4KRNA

Nanobody/vhh domain ega1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
129
structure length
126
Chain Sequence
QVQLQESGGGLVQPGGSLRLSCAASGRTFSSYAMGWFRQAPGKQREFVAAIRWSGGYTYYTDSVKGRFTISRDTTVYLQMNSLKPEDTAVYYCAATYLSSDYSRYALPQRPLDYDYWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Evaluation of EGFR Inhibition Mechanisms for Nanobodies/VHH Domains.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
molecule keywords Nanobody/VHH domain EgA1
total genus 26
structure length 126
sequence length 129
ec nomenclature
pdb deposition date 2013-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4krnA00
1TDQA 4NQVA 1BFTA 4OD1L 4D9RD 2OTWA 1BVZA 2G75A 1QP1A 4L9DA 2R4SH 1DR9A 3K4ZA 1Z0NA 3VW3H 2VZ1A 3EHBD 3PL6A 4J3OC 1JIBA 4U1KB 4G8GB 4MAUH 2B2XH 4OFKA 3VU2A 5HHME 3NMEA 3RY4A 3TT1L 5DFTA 1EFQA 2R0WL 3RGHA 4XBPA 4F8TA 4E42B 4BK4A 5F7NC 3BISA 3GMMB 2Z93B 1U3HA 3H9HA 2QKIB 1QR4A 5F8RC 5D71H 5DJ2A 5F9JB 1IC4L 3W2DL 5KS9B 3L3IA 3OQ3B 2EICA 3BJ91 1EO5A 4WHDA 3RPKA 2J8OA 2YA2A 2V2WA 5EH1A 4L4VA 5MEQA 3IYLW 1AD0A 3D25B 1HZHH 1VEOA 2P49B 5DZLA 2X4TA 2IADB 4BM7A 3RUGA 3A6CH 2OXHA 3MA7A 1OF2B 2ICWJ 2CLRB 2FRGP 4POYA 1XGTB 1I9EA 1AFVH 1HOCA 1PSKL 3WNPA 5A40E 4O2CB 4O5LL 5L9DL 1KGCE 2X89A 4Y7MA 2YS4A 1WICA 2Q8BH 4ZUTA 3MUGB 4HV8B 1A47A 3WHE0 3VGBA 4DK3A 1N59B 2X7LA 3RNQB 1ZHBA 5E8NB 4PJ5A 4S1DC 1UJ3A 1CE6A 1IBGH 2P46B 1A1MB 4MA7L 4ELMB 3WFEL 3NA4A 5K93A 4PJIF 1RZ7H 2VDQH 3D85B 4JRYD 4KKNA 3PQYA 2EC9U 2OJEB 1G6RH 3BOVA 4P2QD 1SJEB 3DXAD 2ZG1A 3U9PH 2XY1A 5TGBB 4X6BB 4G6KH 4QCIB 4C4KT 4PRIB 2Q86B 4Z6AT 4W6XB 2BSSA 2NR6D 1JHKL 3AB0C 3MLUL 3KWWA 3QULA 3LS5H 1CXHA 2H32A 4L8DB 5IR1A 1NEZA 3NN8B 2NW3B 5C07D 1D5BB 3EO0B 3PP3H 1SHMA 5DQDH 3RKDC 3BESR 3LN5A 4ZQKB 2ICCA 1NGQL 2X44D 3OKLA 1JPTL 1PDKA 4LBEB 2XN9A 5IVXA 3BD4A 5E2WH 2E3VA 5DK0B 1RU9H 5HDBE 2EYTB 1OY3B 1DBBH 1AFVL 1PSKH 4Y16C 3WJJC 3FQXA 2OK0H 1SEBB 3PHQA 5EOCL 3CUPB 4LARH 2Y7QA 1KEGL 4JN1L 4I0KA 4ONFL 4IDLA 4FQLH 5HD8C 2Y25A 3L5XH 3D18A 4J3TA 2FWOA 1FVCB 4PRPE 4UIMA 4WJ5B 1MRDH 1IAIH 4IMKA 1OCWH 3O9WD 4JPKL 2YD4A 1ZKAA 1BD2B 2IH1B 2Z31D 4M7ZC 3MJ8A 5D5MF 1QFWM 2FR4B 3GZKA 4MCZB 5D2NE 1QRKA 3I75B 4MAYB 4LLUB 3EO1A 3PV6B 2BC4B 2D03H 1N7MH 3P0VH 1L9NA 3HLAA 5DURD 4X98B 3BH9A 3K8LA 2LAAA 5T1KD 2APFA 4OLXL 1TVHB 1J05B 3O3BB 1CK0H 3ZT6A 2VXQL 4DEPC 4FMKA 2G5BB 3CMGA 4IRSD 3OX8B 1BM3L 4XXDB 1I7ZB 1J1PL 1FGNH 4Z78A 3RIFK 1I85C 1OAXL 1DDHB 3FQNA 2UWEB 2IC2A 3GJFA 2VIRB 2ZSWA 4U1IB 2H9GB 2NXYB 4NBYB 4ENEC 5D6DA 5JXAL 4NNYA 5FKPA 2IAMC 2CGRH 3WEXA 3VI3E 5ERWB 3DURA 3V8OA 3U9UB 1T1ZA 2J12B 1G7PB 4TQEH 3BH8B 1AGBB 1K6QH 3MRIB 2F54A 2R69L 3GSNB 3H8NA 4MNQA 2D2OA 1I4FA 4FQHB 5L6YL 5J3HC 1KFAL 4XNQA 4U1NB 4LVNC 3BPCB 3O4OC 5IV2A 3MLTB 1SM3L 1IGIL 4B5EA 4XH2A 3D87B 3GMLB 4KVNH 3QIBA 1LDPH 3EO9L 4GMSL 1A64A 3IDXL 2P5EA 2FJGA 1RUPH 5IVZA 3TPUB 4EEEA 1A7RL 4NRZA 4PRIE 1TJHH 4B0MM 1BF8A 4AG4H 5D8JH 1EUTA 5I1LB 3RGVB 1ZSDA 2VDLL 3GSOA 1E4KA 4XNXL 1B4RA 5FHBL 1FE8H 3SQOH 4DK6A 4M8QA 2W07A 1HIML 2ATPB 3JV6B 3TH4T 5IP4A 3O9WA 3AS2A 4Z0BL 2COQA 1NDGB 3BPOC 1OLZA 3DTXA 3SOBL 3VXSE 1U2HA 3TBTB 4Y2DB 3QHZL 1A6UH 3K0WA 1T6VN 4P5TD 1QA9A 3DX8A 2QSTA 5I1GL 3FQRB 3CSGA 3UZVB 3B2VH 2L4OA 2JJTA 3GI8L 3QI9C 4OFDA 2W60A 1VFAA 5ITFB 3TBWB 5K9JH 3N1MC 2PO6B 5H2BA 1N64H 4ZUTB 1X3DA 2CDGA 4Z7VB 3FQWB 1ZVSA 4JREC 4XHQA 1Z9SA 3CXHK 1QRNB 5LBSL 5D72H 3FT3A 4YHOH 1CG9B 3TIEB 4PJ7F 2YD6A 1UWGH 4XPGH 2XYCA 1GOGA 1ES0B 4YHIA 5JNYA 4XB8A 3UDWC 3DOSA 2V2TA 4Y4FD 4OF5A 3WUZA 3KXFA 4OD2B 2D7PA 4ZPTA 4ZFGH 3UYOD 3LKSA 4HW6A 2GY5A 5F9WC 1TETL 2DDQL 1UB5A 2I25N 2D4DA 2WM0A 3WIIH 43C9A 4L4TE 3VRIB 4JHWL 2BSTA 4PJ5D 3HE6C 5I74B 2Z91B 4PJXA 1OSZB 5KJRH 4MAYC 3LKRB 3SOBH 1C08A 1VADB 4Z18A 3RWEB 2CR6A 1R24A 5KS9F 2BVEA 1BGXL 1UENA 4G5ZL 4RMVA 5I8KH 1N8ZA 2IAMB 3SKOA 5F93C 1RJCA 4BH8A 2BVOB 4PY7A 2CGRL 3JV5A 3WHE1 1SQ2N 1CLYL 3T0WA 2DQIL 3H6JA 3T0EB 2KQNA 5DZOA 5HY9A 4XP6H 3CC5A 5ALBL 5IESL 4S1SL 1D5MB 1SJHA 1X5FA 1ZHNA 1LDPL 1LD9B 1T5WA 3DX9B 3SE4A 5C9JA 4G6JL 3VXRE 3SE4C 3O3DA 2ZZUT 2NY0B 3HAEA 2FD6H 2ZP0T 1AGFA 4FA8A 5E9DB 4DGYL 1GAFL 4IOIA 5CEZE 3Q2CA 1WQVT 3CVIH 1DZBA 3K4AA 3M17B 5F7LB 5FAAA 4BFBD 4UUJA 2YD1A 3ZKSD 3I9GL 3T65A 4KKCC 4QHMA 5IV2B 1I9RH 4X6DA 2JB5H 2B7DT 4HIIA 3EYOB 1M71A 1FZOB 3HMXA 4PLKC 4K3HA 5FYLE 3MRIA 2ZCKL 4AIXA 4OLEA 4XWGL 3LD8B 2HFTA 1S7QA 1FL6B 4N0RA 1RULL 2R2EA 4A6YH 3MNWB 2W65A 3QQ3A 3IJSB 3WFHB 3HC3H 2DS4A 3QPXL 4YHMH 1IGFH 3KLDA 1A2YB 2GITA 5SV3A 1ZSDB 1T4KA 4RWYL 1HCFX 3VH8A 2NY6D 3PHSA 4P23C 2JELL 3HPLA 5DJXB 3WDIA 4LF3A 2NW2B 5ILTL 1OARH 4OZFA 1RHHB 1XGUA 2VLME 3S5LG 4ZTOL 1S7XB 1R3LB 2V9TA 1MWAL 1OT1A 1EGJL 4XZUA 4LRNL 5IUSA 1UQSA 1S9WA 4F33A 4BQCA 2FLBT 9CGTA 1HNFA 1MRDL 2X4RA 5HYQA 3B5HA 3MV8A 4X5XA 1YMME 1IKFH 3OAYH 3QEUB 3VA6A 1IMHC 5K9KA 3EZ8A 4KJQC 4OCXH 5EOCH 2PW1B 3M8OH 7FABL 3B9EA 3RWJA 2RB8A 5I1JL 1X7QB 2FO4A 3MFFA 4U05A 4UBDC 3C9NB 3FQRA 2LAGB 5C09D 3O2VH 3O8XD 4Q9RH 5LKNA 2BFVL 3KJ4B 3DVFA 4K55A 2G5BA 1UKQA 5EPMB 3DECA 3AROA 4G9DB 1QHPA 1WSST 1U8OB 2C3HA 2A9NH 5KG9B 4WEUD 5IQ9B 5KVDH 3RZCC 5KTEH 1LP9B 1Q9KA 