1DEEB

Structure of s. aureus protein a bound to a human igm fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
223
structure length
223
Chain Sequence
QVQLVESGGGVVQPGKSLRLSCAASGFTFSGYGMHWVRQAPGKGLEWVALISYDESNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKVKFYDPTAPNDYWGQGTLVTVSSGSASAPTLFPLVSCENSNPSSTVAVGCLAQDFLPDSITFSWKYKNNSDISSTRGFPSVLRGGKYAATSQVLLPSKDVAQGTNEHVVCKVQHPNGNKEKDVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Staphylococcus aureus protein A domain complexed with the Fab fragment of a human IgM antibody: structural basis for recognition of B-cell receptors and superantigen activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords IGM RF 2A2
total genus 43
structure length 223
sequence length 223
chains with identical sequence D, F
ec nomenclature
pdb deposition date 1999-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1deeB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1deeB02
1G9NH 4RNRB 2UWEE 2IFFL 4CBPA 3O9WB 3DGGA 3ZL4L 1PVHA 3IDXL 3VXSE 4OZHF 1N5YH 4KMLB 2Y5TA 2PCPB 5LGHH 1KELH 3ZE2E 1QSFE 4NBZB 3L1OH 5DEFA 1NFDE 5DMKA 3T0EE 1EHAA 4LCIH 4UNUA 5DGQA 3QNYA 1A4JA 4ACPA 4D0DB 5ID0A 3DSFL 4GMSL 4JFFA 4YIQB 2P5EE 1L6ZA 5E2UH 4PV9B 4N0YH 4NN5B 2P1YA 2GIYA 3BXNA 2E7CA 3KDMA 2VDRL 3BYTA 1A6VH 3VWKB 4M4RA 5LGJB 3ULUE 5B39B 1G9NL 4ZPTB 4GBXC 3S36L 3T1WA 5DJ8B 4N1EA 4TSAL 4C55A 4U1IA 1IGFL 1C12A 2E8YA 1DQDH 5DJAA 3RDTD 4P2QE 5C2BH 5ERWA 2FD6L 2VWEE 1KIRA 3CVIH 3P4LA 5BVJA 3A6CH 5C0CE 5F3HB 4LEXL 5DI8A 4UB0L 4X6DA 3FB6A 3ZKMD 3TT3H 5ITBH 2XZAH 5I1DA 43CAB 4X7TB 4A6YB 3ARVA 3MRRA 1TETH 1CLCA 5D7LB 1A1MB 2WBJC 3NMEA 1R5VA 5IV2A 3CXDH 2Y4SA 5E8PB 2UYLB 3P2TA 1K5NB 1NLBL 1LDPH 4KHXL 4NUGH 4MSWA 3BEVB 3FRUA 2VDKH 3OGCB 1FZMB 1L9MA 3SN6N 1RZ8B 4DZBB 4RAHA 4PJIB 1A7OH 4YE4H 3SQOH 3L3IA 1BWMA 1Y6MR 2NX5D 2R23B 4WI9A 5D4QA 3VGGA 2VL5A 4ZUVB 2BY3A 4I0PB 4KVNL 5DZOA 5MEOA 2XA8L 3LIZH 4UTBL 4GAFB 1IGYA 2CK2A 3VI4E 3VD7A 3CDCA 4G9DB 4XCEA 3MGTB 2Q76A 3U7AA 4K7FB 4S1SL 2HFTA 3K74B 1ZHNB 4P59H 2J8UA 4P2QD 3ARFC 3H3BC 3RNQA 2P42B 3CDGA 4LHQB 4M9PA 3RZCA 3ZMRA 5ESVB 3MUJA 1LP9E 5FECB 4JR9H 3K2UL 1JGVH 2F54E 2JB5L 5L8LB 4WW2F 4EDXB 5MERB 3WHXA 1INQB 3UDWA 3O6FD 3K1DA 1B9ZA 4KJQC 4M48H 3UTOA 1T1ZB 1NC4A 2IG2H 3NN8A 3MBXH 3BZFA 1H5BC 5ADOH 1U2CA 1CDHA 1J5OL 3HE6B 3GM0A 3C6LB 5DMKB 4OCRL 3OF6D 5JOFB 4ONOA 1R5WB 1D5ZB 1S78C 1FIGH 5T3XE 4JQXA 4DQOL 4J4PC 4D8PA 3FCTA 3WLBB 2Z9TA 2DQCL 3H7LA 5DHVA 3QWRD 1RZIB 4UOW0 1GC1C 1KXQE 1JPTH 5TPWH 4WFFE 5LCVH 4X6BA 4HPYH 4BSWA 4YDVA 3AMKA 1D9KC 1AGCB 3O2WH 5I8EB 1VGKA 3DXAA 1FJ1A 1WZKA 3P30H 4M61A 5HI3C 3X17A 1KJVA 5DJAB 1QPXA 4ZFZB 3EW3B 2EICA 3HNSH 4GBXD 4M00A 4O02L 2DQTL 4NC2B 2G9HB 1MPAH 1UQSB 1NCWL 1JYVA 1AR1C 2WBJA 4J1UA 4QHKJ 1BEYH 1ZGLB 1KIPB 1DN0B 1GC1H 4EXPX 2OTWB 3O6KL 5CZVH 3VRLE 5LGKA 2NYYC 2IPKB 4GG8A 4YPJA 3BUTA 1GGIH 4XWOD 2BFVH 2JF1A 3GO1H 4RQQB 5E8PA 5EWIL 3DO3A 3E2HB 1KT2A 4JM2B 5GZOD 3BXNB 4L4TE 1A7NH 2AXGB 4I3GA 4LPTA 4XPHL 5CIPA 5IVXE 1DLHB 4LPUA 3WS3A 2A6KA 5HYEA 2BNQB 4UT7L 3QCTL 4U1IB 3DRQB 4KH2A 1NCTA 4OZFA 4PJGB 4D0BB 2XY2A 4R90L 3FFCD 2Z31C 3FN0L 3HNTL 2L7JA 5CKGA 1KIRB 1Z6JT 5I16A 5TE7H 3BUYB 4U2ZA 5C6PB 2ZG2A 4OI8A 4HCRL 1XAUA 4X4MA 4PJCE 4NNXA 1U8NB 5EU5B 4PJFA 4IRSB 4LPXA 4RDQG 5E08H 4PP1D 1B3JA 4X8JB 4F7PA 4MQ7A 2APWA 4RWHA 2R0WH 3PWJA 4IHOB 3MRFA 3QHFH 4QRRE 3LEYL 1ACYH 3FAWA 5JQHC 1IGTB 5DFVD 3VCLB 2W07A 5JW4N 4EI5B 4WO4B 4H8WC 4JHAH 4JDVB 4LHUG 4S11A 3LKRB 1LO5B 4HIEA 3EOYG 4CJ0A 3U9PL 4QHLB 3NACH 2VLRB 3MLRL 1GGYA 2NX5A 3PQYE 4L4VA 4C83A 2VLJA 2BJML 4N0YL 1N8ZA 3IS1X 1IGYB 3MA9H 4LEOA 1YJDH 3S5LB 1FLTX 4I48B 5FM4A 4Z7OE 2W60B 1BBJA 3MRGB 2FEEI 2F8OA 3HPLA 4FABL 1GZQA 1RZKC 1E6OL 3MLZH 4IOFC 3CPLB 1KJ2A 2MHAB 1OGAD 1PG7L 3PWPB 4XBGA 3WHE0 3EOAA 3DPBA 4XNXH 3EYFA 4D9RD 5IHBA 1D5MB 2HFEB 1C08A 1I3RA 4AT6B 4F37F 2HT2C 1IC4L 5DD1L 5HI3D 5I2IA 1MFEL 3D39A 4JY5H 3T0EC 3WXVL 1WBYB 3D85B 5HVHB 2N7BA 3BZFB 3EGSA 4NQCB 5D2NA 5B21A 4RBPK 3S9DB 4XXDB 3VXMB 5ITFA 3ZE0F 1VCAA 5HPMA 2BRRL 3H3PL 1WFTA 3DX6A 1JI1A 4CMMA 2OL3L 2DQUH 4FQJH 3TNMB 2PXYC 5D6DC 1HQRB 3CLEL 3CSGA 3PWUB 1LK3H 1XIWB 4OFYA 3N9GL 1JPGB 1IQWL 1AY1H 5TF1H 2Y06H 2XTLA 3JWOL 4WY7L 2GTZB 4EIZC 5AD0B 5GZOC 4KZDH 4FFZL 1IGIL 5EIIA 4DCQA 2AV1A 3RPIB 3G6JA 1T04A 4Y7MA 1VFBB 5CSZA 2N7AA 4ZMAT 1AJ7L 3O3AA 4KRMB 3LKNB 4DVRL 4QRRA 4HEME 1H3PH 3VWKD 3HZYB 3TA3C 1MFCL 4G5ZH 3MO1B 2D4FA 5EZLB 5HYSG 1RUQH 4R3SB 4GRWF 3R1GL 4UBDD 1U6AH 1T5WA 3K2UH 4PTUA 3BP5A 1KUMA 4S2SB 1HHGA 3ARYA 3U2SA 2XWBA 1QLEH 5FUZL 3DTXA 1MIEL 4KAQL 3QXWA 2AEPL 3H6JA 4HLZG 2R8SH 3WNNA 1AO7B 4MDJA 1MCNA 1L0XA 3U0TA 3VWJD 4LFHG 1X5XA 4LSSL 4PRIA 4JVPA 5KG9B 4X6DE 5C9JA 4R6UA 5DFVC 4N5EC 4K94H 4LU5L 4D0BA 4LLUB 4HWZA 2ID5A 4FQLL 4OTXL 3QYCA 1T22B 3MROA 5EU7E 4M1CC 2DLTA 2F8VA 3OR6B 1QHOA 2F53A 1TJIH 1PKQA 4MJ6A 1TCRB 5IROC 1LD9A 4WRLA 1H3UA 3S8WA 4YWGH 4KC3B 4PRAB 2P24B 1ZVHA 2IF7A 3WIHH 4JPIA 5DHXB 3VXRB 4A2LA 4EUPB 1A4KA 4ALAL 4JHWH 3AUVA 5E9DA 1I8MB 2J6EH 3MMEB 2R2EB 3NABH 3AS3A 2FO4A 4LF3B 1I1YB 5CZKA 5J13C 5IJVB 2WWKO 1GHFL 2CLRA 2QQNL 3BN9D 3X3FL 1EHXA 4GXVH 2E27H 