4KRNA

Nanobody/vhh domain ega1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
129
structure length
126
Chain Sequence
QVQLQESGGGLVQPGGSLRLSCAASGRTFSSYAMGWFRQAPGKQREFVAAIRWSGGYTYYTDSVKGRFTISRDTTVYLQMNSLKPEDTAVYYCAATYLSSDYSRYALPQRPLDYDYWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Nanobody/VHH domain EgA1
publication title Structural Evaluation of EGFR Inhibition Mechanisms for Nanobodies/VHH Domains.
pubmed doi rcsb
source organism Lama glama
total genus 26
structure length 126
sequence length 129
ec nomenclature
pdb deposition date 2013-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4krnA00
1KLGB 2J8UB 2EC9T 1BLNB 3GMMB 2XWJB 3WKNA 3MGOA 1TENA 2I5YH 1PZ5B 4FQPA 5D1QA 1XF2A 3C8DA 4WUUB 2Q6WA 1S78C 5FYJH 1IGYB 4HGWA 2DWDA 4TSAH 2FH8A 1WEJH 5C08A 1KCVL 4PLKC 5SX5H 3SO3B 5J9PA 1S7XA 3QIUA 3O4OB 5C0ND 3SE3C 1UYWL 4GJTB 2R23A 5ADOH 3OWEA 4CDGC 4JRYA 5CEYA 3HRZB 3N1FC 4Z76A 2GAZA 5TJWK 1FPTH 4WUKL 1N5YH 1EGJA 3SN6N 1E4KC 4HDIB 5JHDE 5E4IA 3TO2B 5EIVA 1QSFD 1TDQA 1URLA 2ICEA 2KPNA 5HHPB 4GUPB 2VNCA 4LCUA 4OFKA 2O5ZL 1NBVH 4P4RB 1BQHA 5HHNB 1K85A 5IVXE 4BH8B 4HJJL 1MQKL 2MQCA 4DEPB 1AP2B 1TZIA 4JY5L 4Y1AB 4RFOL 1UH4A 3PDOB 4PJCA 1YEFH 1KTLA 2WV3A 1AXIB 4HKZB 3HB3C 1I85A 3IDYC 4LRIC 4TUOB 1JWSB 4F15C 4HBCL 1A0QH 3WJJA 2IH3A 2DQUH 1MAKA 1CR9H 2IF7A 1XH3A 3VU2A 3O2VH 2V7NB 1BWMA 5B38G 4M93C 4DGIH 5FA3A 1BM3L 1L7IH 4XPFL 3SE4A 4G9FD 5MHSE 1KCUH 1IEBB 5FO8B 5IFAH 4FABH 1CFVL 4X80L 3QULB 4C56A 4IDLA 5DZLA 4NPYA 1R3LB 1U91A 4XMPL 5T1KB 3KYNB 5F9DC 4I5BA 2FZ3B 5D7IA 5DD1L 4N0YH 3AXLA 2HFEB 1TMCB 4LLVA 5IEHA 3O9WB 5F7EH 4L4VD 4LLDA 1FE8H 1P69B 4KZEH 1A4JB 1J0HA 1OAQL 1QFUL 3QIBD 4MJIE 2F8XC 1P4IL 3HMWL 1XCTB 1GYAA 4KUCF 4DKFH 3ELAT 1R3HA 4QRPA 3MV7D 1MFEL 4LQ1A 2W38A 4UNVA 5HYJD 1YEHH 1RZIA 2AW2A 4WHYH 2OR9H 3HI5H 1S5HA 4GFTB 4LGSB 5C0FB 3RU8L 2YPLA 3PQYE 3V0VA 3F7PC 2NNAB 4JFPB 2C1PB 3WLWD 4DUWA 2HFTA 4PY7A 3WHXB 3O2DH 3QJFB 3ZKMD 2DQTL 1IL1B 4X6DF 5ADPL 2DM3A 1OT1A 3K4AA 2HFGL 1RJZB 2QADC 3EJYC 4LEXL 4KTEH 3UO1L 1CLYH 5T1DL 3QPQD 2X89D 3HE7B 1D5IH 3H9SE 1X5XA 5D2NC 4G7YH 1CL7L 4PGJA 3THML 1ZT4B 2CLVA 5C09B 1G7LB 4TUJA 2ICWI 4LAQL 3UZEA 5MEOA 5C0JB 2VB5A 1U92A 5KN5B 4IMLB 2NXZB 4R26L 1FYTE 1JNHA 4P49A 2CMRH 1RU9L 1GZPB 3SGKA 4JJHA 4PJIF 2X9WA 4OM1L 2XACC 4XB8A 4M8QB 4QLRA 1Q9WB 1VFBB 4J8RB 5GS0C 3BMWA 4XNMA 4HKJA 4OF0A 4JFED 4RGOL 5I73C 1J1XL 3BEVB 3VWKB 2XA8H 1RURH 4ZSOA 5L2KE 1KYOJ 2OZ4H 2VQTA 2PTUA 3GB7B 2FB4L 3IJHA 1AH1A 5HHQB 2XY2A 1DEEA 4P4KD 4GMSH 4QTIL 3V7AE 1JGVL 3STLA 2PTVA 1RK0B 3GJEB 3S37L 2O61A 2OK0H 4IOIA 2DQCL 4HMEA 5ISZD 3G04B 4LPXA 2DQDH 2EO9A 4OZHA 3HFML 3RIAF 3OX8B 3ARFB 3D39D 3B9EA 1JP5A 3GNMH 4X99A 1JTPA 4HWUA 4UQ3B 4NQDB 3MBXL 4HT1L 2AJZB 1FIEA 5A2FA 3DUHA 4G9FA 3IGAA 1U3HC 3QUMB 1AQKH 1T04B 3QEQD 4G7VL 3LN4A 1CFBA 3C9NA 3MYZA 4UT6H 5EBMB 4LASL 1NJ9A 4N0CC 2VE6B 1ZHBA 2BVPB 5HHME 4OFYD 5JIIA 1AGDA 2J3SA 2AGJH 4N0UB 1SVCP 4UAOB 4ZOBA 2FX7L 2R15A 5T3ZL 3MGTB 3FN9A 1RVFL 1S9KC 4NP4L 1PSKL 1KCLA 3W39A 3QIBA 2IBGA 5FECA 1DSFL 8CGTA 4P2QB 4ZUWB 1CL7I 5IMOA 4UTBL 1RZKL 4ODHH 3MV7A 3S88L 4S1RH 3NFNB 3BH9B 2QKIB 5F89B 1K6QL 2XTJC 5HYJA 3PV7A 5J1SC 3RWFB 4BH7A 1GHFH 4TSBL 4ZFGL 3W0WA 2J6EA 3VXUE 1GZQA 2V17L 1HNFA 3KPNA 5CCKL 5DHYA 2R56H 4P0DA 3DUUA 3P9MA 4PJHA 4EZMA 4IRSD 3SDXA 4KWUA 3X17A 5ECJE 2OL3H 4E41E 3NFPB 4DZ8B 1DQDH 1ZVYA 4NO5A 4I3SH 3KS0J 5IHUL 2EKJA 1VDGA 3MLYH 4ZTOH 1WBYA 2G9HA 5TDPB 1FNHA 2YD4A 4IOSD 3AB0C 3E6FA 4N8PA 4CBPA 3J8F7 5IBLC 3TC9A 2R4RL 1OL0A 5KW9L 3DVFA 4O9HH 1VCAA 4DJMA 3ROOB 2K7PA 4K71B 4UIMA 2YPKB 2EDFA 2GITA 4LHUD 2HKHL 4YHNB 3Q0HA 1UXSA 4I4WB 1YMMB 3G6JE 3CC5B 2MHAB 4XP9L 4YH6A 3VD7A 4HUVA 3RBGA 1JHKL 5FK9A 5FOBA 4NUJA 1QFWL 4J3WA 1N0XH 3VXTA 4JFEA 3ZL4H 5KJRH 2P8LB 3VMOA 5F7MC 1LEGB 5C07A 1T66D 4HEPG 1ZWIA 4XPHL 3GSNL 1OT2A 4L3EE 4PRPE 3RL1A 3TCXA 4P4KA 5JR1H 4NZUH 1CGSH 4HGMA 4YIQA 3CVIH 2QHRL 3BW9B 4N9GB 5J6HA 3G6DH 2X4TB 5TE6L 3LN5A 4JO2L 1QEWB 1NCBL 4FQLL 4CMMB 2L7JA 3G5XB 4P57A 5DJCB 15C8H 5ISZA 1I7TB 3MRKA 1JPSH 2BRRL 2PYEA 5FCSH 4DFIA 2DMBA 3NIFF 4JE4B 4LSRL 4QWWC 5DO2D 1WITA 3D39A 3EO0B 3QG6A 4URTB 5CGTA 1T7VA 2VXQH 5F96H 4PJ7E 1MCRA 5I74C 1F4HA 1WT5C 4X8JA 5CZXD 5KSBB 2F53D 5IF0B 3QAZB 2ADGB 5L2JA 3QEQA 1BJ1J 3K8KA 5BOZG 1MCPH 3RI5K 1MJUL 4FQQA 2VUYA 1MCOH 3K8LA 4OFYA 2WAHA 2XIDA 3NTCH 1MLCA 1T1YA 1Z9MA 1TQBB 3C8KB 3MRFB 5I18L 2X4PA 1S7TA 5IOPA 4DAGL 3VXOB 3RVUD 4U33A 1H3PL 1FGNH 1MWAA 2GJZB 1CK0H 4MNQE 1ZA3A 4PP1C 4X9IA 3TVMD 4PGDB 3DVGB 4M5ZL 1QUNA 2XYCA 3HS0A 4RAVA 5C7XH 1AJ7H 2PYFA 1GVIA 3GMQB 1OSZB 1LO2H 2O5YL 1ZHLB 3BP5B 3REWA 1HKLL 2JB6B 2D03H 2H26B 5IB1B 1HINH 5H37G 1I3UA 3ZDZF 4UB0H 1ZTXH 1U8JA 4IRSA 2IJ0C 2J8UF 3QO1B 4JO4H 1J5OH 2HRPL 3HNSH 1P4LB 3L5XL 3QXUA 3K2MC 1WZKA 3NACH 4OQTA 2VLKE 2VXUL 3KPPB 3H2WA 5CJXA 2BRQA 1SJEA 4ONFH 4FZ8H 5GGRA 4PJAB 1UGNA 3IXTA 4MNHA 4JM4H 1Y18A 4KK5D 5GS0L 3MLRL 4NNYA 1OTUD 3EOTL 3L3OB 2E6QA 2P7TB 3ARBC 5I6XB 5I1KH 1YNLL 4X7TA 4LHUA 2VABB 1AIFA 5D2LA 1INQA 2CDEA 3I2CH 1ORSB 4DZBB 1UZ6E 1B88A 4M3KB 5IBTL 2AK4D 3IVKB 4CJ0A 3WYRA 43CAA 1BJMA 