZGA 1LO3L 5FGCE 2YZ1A 4KZDL 1P7HL 4O4YL 2A6JA 5HVGB 1NC2A 1DCLA 4Y4FD 4X6CF 4J23A 4K3DH 2ATPA 5D7IB 1BZ7A 3IU4H 1E28B 1NAML 2AABH 3HC4H 4W6WB 3BQUC 4WO4D 3RL1A 1SMOA 4J12A 4OLVL 2NY0D 4W68A 4WVRA 4BSWA 5IWLC 3LQZA 3HI5L 5C0CB 1EVUA 1B0WA 3BGMB 1CDJA 2DWEA 4WY7H 4YHOL 2Z92B 4LNVA 3RVWC 4M7KL 4Z7WA 1FCGA 1OTTC 4L3CB 3U4BL 5DD6A 3EOTL 3ZSTA 3EO0A 2HVKA 1N6QL 4NKQB 2CLZB 2VERN 3QZWB 1UB5A 1MNUL 3SDAB 5EU3A 1BEYL 3QPQC 4LIQH 1A3RH 1AO7B 4XP5L 1YZZA 3G5VB 1FH5H 1HDMA 3QXTA 3BHBA 4P2OC 5DHYA 1OSZA 3OXSB 1X44A 5IMOB 1X5HA 1J0HA 2NTFA 5GGSB 3UX9B 1PQZA 4L8BB 1C5CL 2XZAH 5CBAB 5T1MA 3KPSB 2J4WH 3MR9B 5HI5D 1NAKH 5SV4A 1EMTL 1NFIB 1CZ8H 1A14H 1MHHB 1TPXC 2EZ0D 4BYHA 5DJ8A 5HVWA 2MOVA 3PQYA 1J0YA 3NTCH 5DQDH 1RUKH 5TGBA 3ZYZA 4MNGA 5T3ZE 5DUMH 3B2UD 3FCTB 3GJFA 2QSTA 4RDQG 5IKCA 4UAOB 3AREA 5FKAB 2IBZX 4FFWC 3I75B 4OD1H 4NO5A 4O58L 3MBEB 4GW5A 4NFCA 4QTIL 2B1HL 2BY2A 1JE6A 4ETQA 3I02B 4KTEL 3O4LE 4XP9L 1U2CA 5C0DB 2VO5A 1MCWW 3TH3T 4K94H 3MA7A 1D6EB 3WD5L 1EFXD 1J10A 3CFEB 3PGFH 3TCXA 2FZ3B 2AP2A 2PXYB 4RMWA 2GK0A 5EO0A 3HPLA 3VRJA 3H9YA 3OKLA 5IJKC 5FGCB 3LN9A 3MGOA 1FSKB 1HKLL 2ICEB 2VLKE 3CCHB 3SDCB 5IJVB 2PW1B 3D2UA 3N85H 1KB5L 5E8EB 3FO0H 1M05B 4X83A 1I1AA 4Y2DA 3F7PC 4YBQC 2OZ4A 2VLRE 3B9KD 3VG9B 2BNRE 4O2FB 2GT9A 4WTXA 1KIUA 3MOQA 3L1OH 3UTZA 2CRYA 2JJWA 1EHAA 1EO8H 5F21B 4JKPH 3VFOA 3WEXA 5EWIL 4XXCC 2GTWB 1WZ1L 5TFSH 3LQAC 5IR1B 1R3IL 1I85C 2ADJA 4NKDB 3ZE1F 3OKNB 3K2UH 1MVUB 1B90A 4YE4H 2CKBA 4QTHA 5C09D 3Q5OA 1D5IH 3MLSL 3TO2B 3KS0J 3LRSA 2BRQA 4Y4HC 4J3TA 4GRLD 1BOGA 5DEGB 4BK4A 1N5YH 3V7AG 4UUJA 4OQTL 5EH1A 1PYWA 1FLRL 3H3PL 3O9WC 2GJ6B 3HC3H 3TA3C 1WQVT 3NN8B 4ZDHB 4JPIA 3DLQR 2A0LD 4NGHH 1QTYT 3BVNB 2YRLA 1A1OA 2EC8A 4U1GB 