1DEEB

Structure of s. aureus protein a bound to a human igm fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
223
structure length
223
Chain Sequence
QVQLVESGGGVVQPGKSLRLSCAASGFTFSGYGMHWVRQAPGKGLEWVALISYDESNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKVKFYDPTAPNDYWGQGTLVTVSSGSASAPTLFPLVSCENSNPSSTVAVGCLAQDFLPDSITFSWKYKNNSDISSTRGFPSVLRGGKYAATSQVLLPSKDVAQGTNEHVVCKVQHPNGNKEKDVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IGM RF 2A2
publication title Crystal structure of a Staphylococcus aureus protein A domain complexed with the Fab fragment of a human IgM antibody: structural basis for recognition of B-cell receptors and superantigen activity.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 43
structure length 223
sequence length 223
chains with identical sequence D, F
ec nomenclature
pdb deposition date 1999-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1deeB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1deeB02
2WQ8A 4UT7H 4XPFH 4G42B 4I3SL 3NIDE 4IOIA 1FFPB 3C5ZC 3NN8A 1EGJA 5DMIL 1A4JB 1OGTB 4HIHB 1K6QH 1XAUA 2P7TA 4D9LH 1NDMA 2DIAA 5D7JB 5BS0D 2HLAB 4PJXA 3X3FH 3MRPB 5E8EB 3ULVD 4N8VA 4NGHH 5CMAB 5ICZB 3S4SB 1HYSD 3KPQB 4XGZB 1LO5B 5BVPH 3T2PA 1FFOA 1TIUA 1TNNA 1YYML 5FYKH 5SWSA 2N56A 4Z18A 1N6VA 2M8XA 3VFMB 2NY6D 1A3RH 1U8HB 1T66C 4YHLH 5C0JB 3ALWA 4G5ZH 4JE4B 2DRUA 4TUJA 4UTBL 1I7RA 4JFED 1EMTH 3F6IA 3ULUH 3VJ6A 1Z9LA 3LZFL 1HNGA 3NIGE 2EDEA 5DMKA 5T1DL 1BZ7A 3QI9D 5DLMH 3O8XC 3O2DA 4X98A 2HMID 1YMMD 2DD8L 2R69L 3BFOA 3U0TA 4X7SL 4NNXA 1WUNT 5DI8A 3V5HA 1I8IB 4X99A 1YECL 1CE6A 2VXVH 3QEQE 1KENL 5EBMA 5FO8B 3V0VA 4WO4D 4NKMB 3WSQH 3L5WA 1UYWH 2VSDA 3BIKA 3F58H 3ROLA 2XKSA 1A6ZA 4YDJA 1EVUA 3U6RB 1ZHKA 1D9KA 4OD1H 5F7LB 5E03A 4NJ9L 1U8PA 4Y4FC 4JFDB 3S98A 4NKOB 1SMAA 2EECA 4JB9L 1J8HA 4OZFH 3ARBB 1NCTA 5AZEH 4M1GL 4Y5YC 4R3SA 4AENA 2A6DB 1HILA 5DD5H 3K2MC 3E1F1 1BX2A 4NM8L 4CU6A 3ULUC 4M7ZB 5T3ZL 3H0TA 1NKRA 3R06B 1KPRA 4LMQI 2A83B 1DLHB 4TNWK 5CHNB 1C16A 4ZFOB 1P7HL 2FX7L 4I4WA 4YJZL 4JRYA 3WYRA 3PP4H 4QHUB 4XVUD 5DJ0B 1TJIL 2VABA 2YPLE 3VXRA 4D8PA 4GSDL 4Y5XC 1QQDA 4ODSL 1RZKH 1UQSB 1KIQB 2CKBL 4F7MB 5TJWK 5F21B 1P7KB 4G6AD 4FN0A 4KK5C 1MHPL 4R4BA 5F9JA 3SKNB 3FT4A 1Q9WA 3LEVL 4XX1E 4JFFD 2HWZH 2CDGB 3O4OB 3HZKA 4O02L 4Q2ZA 3BT2H 1IC5L 2QHRH 3BPOB 3DV6A 2CH8A 1UFUA 1QO3A 4JKPH 4N8CH 2C5DC 2YMXL 3BEWB 5INDA 4OLUH 4GG8B 4X4YB 3UZQA 1AR1C 3QFJD 4QHKI 3WDJA 1PKQA 1RHHB 3G6DL 4NNYB 5DZLA 4JY5H 3C5ZB 5JDJA 5AD0B 3QA3A 2R8SL 3FFCE 2UWEE 4HIEA 3ZE1E 5IJVB 2XYCA 1YMHA 1ZK9A 3K3QA 5L8JB 4UT9H 4ZDHA 2OR9H 2BRRH 3BP4B 4OLXL 2AXFB 1JZ8A 3L7FB 2IAMB 5I8CB 1NBZB 1Q0XH 1GGUA 1OD7A 2ZZUT 1RZKC 1M6OA 1UT9A 5FCUL 2QL1A 1YEIL 2ESVA 2B0SL 4NJAL 3MCLL 2IFFH 4PGBA 4R4NC 2I9LB 4OSUH 3RX5A 5C0RL 5DJDB 3RDTB 4GRMB 4Z7UA 3V8CA 1WK0A 4O4YL 1FCGA 4PJFE 4DCQB 1BOYA 2GJJA 3IT8D 1CE1H 1R0AL 1M71A 3MFGB 2XICA 5TE6L 4XCYB 3IETB 1NGWA 1T80A 4E0RB 3G5VA 4WGWB 3V7AG 3EFFB 4LSSL 3RUGE 3ARGD 3U9UA 3OKNB 3L5XL 3PDOB 1MAJA 4N9OB 3LIZH 2CJUL 4LNVA 5GRWA 3QUXD 3VW3L 4P59L 4L9DA 3W39B 3W9DB 4GRWE 4I3RL 1T0NA 3EYVA 4KQ3L 4NOFA 5SWQA 5IVXF 1KF9B 1H3UA 3M07A 2OTWB 3HPJB 4N1CA 2AEPH 3X13A 5A2JH 3GM8A 4WI9A 3HE7A 3CXHK 3Q3GA 1T2JA 5F6IB 1OTTD 4Y4FB 4ETQB 1MCJA 1GGBL 3DI3B 5HD8C 3VFVB 1XF4A 3H3BC 3EYFB 3V95A 1XF2A 1OPGH 2RFXA 4WHCA 2DQCH 4X6BA 5FUOH 3F65A 4LRNL 1G84A 3MCKA 1SEQH 1DQTA 4L8BA 3VGBA 4Y16B 5D93C 3MJ8A 3CH1B 5I8EB 3VWJC 4K07A 5AEAA 1NCAL 1D5XB 4LP5A 3I6LD 2G9HA 1I8MB 3VFUA 5IVOA 3IXAA 4HT1L 3WIFB 5JUEH 4ENEC 5IROA 4Y5VA 3DX8B 2EH8H 1U91A 1NLBL 4Y5XB 3WN5A 3V4UL 3SDXA 3BHBA 4KJQC 4NO0D 3VMPA 4DUWA 5F7NC 4P2RB 4XPBL 5J06A 5KN5B 4XBPB 3BKYL 3BP6A 5D7LE 4LGPB 4K71B 3MRDA 3IF1B 1WZKA 3VXSA 1HHIB 1IFHH 3V6FB 2MSPA 3RI5K 2NY5L 4E5XA 4RAHA 1N4XL 5IGXH 5JMRA 4QYOA 1VACA 7CGTA 3QEGL 3UJIL 1G7MA 3PJSB 2X4TB 3SDCD 4FQHB 3HC4L 3BN3B 4CVZA 1FYTE 4MNGA 3T65A 1NFDE 2PYED 3LKOA 3VGFA 5E9DE 4W6YB 1FVEB 2X4PA 4HMEA 1FIGL 3RWGB 1NGYB 1LEGA 1P2CA 2GHWB 2J12B 3FRPG 4Q6IC 4LDLB 5JOFB 1H15B 4NSKB 5D96B 2Z8VC 5BJTA 3VWKA 4GW4B 2YA0A 4X4ME 5GGQH 4XBEL 1CLYL 4NZUH 1NQBA 1FVDB 4X6CE 1SMOA 1C1EL 3IVKB 3GK8H 4N0UA 4PJCB 3I84A 3KPLB 3KPNB 3NFNB 1TCMA 1KCKA 4M7KL 4JANA 5FYKU 3TVMA 3VRIA 1JPGB 5FB8A 4HJ0C 1OB1A 1YEFH 2XWJB 1JV5B 4QY8A 1U3JA 3WFEH 4PJ7E 4PLJC 3IFOA 4CNIA 2HLFC 4I48B 5MEQB 4POUB 4WI4A 3A6BH 4DKEL 4JFXA 5FKAB 5DS8B 4NQDE 5EU6E 4QHKJ 5HHMB 2ZUXA 5ADOH 4NWUH 2AV1B 4JFZH 2JKXA 2FBJL 1ZLVH 1N5AB 3W2DH 5DT1L 2DN7A 1QSFA 5GZNC 3FZUD 4MCYB 1JGVH 3MA7A 3RWEB 3L5IA 3EBAA 4RMRA 3BEVA 4HKJA 3FQUB 4OIBA 4YPGA 1ZT7A 4JGUA 1EXUA 2FD6L 4I13B 5TQ0L 3RZCA 4W4OC 2IPKB 3O6KL 3IDMA 4LKCA 2BNQB 1FC2D 4AEIH 4G9DA 3UTPE 2YD8A 4TSCH 1RK1B 2VISB 3UJTH 3NFSH 4DN4L 5DR5H 4YHKL 1U6AL 5EULV 4MJIA 1J88A 3MV8B 2UUDK 3DTXB 5C0DB 1XGQB 1BAFL 1V3KA 2FYYA 5I1CL 3VDBA 3RX7A 1JPST 3MJ9L 2JJSA 1HZHL 1MRDL 4OUUA 2HFGH 3V9FA 1CK0H 3ZDYE 1LWRA 5K9KA 5F8QC 1S7TA 4HV8B 4P57B 4PRPD 4J4PC 4OAWA 1NSNL 1X44A 3HC3L 4K94H 2HJFA 3CAFA 5BQ7B 5BW7A 4XWGL 2B4CH 4YGVB 2CLRB 2CRMA 4HIJA 4HCRA 5HVGB 4D3CL 2C4FU 4ZXBC 3IJYB 1WFNA 2P5EB 3MRCA 