5CEYA 2IG2L 2XN9B 5IVXB 3SDDB 1B4JL 1KJMA 2AK1H 4WI3A 4PV8A 4I9WD 5BOZG 4NQDE 2JELH 1R0AH 3DX6B 5CJQL 3V5DA 3NOIA 3TCLA 1D9KC 4IJ3B 5KAQG 5IBTH 4LP5A 4NWTH 4X7SL 4APQB 1NDMB 3NFPA 4XCFH 3RTQC 3ARED 1ZS8B 2BY0A 3QIBB 2IAMA 2AW2A 4PJDE 5I1CL 4RZCA 1SVCP 2AJ3A 1NCDH 3BZFA 5HGAA 1G7MB 3QDGD 3PWLA 1PG7W 4XCEB 4M1DL 3OZ9H 2B4CH 3G5ZB 3GRWA 3ULSA 1S5HB 1BQLL 4F9LA 2EC9T 3LB6D 1KCKA 4CL7A 3OKMB 3QUML 1QLEH 5GZND 2ATPA 1TJGL 3JV6A 4P2YA 4PRPD 4QHKJ 5DZNA 5J3HD 4U1JB 4JHWH 3VMOA 4LSRL 3V5KA 5BZDA 2I07B 2VXVL 2FSEB 3QUZA 4J1UB 2DI9A 3L3KB 3O6FC 1WBYB 5EDXA 1FVEA 5TQ2L 1ZXQA 4NYLA 2JCCE 3I3EA 1QVOB 3B8YA 5EIVA 2OTUA 1TQBB 5GS1C 1H9VA 3QH3B 1I4FB 2O5YL 4U1NA 4TUJA 4TOYL 3JVGC 1IAIM 4PJAA 4LRNH 1S9KC 3GIZL 1IAOA 3WL9B 5HHOE 5DC0A 1JK8A 2W65B 2LTQB 1FVCA 5KSUA 5F88B 3S35X 5J1SC 4ZO7A 3RVXD 4HX1A 3QWOA 4LP4A 4PB9L 1G0YR 3CUPA 1NC4D 4AMKL 3O11A 4I5BB 3BSZH 1CFVL 4GXVL 5T1LA 4NQCD 3BZDA 2A9ML 1IEBA 3CZFB 5CCKL 3QIWA 4P57B 1AI1L 3C6LB 1XCTB 4CVZB 4M3JA 1NGZB 1FDLH 3VFVA 5E6ID 4JDZB 3TT3L 1OPGH 2IPKA 1PGRB 3GSUA 4JN2B 2DQGL 2APBA 4P2RB 3DMMB 2EE6A 5FCUL 1TCRA 1A22B 1BFOB 5KZCB 2NNAB 3HAEH 1IC7H 4YE4L 2MMXA 2OMNA 4X0KB 2BMKA 1A4KA 3UPRA 3KXFD 4K9EL 5CD3B 1IARB 2W0FA 4N90D 5DD6B 4UTAL 4NQEB 3ZKXB 5LBSH 1P4BH 4X6BA 4MNGE 4YHPA 2P5WB 4PREB 5DFVD 4GG6A 3JWDL 4PJGB 4LU5H 5FHAL 3MUY1 1P7QA 2NXYC 4TVPL 1WWBX 3KG5A 5HGHA 1T83C 4RMTA 5EUOA 1JRHL 1GZQB 1K3IA 3MXWH 4HF5L 2CO6B 1T1XA 3QG7H 1CT8A 4LPTA 4N9GA 3GHEL 1MFAL 2YKLL 1QRNE 3EJZC 1BBDL 3G04A 3R0NA 4U1IA 3SDAC 5D70L 4Y2DC 5DK2A 4J8RA 3UTSA 5BVPH 5GS3A 2ZOLA 3GKWL 1DP0A 3T65B 2A77H 2LE9A 1A1NB 4EDXA 1I8KB 3VA2C 3QDMB 3TZVC 2A83B 4PV8B 3V6FB 3OHXA 2B39A 3X13B 4LCWD 3S36X 4NZDA 2ADIA 1TJIL 4TTDD 4OCSH 4KDWA 5I19L 2VDLH 3OGCB 1JL8A 3BEWB 4PGDB 3RL2A 4LCCB 4FXGA 3ZKXC 4GRLA 3UZEA 1TTGA 2BVQA 3MRMB 4Q7DA 1UM4L 5FUZH 5I1EL 3NBNA 1FLRH 1EO8L 2NQCA 3B9AA 1D5XB 3LS5L 5GHWL 3DO3A 5HDQH 1YNTA 3W5NA 1KCVH 2C3XA 4LPWA 5JHDE 1IQWL 3RNKB 1LO2L 2VR9A 4G9FA 4PV9A 5HGGS 3MLSL 3B2VL 3PL6D 4YGVA 1NKOA 4CADB 4WU5B 2NX5D 4U2ZA 4WW1A 1FAIH 3C09B 3GUTB 4FRWA 4H5SB 3MBED 5FYJH 2E6QA 4C56D 1RFDH 4KUZH 5C08D 3WIFB 5D96B 4YDKL 5ACLA 3P30H 1ERNA 2ADGB 4FQ2H 3WN5A 3FFCB 4RISH 3MBXL 1F4XH 2NY0C 1OAXH 4PJ7B 1C12B 1F2XK 4GKOA 2M1KA 3RVVD 4AM0A 4KKBC 3WXVH 4OZ4A 2EDRA 2VZVA 3GSNH 5ABDE 1UCTA 2Y5EA 2UY6A 1MH5A 2Z35A 4OCLC 4XBEH 1JGDB 4WHTB 1MHCB 1BF2A 5ADPH 3QB7C 3MV9E 1J1XH 4JFDA 3SGEI 5IEHA 4MD5B 4LMQE 4K7FA 1VFOA 1B2WL 2PR4H 2ATKA 1LP9A 4KVNL 1TTUA 2J6EH 4AQOA 4KY1L 3M1BA 1F3DJ 5JW4R 3MXVL 4HAGA 2CIIA 4AIOA 1ZLSL 5DT1L 5FUCC 4XX1E 3QEQA 5EBMB 1EHNA 3KPNA 1NL0L 4OIAA 1UB6B 3AU1B 3GRWH 1FNEB 2DQHH 5CEZD 2WSKA 4FQJL 1DANT 3G5VA 4TSCL 1U2CA 4LGSB 4PJXB 2XPGA 3DARA 5CZVL 2WK2A 1Q9OB 1S7SB 3DV4B 3FN0L 4EQ3A 1RK0B 3AC0A 1YYML 4GQ9H 3D9AH 2XQBL 3O3DB 2C1OB 4ONHB 3MRFB 2VC2H 4QTHA 1JFQL 3QUYB 2AEQL 2EO9A 3OKOA 3PP4H 3ARBA 3FT2B 5J6HA 2HYMA 3SCMB 3CDFA 2BNUA 4KI5F 1J12A 1MCOL 2H8PB 3HCVA 4QYOB 5EIIA 5CJXA 3CH8A 1A7RH 3RKPA 3VXRD 1PY4A 4MS8C 1EAPB 3L5WB 4UINH 1S78C 2P8LA 3JV0A 3LD8C 1E6JH 1HKFA 3DUSA 1ADQA 1BJ1J 3QR2A 2NY5L 1YY8A 4NJ9H 5HYIA 3V4PH 5D96C 1UYWL 5D7LE 3ILQC 4QTIH 3O6FD 2EDQA 2BY3A 5E8DH 1A6WH 5CKGA 4NRXA 1PVHA 5HDQL 3F65A 2VLKB 4LAJH 4PS4H 2J8UB 3LEXA 2OP4H 4WU7B 3J7HA 1RZKL 3EYUL 2B4CL 4HJJH 2V7NA 5CLTA 5IMOA 2HTLC 3QBTB 4KJPD 3W0WD 1MRFH 2AJXL 3NCYS 2NY2D 1OAQL 3FCTA 4QHUA 2Q6WB 5JLZA 2EIDA 3C6SA 3U2SA 2OZ4H 1NEUA 5A2KH 4Z0XB 5CJ5A 2WINA 4GG6E 1RAMA 4X8JB 3F8UB 1F90H 1VACA 2A0LC 4BELD 3NAAL 5DVKA 4M03A 3PQYE 2JE8A 3DUUA 3RZCB 3SGDH 3E3QE 4JANA 1B0GB 1GYAA 4M6NH 1NUFA 2D03L 4D0DB 1XF4A 3C5JA 1BBJB 2KDGA 3OKNA 4HGMA 4ESKA 3FB7A 1U8QB 2DLTA 1BVKA 1NMBH 4U3CA 1YEFL 4X9IA 3RWGB 3VXUE 3ZKNC 1EGJA 1ZT4B 3T08A 2NY1B 1I3UA 1AXTH 2X6MA 1Z5LB 3NH7L 3FO9B 1INQA 1UM6H 4MA7H 4MDIB 4L3CA 2R0ZH 3FFCA 3QI9D 4RFEA 1X5ZA 4Z7UB 2X4NA 5M95B 3BRDA 1J1OH 4M61A 4DGVH 2BOCA 3GMRB 4L3EA 2IQAB 3GB7A 4WW2B 4WCYH 2R4SL 3UC0L 1CGYA 3QZWB 1EEZB 5IIEB 4L9LA 3DPBA 4WU5A 1GL4B 2EDBA 3GSOB 3ILQD 2D7QA 3HZKB 1AGFB 4P23A 4WGWB 2GUOA 2VXTL 1TJHL 3QUYC 4L1HA 1HSAA 3L7EA 4KKBD 4PJEF 4WI8A 2EKSB 5GGQH 4QGYA 5C0BB 4K7FB 2EDTA 3CDCA 4F58H 2YD2A 5JA9A 2O5ZL 2F54E 1ZHLA 4MXWH 4D0BB 2ARJB 4XX1G 5EUKB 3P30L 4FQ2L 4WWID 1FZOA 3BW9A 5MEPA 2BNQD 3D0LA 3ZYIA 1NFDF 1MH5B 2Z35B 3FOMB 1MCQA 3BHBB 4X4XA 1T22B 5HYJD 3UJIH 1NUNB 4UTAH 3GSWB 3SGJC 5JW3L 4PYGA 4LEXL 1A1NA 1LO4L 4JO1L 5I1KL 1WISA 4PRIA 1CXEA 4JDTL 4HMCA 3B9KD 3MLRH 4U7MA 4M43H 4HK3N 2X70A 1EZVX 1UVQB 3BKYH 4O2EA 4F7MA 3NCJH 3QWRD 4R26L 5MERB 3IFLL 1MCPH 4ZAKB 2OBGA 3DYOA 5SWSB 3DURB 2AJVL 4HIEA 3R06B 1HKLL 3SE3C 1KJVB 4XPTL 4FABL 3QFDB 3ARFD 1FBIH 3MJGX 1EO7A 4OLVH 1ROWA 2QR0A 4CN1A 1NCBL 1T80A 3SCMA 3K74B 4GJTB 3CFKA 4M48H 3UJTL 2VDRH 2CLRA 4KJQD 3VFPA 4GBXB 2CDEB 3OXSB 3FB8A 1ODAA 4MSWB 5EU6A 1BBDH 1BOYA 1ZLUK 3IKKA 1AO7D 3WIFA 4RQQA 2OL3L 2X42A 1NC2A 4ODXA 3CX5K 5KVFL 3INUL 4N8VG 2BJMH 3A6BH 3FAWA 4KTEL 4N9GB 3IXAB 4HC1L 3IVKA 3ZTJH 3PGFL 1JK8B 3U30B 5IKCB 4XGZA 4KQ4H 2Y07L 4QRTA 1DBML 3LV3A 5TGBA 7FABH 3HNTL 5H94B 5INCA 4KRPC 