5JHLL 2VLLB 2YPVH 1K8DA 5AG9A 4EQ3A 2B39A 5GZNC 5GS0L 3P4LA 1ONQB 4M48L 4OJFH 3MLRH 1HZHL 3JWOH 1LO5B 1DEEB 1E28A 1S7UA 5T5NF 3S4SA 1GCFA 4JDZB 1O7VA 3DURB 4LNRA 4OIBA 3TGXA 2JCCE 5FOBA 3QCUL 4PIRF 1QBAA 5ISZD 4RBPH 1WJ3A 4JGUA 2J8UF 3ULUD 5C0CA 3BGMA 4KUZH 1R3JB 2F58H 1KN2H 3L6FB 4Q6IA 4L3CA 1C16B 2PR4L 3QEGH 2CLZA 1NJ9B 3QZWA 3R8BB 5A2KH 3R06A 3X3FL 4OCLC 5TE4L 3H8NA 1KPVB 3I6KB 1JRHH 4MXVF 4I4WB 1IKNA 1JUFB 4NKMB 1AO7A 2NY4C 3G5VA 2VXUH 1OT2A 3HE7D 3D18A 3H0TA 1MAJA 4M1GL 3O4LB 1YNLH 4DWHA 4XNQA 3WUWG 3QIWA 3UYRH 4K71C 5JZ7D 2BSED 3VGGA 5GGSA 4JO4L 4L8BA 4U1NB 5CEZE 4P9HH 4GO6B 4JO2L 1G84A 3NCYP 2DIBA 3KPSA 1B0RB 5DRNB 3HKFA 3MR9A 5LXGH 1OAZH 1IGJA 1I1RA 1EAPA 1MEXL 2AEIT 4JG0L 1IAMA 4M6OH 1PKQE 1WIPA 1MHHA 3QWOA 5I9QC 4PJEF 5IP4A 3IU4L 3CVHH 4X4YB 2VLRB 2BNRB 4QLRA 4R7DA 4LCUB 2PF6A 2AABL 3KDMB 1NFDF 3FCTA 3QG7L 4Z9KB 1U95B 4JKWA 3E8UH 3UTSD 1SM3H 4E0RB 4WY7L 5FKAA 4G9DB 4P3CH 1XGRB 3BKMH 3I75A 4Z76B 1H5BC 4N0CD 3MBEA 4NO0D 3G04A 5JIHA 1UACL 2P5EE 3VMOA 5MHSE 1MCIA 3TH2T 1W8NA 5I30H 4JY4B 4R8WH 3I02A 2VDOH 3WS6C 3HI6H 3PWNB 3SDXF 1J0KA 1A3RL 3LZFH 2B2XH 2GUOB 2Q76B 4P23A 1DFBH 1MFCH 3MJ7B 4O2EB 1FH5L 1AC0A 1D6EA 1O0VA 2ZOLB 4M43L 2R4SH 3T0EE 3CFEA 3HFML 3T2PA 5BXFB 4NN5C 2ICEA 3CCHA 5TDOB 3SDCA 5IJVA 4PJHE 2PW1A 3BZ4B 2YXMA 1EXUB 1M05A 2XZAL 5CGYC 2W0PA 4L4TE 4O2FA 2J4WL 1SJXA 2JCCB 5GZOC 3PHSA 4FQXB 1NAKL 4KMTH 1CZ8L 2A73A 1A14L 5IR1A 4HHAA 3VD3A 5B8CA 3AB0C 4NKDA 3OKNA 3OKKB 1MVUA 1SY6H 4S1RL 5DUML 4MA3B 4DK3A 3RWFA 3S3SA 3FO9B 3WFBL 3HZYA 5ITBH 1J88A 4LSUL 1YECH 1CXIA 1QBMH 3KLDA 5A2IH 1UJTA 3D0LB 1L0XA 4U6YA 5C08E 4D8PB 3NN8A 4ZDHA 3SY0A 4E9LA 4JFEA 3GEWB 3KG5A 3BVNA 3QUXD 2V5YA 5HGBB 2VLLA 3LEXA 4NZUH 2C4XA 4JFDE 2X40A 