1L9PA

Crystal structure of nitrite soaked i257g variant of the copper-containing nitrite reductase from alcaligenes faecalies s-6
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
336
structure length
336
Chain Sequence
b'ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLGGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
molecule tags Oxidoreductase
source organism Alcaligenes faecalis
publication title Directing the mode of nitrite binding to a copper-containing nitrite reductase from Alcaligenes faecalis S-6: Characterization of an active site isoleucine
pubmed doi rcsb
total genus 94
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9pA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9pA02
2FT6A 1NZRA 4X4KA 2JFCA 3NJFA 2JXMA 1PLAA 5B1KA 3SBQA 1L9PA 1JVLA 4A2GA 4E9XA 2HX9A 3AZUA 2HX7A 1EZLA 3ABKB 2FJSA 3ERXA 1AG0A 1NWOA 1PLCA 2EIKB 1UATA 1E5ZA 1A4BA 4E9SA 2HZHA 4DPCX 1L9TA 3FPXA 3X1NA 1L9OA 4AZUA 4WKXA 2VN3A 1SDDB 3DKHA 5D4HA 3WG7B 4JKNA 1OE2A 1AG6A 1XB6A 4UAHA 1RCYA 5E9NA 1W6LA 4E9TA 3AG1B 4GXFA 2TSAA 1N68A 2FT7A 2GC4C 4P5SA 4AKPA 3X1FA 4F7KA 2BP8A 3WKPA 2P80D 4PAZA 2FT8A 3FQ2A 3PXLA 3PAZA 2QPEB 1WAEA 3X2QB 5I6LA 2Q9OA 3EH5B 2J56A 3NYKA 4DP2X 3JT2A 2Q5BA 2I85A 4E9YA 4KOBA 3GYRA 3SBPA 1CUOA 1E5YA 1J5CA 2FQFA 4AKQA 2UXFA 1GS8A 3NJNA 2CCWA 2UXTA 3NJHA 3ABLB 1HFUA 4YL4A 1M56B 1W8EA 4BXSV 2ZWNA 1A4CA 2CALA 4DPBX 2GC7C 1NIDA 2VW4A 3AG4B 1AS8A 3V9CA 5B1JA 4KO5A 3FS9A 2I7SA 1OCCB 1ZPUA 1WA1X 2ZXWB 4TXVB 3IEAA 3G5WA 3FYEB 5I5JA 1AR1B 4A67A 4E9RA 2B3IA 2LLNA 2NRDA 2PLTA 3OMNB 2R7EA 2DV6A 2H3XC 4AKOA 3TBCA 2FQGA 1AZRA 2GI0A 2CAKA 2X88A 3AW5A 3QJVB 5I5MA 2PPEA 3FQYA 3FU7A 4NERA 4A2FA 4G71B 1V55B 1J9SA 5TK2A 2XUWA 1NTDA 3WNJA 3ZX1A 1ADWA 5B7MA 5I5IA 3QJTB 4FA7B 2HXAA 1L9RA 2IDTA 3QJQB 1AACA 4MFHA 3PCYA 2XV3A 3S3DB 2IH8A 4A66A 1IC0A 2CUAA 1ZDSA 3L45A 4DP0X 2PPAA 4NB7A 1X9RA 3TA4D 3X1EA 3AY2A 2BP0A 4Q8BA 1VLXA 3AG2B 4BXVA 4YSQA 1YLBB 3ZDWA 2XV2A 1JOIA 2AANA 1NIBA 3AG3B 3IN0A 2QT6A 1HAUA 1MG2C 2DWTA 2GSMB 1A3ZA 1AAJA 3OD3A 4DP9X 2XU9A 3D12B 4HCIA 3QJSB 1WS8A 1NPNA 1OOWA 1CYXA 1J9RA 2PCFA 3UAEA 1PF3A 4BWUA 5B1JC 1IBZA 3DIVA 1WA2X 2BWDA 3NP3A 2IAAC 2I7OA 3T6XA 2Y69B 2OJ1A 2J57A 1GY2A 1NIAA 2W88A 1J5DA 1ZV2A 3CZUB 4GYBA 1NIEA 3V9EA 1PZCA 1NDTA 1WS7A 4GP5B 4BDVB 5IY5B 3PAUA 3UGEA 1PZAA 3UACA 3SBRA 4KOCA 1JZHA 3NSFA 3QQXA 8PAZA 3EH3B 3KW7A 1KDIA 1NINA 2BW4A 1OCOB 2YQBA 5B1AB 2VW7A 2YARA 1AOZA 1GR7A 5I6MA 1GY1A 2MRYA 3WI9A 1A8ZA 4EF3A 2BO0A 4HAKA 1JVOA 3IE9A 3OMAB 4QKTA 3NJIA 4YVNA 4KNUA 3NSDA 4M3HA 5F7BA 2CJ3A 4DP5X 3S8FB 4HCFA 1MDAA 1JZGA 4A2HA 1ET7A 3HB3B 2CBPA 4NAJA 4ENZA 3CDZB 1PZBA 3PLYA 2JKWA 3MX0B 3WIAA 1TEGA 5PCYA 2PPFA 1GSKA 5AKRA 2IDFA 5D4JA 4GP8B 1ET8A 3ABMB 2IWKA 3CG8A 4ZK8A 7PAZA 1BYPA 2FNWA 3HEIB 4YSOA 2QDWA 2PP7A 2XYBA 4HIPA 4HZ1A 3T71A 1L9QA 1XB3A 1KCBA 2VSMB 2AFNA 3TBBA 1ET5A 1ASPA 1QHQA 2IWFA 1J9QA 2ZOOA 3ABGA 2AZUA 1WA0X 1ASOA 2BP8B 3BQVA 3FSVA 1JZJA 1HAWA 2J55A 4PCYA 1SNRA 2OV0A 3FPYA 2BZCA 2XX1A 3ZIYA 4AI7A 1TU2A 4UF7C 2IDSA 4YSAA 3MBWB 2UXVA 4HALA 1SFHA 3EH4B 2UX6A 3T6WA 4KNSA 3BVDB 5FC9A 1F56A 1MG3C 4G7RB 5D4IA 1AQ8A 2BW5A 3IN2A 1AZCA 1PNDA 4N4YB 3FSAA 1OV8A 2EIJB 2EILB 1A4AA 1M57B 2YAOA 2TSBA 5I6OA 1ZDQA 2AZAA 1ILUA 1J9TA 3KW8A 3NJLA 4DPAX 3ASOB 3NSCA 2QPDB 3N55A 1W6WA 1AIZA 1BQKA 1BXVA 2VMJA 3TASA 2FTAA 1GS7A 2VSKB 1TKWA 2EIMB 2IWEA 2E86A 3CVBA 3WKQA 2GBAA 1ZIAA 2XX0A 1JZEA 3C75A 1ETJA 1GS6X 1V10A 3QJUB 3T6VA 2XXGA 2J5WA 1PNCA 2XVBA 1JERA 3FSWA 1PLBA 4BWWA 1BQRA 2W8CA 1RKRA 4YSEA 1SFDA 3PAVA 4AX3A 4F2FA 3SQRA 5TK4A 3T6ZA 1KGYE 2H47C 4HHGA 5A7EA 3NT0A 3GXUB 2RACA 2B08A 1IKOP 1MZZA 2DWSA 2N0MA 1OCZB 4G70B 1PAZA 2XLLA 2WSDA 1JXGA 3QPKA 2GHZA 2PPDA 4K9JA 2IH9A 2EINB 1TEFA 1B3IA 1NIFA 1SF3A 2PPCA 1A65A 4CSZA 4Q89A 1BXAA 3FU7B 2WO2B 1KDJA 2ZONA 1N70A 4G7QB 4HCGA 1V54B 1KYAA 1FWXA 3NJMA 2PCYA 3UAAA 1OCRB 5I6KA 4WTQA 1AZNA 1GYCA 3S8GB 1GW0A 2P80A 3H4FA 4YSUA 1NPJA 1AZBA 1X9UA 3FQ1A 2OCCB 3S3CB 3FSZA 4E9WA 2YXVA 1OE1A 4E9VA 1SHXA 1NICA 3JTBA 1MZYA 2X87A 2YAHA 4L0PB 3DTUB 5I6PA 1BYOA 5EHFA 3UABA 4BK5C 1SDDA 4RH4A 1OF0A 4F2EA 4KNTA 4G72B 3X1GA 4DP1X 3H56A 1FFTB 1ID2A 2HX8A 4A68A 4DP7X 2YAPA 4YSCA 3WNIA 4E9QA 1I53A 1JXFA 1AS7A 3NJGA 4DP4X 4YSSA 2FWLB 3FU8A 4A2DA 2UXGA 3ZBMA 5B7EA 2PP9A 2YAEA 3UADA 4HHWA 2BP0B 3OM3B 5ANHA 5B1BB 4P5RA 4YSDA 2FQDA 2BZ7A 1L9SA 3GDCA 3ASNB 2HRGA 1OE3A 2QDVA 3NJKA 3OQRA 4JHUA 