4J12A 2IALB 4Y4KC 5F6HJ 3VFPB 4ZOEA 3J7HA 3K2MC 4MD5A 3L5JA 1CLYL 1K8DA 5C09A 3W9DB 4OZIF 1KSRA 4PRNB 4Y16B 3X3GH 1HQRA 1UACL 1LO4L 2EDNA 4JPWH 2PO6A 5JW3H 4KXZI 3HMWH 5B38G 4PRDA 4LLAA 2DBLH 2V5YA 4RAUA 1S7TA 2VXTH 3VGFA 3V4PL 3C8KA 4JHAL 3HR5B 2CIIB 2DD8H 3DWTA 1QA9A 4EDWH 1G6RB 4XNZC 4Y19D 1GPOL 1NAML 5HHPB 5C0DA 5EZLA 1HI6B 1QFUL 5DJCB 4YHZH 1IAIL 1MRFL 5C0JA 4PJ7F 1SVZA 3W82A 2XTJE 1QBBA 2XTJB 3N1GC 2FSEA 1S3KH 3ROLB 5DD0H 1TPXB 3EFDL 3IDMA 3V4VL 1IZJA 2FATH 1PKQE 4X80L 4GRLD 5J89A 3ARTA 1S7QB 5EOCH 2R0WL 1MCFA 3UC0L 1MIMH 3L3OA 2DDQH 1AGEA 4ODUA 4WHDA 4GKSB 4AMKH 3QDGD 2AJZA 4YEEA 1OHQA 4DCQB 4RFNB 4YZFF 4TNVF 4ZFFA 3PHOA 1DBJL 4PJBB 1J87A 3QA3A 4F57L 4MDIB 3O41A 5HVHC 3LKOB 1A64A 3GHBH 2ICEA 4X4YA 5CGMA 3DX7A 2I9TA 5IBTL 1FG2A 4N5UA 3ZDXF 4NJ9L 4GS7B 3F7YA 2X4NA 4Q97A 1O7SA 5E9DB 1TVBA 1DQJA 4Q2ZA 8FABA 4FMFA 3DTXB 2H2PC 5IEKA 1U9KA 5E7FA 5LG1A 3IRPX 3KPMB 4MAYA 5I73C 4HIJA 1I7TB 3HC0B 4D9LH 1P69B 3QFJD 3QI9D 3FQTB 1JWSA 1SJVA 2AXFA 2IAMD 1XGPA 3DVIA 5F3BA 4HXBH 5EO9A 2F8XC 2ARJA 5JQ6H 3P4OA 5E00A 3MZGB 4YBQD 3GMPA 4MNQD 3BJLA 1EUTA 1M1SA 4XX1G 1CLOL 2K3TA 4PJ5D 4PJIE 3VXRD 4PJXF 3QWOB 4EQ3A 3BD3A 4GRMA 2QBWA 5K9JL 3VFSB 2AGJH 1SJHA 1ND0A 5F71A 1ADQA 1S7TB 4OLZL 2VZ1A 2AJ3A 3QUML 4TVPH 3AREC 1T20B 3GSRA 5C7XH 1NC2D 2F74A 4OCWH 5FM5O 1BFSA 2AVGA 4NQXB 4Y16C 3NIFF 2FO4B 3SE4C 5F44A 3TH3T 3EFFA 5IFAH 5F96L 5I1IH 1YPZA 4FTVA 3K8MA 4RFEA 5F9AC 4WWID 3MLUL 3ULVD 1UKSA 5TDNB 3HN3A 3LV3B 5AG9A 4NCDA 1XGRA 4WI4A 4YHPB 4B7LA 3FB5A 2MPAH 2VZ3A 3ARGC 4ODTH 5F6IC 2X4TB 4Z7VE 2X44D 1DBBH 4UOJA 4QRTA 4LHUA 2WUCH 4HKJA 4LVNC 3IJYB 3KPOB 5HDQH 3TEUA 4LLMA 2O5ZL 3HC3L 2PYFB 1FP5A 4DN4H 4EQ2A 3ULVE 2H3NB 3DVFA 1G7QB 3FQXB 5GIRB 4PREA 3KNBA 5IQ9A 3MRJA 5HYSB 2D7TL 4PLNC 5CGYC 3RX5A 3BKCH 4FQHA 4OF3A 2AQ2A 4XP6H 3C8KB 3HR5A 3NVQA 4U1KB 3MYZA 2I27N 2FYYA 2NMSA 2MOVA 3IFNL 4GAGL 2BDNL 1EO8L 2ERJB 4JQVA 4Y5XA 4U6VH 4X98A 2IPUG 3K8LA 5EZOH 1LO0H 5A43C 2XKNB 3LS4H 4XNQB 4H1LA 3WIIH 1FFQA 1DQJB 5F1NA 1LEIA 5FYLD 1QO3A 1ZOXA 1FPTL 1XR9A 2BSRA 4FQIH 2BCKB 1Y0LB 3FQTA 4G42B 4Z7QF 5MEPB 1J10A 2EDTA 1XCTB 2BMKB 3MNZA 3DRTA 5DMJB 3NABL 2ADJA 3FQNB 2GI7A 2FGWH 5JXEC 2BHUA 5F7MC 3MZTA 5GXBB 4JY4A 3GSUA 4BQ8A 5BS0B 2KPNA 3MRRB 3KHOA 4DN3L 1ZWIA 4PY7A 3HRPA 4KQ4L 4XP1H 3SCMD 3WUZA 1GC1L 4MDIA 3TBVA 4DAGL 3SHSA 4X9FA 2UYLA 2YUZA 4AH2B 3GFUA 1Z5LA 2P49B 5D2LA 3QNZA 1BIIA 1XGTB 1VACA 3BHBA 4OLWL 3PHQA 2AJVH 4FMKA 1KB5B 4ZFOB 4PP2B 2DIJA 5DLML 1F02I 4BSJA 4KK5D 5ALCH 1M71B 3MFFB 4KK6D 2P47B 3HB3D 4M7JH 1Q9OA 1A6AA 4QXGH 3E3QE 1MEXH 1T22A 4KJQD 4NPYA 2JLLA 4XVSL 3IDGA 1VPOH 1N7ML 3OR6A 4WI6A 5TDNA 2HG5A 1XEDA 3UYRH 4G6FB 4U3XA 2W9LA 4LCWD 3PWVB 1NBVH 5DZLA 2W65A 3GRWL 3ZE2F 3MLSH 5EBWA 4OZHE 1B0GB 4M1GH 3IKCA 3MBXL 1MFBH 4ZDHB 3F65A 4CN4A 4OLEA 1MQKL 4OCRH 5F7KC 3MMEA 4BSWB 3V0VA 2OL3B 3H9SA 2D31A 4G9FB 4N0UE 4M7JL 4LF3A 4XGZA 4K3GA 4FQHB 3BO8A 1WBZA 3H2WA 3TBWB 1QBML 1KC5L 2VXUL 2B20A 5BQ7B 4OD3L 5FB8B 1N6VA 1MRDH 4JFYB 5DRZA 1AXTL 1GZPA 1A6UH 4C4KT 5L0QC 2L4OA 4AK1A 5DJDB 3QIUC 4BH7B 4KVCH 3RWHB 4C56E 1LILA 1DDHA 1AI1L 5C0FA 3QFJE 5IB1B 2IH1A 1XF5B 1ITBB 2DLFH 2R4RL 2Z93B 1XR9B 3BPOC 3LIZL 4UTBH 2X4QB 3E8UL 2WQ8A 1PG7X 3FFDA 4IRJD 4QRTB 4AEIL 2ZNWA 3GJFK 4AL8H 4H8WL 5CIPB 1G7QA 2ZPKL 4HH9A 5I30L 3C60C 2YC1B 4H88L 3LQAH 3LRGA 2YRPA 1UVQB 3VH8A 2DQEL 3CCHB 5E4EB 1RJYB 3CSPA 5T3ZE 4DUWA 3CH8A 5D8JH 5DK0B 2P5EB 4ZOCA 5HHQB 3KWWA 4JN1L 4NNXB 3WFZA 5H35B 3X13B 2NY1D 3IRZA 1AQDB 5KSVB 3O8XD 3QFDA 3P77B 4GKZB 2OJEA 4UINL 5I1EH 5E99H 1DBKL 3A6CL 4U1HB 4PP1C 3QXDB 1GGUA 4YH6A 5CJOH 1XH3A 4RMSA 3VRIA 4JCLA 1ZLVK 3MREB 3MA9L 4DJMA 1CGUA 1T1YB 2IPTH 4X6CF 3VDCA 4KROB 2QSCL 4K7PL 3ABZA 1ACYL 2YD8A 4ZAKC 4LBEA 1WQVT 3RUGA 1FNSL 2RHEA 1JNNL 1NEZA 3JV0A 1IGFH 1FG2B 4KKNA 4K3JH 1BGXL 5HHMD 5GJTH 2DF3A 2J4WL 2XYCA 2ORBL 4MQ7B 3SOBL 1KF9B 4LSSH 2DD8L 3VDAA 2XWTA 4K3DL 3VRJA 5FXCH 4XMKH 1CFVH 4GQ9H 4N68A 5ETUB 4JQIH 5I71B 4UT9L 2NLJA 4HX1B 4JDVA 3TJHD 5E8NA 3VMNA 5HI5C 2QSTA 3BOVA 3ARFA 1IQDB 4IOFD 3RWCB 5E03A 5EB9A 2HFEA 1MRCH 3GK8L 1YY8B 3OB0H 3CLFH 5EUOE 3OXSA 4I5BB 3D25A 3GNMH 2M26A 4MJIA 1KPRA 5IW1B 1BMGA 1P4LA 1F00I 1QVOB 5IFAL 4Z95H 3LEXA 3VD9A 5FYLE 3TIDA 3RWHA 2GJJA 2W60A 1IEAA 1JHTB 4K8RD 4NKDA 2NZ9D 1OAYL 3KXFA 4GRMB 1YNLL 5D96B 3QJHA 2J3SA 2XZCL 4N8CL 1MCOL 1NUNB 1T66C 4WV1C 4JFFB 3A67L 1OB1B 2YA2A 3MV9D 1B0GA 5D7LD 1BVKA 4Z7NE 1CS6A 3ZYJA 2ARWA 4UQ2B 1OAZL 2NY4D 4LASH 2E6QA 1YEHL 1NFDF 3OPZL 2YC1A 2X4UA 3SDDA 3SPVB 1EO8H 1MJJB 1UB5A 4HUXA 3CSYA 5JNYB 3NZ8B 1X6LA 5J7CC 5MENE 3I6GB 5F7EH 5C0NC 3ZKXC 1EHLL 4L8CB 2DWEB 1EMTL 1MCKA 4MCZA 1R3HA 3GIZH 4L3CA 2RFXB 1UXWA 5FCUL 1NGWA 4K71C 2FJFA 3IXAA 4WO4C 4CADA 1OL0A 5D1QD 3S3JA 1MF2H 2IADA 3KLAB 2EYTB 3V8CA 4P23D 5EDXA 3EO0A 1A6VL 1FVEA 4P2OD 2UZIH 4PUBH 1V7NH 4HKBB 4JFDE 1OGAA 2IH1B 3JVGA 4HT1H 3REVA 3P9MA 5BXFA 4KROD 3C08H 3RUGE 5HYSA 3KPNA 4OI7A 4J3SA 2Y25A 3OKDB 1QR4A 1WEJH 2BNRA 4TPRL 3GSNH 5KS9E 4U3CA 4NQVB 5IEHB 3ZDYF 1R0AL 1RK0B 1FLRH 2OZ4A 4HH9B 1CGVA 2VABA 5DK3A 1R0AH 3LSOA 1U8MA 1ZKAA 5I1HH 1WZMA 5DMIH 5MEOB 3ARGA 1MCIA 5BV7B 4XCCL 1NEZB 2LVCA 2XKNA 4XNQA 5FM5M 