3MODH 5H35B 1OARH 1ONQA 4Z7NE 4GOSA 1LO5A 1DEEA 3TN0D 2WLYA 3PGFL 2BNQD 3DURA 3BFOA 2FLBT 1YEJL 4N0UE 1TVDA 1OD7A 2L4OA 4MJIE 1PKQB 3FO0L 2FSEB 4YHYB 5KG9A 4PRIA 2GYSA 4BQ9A 2WBJB 1WV7T 4EXKA 1UEMA 1R3JA 4FXGA 3GHEH 2A6DA 3L6FA 3LQMA 3QI9C 1C16A 1EO8L 3EYVB 3PABA 4NZDA 1NJ9A 3RDTC 1AH1A 4WW2B 5TFSL 5ICZB 2Z31B 1KPVA 2DS4A 2FHFA 2EXYD 5JUEH 3I50H 1JUFA 4NKMA 5C0JB 1PGRB 3K2UL 3VGDA 4YE4L 1D5IL 1FG9C 3OGCB 2DMCA 5L8LB 5CAYB 1PDKA 1Z3GH 2P5EB 5BQ7B 4PJDF 4ODVL 5HYFA 3HLAB 3HMXH 3V6OE 3O4LA 3CPLA 4WRLA 1R5VB 3BRDA 1UCBH 2D7TH 3RTQA 3DSFL 4ZUVB 4U1NA 4ZFZA 3VRIB 4X4XB 1UM4H 3T0EB 1B0RA 5DRNA 4GT7A 2VDRL 4R4FH 4QHUB 3T65B 3MGAA 4QWWD 4RFOH 2VLKA 3ARGB 4AQ1B 4K2UH 1NDGB 3NGBB 1DE4B 4CDHA 2D7QA 4XH2B 3TBYB 4X6BB 5DD5H 2VLRA 4APQD 3BPLB 3ES6B 2BNRA 2WBKA 5C3LD 4LCUA 2CJUL 4EI5D 4AEEA 1CE6A 4EVNB 5D7LD 5CLTA 5T33L 4XPFH 3EOAB 3A6OA 4BJLA 3MYZA 5FA4B 5HYJD 1DQJB 4TUJB 4E0RA 1XGRA 3LEYL 5T1KD 2ICES 4LVNC 5EG6C 4KZEH 3QNXB 1F42A 3GJEB 4DKFH 4YR6B 3HC0B 4JRYD 4L9LB 1JRHL 4MLSA 4UBDD 1BFVL 3PWNA 5F9DC 3G6DH 3E2HB 5C08B 4MB5A 2Y7QA 2E6QA 3BPOC 1MRFH 2VXUL 3O8XD 5EB9A 4OB5L 1Z9LA 1S9WA 5HPMB 1BMGA 1N0XH 4MLIA 5BXFA 5HVFB 2P7TB 5KVFL 4Z7WF 4P5MB 5GGVH 2FJHA 3O3AA 4JFDB 3VD7A 3UYRL 2AJUH 4ZNCD 5TDOA 1C1EH 3H6JA 3BZ4A 5ESVB 4N8VB 5F88B 4PB0H 1ZLSL 4QRRB 4Y5VC 1J11A 4G9FD 3RKDD 5BS0D 5LXGL 1OAZL 2ED8A 3FN0H 1JPFB 2JCCA 3QQ3A 4E5XB 4UT7L 1QSED 5BOPA 2AK1L 1UVQA 4N0UB 4FQXA 5J1TC 1F90H 1YEGH 4MJIB 4M6OL 3TPKA 1S7SB 1FCCA 3CVHL 2DI9A 1RK1B 2FIKB 4JHWL 3W9DB 4OUUB 4WHYG 2AXHA 2EH7H 3SGEI 5CKAA 4X5WB 4JVPA 2AV1A 4F9PA 3FO9A 3O45B 3AC0A 3CXDH 3ECBA 2DQJL 3MRJB 1T5XB 3G6JE 3D0LA 1MCOL 4P3CL 3K1DA 4QT5B 4D8PA 1GGTA 5KZCB 3ARPA 1C08B 4M6MH 5E4EC 3X12A 5EBMB 4Q9BA 