2XWZA 4A2EA 4GY4A 1AZUA 3CVCA 5LDUA 1RZPA 4FAAB 4UANA 1XMEB 1XB8A 1ZIBA 3NSYA 1QLEB 3H4HA 4KO7A 4W9ZA 5B7FA 3EHBB 4KO6A 2BWIA 4JHVA 3X1BA 1R1CA 1JZIA 1BAWA 9PCYA 1PY0A 1BXUA 2GIMA 1KV7A 1SF5A 2YAQA 3RYMA 4DP6X 1CC3A 2Y1AA 3FU9A 4YSTA 1PMYA 3CDZA 4M4RB 5F7AA 2YAMA 3S3BB 1RZQA 2XXFA 2AVFA 5B3SB 2BHFA 1E65A 2WO3B 3N2JA 2H5UA 4N8UA 5I26A 7PCYA 2A3TA 1AS6A 2DYSB 2MTAA 1E30A 2IDQA 3NP4A 3QJRB 4G7SB 1ASQA 1URIA 4CSPA 1NWPA 2IDUA 3T9WA 1DYZA 3IBOA 2FQEA 4YVUA 5I6NA 1M9WA 1BQ5A 2VM3A 1PCSA 2DY2A 4BWTA 3CVDA 4YSPA 4YSRA 1KBWA 5AFAA 1QNIA 2YAFA 1FA4A 2VW6A 1E67A 2R7EB 2DYRB 2YXWA 6PCYA 1AANA 1CURA 3FT0A 5PAZA 2XV0A 2PP8A 4GP4B 2HRHA 1CYWA 3PPSA 1IUZA 3FYIB 1T5KA 1BEXA 4BDVA 1JXDA 4DP8X 5I28A 2UX7A 3U25A 4QLWA 1ILSA 1KBVA 3EF4A 1DZ0A 3NJJA 1EHKB 1JZFA 1SHWA 4KO9A 1SJMA 4W1TA 3TU6A 1KCWA 2GB2A 6PAZA 5AZUA 1IBYA 2HLEB 2VM4A 3OMIB
chains in the Genus database with same CATH superfamily
2Z31C 1T0OA 4Y1AB 1H5BC 3ZTEA 3DETC 5IEKA 4E9XA 1EHXA 1MAML 3F12A 2RFXA 3CPLA 2WVVA 1Z3GH 3PUCA 4HX1A 4HXBH 2R27A 4H88H 4PJGF 4LQ1A 4NUMA 5DCCA 2OMBA 3D69B 2C3VA 1Z5YD 3DSNA 2DD8H 3WUZA 1OW0A 3BEVB 4TM9A 3W2DH 4DESA 4OZIA 2GJZB 3R8BB 4UDUB 1ZHLA 2BNQE 4KZDH 3DKHA 1KXVA 2Y7QB 3S36L 3IFNH 2AV7B 1EO8L 4KUCD 2FZ3A 1W6LA 2HYMA 5AYUH 5C0AB 2DBLL 3AG1B 1KTBA 2TSAA 1A4JB 1HZHL 2XTSA 1YN7B 4F7CB 1DQJB 2RBLA 3C8KA 3FQ2A 2LR4A 4ZUSA 1E4XL 2NQDA 1EZSA 4ZODA 1IE5A 4X6FA 2H0JA 3OKYA 4PVLA 3E80A 2D0FA 3OX8B 4U6YA 3C5SA 1X3DA 3B9AA 1UASA 1W91A 2O6CA 4I9WE 2FB4H 1UWEH 3UYPA 2FD6H 4OJFL 4L9LA 5C0GA 1UWGL 2HWZL 4MJJA 5JHDB 3GSUA 2QVKA 3MV7E 5ES4B 4EKJA 1NCTA 2J72A 1RJYA 3KLHD 3NIFB 3ROLB 5EOCH 4F57H 1MFAL 2K9FB 4UZSA 2EZ0D 1ZPUA 3D85A 2IH3B 4PSPA 15C8H 2A9NL 3RL2A 1AR1B 1XGPA 2IPKA 1EX0A 5C0BD 5DEFB 1ZT1B 2VLMD 4GKNB 2EZ0C 1IEBB 1S3KH 4ZFQA 5IM7A 3PJNA 3OGCA 4FQHA 3MR9B 3ELAT 4KK9C 5E6ID 3TBCA 2NYZA 1UD3A 4QT5B 4DKFH 5HYIA 3QIUB 2DTSA 3CQPA 1M7DA 3HMXH 1PPIA 1MPAH 4KI1A 3IT8D 3EYUH 4I2XE 4PJHB 4G71B 3S34H 1XF2B 4POZD 2W95A 3LJ3A 3NPSB 3FN0L 4KTEL 4K0OA 4GNKB 3L7EB 3ROLA 4K73A 4WI0B 1E2WA 4GINA 3Q13A 1U3HB 2IGTA 1JRHI 1PG7L 4YH6A 1IC7L 4WW2F 1XGTB 4KY1L 1CF8L 2N7SA 4XHJD 3BZ4A 2JJTC 4RMTA 3H2WA 4X5WB 2J6EL 1CXEA 4NUGH 1MI5E 2HKHH 4F7TB 5B8CC 2AXGB 2F53E 1OSZA 4OGYL 3MOQA 2Y1VA 1NKOA 3W11C 5C0CA 1I9JH 1MRDL 1QFWL 1PD1A 2VZ1A 3F7VB 3FULA 2EDLA 3F58L 3IJHB 2AJVH 4Q9RL 3HE6A 2IALA 1U8MA 1PAMA 5FUZL 4KX8A 3RIFK 1P7QB 4N90E 3UTTE 3T0DA 3B9EA 3EGXA 2WIIA 3BKYH 1MI5A 2OA9A 3BWAA 3D8MA 2CWRA 4XODA 4XH2B 4AUYA 1VGEL 2WWKT 2OMVA 2HVKB 4FZ8H 1IC7H 2P5WD 2E27H 3NP3A 4A7UA 5I82A 5T1KD 2DQCH 3Q6FB 5GGRY 4ZXBC 3NDZE 4RMUA 3NA9H 3CZUB 1GC1C 3EYVA 5HDBE 3THMH 2ZD0A 3SGEI 4N2GA 3INOA 5IB2B 2APXA 3SKUD 3S36X 1QLFB 1MCEA 1JZHA 3QXDA 4OLVL 1DL7L 4JMNA 2H0PA 2JB6A 2DYPD 2Q7NA 3QORB 4BHUI 4O2EA 2BW4A 4M7LH 1NEZG 2VW7A 1ZAGA 5JR1H 2JELH 3D05A 3GMPA 1RULH 3FJTA 2EYRB 4FNLL 2CJUH 2P45B 3LZQA 2M83A 4QKTA 5EDXA 4W9HC 1GKEA 1QEXA 2EDDA 2YK1L 4UAOB 2ORBL 4BRVA 4JGJA 1IC4H 2ZWZA 3IGFA 3A6CL 3OV6A 4OFKA 4DSYA 3CSBA 1I3VA 1TEGA 2YPLD 1II4E 3L13A 5DHEA 2GJ6A 2OLDA 4DAGL 1GGIL 1U8PA 3HZVB 3UTQA 1DSFH 1PZ2A 1LO4H 4TPRL 5C07A 2C1PB 1CDUA 2WXQA 4MB1A 4NYLA 1C9SA 2WP3O 3IJ9A 5B1CA 3RZCC 2XDHA 3E3QC 2ZYRA 1HYSD 1BPLB 2CM6A 4DGUA 3BKMH 1U8HA 1JUFB 2J88H 1W16A 4L9DA 1TDQA 1ASPA 2LFEA 3OZLA 4PR5B 4XE5B 5F96H 1DEEB 1R17A 2IWFA 3NRPA 4JKPH 3RNKA 4ELKB 1YPZA 4YAQB 1J9QA 2WN3A 4NQEA 1VADA 4U2ZA 5AOMA 5E95B 4M4RA 3PWJB 4CADA 4PJFB 1M7IA 4UQ2B 4P5TC 4AEHH 4J3UA 1GMIA 3KPQB 5DRXB 1S2EA 2JKSA 4AT6A 4YLBA 4BEIA 1NCWL 2C7UB 1U3YA 3RWGA 5BRZE 3PWVA 4HT1H 1GOHA 3RPBA 1PCXA 1YEFH 2F8VA 3IMVA 1KUMA 4WV1C 3SJVE 2FWSA 4LQFL 1VESA 1MREH 2XA3A 4LLWA 5BXFA 3K72A 3U0TB 4HKZB 4LLWB 1ZLWK 1F56A 1OM9A 2N01B 4F9LC 3S3JA 2J8HA 2VXSL 3BKML 5CP7B 3WFEL 4F15B 1AD9B 2Q8AL 3MLYL 1K9TA 4F2MB 2WGNB 3UJJL 2EIJB 4O51B 2ZCHL 1IGFL 1NKRA 4XZUB 2XIIA 4JQIH 3L4TA 2P48B 1IC5H 3NSCA 4Z95H 3HNTH 1BFSA 3EJRA 1Y18B 4AH2B 4IOIB 1I75A 2NZ1A 3FCSB 1Q90A 1U8OA 4X98A 4XMXA 5ELIA 1LE5A 4LCWA 3NN8B 1R5WB 2GBAA 2X3BA 4ZXBD 3FT3B 4WHCA 1AY1L 3S35X 3WIFA 1A6PA 4NKMB 1V10A 2V7NA 2Y72A 3FXIC 3V5KA 2VJXA 4KMLB 2XHNA 4TQ8A 3G6JF 4NQED 4WO4B 2XPZA 4LESA 4KXCA 4PUBL 2AEQH 2DQTL 3MBED 2CIIA 4ZW6A 4S0TD 2PWFA 2YGQA 3CZLA 4P2CG 5DA4A 4OD2A 3S88L 2NOYA 3QIWC 2B08A 1VCAA 2GABA 1BXXA 2X1XR 1JGUL 3HAEG 3KXFA 2J6WA 4PGCA 3APFA 3WCYA 1YEEH 3R06A 1KCUH 2PPDA 3KCPB 2YFNA 3FCTB 3QDME 3T8XA 