1JCKA 2H2PC 4JDTH 5D1QB 4GRWE 3UJJL 4XMPL 5CILH 5KSUB 2CK0H 4H8WL 4K3DH 5EZOL 3U9UA 5I16B 2FIKB 5AAWA 5I6XB 4JJ5B 3MC0A 5CWSA 1JGUH 4PBWD 1RUQH 1HEZA 1FV1B 4FTVD 3UDWA 1SEBA 3BD3A 3MMEA 1G9NC 4XNYL 5GS0C 4P46A 3ARYA 4V1DE 2BERA 5HGDA 4UT9H 1NEZB 3VD9A 3E6FB 3N9GL 4GQPH 4FFZH 1MCHA 3SDXF 1DLFH 4QXTB 3MJ9L 3VXUB 5BMFL 2IQ9H 5T1MB 4KQ3H 5T1LB 2PYEA 4QY8B 5C2UB 4PS4L 1G1YA 3TF7C 4P57A 4N0UB 3N85L 1GGCL 3QCVH 2ARWA 3KPMB 1DQML 4LLUA 4JRYE 2Q76A 1OGTA 3W0WA 4XBGA 2BOCB 3K7UA 2JJTC 4JG1L 3O9WB 3QNZA 3P0YH 4YNYA 3HHRB 5D72L 5HHQA 2EIEA 3QG6B 4Q58C 1QR1B 4PJAF 1CICB 4OD3H 1IGJA 1N6QH 1UC6A 1W0WB 4P59H 1J5OL 1JMXA 5E8EB 1DDHA 2VLKE 3PP4L 4L4TD 1NCCL 4LCCA 5F9WB 1TVDA 3VXPA 2HLAB 3OWEA 4YHKH 1BJMA 4UB0H 3OHXB 3KYOA 5H37H 5C3TA 3QEHA 1UCBL 5E4EB 3MRMA 3IFLH 4QT5B 3MCG1 4E41B 3QDGB 2HT4D 1J0IA 3IT8D 4PFEA 1CFSA 3Q3GA 3RPIA 4XI5C 4OLXH 2IQ9L 3KS0J 2Y6SD 4WFGE 1CDBA 2R9HD 3TVMB 2VAAA 2P7TB 2PYFB 4JY6A 5EU7E 3OJVC 5IMLB 1M05A 2V2WB 4YO0A 4K94C 3EDDA 3SEPA 4G6ML 5D8JL 4OFPA 1FVDB 4RAUA 3TGXA 4BQ6A 1NC2D 1TLKA 3RNKA 4ZUWB 4GO6B 1DUZA 5DSCA 4XPFL 5F9AC 4L8SA 4NWUL 1UADC 2FWOB 4KK9C 2C1PB 3TJEH 3EO9H 4YC2C 2X1QA 3ESUF 3RAJH 2YRLA 3ZDXE 5AUMA 3BGMA 3RY5A 3S4SB 4JM2C 5JUEH 4YHZH 1KTDB 2XZAL 2E7BA 4MCYB 3WCYA 1RURL 3QDJE 5E94A 1AKJA 1K5NA 3S7GA 5JQHC 2VXSL 4LCUB 2N4IA 4F2MB 1LO4H 4JFFD 2I27N 1MFEL 3OKEA 3DGGA 3F5WA 1Q9KB 3O41A 5CEYB 2PYED 1BREA 2D0FA 1K2DA 2QL1A 2QTEA 1FIGL 3QA3B 5CP3A 1NJ9A 1T04A 4KPHL 2K3TA 3SY0A 3TBVB 4Q97A 1T1YB 2VRAA 1XGPB 3U0WL 3G6DH 1TNNA 1KPRB 3HZKA 4P23B 3CNKA 4EUPH 2VDRL 1I1AC 1UWEL 1T0NB 4FQQB 3ZKMD 4H26B 5TDPA 4CVUA 4OZIA 4YX2L 4GW4B 5HVWA 4R3SB 1SYSA 4FNLH 2IFFL 3H3PH 3IB4A 5DD1H 3F12A 4LIQE 3O3EB 1AR1C 5KSAA 4PGBB 3BPLC 5KSAC 2DTMH 2UYLB 4UU9A 2F5BH 3ME0A 3CFDB 4YQXL 3VGFA 1A3RL 4ZFGL 4MA3B 2FEDC 2F74B 4WGVB 4XBPB 1LE9A 3I2CH 4KV5E 1F90L 5HYQB 3CH1A 1A7NH 1WV7T 3FFCE 3FFDA 3DRTA 5JXEA 2NY3B 2X4SB 3L3KA 1NBVL 1JWMB 4TUOA 2HVJA 4XB7A 4ENED 3EOTL 1XGTA 3HZVB 4LHUG 5D2LB 5C08B 3TBSB 1GGCH 1YEFH 4IOIB 1RUKH 2DKMA 4P9HH 5FYJU 4H0IA 3BUTA 4YBLC 2W9DH 4YDVB 1F42A 3TCXA 5BVPL 4LSDA 1EJOH 5HI4C 4PJBE 3FFCD 1QFUL 3QFJA 4OGXH 1Z6JT 3MBEC 4M7KH 1D9KA 5BO1L 1KYOJ 1XR8B 4JRXD 3SDAB 3JWDC 1QEWB 3OKKB 3OB0K 4ODVH 1PYWA 4ZXBC 4ZFZB 4Z7UA 2V6HA 3G08B 3VFNA 1KB5H 3WDHA 43CAB 3EDKA 3GSVB 1MJUL 1F4AA 3VFPB 5L7XH 5DRXB 4ELKB 3LCYA 4XPBL 2ZKHL 2RCSL 5DJ6A 5JXAH 1Q1JH 4GSDH 1BLNB 4LSSH 4CN4A 3PV7A 3TA3D 1KOAA 3QRGL 3LS4H 4RISL 3UEZA 4ISVB 1KPVB 3DXAB 4F7TA 1NCAL 2ADJB 4LLDA 3T4YB 2W91A 4OM1L 4Y4HD 1KUMA 5CJOH 1KXTB 4PJBB 5C0EB 5DHVA 5JIPA 5I0ZA 3FT4B 5HTSA 3R8BB 4Z0XA 3C60B 4PJGE 2WINB 4B7LA 3K4DA 5FYKE 3RGVC 3BIKB 1JPGB 4MNGB 1WFOA 1XR9B 1JZ3A 5HPMA 1HCVA 4ODWA 1R3JA 4V1DA 3VG0L 4S1DD 2Y06H 1S7QB 5D2LE 3U7AA 4OLZH 4Y5VC 5EOQH 35C8H 4WRLA 3RVWD 1CD1A 4LLVB 3OMZA 4HIIB 1U8PA 5EBWB 4P2RE 4WUUB 4XCYB 1OTSD 4ZG1A 5C07E 4F7CB 4NN5B 4OF3A 3QG7L 2VSDA 3VGHA 3NIGE 4MZ3A 4U1SB 1J0YA 4L3ED 2DQTH 5C2BL 1NCDL 1I8LC 4AY0A 1A8JH 1IFHL 2A38A 3GJFK 3MYJA 2EKJA 3C5JB 4KFZC 2EDEA 4YAQA 3B3IB 4XZUB 1ITCA 4RGMC 1RZFL 5FA3B 2P24A 1P4BL 1HSAB 3L7EB 2YSSB 3H9ZA 4TRPL 4XWOC 2BNUB 1XIWD 2E7LC 2XKSA 3OR6B 4UDUA 1EAJA 4HFWA 2EE2A 4U6YA 5IB5A 4F33B 1I85A 1S7RB 5IT2H 2DQHL 5ACMA 2W9EH 5L2JB 4LHJB 5GGTA 3P4OA 4J12A 4GAFB 2YK1H 1YPZE 4JCLA 5I1DB 1LO3H 3QIUD 4JKLA 1I9IH 3AXLB 3P9MB 5D7IB 5IM7B 3X12A 5HHOD 3FO2A 3F7PC 3SJVB 3EDJA 2XWJB 4E9LA 4XAKE 4NKOA 5HYSB 4ZFFA 1FCGA 4NN5C 5GS1A 4WHCA 4P3DA 1I9JH 3PWJB 5CGYC 4MNQB 4ORGA 5GGRY 2DM2A 4M1GL 3JVGA 5C8JA 3TFKC 1WAAF 5T5FL 2HLFC 1T1ZB 2Q3ZA 1F3DH 3O2VL 3D39B 5CEXB 4JJHA 2DRUA 1IBGL 2VLLB 3MRQA 5C0JB 3I6KA 3TA3B 2EEBA 3BKYL 2MFNA 4JDVB 2C9AA 2IWGA 3CVHA 4XNQB 5F8QC 4HPYL 1KTKE 2JCCA 5BMFH 3JV4A 5JHDA 5IHUH 2I26N 1N2RA 1OTSC 5DRNB 2Y5TB 5IB4A 5F21B 4YXHL 1F6FB 1FFNA 4LSUH 3Q1SH 4O58L 1JMZA 4FZ8L 3STZA 3MACH 4MA8H 1ZHKB 3CFJB 5HHMD 5SX5K 3B2UC 2N7AA 4JM4H 1QNZH 2F5AH 2P42B 3V8CA 4JO4H 3ELAT 5FYJL 2XA3A 2WP3T 4RX4D 2DM4A 4PLNC 5CP3H 2BNQE 3QNYB 3X13A 4D9QE 3OG4B 4ZXBD 4Z7VA 4EUPA 4TTGA 2YN3A 3HB3D 3O3AB 3RFZC 1EFXD 3OKMA 3VWJC 3TP4A 1KIPA 3JSSA 1B9ZA 1JV5A 4LDOB 3L3GA 3QQ9C 4L8BB 5DJ6B 4RNRA 3AMLA 2IMMA 4L5FL 4MGXA 4IRSB 2Z8SA 2C3VA 4HUXA 4GG6F 3GSVA 1V7NH 3LVEA 3O8XA 4PB0L 3GHBH 1LP9E 1HHHA 2A77L 1LHZA 2Q8BL 4N8VA 5CS7A 4X80H 2OI9B 2KL6A 3QUXC 4ZPTB 5EOTA 4KK6C 1IGCL 2IPTH 4YDLB 4X7DC 5F89B 5C0RH 1S3KL 4URTB 1C1EH 4MLIA 4N0UE 5L8LB 3R8QA 5GGRA 1E4JA 5CZXD 3MLVH 5EFIB 4EXKA 4JG0H 4Z95L 1I3GH 1S7SA 2EDNA 3BUYB 5DMGC 4DW2H 4X99B 5D93B 2E6PA 4JFDD 5IG7A 2XKNB 1R5IA 2D9CA 3V6FA 2NPLX 1AP2A 2FB4H 5C07B 1KPUB 3KPRD 1XH3B 5DI8A 1JNNL 1T66C 1DEEB 1MJJB 5KSAB 4LVNB 1I1AD 2XTLA 2BRQA 32C2A 1CGUA 1PW3A 1UWXH 4QNPE 3G04B 2A0LD 4JFDE 1QLRB 1CVRA 1XMWA 1MJ8H 5HHQB 2A6KB 2VR5A 1OP5K 4R0LA 4ETYA 1PFCA 1IAII 1TMCB 1G9MC 5FM8A 4C56A 2DTML 3UYRH 4LLYA 3BSZL 1JGEA 5EO1A 1I9JL 1J10A 2GK0A 3SKJH 2Z31C 4NHUB 2R8SH 1OTUC 2NY4C 1A4KB 3UPRB 4TYUA 5D2LA 3NPSB 4S1RH 4NFCA 1A3LH 5ALBH 3D6GA 4PB9H 3EYVB 1SJXA 3NCCB 3HR5A 4LSTL 3B9KB 5FYJE 4F3FA 2X4UB 4N0CC 1IC5H 3WIHL 3BDYH 