5E4IA 3TPKA 1YZZA 4K7FA 3ZE1F 5BW7C 4D94A 4HIIA 4M1CD 4OLYL 5DMYA 5D5MB 4OM1H 5TDPA 3GUTA 3QDMB 2W9DH 4JE4B 5IB3A 1Q9KB 5E2TH 3VXRA 1RUQL 2NZIA 5ESVA 4MA8L 3U82B 4Q9QH 4I3SH 2P5WA 1AHWC 1CXEA 5FYKE 3PWNA 1XCTA 1KACB 1T2QL 4ODHL 4XTRC 4S0SD 5KG9A 1MCBA 3DECA 5F1IB 3MOAL 1D5IH 1AGBB 4ISVB 1P1ZB 5FA4B 3NN8B 2CLRB 4HS6B 5BS0A 2JB5H 5MEQB 5JOFA 4MJ6B 2W9EH 4I0PC 4GRWB 4ODXA 2Y5EA 3N85L 32C2B 2R1WA 1H3XA 4ZQKB 1UA6H 1HN1A 3MCKB 4WI5A 4NSKB 4Z0BL 2ZPKH 3LY6A 3K46A 3CX5K 4PG2C 4PP2A 1I9IL 1HK6A 4OZGE 1BZQK 5I19H 2RR3A 2EE3A 5T3ZH 3SPVA 1A9EA 3OJDA 4YHML 1KTLB 4J3WA 3V5HA 1RURL 3D69A 2O5YH 4TVSa 3PG2A 5KAQG 1NCAL 4OGXL 4JFEE 4MNHB 1CDBA 2YN3A 3IDGB 5SX5H 4HF5L 3QNXA 2DKMA 5IF0A 4U0RB 5HYJB 4XZUB 4I5BA 4LLQA 1JTTA 4OF7A 1TPXC 4LLVB 4Z0XA 2HT4C 4FFWD 1BFVH 5C09E 4GOSA 1WIOA 4O02H 1PY9A 1DL7H 1IEAB 4U2YA 4NKDB 4WU7B 2J4WH 3FOLB 3MJ7B 1Z3GL 4O51A 4Y2DC 5C0CD 1BPVA 4P46C 3Q5OA 4QYOB 1T7WA 3RVTD 4P2OC 1C5BH 1JZ5A 2ICWJ 1TXKA 1YMMB 1MREH 1A02N 2EDEA 1I8LC 4OBRA 1TJIL 1WJ3A 5HPOA 1MHHA 3OMZA 3ILPA 2F58H 1E4KA 4KROC 1IEBA 5F3HA 1Z0NA 4I77L 2IAND 4XC1L 2JCCF 1NFDB 4OGYH 2KQMA 4Z78B 2J88H 2NY2B 1JGLH 3FL7A 4JFOB 5FYKL 4QO1A 1XT5A 3RGVB 1KGCE 4FQXA 1NSNH 2EYTA 1BFTA 4NOFA 4HUVB 2B4CL 3EJYC 4LSRL 4L1HA 1K5NA 3UZVB 2YWYA 3KPPB 1IM9D 1W72L 3V5DA 1G7MB 1JHKL 1NUDA 1JMXA 1Y18B 2IBBA 3SKNA 4DZBA 2XQBL 2ZOLA 4LLYB 3OWEA 8FABB 5MENA 3RJQB 1OGAB 4WHYH 2BVQA 2D7QA 1JGDB 2WIIB 3RL2A 4LDOB 4O5LH 1HQ4B 1Q72H 1OGAE 3U46B 1RZ7H 3CZFA 2CKNA 5EC1B 5FIEA 3BH8A 2QQQA 3EO9L 3LKRA 5EUOA 5TQ2H 4BZ2L 1KXTB 3B4NA 1XGPB 3GJFH 1F3DJ 1ZT4B 4MAYD 4QHLA 4HIHA 4XPGH 3RDTC 1ZANH 5D6DA 1JPSL 1T3FA 3M45A 5HDBF 5E1AB 5GGQL 1N8ZB 5AWNL 1HNFA 4HKXA 4MHHG 3V6OE 4TYUA 4M8QA 5JTWA 5FFLA 1R5IA 4YHOL 4K9EH 4QHUA 4ESKA 1CK0H 5KTEH 3OJMB 1S7SB 7CGTA 1GAFL 1CGYA 4HUNB 2YD6A 3NIFE 5F97E 4UUJA 1WT5A 2MCPH 4U1HA 3VGDA 5D5MA 4PGDA 2P8PB 4N8CH 5H37G 1ND0B 1A6UL 4R9HA 5D72L 4PGCA 1I8KB 4OM0L 2DB8A 3TPUA 5E94A 2EEDA 2BOCA 2JB6B 4P2RB 3FB8B 3MGOA 1YYMH 3SKMA 3C6LA 4HEPG 4R0LA 4C54A 2GUOA 4RWYH 3ARED 4R97C 1FO0H 4LVNB 5M95B 1W72B 3I84A 1NBZA 4Z0XB 5KJRH 3P30L 1LEKB 5CJXA 4YHNB 5DDHB 2PR4H 1F5WA 4JFHE 2NY1B 1SBSH 1J0IA 3QDJA 5GGUB 4QNPE 2BXZA 4G9FD 3MLZL 1QSEA 43C9B 1L6XA 5B8CB 1SY6L 2HT4D 4FFWC 1KJ2H 4S1RL 4EUPH 1U42A 3WIHA 2VLJE 5DUBB 2AXJA 5JW4R 4X4ME 4NO3A 1NC2B 5GIRA 1CZ8L 4XAWH 5T3XL 3S7GA 5AZEL 2Q7YA 4ODWB 1DQQA 5C0RH 3JTSB 4U1JB 1A22B 1G7IA 4XAKE 4J1UB 4MNHA 4OBSA 4JB9L 3G9AB 1BZ9A 3MXVH 3R8QA 1KCRH 2BOBA 4WY7H 4I2XB 4P9HH 1QFWM 3MO1A 3PF2A 2WP3T 3ROOB 3WE6B 2V2XB 1X44A 4OSUH 4HKJB 2E8ZA 3UEZA 2CH8A 2DOCA 4MNQB 2QQLL 3MJ7A 3VGAC 3EOBB 4S1SH 3HZMB 4POUB 3KPQB 3FN3A 1CIUA 1CFSB 3EJYD 1SYVA 5FDYA 1I7RA 1P84K 4OCXH 1LDPL 4NUGL 5EC1A 4D9QD 4URTB 1S9YA 1MWAH 4WFGD 4XP5H 3ILPB 1AGDA 4W4OC 3A0OA 1G6RH 4YE4L 2H41A 4PJ5A 1KBGH 3SJVD 2QHLA 4XNUH 1DTUA 2BSTB 1AD0A 1D5IL 3CUPB 1JNLH 1S7WB 5F7DA 3SDDC 5KSAB 4ODBD 4MAYC 3B5GA 1JNLL 1PKQB 2GHWB 1B4JL 3MRLA 1F4WL 3RA7H 4Y4HC 3NFSH 4MA1C 5JMRA 5JORB 4FQXB 5D1ZB 3SKJL 2GY5A 5F6HI 1TLKA 4YHMH 4B7IA 4PGJA 3QDME 4KUCD 2BCKA 3GI8L 3UTTB 4JGUA 3ULUL 3TZVA 1JGDA 4NP4H 4NN6B 1E0OB 3S96A 5EIQA 3VJ6A 1U8MB 4H88H 1JI2A 1U95B 2ICES 3STLA 3QQ4B 3RNKB 5E1HB 3TA3B 5GZNC 3QHTC 1WTGT 2F5BH 3LRSB 4J3UA 1LNUA 4LCUB 1PEZA 3QRFM 3OJ2C 1ZT7B 3V6ZB 4GW5B 5A3IC 1KPUB 1B6UA 4K3HA 1ODAA 4YC2C 4D9QE 5B8CA 3MRNB 5I1JH 1FAIH 4P5MB 2WSKA 1J86A 4KMTH 4YHLH 2YZ1A 3HRZA 4RSVA 3U7WL 3BPNC 3ZE0E 3FT4A 5DHYB 1JPTL 1YMHB 5TPWL 2OL3A 4WFHD 1ZVYA 5EA0L 5BVPL 4OD1L 2XG4A 5DGRA 1EERB 4HUUA 4ISVA 2QR0B 5J1TC 1J7VR 3B2UC 2VQ1A 3V6BR 2Y6SC 4P3WA 4P99A 4PJDB 4IMLB 4M5YH 3FB8A 4HS6A 1ZGLP 4ODSH 3LKSA 1JWMA 3EO1B 5EU3A 3RVWC 2XIDA 1A4JB 4G7YL 5EBWB 4PV9A 4ZQKA 1Q94A 5HHOE 5ID1B 1KN2H 1E4WL 3MCLH 4APQD 3EKCA 2MFNA 5ISZD 2GCYA 3QUXA 4OD1H 3Q1SL 4G9FA 4AM0B 5AD0A 1P84J 2AK4D 2Z91B 3QULB 1DFBL 3RTQC 1WVZA 5T3XD 4NO3B 5SWQB 1UACH 5AZ2L 5CJQL 1C16B 4JAMA 3MLTA 1TJGL 2F54B 1BQHA 2RIKA 3TC9A 2CUMA 1JYWA 4I3RH 4JRYA 2WUBH 3GNML 2AJVL 5KTEL 5GGRY 3PGCB 4A6YA 1MOEA 2DL9A 2IFGA 4F2MB 4DZ8B 1OLLA 3UTPE 4FQ1L 1A7OL 1FVCB 1R5VB 5IV2B 2G5BB 4NWUH 3MOBH 3T0EA 1FC1A 3U9UA 4IOSD 4PJ7A 1YNLH 5A2KH 3WE6A 2DWDB 4BZ2H 3JUZA 4KQ3L 3FO1B 4PRHD 4UT6L 1R3LA 1S7RA 2GYSA 4G6MH 3MRKA 1T7XA 2YD9A 2A6DB 1R24A 2DYPA 5I8CB 4N8VG 2HA1A 5FHAL 1G7PA 3UTZA 5TDOA 1FL5B 4FQXC 2E9IA 4NGHH 3VFTA 5AUMA 2YD1A 3NGBC 4YPGB 1K3ZA 4ZOAA 5D93C 5DUML 3D0LB 4EZMA 2FWOA 4XBEH 3ULSB 1KNOA 1MWAB 1UM6L 1FPTH 1A47A 1J0HA 4PLJC 1IARB 4DGYH 2R0LH 2VR5A 5IFJB 3TBTA 1MI5D 3VFNA 5E2VH 2YPLE 3BDYH 3DUSB 1VKXB 1NDMA 2BNQD 2DS4A 1VFOA 1RIVH 3TBYB 4U1GC 2VZUA 2BDNH 3TO4D 1BZ7B 3WJJA 1OAXL 2NLJB 4JHZA 4LRIA 3T3PE 2VLLB 1WZ1L 1UGNA 2AJ3B 4U49A 2OXHA 5IT2L 4FP8H 4QRPB 5I9QC 1ZT4A 1UWEL 3OKMB 3TJHC 3F5WA 4NQXA 4QRPE 1MELA 4JDZB 1UWEH 3GMMB 4XRCA 4OLVL 1SY6H 4MJIB 4G8IB 4LKCB 4AIZB 3SBWA 4N5ED 4JZNA 3AY4A 2XXCB 1R5IB 3TIDB 5I76A 2BVEA 5D7JC 5J3HC 4PGEA 4UUJB 1JL8A 1IFHH 2M8XA 4P5TA 2EYRA 5DURB 5GGRA 1RAMA 3QDGE 4QWWD 4PJCB 5GS0L 1T0NB 5J56B 4JRYE 3LMJL 4PGBB 1RD6A 2X40A 4ZG1A 1RUPL 5H2BA 4HUWA 1CLOH 2JELL 3MV7E 3CLEH 