5T3ZL 5GISH 4GRMB 4MA3A 4Y1AD 3STBA 3GSUB 4S11A 3O8XA 4OGXH 2A9AA 2KL6A 1W0YT 1IE4A 2FGWH 2X1WL 5IOPA 3VFUA 5FO9B 2HKAA 1CR9L 5AUMB 5CN3A 1NC4A 2ZOLB 4HQQL 1DBBL 3IJSB 4ATWA 1FFNA 1T7WA 1G87A 2P80A 3H4FA 1HHIA 3H9YA 4X6FB 1MCPL 5IB2A 1X9UA 3FQ1A 1OQXA 1M7XA 5F7KC 1G7JB 4OUUA 4RGND 5C0JA 3VFPB 5DVPA 3ML9A 4PRAB 3LKRB 3FB8A 3B5HA 4QRPA 1H9DA 4HSCX 5FFOA 4U6HB 4Y2DC 5A16B 2WW8A 5LAPA 4FTVB 5DEJA 5EHFA 1RZGA 1RPUA 3CQFA 4FTVA 4CN1A 1CU4L 1JV2A 3LRSA 2V2TB 4HHAB 2D0HA 4GMTL 4Y88A 4XMKH 3VFTA 1IQDA 4NZUL 43C9B 1K8IA 4W9EC 2A77H 2DWDA 3IMRA 5MEND 1S9VA 3HKFA 3JWNG 1FL3A 5ID0A 2JSFA 1T5WB 5ALCH 4KXZH 1RZ7L 4JY4A 2X2IA 1GOGA 4LSSL 3WBDA 3O11B 3ZHFA 4G11A 4P04A 4ZUUA 4LL1A 1MFDH 3V0AC 4PJDF 2P42B 1E8XA 1X4YA 1E8WA 3IMTA 4L4VD 3HNSH 3UC0H 4KJPC 1BVKB 5ITBH 2AVGA 3TH2T 4HOMA 3HJ0A 2ZP9A 3KVQA 2DQGH 5E6SB 2HFFA 2KS0A 4N20A 5KSVA 2CGRL 3QZLA 4FJZA 1MIML 1MH5A 2XWZA 4HUWB 4ZAKC 1FO0B 2JQMA 3CVCA 5HDQL 1I8KB 3FCUB 3OHXC 3L7EA 1RZPA 4Y5XA 1AQHA 4Y5VC 4BQ6A 1IM9A 1XD0A 1QEWB 2BSED 3G5XA 5L2KA 2GVYA 2IG2H 3QPXH 3WN5C 2N0KA 4NKDB 3BWUC 1O7VA 5T5FL 4YJZL 2V17H 1G1CA 3EO9L 3EHBB 1YC8A 3GSNL 2BWIA 4RBPK 3AXLB 2Y9RT 2O5ZL 2VCOA 2Q10A 3EFDL 4W4NA 3BUPA 4XNZB 4ZT1A 5I18L 5SWQA 2X38A 4DF9A 4QRAA 4QT5A 3T4AB 3W39B 5DQJA 4Z8FH 1CLYL 4ANXA 3CDZA 3K2MC 4JR9H 4AGLA 2VLLB 1ESOA 2QADC 2YQ2A 3QXDB 5DD1L 4YK4C 3A4FA 2WO3B 1O6SA 4Z3FA 4B27A 1LQBC 4NHUA 1IGJA 2EECA 3ECVA 4URTB 1S9XB 2EUWA 2YOCA 3FT3A 5KSAC 1TZAA 1RXLA 4HWZA 1UD8A 1ASQA 4J27A 3ZMEA 2ALWA 3M7FB 1NGWB 2EXYD 4N6QA 1DYZA 2CPUA 3QRGL 4HXAH 5HDQH 1J8HD 4WW1B 2QJDA 2DW5A 2FUQA 2ZICA 5E2VH 2YKLL 2AJZB 2GK0A 1MJ8H 3O4OC 1F3DH 1G1KA 2VC2H 3RGBA 2YEZB 4BD4A 4NN7B 2J5LC 4RESB 4LO9A 3WS3B 4YXLL 5BOZG 4BFKA 3CC5A 2D31A 2MCPH 1HEJC 2D3VA 5T3XL 4MCZB 5KYYA 1CLYH 4ETQA 5LCVA 4YXHH 5DT1L 4BDVA 1A5FL 3CMGA 5GRUL 4BRJA 1KIRA 4ONGH 1ILSA 2R2HB 4OQ1A 1YN7A 4MQXD 2Z65C 5IBUG 1OGPA 2A6JB 2A1WH 4N2CA 5DHVA 2HSIA 3MYJA 4AL8C 1SN2A 1ES0A 2DS4A 3T77A 5B38G 4M5YH 4PRPB 3CWGA 4IKJA 2GIXA 5AB1A 4NDMB 1CXIA 1FC1A 4FABL 4FLSA 2OPCA 5DJ6B 5BO1H 4N2KA 4QI3A 4GJTB 3LS4H 4QHPA 3QEQB 5DMIH 5J1AA 1PD0A 2K0RA 2TRYA 3N0PB 2JIXA 4E0RB 5DFVD 1V8HA 5DLMH 4M1GH 4Y5YC 2QR0A 4HX1B 3SPIA 3EDFA 4L3EB 4NRYA 2QQNH 5KVFL 3QEGH 2GBUA 2VDPH 1TPXC 1Q0EA 3OLIA 1ZE3C 3PWLA 4FFWC 4NN6C 1A8JH 3UTSB 4ZMAT 1N59B 2NNCA 3MRDB 3HPJA 5E9NA 1HS6A 3B7RL 1KEGH 3X14A 1WGOA 5F70A 3ARDC 5FW7A 1JZ2A 4P4KC 3WKPA 5DEFA 4GG6E 2FT8A 5I1HH 2QPEB 3KM1A 5I6LA 1D2PA 3I3BA 1A7QH 3D06A 2VR9A 3IFOA 3QK0A 4NPYB 4OFYD 4QRUA 5D7IE 5ADOL 4MWFA 2M8XA 3TEZA 1D3CA 4HK3J 1YNLL 5CJQH 2EO9A 5JOFB 3UAJC 4PJ9B 2VZSA 5DZNA 4HOXA 1B0GB 5HYSG 2QQKL 4JZJB 2XTJE 1QWNA 1Z5LB 2VT0A 4FF9A 2O5XH 1WITA 2JJWA 3K6OA 4JJ5B 1TQCC 1FNLA 3EOBB 3H54A 4ZMYA 3DROB 3VD5A 1AQDA 4JHZA 1U36A 4LSDA 5AAPA 4P05A 1F8TH 2F19H 1AYOA 2UV3A 4H5SA 3BO8A 2K4AA 3ARFD 5BVJB 4GUOA 2WV3A 2EIDA 2I7SA 2JIXD 2DQHH 3CFCL 2HG5A 3UP1A 4Q2ZA 2RIKA 1SEBB 1UQSB 3CSTA 2B3IA 4G2AA 3LXCA 4RAUA 4D7PA 4GRWF 3DVFA 3GKWH 3BRGC 5E9DD 3QIWA 1KPUA 1BMZA 2YPVA 2WXKA 1P7QD 1B0GA 1QZ1A 1CE6A 2FD6L 4FN0A 4H0LC 1YNTB 4L3CB 5HYFA 3WNKA 4P46D 1R3LB 5EO1B 4DGVH 3JWNC 5DUMH 1HIMH 1ZT4A 3IJHA 2XUWA 1MFAH 1FZOB 5FK9A 4XNAA 4GSQA 4FP8H 3T1FB 1X5MA 5GGTL 1NSNL 1FDLL 1N67A 2FX9H 1PZSA 1K3IA 1TJHH 4X6DA 4YHNA 4ZTOH 4DP0X 4OCXH 3KPPB 4NB7A 3GEWB 5DMGC 4HUXA 1QZNA 3SCMB 1MCOL 1YMHB 2BNQD 2JKJA 1KFGA 3NPSC 1H3XA 3W0WA 1KULA 2C4FU 5GS0L 2B20A 5L88L 3A4AA 5SWZB 2Z93A 2EVFA 1GTNA 3ZU8A 2H1PL 3FU3A 4J3OH 4XNXL 4EN3D 2QR0B 2K7QA 4NZDA 3ZDWA 1H8OA 4OFIA 1EO5A 4KVNH 1E27B 3VXMA 1QFWI 2X28A 3M1OA 1U91B 2GIYA 5E1QA 5B3JE 5JHMA 3H2QA 4UT6H 1CT8A 4FQLL 4D2NA 1QR1B 1J9RA 2CSPA 1BDYA 4Y2NA 3FUEA 5TE6L 4M6MH 3VXSE 1CFTB 4GFXA 4F3FA 3T77B 3ZRCC 4P9HL 1X6NA 5GGTH 1I8IB 5KG9B 1MNUL 1DJXA 3K5RA 3T6XA 4GSDH 1G7PA 1GY2A 4AJWA 1QQDA 4QWWC 3T2LA 1U8CB 3D30A 4RMSA 5AW9B 3LCYA 4BDVB 3S0PA 2ATKB 3KBPA 2FECL 2VWEE 1FUNA 1F0LA 1R3JA 5IHZA 4JZOA 1RJLA 1UJTA 8PAZA 1AO7B 4G9DA 3EH3B 2PYEE 4IMLA 5JMOC 3RZCA 5KSAB 3TIDA 5IB3A 2PCXA 1U8IB 3LD8C 3VFUB 1F11A 3QJFA 1BM3L 1D5ZA 1Q1JL 1IZKA 2XZAL 1SLUA 4WWNA 4D0CA 4C55A 1A8ZA 3PHAA 5DUPH 3DRQB 1QUNA 4JVPA 4POYA 1OSPH 2BCKA 4WI2A 5DEGB 3BRDA 1HHKB 2FE0A 3WIIL 4BFGA 3ARVA 2LAGB 3BPCB 1ZT7A 3VXOB 2WAHA 1MDAA 1LYQA 1OP3H 4J1UA 5LGJA 4YHPB 4LKCB 4Y4FD 1G94A 2Q87A 2EJ1A 3CDZB 1EJOH 4LL4A 4A1RA 3PLYA 4JKKA 4AC4A 1DQIA 3UBHA 5DURD 3IRPX 4Y16A 1SM3H 5J11B 