4NN7B 3IU3A 1MHEA 3LAFA 1MCQA 2DM7A 5FDWA 3GUTA 4KI1A 1KNOB 4WU5B 3RTQB 5D8JH 2A74A 3NZHH 3HG1A 3BKCL 5GJSL 1EFQA 5FO9A 3AUVA 1U9KA 3KS0H 2V7HB 3EOBB 5GSVA 3CFBA 1FGVH 2XV6B 2YD1A 4JAMA 1Y6MR 3U4BH 1X7QB 5I1LA 5A40E 4FQXD 1F6LL 3LB6C 2ZWLT 4CNIA 1OAUL 1EHAA 5ETUB 2A6IB 4K2UL 1E27B 1CN4A 1DQLL 2BSSA 1CF8L 3D69B 2P46B 2I60H 2GCYB 3O8XD 3R06A 2F53A 1T2XA 4KGJA 4ZFZA 4DUXA 1B0GA 1VPOL 2CRIA 2FBJL 2AV7A 4WFGD 4YHKL 4ZAKB 1JZ4A 3QA3A 4OIAA 3QDMB 4ONHB 4DVRL 4KJWD 2XFXB 4MSWB 3DO7A 4MA7L 5K9KA 4QRUB 3S97C 4NQED 1ZT1A 4UV7H 1RIUH 1RMFH 3MRNA 5D4QA 1IGCL 4PGCB 4FQIL 1LDPH 1QBML 1UJ3C 5TF0A 1F3DJ 3FFDB 4Z0BH 3TVMA 2B1HH 3U48A 1T6WA 4LL9A 5FGCB 3UDWA 4G9DB 1U3ZA 3AS1A 1A3RL 3P0YH 3EFDL 5E99H 3PHSA 3PWUB 1MCBA 2ATPA 4CN4A 1DVFD 4GKZB 4NQSA 1X5YA 5I66B 3ULUD 1VGKB 2OBGA 3EO9H 4H0IA 4U3HA 3I3EA 4RDQG 1ZGLP 4LBEA 3ZKQD 1BJ1H 4MJ2A 1NFIB 4RSVA 3ILQD 5ICXB 1I1CA 4PRDA 5DD0H 4Y5VC 4PG9B 4PV8B 4YHYB 4NKDA 1IGJB 5I76A 2HAZA 2ORBL 3P77A 4V1DD 1NH6A 1RUKH 4NQUA 3OJDB 3CU1A 2UZIL 1YNKH 4RISH 2EYRA 2IADB 3H8NA 5C0BE 4LDLB 4ODWA 1JL8A 1MAML 4R7DB 4PTTB 1ES0A 1NSNL 2OM5A 5DYOA 4QYOB 1FZOB 2AK1L 2AK4A 1LQSR 4QRRE 3WUWB 3SGEH 1FIGH 5F9JB 1WWAX 1X5AA 4XCFL 3MLPA 4R3SB 3D2UB 3MR9B 4JM2C 4N8VB 1T20A 4OCRL 4ZO9A 3UXFA 4XP4H 3EKCA 5IB5B 1BEYL 2X6MA 3M8OH 4PGBA 3VGDA 1T7XA 4ZOAA 4AM0A 2AJSH 1OSPH 1A6VL 2R0ZL 4DQOH 4M4RA 3QQ3A 1P4BL 2D7NA 3GSQB 4NRYA 5HHVH 3WS3A 4Z7VE 4GKSA 5I1IH 4FQXA 4MA3B 3ARGD 4HEME 2W91A 4X0KA 4Q2ZB 4WW2C 2OP4L 4Q9QL 2BHZA 4KRNA 2X7LB 3QNXA 2VMFA 5SWZE 2JELH 1I9IH 1Q38A 3O8XA 1R24A 2IWGA 3MCKB 5J89A 3W5NA 5IT2H 1T7WA 4WI4A 3T2NH 1CE6B 2AJ3A 3F7VB 2JB5H 3QP3A 4NQEA 5BQ7A 5F1IB 4MXVE 3UTPD 2HT3C 1U2HA 1JZ2A 4LMQI 3WHE0 3QISA 4MCZB 2FATL 5L8LB 1QTYT 3QWOB 4S1QH 1IAKB 5KAQF 2C4FU 5IB4B 3X12B 4BQBA 3MA7B 3K4ZA 5EU7E 4XVJL 1QG3A 5ENWB 4ZDHA 1DVFA 4Z77B 1ND0B 1X5ZA 4HS8H 5CZVH 4EN3C 1QLFB 5L0QC 1CE1L 1BFSA 3ARED 4PR5B 1KT2A 1O7SA 3T0EB 4HIEA 3OB8A 3FFCD 3DI3B 1ZLUK 1QSZA 5CEZD 3U4EA 1DQJA 4OD2A 2Q87A 3UZQA 5D9SA 3VXMB 4JY6B 2WUBL 2ZUTA 2V6HA 4NSKA 3TV3H 5FYKU 3CXDL 3RNQB 3PHQB 4L9LA 2H41A 3O11B 4KC3B 4V1DA 3W2DH 5D1XA 1GGYA 1FAIH 4ZO8A 1J11A 2GY5A 3KYKL 4NN6C 4MVBC 2EEBA 4ZXBC 4GSDH 1JRHL 5GSRA 3IU4L 5FUZH 1D5XA 3C6SA 2NY3B 1XGPB 1D9KC 3VJ6A 3VFOA 1FL3B 4ZNCD 5HDLA 4NYLB 3FCTA 5I8KL 2AS5M 3S8WA 3FRUB 3DO3A 3GBNH 5IW1A 4YHMH 1EAPB 2E9BA 5IB3B 3IDJA 4LIQL 2XOTA 4D3CH 3QXWA 4P5KB 3NPSB 1LD9B 1HSBA 4ODTH 1G9NC 3HMXA 4I3RL 4N9OB 5DWUH 1G7MB 1T0PB 2ENYA 4M7LH 4XCNB 4NWTH 5D7JB 5EO9B 5LXGH 1TVHA 3ARGA 3AS3A 4O2EA 4X6CB 5D2NB 3T3MF 4HH9A 3ALWA 3RBSA 2ICWJ 1KTKE 5B39B 4DGVH 4PUBL 4HK0B 4EI6B 4ZYKB 4HIJA 4KK8D 5DSCB 5KSBF 4JDVA 3LPFA 2LAGB 1QSFE 4EDWH 2OI9C 1AFVL 3MV9E 5D1QC 2XQBH 1SBBA 4KUZL 5JW5B 1OQOA 1MPAH 3WL9B 1KBGL 4QY8B 5E8EA 4Q6IB 4HMDA 2D2OA 4JLRA 2YWYA 3NABL 2WINB 3ULSA 3KPOA 4EXKA 3QIUC 1NL0H 3N1QC 4AEIL 2RCSL 3DECA 2L7UA 2OQJA 3B9VA 4GRLB 3O6KL 3U6RB 4ALAH 1QRND 2F54D 4PB0H 2X05A 4F37F 4D0DA 4DCQA 3K1KC 4K07A 5J57B 2HJLB 1SM3H 1AGFA 1BD2E 1MNUL 4JFXA 3RFZC 4I0PC 4ZS7L 3R8QA 4E0RB 5BRZB 1CS6A 3GSWB 4KRLB 1T0NB 2ERJB 3DYOA 3VFTA 5ICZA 5IBUG 2R2BB 4FRWA 1UM4L 4B7IA 5BJTA 1DL7L 1G6RA 3AREA 4WO4D 1MRFL 1F4YL 2NQCA 2KUTA 4JGUA 1JRHI 3U7YL 3TBYB 4WWKD 3FFCA 4TTGA 2OL3B 5JHDB 1YECL 1HOCA 3QFDB 5IFHH 1I85C 4MQSB 3MRQB 3L3HA 25C8H 2XKNA 4NHCH 1OAKH 3FQWA 4FFWD 3G08B 2FIKB 5IVXB 4B50A 5F7FA 5L6YL 4YK4C 5E2JA 2Z31C 3FQUA 2R1YB 1GC1C 1RULL 1XMWA 5F70A 5BCAA 1CG9A 1ZAGA 2VWEE 3SE4C 4OI8A 1KPUB 3MJ6A 3ORJA 2LQRA 1JFQH 3ZDXF 2ZSWA 1LEKA 3SGJC 1ZV5A 2BOCB 1MFBL 4JFFD 1QSED 5CUSL 3MNVB 4LVOB 2NY5H 3RY5A 1HXYB 3L5WA 5CBEA 4LSUH 2CR3A 3ZTJG 2OYPA 4Y4KD 2F74A 1B0RB 1TCMA 2DQHH 3P4NB 4YFDB 4ZUTB 5FA4A 1G9MH 1U8QB 3X14B 1SEQL 2HLFC 4MCYB 1ZLWH 4HS6A 3TPUA 1DDHB 2AJVH 5DFWH 5FYKD 5IJVB 4P5TD 3U9UA 5EZJA 1CDHA 1T2QH 3GIZH 2HRLA 4F58H 3RWCA 3CFDA 3QEUA 4ZMAT 4MJIB 4GMTH 3N50A 1MRCL 1FV1A 3QQ4A 2PN5A 2XQYK 5C0RL 1OTSD 1G7IB 2EDLA 4M6OL 4NHUB 3FAWA 2G75A 4I3GA 3EYFB 5FGRA 1BHGA 4PRHE 2R2HA 2W65B 4XNUL 3KGRA 1XFPA 1UYWH 3QHFL 3BZEB 4L8CB 1KELL 2XY1A 4WTZA 5C0NC 1CQYA 5MI0C 4HC1A 3AVEA 4P5MB 1FL6A 2QQQA 4S2SA 1RZ8B 4KVNH 3MJ8B 4XI5D 5D5MA 5EU6B 3SGKC 3TN0D 3BKML 43C9B 1QRNA 1HYSD 3MRDB 2F54A 1H3XA 2JKXA 4WUKH 1S9YB 4MJ5A 4BFIA 3CVHB 3OGCB 5EO0B 1AE6L 4BQ6A 2MSPA 3D9AL 3JTTA 4FQHA 4I18A 3GZKA 4OSUL 3OZ9L 2X41A 4NDMB 5F93C 4PJDE 3RWHA 1GGIH 2DLFL 3RWDA 1PY9A 4HJJH 1CYGA 1OM3L 3ARRA 2EXWD 3V6OA 4RFOH 4WO4A 3JV0A 4Z18A 1HHKA 1MUJA 5HDOA 2DDQH 4KUCD 1K8DB 4WWKA 3C09C 3BOVA 1A1MA 3UYRL 4U1NB 6CGTA 2QQNL 3HUJA 1L0QA 4RMWA 4WJ5A 1XF5A 4LSQL 1FC2D 1CIUA 1K3ZA 3I84A 3LIZL 5L2KB 4HFUL 3VMPA 5C86A 3AY4C 3CPLB 1U42A 2BNQD 5C3LD 9CGTA 3HI1B 4LQFL 4X7FC 3S5LG 3IRZA 4IIQC 1A02N 3MRGA 1NLDL 3VXPA 2A6JA 2OCFD 3PDDA 2ESVD 3OAZK 3O3AA 1PYWB 2QEJA 4WW1A 4O5LL 4KQ3H 5E00B 1CFVH 4U1LB 3E1F1 1RK1A 5LBSL 3QFJD 2XNAB 4XMPH 1HWGB 4D9QE 4OLWL 3V5DA 4HJGA 4QF1B 4GW4B 3N1MC 1C5CH 3P9LB 3AU1A 1CLCA 4JFFA 3VI3F 1QSEA 2NW2A 5E2UH 5I1AB 1MQ8A 3U0WH 2GSGB 1AR2A 4JRXE 1G9NL 1BQUA 3IDXL 5EOTA 4Y4KA 1EO5A 1ZEAH 3T4YB 1NGXA 