1L9PA

Crystal structure of nitrite soaked i257g variant of the copper-containing nitrite reductase from alcaligenes faecalies s-6
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLGGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directing the mode of nitrite binding to a copper-containing nitrite reductase from Alcaligenes faecalis S-6: Characterization of an active site isoleucine
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
total genus 94
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9pA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9pA02
9PCYA 4TXVB 3FT0A 2HX8A 3NJNA 3ABGA 4BDVA 5B7MA 4DP8X 1GW0A 1L9PA 1JZHA 4G7SB 2HXAA 4JKNA 2YAEA 5I6NA 1GSKA 1OE2A 1WA0X 3NYKA 1QHQA 4DPAX 1ASOA 3PAVA 1MG2C 3KW7A 4A2FA 3FQ1A 2H5UA 1BQRA 1PLAA 3SBQA 1OV8A 4UANA 3IE9A 2HX9A 2JFCA 3OMIB 3WNJA 1OCRB 4DPBX 3ABMB 2GBAA 1A4BA 2FTAA 1E5ZA 1L9OA 1NIEA 1ADWA 2ZONA 3SBPA 2PPEA 4DP2X 2R7EA 1MZZA 1SHXA 4N8UA 4KO9A 5PCYA 3IN0A 3N2JA 4GP4B 5PAZA 1RCYA 2XXGA 3T6ZA 2MRYA 3NJFA 4PAZA 2FQDA 1AZCA 4E9TA 1NIAA 3FSAA 4QLWA 4N4YB 3X1EA 1JXDA 2PPCA 3X1FA 2FQFA 1E67A 1OE1A 1SF3A 1KBWA 3DIVA 3H4HA 1GY2A 5I28A 2CALA 2VW7A 3CVBA 1NWPA 2AZAA 2BW4A 3T71A 1BYPA 2EIJB 1BEXA 1KDIA 4P5RA 1HAWA 5D4HA 1AS8A 2PPAA 4AKOA 3WKPA 4NAJA 2TSBA 3UABA 2EIMB 1J5DA 2P80A 5AZUA 2AZUA 2QPEB 4GY4A 2GC7C 3FSZA 4BWWA 2QDWA 5I6OA 1FFTB 2BW5A 1CUOA 1JERA 1ET8A 1ZIAA 3AW5A 4EF3A 3CVDA 3BVDB 3NSDA 2VW4A 5AKRA 1CYXA 2H47C 2BZ7A 3MX0B 4YSAA 3TBCA 1KGYE 1SF5A 1AZUA 2FJSA 2FT6A 4E9QA 3V9CA 2XYBA 1PNDA 5B7FA 3QQXA 3V9EA 1KCBA 4HHGA 1WA1X 1BXUA 4ZK8A 4JHVA 4DP9X 2PP8A 1ETJA 5I6KA 1F56A 2GHZA 3FU8A 3NSFA 3X1BA 1IUZA 1ZDQA 3EH5B 3WKQA 2HZHA 4BWTA 5IY5B 2ZXWB 3OD3A 2J56A 4ENZA 4DP1X 3ABLB 1X9UA 1NIFA 2DYRB 2VW6A 4BXSV 2XX0A 4Q89A 3QJTB 6PCYA 1E65A 2UX7A 4BK5C 1A3ZA 3GDCA 3GXUB 3AG3B 3SQRA 4DP7X 3FPXA 1AZNA 4DP0X 4HHWA 2BWIA 1E5YA 3T6VA 2J57A 4FA7B 1GS7A 3AG4B 1EZLA 2IWEA 4HCGA 2PLTA 3QJVB 3CDZB 3PXLA 3X2QB 1XB3A 1PMYA 2YXWA 1ZDSA 1BXAA 2I85A 4AZUA 3QJSB 4E9RA 3AG2B 1NZRA 3MBWB 4E9XA 4GYBA 3ERXA 1AANA 1MG3C 2BP8B 3FQYA 1PF3A 1PZBA 1BYOA 1SFHA 2X87A 4GP8B 2I7SA 2GIMA 2DWTA 2UXTA 3EH4B 1AS6A 5EHFA 1OOWA 1M9WA 3NJGA 4RH4A 1R1CA 2Q5BA 2HRGA 5F7BA 1GS8A 5I5JA 7PCYA 1FA4A 3CG8A 5I6MA 1J9TA 7PAZA 2HX7A 1JZGA 4M3HA 2PCFA 1A65A 1GY1A 5TK2A 1TKWA 3CVCA 4QKTA 2ZOOA 3CDZA 2VSMB 4HAKA 4YVNA 1AAJA 3ASOB 3QJRB 1CC3A 2YAMA 3S3CB 5TK4A 1V54B 2XX1A 4NERA 3TASA 1NDTA 2R7EB 1OCCB 3NSYA 1MDAA 1NTDA 1NPNA 1RZQA 3L45A 1N70A 4E9SA 1M57B 4G71B 5ANHA 1B3IA 3HB3B 2FQGA 2UXFA 3AY2A 3EH3B 1T5KA 4JHUA 6PAZA 1SNRA 4YSSA 1V10A 2BP8A 1IC0A 1J9RA 2W88A 2XVBA 4YSOA 2ZWNA 2CBPA 4KO5A 4YSPA 1ID2A 3NJIA 3ZIYA 2GB2A 1IBYA 2PCYA 1JXGA 4WKXA 1L9TA 1GR7A 1DZ0A 2HRHA 1PAZA 2Y69B 3OMAB 2UXGA 2I7OA 4YSRA 4YVUA 4W1TA 4A2HA 5A7EA 2FNWA 1PLCA 3FPYA 3QJUB 1W6WA 2FWLB 2P80D 2YARA 2AFNA 3WIAA 5I26A 4BDVB 4BXVA 4G72B 1KYAA 3UGEA 3UAEA 1RKRA 1GS6X 2VSKB 1A4AA 1ET5A 3NJJA 1NPJA 2XV3A 4HCFA 4NB7A 3HEIB 4YSDA 2IAAC 3NJLA 5D4JA 5I5IA 8PAZA 5LDUA 4E9YA 1AACA 2EIKB 5D4IA 4CSZA 2LLNA 2VN3A 1HAUA 5FC9A 3N55A 2XWZA 4GXFA 2NRDA 3H56A 1AR1B 5B1JA 4A66A 4GP5B 1L9RA 4DPCX 1ZIBA 2XLLA 2CAKA 1NIBA 1SDDA 5I5MA 4G70B 4PCYA 3WI9A 1PY0A 1J9SA 4G7RB 2DV6A 1AIZA 1WS8A 5B3SB 1AOZA 1JZFA 3ABKB 1X9RA 4AKPA 2B3IA 3PAUA 1MZYA 2HLEB 3T6WA 2EINB 2VMJA 2EILB 4A2GA 1QNIA 1JXFA 2QDVA 1IBZA 4WTQA 1SFDA 2CJ3A 1ZPUA 2YAHA 2YAPA 1IKOP 3ZX1A 1KV7A 4KNTA 3S8FB 2FQEA 1BQ5A 2XU9A 3PLYA 1KDJA 1EHKB 2GSMB 2IDTA 2GC4C 1FWXA 2BWDA 2DWSA 2WSDA 3OMNB 2A3TA 1ASQA 4A68A 2IH8A 4DP6X 1KCWA 1PZAA 1JZEA 5F7AA 4YSUA 3S8GB 1J5CA 4M4RB 1URIA 3TBBA 3NT0A 1OCZB 2E86A 3QPKA 2GI0A 1L9SA 2B08A 4AKQA 4HIPA 1RZPA 2XUWA 4E9VA 1AZBA 3PPSA 2IDUA 2IWKA 3NSCA 1VLXA 1UATA 3NP3A 3NJHA 2YAFA 3FSVA 2WO3B 3ZBMA 1TEFA 2IH9A 3IEAA 1WAEA 4AI7A 3TU6A 5I6LA 4DP5X 2CUAA 3X1NA 1WS7A 3NJKA 2UX6A 4YSEA 1BXVA 1A8ZA 4F2EA 4FAAB 2J55A 4A67A 1E30A 4KO7A 1W8EA 2IDQA 3BQVA 2XV2A 5B1BB 3WNIA 2BHFA 4Q8BA 1ZV2A 3G5WA 4X4KA 4YSTA 5B1JC 2JXMA 3PAZA 1L9QA 4KO6A 3NJMA 2IWFA 3IBOA 1QLEB 3H4FA 2VM4A 1NICA 2YAQA 3FSWA 1CURA 1V55B 1NWOA 2Q9OA 4UF7C 3WG7B 3UAAA 3X1GA 3FU7B 3UADA 3D12B 1JZJA 5B1AB 4HZ1A 3S3DB 2TSAA 4E9WA 1AQ8A 3T6XA 3PCYA 1J9QA 1SJMA 1OCOB 4L0PB 1CYWA 4DP4X 2DY2A 5E9NA 4HCIA 1XB8A 1ILUA 1TU2A 1WA2X 4K9JA 1KBVA 4KOCA 5B1KA 3U25A 4YSCA 5AFAA 2N0MA 1JVOA 2Y1AA 4BWUA 2PPFA 2PP7A 4HALA 3ZDWA 3JT2A 1XMEB 2YAOA 5I6PA 1PZCA 1SHWA 2YQBA 3DTUB 2IDSA 3IN2A 2CCWA 1XB6A 3DKHA 4A2EA 3JTBA 4W9ZA 3NP4A 1SDDB 2XV0A 3OQRA 1NIDA 2AANA 2W8CA 1N68A 2OCCB 4KOBA 3RYMA 3OM3B 2FT7A 4F2FA 4AX3A 1AG6A 3S3BB 1JZIA 3AZUA 1AZRA 3FU7A 2BP0A 2AVFA 4UAHA 2DYSB 4A2DA 3FU9A 1ET7A 4KNSA 3EHBB 1GYCA 1M56B 1DYZA 3FYEB 2BZCA 4F7KA 2WO2B 3C75A 1PNCA 2UXVA 4G7QB 3SBRA 3FYIB 2X88A 1BAWA 4MFHA 2MTAA 3EF4A 3UACA 4CSPA 4YSQA 2QT6A 4P5SA 2PPDA 1NINA 3T9WA 5B7EA 1YLBB 3QJQB 2BO0A 2H3XC 1AS7A 3FS9A 2FT8A 1ASPA 1HFUA 2IDFA 2VM3A 1I53A 3AG1B 2BP0B 1OE3A 1PCSA 2JKWA 2J5WA 1OF0A 2QPDB 1JVLA 1AG0A 1BQKA 2OV0A 1ILSA 3CZUB 3GYRA 1W6LA 4YL4A 3TA4D 4KNUA 1PLBA 2PP9A 3ASNB 3KW8A 2RACA 2XXFA 3FQ2A 1JOIA 2OJ1A 1TEGA 1A4CA 2YXVA