3S6CA 1KXVC 2YD5A 4U6TA 1FFPB 4BZ1H 1U6AH 4CRPA 5DMJB 5DK2B 3ZYZA 4X5WA 1NAMB 5DMIH 1OPGL 4LSVL 5EIQA 4YDJB 1A7NL 4P49A 4KK8C 3MV7B 2FIKA 2XWBB 3IDYC 3T2NL 3RHWK 3I6KB 3BKMH 1ZEAL 1UZ6E 4K7PH 1IGYB 3EBAA 3MRDA 5BS0D 1FH5H 1DANU 3MJ7A 4OCWH 5C8JB 3RJQB 3GMPA 4NN6B 4ZUWA 4GRLB 1A14L 2YEZB 3QUMH 5D2LF 3SQBA 3ZT7A 4P48A 4P4KD 5GJSL 5I73C 2E8YA 1RIUH 5IVXF 5ALCH 1K5NB 2D7NA 3AAZA 1QVOA 4R7DB 4NQXA 2VC2L 3ZE1E 3ARSA 4AZ8A 1SBSH 3QHTC 2IADA 1OARL 1C7SA 1YYMH 3W9DA 5J11C 2JJSA 5I6XC 2ENYA 5DJ0A 4XMPH 1R3HA 3WE6B 2GTZB 4LF3B 4U3HA 3RY6A 5C0FB 1AD0B 1AHWB 5J1AB 4NZRH 1I1CA 3MLRL 1CZ8H 2MQ0A 4UIKH 2YEZA 1MLCA 5DQ9B 3WNMA 2HTLD 4S11A 5EZLA 3KPNB 4LSSL 2LTQC 4YBHA 5EPMA 2AI0H 5K33A 5MHSE 1WFNA 3GK8L 2WQ8A 2RFXA 5DK3A 3VXOB 4KK5C 4P4KA 4OQTA 2Y7QB 1A1MA 4EKXA 3E2HB 3P4LA 4X7TB 3Q5TA 1EEYB 1MFBL 3L3GB 2NR6C 3ALXA 3V0VB 4DQOL 4ODUB 4LVEA 2R29L 4R2GD 1X44A 1G7IB 2APTA 4JVWA 3N06B 4OJFH 1EV2E 2A9MH 3MOBL 4IOFC 5IEHB 1HN1A 1S78D 4PJFA 2G75B 5E00B 3VFSA 4LVOB 1BFSA 1RZ8B 1VCAA 1FL5B 2LU4A 5LCVH 1HDMB 4WY7H 1RZFH 1QG3A 2FH8A 4FFWC 3AS3A 4KKAD 4GBXA 3BH9B 3EW3B 4L3AA 5EC1B 3VWKC 4NRYA 3VRJB 2VNCA 4HWUA 2IALB 3QULB 5F9DC 3TYFB 4YDIL 3T0EC 5AWNL 4LLWB 3EO0A 2DF3A 4GT7A 1N5AB 3MRNA 5KS9A 4N8PA 2X40A 3VJ6A 5ETUB 2HT2C 3BYTA 2VITB 4JRWA 3ZDYE 4GUPA 1N2RB 1G7MA 2XKUA 4I18A 1MCDA 4ZXBA 2OR9L 1A7PH 4EN3B 3GK8H 1ACYL 3AY4A 5GRVK 2QQLH 1TXKA 2FYYB 1Q8MA 4F57L 4WO4A 4Y89A 4DOHB 4UT7H 5B8CC 1WAAE 3QDGE 4EUPB 4QHMB 4J1UA 4OZGF 3TJEL 2NY3D 1BVKB 1XR8A 3I6GA 3RWGA 1ZT4A 1UJ3B 1B90A 5JTWA 1QO3B 1Z0MA 4ERSH 3MFGB 1INEL 1CWVA 5EU6E 4R7NB 5I66A 4QF1B 3QPXH 5JIHA 3MV9D 4PJDA 1OAKL 3RZCA 1FYTD 5CWSB 2QQKH 3FQUB 5LWYL 2EZ0D 2OXGA 3FO2B 5DUPH 5ADOH 5F96L 5IIEA 1KLUB 4Z7WE 2ZSVA 3T1WA 1BFVH 4U0RB 4YIQB 4HIXH 3GI9L 4U7KA 5HI3C 1U8NB 4R96A 3C87A 1LK3H 4NN6C 1MWAH 4MB4A 1HINH 1GC1C 1CE1L 3H9HB 2V7NB 3I6LE 3ZDXF 5IMOB 2NY5H 1ZANH 3ARGC 4LIQH 5CINH 5D6DC 2DIAA 5F9OH 3NCJL 1WCBB 4KROB 4LDLB 2DLHA 2JK5B 3MYJB 1U41A 5E7BA 2Y6SC 3C2AH 1RUKL 1OT2A 1N5YH 5ENWB 3GSWA 3L9RB 2DN7A 4OAWB 1VDGA 3WXVL 3DMMA 1J18A 3WKMH 3E1F1 3EFDL 4Q74A 3K8KA 5GGRB 4KAQH 5TDOA 1INEH 3U2SB 3TO4A 5A43C 2PETA 2RQ8A 1MELA 2Y72A 1RZKH 3EYUH 3OR6A 4HJJL 3PABB 4PRPB 2R4RL 1L7TL 3E6HB 2F58L 5DMYA 3QUZC 5DHXB 2YBRB 5F44A 3V5HA 4FFYL 3MRPB 3C6LD 2P24B 4IOSD 2CUHA 5FYKH 5JPMA 4JG0L 2XTJD 1NPUA 1YN6B 3AMKA 4NQSB 1NMCC 4K8RH 5BJTB 4FG6D 4P2RD 2OYPA 5D1QC 2A2QT 1EEZA 1M4KA 2F8XC 1DVFC 2IPTL 4DJMA 3OPZL 4PJ7E 4HUVB 4TSBL 1JHLH 1DUYA 1C08B 1OCWL 1VADA 5DVNA 4MDIA 2X4QB 2XWJA 3F7YA 2J8HA 1IEHA 5FYLD 1G7JA 2PXYB 5I8EA 4JRYA 4PGCA 5JORA 5AG8A 2X4UA 1EVTC 2UZXB 1F4YL 3CXDL 4JKPL 1WEJL 3F6LA 1ZLVH 3V7MA 2EKSA 1LE5A 1ORQB 1KB5L 3C8HA 4RDQG 4YHLH 5DMKB 2D7TL 1OAZL 3PWNA 2DQEH 1DFBH 4R4ND 2C7UB 4QLRA 5EA0H 4OSUL 5GISH 1KJ2L 1T2XA 3MV7E 4NGHL 5I8OL 4RGOL 5JNYB 1LK2A 3QUXB 4WFFE 5I1IL 2PF6A 5TFSH 4NRZB 1KACB 4JY4A 3TH3T 3BDXA 2DQJL 1ZLWK 4WHYG 4GRWF 3S36L 1GIGL 4JKKA 2GFBA 4YK4C 1P9MC 1G7QB 3B4NA 4L8BA 3U36B 4MHHG 4OLVL 3IFOA 5IF0A 3DIFB 2B1AH 2Z31B 3RVTD 3S37L 4FQ1H 4AENA 4XAWL 1O0VA 2KUTA 4PD4K 4XP5L 5J7CC 3CU1A 4I4WB 5I17A 3NZHL 5E2TL 2GEEA 1J0JA 3MV7D 4RRPG 1NGWB 4WW1B 5C0BE 2Q76B 2ZUWA 4Y2DA 2VDMH 1CE6B 1DVFD 3IJHB 1U8MB 5DR5H 5FGSA 5F7EL 1U8LA 3PDOA 2DQDL 5JW4Q 3OAUL 2ATKB 4AMKH 3KGRA 5JIIA 4HXAL 4HIHB 1IRAY 3RDTD 4DUXA 4POZC 3ULUL 4R97C 3LQZB 3CC5B 4NSKA 3K8MA 5BS0B 4OGYL 5CZXC 3O2DH 4CNIA 3VD4A 2SEBA 4NO2B 1G7IA 1KCRH 3WNKA 4KZDL 3JTTA 1RIVL 5I1AB 4NCC2 3NIDE 1P84J 5DJYA 2AP2A 4NRXB 4Y4FA 5FO7B 4JZJA 2MWCA 5C0DB 1AO7B 4FXKA 2XIDA 4DUVA 1XZ0B 1JRHH 3UTPD 2JK5A 1CICD 3NIGF 2DI8A 4TUKL 2VLJD 1FGNL 2VLRA 4WWKC 1NMCB 2MQCA 1CCZA 4AEIH 3CDGA 1Q0YL 1QEWA 4U7SA 1FRGH 4WCYL 3KLAA 4CW1B 2BXYA 1M05B 1P69B 1CK0L 1MLBB 1AR2A 4XP9H 4F7PA 4RFNB 4GS7B 3QUYA 5J4MA 3ZE1F 3TEUA 4M02A 4RSVA 1T21B 3CMOL 3UTZA 1L7IH 1U95B 4HUUA 1MNUL 5FKAB 4ZD3L 5KANI 2V2TB 2FJFB 3QPQD 3WE6A 1BQLH 2IALA 4W6YB 3VH8B 2ITCB 2HKHL 2E7MA 3BN9D 2R0WH 1FYHB 1QSFB 2ZCLL 4KJWC 3I85A 4Z76B 4QRRA 4ALAL 4XP1L 4AH2A 2JTDA 4X98A 2N56A 3B9KC 5D7LB 1DN0A 5GJTH 4YXKH 4NUGL 1CDYA 2BNQB 3BN9C 3ZZ1A 4NKMA 4QO1A 2FJHB 3DVGB 3FZUD 4S0SD 4IMLB 4QRUB 3QPQC 3A67H 1AQDA 2ICWA 2BHZA 4X7EC 2H26A 1EDQA 1DBAL 4KQ3L 4MQXD 2AJUH 3BRFA 4WEBH 1U8IB 4NBXB 2LVEA 4R4BA 2EIBA 3PNWA 3V6OC 5ICZB 4HHAB 2CKBA 1W72L 4JVPA 1EA9C 3WEXB 1P1ZB 1CR9L 5ISZB 1PQZB 3MXVH 1SVZA 3PWPA 4YDJA 1CN4A 1W72A 3P40A 4G6KL 5F6IC 5E5UB 1CQYA 1QTYT 3DGGB 1ZVYA 2EYTA 4WWKD 2Z4QA 4L4TA 3ULVL 3FQXB 1MWAB 2CJUH 3D39E 1JN6A 4OKVB 5C07A 5CP7A 3FO0H 3K2MC 3MQIA 4PJXE 4M5ZH 5K9OB 5I15H 2YSSA 2Q1EA 1ACZA 2HLAA 4MNQE 3NCYP 4ZFOA 1WZLA 3C5ZD 4Y5XB 5I30H 4X80L 3QSKB 3FMGL 1YMHB 5GSRB 2E9IA 3MLYH 4YPJA 4NQDB 4X8XA 4UOW1 2AS5M 2HJLA 2C1PA 1X5YA 4ZS7H 5D7IE 4HJGA 2BJML 3A6BL 4KTEH 4MJIA 1CFBA 3RVTC 1OW0C 1UJTA 4OT1L 3BPLB 2XXCB 4CDHA 4KMTL 1U42A 4M6AA 4P9HC 1GGTA 1YEHL 3LZFL 4BH7A 5F1KC 4ZODA 1RIVH 4ZS6C 1P6AB 4JO2L 5LVEA 4P4KB 3QFJB 5I8OH 4YHNA 4PJCF 5I74C 3CJJA 5CEZH 4YZFE 2G2RB 3ROOA 2HG5A 4KDTC 3PJSA 1N64L 5EZLB 3RVWC 3HUJE 4JO4L 1YEJH 3TBVA 