1P4IH 1WWCA 4OB5L 3QIBC 4H8WH 2BJML 1RUPL 4LCYA 5HHMB 4PS4L 1EZVY 4KAQH 2P8MA 2NPLX 5IVZA 4EUPG 1VESA 2HKFL 4PYHA 3HLAB 3RU8H 2YOCA 1U93B 2A1WH 4OUUA 1I3GL 3PJSA 1Q72L 4O51B 1TCRB 1YPZE 2AJUL 4NN5C 2FX8H 1JMXA 4JFQB 2A73B 2DQTH 1BMGA 5ADPH 1UKTA 3WLWC 1PX4A 2DBJA 1EEYA 3BN9D 4LEXH 4PB9L 3UO1H 3ZSTA 4Z7OE 5DJAA 2CH8A 1TTGA 5HPMA 3H9HB 5C0AB 1CL7H 3QPQC 4QEGA 1UWEL 3WKMH 4C83B 2VC2L 4LAQH 5D7SL 5F9WC 3U9PH 1S8DA 3VXUB 2VITA 4R26H 2FL5A 2AQ1A 4RZCA 1I9JL 4HCRH 4JFDD 1EGJL 3Q6GL 4OLYL 5CWSB 4E41B 1C5BL 1I8MB 2NY4D 3MLZL 1QFPA 5F1NA 3TN0A 3VG9B 1CD1A 5E24E 3L7EB 4KTDH 3CH1B 1JGEB 3VGAB 4NC1C 5KG9A 5DLML 3ZKXB 5F7UA 2DF3A 4U1IB 4OFPA 5CZKA 1GGTA 5IQ9A 4PRID 1V7NL 1UZ8B 4YE4L 4ZD3L 2FB4H 4RAUB 1DN0A 1TZGL 4KJQD 4N1CA 5FKAB 4FQ1L 3RKPA 3IFLH 3G6JB 1NGYB 3S37H 4P4KC 1KN2L 5EOCL 1GC1L 4H26A 3X11B 1MVUB 3HFMH 2AEIT 3GSRB 1CZ8L 5EIIB 3SDDB 2QR0A 5HYSG 5LAXB 2BNQA 3ULVF 4O02H 4X6DA 4WNQB 3VA2C 3MO1A 5HGHA 4KRMB 4L3EB 4XX1E 4PRPB 2FD6H 4HT1H 4W6XB 2ESVA 4PJ9B 1NAMH 1RUMH 3CXHJ 2H32H 2G2RB 3QUXB 3VDAA 4U3CA 1CLOL 3STBA 3QFJA 1N59A 1MI5D 2EC9U 5JPNA 3HAEB 3MGAA 4PG2A 4BSWB 4LNVA 1MF2L 2FX7H 2VZOA 4NBZB 1WTGT 1MHHB 1YEDA 3T1FA 4ZFFA 4YGAB 2WIIA 4PJ7B 4KQ4L 1H15A 2VQ1B 4PJIA 3HZVB 4OZIE 2JJUA 3MNWA 2VSDA 3OKLA 3JVGC 4NQVB 5CMAB 3WXVH 3W11D 2IALB 2N7AA 1RZKH 2F5BH 1KB9K 4J3VA 5CEXA 2X9YA 3PWPE 3GK8H 4WFFE 1K6QH 2AKRB 1IAOB 5TE7H 3VRJA 5EH1A 1KC5L 1JK8B 3SE8L 4Z6AT 1P1ZA 3EDEA 4TSBH 4K94C 2OTUB 3T0XA 4HIIB 5CCKH 1OD9A 2W9LA 4X6CF 4MNQB 4MGXA 4YBHA 4RNRB 2C7UB 5AWNL 2XXCB 1AY1H 3IFPA 4IRSC 3MTRA 4G6KH 1EUTA 1FZKB 3ZHDA 4ORGA 3MUY1 5E70A 2P42B 1Y6KR 5J1AB 1AHWB 3TBTA 4JQIL 2R4RH 3O4LE 3OKEA 1PKQA 4JFDA 1WCQA 1KULA 4CKVX 3PXJA 4YAQA 2HKHH 2H2PD 4NM4L 2MCPH 4XP9H 5H35B 2VLKB 1YQVH 4K3JL 4XCYA 1IQWH 3VFVA 3I6LD 2FJHA 2IAMC 3CSYB 2J7LA 3DI2B 4U6YA 1KJ2A 1QFWH 3LEYL 5A43C 5SWSD 4MWFA 3K2UH 3O3EB 4FTVE 2WP3O 1F5WA 3LH2L 1T6VN 5IWLA 3PWLA 3FTGA 1VEMA 4PRIA 3BGMA 3G6AB 1H3WM 4DVBB 2BVEA 5T1MA 3QCVL 3LN9A 1T66C 3ARPA 3HA0A 3BIAX 1UA6L 4O58H 2X4SA 4WFGE 5E94B 4D9LL 5IR1B 4KMLB 4JO2H 4OCWL 2I07A 3MZTA 1NCBH 4M00A 1MFAH 4PLNC 1R3KB 1ONQA 1J1OL 3TJEL 4YDIL 1FG2A 5IVXF 4PY8I 4IM8A 5DO2C 5IW3A 1MREH 1UH3A 3MRJA 4WUUD 1EA9C 5DMKB 2BNRE 5TDOA 4NOFA 5BV7C 2NTSP 3ARZA 4NCDA 5DR5L 5CZXC 1MVFA 4MB3A 1ZK9A 5J11C 1MJUH 5JPMB 3DX6A 1MI5A 2GFBB 4CGTA 2WUCL 4UDTA 3FONB 3FAXA 5I18H 5C0GA 4YNYB 5FFLA 5E5MA 4DAGH 3MRRB 3KJ6L 2XZAL 1KLFA 4XRCA 4GG8B 1G84A 2VH5L 3V4PL 2V2WA 1H3PH 1S7UB 2FEEL 1BBDH 4S0SD 1OARH 3UBXA 4KFZC 4QXTB 4LU5L 1DE4B 1FVDB 3V6BR 2J6EL 3OHXA 1J1PH 2Y5TA 5F72S 3OJ2C 2ZOLA 3TVMC 1NCCL 2ARWA 3WFCH 1OAZL 3WXWL 3P11L 1YEJH 2OJZL 3C08H 1ADQA 3D25B 3H7BA 4ODXB 1HKLH 5KOMC 1EZVX 3UTQA 1MEXH 5D7KE 1F90L 5CAYB 4Y1AD 2BDNL 4PBWD 3UPAA 4AJ0A 2J12B 3PWVA 1AXSA 2VAAA 2EC8A 4U1HB 3MRBA 4P2RD 3EZ8A 2CLRA 2CUHA 3NGBC 1MJ7H 2VDKL 2A9MH 2GTZA 4YHZL 2YUXA 4U1MB 4HHAA 1B9ZA 5HGBA 3F7QA 4AIXA 3OQ3B 3O3DA 3ZTNL 5BS0D 3FB8B 5GS0H 5J06A 1CICD 1EK3A 4N5ED 4KK5C 2O5XH 3B6SA 1YNLH 2G5BA 4IJ3C 1U58A 1VFAA 4LPTA 3QDAA 1WWBX 4BELD 3FMGL 4Y2OA 12E8H 5T1KD 3SKJH 4OCXL 5DJ6B 5GGRY 3RVTD 4ISVA 5F9OL 3C5ZB 1F11A 4DFHA 4PLJC 4GW1A 3VE0B 2E7HA 2QHLA 3CDGB 5JXAL 2HVJA 3DX9B 1I3VA 2R4SH 2W07A 5C0BB 5HDQL 4FOMA 4A6YA 1EIBA 3EOYG 5E56A 2Z8WC 3KG5A 4GBXB 4R6UA 3QJHA 4OBSA 3F5WA 4AIZA 2RGSA 5DMIL 4RMTA 4QO1A 1SJVA 3NFSL 4QRRB 3PWNB 3GMRB 3VFPA 2BSTB 2XN9E 4BUGA 1FFNB 3BPNC 4YUEH 3HHRB 2X5PA 3UTPE 4HZLA 2DIBA 4PRNB 2FEEI 3L1OL 2IANE 4FQXC 4K2UH 2I9TA 1UJTA 1IT9L 5ESVA 1XF2B 2BY3A 1KLGA 2J8UA 2Q6WB 1BLNA 2UUDH 4YDKL 3HE7D 2VXSL 5E0QA 4HGWB 5IM7B 3JWOC 3VRIB 4WUUA 3ZT6A 5C08B 3IAQA 3IAPA 1G6VK 1I1RA 5C09D 1S7XB 1IGYA 5J9PB 3O8XC 4LIQE 4S1SL 1J18A 1MWAL 3RJDA 1EVUA 2NXZD 5I15H 5CEYB 5EA0L 4YO0B 3DXAE 3FT3B 2APXA 3V7MA 1IGCH 1JTOA 2JJTA 5EZOL 3HRZA 4J12A 4RA0C 4B53A 1MIEH 5SWZB 4K94L 4J1UB 2W0LA 1A1NB 3ARDB 1VA9A 2ICEB 5D70L 5HI3D 4LCUB 3MUZ1 5IW6B 4RFEB 3TO2A 4BFBD 1A3RH 1BQHB 4GUPA 3VWKD 2V5RA 4P4RA 2AJXL 5EFIB 5HHNA 1KTLB 4BH8A 3U0PA 3L95B 1AP2A 4Y1AA 4OQTL 4TTDD 1WLHA 1KJMB 4HULB 3S3JA 3PDOA 4P46B 3RX7A 3ULUC 4M5YL 3UEZA 2IH3B 4HKZA 1F8TL 3V4VL 5CSZA 1JWSA 5LJYH 3MOAL 4ZTPH 4XGZB 1RD6A 1H3UA 5KVFL 1ETZB 2K7QA 5F71A 2V7NA 4GAGL 3N9GH 5BS0A 1N4XL 4OD3L 2W59A 4JQVA 1C08B 4NQDD 5FV2A 4I77L 4NIKB 4C56B 3CLEL 4X6FB 5D1XC 1IEBA 3GMPB 1FL5A 3QULA 1I9RH 3UX9B 5IEHB 5T1KA 3KYNA 1S7WA 1CTNA 1FNLA 2X40A 2HFEA 4XCFH 1Q9OB 2PO6B 1VERA 3WUZA 4OM0L 4OGAC 2I9LB 4JANB 3VFSA 1EEUA 1BEYH 1OGAE 4P2QD 3TYGH 4G42B 1XCTA 3VRLE 1RZIB 2IH1B 3G6JF 1S5HB 4NM8L 2YPLB 2F8VA 1A47A 1A6VH 1UEMA 2P1YA 3V0VB 1P4BH 5AYUH 4PY7B 2GHWB 2B0SL 2ZSVB 2NNAA 4JFPA 2C1PA 5BV7L 2XWBA 3WHXA 3QJFA 4XMKL 2VDOH 2ZCLH 4Q9QH 3ARGC 2PXYC 1RJZA 2K3TA 3HE7A 2CLVB 5J12B 1Q94A 5FM5M 4KHXH 5MEOB 3BESR 4IMKA 1ZT4A 5DK2B 5C09A 1G7LA 1RIHL 5DJ2B 5C0JA 5EZIL 1JNLL 5KN5A 4IMLA 1JHTB 2LU7A 1T80A 2J8HA 3V5KB 1HHGB 1GZPA 3DRTA 4PJ7F 4B5EA 3VDBA 3V5HB 2FATH 4JFHD 3L3JA 1QSFB 1Q9WA 1MCHA 2H3NB 2ZP0T 4JGMA 4ZSOB 3UAJD 3HNVH 4XVJH 3VWKA 3BDYH 4LHUG 1FP5A 2B5IB 2B4CC 3D85D 3LRHA 3GB7A 