chains in the Genus database with same CATH superfamily
2X4PB 2VQ1A 2R0LL 1E8ZA 1AXTL 5FF6A 4MBRA 4A38A 1N2RA 1AGFB 3GPSA 3SGDI 4ABVA 3A67H 3FN0L 3BRFA 1OE2A 3QDJE 3FHAA 2F7QA 5LB1A 4U1IA 3FO2A 2OR7A 5D7JA 3ULUD 5C7XL 1JZ8A 3CDGA 4KRPC 2FWSA 3VFNB 4ES8A 1RZ7L 3MRNA 4PJGA 4OFKA 2E59A 5ADPH 1QKZH 4WSGA 2JFCA 4F8QA 2QR0B 4HSAC 5AOIA 3RZCB 4BK8A 3VUAA 2GBAA 4OJAA 2ZKXA 4K3HA 4KV5E 4OZFB 2VR9A 2Q2LA 2XZCH 2DMKA 1AO7B 5AW8B 1KF9B 2NZ9C 1WGOA 3D33A 1T1WA 3FQTB 3N40F 4Z3GA 4ZXBD 4PBWD 5IM7B 4U1SB 4NNPL 1HT6A 1WFNA 1KTDA 3RGVB 4N4YB 3L1OL 1NANH 4QHUA 5FX3A 2H3KA 1F6FB 2AJZA 3D51A 4OCXL 5BS0A 5CSBA 4H8VA 4PJBB 2V5TA 1XGZA 3EOAA 4U1IB 4FNUA 2W9DL 2JKRM 5D7JB 3LS5L 3QHZL 1D9KC 5DJXA 4BSJA 3CVBA 4K3EL 1BFTA 5GHWH 3MRNB 1W8NA 4PJGB 3MREB 3UYOD 2NX5B 2JE8A 5EIVA 1ITCA 1BHGA 1FO0L 1OM9A 1EJ6A 4MMZC 2QFRA 4NN6B 2HUEA 2GUYA 5BOJA 4FYQA 1DQQB 2X12A 4LHUG 4OLWH 3HZMB 5A2KH 3P3SA 4TKWA 4XOEA 4XPBL 3TN0A 1J7VR 4BWWA 3WTUA 2NQ3A 2F61A 4OJDH 4YHIB 3JUZA 4KRLB 3LRHA 4TSAL 3LKNB 1KTDB 1VGKB 1Z5HA 4JFFA 3AVEA 4M7LT 2H9GB 4OUUB 4YSAA 5BS0B 1EO5A 4OJEH 3JTTA 5C0AD 3GSOB 1UD8A 3DYMA 4HK0A 2HLAB 4APXA 4IKLA 3QUHA 4FFZL 4LLAA 5DJXB 5KVGE 5CCKH 3OAUL 4RFOH 1J88A 3E6HB 2D0HA 4H26B 1T89A 5EU4A 4EUPB 3RX5A 1IAIM 5AOKA 4OF0A 1HN1A 5CHNB 3HG1E 3IFNL 4N3UA 3F12B 5CSZA 3U0TB 4WTZA 2P1YA 5ANMA 2GVYA 5AVZB 4KI5C 4MKTA 5D2LF 1KGWA 1Z3RA 3QJTB 3LZQA 1BM3H 4D3CL 3I6LD 3GBLA 4ONGL 4CL7A 3RUGE 5B39B 3QIBB 3LPFA 3QXAB 5JNYA 2HRLA 1UD6A 1AZNA 3JTTB 4OD1L 1LXMA 2ATKB 3PIQA 2X9XA 2BSBA 4YHYB 1QR4A 3LXAA 2A83A 4KK5D 5F9JB 2R0ZH 5AVVB 5EU4B 4EUPA 3BKYH 1G87A 5ICUA 1MCRA 3V55A 4N22A 4X5WB 1F41A 4Z1PA 1KCVL 5CS7A 5IROD 1C8QA 2FX9H 3VM7A 3O3EA 4JFTA 4C47A 4E9RA 1WCQA 5JHDA 4O4YL 4BHUA 5HDQL 2DLEA 1W2KT 4HIJB 1J0ZA 5JQ6L 2JQAA 4WK4B 5GZOA 1C5BL 1YAIA 3OXRB 2XQYA 2OJZH 4NBZB 1QYGH 4ZUVA 1MG3C 1IC1A 2F1BA 4RWYL 4JHAH 5EZLA 7FABL 4TNWF 3GBNH 1RU9H 1JI2A 3K6SA 5B39A 3HLAB 1KMGA 2BIQA 2K7QA 5BW7A 5DJAA 1CXHA 5EIIB 5KG9B 4M3HA 3L3DA 4BZ1A 3CVHL 2YUWA 1G7HA 2DQJL 5TK2A 5H37H 3IPBA 3WS6C 3DO3A 2YAMA 4NCC1 4NPKA 5F9JA 5TK4A 2VO8A 4DKEL 1HILB 4HC1L 4QOKA 2FWOB 1RAMA 1JHLL 3O2DL 1I9EA 4NNXB 1CLCA 3QI9D 4KVCL 2WNWA 5C08E 3V0VA 1J12A 1INEL 3KWWB 4L4JA 2XZAH 4HIJA 2Q3AA 1WZAA 4KXZH 3G9VA 3KLDA 1JUFA 4I5BA 4NCC2 3P40A 4Y4KA 4FX5A 1VCAA 1RZJL 2CKBH 2R0WL 3ARFC 3L9RB 5E2WH 4HUVB 4GPVA 4OGYL 2P7TB 1DDHB 4P05A 4IOIA 3DV6A 2NXYD 3R0MA 4F24A 4OCNC 3HC3H 4YDZA 4FL4C 3MC0A 1AVAA 3V95A 4N1EA 2KZ1B 4L3EB 5IHHA 3K2IA 3UFIA 3EJTA 5GS1A 1GAFH 5E2VH 4JPWH 2X0UA 1K5NA 3B8SA 5LGYA 2I25N 4L8DB 4S0TD 2PCXA 5FYKL 1XGUA 1T4WA 1XHHA 1EXUA 1SXNA 2VN4A 1ODAA 2EH8L 3HPJB 3KWWA 3P4MA 3NCEB 2PO6A 1OTTD 4K7PY 4PW9A 1OEZW 5F7MC 4P2YA 4JG0H 3NG5A 4YBLC 4KI5D 4ZS7H 4YHLL 5L4FA 4G43B 3S97C 4WHDA 4UNTA 4CSZA 2WZ0A 4OR1A 2AJSH 4QYOA 1F6AA 3OTTA 3SYOA 3HC3L 2NCMA 3MJ7A 5GGTH 4AM0Q 2DKMA 2NYZA 3CN3A 1MFEH 4BHUI 4X6DE 3IXTB 2XLLA 3QR2A 4ONOA 4PP1C 5JORA 5KYXB 2B1AH 3D3VB 4L3EA 1FQ9C 3QUKA 1KG0B 1XQ4A 4DN4L 5BVPL 4LF3B 4NJAL 1J87A 3HJ0A 4XE0A 4HGMA 4DGUA 2VXTL 3G5YB 4I0KA 5L4MA 5JIPA 3ZRCC 4XBEH 3VGDA 4LOUC 1SUJA 1U8JB 1UD3A 1VFAB 4L3AA 2P52A 3BD4A 3DSNB 3CK0L 1OLZA 1WS8A 2JTYA 4ICXA 1ZPLA 3ZYIA 3QJXA 1UA6L 4X7SH 4YUEL 5KSAC 4L0YA 1XGQA 3V0AC 3GKZA 3L4VA 4K94L 5H94A 1URZA 3BUYB 3IKCA 4RMTA 1F2QA 5ISZB 1LGVA 2ZCHL 1H5BB 1HSBB 1A66A 1HHHB 1TTGA 1F6AB 3WKML 1OWRM 5DCCA 3S8FB 1XV8A 1UENA 3LJ3A 3DVNA 4D0BA 1R3IH 5AW1B 4G8GD 5IBTH 2WCGA 4Q6YA 4PJHE 3MNZB 5FUCE 3T0WA 4ZPTA 3FTUA 5HY9B 1A21A 1KPVA 4WUUA 3ARDD 1AGBA 5E94A 4XNQB 3FU3A 1AGDB 4DSYA 4KXBA 1F58H 4B9IA 4LOFA 4X7CC 1WZMA 3FQRA 4FQIH 2AK1H 3AS2A 3Q9QA 4QD2E 4EXPX 4FQXA 1P4UA 2QADB 5CMAA 3QDGE 2NNFA 4NC0B 3MUJA 5ISZA 2J21A 5E1HB 1B0GB 1IM3B 3ZBMA 1YPZF 1FF5A 4OF6A 4U0RC 1FL6B 2QZQA 3BAYA 4MCYB 3LKOA 4AI7A 3WKYA 4JDTL 3X3FH 1F4XH 4JY6B 5CJQH 1VESA 5GRVK 1BAFL 5FYKH 1CIDA 2B0SL 1DEDA 4OD2A 3REWA 2OM5A 2DEXX 3CX2A 2OA9A 4XPFL 3SPVA 1S5IL 4WFFE 2FECI 4B9ZA 1SXCA 5C0EA 1ZJAA 4LZKA 2C9AA 1F02I 3BKYL 3WTXA 1E4KC 5IVXB 1A9EB 2WLNA 3HG1B 3ISWA 1UXMA 2ZUXA 4Q8BA 2B14A 3U6XA 3RKDC 3MHZA 4GFTB 5CMAB 4HKZA 1K4DB 1EXGA 3MR9B 1AY1H 1EVTC 5IF0B 1F3JB 3VXPA 3R1GH 4PS4L 1FFPA 3N85L 4JFHD 5E99L 1PX4A 2EDFA 3C2SA 3ZE0E 3MRLA 4PJAB 3FSWA 1CTOA 4O5LL 5E4EC 3HAEH 4KU1A 3OPZL 3P54A 3QUXA 2VDOH 5DRNA 1S7WB 1D5MB 2D7TH 2FGWH 2V8LA 2X6BA 1EO8L 1QFWM 4JFQB 4AJ0A 5JXAL 4R0LC 5JW3L 3WAKA 3GHPA 1J1XL 3BCDA 3SDCC 4OM1H 3F01A 5EN3A 1BZQK 5IVXA 2FRGP 1J11A 5IUCA 3U83A 2B0SH 4PGEA 4YQXL 5ITFB 1ZE3C 2WBJC 3JWNH 3OKKB 2ZOKA 1J05B 4L1SA 3V9FA 4A2EA 4AL8H 4Q9CA 3IGLA 1E9QB 5D70H 3S98A 1XSKA 2R0LH 2JSFA 3QDHA 1JCKA 3PREA 2QVMA 4UUJB 1ESOA 4WCYL 5EO9A 3BZFA 3TV8A 3MLZH 1FGVH 5LVEA 1WWAX 5EIIG 4MKMA 3JXAA 4C83B 1KFAL 1NGYA 5GGRY 2P24B 4X99B 5KVEL 2CBMA 1D5MA 3BMVA 3CZFA 3ULVF 4OM1L 4IK7A 4MX7A 1PZ2A 3HUJA 4Y2DD 1NMBH 5AD0B 1OPGL 2QSTA 2R69L 1PNCA 3LY6A 2VDOL 2BNUB 1MRCL 4PGEB 5ECJE 1Q0YL 5FLVA 2DI8A 3GBMH 4N0CC 1KV3A 1AFVH 4PSRA 3ILPB 3QCVH 5IBUG 4K0OA 1YLBB 