1WWBX 1XEUA 2ERJC 3DHUA 4MSWB 1NFDE 4FQCH 2IWKA 5EO0B 1C08B 5E8DH 2OW7A 2CBQA 1NCDL 1NDGB 2ZKYA 3LHAA 1ZHNA 2FECI 4M43L 4XPTH 3FNKA 4HSQA 2CO6B 2YC1A 3PF2A 1IM9B 4RVBA 5L2KB 3M88A 4NPYA 4X80L 1ZOXA 2FEEI 1ZANH 4QXTA 4HF5L 1A9BB 5AZEH 5K69A 3KPLB 3POCA 1NBZA 1EEZB 3LPPA 4Z7UA 3QWNA 4KXBA 1FNFA 3O3BA 4JDEB 4QRRE 3EJYD 4JDZA 4LLMB 3AS2A 2OV0A 4P3CH 2JI2A 4HCRA 3DMMC 5BV7L 4XCFH 3RZCD 1T03L 2YJLA 1MHHB 1NAMB 5TFSL 1H6EA 1QO3B 4NBXB 1U93B 1IEAB 4X4ZA 3L3KB 3GDBA 2BX5A 1KJMA 1LK3H 5TDNA 4R4NC 5H4ZA 1DVZA 3BYYA 4N8VA 4B97A 4KJWC 4BKLB 3CDFA 4UTAA 1OGSA 3TV3H 1OTSD 4TNGA 4UOW0 1F4XH 3KR3H 4WK2B 2YD3A 1FN4A 3O9WC 3QARA 3K1KC 3NEOA 1N64L 1AZCA 1JPST 4H4NA 4RWYL 1JYNA 2ZPKL 3L1OH 1OP9A 2DMGA 1MCRA 3VI4F 1NKGA 1KN2H 3L5XL 4YQXH 4XN1A 2JJTA 3LNIA 3QFJA 4ECNA 4HS8H 2HT2D 2A83B 1WE5A 4JZJC 5TTRA 3ZYOA 4OUUB 4QGTA 1RPKA 1FVDA 2IC2A 2DWEA 3VGBA 1J5IA 4C4BA 4R7NB 3NFSH 4NQUA 3TBYB 1IRAY 2P28B 3KLLA 5CSBA 5J4MA 4V2CB 4N5EC 2CMRH 4J2QA 1SYVB 2ARJA 2XG5B 5C0CE 1JERA 3NFNA 4PRIB 4UQIM 4XT1C 4YSEA 3BP5A 4MYWB 1M71A 3SB3A 5EZOH 2XQYK 1QLRA 3QC5X 4N2EA 4POZC 1EZVX 4F2FA 1NC4B 4AL8H 1P84J 1DE4B 5CSGA 4PRID 3O0RH 2R0ZH 1IKOP 3KL0A 4OCRL 1U30A 3EKCA 3VJ6B 4B7LA 4ES9A 2XLLA 3FUDA 3BH8A 1WBXB 3RDTD 4UT7H 2X0UA 4YFDB 4RETB 1TEFA 4DIXA 3F7YB 5L0QB 4MA8H 1A6VL 3IXTB 3KH3A 5E4IA 2HLAB 2AQPA 3A0OA 5D1ZA 3X3FH 4NKIL 3N04A 5DQ9A 3GSQB 2XNAA 4PJ7E 3HUJA 3KPRB 8FABA 3MXWH 7FABH 1SBSL 2GAZA 5I1LA 2EC9U 2Q76B 3HRPA 4L1SA 3N1MC 4F8TA 5DYOA 2AJSH 5E2TL 3GNMH 3VXTA 4K9EH 1FL6A 5FUZH 3QXTA 5CS7A 5TF1H 1RFDL 1JTTA 1AZBA 3BFOA 3FONB 2WMPA 4PYHA 4L1DA 3PWPA 5FCUL 2RCSH 1C1EH 1CJYA 3RNQA 1WYJA 3ULUD 1B90A 5HGAB 3BKJL 5KAQF 5KSVB 2CO7B 5TF0A 3AABA 3L4YA 1F11B 3FZUC 4FKKA 4PRDA 5LBGA 4X6DE 4YIQA 2NY5H 2OR9L 1YDPB 1OF0A 2X89D 3AMLA 4X9YA 3RGVB 1BQLH 2XI9A 4NN5B 5TD4A 5I1DA 3N9GL 4M1CC 1F6AB 1FRGH 5IEHA 3O41A 4PJ9D 3O6FC 4YSCA 1DHKA 3KLAB 2LU3A 5C0NC 1AS7A 4EOWH 5E8PA 1FNGB 4HJTA 1OWWA 3LPWA 3GJFB 1VEOA 1S78C 4G3YH 1BLNA 5CJ8A 4Z3JA 2CQVA 5C6WH 4P3DB 5I8EB 3V6FA 4OF5A 5EV7A 3JYBA 1EDQA 1VEPA 1A3RH 2X2YA 5FCSH 4AYBA 3RWIB 2VN5A 4JPVH 1Y0LB 12E8L 5B21A 2VR5A 4U6VL 3CN1A 3DNKA 3G5ZB 2R69H 5IIEB 3DIFA 3QP3A 4WFHD 5IK3B 2JQAA 2OCJA 2FSEA 3GBDA 4JM2F 5HJ3B 2VN4A 5LKNA 2NW2B 4HWZB 4PWJA 3CSFA 1LILA 2X2JA 1FPTH 3NK3A 3X12A 3Q5YA 3AREC 4KO7A 4LVOB 4AQEB 1HH9B 1SOXA 4TVPL 4DOHB 3APCA 5BRZA 3SDDC 35C8H 2WB1A 3BVWA 3D0LB 1MHHA 1NAMA 3TGXA 3T1WA 9PCYA 3MZTA 1JE6A 2BY3A 2GIMA 2V2WA 4IIQC 4PCSA 5CILH 5HHNA 3FU9A 1NC2A 4M8VA 3K1DA 1EAPB 1P6WA 4ZW3A 1RZQA 4XVTL 1FJ1B 1E9PA 12E8H 2NSMA 3J07A 3CZFA 4G9FE 4Q6YA 4AIZB 3ZPDA 4BE5A 3MUHL 2ESVB 4UYQA 2BH0A 2Z35A 1HOCA 3DBXB 3W0WE 2D7MA 2DJMA 1JK8A 1NUNB 1OANA 2N4IA 4NNPH 3BP7A 2VZ3A 1F18A 4BWTA 1FFOB 1YEKL 4LSUL 4YNYA 1FA4A 4XRCA 2O6FA 1OAYH 2G9HA 4K7PY 5E2WH 2JQZA 1QOKA 2CUHA 5K9KA 3KBFA 2EXTA 4O5LL 4L2LA 5C0EB 1CFBA 4J1UB 1XGQB 4G80A 5BZDA 2XKNA 4LCIH 1FVCA 2Y5TB 1BZ9B 1X5YA 1TSRA 1JPSH 1E50A 4MCYB 1HXYA 1MJ7L 1XCXA 1B4TA 4LXFA 4XMZA 4A7SA 2OMTB 3E1ZA 4JY6A 4Z7NE 4KKBC 3TJHD 4ANKA 3QJFB 5CWSB 2E75C 3VNYA 4NP9A 4ONOA 1DVUA 1F3JB 1G7MA 2YKLH 4RSVA 3BKCH 3L3OA 4L8DA 5T3XE 4OJYA 5KSAA 1K72A 3J2PA 3OMIB 1OLZA 1VEMA 2FT6A 2VC2L 2XZQH 3POHA 5EBWB 3MREB 4R2GB 4G6AD 4F2MA 5B1KA 1HZKA 2IXQA 3CAFA 3O2WL 4IU3B 3UEQA 1AGFB 1GAFH 1TTBA 2HX7A 5CCKL 4WKZA 2X09A 3PGDB 4LSVH 1QRNE 3PGDA 1CFSA 1CGSH 4K23L 3VGHA 1KB5H 3LY6A 4DO4A 4HK0B 5LNGA 3T65B 1TMCB 3IB4A 3J27A 3L3KA 3FPXA 4AZUA 4JRXA 4LVEA 1YDPA 1F13A 1YYMH 1OOAA 2XCMC 4ODUA 3TC9A 3QIBB 3KJ4C 3GJEA 4MRBA 1HCZA 3FKUS 4L37A 4UAHA 4BK5A 4C56B 1MRCH 5DS1A 3GRWA 5FV2A 3ARWA 1RZKC 2MPAH 5HI3C 3KPLA 5CEZE 3PAZA 2PUQT 4ZO7A 3V6OC 4S1DD 4ELKA 4DP2X 1A3LH 2YD2A 2YC1B 1FIGH 3E0GA 1QNZH 2I85A 4ZMOA 5GS1A 5KJRH 2XFXB 2E8YA 1E5YA 2K4WA 3MC0A 2BRRH 3HZMB 4AKQA 2OL3H 4A2LA 3MMEA 1C5BL 2ADYA 1JN6A 3ABLB 4KK8C 4W9FC 4Y16B 5DHMC 4JE4B 1CGXA 1W8EA 3F7QA 5L8LB 3QUZC 2VR6A 5KSUB 4CC4A 1WHOA 1YA5A 4JHWH 2R2HA 4DPBX 5K1NA 3ATAA 2X6BA 4JFFE 5LXGH 1P4IL 3CFEA 3IGAB 4YFEA 5ID1B 5I1HL 1S9YB 1OCCB 3MO1A 4PJ5A 3Q43A 2GSGB 1AR1C 1I7ZB 2CZNA 4UT6A 5HDBB 2Q7YB 5DVKA 1U3ZA 2YRZA 2OI9C 3FCSA 4OFDA 2NY3C 2H3XC 5KYNA 3KWUA 1KEMH 3LZFL 3LQZA 3MRFA 3P0VL 3AT8A 4XMKL 4W6XB 3HAEB 3VW3H 1R3HA 1XD1A 4F7EA 3TEXA 3AW5A 1MCBA 1Z7JA 4A38A 5DFVC 5EBLA 4KX9A 2QLVB 4YHMH 3BJLA 1KELH 4JM4H 5TK2A 5IW1A 5TE7L 2G3MA 5LNDA 3QEQD 1OAJA 4N0FB 4BSWA 2EYTA 2YMXH 2IH8A 