1A2YB 2ICWB 2K9UA 3HAEH 1YY8A 4KVNH 3MLTB 1KPVA 2O61A 4HCRA 3TZVD 2VDML 5TQ0H 1U8PA 3OV6A 4M93C 1MAMH 3B9EA 1IKNA 1HINH 3MRHA 4UQ3B 5B3JF 5L6YL 1HI6A 3WD5L 4IRJA 1KB9J 3MRPA 3O8XA 4IMLA 3VXPB 3WXWH 4KKCD 4CVWA 2HLAA 3D9AH 1INEH 4JFXA 4NT6A 3Q3GA 5IW6A 1C5DB 4I2XE 4PJ7B 3O4LE 3ZTJG 2CKBA 5CP3A 4FZEL 4NNYA 3BX7C 3QUKA 5F8QC 1I75A 4XWGH 1QFWH 4MXVE 1BFOA 3FO1A 1T2QH 4ODHH 5K9OB 3QUXB 5LXGH 1LK2B 4RRPA 3CDYA 4ZNCD 1MRDL 1LE5A 3UXFA 5T5FH 3NFNA 4GO6B 3NPSC 1KLGA 1KIQA 2YD2A 1PFCA 2LQRA 3UBXG 3Q6FA 3DXAE 2J12B 3JV4B 1AFVH 4KVCL 2YPLA 4JG0H 4WHTA 4X6DF 3MNZB 1TZIA 2R15A 1Q9LB 5J8OA 3QB7C 3QA3B 3MLYL 4LOUD 1JIBA 3LSOB 1HKFA 3NA4A 5F7FA 4LCWE 2D9CA 2I9TB 3AB0C 1FRGH 3GMRB 1T1XB 3PGCA 1YMME 5BW7A 4OZGA 4BZ1H 5KVDH 4NO0D 4PY7B 4HKBA 4U7KA 3SGDH 4UI2A 4NQCE 3B83A 4MQXC 3T0EB 1T2XA 2HVKB 4NJAH 4TSCL 1Q9KA 5GJSL 4TTDD 3RL1A 5CP7B 4TUOB 5IMOA 4BK5A 2BNRB 1XGTA 3BHBB 2EYSB 1CCZA 3IDIA 1J8HD 3SDXB 2PR4L 2AK1H 1CDJA 3PWNB 5FGSA 3MRKB 2VABB 4RMRA 1B90A 5EO9B 1RUKH 3WS6C 5FK9B 1S7UB 3EYVA 3RGVC 5D1QA 4HIXL 4YXKL 3JVGC 4LLWA 5L2JB 1UENA 4OZGF 4RMUA 25C8L 5TE7L 4NNPH 3MTRA 3TH4T 2O5XL 1QUNA 4P5KA 2BVPA 3QT2A 5E6ID 3QDMA 1NMAL 3CH1B 5E5MA 3A6OA 3O6MH 3GSWA 2AERT 1NDMB 4QHKI 3NBNA 4ZUSB 3O3DB 4H0HB 2OTUB 3K4DA 1Q1JH 3HMWL 1B0RA 3QO0B 4QKXB 5HVWA 1I4FB 2E27L 1FYTA 4RGND 1OW0A 3LRSA 3D85D 4MQSB 5BZDA 5HBBA 3HNVH 1OAQL 1YEFL 3OB8A 3MUHL 4LLQB 5FF6B 3HNVL 5I15L 4JQIL 1JK8B 2DBJA 2X4TA 4HBCL 4P5TC 4R2GB 5GISL 4KK8C 4JZNB 3RBSA 3QIWB 5EZJA 2NY0D 2B5IC 2VLMD 3TVMA 1FFOA 4EKXA 4U0QB 2VC2L 1H3TA 4TNWF 1LK2A 1A9EB 3ARFD 1S9VA 1T0PB 2BFVL 4YUEL 4W70A 3RWFA 1NL0H 2E9JA 3MJ9A 3U1SL 1U8QA 2XNAA 1ACZA 3NACL 2AV1B 2XG5A 3ILQD 6FABL 1PYWA 2NXZC 5C07E 2H9GA 1U8PB 1PLGL 2VAAA 3SGEI 4JG1H 3I3DA 3OL2A 3PXHA 3O3UN 3S4SA 4DW2H 4PTUB 3QZWG 4G8GA 3BDBA 1MLBB 1WCBB 4LOUC 3Q3GB 3BW9A 3VXMD 4QLRA 1T4KB 1AE6H 5C8JB 1AD9B 2DM4A 4JM4H 4JO4H 5D1XB 3ARGD 12E8H 1A3RH 1M7DA 4JPVL 1FVDA 5JXAL 2OTPA 1NJ9A 1K4CB 5B39G 1D5BA 1JYNA 5DRXB 4PYGA 1XIWC 3QEUB 4GG6A 5BZWB 5JO5A 4YDKH 5E99L 2UWEA 1C5CL 2VZOA 5CS7A 4Y1AA 4Y8AA 5JW5B 3QEQB 1HIMH 1JZ7A 2FX9H 4YJZL 2DAVA 3H42L 4J3OC 2ED8A 1ZTXH 3D1MC 4M7ZC 5DJYB 4UIMA 2BRRH 4ORGB 1MCLA 1GYAA 4NFCA 4WFFD 4X5XA 3ZYIA 3MV9E 3R1GH 5ICZA 2X4PB 4DEPB 4KUCF 2UWEF 3V7AG 1J11A 4JKWA 1JZ8A 4JM2D 5C0ND 4QT5B 4QRPD 3SEPA 4HGMA 4XT1C 5FYJD 1HXYB 3EYOA 3TVMC 4HG4J 4XXCA 5K9JH 1DUZA 3FHQA 2ITCB 4L8DA 4WO4D 2UZIL 2AJSH 4YPGA 4FG6D 4WNQB 2FX7L 3RIFK 1HHIA 2OXGA 4N1CA 1PX4A 3GJFB 3S36X 4OZIB 3JWOH 4CAGA 2YBRB 2DLGA 4G80B 3UPAA 1W72A 5FK9A 3VE0B 1HDMA 1W0WA 3EUUA 4UOW1 4RIRB 4GBXB 4LPWA 4HKXB 4RGNC 1T21B 3WD5H 4A6YL 3TVMB 3JWDL 2LTQB 1CN4A 3W39B 3QDJB 5GGUA 3DV6A 4U33A 1GVIA 2IAMA 4G6KH 4P5TD 1G9MH 4N0FA 5CHNA 3VFMA 5J6HA 2B2XL 5D71H 4HS8H 1JP5A 1TVHA 3LMJH 2DN7A 3HLAA 3BI9X 1DR9A 3H9SD 2Y07L 3I75B 2DMCA 1EBAA 2A74A 3TBWA 4RNRA 3KLHD 2XZCH 2EC8A 1KIUA 3QQ3B 2OP4L 2LU7A 2B4CH 2A6IA 4ZAKB 1IT9H 4ZNEA 3FOMB 4KRPB 2Z0BA 3WKML 1KCUH 3EFDH 1YECL 3B2VH 3INUH 1AFVL 4K7PX 4OCYL 5T33L 5IG7B 1HWHB 2VDOL 3DV4B 4UDTA 1CICC 2HH0H 5DRNB 2EYRB 2X4RB 5T1LA 3MV01 3KYMB 2X70A 4LARH 1IMHC 1QOKA 2O5ZH 4PV8A 3L5WA 3S88L 2PTUA 1A14L 1FRGL 5FA3A 1QD0A 5TE6L 4TUKH 1JF6A 4DN3H 3BKJH 3QIBC 1HEZA 2OP4H 5FO8A 4P46B 5TE6H 3X14A 3ULUC 4F7MB 3ESUF 5HYJE 1QRNE 2D0FA 2NTFB 1IKFL 2VR9A 3I02B 2Q7YB 3D48R 1CIDA 5DJ6A 2GTWA 4YEFA 3QEUA 1BM3L 4K3EH 1OP5H 5JO5B 4DWHA 1SVCP 1HOCB 2V17L 4KMTL 2X89A 3WJLC 1B4JH 4NFBA 1CL7H 1XGYH 3WHE1 2HT2D 2QQNH 1DEEA 1FFPA 3OKEA 3OX8B 3O41B 4MMZC 3E6HA 4HLZH 4QRQB 1R3KB 3O9WD 4EDWL 3IAPA 3LQMA 4OQTL 1T2JA 1TVDA 1A5FH 2X42A 3VFOA 3LKPB 2JJSA 4R97B 1ZMYA 4U6YB 4WW2C 2VTFA 2FBJH 1H3VA 3ZT6A 5FUOH 3VRLF 4Y0GA 1NANI 1I1FA 1I7ZA 3IAQA 5ITBL 1ZAGA 1FV1A 4DTGH 1XCQA 4IRJC 2X2YA 4NN5C 1YEFH 5IOPA 4KUZL 2VR4A 4CDHA 4CW1A 3OAYK 3TJEL 2YEZB 5I1GH 3QQ4A 3U48A 2VN7A 1ZGLM 4XVUC 1DJSA 4I3SL 4MD0B 5KN5A 4JANB 2DQFB 5ESAB 1P7KA 3WFCL 3ZKQD 1FHGA 5J0BA 4JKLA 5HD8C 1KTDA 3SO3B 3PV7A 4S1DD 4ZO7A 3W11C 2R1WB 1QYGH 3R06B 4X5WB 4M1DH 1SJHB 1BBDL 5HHOA 4X8XA 5HGAA 3UJTH 1MHPH 4G8FA 4N8VB 1YMHA 4AG4H 3J8F7 2X1QA 4HK3N 1EEYA 2RB8A 4HJGB 3LH2H 4HUUB 5IROA 4ZTOL 1J1OH 2GSIB 4HPOL 1GGCH 1A7RL 1JZ6A 1FNEA 5EU6B 2VIRA 3QO1B 1RI8A 3ET9F 1SEBB 4AMKL 4EN3C 2CJUL 4NKIH 2EIBA 1FNAA 1CR9H 1WAAF 2HJLB 1KCVL 3RY6A 1MCQA 5D7IA 1PLGH 3FCTB 3WLBA 1H3GA 3IFPA 3V4VH 2PYEE 2VJXA 4KGJA 3VXSD 3BIAX 3HG1E 4BH8A 2O93L 5BO1L 3C87A 2RBLA 4X6CB 2D03H 5HGHA 1U8OB 4YK4B 2X4UB 3SDDB 2VAJA 3MRIB 5EC2B 2JE8A 3VI4F 5L7XH 5L88L 2DM7A 1GXEA 4NUJA 4Z7UE 1FAIL 2YA0A 4XPFH 4AEHL 4YR6B 3MR9A 5B3NA 3GSNA 1HILA 4XH2A 2WBWB 4K23L 2CLZA 3ULUD 2HN7B 3G08B 3RWGB 4Y5XB 4Z8FH 5CZXD 5DA4A 1F58L 2F54D 3OR7B 4C57C 1R3KA 2FEDD 4Z7WE 4WCYL 4Z18A 1G1YA 1PZ5A 1S9KC 2ZKHH 5IIEB 1WEJL 4Z7WB 3P9LB 5EU4B 2P45B 4L8SB 3BZEB 1RJZB 1VDGA 4OAWB 1FVCA 4UDTB 3MUGA 1BOGB 3TO2A 4RWYL 4B50A 4U6XB 3D18B 3DJ9A 3MNVB 5DRWB 4NQVA 1EAPB 2OYPA 4OZHB 1A6TA 3FONA 1MLCA 1TTFA 4CVXA 2XKSA 3O0RL 4NWTH 5DJ6B 1DVFD 3IAGC 5CWSA 3VG0H 4OGAD 1X5FA 4IIQA 1CFQA 4HZLB 5FYKH 2GY7B 5J6GA 2W91A 3KR3H 2FB4L 3RTQA 3VA2C 1TZHB 1F6AB 