5CIPH 4HWEH 2XKSA 5HHQA 1HEZB 4GW5B 2O61B 4J3SA 5B8CB 2YSSB 4TVPD 5C0CD 4U7KA 3E8UL 3AREC 1IBGH 3GJEA 4RFNB 3OKNA 4MJ6B 1YMHB 4M7KH 5DC9B 3RIAK 2CKNA 3G04A 4Y8DC 5A3ID 5LWYL 2EECA 5DRWB 5FGBA 3FKUS 4W81A 3CXDH 2ED7A 4FP8H 1M6OB 1QO3A 3OX8A 1MRDL 3ARFA 4HIXL 3FO2B 5BMFL 4AK1A 3IGAB 4ZFOB 2DBLL 4UQ3A 4NQDA 2DIJA 3QCTL 2DKSA 1EEZB 3RHWK 2AJZA 2C3GA 4GQ9H 3QUMA 1JRHH 1YUHB 1JF6A 2VL5B 1T04A 5E5RB 1YEEL 1EEQA 2VE6A 4K23L 1KB5B 1HILA 2BVPA 1KYOK 1NCTA 4L4VB 4N0UA 4G6ML 4U31A 4HD9A 3UTTD 3F65A 4Y16B 4CUCA 3C2AL 5CKGA 3MGTA 4NRZB 2YD2A 3QCUL 5IMOB 4RA3A 3MV7B 4GKNB 4P2QA 3QB7C 2V5TA 5HYJB 4KMQA 1UZ6F 3R0NA 4LIQH 3BH9A 2QKIA 1GZQB 4HUWB 2X1OA 2VDQH 2ATKB 3FQXB 2OS7A 4XBPB 1EO8H 3RWFA 3DUUB 3P9MB 3EYSH 4XNYL 1A7PL 1TNMA 3SDXB 2ZUXA 4X98B 2LE9A 4RMRA 3OKDB 3MYJB 3ZTJH 2QSVA 4J3OC 4BFEA 3EBAA 5F9WB 4M62L 4DZ8A 5FV1L 2FEDD 1NAMB 5DJXB 4OLXL 2GYSA 4I9WE 5C70A 4HUNB 1D6VL 4KK8C 4KUZH 3CU7A 5I75B 1KBGH 2Z35B 4JG0H 4FQJH 1UM5H 3MRHB 2ICES 4LK4A 4KDVA 4WDIB 2GITB 1CQKA 2RHEA 2BFVH 1JZ8A 1OPGH 5KS9E 2NY6D 3VGBA 3ROOA 4G5ZL 2Q8AH 3TBWA 3GIVB 2YPKA 5IIEB 1A6UH 1LK2B 3O2WL 2JCCE 3OR6B 5ESAB 4RWYL 5FOBB 4NUJB 4I4WA 4WRLA 3CC5A 2MHAA 4JFEB 4HLJA 3JWDC 3IJYB 3ULUL 3QH3B 1MNUH 4PRHB 5DEZA 4P3CL 3ZT5A 3GKWL 3CSPA 3VD4A 4TSCL 4I18C 1LEGA 3GI9H 5GRXG 1A6WL 1QBAA 5F8RC 1UM4H 2A38A 3CDCA 4YIQB 3M45A 4OZGE 1UEYA 1CGUA 5CP3A 2FHBA 3G5VB 2OJEA 3DOSA 5C0CA 3V6OC 4P57B 5ISZB 4WO4C 7FABL 3BW9A 4N9GA 1SBSL 4UIKH 2X4TA 3MRKB 3QUYB 5TFSL 4XHJC 1QEWA 1XZ0B 4WWKC 4CMMA 3G5XA 5EC1A 1I7TA 3BQUB 3QG6B 1HZHL 4KI5C 4PJDB 4Z78A 2VKXA 2XZQL 4APQB 4YPGB 3EO0A 4HQQL 4X8JB 3MJ7B 3BWAB 4KVCL 2PR4L 5DFTA 2C3WA 5DZNA 2CKBH 3QEQB 4XTRD 4KY1L 5KSBA 5IF0A 1Z6JT 4NZDA 1I9EA 4JPWL 2ADGA 3WN5C 4GG6E 2KH2B 3SJVD 4M7ZB 4QXGH 1DBJL 4ZAKD 5IOPB 3QDMD 1B4JH 2J2ZA 3IRPX 5CD3B 1LO4L 3MRFA 5CUSH 2GKIA 3MV8D 1TQCB 1ZA3B 3ROLA 4EEEA 3LEVL 1JHLL 4WWID 1DQML 2GJZA 3HS0B 5EWIL 4PGDA 2PYFB 3DVGA 2EE9A 3HMXL 1BPVA 3ARSA 1TETL 2EH7H 4Y4KC 4OZFA 3RJQB 1SEQH 4QCIB 3ES6B 3REWB 1QR1A 3ZE1F 4Y5YC 1O0VA 3GMQA 3OKYA 3V2AR 2HVKB 4JB9H 1MAJA 1P53A 1ZHLA 3BP5A 5L9DL 5EOQH 2FIRT 2JB6A 2H1PL 1N64L 2H26A 5IB1A 4IRJB 2DN7A 3QO1A 1MRCH 3LV3B 3MXVL 1P4LA 4K8RH 5M95B 3RDTB 4OIIL 5GGRB 4AEHL 1IGTB 1ORQB 4HF5L 3AS2A 3NAAH 5FYJD 2ADFL 2DQJL 4M6OH 4JJ5B 1NCNA 4Z7VF 5EOCJ 1OTSC 1T03L 3IJSA 4JKMA 4PV9B 3X3GL 1YPZB 1OP5H 3HR5B 4R4BB 4K7PH 4CN6A 1HSAB 1G7PB 1GGUA 1KELH 1AIFB 3L3OA 5D2LB 2P7TA 4LARH 4KXZI 1OW0A 3QHTC 3BKMH 3GSVB 2B4CL 5I2IA 1QOKA 2FLBT 3IVKA 2D4DA 3TN0C 5MP6L 1HYSC 4Q97A 1CLZL 32C2B 2GTWB 2JLLA 2X4NB 4M03A 4BSVB 1G6RL 4U4BA 1PEWA 1PLGH 2A6DB 1KNOA 4WU5A 3RTQA 4MXVF 2ITDA 4OTXL 1ED3B 5JORA 4N8CL 1ZGLM 2OR7A 1MCWM 2HWZL 3IT8D 4HIHA 3MLTB 1KCKA 4W68A 5B21A 1U3JA 4R2GB 4U49A 3P30H 4UOJA 2EKSA 4GS7C 2V7HA 3EOBA 1WBZB 4PY8J 4R97B 5I1LB 1XIWC 2H2SC 4Y2DC 4CAGA 1UCTA 1X7QA 2DI7A 3NA9L 2BSSB 2CSPA 1QKZL 2EDOA 1KJVB 4ETQB 5ETUA 3OBAA 1S9XA 4R4FL 4RCAA 4P2OB 3CZFB 3R06B 2E8ZA 3D69A 3PL6D 4UTAL 3BPOC 5CHNA 4ZFZB 4EQ2A 5ALBL 3K3QA 2DI8A 3VFRB 2GCYA 3BSZL 3Q5OA 1SEBB 2M2DA 2APWA 4H1LB 5GIRA 3SJVA 1NCAH 5LBSH 4K9EH 3DO7B 1V8HA 2AXJA 4ZAKA 4W4NA 3QDMA 4ONHA 2QQKH 4MSWA 2XFXA 5FM4A 4QRUA 3RL2B 3QHZL 1UXWB 3MV8A 5DURB 3TCLB 1FO0H 3UJJH 4LPWA 1IAIL 3ESVF 1TJGL 4PGCA 4PG2C 5DFVD 1G9NH 1XGYL 5C9KA 3CD4A 3IDXH 3O6MH 3KPRE 4K7PY 2UVEA 3FFDA 1OAXL 4CN1A 3QIWB 3I85A 4G9DA 5JA9A 3DVNA 4Y5XC 3LSOB 5E2TL 3PWUA 4DKEL 2V5SA 4XPGL 1I3GH 2AJUH 2B8OT 5I66A 1VGKA 4JDTL 1INEH 4OF5A 3T0ED 5DUML 3MCLL 1MCJA 1NFIA 4M48L 1DANT 1A6AB 5ICXA 3PWPB 3QDGE 4PPTA 3BN9C 3IFOA 2DQFA 1NKRA 3VXMD 4PV8A 3I3BA 2E27L 1YEIH 1IC7L 2VC2H 5D7SH 1XF4B 4HC1L 1QYGH 3ZYJA 3VDCA 4ODWB 3JWDL 1PVHA 4R0LB 1I9JH 3MCG1 1WFOA 1ES0B 1A7OH 1OAYL 3KPSD 1UG9A 1JZ5A 4R7DA 4PTTA 3AMLA 5TGBB 2NY3D 4UZGA 4QYOA 1XGTB 1A9EB 2NY4C 4RX4D 1CXKA 3WUWA 3WFDL 4RRPA 1GOFA 5DK0A 1S9WA 5F9JA 2BVQB 2DRUA 5D93B 1D6EB 4R3SA 5LCVL 5E9DE 1K2DB 4YEEA 5I1CL 1V7NH 2MJWA 4ZD3H 5IWLC 1TZGH 2HP4A 1ROWA 3UC0H 3WFBL 3D0LB 1PQZA 3QQ3B 3C60D 3GFUA 4KJQC 5TF1H 3WS3B 1KN2H 5IG7A 4JREB 4TNVF 5EOCH 5FHBL 4JGJA 1NBZB 3E6HA 3GSQA 4V2BA 4FTVB 5A2JH 5D7JD 4MA1B 4MA3A 1N6UA 1IAII 2WBJD 2Y07L 3Q1SL 3A0OA 4Q2ZA 2HT2D 3WNMA 4OLVL 2XKUA 5JW4M 3PL6A 4U1JB 2X7LA 2EDEA 4NC2B 1AR1D 2P49B 4J6RL 4XP1H 3MCKA 1CLOH 2ZNXA 4NQEB 3KAAA 5BQ7B 1JYXA 1QBBA 1CE6A 3F7VA 2GJJA 3DSNA 1VFOA 4X7CC 5F1IA 1EJOL 4LSSH 1KV3A 4KQ4H 4XMLL 1U8OB 3CGTA 3FHAA 4MCZA 4G8IB 3MMEB 4P2RE 5FYKL 5HHXH 4TN9A 3QWOA 4MD5B 2JTDA 5IB4A 3X12A 4A2MA 4I48A 2WWKT 3W11C 1MCKA 1DVFB 3MA7A 1C1EH 3SE8H 5DEGB 1CDJA 4WTZG 1JN6B 4MHHG 4JZNB 5ENWA 1X5FA 4OQ1A 4Z77A 1ND0A 5E08L 3WO4C 3QEGH 4HIEB 1QLFA 4N1HB 4DN4H 1EHLL 1LK3H 1TJIL 3O2DA 4PR5A 1A7NH 3WD5H 2IGFL 3U30B 4UI2A 3T0EA 4PJFE 5CS7A 1YYMH 4OD2B 3QR2A 5T33H 1UCBL 4M43L 2W92A 5JHDD 3DSFL 3SY0B 3UMTA 5GHWL 4L9LB 1S7VA 3I9GL 3VXMA 4JY6A 1E4WL 4G3YL 1RUQH 4PGZA 1NEZA 3VH8B 3RNQA 3PHQA 3O11A 3LQMA 3I6KB 1GSMA 2HJKB 1UQSB 2XG4A 1A6PA 3QDJD 4L9DA 3B5TA 4ZUUB 1TZHB 3KPSA 4NJ9L 5KTEL 2VLLB 2X1XR 4B7LA 1UACH 2ZNWA 4OCYL 2D9QB 4EI5D 4ZODA 