1U8QA 2VXSL 3KPLB 2ZG1A 5I30L 3KPQB 2VDOL 3LPGA 4RGNE 2FHCA 5HGBA 3PWJB 4P5TD 3PHOB 1KIQB 4P3WA 3TO4C 4KMQA 4P99A 2F74B 2VE6B 4O9HH 1MFCL 4BQCA 3VG0H 5EO9A 5CHNB 4DOHE 2R4SL 5J8OA 3HG1D 4UQ3A 3D85D 4XBPA 1T04A 4UDTB 3BIBX 4K94C 1FC2D 1JF1B 5FYLH 2EDTA 2FSEA 1JGDA 5E8NB 1Q9KB 5CEXB 2WBJA 3EDEA 5E99L 1JYVA 4Q9RH 1HKFA 1NGQL 4WDIB 1TQBB 7FABL 3IETB 1NFKA 1MCRA 3NPZB 1JTTA 1WISA 1VFOA 4PRBA 3O0RL 3ARDA 4KMTL 4WW2A 5ICZA 1EBPA 4E41D 1NCAL 4PGZA 5CJXA 1QLEH 4NC0B 5E1AB 4IDJL 1IEAB 3OGCA 1SY6L 3PHQB 3VRLF 3AY4C 2Q8BH 5BQ7A 2P5EA 4BFEA 3CLFL 3V4PH 3HLAA 2ZSWA 1F6AB 1R5VA 1MHPH 3FL7A 4G80B 2X1WL 5C0FB 4XVUC 4ZUVA 4DKEH 1MJ8H 2XACC 3DUSB 1FNSH 4I3SH 3PWPD 5J1AB 2V2TB 1KB9K 4QHUA 3UDWA 4JVWA 4NZUL 3T65A 4TNWF 1T1ZB 1MCHA 3MODL 5D72L 5B4MC 3ARGA 4TUKH 4PJHA 1NDGA 4O51B 1HYRC 2FEDC 3TBYA 1FZMA 4L4TA 4M6NL 4OZFB 4WV1C 1YEDA 4ZQKB 1T7ZA 4JQVC 4TNVK 2R9HC 3DV4B 3C6LD 3JWOC 1MJUL 3QT2A 1DQJA 4TUJA 5D1ZC 2APFA 3RVTC 2A83B 5FYKE 4NQDA 2YD4A 3GHEL 2VQTA 5C70A 1TETH 1CDHA 1INDH 4GAGL 5ADOH 3JVGA 3QNXA 1L9NA 4YR6A 4JJHA 4L9LA 4FS0A 3G6JB 3I50L 2W65B 3RZCC 2OP4H 5C08A 1XMWA 1MIMH 4P4KC 5I1CH 5M7QA 3RX7A 3GSVB 1Z3GL 5IB2A 3LKSB 2OTUB 1X9QA 1JWSA 3HMXL 5IHZA 4RGNB 4P5MA 3V6BR 1PY9A 5D1QD 3IXAB 5TE7H 3H9SD 2D7TL 1QYGH 1WEJH 1A6PA 4Y5XC 1ZLVH 5ESVA 4N8VA 4RZCB 5F88A 4XB8A 4PGEB 2MCPH 1E6OH 2NY3B 3MUZ1 4DOHB 1M71B 1INEH 5J6GA 4YQXL 4PJBF 2GJJA 3S98A 4R4FL 3DVIA 5I8EB 4PJAE 1H15B 5EFIA 1YC8A 3K81A 1JPFA 4E5XA 2UUDH 4XZUB 4N0UA 3C5ZD 4K2UL 4MJIA 4P9HC 4QHLA 1IGTB 1S7WB 3Q0HA 2LAGB 3OKDB 5E2UH 1NANI 5DD5L 2FIKA 4PV9B 4XPHL 3QEQE 1KBGL 4LGPB 4RA0C 4OM0H 2I27N 4MAUH 3O45A 3HAEH 4EZMA 5E6ID 3QUYC 3MRJA 4HWBH 4QKXB 1T5XA 5JOEA 5CSGA 3W11C 4U1SA 1UZ8A 1CL7I 4U1MA 