2YD7A 3E6HB 4ERSL 4MVBD 3H42H 1N3NA 4BQCA 2NXYC 2ZWLT 2EXYD 4F7CB 1T6WA 4U1LB 3IDUA 3TBTB 4R8WH 5GS0C 4X8JA 4F7PB 5J12B 2R0KL 1CVSC 4L4VD 5CCKL 5GGSB 1JN6A 3W0WA 4NZUL 3RX7A 3W11D 2A6DA 1IGTA 1J0JA 1BOYA 1HHJA 2V2TB 1M71A 4ZFGL 3G6AA 2AJXL 4LCWB 1XZ0A 4NZTL 1KTKE 3TPUB 5E94B 1MCPL 1TFHA 2JJTC 2UWEB 4R7DB 5KVDL 4BZ1L 4DKFL 4QRSA 5FUCE 5MEQA 1KNOB 1OARH 1MWAA 4L4VE 4M02A 3U4BL 1IAOB 1D5XA 4GAGH 4WI8A 5DMGD 3O81A 3BIBX 1WWCA 2FDBP 4JZJB 4C58B 2GQHA 4ELKB 1WFOA 4BH8B 2AJYH 3ULUH 4RA3A 4F7TB 2HAZA 2DM2A 3WFEL 2ATKA 3HG1A 5F6IB 4Y2OA 1FN4A 1UADC 1U8KB 1GZQB 1WK0A 1ZLSL 4FOMA 4PJ8D 4F58L 1VEMA 4TSCH 3V5HB 1U8JA 5DUBA 3BPNB 3D3VA 3ALWA 1X4ZA 4IMKA 3INUL 5GSVB 1RJLA 3T2NL 3B9KC 5I1KL 1CTNA 2HN7A 1SJXA 2R69H 3V2AR 2YBRA 4G80A 3SGEH 1NBYA 4GW1B 3QZWB 4XHJC 2EDJA 3TZVC 3LD8C 1ZK9A 2IAMC 2VIRB 3QO1A 4K94C 4U6TA 5DR5H 2FIKA 2EIEA 1KEMH 2CGRL 4QY8B 1L7TL 1RJZA 4GKNA 5ITFB 2MQ3A 4P2CG 3T2PA 1FYTD 3C5SA 5F7UA 4L9LB 4PRPD 5BRZB 4W4OA 4U1NB 3U30B 1WFNA 4JRYD 1P4BH 4UV4L 2C3VB 1EAPA 1TENA 4M9OA 4MNQA 2NY2D 4ZNEE 4NNPL 4ODVL 3RHWK 2A0LD 3VH8B 1YJDC 1YMMD 4P3CH 5D1ZD 3QPXL 4OI9A 4XPBL 1OVZA 3QUMA 3QEQD 4TRPH 1L7TH 5A3ID 3O3AB 4KTEH 4F8QA 3QFJA 3GJEA 2A6JA 2VUYA 1T5XA 2EDWA 4J4PA 5FGBA 3BEWA 1DQLH 5TH2A 3U36A 3S37H 3KYMA 4PFEA 1TNNA 4JKMA 1OOAA 2YSSB 4BUHA 4GSDL 3I50L 2A9MH 5DTFB 2BVTA 4M7LL 1CDCA 1Y18A 4YHKH 5INDA 5J13B 4KK9D 4P3DA 1GGTA 3CFJB 2GSGB 2QADC 4RFOH 3TO2B 5K59F 2J8OA 4P9HL 1AI1H 3B9DA 2Y6SD 2V2TA 2PETA 1ROWA 2ZUXA 2ADGA 3ZHDA 1I1AB 3MNVA 1A3LL 4P4KC 5CLWA 4OV5A 1JWUB 3RVTC 4NRZA 5J06A 3FONB 5F93C 1EZVY 2A77H 2X9WA 3L3KA 5DMIL 5DD5H 3E1F1 1G9MC 4NQDD 1F2QA 1DEEB 1FFPB 4K07A 5DD3H 4ZUVA 3HPJB 4HHAB 4FFVD 2OK0L 4APQC 2NW3B 4LIQE 3FMGL 4GSDH 3LH2L 4KJPD 4GRLA 5L2JA 4XCEB 5DXWA 5J6GB 1MEXL 1QR1B 3V6ZA 1KCSL 4PJXE 4AZ8A 5IHZB 2CJUH 5GGSY 3RTQD 2ADIB 5GSRB 3UC0H 1LE9B 2H1PL 5DSCA 3S34L 3AMLA 5KSAC 4JPIB 1J1OL 1I7ZB 5KVEH 5E6IC 4UV7L 3F12A 3O3BB 3HRZB 1XCQB 4E9LA 3OHXB 2F53E 1ORQA 4HAFA 4IRSC 2GK0A 1U8HA 3HA0A 3I9GH 3NCEB 3TWCH 1NGYA 2UVEA 5A1AA 2I60H 4XNMA 3VDBA 5EOTB 1EK3A 2NY7H 3MODL 2F5BL 5IVOA 4IOIB 4YHZL 3X11A 4MD0A 5KN5B 2C7UB 4QY8A 3OZ9H 3ORJA 4OIBA 1WLHA 2XN9E 1JHTA 4LQFH 1IAKA 4WW2A 2BERA 4H20L 1EFQA 1E6OH 2HKHL 3W9DA 1HXMA 4I18C 4J3VA 5DHVB 1BVKB 3UBXA 5J11C 2HKHH 4P2RD 3GIZL 2NYYD 3O2VH 1OSZB 2PW2A 2ATKB 3HG1B 4LRNL 2OZ4L 1MHEA 2PTTA 1NLDL 5HVGB 2BSED 4MAUL 2AJUH 1I85A 3C5ZA 2HFGH 3CU7A 1DBJH 5I74C 3SY0A 1A9BB 4PLJD 3KXFE 3PNWB 4O5LL 4Y19E 2VDNL 1KN2L 3QR2A 4LHUD 3GBNH 1F58H 4N9GA 2ORBH 1VFAB 4FA8A 1F4AA 1B88A 2QHRH 4JFED 2HT3D 4NQSA 3GMQB 2DTML 2ESVE 2FD6H 5INDB 3F6IA 1PSKL 1CVRA 2EDRA 4ZPTA 2XTJD 1WIPA 4YLQT 1SYVB 5E8DL 1YNKL 3KPNB 4WW1B 4Y4KB 4K2UL 2F19L 4FS0A 4CL7A 1N0LA 4YO0A 5C08E 3T3MF 3SJVB 5J57B 25C8H 4HUMB 4M7LT 1OARL 2K7QA 4PLOB 1F2XK 4FQPA 4OLYH 2EZ0C 3P9WB 3FB6B 4N1HB 1HH6B 4LARL 3ALXA 5D1XD 4A6YH 3CUPA 1IT9L 2VB5A 2QQKL 1JFQL 4F9LC 5I6XC 3TYFA 2Y07H 2CXKA 2A83A 3GJEB 1EJ6A 3CMOH 2X6MA 2FB4H 4JFQB 5C8JA 4B0MM 2CK0H 1EVTC 4MA3A 4KJPC 5KSBB 5HYFA 1JGUH 4OKVB 4ORGA 3QIUD 1IC5L 1SBBA 5SX4H 4M5ZH 5KSBE 1P4IH 1NCUA 3GSQA 4U4BA 4NN7B 2FIRT 4X7DC 1IGML 2IANB 2GFBB 3A6BH 1H3PL 1G7JB 3U30C 1UJ3A 2CSPA 2E3VA 2CD0A 1AXIB 2ILLA 3EYOB 1HXYA 4OF8A 5HHOD 4EI5A 1I85C 5HYIA 5MI0C 1DQML 3L5XH 3FQUB 5BZWA 4XVJH 5DS8B 1JWSB 1QEWA 4KHTL 2ZCHH 2EC9U 1LNUB 3WLWC 3MV8B 3T8XA 3D39D 2YS4A 5ENWA 1FAKT 4L4VB 4S1QL 2X09A 1D9KB 4NBXB 4H25B 2VITB 3EYUL 2BY2A 1AP2A 2CLVA 1N4XL 2OMBA 3EJJX 5IHZA 2DIAA 2WLZA 3DI2B 4PG9A 3DV6B 1N4XH 1MHEB 3AU1B 1A0QL 4L29B 1FSKC 1KTRL 3UTTE 4Y4HD 1KJ2B 2MHAA 5CJ8A 2QR0A 3WUWA 4HUWB 1X5JA 3IFLL 4CU8A 4Z76B 1YPZF 2G60H 4JRXA 1V3LA 2IMMA 4GS7C 1PEWA 3FTGB 2V9TA 5J1SC 4WFEE 5HYJA 1QLRA 3OAUL 1C1EL 1C7TA 1G7LB 5I1AA 1K8IB 5I75C 3KLHC 4GBXA 2DL2A 4RFEB 4N9GB 3V0WH 3ECBB 3DURB 2VQUA 2JELH 3GMQA 5CBEA 3MRCB 5E0QA 2HTLD 3FOLA 4NDMB 2D2OA 4NQEE 1TJHH 5C1MB 1Q9WB 4WUKH 1VADA 4XC3H 1CICD 1A7RH 2HT3C 1UB6B 4ZPVA 3U4AA 2YUXA 4RAVB 3MLVH 4PUBL 35C8L 4JQXC 3VW3L 2XTJC 1JPFA 4JAMB 1E4KC 1HSAB 3IDJB 1UQSA 5DLMH 3WO4B 1J8HB 3L9RB 4HXAL 1N7MH 2WUCL 4WU5B 2VUOA 5IB4A 1HOCA 2DDQL 4H5SB 4OJFH 4F2MA 3TIEA 3DIFB 2VISB 3HMXA 3FFCA 4WUKL 2O26U 5C0BD 1BX2B 1MI5A 5EO1A 1ED3A 3KPSD 4NQSB 2CIKA 5K9KB 3O9WC 3QUZD 4LLDB 3JV5A 4LNRB 5AAMA 1OTSC 3THML 1PDKA 2WIIA 4OFVA 2HVKA 1R24B 2DYPB 4I4WB 1N5AA 1NCBH 1UJ3B 3UTZB 4R0LC 3QQNA 5IVZB 3SCMA 2AJUL 3O45A 2JK5B 3IDIB 2XKUA 5HGDB 4P2OB 4G8EA 3JV6B 5EFIB 5F7WC 4F9PA 3NPSB 2NCMA 3LDBC 4QXUH 3RWDA 5D1QB 4OIIL 5DHVH 1CWVA 4R4BA 3GSVA 1SY6A 1CT8B 4QTIH 4I18B 4ZS7H 2OJZL 1UWGH 1ZWIB 3HZVA 4TULH 3GMOA 3TCXA 4Y4KD 1N2RA 3DX9B 3EHBC 3VMPA 1XGYL 2AS5M 1K3IA 1UEYA 1BJ1H 1LQSR 3MJGX 3QUYB 4P23C 5JUEH 1Z5LB 3IJSB 2W0LA 3KPRA 2C3WA 4S1DC 1JMZA 3WUWB 2NXZD 4NFDA 1AKJA 1FDLL 1LO5A 1EX0A 2ENSA 4N8VA 3OKMA 2YMXL 2EDHA 2N1KA 4HGWA 3BGMA 2EDKA 4PJAA 3STBA 2CRMA 2Z8SA 4HWBH 4UAOB 4JFDB 5FM8A 5IM7B 5KS9B 4FQXD 2DQFA 1NGZB 5ESAA 2HG5B 4R4NC 2DQJH 4KZEL 1V3JA 5IBUB 2WQRA 2VXSL 2JKXA 2K1MA 4WHCA 4LCYB 4LP5A 5CEZE 1EAJA 4HS3A 3WFHB 1MNUL 4JDTH 5E2WL 1UB6A 1J0YA 5HGAB 1JRHL 3P40A 3MCLL 