5JW4N 1CN4A 5DEGB 1MVFA 1VGKB 4JFDE 2FSEB 5FOJA 5GS0L 4DTGL 1MRFL 3AUVA 5J4MA 1CBVL 2BCKA 2OLDA 3GIVB 3SPVB 4POZD 1HQRA 2KPNA 1MRCH 3U36A 3ARFA 4KVNH 1J1XL 1GIGL 1JL8A 2P8PB 1I3GL 1A1OA 1VADA 4U4BA 3GMMB 2D4DA 4LLVB 4LSRH 4GMTL 3WFCL 2A0LC 1EAPB 3VCLA 2Z35A 3QP3A 3PDGA 4EN3C 4XCNB 4UI2A 4Y8AA 5C0EB 2ZUVA 4H26A 4KUCD 4K94C 3HAEG 5FOBA 4HH8A 2NY4C 1FO0H 1TQCC 2AI0H 1XGTA 4NO3B 3BO8A 3EJYC 2XWBB 4Q97A 2AP2A 3RY5A 4PLKD 5GRXG 4OGXL 1KLFA 5INCA 4C57C 4K7PY 3AAZA 4YNYA 3VFRA 4JY4B 4PJAA 3GSWB 3DX9B 4O58L 4X83A 1VFUA 2VN7A 1J0ZA 4I3SH 1FCCA 2C3VB 5DMIH 3HZVB 3DV4A 1S7VB 1RJYB 5T1KA 2IGFL 2VH5L 4LHUA 2EYSB 3K74B 5AAMA 2IMMA 1JGEA 2AJYL 4OCRL 1RD6A 1F11B 1JZ4A 1K4CB 4GJTB 4FS0A 4C55A 1YYMH 1Q9LB 3QULB 4ODHL 2FWOB 4L8CB 2NR6D 4OLZL 1EIBA 2K1MA 3MRHB 4AK1A 4UTBH 3RWDB 4Z7QF 2RIKA 2HTLD 4NP4L 3LZFH 3GB7A 2IC2A 4NIKB 3D2UD 3IDXL 1I1AA 5T1DH 1ZOXA 1K8IB 4Q74A 5KBNC 4TUOA 4M8QB 4P4RB 2R2HB 4RQQA 2DM4A 2R69H 2VLJE 4HHAA 3IJHA 4LLAA 4X7SH 5BS0A 2OXHA 1YECH 4I0PA 4W6XB 1KENH 2Z31C 2GY7B 2Z92B 5E00A 1LE9B 3WUWA 5DUBB 5HHOD 4FXKA 3LB6D 2NY3C 1ZGLA 4YC2C 1X7QA 5ABDE 4JZNA 4DZ8B 3TN0B 2R1YA 3PHQB 1Y6KR 3BMWA 2ED9A 1UACH 4NJ9H 4LF3A 4HJGB 3VFSA 1PX3A 2R0ZL 4F2MA 4JFEA 3TPKA 3BYTA 4JB9H 3FCTA 5HYJB 3Q0HA 5C0FB 4N68A 4P2OB 4M1GH 3SJVD 4F7PB 4NM8H 1QUNA 3QI9A 3VFNA 5T3ZH 5EOQL 1XIWD 1DDHA 4MGXA 1YMMA 5IW3A 1U8IA 4YO0A 3WFHA 3H8NA 2D9CA 4H0IA 4PJIA 5GZOD 4WU5B 4EXPX 4JRXB 5FK9A 1KG0B 2FX7H 5B38G 5KAQG 43C9B 1BVKA 1KC5L 3T4AB 4WO4A 3VI3E 5JA8B 3ZKMD 1KXQE 4TVPL 3DYOA 1TJIH 5ESVB 5F44A 3S5LG 3L3HA 4RCAA 3D6GA 4GSDH 3ECBB 4ODSH 3NMEA 2D4FA 4N1EA 5B22A 4D0DB 2APBA 5CGYC 4OFPA 4ZFZB 2CKBH 4WEBL 5FGSA 1ZA6B 1Q9KA 4NO2A 3DMMD 4L3ED 1MHPH 2AJ3B 1S3KL 3UAJC 3W11D 5IVXB 3MRKA 4IDLA 3GHBL 3IDUA 3LEVH 2EDYA 2X09A 4Z7UF 4FRWA 5F7MC 1WFTA 2ENYA 4O02H 4ISVA 1IC5H 1Z5LB 3OHXB 2WSKA 4E41D 2FR4A 5F1NA 4U1HA 2YMXH 2BNRD 4H88L 3MRMB 5K9OA 2A6KB 2WINB 4G7YL 2OR7A 1TTGA 2P47B 3G6DH 4MA8L 3NH7L 4GKZB 5FEBA 2F53E 3IKCA 1HCFX 3TBSB 3NZ8A 1GVIA 2X89D 5EZJB 4RGOL 2R8SH 1DEEB 3V4VL 1ZS8A 8FABB 2I25N 1A6WL 1JPTL 5HDBF 1P84J 4OLXH 4QGTA 2E6QA 1JGDA 3W0WB 3MREA 5TGBA 3DETC 1KLUA 4WTZG 1NUDA 5FCUH 4KXZH 1YEIH 2IAND 2B0SH 4NJAH 4RIRB 5ESQA 3MCLH 4FTVB 1V3JA 4JFFA 5C0RH 3TM6A 4LK4A 4LSVL 4O4YH 1NEZA 1F6FB 3O3AA 4LPTA 4TTGA 1JF1B 4Z95H 5IR1B 1WBZA 3LMJL 1R0AH 2Q8BL 2C26A 4PJCE 2NY0B 4YFLF 5TE6H 1S9KC 4WNQB 3ZDXE 1YEKL 4OD2A 3TV3L 3QFJA 4RFEA 2A1WL 4DEPC 4GAJL 4LSSH 1OT2A 3BVNB 1BVLA 4WFHE 5DRXB 3SDDC 3L5XH 1BFVL 2CJUH 4OFYD 3VW3H 4P59H 3V8OA 1NBQA 4NKDB 4OF7A 1JYWA 4I3RH 4AM0B 3DUSB 1X5IA 4KQ3H 4GAGL 3IXTB 1JYVA 2NCMA 5HHME 4Z7OE 3RFZC 2NY3B 3SDXF 3ES6A 4BSVB 1GCFA 2GJ6B 4M62H 4AT6B 5TDOB 3QH3B 2F54B 4RSVA 4K3GA 4QOKD 1FIEA 1EX0A 3PHOA 4K3DL 1GGBH 4U6XA 4JGMA 4X8JA 2PCPA 3R8QA 1F90L 1A7PL 2OTUA 3L95B 3B2VL 4Z7NE 1BFOA 5F88A 1TCRA 1SJHA 3N85L 2BNQE 3P4MB 4KKLC 2XPGB 5EN2B 3ARGA 3UXFA 5MERB 3U7AA 4JKKA 3TA3D 3JWOC 4WFFE 4ZUWA 5GQBA 2RHEA 3GUTA 1NCAH 3C60C 3MV8E 5GIRB 3T0ED 4HT1H 4YFEA 4JAMA 1U92A 5FF6A 5DEFB 3RVWC 4APQB 2D7OA 5SWZD 3IDJB 4ZUSA 1I8LC 2ZUUA 3JVGA 4YHPA 1NLBH 3QUZB 3SE3C 3V4UH 2ICCA 3LKRB 2B1HL 1JK8B 1L9MA 1B88A 4XPBH 4GUPB 3BKYH 4HK0A 3CNKA 2XT1B 4OIIL 3QZWA 1BQLL 3QXVA 5DVMA 1T04B 2NY5H 2J88L 1N4XH 4XCEA 1KB5L 3BUYA 5IIEA 1DJSA 3QEGH 3UJIH 4UMGA 2I27N 2D7MA 3HLAA 5TDPA 5H35A 3BP5B 4P2QB 3HC4H 1AR2A 3MRNB 5JNYA 3BP7B 3OXRB 1D3CA 1M7IA 2V6HA 3CCHB 3BZEA 1OAYL 3KYNA 4P2CG 3GSOB 4I77L 2ADIB 1FIGH 1HINL 2ADFL 4P3DB 4EUPA 4F9PA 5EO1A 1IGFH 4GFTB 4MD5A 4DVRL 1S7XB 2G60L 1I3UA 3FL7A 1DANU 1F2QA 3WNKA 4PLOB 4K55A 1FQ9C 5LGKA 4QTHB 1Y0LA 5E6YA 4X0KA 1JN6B 4JO2H 4MQXC 4XBEH 5GGUA 1CLYH 3B8SA 1SY6L 4IOSD 1C1EH 1OAUL 1RJZB 3GJFH 4OQTL 4PYGA 2RQ8A 5GGSA 2FL5A 2Q8AL 1AXTL 2W60B 4F3FA 3MX0A 4M7KH 3GFUA 2H8PB 1KCRL 1BREA 4OLVL 2NY5C 3HC0A 3SDCA 3BKML 3O9WD 1P9MA 2I60L 3VXPA 2FECL 2PO6B 1NEUA 3DVNA 1ITCA 5I76B 3UX9B 1AP2B 1A21A 1CFSA 4JFYA 4DEPB 1NAMB 4DKEH 2PYEA 3DRTA 3LCYA 1AXSB 1JI2A 1KIUA 1UKQA 1A9BA 3KXFB 1G7QA 4N0FB 1GH7A 2FBJH 5HGBA 1WT5A 5EBWA 5DT1H 3NN8B 5FHAL 5J1SC 1QBML 4RISL 2EDWA 4U0RC 2P7TB 1NDMB 3BWAA 4N8VB 5CP7A 2Y36L 1LNUB 1WC7A 3PWPD 2VO5A 5AG9A 5F7YC 1QR4A 4NDMA 4RZCA 5TQ0H 2FD6H 3IYLW 3PGFL 3QWQB 3H7BA 5MEND 3S36L 1J86A 1FPTL 3EW3B 5IJKA 3WLBA 4YHKH 1VENA 4M3KB 4TUJB 1G7JA 2VZVA 5J12C 1I7RB 4QNPF 5EDXA 3VJ6B 3QDGD 5CJ8A 4A2LA 1BAFH 5DMKB 4RMSA 4MXVF 1HWHB 1JGLL 1BZ7B 1ZLVK 3BPNB 4ZS6D 5I1CH 2E9BA 4X98B 3SO3C 2VL4A 1XCTA 1CFTA 1HZHH 1MRDH 3AB0C 3U0TB 4J3OC 4U49A 4CL7A 4NNXB 2MKWA 5DI8B 3V5HB 2XTJD 5I18L 1KV3A 1CE6B 4KY1L 5EBMB 5JHLL 1LMKA 1HSAA 3WEXA 3V0VB 3HC3H 2BSTA 3L5WB 2FGZA 2RBLA 4XWGH 4PJEB 1IAIM 3MOAL 4P5TB 5IK3A 4D3CH 5HVHC 3FHQA 1WLHA 3ROLB 5GRVK 1A6ZB 2ITDA 4YDJB 4ZO7A 5DC4B 1D9KB 3P4LA 1BECA 4H20L 4I18A 1U8PB 1ZTXL 5GS0H 4DTGH 5HVFB 5EZLA 1MRFH 3OTTA 5HYJE 1QYGL 4PJAF 1CBVH 1J8HB 1QFPA 4B7IA 2KZ1B 5L8KB 2OM5A 4R3SB 3KWWB 4AENB 4O2CA 1HILB 1BX2B 5ITBL 1RURL 3H0TB 4HUMB 1T83C 2CUHA 3UBXG 1KPRB 2V9TA 1J1XH 1GIGH 4JRXE 1I3GH 1G9NL 1C16B 1YY8A 3N1QC 4PRPA 4I4WB 4GMTH 3WFCH 2VDRL 4JRYB 2DTSA 2OI9B 1E4XI 3E2HB 4Y5VC 