4R4NC 1OHQA 2PCPA 1TCMA 5T1MA 3FB8B 5E1AA 3SJVD 3KPRE 1GIGH 4NM4H 5DJ8A 5F1NA 1LNUA 5C0IB 1ITBB 3RGVD 3BYYA 1NFDB 4XCCH 4IDJH 5FDWB 4Y4FB 4WUUE 1UWGL 3U0TA 4Z7QF 4PBXA 3ZTNL 2X9YA 4HLZG 5FEBA 2Q7YB 4YDIH 4PJ9A 3MLZH 4YHNB 1GCFA 3U83A 3ULSB 5I19H 1FG9C 1MUJA 4EIZC 5IMMB 1VESA 3C6LC 5GIRB 3N1PC 1Q0YH 2YXFA 2VQUA 3ISWA 3FL7A 1N5YL 4CU6A 5IQ7L 5GRUL 5I1HH 2JIXD 4F7EA 3NFSL 3VDAA 3PE9A 5FECA 4G9DA 1ZT7B 1SJEA 3KYNB 1U8OA 3O8XB 4PJCA 1HHHB 1Q0XL 2RIKA 1XF2A 2PO6D 2MPAH 1F97A 4JZNA 3WL9A 1N6QL 4X6FB 1JV5B 5A2IH 1D7FA 3CDGB 4KUCD 4UDTA 1MCPL 1WBYA 3OL2A 2EH8H 2GCYB 4OFYD 5DJDB 1VPOL 3TV3L 3DIFA 3BGFC 2EDYA 1AHWA 2OTUB 4XP9L 5B4MD 1MCFA 4APQA 2ORBL 1GSMA 1WTLA 1Y0LB 5C0GA 4D2NA 4MCYA 1XFPA 4WV1C 2PTVA 4X4MA 5E9DE 2UUDK 3T0DA 2IF7A 2DYPA 3KJ6H 1IM9B 3KDMB 3GSNL 4JZNB 1IEBB 2DM7A 3CZFA 4M1CD 1RPQA 5F1IA 5IK3A 1R3IL 1CXFA 3RAJL 3DI3B 8CGTA 4XP5H 3LKOB 3MA9H 1I3RA 1LWRA 4KRNA 2CKNA 4FTVA 5IEKB 4JRXA 5LXGL 4N5EC 5HYJA 1T7WA 3GRWL 4D9RE 5DEGB 3T1FB 2R56L 2YPKA 4NKMB 4NQEE 3QFJD 1AC6A 5C6PB 4ZNEA 5BV7B 3HZYB 4LNRB 3IU4L 2BNRE 2PW2B 3L1OH 1D6VL 1FGVH 2VISB 3BEVB 5AZEL 1XT5A 3KPOB 3D3VE 4IMKC 3TIDB 1MI5E 5JQ6H 1UA6L 3KVQA 5TDNA 3RBGA 1K2DB 4GQ9L 2WLYA 1Z5LA 3W9EA 3U6RB 5AWNH 1S7RA 4I1NB 2DJ4A 3QUZB 4HFUH 3LRSA 4WI5A 3ARXA 3IS0X 1Z2KA 1VA9A 4XPFH 3TNMA 5FB8A 2RBLA 4G6AD 4E0RA 3FB5A 1JTOA 2Z4QB 4L4TB 4LLMB 4S0TD 3IGAB 1A7OH 4ZTPL 3IFNL 4ZNCD 4IOFD 3OXRB 3VFWA 4I77H 3MRPA 1NANH 4KZEL 4GLRH 2MNUA 3KYKL 1BX2A 2EO1A 5HD8D 2J4WH 3H9SA 1V05A 3L5IA 1NCUA 3IJYA 2JIXB 5JOEA 1QSEA 3VE0B 1U95A 5J13C 4NCDA 4K3EL 4RZCB 4L4JA 3DVNA 5LQBL 3B3IA 2BRRL 3EGSA 5HHNA 2RAMA 1MFNA 2B20A 1JI1A 2APXA 5JW5A 2ICEA 3LH2H 3MV01 3Q48A 2R23B 3VG0H 1H15B 3L3DB 2DYPD 5BVJA 2HRLA 1T22A 4XNUL 3HNVH 1KLGA 5J06A 3F7RA 3S96A 1DQQA 4JY5H 4F9LC 1PKQA 3MSPA 2QQQA 5DHYA 4PJ8D 3QEUA 1TZHA 1CGSL 4ZDHA 1IZKA 1OAYH 4Y1AE 5ID0B 3OJ2C 2E5EA 3IETA 5J9PA 3LQZA 1IC1A 2Z8WC 3EOTH 1CL7L 4DKFL 5IBUG 4CU8A 4NHCH 2DQIH 4EVNB 3IF1B 2ITDB 4XPAL 3ZHDA 1FFOB 5IB5B 1NMAH 4PLKD 4U31A 3SE8L 2AK1L 4RGNC 4CU7A 2QSVA 3D39A 3T0VA 5CGYD 3MRCA 1KELH 1MPAL 1KGCD 2A83A 5CFHA 4B41A 3KYAA 3W82A 2VLRB 2A6DA 2H26B 1JZ2A 4P23D 3CH1B 5DWUL 4GS7C 5IOPB 4HGWA 1DBKL 5CEXA 5EB9A 3WO4C 3HMWL 4GKNA 3U0PA 4TTDC 5CZKA 4P4RB 3RWCA 5EULV 1YMHA 2NZ9D 5C9KA 2CUMA 3CX5J 4HIXL 5E7FA 5AG9A 4O9HL 4E5XB 1UB6A 4GKZA 4ZFOB 4YHYB 1QA9B 1YJDL 3GMQB 5HGBA 1Z9LA 1G7QA 1S7XA 2N1KA 3E6HA 1OAUH 1JPST 4DN4L 3EJZD 5IROC 2A6IB 2CIKB 5HYEA 4LKCB 5DRNA 3FN9A 1RVFH 1BFOA 1RJYB 4OQTH 4JGJA 3IDJA 2VN7A 1OTUD 2NY4D 3S3PA 3SGEH 4OZFH 2UWEE 1ZHKA 1BD2D 2PKDA 1KN2H 1OP3H 3G5XB 4PJEE 2WNGA 5FXCH 5FFLA 2HT3D 1IGIH 4BYHA 3RVXC 2GSGA 1U8JA 3CLFL 3QCTH 2QQLL 5IFJA 3G5VB 4N0CD 1MPAH 3EUUA 3LN4A 4N90E 3O3EA 1H3UA 4HXBL 3FKUS 1QBBA 1DEDA 4HKZB 2Z91A 4MVBC 1DQDH 4OT1H 2F74A 4MNHB 3ARWA 3CSYA 3QXAA 5F3BA 2YPKB 5LXGH 3VJ6B 3BP7B 5FO7A 4TVSa 3VXMA 1ZA6B 1WVZA 5JXEC 1MIEL 2VABA 1AGBA 4KRLB 4XCCL 3T3ME 3HA0A 1F3JB 4HPOH 2L0DA 4UAOC 1INDH 1R3JB 3S37X 5TF1L 1ONQA 3IDIB 4LCIL 2AV1B 4OM0H 5GGSB 5BXFA 1MHCA 3PWPD 2AQ1A 4Y1AD 4MJ6A 1FYTB 5ISZE 4Z78B 5DJAB 2YRZA 4LHUD 4OZGA 2WIIA 1ACYH 1QSVA 5DUMH 3OAZH 1MIMH 3HZVA 1YECH 5F6IB 5A1AA 1ND0B 4EDWH 2YMXL 3VXPB 4FQXC 1OM3H 1FNEA 1RUQL 3I84A 1KCLA 3BP6B 3CPLB 5FV2A 2WAHA 1Q9LB 3O3UN 3H0TA 4PJ8C 5F3HA 3P4NB 2NTFA 5SWSD 3O4LD 3NABL 3HI6H 4RMUA 5I73B 3TVMA 5L7XL 1N5AA 2YUXA 3THMH 2LU3A 3DVNB 4PJCE 4GLRI 2BY1A 3SDDC 1IEAB 1NBZB 5IFHH 4U3XA 2Q20A 5M7QA 3FO1A 2CO7B 1ZTXH 3ECBB 1JPGA 4LCWA 3ULVH 5DJ0B 3V2AR 4ONHA 4LASH 4XAWH 4Y4KA 2FGZA 1NC4B 4LU5L 3ARTA 4DVBB 2F5AL 3V0WL 3MZGB 1G1CA 4OIBA 3MR9A 1A6TB 5MHSD 1FNGB 3WHXA 2EH7L 3ALWA 3CFCL 2QADC 1TZGH 5DRZA 1XGYH 1QRND 3FOLB 3B9KA 2X4NB 5L2KD 3QG6A 1Q9WA 2YUZA 4R7NA 1NBVH 4NKIL 1CU4H 2VLKD 1IT9H 5FF6B 3PGCB 3KJ4C 1EUUA 4G8GD 4XBEL 4APQD 1ZT1A 3GMNB 2F54B 4O9HH 4U6XB 3QEQB 5EBMA 3HS0A 3JWNC 1IGCH 1RQ5A 4WI2A 3U6RA 2VWEC 4IIQC 1NAMH 4M43L 1AGDB 3CFBA 3VI3F 4WI9A 2BSED 3MV11 1KIRA 3K46A 4WUKH 4R8WH 4PD4J 3NABH 4TULL 1RIHH 2WZPD 5CMAA 4XMKL 5SV4A 2A6KA 5KVMC 2GTZA 1RHFA 4OUOA 3WD5H 3G6AB 3ULUD 5EC1A 4PP1D 5JMOC 1BOGA 3BXNB 3MUGA 2YN5A 3QZWG 3MRHB 5FF6A 3PHQB 4JB9L 5T1LD 2VDPL 3TYFA 2J6EL 5L0QC 2X1WL 3RX8A 3ZE2E 1GZPA 3QEQE 3FQTB 1EXUB 4W81A 5T33L 3RQ3A 1J05A 3O3BA 1DQDL 4Q6YA 2PCPB 3RWIB 4ZO8A 1FAKT 3QFDA 3HC0B 1VENA 4G8IB 3LPWA 3RL1B 1HHIB 5IB3B 1F4YH 2NTSP 1ZT7A 4JFPA 4KJYA 4KROC 4EN3A 3BP4A 4Y1AA 4U4BA 2OQJA 4OZGE 1JPSH 3KWWB 1U93B 2JCCF 3G5ZA 1H5BC 5DYOB 3DSFH 1U8HB 2AV7A 1X5GA 2C4XA 4XVUD 2ZPKH 3P3YA 4HS8H 3VW3L 1U8NA 4UDTB 1GRWA 4QRTB 2D31B 1IL1A 1H8OA 1JTPA 1K8DB 2CLZA 5FYLL 4E42A 5I1IH 4H8WC 2Y36H 4CBPA 4Y4HB 1EXUA 1EJ6A 5T1DH 3K80A 3LQAH 3NIDF 3X3GH 1R5IB 4NKDA 2XTJC 4D8PB 1EH9A 2HFFA 3VD3A 1QACA 1SY6A 3RL1A 4Y19D 3D0LB 3KPPA 2P47B 3PIQB 2EC8A 4K7PY 2E7HA 2NXZD 5I75B 2EDFA 1NGPL 4DKEL 1IFHH 3AAZB 3BKML 4HG4J 4KVCL 3QUMB 2AEWA 4WFED 1I8MA 5DURB 1Y18B 5HJ3A 5F7YC 4PGEB 1OF2A 5DJDA 2DMBA 1BD2A 3AUVA 3O6FA 2FYYA 3MJ8B 3W81A 4LGPB 1A21A 1TZIA 3GMPB 4YHOL 2XZZA 1GGIL 4NN7C 3V0AC 4MAYA 4KU1A 4O2FA 2FCBA 1HH9A 