1NFDF 4MNGE 3DXAE 2PYED 2DICA 1GHFL 4MJ5B 4F33B 2FCBA 1YEJH 2KC0A 4ZUSA 2A9NH 1RJZA 4C4UA 4C83A 5IHZA 3OL2A 3MRQA 4BFGA 4JQXC 4X99A 4YMPA 4NQDD 2QGCA 5GGRA 3FUHA 1OE3A 4WRLA 1DQDH 1YQVH 4TRPH 3GHEH 4IMLA 4U33A 3KPMB 3HUJB 3ROLB 5AB9A 2ITEA 2VXTH 3U7WL 5I73C 4FYRA 5FYLE 1KOAA 4G42A 5AD0A 2V7NB 1QHOA 1E50A 1WFOA 2BNUA 4H8QA 2J88L 2QELA 1WFTA 2NXZB 4PJDB 5GGQL 2PYFA 3FTZA 4MSWB 1UJTA 2AXWA 4GMTL 2PW2B 4PB0L 4U7MA 4LGPB 3SYPA 4LNVA 5JQIB 2MFNA 1WAAA 5JPMB 4HJJH 3L2MA 1WCBB 2HX8A 3ABGA 1A7RL 5I16B 1S9WA 3SD5A 1RJZB 4C57C 1U92A 4YC2B 2ESVE 1FJ1B 1Z9LA 4AH2A 4DGIH 4U1NB 5EUKA 3ZGHA 3GMNB 1YEHH 1XF2A 1SLWA 5I1AB 3OKLA 3ROLA 4EDXB 1JNNH 3LH9A 4I18B 2R8SH 2XZCL 4KK9C 4WHYG 3STLB 2JI1A 3H2QA 3ZQWA 4WNJA 1I3VA 3POCA 3SBPA 4DEUA 3TFKC 1T66D 2LVEA 2XZAL 1KIUA 2VXQL 4LCCC 2X4PA 3ARWA 4U3CA 4U6YB 3WNNA 4FEIA 1HJBC 5FF6B 1FG2A 1X9QA 3GI9H 3QAZC 1AGFA 2YD8A 3PWUB 1RZJC 4PBVC 5KSBF 3WFCL 3F6IA 5LGHL 5ID0B 4QRAA 3CU7A 1TZIA 3FBKA 2YOCA 4WO0A 1HE7A 1LEKB 5D1XB 1A6ZA 3KM1A 2I5YH 3CDGB 4R97C 5AW0B 3QG6B 3GI8H 5IHBA 4HJJL 2Y06H 4U1NA 4GQ9H 4MJIE 1H5BC 3MJ8B 1OK0A 2HLFC 1XF2B 3EGXB 2EC8A 1Y6NR 1AR1C 4HIXH 1KDIA 4HPOH 2E74C 4ZTPL 4N1HB 5D4HA 1UZ8B 2FYYB 3CFKA 3VYOA 4Z7IA 1FVEA 1U58B 1XDTT 2WXOA 4IKKA 1AO7A 4R90H 1CFVH 4U1HA 4UINL 5L8LB 4ODHL 1F3DH 4NAJA 43CAA 1IL1B 4NQSA 4XNXL 4PCTA 4I4WB 5IM7A 2A1WH 3F7PC 3FMGH 3QUYB 5BXFA 3IDNA 3VWKC 3RFZB 1FFTB 3RLSA 1E8WA 4P4KB 4Y1AB 2XIIA 1CE6A 2DF3A 4EF3A 3MRFB 3GMOA 1AQKL 1SGKA 3MZGB 3H9HB 1JWMA 1YYCA 4QWWD 1LEGA 2P49B 3K6IA 1UT9A 3TEYA 4AVIA 1R9FA 3ME0B 5IHUH 5KYUB 5B7FA 3MJ8A 4I1NB 5FB8B 1HKLL 3QJFA 3QJOA 4HHGA 1S9XB 4JHVA 3RGVC 3RVWD 3V0DA 5C6TH 5I6KA 4K3DL 4LLQB 3G6AA 2HJFA 4OIIH 3HZMA 3WKQA 3UTSB 5DC0A 1JE6A 2GIXA 5EBWB 1IL1A 3MOBH 4NQSB 4YHIA 5D7IF 1J10A 1CLOL 1UA7A 5C9JB 3IDNB 2VW6A 1KB9K 5IEHB 4AYID 1A6WL 1XWVA 4JFFB 4I77H 2H9GA 1SJHA 4OUUA 3LSOA 4W9GC 3SDCD 1T22A 1WH0A 2I9LA 4OCYL 3GXUB 3GSOA 4LRIA 1LEGB 1XF1A 3T4AC 1YYLL 3PG2A 1OAYL 2FH8A 4R5VA 1IC4H 4AE0A 2BSDA 4HD9A 4NIYE 2EXWC 4XXWC 3QJFB 4KJWD 1UXSB 3KPOA 2WXIA 4HETA 3GSWB 3WU1A 2CHZA 3PXLA 5CBAA 2B1HH 3BD3A 1A1NB 5AB1A 2X9ZA 3UGUA 3FO0L 1BX2B 4QJ3B 4WHTA 4WU7B 3ZDXF 2GBVA 2W60B 2DQEH 5E6ID 1CD0A 3ZRFC 1U8LA 5T3XD 3L3IB 4FFZA 1PF3A 2FX7L 4FHBD 4GP8B 4KKBD 5AOZA 4J3OG 2GIMA 3NABL 1HXKA 3ETBJ 1UB6B 3NJXA 3QFDB 4XPHL 3SYAA 2UYLB 3ZMRA 4ZMLA 1CBVL 1F8TL 2VITA 3SDDB 5FDYA 3FUEA 1A3LL 3EFFB 4JN1L 5DMIH 2PCFA 2WYIA 3MODH 5L9DL 4MD0A 4QRRD 3NCYP 1S7XA 1OK8A 4MMXA 2YUXA 3UERA 1MW0A 5C09B 5SV4A 1A1NA 1P0SE 4JM4L 1BM7A 4TVPL 4WUUE 1UA6H 4X7SL 4YUEH 2FQGA 3ZKXC 4OJFL 2VDRL 4JANA 4R5XA 3L3IA 4YSSA 1PD0A 2E7HA 1NM9A 1I8KB 2DOCA 4OF3A 5F88B 5F6HJ 3K6SB 3D0AA 3HLAA 5EEXA 4RRPG 1U8QB 5DJAB 2A38A 2VQTA 1QSVA 2UYLA 1KTKE 4FCHA 4KKCC 2PCYA 3NFNA 5CEXA 4AGPA 4CAGA 2PTUA 4XBMA 4Z7UE 3B43A 3EOBB 4UV4H 2CSPA 4ZUUB 1MCWW 3EFFA 3TNNB 3VRIA 2R2HA 4K55A 4JGMA 1ZANL 1D3CA 3NDZE 2FWLB 2C3HA 4MMXB 2YARA 4KI1A 1RP9A 5FO7A 4DOHE 4PJ7E 4P5MB 3UAEA 1JUFB 4I5BB 4WTWA 4ZBJA 4KXDA 4OQTH 1BFSA 5DDHA 1SN5A 3QORD 2VJXA 4WW1B 1Q1JL 2QVKA 3OXSA 4JANB 3L9RA 1UOVA 5DHEA 4HUVA 3C8DA 3BSZH 4HA1A 4WFEE 1JHKH 3CSGA 3SE4C 8PAZA 2P28B 3DV6B 2FO4A 2Z65C 5E8DL 5AVQB 5GGTA 3ATEA 4HWZA 3VFGL 4JRYB 2D7PA 2W81C 2P5ED 2BFVL 4AGMA 4QPEA 3VXMD 4A66A 3GJFA 4ZUUA 3UIYA 3OJDA 3CU1A 4LPWA 2EDHA 2FK9A 2QADD 2ZYSA 3U6XS 2DQMA 3K3QA 4JEGB 2IH1A 5GRVL 4BFIA 3I6SA 3QUZD 4P4KC 3FHQA 2R0WH 2KI6A 3S6CA 4PP2B 5DJ8A 2DQGL 4PTUA 3SGKC 5E6ZA 2NUPA 3BFWA 5FM5O 3V8OA 32C2A 2NMSA 3LXUX 1KXVC 3D5OF 3NIFF 3VNYA 1SLVA 2AQRA 4JRYA 3MN8A 1WUZA 2CJ3A 4W9LC 1NL0H 2AAAA 3CSYB 4RA3A 4OI8A 5JORB 1N8ZB 3Q8EA 1HCYA 1C16A 1H3PH 1KV7A 1KG0A 2E6JA 2VM9A 5IV2A 2EVIA 2ODHA 4XMWA 4LPXA 4R7LA 3NZHH 1TMCB 1WZ1H 3U4EA 5I66B 1ECZA 2GTZB 4S1SH 2IH1B 2EADA 5E03A 4HEPA 2HAZA 5A2LH 4XP4L 1M9SA 3B56A 2EDTA 5A6IA 4U1LB 1XGQB 1IM9B 4Y89A 4PP2A 1URIA 3TBBA 2NUPB 3QPKA 1IT9H 1LMKA 32C2B 3GRGA 1S7VB 3DA0A 4POUB 1GYVA 3VI4A 1KJ2B 2IDUA 4JQVC 5EFIA 5GRUH 2IXQB 1N0LA 1DUYA 4LEBA 4ELMB 1KXVA 3DVNB 1H3PL 2VDOB 4OF8A 4Z95H 4EI5D 4IEFB 4O2FA 3B7TA 5IV2B 1MFVA 4ZPTB 5IOKA 5J6HB 3DJSA 2XYCA 4G6ML 2IWGA 3MBEB 4WF7A 3P0VL 1H6EA 3UP6A 2UUDK 4FG0A 4JM2D 1ZLUH 1NAMB 5C0DA 3T2OA 1O6TA 4KO7A 1TCRA 1JHTB 1HHIA 2DL9A 4U1LA 1NUDA 5BUGA 2ITCB 2E9WA 4YR6A 4HGKC 5J7CC 3PQYD 4Y7OC 2BOCB 3E9UA 2L7EA 3IGUA 1B0GA 3QCVL 5HJGA 2J8HA 2ZUQC 1TIUA 3W11D 3ZO9A 5EH1A 3LKOB 4RESB 2GY7B 1MFAH 1T1ZA 3NCMA 4KV5F 4EPSA 1NWOA 4NQTA 3H42L 1R0AL 4ZFQA 5ICYB 3UADA 5E5RB 1CQKA 3QQ3B 3RL1A 1VFOA 2GTWB 2WQAA 3AWGA 3C08H 1N10A 5T1KA 2VABB 2WD0A 3ZKXB 4L0PB 4DOHB 5BRPA 2IANE 5E56A 4AG4L 1NAMA 2KDGA 2UZXA 5C0DB 2M2DA 4U3HA 5I15H 4D7BA 4K8RC 1KXTB 5FO9B 43C9A 1YUHB 2PPFA 5IR1B 5DC9B 4HC1A 1OT2A 1WFIA 3FB6B 1XMEB 1B4JL 5HYJA 1SYSB 4XMUA 3SDDD 1X5AA 1T0MA 3HZKA 4LSPH 5TDOA 3K2UL 1N12A 2XKNA 2X4UA 2CZNA 4MZRA 3SEPA 4QGYA 4UZGA 2ENSA 5A2FA 2VN7A 4RMRA 5E9AA 5M94B 5CJ8A 4AITA 5DRNB 1UT1A 5I8EB 4JFQA 3INUH 1XR8A 4A55A 3LEXA 3X12B 4UAHA 3FUMA 4A2DA 5LQBL 4UWQB 3IRCA 3QP3A 5C09E 3OJVC 3GC3A 4GIAA 3WJJA 4IK6A 4NCDA 