2Z91A 3U9WA 3KDPB 4PS3A 4A66A 1G9MH 3MRCA 1RZIB 3TCTA 4MZ2A 1X9RA 4U1JA 5C0DB 1IZJA 1MWAL 1HI6A 4UAOC 2Z8RA 3SCMC 2CR6A 5HY9A 2IEPA 1AE6L 2NY6C 3QH3B 4BGDA 4UV7L 3EO0A 3OG4B 4PJCE 5D1QB 4KZDL 5CN1A 1IARB 3C87A 3QRBA 2QGBA 4RAVB 2CHDA 1CXHA 1KTKE 1A3ZA 4ZXBB 2XU9A 2HCZX 3UROR 4HEPG 4Z7VE 4GSRA 2FWUA 1FV1A 1HX0A 4O2CA 3X14B 2MIZA 4YGAB 5CEXA 3DYPA 2BMKA 3S5LA 1Q9KB 1N59A 1F5WA 1NMBH 2GY7B 3LN5A 3DIVA 1G9MC 1X5XA 2FH8A 1TZHB 2ZSVA 3O2DL 4A7GA 3MLRH 1CK0L 1LO5A 2FEEL 4IGBB 4OCYL 1JD7A 1NIAA 1J5DA 1P4LB 3RNQB 2Z8SA 2GT9B 4I85A 4UOQA 5AVXB 1CFQB 3TJHC 1F4WL 3B2UC 2EDMA 4GP5B 4HGKC 5A2FA 3VTMA 1WFOA 1PQZB 4NI3A 3QH3A 4IGBD 2M26A 3QUMB 4NQXB 3SOBH 2OCFD 2CKBA 3CVIH 3K8KA 4R5TA 2CBTA 2E59A 1AOHA 3O6FD 2J12B 5CGBA 3T0BA 5TGBA 3GPEA 1P7KB 3K6IA 3IJYB 4AYSA 1OB1A 2HA1A 1BQUA 3LXUX 1OCOB 2BSRB 3O4OB 2ZCKH 4NO0A 2YARA 1AOZA 1QTYT 4ZQKA 3B56A 4MKMA 5I0YA 4UTAH 3GKZA 2WNWA 4Z77B 1HL5A 1VJSA 4W9DC 3WI9A 1OY3B 4MNHB 4PY8J 4CVZA 3BDYH 4HXBL 4RGNE 2BSBA 3HA0A 1XR9B 4Q74A 4F58L 4JO3H 2OL3A 1J8SA 4GG6A 4JNXA 1TTAA 3MQIA 5GZOA 1FNEB 2D9QB 5AWNL 5IFJA 2OTWB 3LN9A 3WS3A 4H1LG 1KB3A 2EC8A 1I1AB 4IK6A 3O8XC 4PRIE 2HTKD 4FABH 1GSKA 2XWTA 4P2OA 2VXVL 1MI5B 2EKSB 4KTEH 4AG4H 4HIPA 4MZIA 4XNUL 5EEXA 4KXDA 3NG5A 1KGIA 5DJAB 4KK9D 5E6IC 2O4EA 4P23D 1RJZB 5H94B 5C0CD 3VDAA 3G5YA 5IMKB 3FQTA 5JW4M 2DKMA 4UBDC 3HN3A 3CFEB 5KW9L 4F1ZA 2DQIH 2OMYB 1OM3L 4CVZB 3CCHA 2ILLA 3C5JB 1Q9WA 5DJ2B 4ZO8A 2AZUA 4HD9A 3UTTB 3D85D 5BW7C 2FX7H 4JFDE 2A6IA 2YGOA 2AJ3A 1I8LC 3MGOA 3OJ2C 4OD2B 3TO4B 3AFLA 5GRXG 2YKKA 1BAFL 1ZV5A 1ZWIA 4XBGB 5IFAL 3T04D 3WLWC 2WB7A 1GIGH 4HETA 3ZYZA 4E5XB 5A43C 1U91A 3R8QA 3VXMB 1B3JA 3GZKA 3HNVH 3RX8A 3DWTA 3TBSA 4NJ9L 4FMKA 3BAXA 2BJMH 3PNWA 4PJXF 2W0PA 1QRNA 1LP9F 5E1AB 4FL4C 3VVWA 2C9UA 2YA2A 4NI6A 1KJ2B 2CG9X 1YN6B 2XTJB 1K5NA 4NQVA 5DQDH 4IOSD 4IJTA 1IAIM 1OTUD 2G2RA 3KW8A 4F9LA 1X44A 3THML 1R24B 3MGOB 3MV7B 1SLVA 4PD4J 1MQKL 5F8QC 3T65A 4MAUL 3OSVA 2C9XA 3TASA 4P23A 4RAVA 4GAYB 5FKAA 4DTGL 5AG8A 2ADIB 5I9QB 3V95A 2CRMA 3MLXL 1UM4L 3EFOA 1EFQA 4ETQB 3K81A 1E5BA 3GS0A 32C2A 2PTUA 1K8IB 4TL4A 4DK5A 5CUSH 1FG2A 4BWWA 5AVZB 5JW5B 4JFYB 2K7PA 1S7SB 2EDFA 1OGAB 1F3JA 4X4YA 4DN4H 1JIBA 4JM2A 3MLTB 2X9YA 1N6VA 2QZ5A 3QWQB 1H19A 3FU6A 5HGHB 3FRPA 5ACMA 4LARL 3VXPB 4EO5A 2MNJB 1CLZH 3TH3T 5AW5B 4U3HA 5C0JB 5B8CA 4G70B 1HTYA 1NAML 3OR7A 4GG6B 1BFTA 3OKMA 1BQHG 3BE1H 4LLVB 2AJVL 4MAUH 1NIFA 2FX9L 1RIUH 2PPCA 1ML0A 1QRND 4NXKA 3VFNA 2BM3A 1O0VA 3O3DB 1MW1A 5D9SB 3NJVA 2V9TA 5E1IA 5DWUH 1D5RA 4QXVA 4A7VA 2Y36H 1ITCA 2YUXA 4HC1L 4LFHG 4KNQA 2BIIA 2PCYA 3BAJA 2YPLE 3MUUA 2Y06H 3C60D 2ZUWA 4JFUA 1AZNA 4RRPG 1TUPA 1EJ8A 1W72B 2VOTA 4N3TA 2VDLB 2GK2A 2VDOL 2WTRA 5AKTA 4GO9A 4GEIA 1EAJA 1P1ZA 3T0EB 3DPDA 4LHUA 1WBYA 1WC7A 3JWDC 1OE1A 2R2EA 2WQUA 2HB0A 3QNYA 4K4KA 1DL7H 4HUKB 4P9HH 1A7PL 3HI6L 4WI6A 5TDNB 2X87A 1IFHL 4WU5A 1IEAA 1SY6L 2EACA 4ONHB 4TQPA 4UCFA 4OZHE 5EZJB 1YEHL 1UD2A 1VFAB 3VRJB 1R19A 5F8RC 1SUHA 4WO4A 3MI6A 4NCC1 3V5KB 2ESVD 2Y36L 2V2XB 4NJAH 4XNYH 1ONQB 2XQYG 43CAA 4IHOA 1N7ML 2CLRA 1JNLH 1JXJA 2JIXB 3RVUC 3ZBMA 2OX5A 4RMBA 1ZLWH 3HG1A 3V4VB 3D50A 1E8ZA 3B7TA 3NQKA 2IIJA 2D7QA 2EH7L 3OM3B 3QQNA 3MV8D 4APXB 3EDKA 4YDJB 3PAYA 2BOCA 1TR7A 5BUGA 4QTFA 5EWIH 1TITA 3P3TA 2FQDA 4NQDD 1IFHH 4CMMA 2BZ7A 2DLFL 3GDCA 1O9WA 3F6LA 2BSCA 5J3HC 4OD1H 4GO8A 1T89C 1OALA 5ISZE 1MCJA 2NY0C 5F0JB 4WW2C 3QPQD 3TX4A 1CN4A 4M03A 2OMYA 4FAAB 5J06A 1Y6NR 3BAWA 3H9SE 4HBCL 1SVZA 2VABA 3GMMB 4AIOA 4FMVA 5B7FA 5EBGA 3RWCB 4KO6A 1LMKA 1N0XL 5EOCJ 2F5AH 2WLMA 3DUUA 3EDJA 1BXUA 2EXWD 4N1CA 5AYTA 3S9DB 4F8OA 1BBDL 2BVOB 5EFIA 1CC3A 4HLZG 4NQCE 3RWHA 3ZVVA 2VUYA 3OHMB 3O8XB 5CFHA 2ERJB 5BW7A 3U4AA 4M4RB 5I8OL 5D1XE 2EDOA 3AY4A 3D25B 4D8PA 4LVOC 2R69L 4KGLA 1YCSA 3BOVA 3CC1A 5IHZB 3QJOA 4OZGE 4WTZA 3MRJB 3RIAK 3SDXE 5I26A 4BCZA 1OHZA 3EDEA 5GGSY 5D72H 5JW3L 4NN5C 2HKFH 3SDCA 4QRRB 3AACA 3HTLX 2FQEA 5ENWB 2GI7A 3ZR6A 3D0AA 3PQYE 4Z77A 1M9WA 1BQ5A 2GAZB 1AQDB 2LW3A 5I1LB 5I6NA 3MV8A 4W4OA 3DV6B 2VZVA 3R0MA 4ISVB 3FFDB 1CFTA 4KKCD 4MQTB 4F3FB 3SYAA 3N43F 3M6DA 1E28A 3MNMA 1HILA 5GZOC 2Y6SC 4ZS6D 1AKPA 4ABQA 1MCNA 3MROB 4O58L 1CURA 2PKDA 4TVUA 5PAZA 1BBDH 4DW2H 3KPNB 1CYWA 4U1SA 3TA3D 2EUZA 3V4UL 1ECZA 1LWRA 5GS0D 4LLYB 4DP8X 1FZJA 2FHBA 5IVZA 1U8OB 3QG6B 3QUML 1D9KB 2ITDB 4WUKH 5CP3A 4XHJC 3F64A 2BY1A 4K8RD 2MMXA 2ZOTA 3C60B 4KO9A 4MZ3A 3VRJA 4G8FA 1HC1A 1G9NH 1KCWA 5J3HD 1NFDB 