4QT5A 5ABDE 4KKBC 2X1QA 1C08A 1OHQA 5EBMA 1YJDL 3KPLA 3TA3B 3KXFE 3V6OA 4HCRH 3KPQA 3NCMA 3QDGE 1DVFB 4L3EE 4MMXC 1KIQA 1RULH 3G6DL 2WBWB 3L3OB 4EN3B 4RCAA 2F74A 2VE6A 1MRFL 1J1PH 5L0QB 4RBPK 1TJGH 1UWEL 3I9GH 2UZIL 5AZ2H 3P9LB 4HFWA 1M6OA 2ILLA 3VXOB 4EXPX 4GSDL 4XP1H 2GI7A 1ACYH 4PBVC 2AJUL 2R8SH 4NQXA 1C1EL 4EJ1C 1G7PA 2X2YA 1D5MA 4PB0L 5E8NA 5ID0B 1IC4H 1Q9KA 2MMXA 4X9FA 4MD4B 4WDIA 3IETA 1UENA 3FN0L 1I9JL 3VFPB 2MFNA 2VITA 1T21A 4XPBH 3MRIB 1ZGLA 2WSKA 3ZTJH 1MCKA 3TYFB 3RVVD 3C2AH 4LARH 5ALBH 1OQOA 2H32H 4XMLH 1IEAA 1CGSH 3MJ9L 5E5UB 1FAIH 3PHQA 3NVQA 3UTTE 4QRTA 4IMLA 5JIKA 3CXDL 1CR9H 4Y89A 3MRPB 1JWMB 1F6AA 1AD9A 3GSOA 5EIIB 5C0FA 2NX5E 3OKEA 1GOFA 4Y4KD 1RJZB 4M6ML 1A5FL 3UTQA 2DJSA 2X1OA 2V2TA 5F1NB 4QOKD 3N1GC 2IPTH 1FVDB 1IAIM 4R7NB 3RI5K 4YGAB 5SWSD 1J1OH 5K59F 3SCMC 2EIDA 4XT1C 1FQ9C 2RB8A 4OZFA 5DD3H 4PJAB 5I9QB 5C0BD 2IH3B 3DRTB 2HJKA 1MPAL 4JM2C 5FYLL 4DVRH 4NHUB 4X5XB 5DZOA 5DURB 4OAWB 2XIDA 5JW4M 4FQQB 3MMEB 3HR6A 4F7EB 1JV5B 2EDWA 5C6TH 5BZDB 2EYSB 2P47B 2Y5EA 3ARSA 1H5BB 1QLEL 1I1CA 5IK3B 1GPOH 4R90H 1KJ2L 3SKUD 4I0CC 1KTDB 4PJ9C 4WNQB 4H0IA 3LKSA 4HXBL 4YC2C 3V4PL 2OR8A 3KXFB 1AXSA 3QDGB 4U6XB 4L3EB 1MHPL 3SGJC 4WFEE 3TJEH 3Q1SH 3UZVB 1JJUA 1BZ9B 4NOFA 4QYOB 4WUUE 5GJSH 4DKEL 4ZO9A 4PGEA 1FNSL 2VDNL 2BDNH 3BZFA 4HGWB 4I3SL 2AAVA 1P7QD 2VB5A 1H15A 1X6NA 3BAEL 4TSCH 3O2DA 3GB7B 4Z7OF 3INUH 4JRXD 4GG6A 4XAKE 5J06A 2MKWA 3IU3B 4G6FB 4V1DD 1V05A 4NC1C 2VIRA 1S7WA 3OKDA 2EICA 4PV9A 3OPZL 3QDMB 5CS7A 3SJVE 3VXSE 1DQMH 1I85A 4MNQD 3VWKD 4BFBD 2Q1EA 1ZA6A 3DI3B 1EJOH 3JTSA 3MRKB 3FN3A 1LO0L 1P6FA 4U7MA 4JY6A 4MAYD 1INDL 1BJ1J 5ADOL 2F5BH 3TA3A 4G8GD 1DVFA 1NMAH 3MRBB 4JO1L 2OP4L 1T5WB 3L3OA 2NX5B 5K9KB 4XI5C 1MIML 