1TJGH 3DROA 3LOWA 4UM8A 1PY9A 3ZE1B 2YR3A 4IS6A 1ZVHA 2WQVA 3LNHA 3IDIA 5J4MA 4HH9A 5IR1A 1QSEA 4BELD 3KS0J 1NGWA 3DXAD 2TAAA 1BMWA 1A25A 1E9QA 2JV6A 1DQKA 1NOLA 3LEYH 1G4MA 5E8EB 3X3GL 2G4EA 4EI5B 4YSQA 5DEZA 1JGIA 4P5SA 3SPGA 1NQBA 1Q4NX 2XKNB 4GXUM 1WISA 5EO9B 2Z93B 3Q7JA 4B3EA 4F3FA 1F90H 3G04B 3FS9A 3GUTB 4TNGA 4E42B 2B59A 1HINL 1ASPA 3QSKB 4NBXB 2Q8AL 2HG5A 4R96A 2Y7QA 4NKDB 2YEQA 1QABA 1MCNA 2FJHB 1EZSA 1YNLL 4KJPD 4MX7B 4HJGB 1PCSA 2H2SD 3PXJA 5C0GB 2AEOA 5C0BD 2XFXA 1A7OH 1DVYA 1IGTB 2F54E 4LPUA 2O5XL 1KJ3L 2BC4B 3DX7A 4WWPA 4JY5L 3STZB 4ZNEA 1P4BH 4UT7H 3L4CA 4F91B 5DHMC 4GRWB 5F7YC 5KBMA 2FEJA 1H19A 2MPAL 3HNSL 4I0PA 5E5MA 5KS9A 2ZT9C 5DJ0A 4Z77B 5JW4M 2NW2A 2BPBA 5D72L 5E8EA 3TA4D 4ATWA 4KZDL 1DLHA 3QPQC 1P5UB 1PLBA 4I0PD 4E0RB 3E3QC 4YC2C 4D0CB 2NNAB 4PGBA 4F3FB 5SWSD 1P53A 1IGYB 5IHZB 1L9PA 4OCWH 1KNOA 4BQBA 2HG5B 5DVLA 3LTVA 1HL8A 3N43B 5K59E 4ZMPA 4WQOA 2FJHA 2CLRB 1FL5B 1OAKL 3UAJD 5F6HI 2J6EH 3U2SB 1IVTA 2V7NA 4M1CC 1TSHA 4XWGH 4ETQA 2RQEA 1VRSA 3BVNB 4GSRA 1CJYA 3T2LA 1ACCA 3GUFA 4G8GB 2MCAA 1F1AA 2XZQH 3OAYH 1UG9A 2W0FA 2WAHA 4MSWA 1D2PA 3X11B 1G5AA 1L9OA 4N2MA 1N9PA 3LMJH 3BKMH 4PRAA 3EO9H 3WFCH 4D0CA 1WCBA 5KBPA 2O5NA 1NC4A 4XZUA 3FO9B 5GRYA 5GQBA 5PAZA 1RUMH 5I16A 4FFVD 2E7CA 4PAZA 2MNWA 3WE1A 4OLZH 1NIAA 4L9LA 1AH1A 4U7SA 5DHDA 1U92B 2VXQH 5I9QB 4AH2B 5IIEA 3D25B 3NCWA 3VXSE 4UQAA 3F7VB 4G1EA 4EDXA 3F6LA 3FC8A 1OP4A 3DIVA 3U2SA 4JM2B 4ETQB 5AALA 3QWOA 4PB0H 4LP5A 4G6JH 2W59A 1ZLWK 4G8GA 2YEZB 2WXNA 4HUUB 4LQFH 1T6WA 3RFRA 5EZIH 3TEXA 2COQA 2NZ1A 2O1AA 3SKMB 2OMVA 4U6YA 3O3UN 4HX1B 2IALB 3GK8H 4XAKE 3BAEL 4OQTL 4ZTPH 5KBKA 1FG2B 1SLUA 5DHYA 3D52A 4IBZA 4DT2A 4BSVA 1NC4B 4N2AA 3F62A 1Q9OB 1TF4A 1JGLL 2Y5EA 1NKGA 2VAJA 5C0CD 4NP4L 1MI5E 1XXDC 4WNQA 5CR1A 2NY7L 1X4XA 1LO4L 1ZT7B 2PR9A 2R9HC 4MNQD 4AM0B 4C56D 1JBJA 3ZZSA 3BUTA 5I19H 3CFKB 1LILA 2HVJA 5FYJE 2WLMA 4JO8A 2Z4QA 3D48R 2GW5A 1A6UL 4L5FL 2PCPA 2BCMA 3KPSA 4FQPA 3ZE0F 1H3UA 5BXFB 4QCIA 3RFZA 1MI5B 2Y5TA 4RGOH 1N18A 1GC1H 2R27A 2EAEA 1CE6B 4BSVB 1THAA 3MRFA 5DC4B 1WK0A 1COBA 1NMAH 1L3NA 1F6LL 1YEEL 5EWIH 4OLUH 1MFCH 1NCDL 2OZNA 4XI5C 1RZIA 3W38A 3ME0A 1ZT7A 4OM0H 5J6SA 2RJMA 5FB8A 1BAFH 4MDIA 1KYOJ 1PX8A 2BWIA 4PRHE 5CJXA 1S9XA 4F7EB 4NT6A 4ZOEA 1V7ML 3TBYB 4GUPA 4XVUD 3S3SA 4AGQA 3F04A 5F7UA 4XT1C 3X2QB 1MCEA 5AQ0A 4B5ZA 5JHDD 5E95B 1E9PA 2EC9T 2BS71 1T0PB 2CHNA 3KL0A 4BD4A 1AD9A 1CYGA 3CC5B 3QORC 1AQDA 4G80A 4DUXA 1ACYL 1NZRA 4KI5E 1Q0XH 4LLWB 1JGUL 4WFED 1QRNE 2DWEA 3TH3T 1GGBH 3M8OL 2ILLA 1FORH 2YN5A 1DP0A 3UZVB 4PJCF 3KPRA 5TFSH 2E5EA 5JHBA 4MXVE 4OD1H 4CMMA 3K1DA 1DBMH 1IAIL 1UA3A 2WUBL 3OLGA 3UMNA 5HBBA 5DUMH 1UXSA 3IAPA 2VZSA 4L1BA 3GXNA 4FQXD 3GSWA 3BGFB 4F7EA 3ZDYB 1SOXA 4GUPB 3KYNA 3A6BH 5CBAB 4FTVA 1ZK5A 4Y4HB 1J1XH 4NERA 4NZUH 4ODSL 4JRYD 1BX2A 2WLLA 4M7LL 3JV4A 5ILTL 1NPNA 2W60A 3OKOB 4MQSB 1U8LB 4G59C 2A9ML 1N7ML 2FH6A 1TZAA 3FT9A 3CPUA 2BNRA 1EAQA 1MUJA 1PPIA 4XN7A 3PL6A 4ELKA 5LGKA 4WEEA 4I13B 3RWJB 2EH7L 1P4LA 1A0QH 3SDDA 3KPRB 1NEZG 5CCJA 4QRTB 5JHLH 1YO4A 2GB2A 1M7IA 4QAWA 3FZUD 3QQ9C 1RIVL 3DX0A 1CDBA 2VRAA 4GRWE 1DUZA 4GW4A 1TJHH 1S7XB 5D1XC 3ZKND 5FYJH 3L3KA 1FORL 3RKPA 4Z7NE 3KYNB 5DO8A 4XNYH 4Y4HA 3ARZA 3M17A 5A6MA 4LHUA 1TQUA 4N28A 2CKBB 1B2WH 5F1IB 3SYCA 5T33L 4Y9BA 2EDXA 2IIJA 2YPKB 1EJOH 2VSKB 2BK8A 2YD4A 1DCEA 1OALA 2DIJA 2YBGA 3K2MC 4RAUA 5ERWB 2BNQD 2XV3A 1U8QA 5J56B 1H9VA 3QUYC 4ZS6C 1JVKA 1KCLA 4KRMB 1GZQA 4Z18A 2WNGA 5F7EL 5BS0D 5MENA 4K5MA 3BT2H 2BRRH 2XWZA 1GCFA 3GM8A 1IBFA 3L3GA 4GW4B 1ZS8A 3SJVD 1IZJA 4UU9B 3MTRA 1QA9A 3FW6A 3G6DL 5IVXE 2IANA 3MV01 5FO7B 3NACL 4PJ5B 4B53A 3VX0A 2EACA 3B2XA 3LKQA 4ZW5A 4LHUB 1HXMB 3RWEB 3B4NA 3QUMH 3WTVA 1F18A 2NY2C 1ZHBB 2G5BB 2IPUK 4JKMA 3ZT7A 4AQEA 2E76C 2B4CL 2Z6FA 3K6DA 4OGXL 5EOCL 2IQAB 2HKFL 5DD3H 1AJ7L 3ZHDA 3NSXA 4G11A 4IKJA 1CPUA 1CD9B 1XAKA 1KCRH 3BISA 4IBVA 3OJDB 2RR3A 2IOOA 4GFXA 4P23A 5EU6B 4K2UL 1IKOP 3TYFA 3LZFL 5DD1H 2APBA 1ZS8B 5DLMH 4DGVL 2FQEA 4HG4K 2OZ4H 3CCHA 2ZKWA 4UU9A 4FFWD 4NUJA 2Y1ZA 2F08A 1J0IA 3MLZL 3KBHE 1HL5A 2IANB 2FIRT 5IFAH 3BT2L 4LCWE 5IQ9A 4D9LH 3RIAF 1HXMA 3BSZL 2FECL 2DH3A 5SX5K 4TN9A 5MEPA 3QB7C 4LSUL 1CD1B 1ZHBA 2BINA 2C9XA 2DQEL 3AB0C 2CCLA 3GINA 4EOWL 1X5MA 5J13C 5HGHA 4NRZA 4K5LA 3GSUA 4AKQA 4YHKL 2NLJB 3DJTA 5G4NA 1UVQB 8FABB 4DN3L 5FM4A 5KAQF 1JHKL 3ATBA 5ESQA 3SCMC 3Q2LA 2AITA 4GIOA 1EUTA 1D6VL 1L9NA 3QRGL 4LBAA 5I0WA 2KLSA 5D9SA 4J6RH 1TEFA 4X4MA 2FHFA 4HWBA 4ZQKA 3TYFB 3U4EB 4UTBL 2JVUA 1EFXD 3L4YA 1TVBB 5EA0H 5T3ZE 1SZNA 2CUAA 3PDDA 2WUCH 5L4JA 2ZTBA 3U7YL 1ETA1 3CVIL 4NS0A 1YEKL 2A4ZA 4FFYH 4ZFGL 1NCAH 1S7QB 5F8QC 5IQ9B 3SE9H 5J11B 3OLIA 2IV9A 1E30A 2R56H 3ILQD 4E5XG 3H3BC 4WEBH 1YSOA 5CLTA 5ADOH 3BWZA 3FQXB 1CD1A 8CGTA 1S7VA 4NRZB 1KJ2A 4KHTH 1R3HA 1NAML 2NLJA 2PR4L 4ZFOL 1A9BB 3CZEA 5TE6L 1EMTL 1W15A 1BZ7B 1KPRA 3QHTC 4FJZA 4LVHC 4JFOA 3NMEA 4XN4A 4BQ8A 4ELMA 4OIFA 1KN2H 3SE4A 3H4FA 4IEFA 4JFEE 4NQVB 3WFEL 5D9SB 3QFJD 3EHBC 2LLGA 5E9DD 5EA0L 2PO6C 5C0BE 3S96A 4F2MB 4F5CA 5DU7A 2GSIA 4GAJH 1F4HA 1TVBA 2LU5A 1LQSR 3FU7B 1KFAH 