1NC2A 4UINH 4KRLB 5HTSA 1T03H 2ICWA 2OQJA 5FV1L 4FXGA 5GS1B 3OSKA 2VXQH 5C2UB 4M7KH 1DQQB 3HMXL 3BKYH 1F8TL 3FO2A 5CMAB 2QSCH 1R3JA 4K7PH 4NN7C 1VHPA 5IR1A 4JRWA 4MXQD 4R26L 5L8KB 4NQCA 4FQQB 4LGRB 5BO1H 5T1KA 3TO4B 3TIEB 4F7EB 5IVXB 5IUSA 4UU9B 4PY8I 5HPMB 2LE9A 5DVNA 3AREA 3QCTH 3WFBL 4EIGB 3O4LD 1MI5B 1EA9C 1NGXB 5DEGA 3IVKA 4PR5B 1YN6B 5I1EL 4C56A 2R0ZL 4JM2C 1OCWL 5BV7H 4PJEB 3KDMB 3VWKA 2X1XR 1MCRA 1NCNA 1T4KA 4I4WA 3NCYS 3IU3B 4L5FH 1VB9A 4BA8A 1RMFL 4Y88A 2AKRA 3EZJB 2EEAA 3QUZC 4YHOH 4Q9RL 1KCLA 2NW2B 2CDGB 2H2PD 3VFUB 1VFBA 1A9BA 2NNAB 4JJ5A 3D6GA 4P59L 1Q9LA 3DYOA 4I0PA 3R4DA 5GGVY 5LWYL 4E5XB 1E4JA 1QNZH 3FQWB 5FKAB 3T0AA 3CFKA 4G6AC 1VFAA 1EHLH 4ZSOE 4HBQA 3QXAB 1DCLA 3IXTA 3LN9A 2E9WA 5IB2A 4PJDE 2YD5A 4CDGC 4XNYH 4PBXA 4MNGE 4PJ8B 3K81A 1RMFH 1JPSH 1ULVA 5KSVA 2EKJA 3PQYB 1KOAA 1NUFA 3FFCE 3ELAT 2WW8A 3IJSA 1YPZE 1GJIA 4WW1A 3RZCB 5DRWA 1FH5H 4OZFG 2ERJC 3VFVB 2X4PA 5C3TA 5I1KH 3HI6L 3W0WB 1P4BL 4UV4H 2X10A 3FO0L 4WDIA 3VRIB 2W0FA 5FYLL 3ARRA 3HC0A 2WNGA 4DQOH 3MRMB 1XZ0B 1MJ8L 4TSAH 2Z35B 2ITCA 4L8DB 5DA0B 2PF6A 5FO7B 5IMKA 1MCWW 2HLFD 3RTQB 1KENL 1ZA3B 5LVEA 1IAOA 5E00B 3RWDB 2C1OA 4GRWH 3VE0A 4FFYH 1EDQA 1N0XH 3QAZC 4JKKA 5KSBA 3GEWB 3ULVC 2RQ8A 4ONGH 2WWMC 3B9AA 4Y89A 4J4PD 3VXTB 3QG7H 3UO1H 5T3XH 3MLXH 1WC7B 5IGXL 1KCRL 3M17B 4PRPB 4G7VH 1AC6A 2IAMB 5ETUA 5KVFL 1MJ8H 3SDXE 1T0MB 3O11B 3T4AB 3B43A 4G7VL 1GH7A 4M6OH 1HYRC 1UH4A 3GKZA 3MXVL 2PO6D 3L95A 3HE6A 4XCYB 2ZUQC 5IVXA 2VC2H 3BGMB 2QJDA 3EFFB 1X5LA 2LABA 3EDJA 2Y1VA 1OAUH 2X1WL 5CGYD 4YGVA 4NO5B 3AREB 1NGXA 5DEGB 4EVNA 1ZGLA 2VITA 4OLWH 2QKIA 1AR1D 3RGVD 1AIFA 4PBWD 1E28A 1INDL 2OCFD 2DQGH 3CNKA 4PRBA 2YPLD 1AGCA 3KPTA 5I8EA 3RA7L 1RIUH 3H9HB 3DUUA 4CU7A 5DUPL 1U8QB 2UUDK 4V2BA 4CMHB 5C0GA 4RFNC 2G9HA 5MHSD 3NZ8A 1BQHB 2P5WE 1QA9B 4OIIH 5T3ZL 3T0XA 4PJGA 1L0QA 2NY3B 3CFKB 2A0LC 2OLDA 2HFFA 5DJCA 4F33A 3F58L 1MJ7H 8CGTA 1LO2L 2Q8AH 4GG8B 1NGPH 4G3YH 3RIFF 1SM3L 2Q8BH 3WMSA 5BS0E 4KV5F 3PQYA 4FXLA 4C4KO 4YHIB 2X4OA 4Q7DA 4PGZA 5E8EA 4Q9QL 2XZQH 3WXVH 1VFMA 1JVKA 1W0VA 2V5RA 4KK8D 4NYLB 4L3EE 2NY6C 1KB5H 2XRAL 3SKOA 4Y19B 2W0FB 1D5BB 3MV7D 3DSFH 3QIUB 4GMSH 1VGEH 4NCC2 4S10A 2ITDA 4JHWL 4UAOC 4RGOH 1ADQL 2AK1L 1O7VA 4J8RA 3WJJC 1UCBL 2DQTH 3T3ME 5FUCC 3JWDC 5ILTH 4XMPH 3VXOA 3BEWB 3GI9L 4Y4FD 1W72H 5KVGH 1P7QA 5DJ0A 5C08B 5MEND 3VFNB 3QXAA 3C9NB 4FFVC 4JFZH 5IQ7H 4POYA 1YDPB 4POZD 3GSOB 5IQ7L 3TBVB 1L7IH 4FQ2L 4M7KL 5TDPB 2NX5E 4U3HA 3RJDA 1YUHB 1LO3L 1KYOK 4NBYB 3FMGH 3GHEH 3QEHB 3TNNA 4GQ9L 2WWMD 1AXSB 4U0RC 1HSBA 3MLUH 5GS2D 3CGTA 3IGAA 4HK0A 1JZ2A 4OT1L 5MP6L 5IESH 1ADQH 3VD3A 1P7QD 3L3KB 1UYWH 2FEDC 3ZDYE 3LEYH 3L6FA 2YPVH 1PW3A 4BFIA 1OD9A 2NW3A 3DMMB 4JRXD 3UPRA 1FNEB 1RZFL 5FO7A 4NPYB 2KDGA 2MWCA 1MVUA 3DX8A 2VXVH 3W5NA 1J1PL 3T0ED 1E6JL 4JM2F 3EIFA 4J3XA 3G5YA 5DUMH 2ZOKA 3HI1B 1EO7A 2WAHA 2XPGA 1C5BL 5DVKA 5AG8A 1BBDH 5DSCB 4ZUTB 2Q87A 3CFCH 4HBCH 3UBXB 5LGJA 1S5HA 5DEZA 2V9QA 1WC7A 3NFPB 5ACMA 4D9RE 1PX3A 3SGJC 5ADPL 1HKLH 1R3IL 3V6FA 2APBA 4WWKD 1JHLL 4FTVE 3OPZH 3H9ZA 4PJ9B 1NCDL 2GJ6A 3GB7A 3WCYA 3PGDA 1IKNC 1A7NL 3X11B 3WIIL 4CVZA 4XAKD 3O8XB 3MRPB 1PG7H 2BC4B 3MXWL 4Q9RH 2BNRE 5KS9A 3PABA 4B53A 1KJ3L 1IGMH 2FJHB 2WBJD 5HHME 5KZCD 3IFNH 5DF0A 1U41A 2Z4QA 5T1LB 1T5WB 2BHYA 4P0DA 1U93B 3DETC 3FT2B 3QWQB 2R0ZH 5BV7L 4UBDC 2H3NA 5GHWH 2MKWA 1X7QB 1IZKA 3PDOA 2B1AH 4LVOB 4BQBA 4YX2L 1JE6A 3DUUB 4P9MH 5IT2H 1KLGB 2VSDA 1LO0L 1WBXA 3L3JA 1T7YA 4FNLL 5E9DE 4WHTB 2P8MA 1IEBB 4UB0H 4BFEA 4QRRB 3VFGH 1OP9A 1N0XL 5L7XL 3KYOA 1OAXH 3M07A 1QACA 1CICA 2VLKE 4Y4FB 3GMRA 3MROB 2QEJA 3DVNA 5D1XC 3KWWB 2WV3A 4HUVA 2JJTA 2YRLA 5HHNB 5L2KA 3U0WL 4TPRH 4WVRA 4GKZA 4ZD3H 4OCSH 1G7MA 2J2ZA 2R2BA 3ZT5A 3IGAB 1A1OB 1DBAH 3BIKB 2DTMH 1KXVC 4RA0C 2BMKA 1RULL 4KRNA 1I9JL 3FZUD 1I1AC 1IL1B 3VG0L 3QIBD 1AKJD 3B8YA 3MLSL 3ARWA 3FAXA 2HRPH 1FC2D 4IM8A 5J9PA 3BRGC 2XA3A 4PJCF 4XVSH 1VA9A 4X4ZA 4WI3A 5FDWA 5D9SB 4OD2B 1I1CA 3EO9H 1XGQA 5HY9A 3W81A 5JHDA 3HKFA 4GAJL 4LSTH 3QEGH 2ENYA 1S7SA 1TQCB 3VRJB 2HWZL 4PG9B 1KLUA 3BDXA 1G7JA 4OF6A 1ZEAL 3GMNA 4GUPA 3HUJB 3ZO0A 1YEEH 3UMTA 5CJBA 4KY1H 1T1WA 5IMMA 3WXWL 1FYTB 2AI0L 1QQDA 3PABB 1RU9H 5EOQL 5HGBA 5I8OL 3D25B 5JLZB 2ED7A 5GGTH 5TQ0L 4K94L 2UV3A 4H1LH 5KVEL 3B5TA 3QEGL 5ACZA 1V05A 3C2AL 1I7UB 3THMH 1U58B 4XP6L 3ZTJH 4XVUD 1CG9A 4V1DE 5SX5K 3L7FB 2A77L 3NCMA 3M17A 4PRPA 2FRGP 2PO6B 4U6HB 2WZPD 1KT2B 5D7SL 2FSEB 5HD8D 4Z95L 3P0YL 2AXGA 1UWXH 4CGTA 3DVGB 5T3ZD 1WBXB 4ODSL 5DJXB 6CGTA 3W9EA 1S7QA 4DGVH 2WINB 4F57H 5H8DA 2BNQA 3FTGA 4KTYA 2CK0L 3GI9H 1U8LA 1ZLSH 3L3OB 2VLRD 2VLKD 4TTGA 1H5BB 3QXTA 1CICB 2C4FU 5IB4B 5CBAB 1QBLH 3HI5H 4JJHA 4YDIL 3ZDZE 3D3VD 4ZFFB 2IG2L 4OCNC 4WENB 5JR1L 1MFDL 3LOWA 1MH5A 5CLTA 5IB1A 1MFDH 5ID0B 5JIPA 5A16B 1Z9LA 1FVEB 5C0EA 5F9OL 5DTFA 4ZPVB 1FGNL 2FX8H 3IDMB 1EXUB 3BIKA 4M43L 5B39A 4AENA 1NGQL 1MF2L 3L3IB 3ZKSD 2X4SA 3T0VA 5ADPH 3CIQA 5CGTA 2ESVB 4Y1AB 2ZSVB 5JW5A 4GW4A 1ZLWK 3DIFA 4EBQL 3RKDD 1RZJC 4QF1A 2J7LA 5FYKU 5CEYA 4NCC1 3QJFB 2YOCA 4P3CL 2BSTA 3PL6A 2AW2A 4X83A 1U91B 5I1GL 3S5LG 3LS5H 3FN0H 4GKOA 2FBJL 2CIKB 5K9KA 4XP4L 4KKCC 4MD4B 