3N0PB 1MVFA 4G42A 4JFXB 3UJIL 3Q6FB 2DJUA 4QGTA 4M61B 4TUJB 3VXRA 1LO3L 4KROD 3U9PL 2B8OT 5ICYB 1YY9C 4Y5VB 5F1IB 1MIML 2EXYD 4Z9KB 1JVKA 3KPMA 5F72S 2HMID 1CFQB 2WUCH 3LPFA 1SM3H 2BFVH 2P8PA 5F3HB 3ROLA 3MOAH 1P4LA 1KT2A 1EO8H 1LEKB 1PBYA 2MKWA 2D0GA 3SCMC 3CDYA 4E41D 3HI5L 5ADPL 1BQHB 4MJ4A 5FOBA 4MSWA 4D3CL 2EDXA 5IFJB 1VGKA 4LCWB 1ZHLB 3VXTA 4P5KA 1K85A 1LO0H 4QXUH 4PJHA 1P4IH 1X6NA 3EHBC 3P4MA 3QT2A 1E28A 1IC7L 5F97E 5C09A 3RWFB 5H94A 5BW7C 4R0LB 4LRIA 4WEMB 4YGAB 4XGZB 1NCAH 1AGDA 1T1XB 4JLRB 5KSBB 3GNMH 2YC1A 4I9WE 4NKIH 1DE4A 2X70B 1RI8A 4OGAD 4NCC1 2O93L 1KLFA 4RWYH 2VXVH 1MY5A 1PEWA 4POZD 4IS6A 3IDUA 4IMLA 1ZMYA 3G5YB 5MI0C 4F37F 3PXJA 3ILPB 1FN4B 1YEEH 3K1DA 1JHTA 2QADD 3TT1H 4P46B 1PLGH 4IRJA 4HC1A 3DMMC 3L6FA 1MIEH 5FA4B 4YEFA 5BQ7B 3JWOH 3MYZA 4I0PD 1AQKL 4TPRL 2LQRA 2YD8A 4OF7A 4BFIB 3DRQB 3AREA 1D6EB 2H8PA 2OL3A 4WFHE 4OGXL 1RHHA 1XGUB 4EOWH 5C70A 1I9RL 4ZUVB 1KB5A 1QSED 4GW1A 3MNVA 3VFMB 2F19L 2QJDA 5L9DH 1ZAGA 4WHYH 1HXMA 2EDLA 2VLRE 4XNMA 1RD6A 1BIIA 3DV6B 1QKZL 2BCKA 4QHLB 3DX9A 3KPLA 5IHZB 5KJRL 3VGAB 5IKCA 4ELME 2FJFA 1G7JB 2PXYA 4LPVA 4R4FL 5HGAB 4WU7A 3C9NA 3T2NH 4L8CA 4LSPL 4N0FA 1XF1A 5EO9A 3U46B 1A6VH 4UAOB 1NAMA 4HH9A 2AJSH 3WFBL 4LOUC 1EBPA 4PTTA 4XCNA 5DJYB 5C92A 1F2QA 5DHVH 3I2CL 3LDBB 3MNZB 2NXZB 1RMFL 4HMDA 4GAYB 1CLYH 2ENSA 3FONB 4Y1AB 1GGIH 3BGAA 4NQVB 1H0DB 1KTLA 5GS0H 4OBSA 2FX9H 25C8L 2R1YB 4GKSB 3ULVD 3ZKND 4CNIB 3OBAA 5HDLA 1JWSA 4NO2A 4OCXL 1WUNT 5FUOH 2ARJQ 1HHJA 3IAPA 2A6IA 2CIKA 4GMSH 2YPLA 5I8CA 4HG4K 5DMKA 3UTSD 4UB0L 1RZGB 2GI7A 4UI2A 2P5WE 1PQZA 5TDOB 3SKJL 3IRZA 4FZEL 3F7VB 5C0EA 3OKDA 4FQCH 4PG2A 5IVNA 4OZHB 1GHFL 1RZJL 4H20H 1MCIA 3ARGB 1MAJA 4LDEB 5FO8A 4IRZH 3HN3A 3QHZH 1XF5B 1YPZF 1A7BA 3IDMB 4L3EB 3NIFF 2IQAA 2IG2H 1PKQB 1W0VB 1RIHL 4PY8I 4I77L 2R9HC 1T0MB 4ZFZA 3R1GH 1FORL 2BVPB 4XHJC 4PBVC 4AENB 1S8DA 2MPAL 2EDDA 1BM3H 4I8DA 4NWUH 4QRQA 3RZWA 3SGDI 1C5CL 2PO6A 5H2BB 3Q0HA 3K81A 3HAEB 5LGKA 2YWZA 1CIUA 3F7VA 4I3GA 1ZGLB 3NTCL 3ZMRA 4DVBA 3DX7A 5T3ZH 3D3VB 2V17L 3C60D 2I07A 1SY6H 3QIWD 2AK4D 4BKLB 2NLJA 3ZDYF 2BNRB 5T33H 3MLWL 4YBQD 1P2CA 4UT6H 1EERB 5FK9A 3O6LH 3VRJA 4D3CH 1JHLL 2C1OA 1OGAD 1FSKB 1KFAH 4N1CA 4C58B 4LHUB 5FM5O 4I3SL 3C2SA 2FBJL 4KV5F 1RK0A 5ALCL 5ANME 3L3JA 4AM0B 2O5ZH 4QRQB 1FL6A 1KN4H 3VXTB 4P5TA 1C5DB 1ZEAH 2VQTA 3G6JB 2Y4SA 3GBNL 2W1NA 1G9NL 4HUKB 4XVTH 4ZS7L 4XP6L 3L5JA 3STLA 4YX2H 2VXTH 4MXQC 1L7TH 4P3DB 1U8PB 2VZOA 4WTWA 3HI6L 5EIIB 1XCQA 1OSZA 1HNGA 2DMCA 3WFZA 4ZXBB 4EOWL 4JG1H 5B3JF 5H8DA 3EJYC 3M1BB 1NGYA 5TJWK 4FTVE 3DETC 1WJ3A 1FJ1A 2QQNH 1WBZA 3HRZB 1OTTC 1X5LA 1VB9A 2Q6WA 2R1WA 5B39G 4UMGA 2ILLA 4KMLB 4DW2L 4Y19E 1RSFA 4MX7A 3W0WE 1CXIA 1BX2B 1JGLL 2J8UF 1XGPA 1U8LB 3PDOB 1Q72H 3QIBD 1BLNA 2XQYG 3TH2T 4IRJB 3FB5B 5F6HJ 3C6SB 2H2PD 4TNVF 1WLHA 2Y07H 1DQJB 3RZCD 3FJTA 1XEDA 4PJFE 1LK3L 1YNKL 3I75A 4ZO9A 1CICC 4BSVA 2WQRA 4XCNB 4Z8FL 1TNMA 4HUMB 1C8PA 2FNBA 4R96B 2IH1A 5IQ7H 1FIGH 5GS0D 3ALPA 4K3DL 1NFDE 5KVEL 4HJ0D 2XN9E 5IVXE 4TNWF 2ED8A 5EUOB 4LQ1A 4UNVA 1XGQB 3KPTA 2AXHA 4LQFH 3T2QA 2P7TA 5DJCB 5E4EC 3TV3H 2P8LB 1WCBA 1N6UA 5I71C 2E9JA 4K8RC 1LK2B 3F58L 3QUXA 1OVZA 3UPAA 4HJ0C 3TZVD 3VXSA 2WUCL 2R15A 3LMJL 3QFJE 4PRAA 4R4FH 5DEZA 2OL3H 1A3RH 2ZUXA 5IMKB 3EJYD 12E8L 3ULUE 1U91A 4S2SA 1OWWA 4KZDH 4S1QH 2QBWA 2DDQH 5CD5C 3GIVB 1HYRC 4OTXH 4M7JL 2VLLA 4OFIA 5H35B 4WFGD 1T03L 1K4DA 2OS7A 3RJDA 4U1SA 5E2JA 3AREB 1CFTB 3IDNA 1NBQA 2CXGA 3U0WH 2XQBH 4HUVA 4HS6B 4M4PA 3WKNA 4O51A 3CSBA 5HYSG 1U36A 2VL5B 2APWA 4DZ8B 1KCRL 1FRGL 3QUYD 3G9AB 2DBLL 2VDNH 2H41A 3ARGA 5IK3B 4PJFF 2VH5L 3RP1A 1QLRA 8FABB 3WUWB 2J3SA 2Q87A 3KPLB 4EUPG 1T2QL 2P45B 5IB3A 4LLQB 4Y5YB 1F4WL 1XIWB 4UINL 3WIHA 4QOKD 2LVCA 1C5BH 4HLZH 2AJZB 5KOVC 4N5UA 1REIA 4XPTH 1MQKH 1LILA 2GT9A 4N1HB 3P4MB 1KIUA 3BX7C 4U0RC 3U4BL 2E7CA 2BX5A 4JE4B 1FFQA 2X41A 4QXGH 3UO1L 3TN0D 2CRMA 2HAZA 3VGGA 4G43A 4K3GA 4LCYA 5E08H 2ZWLT 1EEYA 2NXYD 3QUMA 5E99L 2AI0L 3PQYD 5D4QA 3KNBB 4HEME 3X11B 1FP5A 4KI1A 1F11A 2YPLE 3AM8C 3BZFB 3K3QA 4ZOBA 3NFSH 1KCUH 2DQCL 1QSFE 4I5BA 3B9DA 1KEML 4CAGA 3CZJA 4DCQA 3VXRB 3PGFH 1L0QA 1Z9MA 2H1PH 4MJ5B 4F7EB 4WTZG 3SJVE 3WYRA 1DVFA 2NCMA 3D18B 1T20A 4DKAA 3NAAH 4MD0B 4OJFL 1VKXB 4OLWH 4PV9B 1SBSL 1WC7B 1OB1A 5INCB 2GQHA 5IWLC 3T3PE 4N8CL 4CMMA 5HI5C 5D9SA 4PR5A 4HWNA 3LPGA 5E8PB 3SKMA 1BMGA 2I24N 1ES0A 4YHIB 5CD3A 4EN3D 2A6JA 4OGZA 2DWDB 4I48B 5GQBA 4Y16B 1HHIA 3QIUB 3LSOB 4N0YH 3JTTB 5TE4L 4NHCL 1Y6NR 2AQ3A 2AV1A 2ZUVA 3PV6A 5BZDB 4JPWL 1AO7E 2R1WB 3EYQD 6CGTA 4WO4B 2FR4A 1JGEB 5EO1B 3LS4L 4J8RB 3UTSB 5JR1L 2F5BL 3CX2A 3E8UL 5ISZA 3D85A 3V6BR 3VGDA 2IJ0C 2ID5A 4XNXH 5BS0E 3QWOB 2OR7A 5C0JA 1XGQA 4YHYC 4HUXB 3W39A 4D9LL 4GG8B 4M7JH 5HHPB 3U7WH 4IEFB 3T1FA 1PZ5B 1Z3GL 1G6VK 3H0TB 3OJMB 4OLUL 4RMQA 3VFGL 5B38A 5FYJD 1G84A 3DVIA 3OPZH 1YEJL 1QLFA 1H3WM 2BZDA 5D6CB 5L0QB 3DYPA 2VJXA 4KPHH 2BXZA 3O6LL 2Y06L 1YEKH 5IMKA 5E8OB 1OAQH 3TJHD 1U8KA 2J2ZA 1E6JL 5IVOA 3TN0B 2I60H 1AJ7L 4Z7VE 3HZMA 5DF0A 5TH2A 1T66D 1TCRB 1FL3B 3AREC 3NZHH 2DMKA 1O7SA 4HCRH 2NW3A 1WZMA 2V2XA 4K2UH 3UXFA 2FJGB 3C6LA 