3U0TB 1R0AL 1XGPA 4K3JH 4LSPL 1BF8A 4P9HH 2H2PC 3N85L 1FL3A 4RX4A 5T3XE 1PY4A 4X4ME 4TULL 4NYLA 1N7ML 4YHOL 2HLAB 5I1JL 1BREA 3TP4A 1V7ML 2Y7QA 5MHSD 3FRUA 3S3SA 4L3CB 1A1OB 2V9QA 1UA6H 5IB3A 1J87A 3C60A 4M1CC 4GOSA 3S36L 4D9LH 2IPTH 2NZ9C 3EYOB 4BZ1H 1LD9A 3ZHLA 4O2EB 1G7MA 1N2RA 2AABH 5KVGH 4HH9B 2AXHA 4PJDF 2WK2A 3TJEH 4XCNA 5AD0B 5D7JA 5EO9A 4F2MB 3H3PH 2WBJA 2E5EA 4X6CA 1G0DA 3HG1E 4FQCL 4JDVB 5B39A 4MJID 2AEPH 1A64A 2VXTL 2XZCH 4HK0A 2C3XA 4P3DB 5DSCA 3F58H 5TQ0H 3BRDA 1YYLL 5DA0B 4O2CB 5E1HB 2XN9B 1ZA6A 4NO3B 5ERWB 5JW5A 3PQYD 3WL9A 1VEOA 3KPOB 2NXYD 4QY8A 3UPCA 4Q6IA 1KIQA 2IANB 2WINA 3SO3C 3R1GL 3O4OC 2VH5H 3MRMB 3V4PH 5CJOH 5EPMA 1YY8B 4XBGB 3U6RA 3H9SD 2JJTC 4AG4H 3UTZB 4JPKH 4LU5H 2J6EH 4K7PX 1KN4H 4MB4A 4QXWA 2HJLA 1OAZH 3KNBA 4EXPX 5EUKB 1K9TA 5I8CB 4E0RA 1FYTD 3CSGA 2X4RB 4GRWE 5BRZA 3VCLB 3GSWA 4AEFA 5BJTB 4LCWE 3QWQB 3B4NA 1T0NA 4X6EB 5C0IB 2DM4A 4IRZH 2R2BA 1JV5B 2BDNH 5CBAB 1ZLUH 1SVZA 4QT5B 4DEPC 1HOCB 3TBYA 2CRMA 4XP5L 2OL3A 1VB9A 1NAKL 3L3HB 5JHDA 1GPOL 1IC5H 1Q0YL 5E6ID 3GJFK 3QFDA 3BJLA 3FQWB 1DZBA 1FLRL 3QNZA 3JUYA 3MRQA 1WIPA 5L2KD 1CT8B 2VLJE 3FQUB 3NCCB 3H0TA 1YPZF 3G08A 3ZTNH 2FIKA 5IVXA 4XNQB 1KENL 3GHEL 4HXAL 1DBKH 1GOHA 2R1YA 3LMJL 3OAYH 5LGHH 2BVTA 3HZYA 2DTSA 4Z7OF 2CR6A 4EDXB 1KJ2L 4PJEE 5SX4I 2ZSWB 5DJDA 3FMGH 1FFPB 1KPUA 4EI5A 3MLWH 5JOFA 1PX3A 4OCXH 2OX5A 4ELME 1U36A 3V9FA 1A5FH 2BOCA 4R4ND 3D0VA 3GHBH 5CBEB 2W9EL 2R29L 3O6FB 3MNVA 2F74B 2E6JA 3TESA 1HXYA 5MERA 3O9WC 3OL2A 5JXAH 2BK8A 5HDQH 1B0RA 1BX2B 2AQ2A 3P4NA 1KPVB 1CGYA 3TPUB 4ZUTA 5T5FH 4ZUVB 3TZVB 5HHMD 4MCYA 3NFSH 3U9UB 5DD6A 1F00I 1DDHA 1NC4B 5ID1A 1FRGL 4K55A 3PHOB 4JPVH 4CVWA 5H8DA 4PJXE 4JY4B 1S7QB 5M7QA 4L5FH 1ZKAA 3NZ8A 3RGVB 2CQVA 2KDGA 1IT9H 5FKPB 2VLME 1HHHB 4MJIA 2AI0H 2DL2A 4NT6A 2CKBB 5TQ2H 2VXSH 4RDQF 1UB5A 4NUGL 3HE7C 2R2HB 4BK4A 4IDJL 3EHBD 3KDMA 3LQAC 3PQYA 4YFLF 5JQ6H 4IMKC 4S1SH 3EYFA 1S5IL 4UINH 4S2SB 4L8CA 1A6ZB 2NXZC 4TVPE 5D5MB 1U8KB 4E41D 4F7EB 3REVB 4P5MA 1S7RB 3OR7B 3WJLA 1RZ8A 3MJ8A 1ADQL 3H9SA 4JN1L 43C9A 3MRDA 1KCSL 4FQHB 5HD8D 1S9YA 3CVHA 4M1GL 4OF7A 3L3DB 3O45A 3RWHB 4G8FB 1WBXA 2IFFH 5HI3C 1RFDL 1DLFL 4NDMA 1NFDE 1FYTA 3E2HB 4FQ2L 4FZEL 4YHPA 4WO4B 3TIDA 2AJXH 4HPOL 3VWKC 4OZIF 1GCFA 4DKAA 1ZE3C 1XF5B 4TTDC 3T8XB 5TH2A 3V4VH 3MOAH 4U1NA 1DQQA 5T3XH 5DT1L 5E6IA 4NFBA 2R0WL 1IKNC 4HMCA 3UTTE 2CLZA 3M07A 3P2TA 5KVEH 1U8IA 2F19L 3DGGA 5KVFH 3SDDD 5L2KA 3CPLA 2RFXA 3OKOB 2Z8VC 3S35X 3HI1A 1N4XH 4WW1B 3ARFC 4L3ED 4PRPD 1ZVSB 4I77H 4YZFE 2PTTB 1YZZA 2FJFB 2F5AL 5HI4C 4PJ9D 2Y36L 4LEOB 1PYWA 3H6JA 5E00A 4CADB 5ALCL 4U1LA 5IHZB 2X1WL 3QUXD 3TBSA 3VXNB 4KJYB 5A2KH 2NR6D 2XNAA 3BPLB 4QF1A 3SQOL 4GW4A 1F4XL 3P9LA 3TIEB 1GAFL 4BQ9A 1ZOXA 4A6YL 1INDL 4XPTH 5EOTB 3NCJL 4KKBD 3HCVB 5LVEA 3MOBL 3JV6B 4UAOC 4KHTH 3CX5J 2C5DC 1IGIL 4KMTL 3SOBL 4Q9RH 2A6KB 3T4YA 1S3KH 2W1NA 4JQXC 3BHBA 3IDGB 4P5TB 1WGOA 2VDNH 5IESL 1NEUA 5E8DH 3HLAA 2BXYA 1U93A 3MLVH 3OAUL 3UBXI 1AQDB 4O51A 5D96B 1EBPA 1V3MA 2BVOB 2UWEE 3TNNB 4NNXA 5BV7H 4Q0XL 5HSFA 1BFVH 2F9BT 4JFQA 3RY6A 5I1GH 5DJAB 4AL8H 4MNQD 1NCDH 2MPAH 5DC0A 3LY6A 4N0FB 2VXVL 4MLIA 4QHNA 1IJ9A 1WZ1L 5DVLA 4FS0A 2OTPA 5EIQA 2ZUWA 1S8DB 4R9HA 3RWGB 2CRYA 2VITB 4GRWH 4NFDA 1MCFA 1TFHA 2FL5B 2R69H 1T5XB 1FNGA 5GGVH 4C83A 1RIHH 3KPQB 4R7NB 1W2KT 5BO1L 3VXUA 4F57L 3NN8B 2F8OA 1OTTD 4IHOA 2HMID 3LD8B 4YX2H 1TITA 3MLSL 2R0KL 1MJJA 1B90A 5CWSA 4E41A 1Y0LA 3QUKA 3VG0L 3BYYA 1MLBB 4K71C 2VLKD 1IM9D 3MNZB 4XCCH 1JGEA 5IQ9B 2HG5B 2P5WE 3BN3B 3V0WH 4U1IA 4AT6A 1KSRA 1V3KA 3LS5H 3UAJC 1F97A 3BX7C 5GRJL 1UZ8A 5F21B 5FUOL 4RAUA 5ACZB 2WMPA 1V05A 3QO0A 2DTML 1A8JH 5FKAA 3ARXA 3G6JA 1NGYA 4HZAA 4MYWB 3CK0L 4JCMA 3KJ4B 4CL7A 1QVOA 3EGSA 3TLRA 2QR0B 3JV5A 3X11A 4MJ4A 1PFCA 3O41B 1KLUB 3MO1B 5A3IC 4OV6F 3SDDA 1XAUA 5CLTA 3OAZH 4YDLB 3KYMB 4WNQA 1EFXB 4OZGB 5IHBA 2FR4B 4L3EA 4PRPA 4PJ9A 3PDGA 3QYCA 2XZZA 1G7JA 5DDHB 4RAHA 5JPNB 1SYSA 3QUXA 1R3IL 1YEEH 3CMOH 3NOIA 4P9MH 4ACPA 1GGCL 1YEDB 2WIIB 1MIML 3HAEA 4FFVD 1H15B 2D7OA 5IROA 5GGVY 3C2AH 4G6JL 3MNWB 4WENB 1CDIA 1MHHA 3QCUH 1TQBC 1JVKA 1GL4B 4JKPL 4PJ7A 2D7QA 3FN0L 4P59H 2ZCKH 5HHOD 5CEXB 4NQVA 5CMAA 1WQVT 2IALA 4LSVL 3INUL 5F3HB 3ABZA 1J12A 4XBEL 3TT3H 1IAOA 4XC1H 1JK8A 3JWOH 4XNYH 5F44A 2OTUA 4HIIA 1L0YA 5SV3A 1QFHA 1A7BA 3TJHD 1BVKB 4MNQA 3LQAL 3MQIA 3CXHK 4M1DL 2C7UA 1BBJB 5TDNB 1SHMA 2G60H 4NO0B 1ZANH 3P40A 3GBLA 3WS6A 1IGFL 1FZKA 2DQEH 1C12B 1W0VB 1UM6L 4S1DD 5GISL 3U7AA 1JF5A 4BUHA 5J1AA 3EUUA 4LSDA 4JFDB 1AHWA 5JTWA 4XPAL 4YAQB 3AAZB 3T2OA 2YHGA 3EYVB 4MA8H 4RWYH 3VFVB 5I6XC 1MOEA 1QFWM 4U6YB 1VFUA 5H35A 5LQBH 4MWFB 2VLKA 1OW0C 1LE9B 2BHYA 3S4SB 2LVCA 4X7SH 5B22A 1BQSA 4XH2B 3C5ZD 5J3HD 2EEDA 4ZPVB 5EB9A 1KJ3H 3O3EA 3TA3D 4M6ML 5T1MB 4NN7C 4TSCH 1X5IA 4HKBA 5D7LE 5EULV 5C0BD 2NX5E 4DVBA 1PG7W 4WTXA 3RTQC 1M7IA 3GBML 1UH2A 1YC7A 5JHLL 1LP9E 1MCWW 4YXLH 1W0WB 4KXZH 7FABH 5E94A 4I8DA 3JXAA 4QRRD 1D5ZB 1LO0H 1SBSH 2JIXB 2AXFB 5DUPL 1TLKA 1R3KA 2YZ1A 4U3XA 2C3HA 4C59B 2H6PA 2OXGA 2H8PA 1MCCA 2ZKHH 3V6OE 1HDMB 3QUML 1YA5A 3I50L 5I0DA 2MTPA 5GGTH 5TDOB 2UUDK 4KY1H 