4X42A 3KLSA 4E9WA 4ETYA 1N64H 5CFAA 3D6GA 1J9QA 1IAOB 1VEMA 3CSFA 4HC1H 4ZO8A 1ILUA 3GSNA 4YSCA 1OP5H 4L3EE 3SZKC 4PRPA 2YJQA 1GVIA 3N40P 3N9GH 4JO2H 1CDCA 5HVHC 5CLZA 1CDUA 3CLFH 5DTFA 4AZ8B 1VGEH 5GZNA 3PUCA 4P2OD 5CJXC 3WHE1 5I6PA 2LR4A 5IEKA 2O5XH 4OJCA 4YDMA 1OD9A 4J5VA 4FYSA 4Y1SA 3VWJC 3O3AB 2CD0A 1AOHA 5DC2A 1CTMA 3ARFA 1SJVA 3OM3B 3VGAC 3W56A 1U95A 1R75A 4U49A 3S96B 5DRXA 4F2MA 3PGFH 2VABA 1PDKB 3FU7A 4RISH 3O41B 4B7LA 1KTJA 5C08B 4PS8A 1E42A 1KXTA 4KNSA 3HE6A 1YUHA 1UJ3C 4M6OH 3K6FA 4PJCE 2MNJB 4YDLC 4O2EA 2BZCA 2XHNA 3BEWB 1V3JA 3IJ8A 5HYJB 2WO2B 4QTHA 5I1IH 5EF2A 4QXVA 2L7JA 3MRMA 2UXVA 1KPUA 2NY4D 1CDHA 3MNWB 4X83A 4Z7UF 4TUOB 2RH0A 3PWPD 2FATL 5LNEA 3ELQA 3UACA 4X5QA 4WAFA 4ACPA 4UT9L 3NDYE 4WV1A 3MVSA 3PWPE 5D5ME 5JTWA 3CZNA 4AYEC 3QJQB 1A6TA 1ZTXH 4CGUB 2YRPA 2WUCL 4OIBA 3X12A 1WAPA 1JGEA 1JYNA 4NKQB 4PJ8D 1DVFC 1K6QH 3C9NB 2IBZY 4BH7A 1PBYA 4MNHA 3VAEA 1CU4L 4G8FA 4L4VB 2WQSA 3S5LG 3L7FA 1J48A 1IARB 2X89D 3HG4A 5HD8D 4IS6B 2UZIH 1RHHA 3N3EA 5IHUL 1OB1B 4JFPA 3NSJA 4O2EB 2VH5H 4CVZA 5E08L 4QTHB 1MXGA 1MFBL 3D0VA 4WY7H 3VX1A 3MNWA 5I2IB 3EDFA 1MAML 4LT7A 4APQB 4LVNC 4OZIF 3QUXD 4L23A 5GHWL 4P46B 2VE6B 1WG3A 3G04A 5HXMA 3RUGB 4LP8A 4LBEB 4GEJA 4LQFL 5J6GA 4PJ8C 2B59B 2OJ1A 4Y5YC 1C1EH 3O6KL 4B9PA 4JO1H 4R96B 5IFHL 2WMPB 2Q20A 4G7SB 4PJ6A 4A1RA 4AEEA 3HE7D 1JGEB 2X7LA 3WMPA 4D0DA 4MBOA 2XFXB 5TE7H 4MNHB 1IGTA 5T1LB 3V4VH 1NDMA 3U1PA 4AYGA 3L7FB 4NNYB 4WWKA 4QF1A 4MDJA 5EOCJ 2VNCA 3SQOL 3HHSA 1LE5B 4WI9A 1R47A 2ADGB 4Z77A 1Q9KB 3BKML 5JW4N 3ABMB 3MRCA 4G5ZL 2XQBL 3FUJA 1JF5A 2VQUA 3CUPB 4M61A 4AQ1B 1HTYA 5D1ZB 3T1WA 2C9SA 4KK9D 2VJ0A 5ADPL 5HGBA 2PPEA 1TSRA 4M1CD 3BIKA 3KBEA 4LLVA 3RUGA 1BMZA 3D9AL 4PG2C 5HHMB 2XA3A 1PG7L 3PV6A 5BOPA 1HSAA 3KH3A 1RCYA 3EYSH 3PNRB 3HVNA 4YXHH 4PRBB 5LGJA 1GKEA 4G6AD 4RVBA 2WLHA 5K9OA 3QISA 2IDCA 1HYRC 4A7GA 1FL5A 5EU5A 4AYFA 4UTCA 4LCYB 1I1AB 1SN2A 4PBDA 4RSVA 3KAAA 3BVNA 3P9WB 2Y6SD 4MA7L 5F44A 4FG4A 5HI4D 5HHQA 3H4HA 3ZLQC 4NNYA 1F8TH 5DUBA 1K2DA 1RIUH 4I7ZC 4P2AA 2Z3FA 4ZDHA 4OLWL 4Q9QL 2TRYA 3AXHA 3A22A 5E00B 2XN2A 4BINA 5JXED 5IT2H 5I8KL 4GG6B 5IQ7H 4M61B 2A6KB 2WVUA 3UABA 2NSQA 5IHWA 2JKJA 2R2BB 1FL3A 3TZVD 4LLVB 4AK2A 2H2SC 1KTRL 1AE6L 3O6FC 4PRBA 1MREH 2VDNB 4QRRE 4XP1H 5IIEB 3AW5A 1I82A 3PRZA 3BVDB 4EBQL 4PG2A 4FQLH 4F7MA 2DQFB 4P5KA 2MCG1 1UCBL 2AGJH 1SF5A 2J6WA 5HHQB 4NC1E 5D2NE 2Q8BH 3V9CA 4UNVA 3D85D 1Z66A 3OWEA 4I9XA 5FYKD 2X1XR 4E5XB 2DTMH 3HMWH 1MJUH 3ARDA 1I9IH 1ETJA 2JF1A 2ED9A 4OZFG 4PG9B 3SE3A 5I9QC 4U6VH 3IGKA 1HHJA 2XJKA 2IALA 3BPNC 3NA9L 4IRZA 2PXYB 2A9MH 2Y7OA 5IY5B 1VEOA 4GRLC 1BA9A 4Y1AE 4WNQB 3SGEI 1FAIL 4NXSA 2C9VA 3QEQD 5E5UB 1B4TA 3O81A 1WC7B 4P5KB 4N87A 4R7DB 3CFDA 3F7LA 2XI9A 4M62H 5F3BA 4OFIA 5DHVB 2OI9C 4HHWA 4C56A 2GABA 1PKOA 3D07A 4G5AA 2ROXA 1ZA3B 3EG9A 4XHJC 3VSVA 3O0LA 3DURA 2K70A 3RPIB 1KLGB 3APCA 3VXSA 4QCIB 4OLVL 1KBPA 2Z31A 3QJSB 4NAMA 4YHML 1MFNA 4NYLA 4XNYL 1EH9A 1FVCA 3HS8A 2C4FU 4E9XA 4CMHB 1G0YR 1U8PB 3CFCL 1TT6A 4O58H 1KIPA 2EYSA 4DAGH 1RZIB 2UXTA 1DVTA 3EH4B 4ZG1A 2OR8A 1LEIA 1OAYH 1ACXA 1DFBH 1Q9WA 1Z3GH 1K8DA 4Y4FA 3TBYA 1KEML 3MUY1 1PKQB 1C7SA 5EO1A 3UZQA 4LLDB 5L4IA 3RQ3A 3QJRB 4LNRA 4OU3A 3VG9B 5C2BL 5I19L 4AQOA 1E9PB 3D39E 3RPIA 1NDTA 4XCCH 4NKOA 1IVLA 4JFFD 4LK4A 1MDAA 2ICWJ 2DQDL 4JREB 4QOKD 1U21A 3C60A 4C8XA 3BWSA 4NO3A 4NZUL 3CHSA 3MNVA 4HCRH 4ODSH 5ADOL 2UXFA 4NYLB 1WWCA 2VLKD 3I50H 1VKXB 3ZKSD 5I8OL 4Q9RL 1AP2A 1BVLB 3NQKA 1KBKA 1IC0A 2E27H 4WW2C 1JZ5A 1IM9D 3Q2WA 1LK2A 3EJJX 3R8BB 2OJEB 4ZAKC 4LOEA 4ADJA 3K46A 1VZIA 5CP7A 3TTYA 2AXHA 3DO7B 2KQMA 1L6PA 1YEDA 1GYUA 4ZNEE 3AITA 1KBGH 3CSTA 1E43A 4LLDA 1BF2A 3E2HB 1Z2KA 4HJIA 3U2IA 3APDA 1IGFL 2N0KA 1QI4A 2QVIA 2YS4A 4NKOB 3HNVL 1U93B 2AQTA 2XKUA 4FNLH 5DJ2A 3UGEA 3TNMB 1KB5L 3C60B 1GS6X 1FAIH 4FG6D 2P43B 4H1LA 1A4AA 1VKXA 4HCFA 4MNGB 1QRND 2CNZA 3T8XA 3WSQL 4QRTA 3DJRA 1QFWI 3OR7A 5C0NC 3D05A 1M7IB 4FOMA 2ZD0A 5C07E 5F0JB 4L37A 1KWKA 5LWYH 4AQ8C 3B2UD 1SXSA 4GSDH 4JY4B 2VN3A 4S1SL 3VDCA 3RWDB 1JZ7A 5CP7B 1DN0A 5FGRA 1XCWA 3UDWC 1QPXA 3H56A 1NBZA 5CJ5A 3L3KB 2Y72A 3HI5H 4LEXH 5GZOD 1EDYA 2NY2B 2X38A 1MEXL 3RP1A 4YGAB 4OZIE 3QUML 2DJUA 3HFFA 4XVJL 2VN5A 3PJSB 1KCUL 5I71C 1P6WA 2YJLA 3PABA 3O11A 4KKBC 3CDYA 4PJFF 2QLYA 2FD6L 2YPKA 3P4NA 1D2OA 2KMWA 4JDZB 4QRQA 4Y9CA 1J9SA 1U8HB 1ZE3H 5HI4C 4AIXA 2EP6A 2HKHH 1T7VA 2X0WA 5C97A 1INEH 5IROC 1E8YA 1S5IH 4WGWB 2AP2A 4K4KA 2WCPA 4HUXA 1ZGLB 2KZKA 4M3KB 3D7PA 3VFNA 2JQZA 2OS7A 3T77B 1I9JH 1R46A 2QDVA 1XCQA 4OFPA 2EDDA 3JT0A 2QR0A 4H20L 4H8PA 1NBZB 4WDIA 5HHOD 5JZ7D 3Q6FB 4BZ1L 4M1DL 5KVEE 1BJ1H 1BQ5A 1KJVA 1N6VA 3OKMB 4X6DF 2Y1YA 4PJ5A 1IBGL 5IVOA 1CLYL 2ADFH 3LKQB 3PJSA 2IDTA 3RWEA 1U4FA 3ZTJG 4QT5B 1XGYH 1KYFA 5BQDA 5EPMA 1JMXA 4DUVA 1BZ9B 2IH8A 2PTTB 3TPUA 3DUHA 4PVBA 1DSYA 3VGFA 5KTEH 4Z78A 1GJWA 1FBIH 2J25A 2G3XA 4TLKA 3UBGA 4QJ4B 2AJSL 3MV11 3EOAB 3Q6GL 4FMFA 4JZOB 4YIQA 5CEYA 4X7TB 2OI9B 2W0LA 3KYAA 3APMA 3REVB 3QDGA 4DF9A 4PLJD 1JJUA 2JIXA 3IPFA 4JVWA 5EU6A 3ZU8A 4H20H 2E4TA 4OJYA 3NZ8B 3PL6C 5I6LA 1VZGA 5FW6A 1OAXH 2FX8H 2VC2H 