3R06A 1A9EB 4LLAA 3PGDB 5EN2A 1PZ5A 3VXSB 1CGTA 2WWKT 4YXLL 1QSZA 2AXJA 1ZANL 2GJ6A 4O51B 1GOFA 2ESVA 2FBJH 1QLEL 4MLSA 1A2YA 2GITB 5GGUB 3BKCL 2C3VB 3O2DL 1MFBH 3ZSSA 3DMMD 2ADFL 1K4DB 3HFML 1ZT1B 3GMNA 3GMRA 3HS0B 3MLPA 3WIIL 4DTGL 4UNUA 5D70H 3TVMD 1LO5B 2QQKL 3ESVF 4R8WL 2DLFH 1NL0H 1LMKA 3MODL 3O8XC 5DR5L 1FFPA 1TQCC 3IFOB 5IF0B 5C08E 4BSVB 2YRPA 4LVHC 3SO5A 3BKJL 2VH5H 1TTFA 3BDBA 4JFZL 3M45A 4AIZB 2MQ3A 5E2VH 5JXED 3VWKA 1HHKA 3RDTC 3GDBA 1V7NL 2CD0A 1M7IA 1UQSB 1T3FA 3HLAB 2NY0D 1X9QA 3IFPA 4DN3L 4PLJD 5E6ZA 3L5XL 3TFKD 4P46C 3UX9B 1JPSL 5E2UL 1RFDL 4HQQL 3U4BH 6FABH 1NBZA 2BVUA 1F3JA 3KAAA 3NPZB 1MFCL 3NIFE 2E6JA 4K2UL 2GT9B 3L1OL 3V6OE 1XF2B 3PF2A 4X8JA 3HUJF 3BZEB 5GPRA 1FZKB 3S88H 4ZOAA 4KKCD 1FYTA 1IQWH 4I0PA 3AY4C 3IAGC 1VGEH 4IRJD 2HKHH 4W4NA 4M9OA 5CJBA 3MV8B 4X5XB 3HMWH 5DFVC 2O5XL 3WUWG 4P3CL 5JHDD 3UBXG 3BKCH 4JFQB 4BQ9A 5GXBB 5SX4I 3VDCA 3VXNA 1F58H 2HTKD 4TQEL 2HKFL 2R23A 4L1DA 3F6IA 3LKRA 3MCKA 3SDDA 3FB6B 1LNUB 4KI5E 3BI9X 4MJIE 2IGFL 3H9SB 1P2CB 2V17H 2JJSC 1H3PL 4RMSA 1NGQH 1BD2E 2VKXA 4S2SB 1A7OL 1DSFH 3MBEB 2H6PB 3BIAX 3C5SA 4LEOB 5HHOA 4QRPD 1WCQA 2MSPA 3HPLB 3QO0A 4KVCH 3O2WL 4JO3H 5E2TH 1ZHNB 1CBVL 3GHEH 5AYUH 1MCLA 1RJZA 1UGNA 4FQJH 3UTQB 4PGZA 4Q0XL 4WHTA 4RFEB 4NO5B 4X6EA 2B1AL 4QF1A 3S37H 4Q9CA 4XBGB 4C59B 1KLGB 5TDNB 4OLUH 1YZZA 3VFGH 4JDVA 3WDJA 4FFWD 1H0DA 1FG2B 4MDJA 2XTJE 1VHPA 3EJJX 3GSQA 1OGAB 2EYSA 2F19H 2DWEB 1NCBH 3H42L 3RUGE 1RULH 3BPNB 4RDQF 4PTUA 4CUCA 4AH2B 4YE4H 5D6CA 5IOPA 5IBLC 3TWCH 43CAA 2YA1A 5EU6B 1MQ8A 3OKYA 2I9TA 4PJ8B 3NGBC 1KPUA 3CSYB 3DETD 3QXAB 5F71A 5F3BB 3ZYOA 5EUOF 1RZKC 3MRKB 4H0GA 1JYNA 2HWZH 5CILL 1RJZB 4Y5XC 4X4YA 4M7LL 5CZVH 1R3KB 4GW5B 1P5VA 1PD6A 1A6TA 4DOHE 4G8EA 4MA1C 2AERT 4QTHB 5J89A 3KDMA 4MAYD 25C8H 2VERN 3CLEH 2Q3AA 3C60A 5DWUH 1FV1A 3SPVA 4KQ4L 3EFFB 1F00I 1ONQB 4QTIL 4OI9A 1G7HB 1Q9OA 4YPGB 4LKCA 1VSCA 3RKDD 1DLHA 3WLBA 3DXAA 1YQ2A 1T0MA 4UILL 1RV6X 4P5TC 5CSBA 4JQIL 3OGCA 3SGKA 2WWMD 3WFHA 2DWDA 4I48A 3OV6A 1ZLVK 2N7BA 3NFNA 4PRBB 3QHFL 3U4EA 3MRRB 5GJSH 3BRGC 5E8PA 3TA3C 2VLKA 1M6OA 5DS8B 1I7TB 2AGJH 1LO0L 4YAQB 5HYJB 5GS2D 4BUGA 4BSJA 1RZ7L 4G80A 1N26A 4U1LA 1R24B 5GHWH 3SDYL 1O5DT 1CDUA 5B3NA 4U1GC 1S5IH 4YXKL 3G5XA 5DDHB 1UYWH 5D5MA 3MODH 5D7JB 5KS9E 1KG0A 2R2BA 4X9GA 3PDGA 4KK8D 2UZYB 5HYJE 4H1LA 2VR4A 1MCJA 1U8MA 3SY0B 4CKVX 4NZTL 2FB4L 1BAFH 5JLZB 3GEWB 2ADFH 5EZJA 2UUDH 3GO1H 2BMKB 1NH6A 3BGFB 5HHMB 1D6EA 2OL3B 3SBWC 4G8GE 4AL8H 1A6VL 3GSUB 4JN2A 4G80B 4JZJC 4M6NL 1EMTL 1FIEA 1HHKB 3KPPB 3LHPH 1WAAA 4L8CB 1BQSA 4NQXB 4P2CG 5E95B 2WW8A 4MD0A 5E2VL 1T1WB 3TO2B 4U6HB 1AO7A 4FXKB 4NQTA 1KYOK 4J3SA 3UYRL 1AE6L 4PJGF 2L7JA 3C08L 4YFDB 5TQ2H 3PWUA 5CJ8A 1P7QB 1V7MH 5HGHB 1IGFL 4K07A 4NKOB 5HYSA 4WY7L 4JZOB 4XNUH 2GJ6B 1FFRA 4K71C 2J88H 2RCSH 3IRPX 1D5ZB 1NGXA 4JM2A 4JQXC 1HXYA 5GGUA 4HXBH 2Z0BA 3FQUA 5C86A 3OJDA 1KJ2B 2R0ZL 4FXGB 1KV3A 3HC0A 4G8IA 3TYGL 4K23L 1EGJH 1MEXH 3ZDZE 4X9BA 4PGEA 3TNNA 1JPFA 2V5YA 4P3CH 5L2KA 4NJ9L 2XG5A 5SWSE 1CIDA 1CTNA 4LCUA 1QRNA 2XPGB 4PRDB 1A0QH 5C6WH 3JXAA 2VN4A 3DROA 2EEAA 3L6FB 5FA4A 2HLFD 4Z5RA 1KELL 5J57B 3CLEL 5ACZB 3QXDB 1FL5A 3VWKB 3KS0H 2VZSA 1W72H 5CGTA 1U3JA 1WGOA 1TENA 2FHBA 1IGJB 4GG8A 1W0WA 4JHAH 3KPSD 4Q9QL 1T0NA 3BQUD 4R0LC 2HWZL 2UYLA 1KULA 4Y5VA 5EWIL 1IL1B 4D0CA 1LO5A 3VWJA 1T1YA 1X5XA 4GAJL 2HVKB 3F12B 4G3YH 2NX5E 1KENL 1I3RB 1LEGB 3H42H 3H9SE 1I8MB 3B2UD 4R4BB 3HRPA 4XP4L 4RGNE 4M00A 5AEAA 3MCLL 4PJ9B 1CGVA 5T3XD 4NC0B 5ACZA 1M7IB 1OD7A 4PJBA 1FBIL 3LKNA 4IHOB 1A6ZA 3U1SH 2BSRB 5MENB 2IFFH 2HFFB 1KB9K 2WWMC 5AUMB 1ZGLM 4G6JH 3PWVA 5DK0A 3BFOA 3HB3C 2OTWB 3RTQB 1MEXL 4WI7A 4PP2A 1HINL 4OKVA 1CD8A 4Y16D 1A7QL 4BQ8A 3D0VB 3K2UL 4JR9H 3H2WA 4CMMB 3N50A 3SE9L 4PGDA 3RL2B 3LSOA 5I1HL 1DUZB 1YN7A 3A6OA 3V5DB 1IT9L 1B2WH 2VO5A 2X4TB 6FABL 3BWUC 4JREB 5BRZD 2IPUK 2YOCA 5C0ND 1IEAA 4ODUA 4U1GB 3BKJH 4IS6B 4EBQH 3BO8A 1DBMH 2P5WA 4QXWA 4C56B 3OKKA 2BCKB 1KSRA 4BA8A 2A74A 3T0XA 2NY1D 3NZ8B 2DD8H 1SYSB 2W0FB 5DD6A 4HBQA 5EC2B 5T5FH 5DYOA 5C6TH 3V52H 3PUCA 1IM3B 1ETZA 2IH3A 4ZSOE 3LH2L 4TSCH 2NY7L 4GG6B 1J8KA 1E27A 1CTOA 4X4ZA 5F7KC 5ANMA 5HHXL 3AVEA 3OTTA 5TF1H 1PG7X 2E27H 4MJID 3KNBA 4Q9BA 4XVSH 5ID1B 4WFEE 3Q1SL 1GGBH 2NZIA 3SE8H 1ULVA 1P4IL 4U1JA 3WXWL 2X4SA 3P0YL 3UP1A 1ZGLP 1AD9B 1YJDH 4HS8L 2BK8A 1F4XL 5DD3L 5GRJH 3UAJC 4DAGH 1B6DA 3I3DA 3VXME 4AG4L 1K4CB 2H32B 5IR1B 3SE9H 1A9BB 1OM3L 5KW9L 4MA3A 1AXIB 2Q86A 5DJXA 1QBMH 3DI2B 1IAOB 3BQUC 5I17B 5E5MB 3VGAC 1UA6H 3CVHB 4WIQA 1M7DA 4O2FB 4HJGB 1K6QL 4R9HA 2VDQL 3WNLA 3CVHL 5EU7C 5KTEL 2VZ3A 2NY1C 3MRGB 5I2IA 5EOQL 1B0GA 3FOLA 4JKWA 2OZ4L 4V2BA 1FZJA 1P7HL 4GOSA 1VFUA 4IJ3C 4XVUC 1KT2B 1J11A 3WHXB 3FO1B 4L5FH 5H35A 4OZHA 5D7SL 3AXLA 1V3LA 3TNNB 4Y4KB 4ZMAT 1SMOA 1FQ9C 3K1KC 3VFTA 1MAML 3UBXA 2GJZA 1RY7B 4DEPB 3GBNH 5LJYH 3IJSA 1JPFB 1MWAA 3ARFC 4Y4HA 2IAND 4DZ8A 1YPZB 3ARFA 4Y4HC 5CMAB 5D1ZB 3RVUD 1QFUH 2VB5A 2HVKA 3BWAA 4KMQA 1MCWM 4G8GA 1IILE 2AXFB 4PJ8A 4YHPB 5DJ2B 1CD0A 5HI4D 3UJTH 2DI7A 3TA3A 5IJVB 4YO0B 3VXOA 2OI9C 4F7PB 2ZG2A 3M07A 3QXWA 1MFDH 5GIRA 4AJ0A 