4KI5E 1HIML 2Q8BL 3AM8A 5DMKA 4JPWH 3Q2CA 5K9OB 3VW3H 4OAWB 5JPMA 5E5MB 2GFBA 4DW2L 3BE1L 4OT1H 4ZAKC 3FONA 3FL7A 4YNYA 3LEVH 4M7JL 3MRRA 1JHLH 3UBXB 4GG8A 3IF1B 4HS3B 1S7UA 3M1BB 1JBJA 2CUIA 2Y5TB 3DHMA 4CVZB 3BZ4B 3RY4A 2D7TL 5JW4R 1NGQL 4QXTA 5IV2B 1DE4A 1V3LA 1FVDA 2DQIL 3H7BB 3TBVB 3E3QE 3FT2B 2EEAA 3D3VE 4LVNB 5EZLA 3SKUD 2RB8A 3D25A 1A7RL 1A7QL 4NGHL 3LHPL 4ODXA 1A9BB 3DBXB 3HC0B 1N64H 1U2CA 2OTWB 1MCNA 2Z92A 5I9QB 4DK6A 2ITCA 4P46D 2ZOKB 3GSXB 1ITCA 3Q6FB 2W60B 1NCWL 5HJ3A 2CLRB 3VRLF 3FT4A 3MXVH 1MFDL 4NKIL 2JE8A 1P2CB 4U1HA 4A2LA 4ODSL 4OIIH 5IHLB 2A0LC 1KEGL 4HF5H 2ZPKL 4X5WB 3O3DB 4NQXA 5DQDL 4ENED 1T03H 5ILTH 4YHYC 3X3GH 3EJJX 4NKMB 3HC3H 3VI4E 3FB8A 1SJHB 2QSCH 3LKQB 3CFCH 3NBNA 5DQJB 2A9NH 2APVA 1JI1A 1JGDB 3QDGB 2B4CH 2DB8A 5SWSB 1F11B 5DJ6A 5MP6H 1CLZH 3C5ZA 5FF6B 1RZGB 4Y19E 2Z4QA 3TA3A 3OSKA 4A6YB 3OJVC 2Q7YB 3VE0A 4JHBA 3CDGA 4OTXH 3DX9A 4Z7WE 5DHVH 3QWRD 3DX7B 5C0BA 1JI2A 4I2XE 3WBDA 3VGGA 3QG7H 3I6GB 2BCKA 2LTQB 4J2XA 1G0YR 5B4MD 4UILL 4P23B 1KCRL 1ZLSL 1QA9B 5AG9A 2W0FB 4QRRA 5I1EL 2HA1A 3PWNA 3GMRA 5IKCB 1JGUH 2BSTA 4JZOB 4D9RE 2DQGL 1FFNA 2I9TB 5E2VL 1J0ZA 2MQ0A 4MMZC 3NA9H 5A2IH 1AKJD 5L7XH 3V6FB 4PRNA 3LPGA 5KAQG 2ZCHH 1EO7A 1N26A 4M6NH 4YQXH 5GZOD 3PGFL 1PDKA 4PTUB 5ALBH 2GSIA 5EC2B 3VRIA 5IM7A 3L3IB 3PV6B 4KKLC 5CSBA 3D87B 2YKLL 1L0XA 4Z7VA 1A14H 4XP6L 1BOGB 4J4PA 4YO0A 4ELKB 3FQNB 3FT3A 3W5MA 2DJ4A 2CGRH 1H3VA 3VXQB 1XGYH 1FORH 5SWZA 4HAFA 3UCRA 4J1UA 1A1NA 3ARDA 2XRAL 5DFVC 1T1XB 3MV9D 2WLYA 2VLRE 1IFHH 2A77H 5IW6A 4RFEA 4PJBE 1N5AB 5E2TH 3U0PB 3IDMB 2EZ0C 1DFBH 4XPGH 2LVEA 5EFIA 3B9DA 1WC7A 3QDJE 2PKDA 4UNTA 4XVTL 1I8LA 4F7MA 3L95A 3U2SA 1A2YB 1Q1JL 1KJMA 5CSZB 4C4KT 4P46A 4P2RB 4AY0A 4WTWA 4N90E 2WBWB 3QXTA 3T0EC 4M48H 3RI5F 4KPHL 2H9GB 1MJ8L 2LFGA 4XGZA 1BD2D 4HX1A 5BS0B 4E5XA 1ETZA 1CICB 2EH8H 4HC1H 3NA4A 2VIRB 3VFGH 3BP7A 2X44D 1FBIL 3PP4H 3JWDH 2AP2A 1FL5B 1C08A 3ULVC 1OAYH 3WO3B 4HWBH 4X6FA 1UB6A 4ORZC 1S7WB 3GMPA 3TYFB 3BP6A 1BIIB 3CDFA 3ARTA 5HYQB 1IEHA 3A6BH 5HGDB 4NJAH 2NY3C 5GJTL 1QNZL 4Y16D 1Q9OA 2PO6A 3VFSB 1X5LA 1IRAY 3S34L 1NMBH 3CZJA 2I9LA 5KS9F 4H20L 3FO1B 3QWRA 4JANA 1QLEH 2CO7B 4G42A 2JCCF 2KZ1B 1B6UA 5DQ9B 2IH1A 2NYYC 1CDYA 4R8WL 3Q48A 3UP1A 1REIA 1GJIA 5FHBH 2XWBB 5JUEL 3L3KB 3NPSC 3KPTA 2ZSVA 4KZDH 2Y07H 1AKJA 3Q1SH 5D7JC 3DRQB 1GGBL 1Q94B 3NCBB 4OZGF 3MACH 4L8DB 1KTDB 2HT2C 1KEMH 3QI9D 5EBLB 2F58L 5HVHB 4OIBA 1RPQA 2FGWL 3RNKA 2FWOB 4OLZL 5DK2A 4UV4L 4U2ZA 5C6TH 1FVCB 3QUZD 5DJ2A 4FMFA 2YPVH 1DBAL 3DRTB 1RJLB 1JHTA 2Y23A 3VD5A 4Q6IC 3V5KA 1HHGA 3L3JB 1JPTL 2J88H 2E7LA 3WNLA 3TWCH 4CU6A 3V5HA 3KLAB 1FAKT 3G5YB 5FYKH 1QSFA 4BZ2H 2D31B 3MV9A 3JTSB 3DMMB 2BMKB 2DD8L 4GRLC 4GG6F 2H3NA 4XWGL 2IPKB 3VFWB 1NMCB 4EVNA 3BT2L 4PRHD 3U1SH 4O00A 1RUAL 3V0AC 1VEPA 4YXHH 1WVZA 2I5YL 1TJIH 4UT9H 2ERJC 2BY0A 1HEZA 4GW5A 3OKNB 5B8CA 2YSSA 4KROB 2DL9A 4PLKD 5FYJL 2HH0H 4Z0XA 3MSPA 1UCBH 4MAUH 4M4PA 4LLYA 5HVFB 3VFMA 3DSFH 3QUYD 4MJ6A 5HYEA 1YMHA 4HLZG 1Z0NA 1QO3B 3BQUD 3BGFB 4Z7UE 5DRWA 1I1FB 4GRWB 4LCWB 3V4UH 1M6OA 4APQD 3FO2A 2EYTB 2L4OA 4MNGB 1SMAA 5JDSB 4ZFOA 1FPTL 4HCRA 5EG6C 1EEZA 4Q7DA 1P9MA 1OGTA 4NJ9H 5BVJA 3E0GA 3IFNL 1HILB 5DRZB 1YUHA 2VL5A 1R3JB 1F4WH 4TYUA 5SWQB 1R0AH 1GH7A 2YA0A 2ED9A 2HJFA 1KB5A 1B3JA 1NBVL 4L4VA 4Y16A 1N7MH 4YHOH 4NRZA 1T7ZA 2FYYB 3QXAA 5KSAD 3GEWB 4D94A 2FJGB 3FRPA 2EICA 4LVOC 3MPCA 1C5DB 1V7MH 2VAJA 3MRPA 4GKNA 3TH4T 1DLHB 4F8QA 4PJEB 3MFFB 5AYQA 2YBRB 1CWVA 3S36H 4MB5A 4MQXD 4D9QD 5SX4H 4U1KB 4ELMB 4HUWA 3O2VL 2ATKA 3FQXA 4XBPA 4BK5A 1FNFA 4DGIL 4NKOB 1G7HB 3QXDB 1Z2KA 3D18A 5KANI 3AC0A 3CDYA 4IRJD 5KANG 4X98A 1LNUA 4JRXD 4NZRL 3OKDA 2X89A 3MYJA 1I1AB 1QPXA 4MAYB 2VXTH 2DYPB 1I75A 4WU7B 3QI9A 1NAMA 3RDTD 5DJXA 3SPVB 5GRUH 4N0YL 1YYLH 1E28B 3EDDA 1BVLB 3RA7L 2GQHA 5F7EL 3NVQA 4PRAB 3VXSE 5ICYB 1FE8L 2OMBA 2Z35A 4PJXB 3BFOA 4KZEL 3OKMA 1OP5K 3MRHA 5DS8A 4JN2B 4EKXA 4WDIA 1Z0MA 2WM0A 4HKXB 4IS6B 5BZWB 3TBWB 3B43A 1DANU 1ACZA 3R1GH 1NLBH 2FBOJ 4HK3N 3GIVA 1YN7A 1UWGL 5IIEA 2L0DA 1LK2A 3OR6A 4OLUL 5ESAA 1IAMA 4CVUA 1YEHL 3P4MB 2OR9L 1Z3GH 2NMSA 3IJYA 2BXZA 3QH3A 4PRHA 3O2DL 3D85B 5BZDB 3MLUL 4LCCA 1WIOA 3SDYH 2Y72A 4KTEL 2OJEB 1CLYL 3EYQD 5C0CB 1FN4B 5I71B 1D5IL 1D3CA 2AQ3A 4G7YL 3G5VA 4R2GD 5TE4H 5EC1B 4G6AD 1FG9C 4TQEL 5C6PB 4Z8FL 5DEFB 4Z78B 2E6PA 2X2YA 3QUYA 3SE3A 1XZ0A 5C2UB 3ULVL 1HH9B 1FLRH 4N8VG 3FOLA 4AMKH 2FHCA 3BQUA 4PJDA 1VADA 3DIFB 1NFDB 3A6OA 4APQA 4YPGA 4P2OD 3MJ7A 3BWAA 5DJYA 3GHEH 5F9AC 4MZ2A 2X1PA 4K3DL 3OF6D 3QZWB 2YRZA 4I13B 4XNZB 3UTTB 4ZUSB 5JLZA 1Q0XH 2XA8L 5J4MA 1IC4H 1RURL 3ROLB 1T22B 3O6LL 1U8MB 3NCMA 5CD3A 4OFDA 2W9EH 4M8VA 2R29H 4TOYH 5DURD 3ZKSD 3MC0A 1HCVA 3QEHB 4NWUH 4QHLB 5KSAA 4GMSL 4YHIB 4UT7L 4OZFB 1RAMA 1YN6B 1IGMH 1XGRB 2OK0L 1NUDA 1QR1B 5HYFA 3QIWD 1OF2A 2DQDL 4Q9BA 1A6TB 1JZ6A 3KLHC 4DN3H 4QCIA 3ES6A 1EMTH 3CLFH 4D0CA 3DUSB 3N0PB 2HVKA 3GNML 4L3AA 1W72H 1HQRA 4QXUH 5I19L 2XT1B 3BD3A 3QDHA 2VYRE 4IRJA 5JOPE 2VL4A 4B41A 4JRXA 5ID0B 1AQKL 2ARJB 3RY6C 3WIHH 1F3JA 1SY6A 4UT6L 3LV3A 3P73B 1VACB 3PWPD 3RDTA 4WFFD 2AGJL 4NUGH 1IGTA 1F6FB 1ORQA 