2NY1B 3FB8B 3TONA 3C5ZC 4QKXB 4Q7DA 2UX6A 4KX7A 4RX4D 2F8OA 4CMHC 3US0A 3FN3A 3EJYD 2AI0L 4AGNA 4YHOL 5EPMB 5FGSA 4WI0B 4XPTH 1BZ9A 2NY3C 2E75C 4LVHB 5HGHB 4DQOH 2ZICA 1Q0YH 5DRWA 4MS6A 4YO0B 4CU7A 1SBBA 2WBWB 5LUMA 3GBEA 1LHZA 5ESQB 5IB2A 4JZOA 2OMBA 4HK0B 5DFWH 5CEYB 4GKNB 3V4UH 3VFMA 4ONFL 2VR4A 3U0WH 5I1CH 2IWFA 2R9HD 3FF8A 3QDGB 5D7LE 4LEXL 2QSCH 4ZQKB 3LPGA 25C8H 1NCWL 3BSZA 1MCJA 3AB0B 2Y2TA 2K6WA 3GMPB 4GSXA 1RH8A 3NZ8A 5JYMA 2CGYA 2LE9A 3I02B 4CRPA 1V5JA 2E7LA 1BLNA 2PWEA 2RCSH 5TJWK 4IRJD 1QX1A 3WTTA 4ZSOA 1DR9A 2W0PA 5E9NA 2VDMB 3CLFL 2NR6C 2EH8H 5B1KA 1NCBL 5HGGS 3U9PH 4AV5A 1BQHA 3QIBA 5FHAH 4QRFA 3LD8B 4XNUL 3D3VD 2DQIH 2XXMB 2EEAA 2AK1L 4U31A 5C0RH 1JYXA 5HVWA 2OLDA 2DMBA 4ATTA 5CGMA 3UJJH 1HOEA 2A83B 1WE5A 2OKMA 3KXFE 3J2PA 4JDEA 1XGTB 5I17A 4KOBA 1DBJL 5DS1A 5DMJB 5EV7A 3EBHA 4Z7WE 1FCCA 1FPTH 2HTLC 3D2TA 3W11C 4X50A 5INCB 1MCPL 2AVFA 3TTSA 3OXRA 3DUUB 3L1FA 4ODBD 1WFJA 5D7SH 2CGRL 2K7PA 2VSCA 1I85C 1RZKH 1DBBL 1OARH 4P2RA 2CJUH 3KXFA 4P49A 3FF7A 5DTFB 3GLEA 4AZ8A 2XOTA 3W81A 1HH6A 1XEDA 3FSOA 4PY8J 4JO3H 3MO1A 1NKOA 1HKFA 3AXLB 5IESL 2X88A 2YGVA 3LQAC 4Y19E 1TZ8A 2Y1VA 4GG8A 2E8YA 1BCIA 1CF8H 4XC1L 4JPVH 4PJHF 4BGLA 4QOKB 2BO0A 4M6MH 2WXRA 4Z7NF 5I17B 2Q2EB 4N5EC 2D73A 2FT8A 2FX8L 3EH1A 2ICES 4BA8A 2VM3A 3BWUF 4JPSA 5ALCH 3T65A 3QUYD 4NQEA 4ZS6D 5CKAA 2J7LA 2NY5L 3TN0C 1ZHKA 2JCCB 4PRIB 3K2UH 3U6RA 3A21A 3WEXA 3VGBA 1OZUA 3JYBA 2O6CA 5D6DC 2KPNA 5FKPB 4UZSA 1MWAB 3ESVF 2ZSVB 2EECA 5EN2B 4P2RB 1JVLA 2DLFL 5ABAA 4P46C 1HK6A 3KM2A 5E6RB 3MRMB 4X6FA 5HD8C 1XVSA 3HJEA 4FQIL 1ORSA 4TUOA 4MD5A 5LBVA 4PJ9D 4I3SH 3TX4A 4B5EA 1XD0A 3GYRA 4WV1B 3RGHA 4C4KO 2YFNA 4NC2B 1FUNA 1TPXB 1QFPA 4TS6A 2X44D 3VXRB 5KSAB 15C8H 3NZSA 3HC0B 4I1PA 2C3GA 5E4OA 1XT5A 2WM0A 3UTPE 1K5NB 5E2TL 1XGUB 3MLXL 3VD0A 3HPJA 4R26L 3T65B 3KPLA 2ITDB 2HRPL 5EZPA 1GCYA 2FNBA 1TQBC 4ZUWA 4PRIA 3EO0A 5J57B 5CO1A 3OAZK 4XBPB 1RHHB 3BW9A 3T2PA 4KGJA 2NY5C 4B0MM 5EBGA 3WDJA 4JFSA 2R4SL 3M1BA 4DK6A 3LS5H 3W39B 1CCZA 1PLAA 4N9OB 2JJTA 3MNDA 4P8QA 5HYIA 3NA9H 5ISZD 4NQCB 4OT1H 1JN6B 1U3HB 2AXFB 2RB8A 3CQPA 3MJ7B 3QEGH 4YAQB 5JA9A 2GSGB 1UM4H 3ZUCA 2WNXA 4M9OA 5PCYA 1OO2A 5LCVL 5IW1A 2BZDA 4LF3A 3BESR 2OMXA 3F58L 4PS3A 3RPBA 3WMQA 4QO1A 1AI1L 4MB1A 1U8JA 1VFAA 3MAWA 3ECWA 4LCUB 5D72H 4TSAH 4JS7A 2ZX7A 4J27A 5K39B 2EDYA 3OKDA 2FQFA 4WWKB 5I0ZA 2GY5A 4MDJB 2P45B 1KBWA 1WRFA 3BUYA 3EXLA 1H8OA 1AHWC 2ADGA 3B7YA 1U4EA 2QPFA 1DSFH 3MRCB 3MYJA 4PQXA 2ZXAA 5D1ZA 1T89C 1AS8A 2HJKA 3UAJC 4IW4C 4AKOA 5G4MA 3WEOA 1FG9C 4YWGL 4YAQA 2G75A 4Q97A 4XO3A 2GSGA 4D0BB 3NIDE 1U8MB 1NBVH 1RZ8A 5AB2A 3QIWA 3EHBD 1P84J 3FSZA 4MA3A 3DDFA 3FQWA 1AGBB 1A7BA 4R83A 1RZGB 4WZ9A 1YNLH 4ONHB 4JFXA 4I3GA 4QMEA 2X89A 4CGTA 4DEPC 1G9HA 5FCUH 1JK9A 1PCXA 3FQRB 1A0QL 2MOGA 5DUBB 5JHLL 3UBHA 1AZUA 1GA2A 4AC4A 1E4XI 4TNVF 4E36A 1EANA 3QQXA 5AOMA 2YLHA 4ENEC 3N6YA 4I48A 3UC0L 4BZ2H 3K72B 3QW9A 4LASL 2A6KA 3I3EA 2HVKB 2OMWB 2R2BA 3OPUA 1JI1A 4MCYA 1CXFA 1LMIA 1MVUA 4JY6A 3U9WA 3EJQA 5JOFB 1U8MA 4OW6A 3ABLB 4OSUL 3MDJA 3HG0A 4ODWA 3TBVA 1J5OH 1E4JA 4JFXB 4WHCA 2KDYA 4ABWA 4XPGL 1ZGLM 5FM5M 3ZVVA 3MV8B 1NC2A 3AG3B 2J5LB 1B88A 3II1A 3QULA 3KS0H 4M5YL 4AYSA 4PJGE 1RSFA 4E5XA 5L0QC 4HLJA 1K4DA 3RILA 2F9BT 2XETA 4D2NA 3NIGB 4U4IA 5AZEH 3QG7L 4MJIA 4H25A 4I48B 5KJ4A 1E3ZA 5I30L 3HVDA 4J7RA 4WY7L 4UV4L 4G83A 2X6UA 1XB3A 1MJ7H 1AQHA 1ZDSA 3O2WH 5JYLA 1CBJA 5MHSD 4GLRI 5E8PA 2PMZA 5ESVA 3AG2B 3R8QA 1MPAL 5IESH 3IMTA 1N5YH 2AQNA 3ARSA 4YX2H 5IKCB 2GK0A 3AMKA 5A2BA 2WINB 4XBGB 2BSRB 3BPNB 4XP5L 1CGXA 4PJEB 5EHFA 4I89A 1HNGA 1JPTH 5EOQH 4OM0L 5F3BB 1R1CA 5FYLH 4UT9A 5FV1L 1NC2B 3QULB 3VD3A 5ITFA 5LAPA 1JZGA 3EDDA 2EIZB 3OKKA 5B22A 4ZD3L 3ZE2B 3DURB 3E8UH 2ZOOA 5FM8A 1OAUL 1AXSA 3ASOB 3C8KA 2V0AA 4H25B 4NN5C 1KEMH 2L7UA 1CB4A 3DX8B 3FAXA 2R51A 3T4YA 1UTDA 1AD0B 2LW3A 3UO8B 2VDKB 4AQ1C 5CIPA 1DO6A 2ITFA 1JRHH 2AMGA 3EIFA 2FL5B 5IKCA 4JE0A 1LEIB 3HFMH 4TTDD 3NOIA 1Q9WB 5JPMC 2X3BA 5CD3A 1UWYA 3NJIA 4G1MA 3E1ZA 4UQ9A 5F7WC 1PKQA 5T1DH 3BO8A 3MRBB 4NHCL 1X5YA 3QPXH 3HN5A 5GZNC 1C8PA 3THMH 4LNRB 4K3JL 3SDYL 2PETA 5D7IE 1CFQB 3I3BA 1PQZA 4P2QB 4XH2A 4YSRA 1AXSB 4ZO6A 3ZYZA 1E3XA 3NCJL 5IVZB 2AEWA 2RCSL 1Z32X 3CE1A 4OBSA 3ULVE 5GGVL 3S35L 3M86A 3HOGA 4YFLF 1RL1A 3QIWD 3KNBB 1KCRL 1JRHL 3KYKL 1SMAA 4HP5A 3UYPA 1G7JA 1A4KA 1HEZB 4P2RD 2DLTA 5JUEH 4KBPA 2FL5A 2YRLA 1UH2A 2JH2A 3PHQB 5EOTB 1D9KD 5D4JA 4HIIA 5IBTL 4ZYKA 1AACA 1X6LA 5D4IA 5CD3B 2W94A 3FT2A 2X6CA 4N6RB 5FUZH 3UGXA 5G55A 5FYJD 4QNPE 5D2NA 4M43H 1YEDB 2R1WA 5GS0L 1FH5H 3HHMA 3G5ZB 3KHQA 3MUHL 2CXKA 3GB7A 4GBXB 2PW2A 2ZG1A 2QSVA 1VHPA 4HXAL 3KH4A 4X4YB 4KUCF 5E9DB 3AACA 3VB8A 2IMNA 3WI9A 3T0ED 5MEQA 1WT5C 3RU8L 3JWNC 5MERB 5HHVH 4J3SA 4N2HA 1AIZA 1FC1A 5B3SB 1D6VH 3QRGH 5C0FB 1AMYA 4EKXA 1UB5B 2QEJA 2B3IA 4HXBH 3UJTL 4AJVA 1LP9B 4LP4A 4IRJA 4JLRB 4IKNA 2J20A 4YHKH 3RWDA 2EILB 4HIIB 3TEWA 3WEMA 2HN7B 1CK0L 4LU5L 1U3HC 3AU0A 3ROOB 4QYAA 3DNKA 3CIQA 2GIYA 2AMUA 3VXUA 2LTQC 3KJ6H 2R39A 1NMCC 3HRZC 2AJUL 2BIPA 2X3AA 4PJEE 1BP3B 4L8BA 4YHLH 5D5MF 3I75B 4GBXA 2X05A 3P4NB 