2PXYA 4AQOA 2VKWA 5T1MB 5GGSA 3DX9A 4RRPG 5DFWH 4YUEH 1KLUB 2EE9A 3LHPH 3O3EA 3ULVL 1HHJB 2FLRT 1FG9C 4MSWB 4JFPA 5JDSA 5GISH 2J5LB 4F9PC 4XXCC 4DOHE 3O3BA 5JOEA 1J88A 1I9RL 4WUUB 4ELMB 4XP9L 4P9HC 1WAAA 4LAJH 4PJIA 2YUVA 2GEEA 4HKZA 2B39A 1ONQA 1C08B 4G8EB 2DICA 5EFIA 2Y7QB 3BQUD 4I3RL 3O4LB 5AWNH 1MQ8A 2ED9A 4D8PB 4XP4H 4MNQE 2OM5A 4G9DA 3QQ9D 1P4IL 4OLXH 3T65B 1ETZA 3T0BA 1U58A 2AK4E 3B8SA 2G75B 3VXMA 3BMWA 3Q1SH 2CXGA 3L1OL 3FB5B 1ZHNA 3ISWA 5I1LB 4R4ND 4QRUB 2JIXB 5K33A 3N1FC 3QEHA 1BD2E 1HCVA 3TNNB 3MCKA 4ZS6D 1YJDL 4MVBC 1YY9C 4BFBD 2Z8VC 4LPCA 5AZ2H 1TQBC 3B2VL 1IQDA 1MIML 4OCSL 3MLRH 2D7NA 4HGWB 2A6IB 3GMNB 3W2DH 5IBTH 4WJ5B 5CMAA 4FTVB 2IGFL 2PYED 4MWFA 5GRUL 1A3RL 4JPVH 3TO4A 3LKNA 5EU3B 4FQCH 5JHLL 4GKNB 5HHVL 3G5ZA 3DV4A 2VXQL 5IJKA 5HHMB 3FQRA 4EOWH 4H1LB 4X6FA 4S2SA 5DMGC 2C3VA 3V8OA 4A2MA 3FJTA 3MQIA 3L7FA 1V7ML 3BQUB 4RMQA 4GLRI 1DSFH 5FO8B 1RY7B 5ILTL 3ZL4H 1D6VH 3X12B 5HDLA 4P2QB 2ATPB 4YBLC 2IGFH 2GTWB 1G9ML 2BSRB 3O4OC 1F3JB 1RIHH 3WLWD 4MCZB 5C0CB 2NW2A 4KKBC 4U7SA 4KY1L 2H2SD 2FYYB 4QF1B 3RVVD 2FJHA 4O9HL 1MUJA 3OKEB 4MZ3A 2IADB 7FABL 4PRHA 1J05B 1RIUL 4XI5C 1GGBH 5I0ZA 2ZSWA 3O0RH 4NWTL 3PL6B 3UTSB 1CF8L 1MAML 3RZCD 2FHBA 3S6CA 5CBAA 2XA8H 1A21A 1G7HA 4NQEB 2Z92B 2WLYA 3RKDC 2FX7H 5EU6E 4U1SB 2Y06L 5C92A 1ZVSA 2KBGA 2FX9L 3P0VL 4ZO8A 2YKLL 3SKJH 3KPPA 2EH8L 3QNZB 2DWDA 2D9QB 1Y0LA 4HFWB 5DUPH 1LGVA 3U7YL 3RP1A 1RK0A 4HSQA 1IILE 4JJ5B 2ADJB 3U46A 1XMWA 2PW1A 3MRMA 1I9JH 2CDFB 4E5XA 5EUOB 3TFKD 3D0VA 3I2CL 2DMKA 5ADOL 1YEKL 4ZSOA 5F88B 1J12A 1PD6A 2AK4A 1KEGH 3HMXH 1JGUL 5TE4H 4I9WE 1BVLB 3NOIA 1D9KA 1RUPH 4LMQI 3KPLB 3MOAH 2NR6D 4PJHA 4DK3A 1B0WA 4M8QB 5I6XB 1PG7W 1AGFA 4E42A 1CD0A 4JQVC 4Y5XC 4LDEB 4MZ2A 3VFVA 1JFQH 3MRFB 2OR8A 1L0YA 4PGDB 1X5YA 2GK0B 5E95B 4YZFE 1RUKL 3UTPD 4KK9C 4UTAL 1PJ9A 3E0GA 2AEPH 2CKBL 4LL9A 1BREA 4PGCB 5IMLA 4RAUB 1Q9OB 1BFVL 1ZHLB 2C1PB 3MACL 3TM6A 2W92A 1GCFA 1X5KA 4HIEB 3D2UD 1NEZG 3MGOB 2N56A 5FYJH 1L7IL 1CFBA 1F45A 4HF5H 4BK4A 4P4KA 2NX5B 1I8LA 4D0DA 1QTYT 5FYJL 1IVLA 1GRWA 3FQRB 4PJXB 1CFTB 1EJOH 4O2FA 5DD6A 4F3FB 3IFPB 3AS1A 4OCLC 5I18L 3G5XB 3AVEA 5C0JB 4DFHA 3WKMH 5JW3L 1BBJB 3MRGA 4WFED 3H9SB 3HTLX 4XP1L 5DURD 1IGCH 4KDWA 3H9YA 3O11A 1VADB 4DTGL 2X4QA 1QYGL 3FFDB 4GUPB 3V7MA 4KTDL 4J23A 2OS7A 1NPUA 4F15C 1F3JA 3HE7C 2BX5A 3MR9B 2HKFH 1UWGL 1IBGL 4UNVA 5DJ2B 1KPVB 4RFOL 1UVQA 3TVMD 4S1RH 3C60D 1A5FL 4GKSA 4JGJA 3UTSA 4HMCA 4L3ED 5HI4D 3EHBD 1I7UA 2YRZA 1QSFD 3TH2T 3RDTB 4L8BB 5I71C 2QSVA 4TVPL 2AEQL 4LSUL 1MY7A 3MRBA 5J4MA 1P2CB 2GT9A 1VERA 4WWKA 1CXKA 4MX7B 1H8OA 3DX7B 3KVQA 4TOYL 2NY3D 3BGFB 3SDDD 3D18A 1VSCA 5EU7C 4EI6B 4YO0B 3QI9C 4HMEA 3QWRA 1YNTA 5B38B 1MLCB 3BQUA 4MJIE 1BQLL 1F97A 4X0KB 2VLME 2VL5B 1XGUA 2WUBL 3P4NB 2BP3A 3CCHA 3V9FA 3O45B 5D96C 2X89D 4Z5RB 1S9YB 1U92A 1PY4A 3B9KA 3RPIA 1WUNT 4KWUA 4PLKD 4GT7A 4EI5C 3JV6A 3VW3H 4K23H 4NIKB 2MNUA 4TSBL 4KXZH 1NDGB 3RGVA 3L3GA 1J05A 4PJEE 3ARDC 4Z8FL 1IGJA 1CD9B 3KPLA 4PJHB 3MJ9L 4QXGL 4Z6AT 1A4KB 1QFWI 2IPTL 4UDUA 3GMOB 3VI3E 1I8MA 2PN5A 3GSQB 4CJ1A 5EULV 1YQVH 5C0BB 3WL9A 3WN5A 3SKOB 4ZTOH 2X4SB 3CZJA 1P6AB 1CXFA 5IK3B 1KJMA 3WO4C 1KELL 3NA9L 5GRZA 5BRZE 2EECA 4H0GA 4U1GB 3AS2A 4NKIL 3K0WA 4QRSB 2UY7A 4J8RB 1SBSL 4G9FE 4BFIB 1QFUH 3EYVB 2R2HB 4G6JH 2EZ0D 4CN6A 1NCCH 3EOTH 3CSBA 3BDYL 1MVUB 3G5XA 3S3SA 2Q76B 3LDBB 3W0WE 3IYLW 2R1YB 2J8UB 3AU1A 2I9LA 1QHPA 4KRPD 4OGYL 5DVLA 1CU4H 2HVJB 4P4RB 4JFPB 4EUPA 1MCDA 3IJYA 3KPOA 2DQUL 4FQJL 3BT2L 4Q6YA 2JB6A 4P2RA 3VFGL 3G5VA 5JQ6L 3W0WD 1Z9MA 4ZUSA 4UILH 3EYQD 1YC8A 3F6LA 3WYRA 4PJ9A 5HYQB 5JZ7C 1CD8A 2NY5C 1R3HB 3PQYD 1UKTA 2BVOA 4L3CB 4GAJH 4LSTL 4N0CC 3VXME 5IFHH 3C5ZD 3T65A 1ZTXL 5CBEB 2AJSL 1IFHL 5J11B 1S7XB 4E0RA 4NC1E 5F7LB 2GJ6D 4P4KB 3KLAA 2XT1B 3U6RB 3KR3L 2JJWA 3CXHK 2G2RB 4MX7A 4ZUTA 3IVKB 3AXLA 5ID1A 4HULB 1J1XH 4XMLL 5GGVH 4NKOA 1G0XA 1KB9K 5GRVK 3EYSH 3BWAA 1OGTB 3T0WA 3NCBB 5BXFB 3GRWA 2HMIC 4HUXB 5JNYA 1CBVH 2G5RA 1HHHA 5DC0A 3FB7A 3MA7A 4WJ5A 1CDYA 5KBNC 4ODUB 5ISZB 2EDLA 2HLFC 5C07A 1VFUA 3MACH 4Z0BH 4XMKL 1F4XH 4DVBB 3K4ZA 4MLSA 4RGNE 3WSQL 5FKAA 1IGJB 4NKMA 2ICWI 4YIQA 2MQCA 2C3HA 2P46B 4OT1H 4QXWA 5MP6H 3WFEH 2X7LB 2X4NB 4I1NB 4PJHF 1KCUL 5IJKC 1UYWL 1UG9A 1F3DH 5GQBA 1JV5A 2DLIA 2GSGA 3HZMA 1XF3A 4PJ8A 4Z9KB 3IU4L 1OQOA 2NY5H 3L7EB 1N5AB 4HWEL 4DKDC 3LZFH 1FYHB 3KAAA 3RGHA 4F9LA 1YN7A 4RMVA 4HWEH 3IDNA 2WM0A 1S9XA 4FTVD 4HS8L 3MNWA 2B5IB 2KH2B 5EBLB 3BVNB 2A9NL 3MBED 5C0IA 5M94B 2NPLX 3VFWA 5T33H 1HCFX 1FORH 3QEQA 1WSST 1OD7A 1HZHH 5FAAA 5A2FA 1ZVSB 1N6UA 1YEKH 5DJYA 2FGWL 2I9LB 4PJFB 3U4BH 3CFEB 5D71L 3KYKL 5D9SA 5IFJA 5JHDB 4HWBL 3MXWH 1R6VA 3V0WL 4X9BA 3MJ6A 5ICZB 4KUZH 5JIHA 4JR9L 4HDIB 4KRPC 3BGFC 4QWWC 1DQMH 3L5XL 1BVZA 4E41E 1IL1A 2PW1B 1DEDA 1KCKA 2A2QT 4JN2A 1BQHG 4L4JA 3V52L 5F3BB 1QQDB 4XPBH 1RZGA 3ZTNH 1XGRB 4YHPA 4DKEL 1D6VL 3P4OB 1AQKH 3ZTNL 5FEBA 4H1LG 4NZDA 5C0AD 1I8IA 4OGAC 2VZTA 1VEOA 4BH7A 3OKOA 3SGKC 4PJ7E 5EOQH 3QWOA 1Y6NR 3ARQA 4P5TB 4R2GC 3RI5F 1YEDB 5LCVL 1WCQA 4FQIL 2MJWA 4XNUL 4N0FB 1EHNA 5IWLC 1YEGH 4PGBA 3ZT7A 3QDGA 4YXKH 5FYKD 4Y2DD 4EXKA 3MRQB 1IAMA 5ISZA 4PJFF 