3CDCA 4LIQE 1HILA 1GC1H 2AGJH 2ICWJ 2OYPA 1CF8H 1A4JA 4G6AC 3P9LA 2X4UB 3VXME 2EDHA 1FYTE 4QHMB 5TE7L 2ITCB 2HFTA 1WEJL 3L95B 3BYYA 5ID0A 2PTTB 1OP3K 1C12B 4BKLB 1INEL 2RBLA 4MD4A 4ODBD 4UILH 3NPSC 2AJVH 3BP5A 2AJ3B 5D1XD 1ZHKB 3IDJB 3TYFA 1GOHA 3CSBA 3U1SL 5IVXE 2HT2C 3MRMA 1RU9H 3VFRA 5GPRA 1Z9SA 4OM0L 3QCVH 4MAUL 3BKCL 1OGAE 3MRPA 1JWMA 1FNAA 4R2GC 4XPAH 1MCBA 2CDEA 5EIIA 3O2WL 4B41A 5BRZE 2V5RA 1KCRH 3QSKB 1RJZA 5DRXA 4I77H 1NBYB 4OLZH 3HNTH 1K8IB 4YEFA 5L2JA 1A9EB 4ZUUA 1L7TH 3NIDF 2AEQH 1QOKA 1JPSL 3ULUH 3O3BB 1RULL 2V7NA 4I2XA 5DFVC 3ARFD 2OLDA 3VH8B 4HG4J 4FQHB 4WUUB 1GZPA 4HWZB 5JLZA 3VXUA 1TJGL 4U6HB 3T0WA 1Q72H 3EYQC 1FNHA 3I9GL 5AZ2L 5ALCL 3CFDB 5L2KE 4G43B 5I0DA 4JRWA 4RDQF 4XP4H 2R8SL 3MJGX 2WV3A 1LWRA 1MIEH 1QLRB 4GAFB 2EIEA 4OAWA 25C8L 2BNUB 4FQQA 4KKLC 3MMEA 1LILA 3ZTNH 4F7EA 2LQRA 3QEQA 3VXSB 3SJVB 1JV5A 5BZDA 2EYSA 2FX7H 4HPOH 4XPBL 3RWGB 1RJLA 2CRZA 1H5BA 3C2AL 2VSCA 2VDPH 5IK3A 4XMLL 2R1YB 4ZUTB 1HQRB 4GKNB 1CGSL 5CJQH 3GSUA 3GMMB 1KTDA 5DHVH 4WNQA 3TCLA 5KVEH 1JIBA 5FYJU 3KXFA 3QDGA 4U6XA 4YNYB 2VZOA 4NCC1 5CUSH 1RIVH 3G5ZA 1VEOA 3O81A 5I75B 1IGFH 2R2EA 3MNVB 4FQ2H 4HGWA 2NNAA 4Y19E 3A0OA 4KK9C 3VXMB 2P45B 3S8WA 1FYTB 1J1OL 1DQDH 4ZTOH 3IU3A 2H1PH 1HYSC 1SEBB 4CN6A 3U82B 1IRAY 1EBAA 1U93B 5DD3L 4U1IB 2ZCKH 3S37L 4P46D 4HMEA 4J3VA 1U9KA 2CIIA 2NY6D 1X5JA 1N6VA 4DVRL 3LDBB 4AIZA 4OF8A 4KU1A 2DTSA 3K1KC 3V0VB 1S9XB 5FFLA 2G9HB 5IBUG 5HVHB 4JZOB 1KNOB 5IVXB 3ULVD 1SBBA 3FQWB 3MSPA 3MRKA 4PJHF 4F80A 5F7UA 3UTTA 3W9EA 4U1HB 4NCDA 4JFZL 3UEZA 2P8PA 1DN0B 4OLWL 4BA8A 1OGAB 5GIRB 1SEQH 5FUZH 3P73B 4M5YH 3MRBA 5E4EB 3VFWB 3T0BA 1P6AB 2H2PD 2PYED 5D8JH 5BRZB 1GPOL 1RZGB 2NX5A 4OQTA 4R90L 1S3KH 3VFGH 3UCRA 1RURL 3JUYA 