4OI9A 4PJ7A 1PZUB 4LEXL 1NZRA 3A3YB 1I7TB 5IGXL 3IGUA 3P77B 4FFZA 3JT0A 2CMRL 4HCRL 1FE8H 5TDPA 3WJMA 5EEZA 1QSED 1UH2A 5KVGH 2KI6A 5C1MB 2EIKB 2C9SA 1T22A 3SKNA 2H0FA 3VE0A 1U8NB 4XOAA 2HZHA 5JPNA 2C7UA 4OGXL 5ICYB 3QIUD 5C0AA 4U1KB 4OSUL 2NY3D 1UEMA 3V9FA 1J1PL 1XB6A 1OW0C 3B9KD 3CSYA 3VI3A 1ZHLB 4IM8A 3ULVL 4OQTL 4U6XA 4AK2A 5CU5A 4AKPA 3ZSTA 4TTDD 3UZVA 1ROWA 4ZPTB 4MNQE 5DHYB 3DTXA 1P4UA 1YEIL 3MGTB 4WK0B 5FYLD 3NZHH 5DK2B 3WFCL 2WVVB 5M95B 4QR7A 4NC0B 5D1QE 4N0YL 3O2DA 4V1DA 2D8KA 1XGUB 4ZFZA 4WY7H 1KB5L 2VXSH 1GS8A 3IU3A 5EBLB 1SQ2N 3I6GA 2D03H 3WNNA 4E41B 5I1AB 5JLZA 4GS7C 3MRIB 3WAJA 4XX1E 2YD6A 4GLRH 3QQDB 2XY1A 4ERSH 2XA8L 1KBGH 1NIDA 3CMOL 3AWFA 2EVIA 5EOQH 2YR3A 2IPUK 1JHKL 4UOZA 3VGDA 4AIZA 4G8AC 1OP3K 1SMDA 5CEZH 1T1YA 3G5WA 4KX7A 3EG9B 3BUYB 2DM7A 3QR2A 2BP5M 4NZFA 2KH2B 4GLRI 5KVFE 3QRFM 3T4YB 4D3CL 3QIUA 1RSYA 2C9AA 3BAIA 3N9GH 3QDJB 2FQGA 1TIUA 5IMLB 5IM7B 3UTSA 4NRXA 3NTCH 4LVNC 4XBEH 4YBLC 4CILA 2I9LA 4L3EA 5J7CC 1KGXA 1UKSA 3ZTCC 4QRRD 5BRQA 1DUZA 1JWSB 3P2BA 4N9GA 3WXVL 4RGNB 4PP1D 2NCMA 3QJTB 3S37L 5AALA 1JVKA 1QX1A 4JFXB 4JZNB 5EO9A 1A6AA 2EE9A 3QYMA 1EAOA 1YECH 4M7JL 4PGDB 3HC4H 2OTUB 2H1LM 1P2CB 4H25B 5DURB 3OXRB 2OSXA 1E3ZA 3KG5A 4X6CE 3MOAL 2VDNB 3BAEH 1F1GA 1VZHA 3CLEH 3D39E 5EZIH 1D7DA 4N68A 2R0LL 1QSZA 4AQ1C 2VDKH 1FVEA 4ZUUB 4QXUL 4HK0A 3RILA 4G6KL 1E4HA 4UTBL 4X0NA 4PLJD 4EEEA 3K72B 2CCVA 3HIZA 3U0TA 2CLVB 4YDLC 3APMA 4AJ0A 3MA7A 2VSDA 2PTVA 5GRVK 3RWGB 2J8OA 4GIOA 2AK1L 2Y0SA 2XVLA 1NCAL 3RVTD 5F7NC 3KVDD 2PCFA 4G6FD 3L3OB 4L8DB 2F7IA 4BWUA 4PLNC 4NP4H 2FATH 3MNVB 2HTLC 4ZW7A 1FZKB 4WI7A 2WWMC 3BPOC 1LL1A 3AJ7A 3GMQB 1QPKA 3LEYH 1TQUA 1ZV2A 1T22B 2LVCA 4HKJA 2P7TB 1KBBA 5CGYC 3BLPX 3B2VL 3HG2A 4WFED 4RZKA 2HJFB 2UYLA 4TRPH 2ETWA 2IANE 4N8VB 4QXUH 3UACA 2JNZA 3CX5J 1KJMB 2NYYC 1RZ7H 1U92A 4AEEA 5GRZA 4XPHH 1SJHA 2HAZA 3FUKA 2I60H 3I6KA 4XZ4A 4B5ZA 2P8MB 2VRAA 3N1GC 2DQJH 4M61A 4XCNA 4F27A 3AC0A 4HMDA 2I26N 3V0EA 5ESQA 1B4JL 3GSWB 2OP4L 5INCA 4MGXA 5IQMA 4CMHB 1G4RA 1NBZB 3O2DH 4CW1B 1AI1L 5FA3A 1MELA 4IDJL 1G0YR 2KZ1B 1AGBB 4BIKA 2Y24A 4LEOB 4MB3A 1AGBA 4PGBA 4X5XB 2V5RA 1JZGA 4GG8B 4Y4KD 1WFTA 1T1WB 5SWSB 4CC4C 5IJVB 5HPOA 1TTUA 5J6HB 2VXQA 4LF3B 3FTXA 4IRSD 5J11C 4HJ1A 3RVVD 4FCAA 5KBMA 3H1ZA 4LP4A 4LHQB 1PZ5A 3QVAA 4CC0A 1TZGH 5FDYA 3I6KB 1BZOA 4HZ1A 4OZFH 3RTQC 3VWKD 4A7TA 5MI0B 2OXGA 2SEBB 2IAMB 1A7QL 3GBNH 1QHQA 2Z31B 3VQMA 3GXIA 3U9UB 3HHRB 4ZTOL 1E90A 2UZIL 3Q6FA 1QUNB 2JV6A 2P5PA 4X7CC 1KLFB 1FGVH 1WA0X 1QSEE 2X1PA 4PY7B 4APQD 1QACA 2QMKA 2OAAA 3QFJB 5HGHA 1UXWB 5BZXA 1NEPA 2C4XA 2LHAA 1LEGB 5AVQB 4DVRH 4RDQF 3Q6GH 1RZGB 3RI5K 5FV1L 2Z8WC 4X4MA 3VI4A 5ALBL 4ZW5A 5LDSA 1OGAD 4QRPB 3MPCA 1FIGL 3PHOB 1R3JB 2F19L 1S8DB 1I8AA 4BQ8A 5HYJB 4PRHD 1M2OA 1QHOA 2JTDA 3ZHKA 1BEYL 2NLJB 4YBQC 5C70A 5AYQA 4KI5C 2OMWB 2JXMB 2NY1C 3GHBH 3IJSA 3U4BH 5LQBH 2BDNH 4WWOA 1JD9A 1V7NH 2TSBA 3NEEA 2UZYA 4X5WA 3K0WA 4OCWH 1ZEAL 1RUPL 2FL5B 4GS7B 2R0KL 3QUZB 4LSQH 5IZ7A 5AVVB 1GS7A 1L3NA 3O6KH 1BA9A 2BNRD 2CBOA 4CJ1A 2CO6A 1G7LB 4XGZA 3GRWL 5DMYA 3JWDL 1QPPA 2BJML 4HDIB 4YEFA 3TF4A 4AYFB 5I1EL 4L8SB 2XPGB 3BZFB 1FDLH 2DN7A 4NO2B 2FJFB 2Q76A 3IM1A 4ODHH 4PWHA 2A6DA 2R15A 3GSRB 3WFBL 5IUCA 5L0QC 4KZEH 5D1XD 4MAYB 1JZDC 3DV6A 3MKKA 5MEQA 3VH8A 1C16A 4MAYA 5EF0A 3BP4A 2NW3B 1J1OL 2WZPA 4N5ED 2EUVA 1J0YA 2VDQB 2XSKA 2R2EB 1WDAA 4UZGA 1HQRB 4PW9A 2XFXA 1ZT7B 4K8RC 3VXOA 2FHCA 3SGJA 2F6AA 1Q72H 4LSQL 1ZTXE 4BKTC 1NBQA 2P26A 4GQPH 4Q89A 3SDAA 3RTLA 2ZOWA 1N6UA 3ARBD 4L3CA 1PKQE 3VTTA 3ZK0A 2EKSA 4PRPD 3HZYB 4NZRH 4XBPB 1B6DA 3UJTH 4CU6A 5CD3A 3MCKB 3UO1H 4H20L 2A9NH 2GTQA 2ZOKA 3I9IA 2IV8A 5D9SA 2WBKA 4Y2DB 5EA0H 5I1GH 1TFPA 4XVSL 5CLYA 3TP4A 4J3XA 1BFOB 1E4XI 1GYCA 2VABB 4JFOB 2OL3B 4PRHB 4OCNC 3RGVC 2NY4C 3OKKB 4K8RH 4QIRA 2A73B 3EYVB 4GBXC 5C7XH 5TFSH 1AKJA 4PS8A 1DCEA 3O81A 2ZOUA 2HH0H 3IVKB 5CR8A 1V3KA 1I1YA 2E0PA 3JV0A 4I18C 2NXZD 4NLHA 5GGUB 3UP6A 4L1HA 1LO2H 5CWSA 4P2RD 1MCFA 3UJTL 2KHAA 3P9WB 1PG7H 2J25A 4MJID 5EU6A 5JR1L 3L7FB 2O61A 1HHGB 1UC6A 2FLRT 3U7AA 2Q3XA 4AV4A 3BVUA 3LZLA 2VQ1A 4ZPVA 1ADQL 1UXLA 3CVIL 1J8HE 3IFNL 4YSSA 2G2NA 1KNOB 2VLJA 1WWWX 1YNKH 2HKHL 3FO0H 4G6MH 2WCGA 1IBBA 4OJAA 2KZKA 5B7EA 3HBZA 1DBJH 5AW0B 2FJGB 5K9OA 1UJ3A 1XGQA 2UUDK 1UUNA 3ARBA 3ORJA 5I0WA 4K7FA 4XO9A 5IMLA 2K6ZA 5ANHA 1KGWA 4K15A 3QE5A 4K7FB 4G6AC 4P5RA 3RJDA 3QZNA 4K3GA 1UD4A 1XCTA 1NFDF 2Y23A 2ZE0A 2G0LA 2EVGA 4QRTB 