5J6HB 2VABB 3QUYC 3VXRB 2D0HA 4LARL 3MLWL 2V2WA 2J1KA 3D5OF 3LSOA 4WRLA 3V5KB 4LSUL 2J2ZA 2NYYD 3FFDA 1FNFA 1S78C 4KKAD 1CCZA 4RGMB 1KIRA 2BMKB 4OGXH 2HA1A 4FABL 4PV8B 5IVXE 5F9JB 3FT4B 5DRWA 1Q9WB 4K3HA 3HRPA 2DTML 4O58H 4MQ7A 2CIKB 3HZKB 3IFNL 4Q2ZB 4F7CA 3ZDZE 5AG8A 2YEZB 4GG6A 3DV6B 1T7XA 2QQKL 3ULVF 2IGFH 1QO3B 5INDB 4MJ5A 2VH5H 2IJ0C 4WW2A 3WXWL 1HOCA 1PKQB 2AJYH 4OCRH 1SEBA 2R2CA 4B53A 1T5WA 1R3KA 4X9BA 3QA3B 4ODHH 3STZA 4HIEB 4G9FE 3VWKC 5KSAD 2BOCA 1YMHB 3QNZA 5FGBC 3VG9B 4ZDHB 4P23D 5BMFL 2A77L 4OLZH 5DUML 1MCIA 4P46D 4JR9L 2CUIA 2ESVB 4L3CA 4NP4H 3CMGA 4PGBB 5ITFA 3S34L 3S3PA 3IDXH 2WBJC 3TVMC 2IEPA 4L29A 4Z7UB 4K8RD 1LP9A 2OMBA 5IMMA 1JZ7A 3PGCA 1FVCB 4YXHL 4N5ED 1M71B 4R6UA 4PJIF 3C8HA 4V1DA 1AE6L 1NGWB 2YPKB 1WZ1L 4DFIA 4BH7A 3K1KC 3KPSD 4LPXA 1A1MA 3D3VB 3UBXI 4MA1C 5ICYA 1QLRA 3H2WA 2VKXA 3MUY1 1T0NB 3EYVB 4BFEA 5ALCL 2PKDA 5SWQB 4KJWD 2R0ZH 4IMLA 1UKTA 5ENWA 4MNHB 5F7EL 2GJ6E 2B20A 4PR5A 3MXVL 1KCSL 3QDJD 3V6OA 5HGDA 3X13B 2OSLA 4DW2L 4AY0A 3RZCC 3HE7B 5EOQH 3C6LD 3BH8A 1VFOA 5HI3C 3O2WL 1IJ9A 3ARQA 1XF4B 5IMKA 5HI5C 5H94A 1XF2B 1BQUA 2RFXB 2DQEL 4BA8A 1KC5H 4BK5A 2AJXL 4OCXL 1CGTA 3MCKB 1UM5L 4TVPH 3T0VA 3TIDA 5GJSL 4FFYL 2QSQA 5HHOA 3OL2A 2ORBL 1S9YA 3MJ8B 5IT2L 3O6FD 3RP1A 5E1AA 2G9HB 2JJSC 1J0HA 2IQAA 4M6OL 4S11A 4X5LA 1H3TA 3VFUB 3IXAB 4WEBH 1G9MC 4MDJA 4PBXA 1MCWM 3JV4A 4L9LC 1MHHA 1RUKL 2WIIA 5ID0B 2K7PA 2EE9A 2VR5A 1S3KH 1EJ6A 3LV3A 4JDTL 4Y5VB 5BXFA 2X4NA 4M4PA 4PP2A 3GHBH 5BZWA 3LN9A 2HT2C 3SJVA 2EC9U 3SDXB 3BHBB 3WN5B 5JZ7D 2ZSWB 4IS6A 4LKXA 1UCTA 4FFZL 3LVEA 1CICB 4X4XA 4JVUA 3BP6B 3EO0A 1XIWA 2AEQL 2HFTA 1ZANL 3MRDB 4HX1A 2EDOA 1NDGA 3VXSB 4H88H 4E5XB 4LBEB 4G7YH 2ZG3A 4MA8H 5HYQA 1P7QB 1JF6A 2OJEA 2VIRA 1M4KA 3NH7H 4QYOB 4P2QE 4XXCA 1YYLL 1CS6A 4RGOH 3ARVA 2HVKA 4X9IA 3SCMA 1EZVX 4CVZB 3V4VH 1A6WH 1JPTH 1OTSC 2VDNL 4MNGB 3T65B 4CN1A 3UYPA 4YHNA 3SGDH 3LKOB 4OM0L 2X4PB 3ARWA 2I9TA 4L3EA 2X4RA 2BK8A 1IKNA 1QRKA 5BJTB 3I6GA 4G6KL 4OF8A 1QSZA 3FRPA 4IM8A 4LSVH 1YEJL 5HYSG 3LMJH 4RAVB 2Q8BH 3ET9F 4N0UB 2JB6A 3VXTA 3QWRD 4E41A 1HCVA 1YEKH 2BNRA 4OTXL 3ORJA 2IPUG 4K9EC 4JANB 3TV3H 5CGMA 3AXLA 4PJGE 3TVMB 5T3XD 2A1WH 5A3IC 2R4SL 3AM8C 4GAJH 5DWUL 1OB1B 3C5JA 4C56D 3RWJA 1NCCL 5CZVL 2X89A 3ARSA 4QY8B 1BFVH 2AK4D 3G5XB 5C8JA 3IFOB 4NN5C 1LE5A 5FCSH 3ARUA 1ZGLP 2ILLA 3LKPA 1QFUL 3W9EA 3TO4C 4YHOL 4GAGH 4XHJC 5A2IH 2FJGB 4YK4B 4MA1B 3RPKA 5EB9A 2IANA 4U1GB 3PIQA 5E8NB 5DHVA 2BOBB 1MI5D 3VDCA 4PJXE 4YQXL 3MA7B 4K3DH 3MACL 1PAMA 4ERSL 4FQLL 2CRZA 4DN3L 3BEVB 4HKJB 3DO7B 1F90H 4PRID 1A7PH 1OLLA 2GT9B 4YPGB 3B2VH 3FO0L 3B9AA 4BZ1L 1EXUB 5SWSE 3RZCB 3HG1D 4YIQA 2K9UA 3N85H 3KPOA 5IKCB 3IDMB 1CGYA 1IEBA 1P1ZA 2F15A 4L4TB 4G9DB 5I1DA 4WU7A 3BPCA 1IAOA 3QUMB 5CWSA 4OFYA 1KNOA 4MJIB 3SY0A 5J3HD 1F4HA 2IBZY 3BW9A 5D7IA 3ULVC 1TVBA 2NXYD 3CDCA 3MV01 2D9QB 4XAKE 3CFCL 2B1HH 1YEHL 2VR4A 4OUUB 4G8FB 2HTKC 5GPRA 3HCVA 5F1OB 1S7TB 3RL1B 4QOKA 3VI4F 4OIIH 4J23A 2NY6C 1BQLH 4OAWB 2YBRA 3X11A 4K7FA 4XNMA 2J88H 1IARB 1KB5H 2BZDA 2HYMA 4HIJB 4YEEA 2HKFL 1I1CA 4PRAA 4ZNEA 5C0BD 1C08B 3QI9C 3MUGB 1J0JA 2J7LA 4LQ1A 5EO9A 1OAYH 2HMIC 1JCKA 4HZLA 4I77H 1J8HE 3T0EA 1FV1A 4Z7QE 1HINH 2ADFH 2BCKB 4U1KB 2ARJB 3SN6N 3CU1A 3TIEB 3TFKD 5SWZA 4DVRH 1MJ8L 2G60H 5K93A 1J9CT 1HQRB 5F1KC 2GW5A 3E6FA 1AC6A 1EEYA 3UJJL 3OB0H 2Y07L 3U36B 3ZTJH 3ARFB 5DJ8A 4LSPL 4UNUA 1SY6H 5JW5A 1OARL 1T21A 3ZMRA 1VADB 1A1OB 3NVQA 1IC1A 4HWEL 5FV1L 3GDBA 4OQTH 3QXWA 2Q8AH 3MUZ1 4JRYE 1AXTH 4XC1L 3VCLB 1A6UL 1H5BA 2Z35B 1MWAL 5J56B 4NQED 1DBJL 1NFIB 5CIPH 3VXRE 1FNSL 4ZS7L 1KCRH 2XKNA 5LKNA 4OLVH 3AMKA 4RMTA 5J9PA 5FOBB 3CPLA 1L7IL 4YDVA 3BKMH 5KVFL 4JQXA 2C3HA 2I60H 1OAKL 3HAEA 1OLZA 4MA7L 1CFBA 5DEZA 3ZHLA 3AAZB 3IGAB 3I02A 2E7LC 1E6OL 4U2ZA 4MWFB 2H2PD 2YC1B 1BIHA 4IOFC 4X6FA 1K5NA 4NN5B 5FHAH 4NQSA 1QBMH 5BV7C 3CZFA 5ACZA 3EO1B 3DV4B 4RISH 3KLHC 3O3UN 4XVUC 5T1KB 2ZG1A 3WNMA 2YN5A 1CDCA 3GJFK 4LHUB 1PKQE 2CK2A 2Y36H 1JGEB 3S96B 1DQDL 4S1QL 5DD6A 3MBXL 4I1NB 2PR4H 2DLIA 4IRZL 2ZUSA 3PGFH 2VZTA 2W0FA 4IRSC 4JG1L 1HHKA 3S36H 5C7XL 3OKKA 3GKWL 5IB3A 3VGAB 1FNEB 2VWEE 4KK6D 4RA0C 1KCVL 3O9WA 1L0YA 1WBYB 4F9LA 2QSVA 2AAVA 4N90D 5CEXA 5FA3A 2ESVE 1P5VA 4GAFB 1Q0YL 5IHLB 1U8JA 3GB7B 4W70A 4MAYD 1I1AB 4Z7UE 1JGLH 4Q9QL 1J7VR 4YLQT 3QAZC 5DD3L 3A6CL 4RQQB 4XPHL 1MSPA 4HHAB 3V2AR 3IJHB 3MGTA 4I0PB 1HE7A 5IFJA 4KY1H 4GXUM 5JHLH 4IDJL 4YHYC 1QSED 3O45A 4NRYA 3PWPA 1WV7T 2B39A 3MC0A 5E00B 3H9YA 3WUWB 1IGML 3MOAH 1ES0B 4FXKB 3VFGL 3P4OA 4E9LA 2YSSA 2YZ8A 1KELL 1X7QB 4GW5A 4X8XA 3L3DA 5HDBE 2NY6B 2R1YB 4H20H 1FH5L 4HAFA 4OFVA 4EI6A 4LF3B 1ZTXH 3GSXA 1T5XB 1OVZA 2Y7QA 3VFSB 2F74B 4F2MB 1QYGH 2IAMD 4HC1A 4JFEB 1OCWL 1U8KA 4IMKA 4FG6C 3TT3L 1TQBB 2NPLX 1PFCA 3QDGA 5DRZA 1IQDB 1D5MB 2VLME 5ITBH 4OFKA 3VFNB 1RURH 4GG6F 1DDHB 3ARGC 1YMMB 2XA3A 2R39A 1Y18A 1DQQA 3EOTL 5EFIA 1U8IB 4YO0B 3OKYA 3K8LA 3WFHB 3DRQB 4PJIB 1G9NH 1AFVL 2YD2A 3QUXC 4MXWL 4OF3A 1ZSDA 4M8VA 5FK9B 3MLXL 5JR1L 4MHHG 1BVKB 1M7XA 2VDRH 4WO4B 5IHZB 4KUCF 2DQIL 2R2EA 3JVGC 5B38A 4LARH 3MLWH 1FNHA 4XVTL 5D7KE 4KPHL 4LPYA 4GW1A 4LSUH 5A1AA 3S5LA 5LGJA 3I50L 4NO2B 5HY9A 