3KLAA 5SWZE 1ZLUK 1CXHA 5HI3C 2CPCA 3N1FC 2C3HA 3BDBA 3FO2B 1V3MA 3F7RA 4QHMA 4HIHA 2XXCB 2WIMA 3Q1SL 5CD5D 1F11A 3WIFB 2FATH 4MSWB 1OB1B 3BH8B 4PJ5D 3KYMB 4U6TA 4QNPE 3CVIL 1YEHH 2P24B 35C8L 5GGTA 3C9NA 3ALPA 2PETA 4TSCL 3VGBA 1ZHKA 1QUNA 2IQAB 3INUL 4LKXB 4K9EL 3QI9A 4OBSA 3JV6A 3BKJH 3ZKMD 3RDTA 1CFBA 4D0BA 5KSAB 2YSSB 4I48B 4OCMC 1D5BA 5KSBE 4JO3L 5JMOC 3DX9B 3FB8B 3QXVA 3DXAD 1IAII 2WLZA 3TV3H 4S2SB 3GFUA 1OAYH 2DYPA 4I0PB 4NQCE 5D7JD 4GLRI 1HK6A 1T7VA 2DLGA 3IGAB 1NBYA 1X5YA 5IHUL 2F5BL 3L9RA 1U8MB 4AQOA 3BP6A 3RWJB 1A9EA 4D9QE 1NMAL 5C0AE 5H2BA 2DIJA 3O3BA 3FFDB 2GFBB 1CLOH 2BVUA 4HF5H 3VH8A 3DMMD 1F58H 4FQHA 4HX1A 3WL9B 2AGJL 4U6HA 4QRQB 4Y19B 1TLKA 5FDWB 4WGVB 1BJ8A 3CFDA 4KDTC 1QO3B 4MJ5A 4G43A 2YWYA 1ZT7B 4U2ZA 2VN7A 1A7PH 1LE5B 1QLRA 3TC9A 4I5BB 3VXSA 3SJVA 4UILL 5K9QI 5E94A 4KUCF 3RWIB 1NCCH 5HGGS 4LLQB 3M8OH 3T0AA 3BE1L 2OL3H 3I6GB 4GRMB 4YHNB 1UJ3C 1HQRA 5KVDL 4GKNA 1RU9L 1P53A 2WW8A 2RQ8A 3SGDI 4X9GA 1ZLVK 5HGHB 1IEBB 4PJXE 4EUPH 1SQ2N 3EUUA 2XKNB 5DA4A 4EOWH 4YNYA 1G7MB 1X4YA 3IKCB 4XPAL 1IAKB 3VFVA 5C2BL 5JOPE 4LCCB 4CDGC 2Q7YA 2UUDK 2L0DA 1KCRL 4JHAH 3MNVA 4I77L 5D93C 3LV3A 5LQBH 3RX5A 3EIFA 1PKOA 2V2WB 1R0AH 3VXMA 2ITDA 4FQIL 1E0OB 1HSAB 1FYTA 1QR4A 4Y5VA 2B20A 4HPYH 3ULUL 3L5WB 2PO6B 1Q9WA 1A8JH 4WO4C 2AJSH 3ULSB 2NY0C 2A1WL 3CDFA 3IDMB 1U93A 4K7PL 1Q8MA 1ETZB 3LCYA 1NDMA 1P1ZB 5I8KH 3D69B 1MIEL 3B43A 5A3ID 5GGRB 3V0VA 3F58H 5BMFH 4FZ8H 1KNOA 1U3HD 1I8LA 5IVXA 1EERB 4MMZC 5HY9A 2FYYA 5C9JA 2YRPA 4PJ7E 4S1SH 2IAMB 5FGSA 4RMSA 3MBXL 4JZNB 3D39E 1FBIH 4JZJC 3IJHA 4HPOL 5EUOE 5KW9L 1F4YH 4U1KA 1CD9B 1OGAA 4YDIL 5J9PB 3P73A 3QNZB 3WE6B 2VDPL 2YKLL 1WFTA 3HZVA 3VFWA 1G7JA 4NQCB 4YHZL 5BRZA 2Z35B 1RZGA 4LF3B 4LOUD 