1TVBB 3IJSB 1IEAB 2J5LB 1RZFH 4S10A 4JJ5A 3A67H 1FH5L 4LPVA 4PV9A 3EHBC 2UWEB 1YPZA 2D3VA 3HR5A 4RGMB 1YNTA 2NY6B 3HZMB 4R4BA 5HDBE 1HSAA 1G7PA 5GGSA 4OUOA 2XICA 5D72H 5FYLE 5K9QI 5I2IB 4ODHL 3EYUH 4S1RL 1OB1B 1UC6A 1ADQH 2BSRB 2P43B 5EU5A 3GSVA 1KCSH 1N6QH 1GHFL 3RVVC 4M1GH 4GKOA 2EDRA 4J3UA 3SE9H 3VG9C 1FFRA 32C2A 5HD8C 2GTWA 2R56L 2X4NA 4BSVA 4TPRL 2ITDB 5JORB 4POYA 3VGAC 4HIHB 2A6DA 4FQ2H 3O4LD 3ZKXC 4L8BB 4HPYH 1PG7H 2A83A 1ED3A 1OCWL 3SBWA 2OL3L 2EKSB 2ENSA 1DQDL 1U6AH 3MLTA 4I3SL 2CDGA 4U6TA 3MLYL 1WBZA 4ZTOL 3T0AA 4RGNE 1KTRL 2GK2A 3WLBA 2R0WH 2P5WB 3CCHA 1BZ7B 1RV6X 1R5WA 1S9XB 4FTVD 4O9HL 1KJVA 4ETQA 5CHNB 4P2OA 3SDDC 5HHOE 3L5HA 3CZFA 5C2BH 3HPJB 1H3TA 4PJFF 2F5AH 5GIRB 3SJVB 2B2XL 1I7RB 3ECBB 3VFRA 1O7VA 3OF6A 2GI7A 1SEBA 4H1LA 4PJ9C 4O2FB 4KRPB 3MV8B 2YUWA 3RP1A 3QUXC 2QQLH 5B39G 1F4XH 1GAFH 2NR6C 2ADJB 3RL2A 1UXWA 2OLDA 3NCJH 3TCLA 5F6IB 3G9VA 3MOBH 5EORH 5IROC 5F97E 2ZUQB 4GH7B 5INDA 2WZPD 5DHVB 4KKBC 4HWZA 3G6DL 2BNRD 3DVNB 3UJTL 3DTXB 3QIWA 4KGLA 3ZE0E 2HFFA 1JPSL 5IESH 1M05B 4MQ7B 1SYVB 3LSOA 5HBBA 2O93L 1J0JA 1SJXA 5DMYA 1MELA 2VXQL 5F96L 3DYMA 3IDNB 2FSEB 4OZIA 5E03A 3BWUC 5FM8A 3ZZ1A 3IFOB 3KR3L 1L7TH 2DQFB 2Z8SA 3LDBB 4X9HA 1MCPL 3V6ZA 1TJHH 2FCBA 3PIQB 2VDML 5IK3B 4EOWL 5F3BA 1MCOL 1A6AA 1X44A 3PWPA 2Y06L 1K4DA 2N4IA 2EDBA 5BO1H 3WS6C 1I3RA 1XF4A 5EN2B 5D7KD 5GRVL 1FGNL 3P0VH 2BX5A 5E8OB 4R0LA 4RMQA 1AHWC 3MLSH 3CVHL 4WHTB 2HMIC 2JK5A 5C7XL 1ZS8B 1RZJC 5TGBA 1LO2L 4OGXH 5DK0B 1S9WB 1XGTA 2I27N 5C8JB 1A9EA 2D03L 1HINL 5C6WH 2NY7L 2BVQA 1ZTXL 1AGEB 1D6EA 3GMLB 3OV6A 1K2DA 3OXRB 3O4LA 5FXCH 5FUOH 1TPXB 1PQZB 1EAJA 3HNSL 2WWKO 2AV1B 3D0LA 3NACL 1YMME 5DK3A 1R5IA 3MA9H 5IG7B 3EO1B 3CK0H 3E6HB 3IKCB 1KG0A 4DOHE 5K9JH 3ZYOA 3KLDA 4FZ8L 5I0ZA 3ARBD 4JM4L 1NBZA 4FTVA 4GRWF 5C92A 4H88L 3PL6B 4N0RA 2NX5B 5KOVC 2B7DT 4HXBH 2QSTA 3HN3A 3I2CL 4U1JA 1LP9B 2CK0H 3L7FA 3ILPB 1B6DA 1RY7B 5JNYB 3DWTA 3RIFK 3TFKD 2XN9D 2VDPH 3AM8C 3LZFL 5EUOE 2JJSA 3EFFB 1T3FB 5D8JL 3T3ME 4P48A 2V5YA 3WFEL 3RVXD 5JIPA 3V52H 2IAND 5A16B 5JO5B 1CDBA 3FN0H 1U8OA 1UT9A 1MY5A 4I48B 4G8IA 3MMEA 4PJEF 2BNRA 2EDDA 4MD5A 4HG4J 4G8GE 3U4BL 4LSVH 2ZUSA 3INUH 4OGYL 4XBEH 1ZSDA 4ELMF 2C26A 2COQA 2EE6A 5DEGA 4AZ8A 4R90L 1XT5A 1JN6A 4JZNA 3DXAD 5MENE 5FYLH 1RI8A 4XPBH 4YXKH 2I60L 2W9DL 4HJ0C 4TNWF 3D1MC 4WFHE 4GRMA 3TJHC 1S7VB 3SY0A 1NEZB 2C1OB 3D3VB 3GGWB 3MJ9H 1IGFH 4YR6B 1RIUL 1RMFL 1FLTX 2VDLH 2DMKA 3VH8A 1F3DH 1G1YA 4PJXF 1PD6A 4LFHG 1LDPL 4GXUM 3I6KA 3KPSB 1H3GA 4JZJA 4S1DC 1T5WB 4XPAH 4YWGH 2HJKA 1UQSA 3OAYK 4WY7L 4ZPTB 4ZUUA 1TZHA 2VLLA 1ZHNB 1QBLH 3P0YL 5E99L 4HWNA 3MFGB 4U1SB 3U0TA 4U6XB 5E4EB 4PJAE 1HXMB 3O6FD 4ONGH 2Y7QB 3V7AG 3C5ZC 2HLAA 4KK9D 4JFZH 1FNSH 2PF6A 3NMEA 1FVEB 3TA3C 3C60B 2X1QA 1IE5A 1WZLA 2DLHA 3GBMH 3PWJB 4L3CA 5DD0L 2IQ9H 1A1OA 3C6LB 4XT1C 5JHLH 1NGWB 3TZVD 1N2RB 4JHWH 1X5JA 4GBXC 3EYOA 5IMLA 2YZ8A 1NC4D 35C8H 1PJ9A 5DUPH 1RUKL 2WBJB 1E6OH 2VTFA 4Y19B 3ARBA 4L4JA 5AD0A 1QRKA 1NFDF 4G80B 4RISL 4F2MA 5CINL 3RGVD 2M8XA 3QUMH 3LCYA 1OGAD 3FQTB 1TIUA 3I50H 2QJDA 3K1DA 4D2NA 1JIBA 4RMUA 1ZA6B 4P3DA 4P99A 4WFEE 1MHPL 2UZXB 1T7YA 5EU3B 4JM2D 4O2CA 1KIQB 2XN9A 4NO3A 5ERWA 5J7CC 3RAJH 1C16B 2R0LH 4DW2H 4LPCA 5EPMB 4LSTL 4XP4L 2Q76A 2IANA 1F2XK 3M8OL 3KPMB 3RVWD 4J4PC 3MRMA 5DJZA 4YZFF 4NQCE 4ZS6D 1YY8A 4NNPH 4XBGA 2NY5C 2AJSL 4LKXB 3KNBB 3UTZA 2D7TH 1U95A 1I8KA 5JDJA 1NUNB 3IETB 5HHVL 1JUFB 3ARDC 5I1IL 5LG1A 1ZHKB 5EUKA 4F3FB 4ZOEA 1EERB 5HYIA 4QHUA 5I8CA 1A7RH 4AIOA 2X4RA 3VCLA 3DXAA 5FCUL 4X6EA 5AAMA 1NBYB 5C0IA 4YC2B 2P4AB 2QLVB 3F12B 1JPST 2JELL 1JV5A 1I9IL 3H42H 5CBAA 1UADC 2YC1B 4QT5A 1I8LC 2LU4A 5J1TC 1NCWH 3LS4H 3QNZB 3VD3A 1MFDH 4NKIH 4P46C 1XR8B 3WJJC 4K8RD 1PG7X 4GAYB 4PJBB 4G8EA 3H0TB 1J9CT 1RIVL 2JB5L 5DQDH 1CT8A 1H8SA 1UJ3A 4FFZH 4NCC1 2BP3A 3U4AA 2VQUA 1RZJL 2APTA 3EDJA 5IP4A 2UWEF 3QDJB 3HZYB 4HSQA 4ZO6A 4XNQA 2EDJA 5E8NB 5DJDB 4S1QL 3QNYA 4EI5B 1V3JA 1A3LL 5JOFB 5IEKA 4EDXA 1LO3L 1WAAE 1K8IB 5DXWA 1FFPA 3D0VB 4EN3D 4WCYH 3TNMA 1CXIA 2AEQH 4HS8L 4MXWL 5MERB 4ODBD 5J13B 1FNEB 4JVWA 4LHJB 2PUQT 3O6FA 3MLXH 3KXFE 2UV3A 4UU9B 2PO6C 4WEBL 1FHGA 1QHPA 2ZG1A 3L6FB 1BX2A 5BVPH 4JEGB 1KPVA 5DD6B 5ID1B 3UTSE 1FJ1B 2P24B 3HAEG 4ZUVA 3TV3L 3TZVA 5DJ0B 3T0BA 5B4MC 1NC4A 3PHOA 2DQGH 3RX8A 4DK3A 3NZ8B 3W2DL 1HH6B 1LWRA 5T3ZE 1OD7A 3CUPB 1S7QA 1FAIL 3PGDB 4JY4A 4NT6B 2EIEA 5HI5D 3RGVA 4GSDL 5FKPA 2X4UA 1HHHA 1OGAA 3TH3T 1UB5B 5FUZL 4E9LA 2CKBA 1LEIA 5KSVB 3KDMB 1DUYB 3PQYB 1IILE 3V79C 3BRGC 5GZOC 1KCVH 5E6ZA 3TGXA 2NXYB 1CXEA 5J12C 1J8HE 4CU7A 5GS1B 2YKLH 3T0DA 1N8ZB 1P6FA 3HPLB 1XR9B 4IEFB 1J05B 3U46A 1A6ZA 3H9SB 3Q3GB 4JFYB 2ZJSL 1U8KA 2Y9RT 4F7EA 3REVA 4LLWB 3O45B 3PP3K 1S7RA 3OR7A 4KV5E 5E1AB 1WBXB 4I9WD 2XRAH 2RJMA 3OG6B 3WDIA 4E42A 5DWUL 3WDHA 3L3DA 4M7LL 2O5ZH 1FYTB 4G8FA 4NWTL 4YHPB 3ZKND 3TIDB 1BZ9B 4D0BB 1MQKH 4H8WC 4HUUB 5GGUB 1W72B 4JY5H 4DGVL 5IB2B 2O26U 5TH2B 4EJ1C 3WIIL 2B5IC 1DQQB 4HBCH 1QZ1A 3GJFH 5E6IB 2XQBL 3PXHA 1RQ5A 2CLZB 5B8CC 3T8XA 3I02B 2C9AA 1U8IB 2XPGB 3DGGB 1MJ8H 1XGQB 2RFXB 4RFNC 5F7NC 4MX7B 3HRPA 5F7KC 1BM3H 1NC2D 