1OTTC 4FABH 2AKRA 3U4AA 2W9EL 3MRKB 4D9QE 3SDXE 2DTMH 1HQ4A 2ITCA 1LP9F 3CVIL 3EUUA 4HQQL 4KROD 5I1JL 1UZ8A 4FFVD 3IFNH 1LO2H 1IT9L 4ISVB 1FL3A 3MV9D 3VXSE 2FR4B 2QQKH 3PQYD 4U1HB 4M43L 2YD6A 3QQ4A 3U46A 5K9OB 4PREA 3WXWH 1ORSA 3FONA 1NANI 4NRXA 1PEWA 3IKCB 3IDYB 3NZ8B 3G6AA 5BV7B 3FKUS 4F9PC 5D5MA 4OLEA 3MV7D 1ZS8B 3BDBA 4WHYH 1DL7L 4MNGE 1DLFL 1C5DA 2XI9A 3N1MC 5DA0B 3P40A 1YQVL 2A77H 3MPCA 4Y16D 5BMFH 4BQ8A 3MREB 5TE7L 3RRQA 3H3PL 5TGBB 1KLUB 3REVA 1RVFL 5DUMH 4J6RL 4DUVA 4JR9H 1FSKB 4R7NA 2L0DA 3P30L 5FO7A 3S34H 4JFFB 3WS6A 4Y2DD 4J3XA 1NEZB 3V6BR 3O3AB 4Z0BL 5GS2D 2ZCKL 3VFWA 4P2RD 1WBZB 3LKQB 4N0UE 4YXHH 1P9MC 5MEOA 1KJ2A 4F37F 3F7VA 4PJ8C 1QFWM 1AE6H 3B5HA 1PYWA 1WZ1H 1NFKA 4PY7A 3U7WL 3QFJB 3CIQA 4WTWA 3BRDA 1HEZA 3FN3A 3LRGA 3VXNA 3UZVB 5FUCC 1BVLB 5C9KA 3NCFB 1HYRC 4WV1C 2ID5A 3EFDH 2Y6SD 1RIHL 1WT5C 5KSAA 4QWWC 4HUVA 1XZ0B 3HI6L 4P23A 3TGXA 5ALCH 2EEBA 1UZ6F 4MHHI 4PGZA 1S7WA 5F7EH 5D72L 3MXVH 1KCSH 4EBQL 4DW2H 3HI5L 3G6JA 3HNSL 1RHFA 3CX2A 3LEXA 3FHAA 3D87B 3O2WH 3DVGB 5LQBL 3PHOB 4LPVA 4U6XB 2F19L 5DZNA 4X8JB 2PCPB 2PTTA 3HE6B 3PWJA 2OTUB 4ONGL 2PW2A 1IAII 3OKEA 5F88B 1TCRB 3BPLB 1A0QL 3EDJA 2BVUA 3RTQD 2DQEH 2AV7A 3UTSD 1SJHB 1OD9A 1GC1L 2AJXH 3KPSA 4OCXH 2FNBA 4L4TE 5JXED 1VKXA 1UM5H 5GJSH 4FFYH 2ORBH 3G08A 4ZUWB 2NW2A 3GUTB 3UPRA 1PZUB 4M6OH 4MJIE 3E3QC 5EC1B 3BKJL 1YQ2A 1EVTC 1NCDL 3FZUC 5FF6B 1RUKH 5HJ3A 4JDTH 5EZOL 4ZUSB 3F6LA 3A0OA 5I6XC 5IF0A 4YHPB 1J8KA 2WMPA 4AEFA 4MMXC 3QDJA 3B3IA 2X7LB 4FFZH 5C08D 1NC4B 4HK0B 3C6LA 1EHLL 1ZANH 1CF8L 1T3FA 3QZWB 4ZO8A 5GGVY 4I18C 1G1CA 4XCEB 3BUYB 5IIEB 1YYLH 3HLAB 5TDPB 5H35B 2D7TL 2YUXA 3QCTL 2E3VA 1U93B 5JNYB 3QIUC 1M7IB 2WLZA 2VDNH 2IF7A 3BZEB 3KYNB 3O6FA 4J3SA 4PJ9B 1ODAA 4OM0H 3QXDB 5I1EL 1ZLUH 4QNPE 4EUPB 4S0TD 4JFHD 1OAXL 5EO1B 1H8OA 2UVEA 3CUPB 4MD5B 4G6KH 5D1ZC 5J8OA 5I19H 4Y4HD 1Y0LB 4X0KB 1UXSA 4G8GD 2AEWA 4GT7A 2J4WL 1YEJH 4HEPG 5GGUB 1YUHA 3UZEA 3PL6C 3BGMA 5GGSB 2APVA 4KHXL 2CRYA 2NNAA 4OTXH 4F3FB 4H0GA 2VXTL 4X80L 3IFPA 4X6DA 2R4SH 5DWUH 3ZKXC 4XNXL 4CMHC 3I6KA 3HC0B 5HXMA 3SDCB 1NCCH 5CZVH 1J10A 4POZC 4U6HA 5GSVA 2VAAB 1OP3K 2P5ED 2DS4A 1HHGA 1CFSB 1QFUH 1D5ZB 4JFYB 4PBWD 5D7IF 4YHOH 4PJAE 2PYEB 3DUUA 1XGYL 1IRAY 1JZ6A 1WITA 4WW2C 1A9BB 1G7QB 2W91A 4Q58C 2B7DT 4MJ4A 3BWAB 4YQXH 5CP7B 3MACH 4ERSH 3UDWA 4FQLH 2ZOKA 4DN3H 3CH8A 3QWRA 1WC7B 2E8ZA 3GZKA 3IJSB 1N2RA 5DC9B 4R96A 2GAZA 3FO0H 4DKFL 4NDMB 4BZ1H 4FZ8L 3QQ3A 3H7BB 3CVHL 1JUFA 1I9IL 4C56A 5IEHA 2XN9D 5EBGA 1NGZA 1U8MA 2AK4A 3C5SA 5LXGL 3WLBB 1G7JB 3KYMA 5CEYA 1U3HD 4M6AA 5D1XD 4P0DA 4P4KD 4KQ4L 3CFCH 1YEHH 1XCTB 1CFTB 1MI5A 5BS0E 4ONOA 5DVKA 3AMLA 1Z9OA 5I73B 3ULVE 2OP4L 4XX1G 2B8OT 1W0WB 3FQTA 3HS0A 5I6XB 2EDNA 2GYSA 1HSAB 3WEXB 1F5WA 2BSTB 4PRIA 2Y25A 3KG5A 2X41A 5MI0C 5IK3B 2HKFH 2HTLC 3HG1A 3NCEB 3V6OC 3REWA 2QTEA 2A6IA 3FB8B 2M26A 1BLNA 4O2EB 5B3JF 3K46A 5EZLB 4JFEE 4U2YA 2DKSA 1LEKA 5JLZB 4Q9RL 5IP4A 2B5IC 3IAGC 4O2CB 1MJ8H 3UPCA 3MNVA 4N1HB 1YMME 3UJJH 2OL3A 5GGSY 2Y07H 4LSPH 4G42A 4PJIE 3CSGA 1OARH 1UJ3A 4UAOB 2X6MA 5CEZD 3F7QA 4HWEH 1YY8B 3F7PC 4PRPB 4OF0A 3UBXA 2J8UA 2HLAA 1KTKE 4XC1H 1A6UH 1DQLL 2X42A 1MWAH 5L2JA 3H9SA 3L1OL 1DBJH 5ICZA 4XGZA 1FNSH 1LO5A 4ZS7H 2H32H 3BJ91 3I3DA 2OQJB 2V2WB 3WNPA 1S7SA 4DQOL 5C0BA 4BZYA 3ELAT 1OAKH 3FFDB 5CAYB 4HFWA 1XIWC 4MA7H 3ZE0F 1LK2B 5DRWB 3LN5A 3ZKXB 1JNJA 1E6OH 5D9SB 4PG2A 5I1AB 4MQ7B 3WO4B 4EI5C 1Y6MR 3QXUA 4KWUA 1BMGA 4XXCC 4KRMB 5A16A 4EIGB 4X9FA 4GG6B 5KSUA 1V7ML 3F7YA 4MJ5B 3FO1A 1H3PL 1CLZL 1IGCL 2VITA 1EHXA 1HOCB 1NANH 3VD4A 4RNRA 1DQDH 1SEBB 4S1QH 3MBXH 2WUBL 4IRZH 1T5WB 3DMMC 1R3KB 4NQEA 3HMXA 5DFVC 3STZB 4JG1H 3W11C 5C7XH 3GKWH 1E4WL 1QNZL 2BOCB 3QNZB 4R90L 1KCVH 4LPUA 2MQ3A 3U6RA 5E6ID 5JIPA 4M61B 3DX6A 1Q0YH 4L3CB 1J87A 5ITFB 4JFFE 4FQQA 3RVXC 4NKOA 4Q9QH 4LLQB 4L29B 2RB8A 2BHYA 1LP9B 1KN4L 3A6CH 1CGSH 3Q1SL 4H1LG 5DD3H 5IMMB 4BSWA 4XPHH 3PGCB 3D25A 4G43A 4UV7L 1ETZB 4V1DB 3QFJE 2GSGA 2A83A 4BH7B 4IDJH 1R5IA 3P9WB 1OY3B 4WDIA 4YZFF 1CD0A 3HUJA 5DA4A 5KAQF 1IGMH 2WW8A 4IRJC 5ICYB 1QLRB 1KELH 1EHNA 3TO2A 2Q76A 5ID1A 3HMWL 2LV4A 3LAFA 4OF5A 1FH5H 3B9KD 5KSBA 5KANG 4IMLB 1RZIA 3W0WD 5ENWB 1CDUA 3MBED 1OCWH 4OKVA 4PR5B 1OM3L 1LD9A 1INEL 1HKLL 3OX8A 5HGDB 1LGVA 5GHWL 2EDJA 2OSLB 1NGXB 3SKNA 3CLFL 4MAYA 2HG5A 4FTVD 3RKDD 4NC0B 4AG4L 5DQDL 2CD0A 4G8IA 3BH8B 3ZKND 4CADA 4YR6A 3RGVD 3EOTH 2MMXA 1SVCP 3WL9A 1AFVH 1WQVT 4MXWH 1EBAA 2NY0D 5H94B 3MLXH 5JR1H 2XG5A 4GG8A 4X4YA 1QSEA 5D5MF 5C2BL 3IDIB 1FFNA 1MFEL 1MJUL 2DQIH 1YPZA 4XPAH 1S9YB 5JDSA 4XVTH 5DUPL 4CRPA 5EIIA 4KPHH 5E1AB 5BRZD 2IQAB 1KN2L 5JTWA 2V5YA 5IJVA 3I50H 4MDJB 4URTB 3JV4B 5AUMA 3O2VL 1LEIB 1MHHB 2WIIB 4AEHL 3A6OA 3LV3B 2W9EH 2IAMA 2R9HD 5J1AA 2X4NB 1CR9L 2UYLA 4PP2B 5BZWB 3ZLQC 3SJVB 4IS6B 1V3MA 2AS5M 4HQQH 5I1JH 3TH3T 5ETUA 4X4XB 2I9LA 5M94B 1XIWB 5KVEL 1IT9H 4OZHA 4X9GA 4GRMA 2F54D 1NDGB 3TA3C 4M43H 4GS7C 1WTLA 2JJWA 4HUUA 2JLLA 1G1YA 1VESA 4U31A 4TQEL 4XCYA 4JO1L 4MJ6B 3T0EC 2OJEB 2VIRB 1OQOA 2AERT 2D7QA 1IEHA 2R1WA 2YHGA 5FYJD 3QCUL 2HVKB 3SCMB 2DL2A 3EFFA 4UILL 1DL7H 1DLFH 1BJ8A 3I6LE 1MCLA 1XT5A 1QZ1A 1YQVH 3IRZA 2J6EL 4YHNB 