3DV6B 1K4CA 5IB5B 1UFUA 3T3MF 3FO2A 5IROC 4FQLH 5C0AB 3GSNL 1I3GL 4N5ED 4XCFL 4LK4A 2M1KA 3WIFA 2DLFH 4IJ3B 3H9ZA 4LHUB 1OB1A 3BH8A 3KYMA 1KN4H 3OJVC 4MHHG 4MDIB 2EZ0C 2P24A 5L2KA 5FYJL 1V7NH 3WBDA 1PFCA 1B3JA 3PL6D 2IQAA 4RMQA 4ZTOL 4LKXA 4Z5RB 3B2UC 4A6YH 3VXTB 2FECL 1G6VK 4IMKC 1F4WH 2YSSA 3OAYK 1U6AH 1YEIH 2DM3A 4I48A 3QUZB 2P44B 4KVCH 3DX9A 3FB8A 1VEPA 4LLYA 1MRCL 1YEFL 4S2SA 4KQ4H 4FXKB 4Y8AA 4UB0L 2R0WH 4ODTH 5I1IH 5DJYA 1V3LA 4G5ZH 4GG6F 3IGAA 4OSUH 1MOEA 2PN5A 4PJXB 4QXGH 3WFEH 3P4MB 1N4XH 1L7IH 4YHPA 5DMGD 5FUZL 4X6FA 1QBBA 3MRCA 4M5YL 3ZKND 2FLRT 3NABL 5D8JL 3FFCA 1E4JA 2ICCA 3FFDA 1LK2B 1S3KL 4XWOD 4WI8A 3VFGL 4NRYA 3WNLA 3WL9A 2QTEA 2XV6B 4G8EB 1MFBH 2IG2H 4PP2A 4Y1AE 1EZVX 4QRQA 4Y19A 2VDML 5D2LF 2W9DH 1QO3A 3BWAA 1ZT7A 3B9KC 1GC1C 1LE5A 4WV1A 2FATL 4KGJA 4XPGH 4WHCA 3L3HB 1QNZL 4I5BA 4XBEH 2L7UA 5GRUL 2A77H 1YEHL 1CGYA 5AYQA 5LGHL 4YLQT 4PJ8B 3C87A 3RWIA 3BOVA 4CGTA 3EDFA 2CXKA 5BV7B 5I1EH 2OJEA 3BKJL 4GRLC 2WINB 2G5BA 1S7VB 4Z95H 4JHZA 4PJ7B 5E8PB 2F53D 3B4NA 4XP6L 5HGHA 2XNAA 3IFLH 1IEBA 3D39B 1X4ZA 1BVLA 5EUOB 2JJUA 1ES0A 4P4KA 1J87A 3TV3L 4JFXA 1G7MA 2X6MA 3IKCA 2A0LC 2EDXA 4ORZC 1OAYL 3HUJE 5F7MC 5IUSA 3FQXB 4L1DA 5DJDB 4PRPE 5CBEB 1MHCB 3LN4B 5IEHB 2QBWA 1OAKL 1JBJA 5SWZA 1PG7L 4NQEB 2V2WA 4HZLA 4Y5XA 2W38A 4CU8A 3VCLB 1ZSDA 2K9UA 3JZ7A 4HK0B 2PO6A 3GI9H 1CLOL 5SX5H 1F58L 4U1LB 1PY4A 5D9SB 1X3DA 1T20A 3IDMA 2YMXL 1VFAA 5B39B 5DC0A 4Y16B 3ULUC 1JGVH 2UVEA 1P1ZA 3D69A 4ISVB 5HDBE 1MELA 3VXRD 4G7VL 2IAMA 3HAEG 2HFGL 4ZOCA 1IMHC 1MAMH 5KSBA 5HI4C 4ZTPH 4Q6YA 5KANI 5J9PA 3M8OL 3WE6A 1T1YA 3HE7C 5JPMB 2OL3L 4NQCA 2F15A 2Z35A 5AEAA 2KQNA 3BESR 1BQLH 1A7OL 1W0WB 4MCZB 1UWXH 5IB5A 1BFTA 5JZ7C 3LH2L 3MLZL 3VWJD 4EOWL