4JHBA 4NQDA 2LV4A 3B5TA 2QQNL 4ODSH 4JFEB 2I9LB 5B39B 4PRID 2XA8H 3E8UH 1ZLWH 2OK0L 3ET9F 4UTBH 4PP2B 1P6FA 1DQMH 2A73B 4NPYA 1K8IB 4JM2D 4EDXB 2XFXA 2BSRA 3IS1X 3QO0B 4RFNC 1JZ5A 4Z76A 1FORH 3MRLA 1J8HE 3R1GL 2VWEE 4NM8H 2V5SA 1S7UB 5D1XA 1OP3K 2HG5B 5CUSH 1HEZB 4M4RA 2AJXH 4U6YB 4OD2A 1E4XI 2FL5A 2H3NB 2NX5A 5DGQA 5C0CE 3S34L 4PRAB 2VXSH 5ICXB 3TC9A 5MERA 4P59L 5SWSA 3F7YB 1HSBA 1XCQB 1MCNA 3HUJA 3GIZH 4FP8L 5FGRA 3SHSA 1UJ3C 4MJ2A 1QZ1A 1DBJL 2X4OA 3AS1A 4QRRE 2HP4A 1B0RA 3IU3A 3IDXH 1JZ8A 3T8XB 2IANB 3T3MF 4ZAKA 3GSQB 1DQJA 1TQBC 1BP3B 5IFHL 1GPOL 3VRIA 5C0DA 5E9DD 1Q9LA 4PJDF 1HK6A 5L6YH 4Q2ZA 3TCLB 1CS6A 4AEIL 5TE4H 2PO6C 4LHUA 2V9QA 3FTGA 1BIIB 2CMRL 1U8JB 4XMLH 5DC4B 1FNLA 4FXLA 4OB5L 3BZEA 4IBLT 1A0QL 3SJVA 1R3KA 1KLUA 5JDJA 1G7HA 1HILB 3EDEA 2JB6B 4JY4B 2NLJB 2ZNXA 3MGAA 5D7IF 1NEZG 2Y5TA 5IB4B 2G5RA 5FOJA 3FN3A 4FS0A 3SPVB 5DD5L 3ARRA 4EVNA 1JUFB 1YEEL 2E8ZA 4JPWH 4NDMA 5IBLD 1QFWH 3EOAA 4HKXB 1NCCH 2EE3A 3BVNA 1KEGH 2WP3O 1I1RA 4N1EA 3WNNA 1JHTB 2ICES 2P43B 2PYEE 2O61A 1CR9H 4Z7VF 1MFAH 1LEKA 2Y23A 1NFKA 1QBML 2EDOA 3WFDH 2D7TH 5LGHL 4QRPB 3IKCA 1CQKA 1M71B 3CU7A 5IB2B 3SO3C 4D0DA 1VACB 2X1OA 3C5ZA 3W2DH 3ULUF 3UTTD 4QNPF 3RUGF 1JUFA 5EBLA 3P4OB 5I1DA 1CFNB 2AK4E 4MAUL 2H45A 1BPVA 2SEBB 1S7VA 1CL7H 2VITA 4WW2F 4OF6A 5EUOE 1PEZA 4U1MB 5E1HB 4ETQB 2MCPH 3MLYL 3S36H 2NY5C 3BIKA 1NCWH 1L4IA 1ORSA 3VFTB 4K71B 4A6YB 2VL4A 4PJ9D 1TPXC 2EYRA 4UNTA 3ARGD 3D69A 3HMXL 5F1OB 5D2NA 5DDHA 2GIYA 2NYYC 5E00A 3UCRA 3MOBH 3VFSB 2FX7H 4BJLA 3QDMA 1S8DB 4UT7L 5ECJE 4KRPB 4Y0GA 3QCVL 2H1PL 1MAMH 1Q72L 1N8ZB 2R2HB 4LSVH 4BK5A 3O6MH 2Q8AH 4HK3J 4QKXB 1IKFL 1IM3A 2HH0H 3DGCR 2X4RB 4HKZA 3D39D 1QOKA 3G6DL 2YZ8A 5CAYB 1BWWA 4NO0A 2YD3A 5CSZA 1FFOA 5FKPB 2A6DB 4CVXA 3HC4H 4DGIH 4JRXE 2BDNL 3RVVC 4CMHC 5TQ0L 3GSXA 3BH8A 3MRJB 4UILH 3MRCB 1DLHB 3WLBB 3LEVH 1TIUA 2CRYA 2NY7H 2UZIH 4I2XE 4RWHA 2GYSA 2D4FA 4K8RD 2OSLA 2PTTA 5DD3H 5GRJL 3MZTA 3VFWB 2FECL 4DAGL 4CGTA 4YQXH 5IHZA 1MCSA 2DYPB 3M8OL 3QEGL 3Q3GB 4Z7OF 5M94B 2BHYA 4XNMB 5E6YA 1IVLA 1CL7I 4JPVL 5DEFB 1NLDL 2HJFB 4HWEL 2GW5A 4D8PA 3LIZL 3QDGA 4ZUVA 1ZWIB 4XTRC 4MA1B 4M62L 2HRPL 2EXWD 2BP3A 4U6VH 5TFSL 2ZCHL 4BSWB 2J4WL 1S9YB 4PJDB 2AJUL 4YC2B 5JZ7D 2NMSA 5C0AA 4TNVK 4WWKA 2B2XL 5IT2L 1H3VA 3WS3B 4N0FB 3BGMB 3MRQB 4HZLA 4XTRD 2R0LL 5EORH 4ZFFB 5DUPL 5FHAH 2AJYL 4FQXB 1T2JA 2WBJA 3QIBC 4RCAA 1NDGA 3MUZ1 3MREA 2ESVB 1MVUA 3QRGH 1JZ7A 3RDTA 4YFEA 1SMAA 4XVTL 4XXDA 4XCFL 2CK2A 3TNMB 5FB8B 1BQHG 4QHNA 4RIRB 3O0RH 2FIRT 1HHJB 1FZMA 5IFAH 4TNWK 5CBAB 4LSTH 3LEVL 1UZ8A 3LRGA 3VFOA 4Z8FH 3UO1H 1OLLA 2XNAB 2B5IC 4J6RL 4KDVA 1NJ9B 1T04B 4A2LA 1QLFB 3EOYG 3H3KA 4QRRD 4EDWL 1PKQE 2W38A 4JRYB 4PGCB 5JORB 4NOFA 5CBEB 4ZPVB 1MQKL 5EU5B 3RTQA 3V4UH 4W68A 4UQ2B 4YXHH 1GGYA 4PRHB 3BPCA 3WN5B 4OZHE 3MLTA 3MJ9A 1UXWA 1FL3A 4HGWB 3KPSE 4LLYB 1HI6A 1YDPA 2OZ4A 2G2RA 1WEJH 3ROOB 3RWCB 5BVJB 4J4PD 1A6WL 4GW4A 1MCKA 4R26H 5IMLA 2CPCA 4AEHL 3CIQA 1JTTA 4ODWB 4V1DB 4MJ5A 1IM9A 2A1WL 3FO0L 2O5YH 2FL5B 2H3NA 4GMTH 2VDPH 2X4PA 4OF0A 2B1HL 1MREH 5IROA 4ORZC 3QH3A 1W8OA 5FIEA 1A5FH 2AEIT 2BRRH 3E0GA 4KUZL 4X7TA 5JW3H 35C8L 3VFUA 1HH6A 4OIIH 1JNHA 4J3XA 2NTFB 2Z92A 4GRWB 3BT2H 1TZIB 1MNUH 3WFBH 5HXMA 3CPLA 3ZSTA 5KVDL 5DQ9A 3W11C 3WS6C 3RIAF 5I1GH 1II4E 4L8DA 4DWHA 3UROR 4F2MA 2DBLH 2P5EE 1W2KT 4TVPH 5E56A 1NCTA 1A4JB 1CLCA 1MI5A 1N3NB 4RAVB 3CK0L 1YQVH 3G08A 2M26A 4NZRL 4NT6B 3OZ9L 3V4VL 2RGSA 5T3XH 2Z92B 2P48B 5DRXA 4ELKA 4XCEA 4MCZA 4MS8D 4JFOA 3N9GH 1NQBA 3DNKA 4M62H 1MJUH 4MQ7A 1T7VA 32C2B 1S7TA 4HV8A 2C4FU 3LV3B 1RK1A 4LSPH 2YPLD 3CVHH 4M48L 1T20B 5C0AE 1A6AA 3V6OA 5E70A 3C60C 1A9EA 1YYLH 3KXFE 3TO4D 3CFIC 4JPVH 2HN7A 1OWRM 1YNLH 2F53D 1HQ4B 3PP3K 1QUNA 4Y5XA 4JM4L 4Q6IA 1F11B 4OCRH 3FFDB 4HCRL 2KPNA 4JGUA 2UZIL 2AVGA 4XHJD 3TLRA 1EHAA 2NW2A 5MEQB 1YEDB 5KSBE 4EQ2A 1G0DA 5ESVA 2R0LH 5IHUL 1DN2A 3I3BA 5JPNB 1T4KB 3MRHA 2ZOKB 3LHPL 3DO7B 5D7KE 1UFUA 1E4WH 3RY6C 3QP3A 4P2QB 4Y5YA 5K9QG 4FG6C 3MX0A 1I7RB 3GFUA 2EH8L 3MRDB 1IAKB 3WJJA 4LPCA 4FQXA 3VG9C 4NC1E 3ULVC 1M7XA 2DLEA 2CMRH 5JO5B 2WV3A 5E5RB 3SGKC 2E27L 4HZLB 1X5KA 1OP5H 4WFHD 3UBXB 4BH7B 3RWJB 3GJEA 4LSQH 1H5BA 5IGXH 3H3PL 5DD1L 3DUHA 2WBJB 4H26A 3WO4B 4PJEA 1U91B 4M7KL 1HKLH 3P11H 4MD4A 1EZVY 4GXUN 3C5ZC 4U6XA 2Q7NA 5DRZB 1KN2L 2E7LA 5I18L 3W5MA 3MV8E 5L2KB 1VFBA 3GBMH 1MCRA 5KW9H 4UTBL 3HPJA 4K94L 1XF4B 3OKNB 5DQJA 2IBGA 4OFVA 4P9HL 5SWZE 3DX6A 4N0YL 2QSCH 4F8QA 4Z7WF 3T09A 2W9LA 3A67L 1NFDA 5IM7A 1Q1JL 2CUIA 3RWDA 1AIFB 4EI6A 3WXWH 3REVB 1Y6KR 5I76B 2C7UA 3CFDA 4ZTPH 3CFCH 2MHAB 3VH8G 4BKLA 2CLZB 1KG0B 1KIRB 1UZ8B 5JUEL 4KTDH 1BOGB 5F7MC 2PTTB 3PQYB 5BV7H 1I7UB 3IDGB 1B6UA 3SGJA 4L4VB 4JPKH 5J8OA 2PR4L 5DUML 3MRJA 4L8SB 2PYFA 4JY6B 4WO4C 2D0HA 3NGBB 2IBZX 1SYVB 4G6FD 3JWOL 2CJUL 2XWTA 4ORGB 4YK4B 3MGOB 4CVXB 5I9QB 4HS6A 2UWEA 3GJFB 3SDCD 2VAJA 2XRAH 5DI8B 3P77A 2QHLA 2Z93A 4OM0L 4I3RH 4M8VA 4I18C 4OLZL 4NO3A 4LPUA 3OKEB 4WV1B 3NFNB 2GFBB 4PRBA 1YC7A 3U4EB 5JW4M 4GBXD 4OUUB 3QNYA 2J8UE 1ZWIA 3QEGH 3IAQA 4LCYB 3I02B 1G9MH 3FOMA 2OTPA 5GSVB 1S9XA 3TZVA 1DBAH 3TBYA 1S9YA 4FQPA