5TE7H 2DYPB 2K3TA 3H3PH 1Z9SA 5DFTA 1FAIL 1RVFH 1QPPA 3W39A 2I9TB 4J6RH 2X4RB 1H3WM 4OJFL 5D2LA 5EOTA 3MZTA 1L7TL 3P30H 3KJ4C 4APQD 1G7PB 1H5BC 4KI5D 2C4FT 3MLYL 3G6JF 1G0XA 2OTWA 3QUZD 4OZ4A 4LNRA 3VXUD 1S5IL 5EORL 5IWLC 4Z0BH 2ZCKH 5DFWH 2WZPD 1OP5H 2KQMA 5KANI 3GGWA 4JQXC 1MCFA 3VI4E 2JB6B 3MV9A 5I1IL 3VXTB 4E41B 3PQYA 2EKSA 5HYSA 2BNRB 1ZVHA 3OG4B 3U7WH 2X1PA 3AXLB 1XR8B 3VFVA 1TITA 3MJ7A 5F7UA 3C2AL 3RWJB 3NFPB 4F8TA 1RIHH 5C8JB 3MV7A 4P2QD 1IZKA 1LE5B 4GO6B 3HI6H 3QSKB 3SHSA 3LKPB 3BXNB 2PYEE 5I8EA 3W9EB 5ANMA 5FUCE 2X9YA 2JJUA 4YHIA 1I8MA 4ZFOL 3ARDA 5JHDA 5EBLA 3WIFA 2IANB 4KTYA 5D72H 1RULL 3LRHA 3PIQB 1VERA 3DWTA 4EBQH 3HI5H 1QFWL 3KGRA 4Y2DA 3HNSH 2ATPA 4RBPK 2NTFA 1KXTB 2EXWD 4P2RA 4RDQG 2W07A 5LQBH 3FQWB 2X44D 2F19H 4F9LC 1A6VL 4FFWD 4PTTB 2H2SC 4CDHA 2FIKA 3JV0A 4ONGH 1EH9A 3OJ2C 1A0QH 3O3DA 3RPIB 5CILL 1GC1H 5I9QC 1IEBB 1P1ZB 5LVEA 5IBUG 5I1DB 3TCLA 4WU7B 3BPCB 3JTSB 2X4TA 2JK5B 4AIXA 4FQHA 5CWSB 1KNOB 2PO6D 4YBQD 1CL7I 3BKJH 3GMLA 4PJHF 3SY0B 1NCDH 3CFJA 5D7IB 2IWGA 5EZOH 3RWGA 2HN7B 3CLEH 5I1HL 2EIBA 3KXFD 3E3QE 1H15A 2GIYA 4OZIA 1F13A 4QF1A 3HCVB 1EHLH 4EI5A 1CF8H 1FZMB 1ERNA 4PJDF 4QXWA 1IE5A 3X11B 2YBRB 3AU1A 4K7FB 4XNMB 1JZ2A 5D6DC 4X6DF 1AQDA 5E2VL 1RUQL 1SJEA 4IMKC 3RTQA 1CLOL 3UTSA 4PRAB 2D7TH 3QCTH 5JXEA 5C6PB 2BXZA 1BBJA 3VU2A 4MD4B 4KJYA 4NBXB 2BVOA 5TPWL 3QDAA 1GC1C 1KCLA 1MFCL 5B3NA 5EO9B 4HZLB 4PJ5B 4RGNB 3T0EB 1E4KC 4HMCA 3EJZD 1FV1B 5I1EH 4V2BA 3EDEA 4JPIA 2XV6B 1OAXH 1S7RA 2XTJC 4M6NL 2EDQA 4ODVL 1HWGB 1EEYB 4XAKD 2J4WH 5DJ8B 5C08A 4GBXB 3MLTA 4UDTB 3VRJA 3LD8B 4PRPE 5FHBL 4WWKD 2QJDA 4KHXH 3UPAA 3MGAA 4MCYA 3U83A 1H5BB 1R3LB 2VXTH 1JE6A 1GGCL 4X80H 3VDAA 1ZVYA 3FOMA 2XKNB 4XNXH 3CPLB 4P5TD 4YDVB 4H25A 4J12A 1WBXA 5L88H 1KJ2H 1QTYT 5L6YL 5IM7A 2MQ0A 3HAEB 2Y23A 4NBZB 3I02B 3CXHJ 1XGYH 2HRPL 4FXGA 1G6RA 4X6FB 5F7FA 2EC8A 3TP4A 4Y4HA 4KU1A 4NQSB 1J1PL 1I1RA 3CZFB 5ACZB 3TYFA 4GG6E 5I0DA 1F3RB 4G8GA 3LS4L 2Q7NA 4ELMB 5IB2A 2AQ3A 3ALPA 3SQOL 5DO2D 5DD6B 3Q6GL 4KKAC 4L8SC 4DKFH 5DJXA 3T0BA 3BSZL 4FZ8H 2W0FB 2VRAA 1RIUL 3CVHH 1HHKB 3OKKB 5IB3B 1I9IH 4ZO9A 3O9WB 4XPGL 3WS6C 3GSNA 3BN9D 5LXGH 2VDML 4WEMB 2P5EA 5F3HA 5CEXB 1MVUA 3Q48A 4TUKL 5FA3B 2O93L 1XGUB 3CC5A 4MA3A 2FSEA 4LVOC 3IDGA 4DGYL 4KQ4H 3MODL 4U05A 2VQ1B 1BWWA 1LP9E 4PRBA 1L4IA 2I24N 3E8UL 3WKML 5I66B 5ESAA 3GO1L 4V1DE 5J1TC 3F8UB 2E9WA 3QUKA 2OP4H 1FG2A 5KSAC 2J8UF 3OB8A 2D7NA 5IFJB 4P23C 3PABB 5CZKA 5EUKB 5JO5B 2ZUQB 3O45B 4NRYB 2FATL 1B2WL 1JI1A 4P99A 1U0QA 3P4OB 1A02N 4P46C 2YSSB 2YS4A 4CJ0A 2HT3D 4XCNA 4GW5B 3L3DB 2XN9A 5E8OA 1DUYA 1PY4A 1M05B 5C2UB 4EI6B 2H3NA 1RZKL 4OZFG 4K8RC 3RBGA 3GSXB 2NXZB 3P73B 2Y7QB 4N5EC 2XWBA 3R0NA 1U8KB 3N50A 3QDMD 4Q9RH 1U3HA 3V6OE 3PWLA 3QDGB 5D1XA 5DZOA 5DRZB 1CYGA 4GLRI 4P4KA 4JY4A 4R0LA 4JJ5A 3DX9A 4UUJA 5ACLA 5EFIB 2C3VA 2GUOB 3D69A 3LH2L 1NGPL 2ZUWA 1XF1A 4GRWH 1Q8MA 4OGYL 1PG7W 1KBGL 4LCWB 1DQLH 2WNGA 4ZOAA 3L1OH 4PFEA 4YE4L 4L8DB 5HHOE 3WDIA 4O2FA 2MFNA 2R2EB 4JRWA 1CU4L 4K7PL 5EOCL 3D3VD 4F33A 4LCCA 1A9EB 2C3XA 4DQOH 1Q9LA 2YD1A 2FWOA 1QACA 1I75A 3S5LB 5LGJB 2E7BA 1UZ6E 5HY9B 4IIQB 4XAWL 1TPXC 3AROA 2AKRB 1HIML 3SJVE 4LP4A 5CBEA 3RWDA 1HQ4B 2ITCB 3HNVL 5BO1L 1UZ8B 2BSSA 1YNLL 2LE9A 1FL3B 1K8IA 4D94A 1NUGA 1V7MH 3OPZL 1YY9D 1H3PH 3U46B 1CLZH 3BGFC 1IGCH 4PREB 1ORSB 5F72S 3FONB 4A6YA 3HUJF 2Z4QA 2ARWA 4Y0GA 5D5MB 4FQJL 3Q5OA 4BFGA 1I7UA 1TJGL 2FEEI 1E4WH 1N3NA 1QNZH 4JFOA 1C5DB 3WFDL 4R90H 3OGCA 2OMNA 5JZ7C 3TJHD 5KSBF 2ZSVA 1UGNA 4KGLA 4L3EE 3REVB 3FO9A 4Z5RA 4WUUB 4R7NB 1NC2D 2DKUA 3VD9A 5FO7B 1OWRM 5E5MA 5C3LD 3EJJX 2MPAL 4NM4L 1F4WL 4YXKL 3W2DL 4DAGL 2AEPL 1IGJB 3BZDA 1KN4H 3Q1SH 3VFWB 4WI3A 1CICD 4E41E 2DLEA 1SJVA 4UV7H 5MEOB 15C8L 3UTQA 1KEGL 3F7VB 2BNRE 1PYWB 2DQHL 4PY7B 3I9GL 4KZDL 5CD5C 1HEZB 3NIFF 4WU5A 3TEUA 1DANT 3WJJA 1YPZF 1P7QD 4S2SA 3WLWD 1LQSR 2UY7A 1G7HA 3HMWH 3VFOB 5E24E 4P9ML 3QRFM 2AXHA 4U33A 5E6IA 1S7WB 2IANE 4KK8C 5JUEL 1OM3H 2EDTA 1INEH 1HKLH 2CPCA 3RIAK 4LCUA 1X9QA 4BUGA 3CLFH 2ZKHL 4HJJL 3G6JB 4OZHF 1S7QB 4AG4H 5DQDH 4EZMA 3LEXB 4HKZA 3MTRA 1MAKA 5D2NB 2PTTB 3PWJB 1NJ9B 1Z5LA 2OYPA 2PW2B 4P9HL 3OKEB 1V3LA 4L4VD 4RA3A 3MRMA 2AV7B 5CSGA 5C2BH 1VKXB 4YDIL 3U30C 1MFEH 1MJUH 1VDGA 1CQKA 5IGXL 2CLVA 5GGTA 1C5CL 2OJZL 3G08B 2NW2B 5E4EC 5DUPH 3UPRB 1Q94A 1KN2H 1X5ZA 3DGGA 5D7IE 3O2VH 2EXYC 3B9KA 5D2LF 5HJ3B 3C09B 4AEHH 1B0GB 2PXYB 5ALBL 3W0WA 3MBEA 5J7CC 1CR9H 3HNTL 4NCDA 3QDJB 5IW1A 2V2TA 1MH5B 4FTVA 4XHQA 3DROA 5CD3B 4QOKE 3C6LB 5KVEH 2ICWI 1TPXB 1T3FB 3RGVA 1UENA 1D6VL 2WANA 1KTLA 2J5LC 3ZSTA 2FLRT 4WNQA 4JO1H 3S37L 1T7YA 3K2UL 5GS1A 5J3HC 4ZNEE 4LVHC 3VFTA 5CP3A 3H3KA 4JEGB 2P8LA 1NLDL 2DLFL 2NXYC 3QCUH 2Z8SA 5I8OL 4ODUA 4O51B 4UILH 4CU7A 2CIIA 3QG7L 4L4TD 3QIWC 1JHKL 1I85A 3CK0L 3O6FB 3T0EE 2J6EH 5BRZA 2EIDA 3L9RA 4N9GA 2DLTA 1FAIH 3ZE2F 4PJHB 5SWZE 5GISL 4OJFH 5D7JC 1L7TH 1RV6X 1JYXA 1AQKL 4OKDA 3MLYH 2D2OA 2DAVA 2QQNL 2YKLL 1UXSB 5E8DL 3EDFA 3WCYA 1MLCA 3MUJA 1CT8A 1S5IH 5EORH 1T22B 2BC4A 1YUHB 4LGSB 5J11B 2F54A 5I1IH 1ZWIB 3BGMB 4PJDB 4D0CA 3ISWA 2NNAB 5J6GA 4D0BB 4UOW1 3RNKA 1QRNB 1T1ZA 4W81A 2X1WL 1OGAD 3IFPB 4X6DB 