1NL0L 4HUXB 3OKOA 4YLQT 1CTOA 1CVRA 1FBIH 4XPFH 1R5VB 1EFXD 1ZVSA 4X80H 2PTTA 2FJFA 5F1KC 3TBSB 3STZB 4I0PD 4LEOA 5IHZA 4CADA 1S7SB 1P9MC 1SM3L 1CXFA 5DD1H 3VXNA 1G7QB 1Q9LB 4KJYA 3PNWB 4FXGB 4HLZH 4EN3A 3CX2A 4IBLT 3TIEA 1X5GA 4JO3L 1OAQH 1QFUH 1YJDC 3HCVA 4LLUB 1E0OB 3JV6A 3DARA 3HMWH 4U0QB 1JCKA 4Y16C 5F6HI 1MCSA 4H20H 4JDZB 4WV1B 3BHBB 1MFEH 2A6KA 2VJXA 1ZGLB 2V2XB 3ESUF 3IDGA 25C8L 4P5TA 3ARYA 2VWEC 4NHCL 2Z31D 1OAKL 1YEGL 1I1YB 4PREB 3K80A 4NNXB 2D0GA 3O0RL 1PBYA 1AQDA 2HFGH 2BVOA 2ZG3A 3TNNA 3ZKMC 4QHNB 5T1DH 1MHCB 3HE6B 4MDIB 4BSJA 3OJMB 4N0FA 5DD3L 1LP9F 3THMH 2F58H 2VZTA 3BMVA 4NO0D 1JFQL 1FNGB 2YK1L 5I17B 1P84J 4HW6A 3RWGA 4OLZH 1YY9D 3DX8B 4EIGB 1T5XA 4IHOB 2NY5L 5TPWL 2FECL 1RU9H 4R7NA 3KPQA 1AGBB 4HH8A 5D2NE 4H0GA 4LSUL 1DBAH 1MJJB 3NN8A 3UROR 3CX5K 5DVKA 5I75C 2Z8RA 2DQHL 1Y0LB 4OM1H 3QUKB 5KBNC 1FSKB 1FO0A 1JPTH 1QLRB 3ALPA 3WNKA 1OWRM 1MLBA 3QRFM 4PJ5E 2PW2B 4ZO7A 4RGOH 1J1XH 1D5MB 4AT6B 2KQNA 1K3IA 3MNZA 3GIZL 2KBGA 2HG5A 2NY0B 4F58L 1VGEL 4BA8A 4JO1L 4UQ2A 3QO0B 4KKNA 1RUAH 4GMTL 3T4AA 4QTIH 4LCCC 1JGVH 3B2UD 5ACZA 2N1KA 5KS9A 1QVOB 2JCCA 3EGSB 2DQCH 4QNPE 1KXQE 2Q86B 2JIXD 2R1XA 2RIKA 5IMMB 5BRZE 3JSSA 3O3BB 3QUYC 4M6AA 3T1WA 3DV6B 3O41A 1KLUA 2W0PA 3BQUC 3MBXH 5T1LB 1NC2A 5KZCD 3DURA 3KYMA 1X5HA 1EFXA 4KVNL 4OZGA 2FR4A 4APQC 1G7JB 4H0HB 4G7VH 2E7MA 1SYSB 1PGRB 1NGPL 4LASH 1P5VA 2GJ6E 4I0PA 3IFNH 5DDHA 3HI6L 1GGIL 2Y25A 5T3ZH 4M7ZC 1JJUA 2GIYA 1RVFH 4NP4H 1PSKH 3VI4F 2NW3B 6FABL 1DSFH 2DDQL 1AC0A 1TQCC 5EBGA 4UTBH 2OSLA 5FHAL 5KSAC 3S88H 1LE5B 2H45A 3WFHB 3SDCB 4GG6A 1Y6NR 2IEPA 3BUYB 5F3HA 4ZFGH 2OR8A 4KDTA 2FECI 2V17H 2Z31A 4XXDB 4MQXC 5FB8B 4KKCD 3HZKB 2CUMA 4PJ8B 2XTJE 4NZRH 1ZLVK 4Z7WF 1BVKA 2VDRL 3KPRD 4KQ3L 3FB6B 4EBQL 4IRJC 2E7BA 3LKOB 4CVXA 3SGJA 1BBJA 5TDNA 5IHUH 1BQHG 3ARVA 4NO0A 1C5CL 5CJXC 3RA7H 4X8XA 5E2UL 3B5HA 5H37H 3RDTC 1C12A 1W0VA 3U0WL 3U83A 5KW9H 5E7FA 1NUFA 4X5XB 1F45A 1FDLL 3BIBX 1EX0A 2EIDA 1ZEAL 3AAZA 4MD4B 4OLEA 2WWMD 1T0MB 1IM9B 4H8WL 4LMQE 1UWGH 3EYVA 4OLUH 1JHKH 3QDGD 4KAQL 4BFGA 1CGWA 4N5UA 1J0KA 1LE9A 5DJ8A 1DBML 5A1AA 3W0WD 3QPXL 2A1WL 3S4SA 1VENA 2YD3A 4XH2A 2Q1EA 2DWEB 3TT1L 2FX8L 4ZPVA 3IXAB 4HKBB 3MLUH 1FC1A 4XPHH 3GSNH 1M7IB 3VMNA 1BFOB 2FRGP 4LVHB 4M7LT 2X4QB 1JPGB 3OKKA 2QHRH 1P7KB 1KGCE 5EU6E 3SBWC 5TE6H 3EYQC 5HTSA 5J56B 4FQLH 1DR9A 4P23D 1W0WA 4Z8FH 4TQEH 1N3NB 3WKML 1D5ZA 2JJWA 3U9PL 4R2GC 2JIXA 2BRRH 1U8NA 2H6PB 4PJBF 2AXFA 3TPKA 3ULVH 4R97C 2H8PB 4G6AC 4LSRH 4GLRI 2SEBB 4ZFOL 5E9DD 4HCRL 3O81A 4KJPD 1HDMA 3LKPA 3T04D 2EIZA 2E9IA 4P2OC 1KB5L 4KTDL 3MOQA 1H0DB 4K3DH 3PE9A 1YJDL 4L4TE 5K9OA 4RGNB 2UYLB 4OAWA 1CBVL 1NBQA 3TO4B 5C07D 4U7SA 4HFWB 3O6LH 4L8SB 3EIFA 2IPUK 5HHOB 3VFUA 3RVUC 3IF1A 4HS3A 4UT7H 3IFLL 1HWHB 3M1BA 4M5ZH 2EDKA 4CVZA 3SCMB 3BZ4A 4LRNL 3SDAB 5EZLB 1Z9OA 3UDWC 3AY4A 5IV2A 2O5YH 3TBVA 2WBKA 2PYED 2P5EE 3FT2A 3QIWC 4IIQA 2Z92B 1SMOA 2ITCB 3VWJB 4O02L 1A9BA 3DBXA 3HC0A 4LVEA 4AENA 3ZHKA 2OTWA 3MRLB 5I19H 2FD6L 3WEXB 1BWWA 2EDTA 2FDBP 2HRPH 5HJ3B 1NAML 3RHWF 3FT4B 1RUML 3RUGE 1I8IB 3KPRA 3L5XH 1KUMA 2ZOKA 2P8PB 3GSXA 2CIKB 3Q6FA 2W60A 2AJYL 4U7MA 2VXUH 3MBEB 4NQXB 1P2CA 1EJ6A 4X5WA 2CO6B 1P7QB 3MLRH 1FH5H 3EOTH 5BXFB 2DLIA 4NKMA 5D1ZB 1OTUC 3S98A 1NDGA 1SJHA 3WXVL 5H94A 2K9UA 4EQ3A 3LKQA 1XGUB 3BKYL 5IBTH 2F5BL 4R0LC 5CJ8A 5DQJA 1JGDA 5C0AE 3FO9A 3GK8L 3QDGA 5TE7L 3JBG7 2BY2A 5SWSA 1IKFL 2Z4QB 3TA3B 5FF6A 1RZGA 3ZMRA 4TPRH 1CXLA 3A6CL 5GGSY 2BCKB 2Q7YA 1EXUB 3BKCH 5GJSH 5D93C 1OCWH 2DKUA 4LDEB 1EBAA 1AY1L 1BFTA 3DX7A 4PLOB 1BAFL 1RHHB 3LPWA 3UPRB 3I6GA 4G6KL 1AD9B 1IM3B 2VR9A 5JIKA 4FN0A 4P23A 4U0RB 1QA9A 3MUJA 2RAMA 2W0FA 3O3UN 5IKCA 3I75A 5T3XD 1OAUH 4JZOA 3FRPG 4C4KO 3HC4L 3N1GC 3DROB 1DQLH 2EYSB 4JREC 4XVSL 5E9DA 3WHE1 1CF8H 1HYRC 2NY2B 3V6FA 4MA1C 2GSIB 1HE7A 1J7VR 2IAMD 3ZE2E 2MCPL 3W9DB 4R96B 4HUKB 1YQVL 2QBWA 4PTUA 2B2XH 1JWMB 1IQWL 1VPOH 2FBJH 5EC2A 4YHKH 3L3IA 3PV6A 4Y4FB 4Z7VB 4DOHB 4Q6YA 4DVRH 1K4CB 3K2UL 4MA7H 4WGVB 4Z7UF 4F80A 1IAIM 4RQQB 1WCBB 5F7DB 4KJWC 4OV5B 4FQIH 5B38B 1BOGA 1QBMH 4Y4HB 2KZWA 2F15A 4DTGL 2JJSC 3FQNA 4ELKA 3HG1D 4P2YA 1NDMB 4LP4A 3N1PC 4O58L 2D7MA 3VXQA 4CMHC 4XAKE 2MOVA 5IMKB 4DGYL 2HTKD 2PETA 1AGCB 1T1XA 4RBPH 3UJTH 1MFAL 3DMMD 3EFDH 2YD6A 4LLQB 1FNAA 2RQ8A 5EUOB 4NBYB 3OXSB 1N5AA 1WC7B 1ZT7B 4F7MB 3IDMA 4AQ1B 1GOGA 1DVFC 3U2SB 1SY6L 2BERA 1SQ2N 2ZG2A 1MREL 1W8NA 4QRQB 1ACYL 4H25B 3VGHA 3EW3B 1AD0B 1BZQK 1A2YA 5I1DB 4KROD 3N06B 2K1MA 3GSOB 4Q9CA 3KR3H 4P2RA 4HX1B 3C5SA 3U30C 4OFVA 2VDMH 4G8GB 3ILQC 4EOWH 4E5XB 2ORBH 3Q5YA 3B83A 2H9GA 2Y06H 3DV4B 4GAFB 2EDHA 3BP7B 4L29B 1X6LA 2YMXL 3S37X 4L9LC 2UZIH 4LCWD 5MENB 1CICA 2VIRA 3JVGA 4TUKL 5D6DA 3VFNA 1BBDL 1RJCA 2DLTA 1OARL 1UB6B 3BD4A 1MAMH 4BYHA 2YXMA 5AAWA 3BP6B 1NSNH 3CVHH 4PJFA 4JZJC 2WQ8A 1J1PL 3P3YA 2AK1H 3TYFA 3WFCL 4LNRA 1YEJL 1UWXK 4YEFA 3C08L 1BIIA 5BOPA 5HYQA 2MKWA 4XZUB 5HGDA 1MEXL 2ICWB 2BC4B 2VLJD 4OCRH 1J8KA 2IQAB 2NY7H 5ANME 5DTFB 3MXWL 3AROA 2YXFA 4OKDA 3RWJB 5AUMB 1NKOA 3FO1A 3P9WB 2X10A 3IDUA 3MODL 2R0ZH 1QFWI 4X83A 5DQ9A 1MJ7L 3GJFB 3EOAA 4RWHA 2A9ML 3U79A 3BEWB