4IIQB 5IVZB 3PNWB 3MNZB 2I07A 2Y4SA 4IRZA 4PB9L 4M6NH 4UT9A 3UIYA 3KYNA 5L7XH 5EIQA 4CMHC 4D8OA 2EH8H 3JYCA 1Z9OA 5KAQG 3LKPA 2EYRA 1HI6B 4I2XA 3CZGA 5GJTH 3PHQA 4G6ML 4PWFA 3RP1A 5GPRA 2C26A 4H40A 4WI4A 2ZCZA 4YHYB 3VXSB 2GTZB 3D5OF 4EDWH 2J8UA 3RY4A 1HINH 3WIHL 4QXWA 4HUNB 4MXVF 1QBMH 2YAMA 3VFNB 4LKCA 5B3SB 2QGEA 1E65A 3B3IA 3N2JA 5TQ0L 1DSYA 1A6TA 1QA9B 1T5XA 2EDNA 3WEOA 4JB9H 1LGVA 1F4XL 3IF1A 3QFDB 4WTWA 1QPXA 3HZKA 4ZG1A 1FZMA 4IKNA 1SBSH 3IBOA 4I48A 2CH8A 3PY9A 3EDDA 1EGJL 4IOSA 4QD2E 4LT7A 4YSPA 4YSRA 1KBWA 4FQQB 4JANA 2YAFA 3U1QA 3SO5A 4XH2A 3JV4B 5AL8A 4B53A 2WLKA 4P2QA 3NUKA 5I8EA 5IB1A 1BLNB 1T1ZA 2CJTA 3H6JA 2ZUTA 5EDSA 1NLBH 1D6VH 3HE6D 3KCPA 3NFSL 3SKNB 4JRFA 3TYGL 5I2IB 4NHUB 5GS3A 4PRNA 4FI7A 1GZPA 4Y19E 1P4BH 2CDGA 2B16A 4Q6IA 3QR0A 4UWQB 1EBAA 5DD0L 4ZUVB 3RQ3A 1DZ0A 1MLCA 3UH8A 2F7RA 1D5XB 5D1ZD 3U7YH 1QAWA 4PJBF 1TPXB 4J8RB 2AXHA 4MS6A 1YYCA 4P06A 4PJHF 2ISDA 2CIIB 4BUGA 3K5SA 2G3XA 3ZE0B 3LKSB 4BQCA 4JRYE 1E5UI 3KAAA 4CRPA 4JPIB 5GS1B 3MRRB 1S7RB 3ML8A 3T0EC 5C6PB 2C3VB 1JF6A 1UYWH 1NGZB 3QAZB 4KKLD 3VXQB 4MYPA 2AMUA 4OAWA 3CFBA 4I0PB 1E5ZA 4JPVL 1A4BA 4RX4A 3X3FL 1KMGA 3EUDA 4OM1L 3IGLA 4MDJB 1LJMA 1L9OA 1M05A 2Z7ZA 3K6NA 3ZE2F 2X3AA 1L3WA 4HIJA 1LK2A 1UVQA 4LASH 3NABL 3ZMRA 2BVQA 5D4HA 3MV8E 4HJJL 1BFVL 2ZUVA 2IO5A 3K6SB 5LCVH 3L5WB 4UM9B 1CR9H 3VUAA 2FJUB 5AAMC 4MHHI 4ZSOE 4WZ9A 5ACZA 3UTTA 2V9UA 4P57B 4GRLA 3ZL1A 3WO4B 5IFHH 3AWGA 3NFPA 3T1FA 3BN9C 4GW4B 4OVUA 1ZLUH 3WN6A 4CVUA 2HFEB 4DZ8B 2Q9OA 1N8ZB 2QFRA 2OMXA 4GBXA 2HPTA 3TFBA 3TV3L 3UPCA 5FYJE 2YMOA 4ABWA 3BHBB 4PREA 1NBYB 1CIUA 1DBAH 1AMYA 1UYWL 4FJYA 3UX9B 3E6FB 2R29A 1C8PA 2PO6B 3BGFC 1MFMA 4OIBA 4ZRGA 1A4CA 4AW7A 2B1AL 1S7VB 3R4DA 5E99H 3QDGA 1JDAA 5I1CL 1CB4A 3O3DA 3OVUB 2F0CA 2HVJB 4G5AA 3K2IA 4J23A 2F8OA 5I71C 5FUCC 2HG5B 4KUZL 4UU9B 4I4WA 2IAMA 3L4VA 2ZXWB 3KGSA 4OJEH 4I4WB 2R8SH 2QVMA 3ROOB 5HHVL 1SY6H 4A67A 7TAAA 2WO4A 4G80B 3PDGA 4QMEA 1J05A 5BZDB 1JGUH 1LO4L 5B8CB 4OZ4B 1MRFL 4L5FL 2DKSA 2VUOA 3FDWA 3IS0X 2GTZA 3DSFL 2G9HB 2BS9A 4HPOH 5H4YA 5HVGB 1IBGH 2NYYD 5BRZD 2R2CA 1HWWA 5G2NA 2X4SA 1VB9A 2X88A 2ITCB 4PTTB 3VYOA 2ZYIA 4Z7WE 1FYTA 4UB0L 1ORSA 2MWCA 5JXAH 4ZO9A 1ETZB 1OXYA 3MRHA 5HJBA 5L9DH 1WAAE 3KYNB 4AEHL 1IM3A 1DQDH 4RBPH 3LQAH 4XNZC 5KSBE 2E7DA 3I6LD 3OAYH 2ICEA 5F44A 4ODSH 3SY0A 5C3IA 1G0DA 3U6RB 1E9OA 4HWBA 5D70H 2Y22A 1UXSA 5D7LA 3I02A 4YPGA 3GS4A 3I02B 2GJ6E 1MRFH 1IFGA 1RULL 4M5SA 4N2IA 1JFHA 2R1YB 5AB2A 1DVFA 2Q8AH 4WHDA 1RK7A 4XP5L 5FOJA 4Y4FB 3FB6B 2Y1YA 4DPRA 5I5RA 5MERA 1NDMB 3TVMA 2CLZB 1UD5A 3EW3B 4WW2B 4OW6A 3MNWA 4JO2L 5JPMB 2DWTA 1MG2C 4OLXH 5DRNB 1J10A 1E9QA 2JI1A 2WLIA 3I3DA 4RDBA 4U0RB 5C97A 5IIEA 3BPNB 1DQDL 1N4XH 4A7QA 1YEKH 1EK3A 2DYPB 1G7QA 2YRPA 2IFFH 5ALCL 5JUEH 3EH2A 3BWAB 1W80A 3GMLB 5F97E 2QEJA 1BW8A 4ODSL 4LLUA 5D2NB 5SV4A 2IAAC 1A7NL 5BO0D 1F58L 5KJRL 4JFFB 5D72L 5JW3H 2R9HD 3KGRA 2BVUA 3P73A 1WIPA 1NIEA 3Q3GB 4GYBA 4KRNA 1JFQL 5D6CB 4PCTA 3TJPA 3PAUA 5IW1B 3ULSA 1OSZB 4KQ4L 4FLRA 5DT1H 5EOTA 4M8UA 5IVOA 4XP5H 1VIWA 4FI6A 1HL4A 4KOCA 2NQ3A 3HS9A 3REVB 3NSFA 3SBRA 3NRQA 5JOPE 1HVXA 3TOPA 3U2SB 5JIKA 1U0QA 4PV9A 5FO9A 4KROB 2EDHA 1HWGB 1I31A 1NINA 1OPGL 4LLQB 3ES6A 5IOPB 3EO9H 4X4YB 3M8OL 1PEWA 3TEWA 4JFXA 1F3RB 1CXKA 2UY7A 4B9JA 1JHLH 3ARPA 5IBTH 2KUTA 4ZFOL 2GCYB 1G7IB 1RUML 1WT5A 3SYCA 1ZA3A 3RHWF 2O26U 3NJIA 3S6CA 2VDRH 5CINH 3NCFB 4LSVL 4XP4H 5DJZA 1UB6B 3CUPA 3SE3A 1CVRA 4MHHG 2P5ED 5DRZB 5E2UL 2DMHA 2CBPA 2M1KA 4ENZA 3ARYA 5EF3A 4NRXB 3DUSB 1TVBB 2H41A 4HKBA 3MV7A 1QBLL 4EVNA 1ET8A 5AQ0A 3ABMB 4M56A 3GSQA 3HEIB 3UAJA 1QR1A 1YJDL 2W0FB 2D0GA 2YFOA 3PL6B 4YR6B 4Y9FA 2H26B 2AF2A 1QW9A 3RU8H 1HNFA 2EDBA 3SDXB 1OPOA 4QXGL 5D93C 1UZ6F 4QCIA 4I1RA 1OTTC 4WJKB 2JLLA 2AEQL 2DQTH 1Q9OA 1TTCA 2CDFB 4Q4EA 1T4KA 2WSKA 3LXAA 4PJ8D 3I9PA 1JJUA 2A0LD 4YXHL 1HNYA 3UOAB 3PWNB 5E51A 4MDIB 2FIKB 2L8AA 1R5VB 4JRXB 3HI1B 2UXVA 3WN5A 1GZHA 5BXFB 3H6AA 1NFAA 3UC0L 5E56A 4N22A 4PJFF 1K4CA 4HWBH 2VLKE 1KB5B 3T0EE 1JPSL 3A21A 2FGWL 2LLGA 4F92B 1D2OA 2AEWA 2NY7H 3HS0B 1WIUA 4G6JL 4A6YA 2AZAA 3HI5L 1HL9A 3MV7D 5I8KH 4YDMA 1BZ7A 1QSFB 3CX5K 3H9ZA 3I85A 4HGMA 4FQQA 1RUKL 4HEMA 4YZFE 1I1RA 1UOLA 5DK0A 3RZWA 1TKWA 2AP2A 3F7RA 3IFPA 4JG9A 4MTMA 3TJEL 2O5ZH 1ETJA 3ARGB 3OC8A 1GJWA 4YLQT 2V5SA 1PG7X 4WCYH 3AMKA 3UAFA 3ZZ1A 3ESUF 4ZNEA 1YQ2A 4G9FD 4AJVA 4ZX4A 2DLEA 4XOBA 4ODVL 4RZCA 3ZUCA 4HJIA 2PCPA 1SFDA 2VXUL 4Y2DA 1AR2A 