1CO1A 1MQ8A 5D71L 5FK9A 3MBWA 1U8HA 3QGVA 1KELL 2X4QB 2GI7A 1ASQA 1E2VA 1I9RL 4UOQA 5MERA 5ACLA 1KCWA 5FUCC 3Q06A 1UURA 3A4EA 3S8GB 2FEEI 4P5TA 2ZPKL 5C0FA 1A6ZB 1SY6L 3HNSH 3QG6A 1K3ZA 4QGTA 5HDBB 4DVRH 4IRJB 3MLTB 4PJ9A 1WLHA 1XCQB 3DV4B 2O6DA 5LHDA 2VYRE 5C09D 1JTTA 3PP4H 3ZOAA 2HN7A 2Y0SA 4NM4L 3HPLA 5LGHH 3SDAD 3ULUL 3QI9A 5EMYA 1ECYA 3CPLA 2IAMC 5L8JB 3BYYA 1AGEB 4M7ZC 4WWOA 3I75A 4JFDD 4M29A 1A8ZA 1WT5A 4P4KA 2X4QA 1YC8A 2F6AA 4KY1L 3VW3L 3K4ZA 2B16A 2I07A 1CDYA 3UTTB 1E4XL 3BQVA 3H9HA 3FO2B 3GF8A 2BHFA 4H8WL 3AQDA 5E6YA 4X4KA 3SPHA 1NGPL 3IM1A 4YE4L 3IJ7A 1CL7L 2JIXB 3DV4A 1MWAL 3ZJAA 4EI5C 1ADQA 4PJGF 4ZMVA 3RZCA 3RY6A 3NN8A 4HU2A 2D9CA 3UBXA 3QI9B 4LLQA 1I3GH 2HJFB 3JYCA 3MNMA 3MCKB 3OWRA 1WYJA 3BEVA 2A4CA 5CZRA 1RUQH 5B1AB 1ZWIB 4HULB 5EBWA 3BH8A 1UUSA 2EIBA 3V0IA 2VMEA 1TCMA 4E2OA 1XIWA 5IEHA 3J7HA 5FYKU 3DWTA 5GSRA 4AJWA 3RGVA 3NIDB 4QHUB 2R59A 4QXGL 1XIWD 3LSOB 1BQHG 5FFGA 3UTTA 4PJBA 3FFCB 2IFFH 5IB2B 2AK4A 3HB3D 3ZDWA 1GHFH 2VMFA 3VFMB 2YGOA 1O6VA 1R3KB 1TKWB 3OHXA 5DD5L 1DQTA 3CXHK 2IDSA 1XB6A 1KN2L 5E1IA 1KYUA 4U4BA 4WFFD 1CU4H 4I87A 1DQIA 4Q56A 4GXUN 4F9LA 1I1CA 5LBGA 1KEGL 1JZIA 4WHTB 4YZFF 1AZRA 1BLNB 5KW9H 3P30H 2CJUL 1E7VA 1XF5A 4KQ3L 1HJCA 2IGTA 1CFTA 2DPKA 2XNAB 3FU9A 4PYGA 5HJBA 3TL5A 5GSRB 3MLXH 1HCFX 1JTOA 1MCFA 2OZ4A 1GYCA 2RMNA 4XN8A 4JFHE 3TT1L 5L8KB 4MMXC 3HNTH 1M56B 1DYZA 1KGCE 4MASA 4XXDB 5TE4H 3WY4A 4F7KA 1D9KA 2VDQL 4LKCA 2EXWD 2AK4B 4JO1L 3UPRB 2HLAA 3S37H 4APXB 1AKJD 5AL8A 3E6HA 1TVHB 2PCFB 3FYIB 3Q5OA 4WU5A 2P42B 2XWBA 1ETZA 1ANUA 4MJJA 3U48A 3IMUA 5K1NA 4EKJA 5CHNA 5HHXL 5B7EA 4F8NA 5CSZB 4KHXL 1S7SB 3PGFL 2LOEA 3LKPA 4AG4H 3O6FA 4FHKA 1MNUH 1QR1B 2M8XA 5GGTL 4JRLA 1KLFA 2DQHH 2JKNA 4ZW6A 1AQKH 4NWTH 1XF5B 2P8MB 4L48A 4XE5B 3ZR5A 1CFTB 3HI6H 2JKTM 1BQKA 5K59F 4YLQT 2A74A 3QXAA 2JIXD 3Q5TA 1D9KB 3U9PL 3QDGD 2ATKA 2FJGA 5CEXB 3PIQB 5D1XD 3CZUB 3ZKNC 2PO6D 3FU6A 2R2HB 4WU5B 1E4HA 5DEGA 4LRIC 2VDMH 4PWGA 1ETZB 2APFA 2QTEA 1X5HA 1JOIA 4ZW7A 4U6TA 4O00A 3WFZA 3TYGH 3V5DB 2YXVA 3LXCA 1N59A 3FHEA 1WDAA 5DS2A 3RDTD 2ATAA 3QDME 5EUOF 4YS4A 1ZHKB 2JCCA 4XX1G 1OW0C 3CQFA 5EZOL 4K7FB 4NGHH 1PD6A 2ETWA 2Y2WA 3Q5YA 5FKPA 3OXSB 2P8MA 2XN9E 1QHQA 2FWUA 4NZJA 3WJMA 3FQNB 4TNWK 3IDJB 2ZWSA 3VTTA 4QNPF 3GMQB 4XB3A 1G7HB 1MVYA 2P4AB 5JHLA 4GAAA 4ORGA 1QSZA 1NIEA 2GQHA 2Q3XA 3HG5A 3ISYA 4NQUA 2FWOA 3W0WD 5FECB 4NNXA 3T6ZA 4GRMA 2SEBB 1S4IA 3CMGA 3NJFA 1N59B 3P3TA 3KPLB 3TCLA 3KL5A 4TVUA 5IW6A 4ZUWB 1B9ZA 1Y0LA 1P7BA 2H0FA 2HT3C 3ZTNH 1CF1A 4N2DA 4XBPA 2TRHA 5JOEA 4B0MB 1HL9A 5AKTA 4U2ZA 2VDNL 3W39A 1SF3A 4FZ8H 4R8WL 1XSOA 2Z7UA 2ZOTA 5I76B 5L7XL 2D0GA 2VOTA 1RPUA 3T71A 3TVMD 3GSXA 3NK4A 1G4RA 3GMQA 3CSYA 4L1LA 4QHMB 1N19A 1ETB1 5KAQG 4ORGB 1IIKA 1BECA 5IW1B 5D6DA 5KANG 4RZCA 3ZPDA 1C5CL 4YE4H 5TF0A 4F93B 2PR4H 4BFNA 3D39D 5ID1B 4AL8C 4DKAA 2GTZA 4GRMB 1H6TA 5D2LB 3TCTA 2H41A 2YRBA 5I1KL 3KDMA 2IBZX 4ANWA 2VW4A 5KVDE 5JDSB 4JFZL 3U9UA 2G3ZA 3OZ9L 3P77B 2C1PA 2VZ1A 1H3TA 4FA6A 3GI9L 1HNYA 1EJ8A 5I76A 3ILEA 2NQCA 3VI4B 5MENE 3ZRSA 2AK4E 2HJKB 3GSXB 2G75B 3CV5A 3TO4D 2ZP9A 5DD6A 35C8L 2QBWA 5KYXA 3D3VA 2P3YA 2HZHA 5TDPA 1C5CH 4YEFA 5IB3B 4KMQA 4JMNA 2C5DC 5J6HA 2J56A 4RETB 3V6FB 1TMQA 1WSST 1RZGA 1X9UA 1XF4B 3AFLA 3MBEA 1HI6A 5D2LA 5CGBA 3DSNA 4YFDB 3R7QA 3N1GC 4GO8A 1JHTA 2AAVA 1QZNA 5JDSA 2DLIA 1R3JB 3QYMA 2OQJB 2C1PB 3FULA 1Q90A 2BOCA 4R7XA 4ZO9A 3VFRB 4BKTC 2CGZA 1D7DA 3NCJH 1HHHA 1TJIL 2CPUA 4JRXD 4M7KL 2DL2A 1O5DT 1ACYH 1S6NA 3NCCB 2ZP0T 1E90A 2DBLL 1EJOL 3QXWA 1RK0A 2AJXL 4RA0C 3RE0A 4JREC 4I2XE 1KPVB 1A6AB 2V5SA 3BP7A 2J1ZA 3ERXA 4P59L 3TBVB 1FFQA 3FQYA 2ZNXA 1BYOA 4UT9H 2CDEB 2WVVA 3ZL4L 2V5RA 2CA4A 2Q7YA 2ZCLH 1M9WA 4RFEB 5DVOA 3BAWA 3ZN6A 1GS8A 4JCLA 3CG8A 4LAQL 3FH8A 4XMLL 2KZWA 2PKDA 1SYSA 2E9BA 1JDAA 1XGRB 4JJ5B 3T3ME 4J3VA 3OC5A 3GS7A 4F58H 2VXVL 5CCKL 2X1WL 5TDOB 4HT1H 4XXCC 5DUML 4EIUA 2X4UB 4M43L 1FL6A 2R7EB 3CVHH 4GI8A 4N8CL 3ARBD 3WJJC 4KPHL 3EYOB 3TA3A 4JG1H 4LEEA 5JZ7C 3FUDA 4Y1AD 1RK0B 3T0DA 3REWB 4X9BA 1Z5LA 1CGYA 5I8EA 4KGLA 1MREL 2GK0B 1XR8B 3QVAA 4M7KH 2WINA 3PXHA 4V33A 4YEEA 4IMKC 5DK3A 2NY0D 3Q3GA 1P5UC 4WJ5B 3RDTB 2YMXL 4OZIB 3N0AA 3HG1A 2AJXH 4RFEA 1XTLA 3ZIYA 1L6ZA 2VUYA 5KN5A 5DJDA 3ULUF 4CU8A 2X4TB 1F45A 4HWBL 2B20A 1DZ0A 1KCSL 4J3UA 5GS2H 3MA9L 5HHNA 5HDBE 4RGNB 5JOPE 2E6QA 3CFMA 5F96H 1MNNA 4RQQB 3T4YB 4G6JL 5D6CA 2FNWA 4W9EC 4FABH 1SDYA 3FPYA 5I1JL 4LARL 4UCFA 4J2XA 3TA3B 4WK2B 2XWJB 3GUTA 1NSNL 1DBAH 3RGVD 2IFGA 3SKJL 4B9KC 5KANI 4QDGA 3BUPA 1IC7H 1Z5LB 2VDPL 1EERB 4S1QH 2C9RA 4I77L 2FE0A 3F65A 3MV8D 4K7PH 3Q3GB 4G1MB 3BZ4B 3D8MA 3OBAA 5HI5C 2IAAC 5E7BA 4OZIA 2Z1KA 1WZKA 2BC4A 3STZA 5AENA 2KH2B 4O02H 2LLNA 2JKXA 3N55A 3LN5B 5KN5B 2RAMA 2MQ0A 2X4TA 1J0KA 1CFQA 3CAFA 2ZOKB 3D85B 2J4WH 4I0PB 5E5MB 3MLWL 4DNLA 5KS9B 5DJ0B 4OGQC 5IVZA 1HDMA 2CAKA 3IKKA 2DKSA 4E41B 1FFNA 4ZD3H 5I5MA 1MY5A 1DBKL 4HS6B 1D7FA 1KIRB 2W38A 3WS3A 3QWNA 1PY0A 3QHFH 4TSBH 5I1EL 3O4OB 4G7RB 4N1CA 1X5LA 1A4KB 1HEZA 3FTWA 5KTEL 1U41A 3CZFB 1TITA 4JFDA 2CLRA 3TWCL 1MFDH 3JWDH 4PW3A 1G9EA 1WD8A 1MZYA 2RD0A 