3C2AH 3L95A 1QA9B 2YUZA 1GZPB 2LVEA 3TFKC 4FQIL 3G5YA 4HUNB 4U6HB 3B4NA 5GSVB 1QP1A 2XPGA 3DECA 2Y5TA 2XZZA 1UXWA 4LLWA 3PWUA 5GRVL 1HHGB 5DK0A 5B3JE 3JSSA 3ULUD 2PTUA 1MCOL 1MIML 4XI5D 3BIBX 5KVGL 2ZG2A 4QT5A 2JTDA 3OQ3B 1RULH 2DI8A 4UOJA 3K1DA 5DEFA 3SGJA 3EAKA 3VA2C 4APQA 4OZIF 3AS1A 1QFWH 3QUZA 1DBBL 2NY2B 1OP5K 3VXUA 3EZ8A 1HXYB 4QTIL 4U1JA 1CK0L 3GRWL 3MLRL 5F9AC 1A6VH 2OXGA 1PSKL 3A67L 1N2RB 4R96B 2GAZB 2DM2A 1ZKAA 2HVJA 3QQ3B 4J3UA 2Q87A 3ZT6A 3JV5A 5CILH 4NCC2 1JUFB 1F3JA 4GMSL 1U42A 4C56B 3P0GB 5IEHB 4DWHA 1QBLL 1NGZB 2H2PC 4ZOEA 5EC2A 2AK4B 4FOMA 3D48R 3ARBC 3C5SB 2ERJC 2ZOLA 4NC1E 4JVPA 3KYMB 5CEYB 25C8L 2UZIL 3LDBB 3ZE0E 4OZGB 5D4QA 3WFZA 3OXRA 2P42B 4LFHG 5DC0A 3RL2A 4CJ1A 2CXGA 3OF6A 5B8CB 4P3DA 5E4EB 5I1HH 2IBGA 1MI5B 4PGDA 1J0IA 2YRLA 2EE3A 1MCWW 5J89A 4JFQA 4KK6C 3FQTB 3HI1A 3DX7A 3PWPE 4ZSOA 4LU5L 4NYLA 4QLRA 4PRIB 5E2VH 1KXVC 1RUQH 1O7VA 2W60A 2BY1A 1CLOH 3HG1B 1CXHA 2IQ9L 2YD5A 1NKOA 1RZ8A 5FM8A 2F5AL 2MKLC 3SDAB 3FN9A 4PTUA 2A6IB 4MAYC 5E5RB 5TPWH 1BLNB 1MFCH 3T1WA 3O4OC 2PO6A 1E27A 4WI2A 1LEKB 3QDGE 1BEYL 2DMKA 4GLRH 4OCWL 3NTCL 1JPFA 3KPRB 2NXYB 3BPOC 4M6NH 3MNVB 1NAMA 1AXIB 2QQQA 3BKCL 3DJ9A 4ODVH 1UCBL 5E99L 3KXFA 2OL3B 4N0FA 1Z0MA 2W0PA 1UJ3B 4C4KO 2XTJE 5FHBH 4FMFA 4Y19A 3UBXB 2J8UB 2VQUA 4I0PD 4JDVB 3ARXA 5L2JB 3H9SB 1GGCH 2GJZA 5M95B 1LNUA 3DIFB 4YZFE 2IAMC 4GXUN 3MNWA 2XQBL 1IAKA 4RRPG 2O61B 2AXGB 1S7SB 1RI8A 5C0BB 1MCNA 3WE6A 3W81A 5L6YH 3HFMH 4HFWB 2UV3A 2ICWJ 3FB5A 5FKPB 3RDTC 2R23A 3D0VB 3LN5B 2I26N 1V5JA 2HRPH 1O0VA 2CLZB 1J1PH 1TZHA 2VLKD 5A16B 1MHEB 3TJEL 3LS4H 3OKOA 5KSUB 3F7YB 3FO1B 5DJ2B 3O41A 4NCC1 1T7WA 3O11A 5F7WC 4WWKA 2VITB 3SQOH 4RNRB 5BVJA 3Q6GH 4TNVK 1W72A 5D5ME 4AQOA 4NQEB 5C09D 2EC9T 3BSZH 1RIUH 4OFDA 3RAJL 1TZIA 4PJEA 4P5TA 4NFBA 4XPGH 4GAYA 2VDMH 4FFVC 4HGMA 4TUKH 1YZZA 5BOPA 3JZ7A 3DX6B 4OCMC 1A22B 5F6IC 1UACL 2GSIA 4FQQB 4DGYH 3MODH 4OCSL 3WHE1 1YC8A 3PWVA 2ERJB 3KWWA 4M7LL 3X14A 3E8UH 1O5DT 3WKMH 4BSWB 3QIBD 3D25B 3L7EB 4G43B 3RWIA 3GO1H 4S0SD 3DYPA 3DXAD 3TC9A 4H1LA 1J0YA 2GSGB 4BKLB 3WV0A 4TTDD 1R5IB 3KLSA 4Y16C 4MD0A 2FATH 4WDIB 1B2WH 5EIQA 1ZHBA 3HUJB 4NQCD 2W9LA 5DD0H 5FYLE 3WHXB 3TO2B 3NPZB 2Q76B 5ID1B 1AKJD 5J6HA 5FM4A 4Y2DC 1ZA3A 5KSBB 1CVRA 4PGJA 3K8MA 3V5KA 1RZIB 4L5FL 2WLYA 4OKVB 2BMKA 4LEXL 32C2A 2ZJSL 1LD9B 4K71C 4PV8A 3VE0A 1YEGL 3OX8B 2NZ9D 3M8OL 1AGBA 3G6JE 4MAYB 1CDJA 2HG5B 3MO1A 4G8IB 4CADB 1AHWB 3D0LA 2CIKA 4PRHB 4U1NA 2WV3A 4YR6B 4K23L 1U8QA 4H5SA 3UTZA 3LH2H 3WL9B 1NGPH 2YEZA 3E0GA 4NN7B 3GMRB 1CIUA 4OGYH 1NAML 1KBGH 1N8ZA 2YD9A 3KPSE 1QSEB 5DVLA 4R97B 4YE4H 1FFNB 3RGHA 1T0MA 1YPZB 1TMCB 1CU4H 4K7PH 4KVCL 5EOCH 5JDSB 1EGJL 5EIIB 4WEUD 5D96C 1PZ5A 1K3ZA 5TDNA 5AUMB 4XAWH 1HDMA 3D39A 4ZQKA 1JWSB 5J1AB 1HIMH 2UYLB 5GZND 3QDMA 3SGKC 3T2NL 3ZYOA 5SX5K 3QDJE 3WO3B 4QRRD 2V5RA 3HNVH 5BO1H 1FP5A 2DF3A 5GRUL 5ETUB 3ZKQD 1YNLH 1CWVA 1BOGA 4OZHB 1ZAGA 3MYJA 3DVIA 3PGDA 4KDTA 3OPZH 4Z95L 4HUUB 1ZGLM 1FVCA 4K2UL 3UC0L 3HE6D 2YPKA 2FZ3A 3BJLA 3N1PC 3T0DA 1JZ5A 5HYFA 2R1WB 4FQJH 4AEEA 3JWOL 4ORZC 3NPSC 1TJGH 4KTDL 1I9JL 1C12A 3O2DL 3RU8L 3D3VA 1RZ7L 2E7MA 2VYRE 3WFDH 4EOWL 1MY7A 2SEBA 2V7HA 1HSBA 3CFDA 4KRLB 4LEOA 2JIXB 5JW4M 3FAWA 1MNUL 2A74B 1F3DH 5F7DA 4EIZC 5D2LB 5EOTB 4JO4L 2LFGA 2MPAH 4NM4H 1F4WH 4MNHA 2V2XB 4XNQB 4YXKH 4JN1L 4OZ4B 1ZLWH 4DAGH 4J4PD 3GMQA 4KROB 4LNRB 3T3MF 3OMZA 4M62L 5F89A 2X4SA 2VN4A 3S35L 3GGWB 3S6CA 3MV9B 15C8H 1NC4D 1FZOA 1KEGH 4NQXA 3PQYB 2EKSB 5HYSB 2MWCA 4ZXBD 4HFUL 2DQHH 3I9GH 4X6DE 5C0AB 4KZDH 3MJ7B 1ED3A 4ZUVA 4GQPH 1MCPL 3GIZL 5HI4D 4RWYH 4I9WD 5C0GA 3MV7B 4ODWA 4LLYA 2W59A 1DQML 1OL0A 4HLZH 4OGAD 1DQJA 1G7LB 4P9MH 5ANMB 5C3TA 4QRQA 1CG9B 1RMFL 4PJ9D 3FRUB 2EKJA 4YHIB 3ARDB 4HF5L 5JHDB 5ICXB 5EBLB 4XNUL 3E6HA 1JMXA 4EVNA 1CGUA 2OZ4A 1NC2A 4HWBA 5ID0A 4LFHD 3G5ZA 3OXSA 1IL1A 2ZKHH 5LBSL 4HJJH 4Y2DB 3AVEA 2ATPB 2BNUA 2A0LD 3MRJA 2NTFB 4JZJA 2ZSWA 4EN3D 1CICA 4QHMA 1RK0A 3PE9A 2FIKB 4HXAL 3SKJL 3OJDB 2VTFA 4P9HH 5T3XE 3O3DB 1FAKT 4QRTB 4LBEA 1A14L 2OS7A 4YDIH 4C56E 3VA6A 1P7QA 1C5CH 3AS0A 2OJZH 2AK4E 3GSUA 3TCLB 2X9XA 3GMLB 2BERA 3MRLA 1QLFA 1CXEA 2D03L 2UVFA 3CFJB 3KPPA 1EBPA 1X5HA 4PY8I 5ALBH 4AIZA 4RMUA 4R4FL 1F8TL 3HNTH 1IGFL 3NCYS 4HGWB 3LS5L 1MI5E 4OZIB 5IQ9B 4KXZI 4XVSL 4QF1B 3NGBC 1C5BL 3O3BB 1IEAA 5D6CB 4JO2L 5DD1L 3KS0H 1XGPA 5IBTL 2BJML 1D6VH 3AU1B 4RAVA 4PRIE 2QQLL 4G6FD 1SYSB 2R0LL 1AQDB 3H9HA 3S37H 1SJEB 3HG1E 4L4VA 3K2UH 4M02A 3RTQB 2F8OA 3UTSB 1U3HC 1EEUA 5D1XC 1NLDH 2DLFH 4P9HC 5A43C 1PX4A 1BBJB 2FO1A 5I8OH 4KJYB 2BVOB 3QG7H 1OOAA 1JHKH 3CK0H 5JMOC 5E94A 3G5XA 3DGCR 1MHCA 3QISA 4JPIB 2QEJA 4WY7L 3QNYA 1S7RB 1MQKL 5GISH 3LKNB 2IBBA 3NPSB 4BH8A 4KI5F 1T20A 1AQKH 2FJGA 4U1LB 2V17L 1JHLH 1WCQA 1AO7B 2QQNH 2YKLH 5E8DH 1LILA 2Z31D 4OLWL 1I9RL 5C08B 5E8NA 4EQ3A 4NQTA 3MLTB 3ILQC 3ESVF 4FQCL 3VRJB 2BOBA 4U7KA 2J8UE 2O5YL 3QQNA 2KKQA 1FBIL 3H9SE 2XIDA 1BQSA 5IMLA 3FOMB 3DO7A 4F7EB 1A3LL 2EYRB 2GT9A 4QXUL 1DCLA 5C0BE 3AFLA 4FQIH 4H25B 1WBXB 4K7PX 1NH6A 3FQNA 4KFZC 5IKCA 1J0KA 3MLSL 5IM7B 3RVTD 1KTDB 5GXBB 4L4TA 1KULA 4Z76A 1YEDA 3QUMA 4N0CD 4JO3L 1MCOH 1UKSA 1MIMH 5KVGH 1RIVL 