4Y1AD 5IMMB 2COQA 4PJDA 1DUYA 3G5VB 1MHHB 3MLVL 4F7EA 5HGBB 2E7HA 3Q6GL 3ZE1E 4D2NA 3NGBB 1WBYA 1JNHB 4NRYB 1JUFB 4L9DA 3WNKA 3VXPA 3T4YB 5EN2A 1N6QH 2P5EA 2XWBB 4HC1H 4HV8A 4RX4A 1RZ7L 1OWRM 4HC1L 3P77A 2FJGB 3AXLB 2Z91A 2VXTL 1DQLL 3V5DB 4HK3J 4ZFZA 3IDNB 6FABH 1H0DB 5KSUA 3SDXF 2A9ML 4AENB 3OAZH 1QRNA 4O00A 1DL7L 4Z7UA 4PS4L 4JZOB 3QXDA 5HHVH 4GMTL 1GGCL 3PP3H 3MA7B 2BNQE 1CGSL 4Y2DB 3BP4B 3PXJA 2KZ1B 4RX4D 2OSLB 1FDLH 3M1BB 3B9KD 1UM5L 4X99A 5CJ5A 3ARSA 1MJUH 4R96A 3CDFA 3ES6A 3FO0H 5AAWA 4MXWL 3VXOB 2AXHA 5TF0A 3SGDI 2MSPA 1CTOA 3LKPA 4WGVB 2WMPA 2IEPA 1ORSA 3O4OB 4WWKC 2CRIA 1H3WM 1S7RB 2JIXD 4QOKA 1LMKA 4LRNH 4OF5A 3TGXA 1M4KA 1EFXD 5E6IB 3S37X 3OKNA 1XGUB 4Z7NF 5CP7A 5IMOB 1AXSA 1HSBB 3H3KA 1A6AB 4LPVA 3NH7L 2JCCE 3BH8B 3PDGA 1U3HA 1S9XB 3D0LA 4QXUL 5A2IH 1FZJB 3L6FB 3FQNA 4K8RC 4JY6B 5CILL 1NFIB 3QHZH 4J6RL 1U91A 2XV6B 2Z31D 3UPRB 2FZ3A 4TULL 1LEKA 3UCRA 1DQDL 4JY4B 2ZUWA 5IKCA 2XZAL 4MD4A 2PXYB 1LD9B 5D8JL 4MCYA 1P6FA 2BVPB 2KZWA 5CUSL 2ZUQB 5D2LB 2V5TA 5IK3A 2LTQC 4TVPE 5HHOB 5CINL 3VXUE 3OGOE 5I30H 4WUUA 3QIWD 3BO8B 4ELMA 3V7AE 1FZKA 2R29L 3VXUB 2QADD 1BJ8A 1ONQB 3PP4H 3O6LL 2FH8A 1WZLA 1YY9D 3BT2H 3CSYB 4FQ2H 3V6FB 5BQ7A 4ODWA 1CD1B 3HAEA 4N0UA 3HR6A 3VXSA 2ZUTA 3T3PF 4K3JL 5D7IF 2D7TH 2DWEA 5F9OH 1JNHA 2AJXH 3REWB 1NH6A 4OB5H 3UTQA 2FJFB 4ODTL 5MI0B 3RHWF 1V7MH 2IALA 1SHMA 4N90E 2E7LA 1O0VA 2YPVL 1BJMA 1QSEB 3HPLB 2PYEA 4R8WL 3EO0B 3WV0A 5DQ9B 1OSPH 4XBGB 5H94A 2EKSB 1H0DA 5KSUB 4CN1A 3LQZB 3RUGF 4JEGB 1X7QA 4JZOA 3CFIC 4OZFH 1I3RB 1FYTE 5I1IL 3DGGB 4EN3A 1TNMA 3L9RA 2R8SL 3D39B 4Y2DA 3DYMA 3OJVC 2F19H 2Y5TB 3FO9A 3ARDA 4H5SA 5ISZE 3LD8B 1I3GL 5EBMB 1QLEL 5FUZH 1S7XA 4E0RB 2YXFA 4NT6B 2BY0A 3B9VA 5LAXB 1FL6B 5HYJD 4K9EL 2DTSA 5EO1B 5T1DL 5CD5C 1S7WA 5F7DB 3BZ4A 1YEEL 4G5ZL 2JCCA 2DIBA 4OZ4B 3T4YA 2GJ6E 1YYML 1QLFB 1YEHH 1KFAH 1ORSB 1A0QH 4RGOL 5IEKB 7FABH 1CFSA 2B7DT 3IJHB 1QSVA 1ZLWH 5GGQH 1HHHB 1WWBX 4MGXA 1EFXB 2EXWC 1B2WH 2XY1A 1H8SA 2R2BB 3G04A 4PJ9C 1QSFA 3T2NH 1QP1A 2P5WB 4ZS7L 4R4FH 2YPLB 1GAFH 1ZT1A 1LEGB 5D6CA 1OAZH 4LASL 5FCSH 2ZUSA 2R23A 2ARJB 5I17A 4X6DB 3RNKA 2ZSWB 4KKLD 2L0DA 1S8DB 3L3HB 2FZ3B 1WT5C 1DFBH 1CYGA 2CRZA 1OAYH 4OTXH 1IC1A 5F88A 5H35A 2HJKB 3C09C 3IKKA 1YEJH 3QUXD 4JLRB 4JY5L 1S5IL 1CL7I 5FOJA 5GRJL 3TT3L 3EDDA 4U7MA 1NAMA 3DHJA 3KYKH 1G1CA 1MVFA 2NR6C 4W6YB 1DLFH 3DMMC 4CUCA 1NKRA 2R69L 1QPPA 3KPMA 4MAYB 4KI5F 5INCB 1ZHKA 2FHCA 1OP3H 5IGXH 2Y23A 5K9QG 5C0IB 1DUZB 3CK0L 3UZEA 5C0AE 4EOWL 1T1ZA 1P4LB 1PGRB 3ZZ1A 1K6QL 1T1WB 3RY6C 2V2WA 1U3HB 4LLWB 4M6OL 2A73A 5CCKH 5HVFB 3UTQB 3DBXA 3QNXB 5SV4A 4HG4K 1OPGL 1A1NA 4OJFL 1XFPA 3TT1L 5DJZA 5BV7C 2XPGB 3OAZK 3QIBA 4LLVA 5DD3L 4XPTL 3TT1H 4HXAH 4HS3B 1V3KA 3WFHA 1MCPH 2JJVA 5DQDL 3N1PC 5F89A 4JB9H 3RIAF 4H26B 2A38A 1MRFH 2GCYB 4YHYC 1F4XL 4JFFD 5DD5L 3GBML 1OLZA 3VWJB 4JKPL 3VGHA 4POZC 1T7ZA 3QULA 1GPOH 4FRWA 1NCAH 2L7UA 1TQCC 4OLXL 3WNOA 3WFCH 3BRDA 5E2VL 3RWCA 3VXUA 1CGWA 2I5YH 3LKSB 2IBZX 3TYGL 4X9IA 5DWUL 3PGFH 1E27B 1FFNB 5FF6A 2EE2A 4X98B 1KPRB 5IW1A 3LZFL 1K8DB 5F1KC 5C09B 3P4MB 4N8PA 2KUTA 1G6VK 4C56B 5CILH 2FEEL 1E4XI 3DROB 3PWPE 1D9KD 2P4AB 1OTUC 2J8HA 2JTDA 2OTWA 3JSSA 4JG1L 1U93A 4QTIL 3FT2A 4DGIL 5FGBC 1TMCB 2W9EL 5A16A 1IC4H 5LQBH 4DGIH 2AKRB 3RWFB 2R4RH 1I1RA 3OKDA 2NY4B 2ARJQ 1QSFB 4LLMB 3QUZA 2NY3C 4ONHA 4APQB 2V7HB 4H8WH 1M05A 2F54A 4XNYL 1NMAH 1PQZB 2F15A 3QQ9C 5D7JB 3TWCL 4ETQA 4YFDB 2EXWD 5HHPA 3N06B 5GS0H 1WGOA 3RFZC 2DLEA 2PUQT 4Q9BA 3FO9B 3S4SB 3PV6B 5JOPE 1J9CT 3DVNB 2VN4A 2D0HA 3WIFA 4PJBE 3QDAA 1P2CA 1WWAX 5FHBL 3GUTB 4QHNA 4W68A 4IRSA 4KDTA 2XN9A 4ZYKA 1T7VA 4Q0XH 3ZKND 5L6YH 4AIXA 2D7PA 5F1SA 1FBIL 1A1OA 1I3UA 5GRYA 4ZFOA 3MJ8B 4HJ0C 4HAGA 2I60L 3AY4C 5F1IA 1EUUA 1G7PB 1OTTC 3PWPD 3V4UH 5F9JA 3DRQA 4JPKL 4OZFB 1CF8H 2D7MA 1NCCL 1P1ZA 4OV5B 5FA4A 4ZFGH 4G42A 3RBGA 2AJZB 2V2WB 3C09B 1N59A 4ONGL 4GRLC 3U7WH 1A6ZB 2I07B 4MA7L 4O4YH 4F15B 1NAKL 4R96B 3PWVA 4HUKB 1EV2E 3LQAC 4JFZL 1AO7E 3CAFA 3NA9H 3IKCB 4ZO9A 1IGIH 5F96H 3I85A 3STZB 4J7RA 2G75A 4NSKA 1IAII 3V5KB 4JG0L 2C5DC 4ENEC 3FHAA 4KPHL 5CJXC 4GQPH 2X1PA 4P2YA 4YNYB 3T4AA 4NQUA 5D2LF 3OKNB 3QPQC 4MLIA 3TF7C 5E6ZA 4KFZC 3PHQB 2AGJL 2F58L 1OTSD 1F4HA 2Z8WC 3QXUA 1FH5L 3RKPA 3BP7B 1U8HB 4OIAA 3RZCC 2EO9A 4HH8A 5EWIH 4OZIA 3LKQB 4PJFE 2EE6A 5J12C 1KG0B 1G7IB 2FCBA 2XQYG 3NIDE 4W6XB 5EZIL 2PCPA 5C09D 3MYJB 4UT6H 3T77B 1HNGA 5DJDA 1RHHB 3SQBA 4ONFL 3ZYOA 1RHFA 2BRQA 4ODXB 1A1NB 4PRBB 3VG9C 3U6RA 5I66B 32C2A 5GGRB 3DX6B 1HXMB 4NNYB 3QUKB 1FSKB 1FNGB 3UTSD 3BD4A 4DK6A 1OSZA 2IC2A 2DYPD 5K9OA 1CK0L 3EYFB 3N1MC 5C0AA 2V7HA 2SEBB 2WINA 4H20H 2GTZA 1M05B 5FOBA 2OX5A 5EZOL 2R9HD 4UQ3A 3G6JE 5F7HA 5EIIB 2UZXB 4IRJB 3UJJH 2HFFB 5BVJB 4XXDA 5E8OB 1AGDB 3TN0D 4XNXL 5LBSL 5JXAH 2HLAB 3BAEH 1Q0XL 3DARA 4QHNB 4NQDB 5ALBH 4OLVH 4R3SA 3NPZB 2X4OB 1H15B 2X70B 1UWXK 4X7EC 4K3EL 4WIQA 4AEEA 1BFOB 2OR9L 3U2SB 3HNSL 1A1MA 1XIWA 1HEZB 4OCXL 3JBG7 3RL2B 3KNBB 3UO1L 1GGBL 2NXYD 1LE5B 2BNRD 4WFHE 1QZ1A 1TZGL 3FRUB 3OGCA 3LN5A 4KI5C 4FNLH 2WK2A 5BMFH 3RU8L 5KANG 4ONHB 4APQA 2VDPH 1T04B 5CSZB 5FV2A 5SWZE 4JVWA 3RU8H 2MMXA 1N26A 3WIHL 1LDSA 4LSDA