3HN8A 2EINB 1UEMA 3HRZB 1ZLDA 3QIBD 4V11A 4JPQA 1RY7B 2DQIL 2BY2A 1IC5H 1BQSA 5F97E 5IJDC 3FT4B 4NOBA 2ORBL 5KOVC 3LN5A 4BFFA 4EBQH 2FO1A 2ZAGA 1FYTE 4GSUA 4KRNA 3QNFA 1P6FA 3X11A 4B6ZA 1FNSH 1OGAB 3FB5B 3PWNA 3T0AA 5GGSB 5F0MB 4X4YA 3BZEA 1FFNB 1QTSA 4Q6KA 3LZFH 4B9JA 4ZTOL 1KIRA 1QNZL 2R2EA 3A24A 4ZUSB 3WXVH 4JNXA 2G60H 4A68A 3TIEA 3U30C 3IMVA 3MCLH 1A5FL 5HDOA 3II2A 1IGIL 4JLRA 1D5IL 1NCCH 4G6AC 5HVHB 4IMLB 5D1ZD 3D39A 2IVFC 1FYTB 5K1JA 3EO9L 4QLRA 1LTXA 1RZPA 3GLZA 4NFCA 1AZBA 1VLXA 4N0RA 3QXTA 4Y5VC 2HKHL 2AEQL 3I9IA 4WWNA 2YEZA 4HUUA 5F1KC 4EI0A 5L6YH 4LIQH 2E4FA 2HB0A 3BJ91 1NDGA 4XB8A 2ICWA 2GEQA 3UEZA 2BS9A 2ZXEB 4HX1A 3MV7B 1HC1A 2ZX9A 1MAKA 2UWEF 5FAAA 2G60L 4H2AA 3ULSA 3IDUA 4R4BA 1JGVH 1FJ1A 2V6HA 4E41E 2IPTL 2K8QA 4Y19D 4RGND 1CLZH 2ZXDA 3GMNA 1I7TA 2Y7MA 1RUPL 3AWEA 3EOTL 5EB9A 3SE6A 5GSVA 5DMGD 3S36X 4HLZG 1DANU 1L9QA 4I3SL 4W4OA 5F7FA 5JW4R 3KZ8A 4DAGL 1WF5A 5E6IB 2ZOUA 5CJBA 4XNMB 5I74B 2Z4QB 2J1XA 5DRZA 4HUWB 1V55B 1Z9SA 2NR6D 4MTMA 3L5JA 1NDGB 3X13A 1RPKA 1UWEL 4BE5A 1VPOL 2E7MA 3CXDL 1A1OA 4YXLL 4IRJC 2N3JA 2AJUH 3CFBA 5KBNC 4N2LA 1KZQA 3HZYA 1YN7A 4RMQA 1H15B 4HJ1A 3HKZA 2JJSC 3LZRA 5CINH 3ARBB 4DP4X 5ID0A 2ESVD 4WHYH 3IDXL 4S2SA 3JTSA 2BSED 4Y4HC 2Q7NA 2FBJH 2DAVA 3MXVH 3RTQB 2YD5A 2PP7A 1G6RA 2WZPA 3TBWB 1XXFC 4GKSB 5DMKB 3NIGE 2WNKA 2XDHA 2V9TA 1K3IA 2WPGA 2WWMC 3AWFA 2YQBA 4NT6B 1JPGA 2YA2A 3NEEA 3NN8B 2V9UA 4MAZA 4X7DC 3X3GH 4HSCX 1UZ8A 2FYYA 3UBXB 3SCMD 4XVTL 4HOWA 5GRWA 2WXGA 1QWHA 4HUWA 5IGXL 1E8XA 1G1CA 3C2AH 3S3BB 4I4WA 1HINH 3QUYA 4NQED 1AD9B 3CC5A 5EUOA 3RB7A 3IAQA 1AQDB 4JFZH 2XVKA 4YJZL 1YN7B 1H15A 1ET7A 1GKOA 3CVIH 2DWEB 3T2NH 4YPGB 5KW9L 4F9PA 1O9VA 2A77L 3JTSB 3MXVL 3TS8A 5G4OA 4OQ1A 1MJ7L 2Q87A 4N0UA 5KVMC 3C75A 5DFVD 1B6UA 1LJMA 1R3KA 3OHXB 1XR9A 4RZKA 3MRGB 1BQUA 4PUBL 4LSPL 2XKSA 4HGWB 1JPGB 2WXLA 3TWYA 1EHXA 3GRWH 5IVXF 1JAEA 5F1OB 3VQ2C 5FHAL 4XO8A 1AS7A 4QHNB 3UTSA 3JV4B 1CTNA 2VXUH 5D7KE 4ERSL 1FYTD 5EUOB 2XNAA 4PCKA 2EDBA 3VD4A 1RULH 4CW1B 1SJHB 1TOXA 1VGEL 2BSTA 4XMPL 5DZLA 2VRQA 5DYOB 3S3PA 2CO3A 4F20A 1RMFH 2ZXCA 1ILSA 4TSCL 4FQ2L 2NTFA 2VR7A 3V4PA 3U0WL 5IQNA 3MRGA 3BDXA 5SX4I 1MW3A 2CBOA 2IO5A 3KXFD 3L1OH 4PVLA 4Z7OB 1JNLL 1K8IA 3ASNB 3Q48A 4JL1A 4B50A 3AUVA 1EGJL 1B90A 3QFGA 1S7SA 3ARGB 3O6FB 3H55A 4WI3A 1QR1A 5FOJA 1GW0A 1KLFB 2JQMA 3VXUD 3TT1H 3U30B 4A7GF 1EEUA 1W8OA 4I2XA 3CXHJ 3OLEA 1LWJA 1CFSB 3LRKA 4CW1A 1HKLH 2A74B 1NH6A 2OMUA 3QFDA 3N0PB 1MG2C 3CMOL 4X9IA 2ZUVA 2FUQA 5AKVA 1BQRA 4ECNA 4J3TA 4NQCE 1E5BA 4S1RL 3TFBA 2JJTC 4HVBA 3OJ2C 3KPTA 4G9FA 1BQLL 3V4PB 4P48A 4MD0B 2FTAA 3L3GB 3FT3B 4ODTL 2NY7H 3T0EA 1W0VB 5D7LD 1BOGB 1K8IB 3Q6GH 4PWIA 1S3KL 4J3OC 1SHXA 2O6FA 5C09A 4XCEA 3N2JA 1NBVL 1RK1A 4LGSB 4GXVH 4LL9A 3IGAB 3IRPX 3ML8A 1AZCA 3NGBC 2Z0UA 3TXAA 4CA4A 3KEDA 2ZAHA 3FSAA 5LN8A 4BQ6A 5K33A 2G5BA 3E9TA 3FFDB 1DE4A 3ECVA 1KUMA 4IU3B 3WJMB 2GHWB 1CFSA 3KEHA 3ARPA 4Y19A 4NWUH 2NY4B 4M5ZH 2OMUB 1V05A 2VLKB 2WXHA 3FUIA 4M8RA 2DDQH 5LNDA 2EDRA 2CE6A 4KJYA 4UINH 1V7NH 2RALA 1BEXA 1UFUA 3EOBA 3HMXL 1U8NB 1HAWA 4LSSH 2XZZA 3SE3C 3TNNA 3VI4F 1INQB 4LASH 5IQOA 3CZLA 4P23B 4HS8H 3B1UA 4P2RE 5EO0B 3FT3A 5C08D 4JFWA 5FECA 4PJCA 1RUPH 3EOTH 4K94H 1HH9B 2JKLA 3F58H 2VR3A 2F5AH 3WV0A 4AVJA 1FNAA 5IB4B 4XCEB 3AY4C 4XMKL 1U91B 5I6OA 5IW6B 5JA8B 1Z5YD 1KB9J 4Q0XH 5FXCH 3WN5A 1ET8A 4KVNL 4PMFA 4ALAL 3LQZB 3VWJA 1L4IA 3QEGL 4KJQD 3IT8D 4WW1A 1N6QL 3QK0A 3L95A 3IYLW 1TZHB 5ETUB 3GSUB 4HJEA 2EYTA 4Y19B 2XYBA 4TOYL 4RMSA 4BUQA 4HWZB 4RGMC 2BFGA 4HISA 1KCBA 1WA1X 2BS8A 2CR0A 4QHMA 4UQEA 3S4SG 3RWCA 2EO7A 3K8MA 2ALWA 2PYEA 2P26A 1T4KA 3FRPB 4X80H 4H0HB 1INQA 1UJ3A 1XMWA 2XN9B 3BPLC 4NZTH 1IUZA 4AUJA 3T6QC 1QPKA 4NZRL 4JPIA 3EH5B 3MTXA 2D9QB 4NWUL 4BWTA 3VDAA 5CZVL 4OCRH 4KKPA 4PJ7A 5JPNC 2WBKA 4BFEA 5I1GL 2DQJH 1S7QA 1QMUA 2KYIA 3MLPA 3FCSB 2OL3L 2G2RA 3LQZA 4XZ4A 3U9UB 3VWJB 3H9SB 3WHXA 4BK5C 3IVKB 3P77A 3S34H 1TLKA 3R0NA 3VD5A 2DLHA 4Y8DC 3CQQA 5KVFE 3TJPA 1ZLEA 2G0LA 2IOIA 3FPXA 4DP7X 3OHXC 3EYQD 3RJOA 2DIAA 3L5IA 4K71B 2OX5B 1GYWA 1QW8A 1RXLA 2F53D 3PHSA 3QXUA 4J3OH 2WSPA 2EQDA 1AR1D 5DD6B 5BMFH 2PYEB 1C16B 5CGYD 1FLRH 4NQVA 4WI5A 4Z3EA 1UJ3B 2XN9A 5I0YA 3T3MF 4PSPA 5E2WL 4F57L 4PGDB 1UM5L 4J3OF 4JPIB 4ZRGA 1K72A 2CDFB 1XF4A 4OAWB 2QGBA 2B1HL 3MROA 1HI6B 5E24E 5FUOL 3US1A 1EUUA 4L4TE 1AANA 3ZR6A 1B0RA 2BP8B 1UT2A 1U8KB 3GHBH 1OTUD 4LAQH 3BN9C 1KT2B 4X5RA 4UV7H 3IFPB 2ATPB 1AS6A 3FCSA 2VWEE 2O26U 3EYQC 4NGHL 5CLXA 1I8IA 5H35A 3GSNB 4RH4A 3B6SB 1HU8A 1FRGH 1MCOL 1MQKL 4OTXH 1O75A 2WTRB 4KC3B 5DT1H 3CGTA 4Y88A 4BCYA 3FONB 5TQ0H 5D8JL 1BBDH 5IEKB 2O5ZH 4H4NA 4ABQA 1UKTA 1N0LB 3CC1A 1ZHNA 4FYTA 4O2FB 4OJFH 3GS4A 1B2YA 4QRSB 3LNDA 1A6AA 2DM4A 4H8HA 1D7BA 2HH0L 3DK2A 3IETB 4OAWA 5FR3A 1T5KA 2E47A 5DD5H 2CDEA 2WVVB 3BMWA 4PJ5E 4KKNA 4AL8L 1LE9A 2Q7YB 1V10A 2BP8A 1HHIB 5C3IA 1ONQB 1YUKB 2FX9L 2ATPA 2CBPA 2ITCA 2Q0ZX 3RNKA 1GGIH 5KVFH 1FN4B 3NTCH 1MCLA 1JXGA 2A99A 4MB4A 1XGRA 4WKXA 3BN3B 1GR7A 4WLCA 3FTSA 2ARJQ 2EUWA 1W0WB 2HRHA 3HBQA 1V8HA 3L6FB 5D55A 4LLMB 4AYBA 1IEBA 2VLRD 3FU0A 5A7EA 4FLRA 4HIXL