3DOSA 4FXGB 1G6RB 3T04D 2C1OA 4Y4HB 2DJUA 1CIDA 1A5FL 4OIAA 3TYFB 2I5YL 1U3YA 4W4NA 1DBBH 4G8GB 5IB2B 4QTIH 2APFA 4YGAB 5DJCA 1KPUA 4G8FA 3GRWH 3MLRH 3JWDC 4JKWA 1PSKH 3A67H 1TVHA 3RL1A 4NQEE 3TN0C 1ITBB 5DJXB 5DJAA 1DN2A 1I8KA 1MELA 1OGAA 4YBLB 1JRHL 1MPAL 4GMSH 8CGTA 4Y1AD 1QBLH 1XCQA 1FC1A 3GSNB 2R0KL 4P2OC 1JTOA 3P9LB 4NOBA 4B0MM 1X3DA 2EIZA 5F3HB 5EPMB 1C08A 1MVUB 3MRFA 4Y5YA 2F9BT 25C8H 2UZIH 3BESR 3MUGA 3CC5B 1MUJB 4MA3B 5AWNL 4KMQA 3IDGB 1G7IA 4RAUA 2KBGA 3S3JA 2BVPA 3HR6A 4U1KA 4PRBB 5T3ZD 2ARJA 3TIEA 4I3GA 4ONHB 3WJJC 5E7FA 3MLVL 1YNTA 5ESAB 2EICA 1P4IL 3QUKB 1JHTA 1FG2B 1AY1L 1MLBB 5A2FA 3N1FC 4LU5H 3HUJE 1JMZA 5JW4Q 3U82B 4MZ2A 2IQ9H 3NGBB 2GITA 1KGCE 2F5AH 3V5DA 1NFIA 3BOVA 2XN9B 1OSPL 5E8OB 1DUYB 1ORQA 4N90E 3O3EB 5KSBE 3EOYG 2H3NB 5TE4L 1TTUA 2Y72A 2GFBA 3NBNA 4LIQE 3RUGF 1BEYH 5IV2A 1U3HB 4NO5A 4OCWH 3NTCH 1E6JL 2DLHA 3PWLB 4UBDD 5D1XB 2NY1B 1DTUA 5FIEA 4WUKL 2IH1A 4P4KB 4UB0L 3BKCH 2VMFA 4CVUA 3IGAA 4R0LB 1UCBH 3P9MA 4JJ5B 5E99H 12E8L 4MWFA 4PP1C 1MJ7L 2YC1A 4UUJB 5IG7A 5DGRA 4MXQC 3D69B 3EO1A 4EEEA 5I74B 3WIHA 3SDDD 4V1DD 1QSEE 5E2JA 3NIFE 3B9KC 4PY8J 3U7YL 5J13C 3V7MA 3S96A 1YPZE 4O2FB 1TDQA 3MBEC 4PJEF 2XQBH 5JPMB 5EU7E 4F33B 1JNLL 4LCCB 1J05A 1HHHB 5JXAL 4JHWL 4XRCA 1DBAL 3HR5A 5CZXD 3VXMB 3RKDC 1FNEA 5DK2A 3JTTA 4LVNB 2VKWA 4B5EA 1R24A 1WBYA 3EYSH 1QSVA 3RGVC 4ZMAT 3TZVD 5CBEB 3MLPA 2XWTB 2NY0C 2G5BA 2BSSB 4OZHE 1VFMA 3TJEH 4OD3L 2EEDA 3QR2A 4M1DL 4AZ8A 5T1MA 5CLWA 1ZT1A 4A6YB 2Z4QB 2X40A 4XB7A 5BOZG 3S37X 4XP1L 4OI9A 1I7UB 1GOGA 2R9HC 3RAJH 1N3NB 3RVWD 4JFOB 1ES0A 2BXYA 2XZQL 3OGCB 4WVRA 2ZSVB 1G9ML 4Z6AT 4ODTL 3FO9B 5D2LE 4Z5RB 2X4QA 2DQUL 4GQ9L 1T5XA 2IPUK 5CJ5A 2F74A 5E5MB 2ICWA 4HCRL 4OCSH 2M1KA 1G0YR 4M7LH 2LQRA 1IQDA 4QRSA 4RMQA 5IW6B 1D5MA 2VLKA 2XY2A 3MV9E 2Z93B 3PQYE 2XQYG 4GXVL 3UTQB 1WWCA 3QHZL 2YA1A 2A6JA 1MIEL 2JJTC 1FJ1B 2AABL 1Q9OA 4XP6L 3DRQA 3ZHKA 3VXQB 3AS2A 2YK1L 4S2SB 5C09A 3MV7E 4MNQB 1Q38A 1WJ3A 3W5NA 4APQC 1G7HB 4XP9L 5IHZA 4KI5C 3SCMD 3LHPL 1NGQL 3QUZC 5ANME 4YUEL 5CSBA 5DDHA 3EYQD 5JHDE 3ZE2E 5FGRA 4L5FH 2DYPD 5E6IB 3C87A 4LEXH 3KNBA 4QCIA 4S1DD 4KH2A 2ZJSH 1YEGH 1KPVA 4Y89A 4KGJA 3M8OH 4LCUB 3G04A 3EOAA 1KFAL 3MLZL 4NUJB 4P2RE 4HKZB 5ERWA 1BHGA 3QIBA 2R56L 4I0KA 4K23H 4KTEL 1VEMA 1DN0A 1XGRB 3C9NA 5DMYA 2M2DA 3DXAA 4K9EL 4HULB 2VUOA 1NAMH 2Y4SA 4LASL 3RBSA 2VUYA 2EO9A 3IDNA 2CLVB 5JOPD 4NQCA 2E8YA 4QHLB 4KUZL 4KVCH 1EGJH 1BPVA 2H41A 4M5ZL 3PWNA 1AKJA 3WIHL 1Q94B 4Q6IA 2Q6WB 4KKNA 3DGGB 4BQ6A 4LLDA 4WGVB 2NX5D 3B9KB 1K85A 5J13B 1WEJL 3I75A 3MBEB 3RHWK 3T2NH 2XXCB 4FFWC 3Q6FB 1REIA 4OZIE 1ZVSA 4R7DA 1T7VA 5IW1B 2V2TB 5GRUH 3DROB 1D6EA 1I7ZA 2Y9RT 3LQZA 2CQVA 3RGVB 3SE9L 3U2SA 3G9AB 3LKQA 1KTLB 4DVBA 4K2UH 1LO3L 2PO6C 4YBQC 3UC0H 4PB0L 3UTSE 5GS1B 3LEYH 3VFTB 1AGDB 2P8LB 4NNPL 3IB4A 3JWOH 3LPWA 3HZMB 4KTDH 3RWCB 1I9JH 4ODUB 1IGTA 3O2DH 3RU8H 2CIIB 1MJJA 1RZ7H 4EOWH 3ALXA 5I8KL 1LVEA 5BRZB 1FL6A 2AJZA 4MCZA 3DSNA 3L9RB 1AGEA 4N9GB 4TYUA 4WENB 3ULVL 1XZ0A 3EOBA 1MNUH 1F97A 4G7VL 3GSVA 1GGTA 4JO4H 1CXKA 4OI8A 4QRRA 4JN1H 3RKPA 5C08E 1MLCB 1CT8B 3GSRA 4R8WL 2BC4B 1A4KA 2F8VA 3S35H 3CX5K 1LO0L 3MGOB 4D0CB 4RDQF 4W4OA 5J6GB 3DVGA 4HFUH 3RNKB 1T1ZB 1MCPH 3HE6A 3EJZC 1BJ1H 3GIZH 3NCYP 4JDZA 5IMOB 2D31A 3QJFB 2AXJA 3K7UA 3BI9X 3G5YB 4LLUA 2W9DL 1WZLA 1CFVL 2D3VA 5FV2A 2Y5TB 1UXWB 2N7BA 3QJHB 4LLWB 1DQMH 1UWXK 2AJVL 3PWUB 3BPNC 5DK0B 4R9HA 2YA2A 3QEQB 4JFHE 1RMFH 4HF5H 4PJ5D 5DJ6A 4RGND 5EC1A 4QT5B 4XNUH 4LDEB 1P5UA 1ZLWK 3TCXA 1A7NL 1QPXA 4G8GE 3I3EA 1FNLA 5LBSH 3FQXA 4J4PA 3VXUB 3S3SA 4Q9BA 4PYHA 1F02I 2X7LA 4JN2B 4P5TC 4GBXD 4U1JB 1NC4A 4IJ3B 3QUYD 3PXHA 1HN1A 4XXDB 4HXAH 3SKJH 4ZXBA 1D9KC 5F1IB 3L5HA 2HVJB 1QHPA 2QADD 3SDYL 4OFIA 1A14H 1F3JB 4F8QA 2P46B 3GBML 5EC2B 3T1FA 1U36A 2P5EE 2ZOLB 5GS0D 1U93A 2KDGA 5IFAL 2F58H 3PV7A 1UEYA 1TNMA 2D03H 1I4FA 3RL2B 4N8PA 4PJ9A 2VZUA 3QXDA 5ADPH 1X5YA 1YN6B 2CK0L 1HI6B 3SGDI 4R4FH 3S7GA 5DO2C 1F8TH 3J8F7 5BV7L 2XZAL 3CUPA 3LS5H 5GGVL 4XVSH 2OBGA 1CXLA 35C8L 4G6ML 1HKFA 4PGDB 5LCVL 2OI9C 3TH2T 1KB9J 1C5BH 2V7NA 1IC4L 3E2HC 4TN9A 1RUPL 4EN3A 5DD1H 4JFQB 3HI1B 5IBTH 3DX7B 2BJMH 3RVUC 5L0QC 4ZSOB 2QQLH 4NYLB 1FGNL 2R0LH 4RGMC 1RZ8B 5E4IA 1X5KA 2XN9E 4PTUB 3NCMA 2JCCA 2G5RA 1E27B 2WBJD 2DBLL 2VAAA 4WY7H 3K80A 1JPFB 1MQKH 5FYJU 1D5ZA 3ZTJG 3FFCB 1N26A 2V17H 3TBVA 4NHUA 4OLWH 1I9RH 3HPLB 3QEUA 2HT3C 4FQCH 4JHAL 1UJTA 5H37H 4QO1A 3SGEH 4Y19B 2O5YH 3KPMA 5I16A 1FBIH 3VG9C 2VWEC 2DL9A 2GJZB 1XFPA 2NQCA 5KW9L 5AYQA 3IJSA 3MNWB 1A3LH 1IAKB 2PR4L 4QXUH 4HAGA 4HBCL 1DVFB 1FO0A 3AREB 4BFBD 4PS4L 5CSZB 3WE6B 2Q20A 1SVZA 5I75B 1D7FA 3BUTA 3MLSH 4M1CC 2O26U 4RRPA 3FB5B 2X1OA 3WMSA 3ULUF 2R23B 4QHNA 3T09A 3AGVA 4JO3H 1RSFA 4HUXB 5SV4A 4KDTC 2NXZD 2EDHA 4Z7WA 3T0AA 1Z2KA 2A9NL 5JIKA 5HI3D 1J12A 3RUGB 1RIVH 2IPTL 1ZMYA 4U1MA 1A5FH 1TZHB 3VGDA 2I5YH 5IB4A 3OKOB 1J1OL 2Z31A 3MR9A 3MUHL 1A7QL 2MCPL 4RFNB 4AQ1B 1X5LA 4D9RD 3O41B 5CEZE 3O11B 3BX7C 4WWKB 3LQAC 4I8DA 2APXA 3VMOA 5BVJB 1W72B 4ZUTA 3TBYB 1W0WA 4JVWA 4LCWD 3T77A 2FGWL 1JRHH 1NMAL 1F6LL 1QD0A 5GSRA 1MPAH 1TZIB 2FCBA 2AJUL 3TWCL 2R0KH 4GAYB 4ZOCA 3DYMA 2HT2D 4Q6YA 3DARA 3FT2A 4UU9A 4IBLT 3FB8A 3HE7C 2BP3A 3QCVL 2GSIB 5AWNH 1K4DA 4O2EA 4OT1L 1HHJA 4MJ2A 4DK3A 5JLZA 2COQA 3BD4A 3PWVB 4UNTA 1B9ZA 1UB6A 3X14B 5IB1B 1FZKA 4M93B 3MLVH 3D85B 5KOMC 3QHTC 3RWIB 3OBAA 1QEWA 1P4IH 5D1QD 3CSYA 3S35X 4H1LB 4RFOL 5CUSL 1AY1H 4TPRL 3TJHC 4MD0B 5KG9A 5DMJB 1CFQA 1F00I 1ZHBB 3RZWA 4TVPD 1RUAL 2ED8A 5IROC 3WNNA 4M48L 5D7LB 4Y1AA 2CUMA 1OSPH 4NZDA 3SBWA 4DJMA 5J0BA 5TE4H 5L0QB 2OQJA 3WN5C 1ZA3B 2CO6B 3BDYL 5EWIL 3BZFB 1CICC 1KTRL 2FECI 3RX8A 3MMEA 4PGCA 32C2B 1E6JH 2OTPA 4JLRA 1LK2A 3CFBA 4WUUD 3VE0B 4WUKH 4UB0H 1AGBB 2BHZA 2VDKL 1RZGA 3MO1B 5D9SA 2AW2A 1KJMA 3T3ME 12E8H 3T3PF 4CN4A 1MJ7H 2C7UB 3D0LB 3LRSB 5I1AA 4U1NB 2BVEA 5A3ID 3WLWC 3ZT7A 1U8QB 4H5SB 1LO2L 5F9WB 3UTZB 5E9DB 3ZO0A 4ZYKA 5EO0B 5JOEA 1N8ZB 1JYNA 4MS8C 3KPTA 3U7YH 1CQYA 1A6TA 3SKOA 1T0MB 1EDQA 2ZCHL 4NHCL 3TO4D 5KS9A 1EUTA 2LU3A 4XHJD 1JNLH 3FJTA 5JXAH 4JHWH 1FGVL 1DBAH 1PZ5B 4BELD 2CKBA 1ROWA 5FYLD 5TDNB 4H8WC 4UT6L 4Y4KB 3W0WE 4Z7NF 1HDMB 3PXJA 3D39B 3MZGB 4ZQKB 3KJ6L 2R29L 3QDMB 2E7CA 4YHZL 4M61A 1MCCA 4JJHA 1T2QL 4FTVE 1N7ML 5SX4H 5TF0A 1BOGB 4LLQA 5DTFA 2O5ZL 4OD3H 3MYJB 2H9GA 5GGRA 3PGDB 4M1DH 1YJDL 5HDQL 3SDDA 3V0WL 4B7LA 1ETZA 2VZ3A 4LL9A 4P3CL 4WHYG 2FZ3B 3GBNL 4XP1H 5H2BA 1NCWL 1C12B 4TSBL 3MA9L 4GKNA 3U79A 4YK4C 2SEBB 2XZQH 1T1WA 1BGXL 5BRZE 4ETYA 2V7HB 3EFDL 3X12A 1HSBB 3CFDB 3ZL4L 1G9MH 4ZTOL 4U1GC 4ODTH 4LEOB 4G80B 5F7DB 5GRJL 2FIRT 4WCYL 1T4KA 2DQUH 1PGRB 2HTKD 4GQ9H 4Q0XL 3RNQA 1J18A 3TZVA 2PXYD 1LO4L 1R6VA 3CFKB 1KEML 4HCRH 1OAQL 3GMQB 5F7KC 2EDKA 4ZTPL 2Y06L 2DB8A 5KJRL 5F89B 1NGXA 2X4SB 3NCBB 2F54E 3GNML 4BQCA 4GXVH 5FUZL 1FZOB 4NQXB 1GAFL 1JVKA 1VEPA 3QHZH 4NRZA 2DLGA 1MIEH 2EYTA 2Z91A 2AABH 4XP6H 1W8OA 1ED3B 4ZUVB 3BQUD 1D5IL 1CD9B 2I07A 1QVOA 2YK1H 5FYJE 3C60A 2E9JA 3VMNA 5C0GB 3IDIA 4ODWB 4XP9H 4LLYB 1FFQA 1DZBA 1NGQH 3LHPH 1DQJB 1I8LA 2JELL 3SE3A 4YUEH 3TLRA 4QRQB 1F58L 4HW6A 3E6HB 4EVNB 3D18A 1LEIA 4KI5E 1NC2B 3G5ZB 4TULL 2A38A 3OXSB 4IEFB 1IL1B 3VXUE 1KFAH 3MLZH 2BNUB 3MRJB 4JZJB 2DIBA 5BW7C 3N9GL 2R56H 4KTEH 1RK0B 4QHMB 2VLRD 4K9EH 4NUGL 5GRZA 4B41A 2LAGB 4WFGD 1QRND 4LASH 2YUVA 4BK4A 4GH7B 4XI5C 5MP6L 3MCG1 4MJ6A 3GSUB 3QEHA 4KUZH 4GKOA 2IBZX 3ARTA 4QRPD 4M5ZH 1S9WA 1S8DB 3KYOA 3SQBA 1WWAX 3WIHH 1CFNA 5IBUB 3QBTB 3QYCA 4IOFD 3MRLB 1QLFB 3WBDA 1OP3H 2LABA 1U41A 3KPPB 1WEJH 3QT2A 3KLHD 3ARFC 2DYPA 1ZEAL 2GY5A 4AIZB 4LGRB 4JHZA 4KK9D 1DUZA 4N0YL 5C0ND 3SO5A 3TESA 1YNKL 5I19L 1G7PA 1U58B 5I71B 1IEAB 4HUWA 4OM1L 4UIMA 2NY2D 1EV2E 1XGPB 3SE9H 4IRSD 4ZSOE 4FA8A 5IEKB 1LO3H 3UTTB 3H9HB 1GXEA 4PB0H 3MRQA 4YWGL 4L4VB 4BZ2L 3UROR 1XR8A 4NNPH 5E2UL 4PGEA 4HIXL 2VXSL 3RWHB 5I8KH 3NFPA 4JPVL 5E94B 2X4OA 1MHCB 3ULVH 2NX5A 4P5MA 3QNYB 1OAZL 3QRGL 4G7VH 3BXNA 1QFHA 4BH8B 2MNUA 3STBA 1RU9L 1T20B 3KXFE 2P24A 1FYHB 4R8WH 1L0XA 3GMOA 1MCBA 4ELKA 1Q72L 4Y19E 1JFQL 3B6SA 4PD4J 2VDPL 1LO0H 1RZJL 3ARPA 3GJFA 4OB5L 4O9HL 3VGAC 1T1XA 5GRYA 3FQWA 2H45A 1NAKL 5IMLB 4BQBA 4PTTA 3D9AL 3OKMA 5AZ2L 2W9DH 3RPIA 2VLJB 1CFVH 3FQNB 4FG6D 3SDAD 5ELIA 2AJVH 1I1AC 3JTSA 1YEDB 4Z76B 2JK5A 2Z8WC 3O8XB 1KACB 43CAB 3B5TA 2Y5EA 2C1OB 4I0PC 3KPRD 2APWA 1TENA 2DQFA 1A7NH 3U48A 3NABL 4KV5F 2HN7A 1HYSC 3CSPA 1CZ8L 5DJCB 1KPUB 1URLA 4PPTA 1TVHB 1FZMA 5DJAB 1IGYA 3ZTNL 4R2GD 1I8KB 3QFDA 1OGAB 3SDYH 3H9SD 3MOQA 4PJEE 2JCCF 3ZDZF 3MRGB 1XCQB 3GBMH 4XVJL 2VQTA 1TQBC 2FEDD 2EIZB 4Y5YB 3MRFB 5IFAH 5JPNA 4MD4A 3MV11 1FORL 4PUBL 3KR3L 1G7IB 1T83A 4PJ5A 4RAUB 2BVPB 2CK0H 4UQ2A 3B83A 1IBGL 3OAZH 4Y88A 3VH8G 5BV7H 5ISZD 2XZAH 5GGVH 3MJ9A 3KLAA 1YNTB 3ILPA 35C8H 4G6MH 4MQTB 5LCVH 4WO4C 1IC4H 4J3TA 3OJVC 1JHTB 1RUPH 1V8HA 1BF2A 4WW1A 5DQ9A 4GBXA 4UDTA 3QUYA 4XCCL 2NLJA 4EXKA 2G2RA 2DQGH 2VE6A 1FGNH 1TETL 2NMSA 2ZNWA 3ZYZA 3JBG7 1Z0NA 1EO5A 4P48A 3X3GL 2DMCA 1R3LA 2GITB 4S1SL 4LSTL 3V5DB 1INDL 3FB7A 1NMBL 1ORQB 4XP5L 1ZXQA 1NBYA 3GBLA 2GFBB 3QIBC 4X7FC 4Z7WF 2DBLH 1OP9A 5IV2B 4NO5B 4OZFB 4XT1C 2F53B 1M7DA 2IH1B 3NA4A 5IOPA 4TTDC 3KLDA 4M9OA 4PJ8D 2FBOJ 3P9MB 5FXCH 5IG7B 1FNGA 2P5WD 2DQDL 3IDYC 2RCSL 4JHAH 1YN7A 2VZ1A 4LQFL 2FO4B 4ELMA 1FHGA 1FG9C 3OG6B 3DBXB 4QWWD 4JZOB 5FGBA 5KW9H 4XTRD 4LOUD 5C07D 4HBCH 4G6AC 1J05B 4PS4H 2NZ9C 1CD1B 1FSKC 4XRCB 3HR5B 5DK2B 3JTTB 1KGCD 3D39E 1R24B 4MMZC 2GQHA 3IFLL 2WBJA 2E6JA 3QDME 2EDLA 1NCUA 3OR7A 2A9NH 3K81A 1EUUA 4X4ZA 1XGUA 1PLGL 2G5BB 2IPTH 3MRBB 4JM2D 3L3JA 4NT6B 1N0LA 4NKIL 4CN6A 2XY1A 5T5NG 2VQ1A 3BRFA 4C83A 3U4EB 4LLMA 1J1OH 1AGCB 1IQWL 1CGSL 1A7QH 2MCPH 5T1MB 4PRHD 5I66A 5KTEL 3Q5TA 3WNOA 1ZT1B 3TBTA 2XKUA 3L3OA 3O4LD 1WTGT 2Q86A 3PABA 4XNYL 5EUKA 5JO5A 2FGWH 1NMAH 2GK0A 3D3VE 2WK2A 1UC6A 3FQRA 2AJUH 3TWCH 5JQ6L 5HGAA 3TBWA 1II4E 1CXFA 1M05A 3EHBD 2X4QB 3QCVH 3P73A 2IFGA 4OT1H 2ICWB 4YEFA 2YD7A 1A7BA 2YPVL 1TXKA 3HE6C 1EEQA 1ZE3C 4FQXD 4QRSB 2VLKB 2X2YA 3BPLC 3WXVL 1C8PA 1MCRA 4RFOH 5CUSH 5C71A 4CVXA 2A6JB 2FHCA 3QQ9D 4TPRH 5B4MD 1B90A 1Q9OB 5C0CD 2GUOA 1VA9A 1DR9A 3QIUD 4EUPH 5D93B 3P77B 4HS6A 3SOBL 3VWJB 1FRGL 5KS9F 5C09B 1RUAH 4XB8A 4LCWA 4MDIA 4C59B 4U1IA 4DKDC 3I2CH 4L8DA 5I17B 4L9LA 4M48H 3LQMA 5DHXB 4XPAL 1CXIA 2BY2A 5DQJA 5D1ZD 1OQXA 3BDYH 2F5BL 5EWIH 1A9EA 5DDHB 4PJGF