4G8FB 4X7DC 3CVHL 1S7UA 4C56E 1AXTH 1IGYA 1KCVL 2GJRA 3C5ZD 2NZ9C 1M3JA 4GOSA 1H0DA 1NBYA 5L2KE 2EADA 4DGYL 4GAAA 5L2JB 3G6JB 1AHWC 4NNXB 5CM1A 1M1XB 5I16A 5ISZB 3C6LC 1KXTA 2B3RA 2IH9A 2XBZA 4PJIA 5ISZA 2O93L 5FKPB 4LL9A 4GAYA 5IROC 1IM9D 2BSEA 5L2KD 3FU7B 3LRMA 5AKSA 2WO2B 1KY7A 5MP6L 3WO3B 3VA6A 4EE2A 5FOBB 5EZIL 3TN0D 3EBIA 1BJMA 3P4OA 3REWB 4AIEA 4D0BA 2H32H 4NQVB 3JWNE 4M62L 1MAMH 3TNMA 2ICWI 1BOYA 1EGJA 2FJGA 5T5NG 1RI8A 3DYOA 3TA3B 1LVEA 2WQSA 1Z66A 1KNOA 3S8WA 2CR3A 3W2DL 3TZVC 1S3RA 4KROC 5EIVA 3LS5L 4ZSOA 3QISA 2PABA 2BC4B 1WD9A 2Q2LA 1ZGLB 5J9PB 2BVPB 5F9OL 1EERB 4U33A 5BMFL 1FSKC 4PJ8C 5KS9E 2WPGA 5D7LE 4BQBA 1GTFA 3MKGA 2VN7A 4IMLB 4PG2C 3U82B 4KNTA 3VB8A 2O5YH 1UGKA 2EYTB 5GZNA 3GMMA 3D2TA 4QPEA 3MSPA 2MH4A 3P30L 3T4AC 4OM0H 1SXNA 4J28A 3O41B 4A2DA 3WFDH 2H6OA 4P9HC 1AGFA 1CYGA 3Q8BA 3BPNC 3HHSB 5C7XL 4HV8B 1MQKH 1SJXA 4XVUD 3FT2B 2WXHA 4H8WC 3DOHA 4NOFA 4NPKA 4LPYA 5E08H 3L4UA 1CZ8L 3V7AE 2NQCA 1V5JA 3NIDE 4QOKB 3TVMC 5CZVL 3R4RA 4AGPA 4Z7QE 4JKWA 3FQNB 2NTSP 4G7YH 4I48B 4JHUA 1MWAH 2B39A 1YEWA 2XXCB 1V27A 4KITB 3C09B 3KEHA 4DN4L 1BM7A 3BIAX 3PWPE 1XB8A 5IB5A 5GRYA 3LNEA 5AZEL 4AC2A 4OF3A 4APQA 2R4SL 3LH2L 5K1JA 1U2HA 4UIMA 4BGLA 5F7UA 1QO3A 2ENYA 4OM0L 2B0SH 1JZIA 3DX3A 5BRPA 1PW3A 5DO2C 1H6UA 3RYMA 1FH2A 1SXZA 3I50H 1WEJH 5IV2A 2DQHL 3NZ8B 3MMEB 3VG9B 2A74C 5DMIL 4BUQA 1HNGA 1WBYB 1MFBH 3CPUA 5E94A 1IIKA 2DQDH 5HD8C 1EO7A 3LEXA 5DSCB 4XI5C 1G7LA 4XGZB 7PCYA 4JPSA 3FOLA 3JV5A 5GRVL 5ABZA 3QEHA 3D9AL 1SOKA 1FO0A 4I3RL 4ALAL 1NMAL 1WV7T 4Y1TA 2ZUQB 2N56A 4WSJA 5CJXC 2NY2B 3RY5A 3QULB 5AFAA 4IIZA 2C3XA 2P8LB 5FGCB 3SKOA 2KLSA 3U4EA 4E41E 1EO8H 2CCLA 4FTDA 2AJUL 1H8NA 3ZY7A 2CDEA 3B2XA 1IEHA 2YXWA 2DYRB 1XGUA 2ZCKL 4QF1A 1U92B 1T0PB 3ZTJH 1KXQA 2JKIS 1QFWH 3KPOA 2ZSWB 2K6WA 3FW6A 3ARGA 3PPSA 4YWGH 3GHBL 1T5KA 2JJUA 4UM8B 4U1NB 1FVDB 4ZMNA 4BH8A 1UD6A 3KMDA 2XZCL 3PHOA 5EZPA 1JZFA 1KGCD 4Z23A 2BERA 1YNTF 3S4SA 4KQ0A 5I1IL 2WKLA 2LGNA 2DYPA 3GBLA 3UZEC 4XNXH 4AWJC 5AZUA 1H3PH 1YEJL 4YDKL 3ULUC 3TN0B 1UXWA 4JPQA 3V0FA 2HMIC 4E68A 25C8L 2HX9A 2B77A 4MWFB 1CGTA 4GBXB 4P46A 3PGFH 1I9RL 2FJSA 5DJYA 4R0LC 1MF2L 5DYFA 3SDAD 1D6VL 1FVCB 2ZSWA 4MXQC 3VD2A 2BHYA 5EUOF 2ZXDA 3NSJA 1MNUH 2DOCA 3DJZA 4LOUD 4QGYA 4KRPB 5K33A 3JTTA 4WO4C 3HRZA 3ISWA 1PIGA 4P5TA 2QSQA 1LK2B 1UVQB 3VVVA 3ZKSD 4XNQB 5D1XB 4FNLH 2ZPKH 5DZJA 5J89A 5D5MB 1AH1A 4FYTA 4XPBH 3VXME 2G5BB 4M8QB 2A38A 1EBPA 1SOSA 2K1MA 4H8VA 4NJ9H 2EO7A 4FP8L 4W9CC 1FCGA 1XXFC 1PKQB 4V11A 3WUWA 1HILB 4B9IA 1CGVA 3Q8AA 4FZEH 5L4IA 5BOJA 3AY4C 4X7EC 3OKOA 4U1GC 1IC1A 1QD0A 4HW6A 1CD0A 1A7OH 5IV2B 2HMID 3CN0A 3RUGA 5FYKU 1OSYA 4BKSC 4EVNB 1H3WM 4XP6L 1Q0XL 2P4AB 4OZHF 2FJFA 3HKZA 2UVFA 3DMMD 1D5MA 5FK9B 1BP3B 2X9XA 3PXJA 2J1XA 4OGYH 4M7LT 2HRPH 1T0MB 2MQ3A 2JCWA 2D4DA 4EOWL 1IFRA 1DJIA 2P44B 3QW9A 2WKOA 4U2YA 2J6EA 5C9JB 2X6UA 4J4PA 2FL5A 2BSTB 3JV4A 4XP1H 3T08A 3SZ6A 1JRHH 4POUB 1RERA 1MCHA 1CL7L 4LU5H 5HBBA 1A6VH 1E4KA 3QUXB 4ODWB 4CL7A 3I6GB 4Z9KB 5F7EH 3FQXB 5H2BB 3RFZA 1PFOA 3INUL 4HIIA 4HZLB 3X13A 4JO5A 3II3A 1J8HB 4PJGB 2DQEL 1WZAA 4C57C 4IW4C 4DFIA 5B39A 1IGJB 2F53A 4XCFL 3AB0B 1T03H 4AIXA 4LEBA 3U7WH 4LDOB 1TYEB 4Z76A 5E2TH 3I74A 2WOYA 3QJQB 1AACA 4M5ZL 5F7WC 3ZE2B 4Z7OE 2D4FA 2ZG2A 2AABL 1RHHB 4TV3A 1FBIH 4HVBA 3HNTL 5SWQB 1IGTA 1BM3H 1PSKH 4M02A 3BFWA 4HPOL 1Y1DA 2E46A 3FQ4A 1DDHA 1INQB 4FOMA 3TCLB 3H55A 4X5PA 4Q8BA 1OSPL 1VLXA 1KIPB 3CFQA 4PB0L 1XF5A 3WE6A 3DTDA 2F2HA 1RSFA 4ZBJA 4JAMB 3QQ4B 3S5YA 4L0ZA 2XV2A 3G9VA 1OLLA 4D9RD 3SDXF 2OXGB 4PJ7F 1FFPB 3F3HA 5J12B 4QJ5B 4J4PD 4NNPL 5IBUB 1PVHA 3KGUA 4G8GD 3U7WL 4NQCA 1WZKA 4YGVA 2WJ7A 2DMKA 2Y25A 2W5PA 4NQCB 4MS8C 4OLUL 3ZGIA 4Q58C 1AP2A 3APNA 1WA2X 1B2WL 4Z0XB 1MVUA 2V5TA 4X9BA 4N0CD 4N0YH 1PG7W 2WXNA 1J5OH 2XN9A 1VGEH 5GISL 2B14A 3GLZA 4FZ8L 1MVFA 1KXTB 1OCWH 4X5QA 4HIXL 5D8JH 3MRGA 4PB0H 3B83A 5HY9B 4ZW8A 3MROA 5EU6B 3UZQA 3WNOA 4X6DF 3WL9B 2ZUSA 4KZCA 4RNRB 4DN3L 2WBJD 3GRGA 4R4BB 4I77H 4HUCA 4FD0A 4JFZL 3NK4A 2VDML 4TVPH 4FTVD 4OLVH 4MA8L 5EG6C 3KE0A 3FHQA 2EE6A 1P4BL 1A7NH 3S96B 2GTWA 3KWTA 3UDWC 2FBOJ 3IE9A 3QC6X 5GS2D 4NFCA 1ZMYA 1YPZE 4DP5X 4XCEB 5IVXA 5LGHL 1CQKA 5C08B 1S7QA 1C7SA 4HKJB 4B3VA 5K9JH 4PMFA 4ODBD 4XVTH 2Y07L 1JCKA 2J8UB 3CFJA 3FTWA 4NWUL 3UGXA 4JJ5A 5T1MB 5FO8B 3S2AA 1WFMA 3Q2CA 1GPOH 4OD3L 5EC1A 3ZKXC 3AAZB 5J1SC 1ZSDB 1Z5LA 2ORBH 3CSYB 3QZMA 3CG8A 1KXHA 2ADGA 3K8MA 4C58B 2PCFB 3MV9E 1ZS8B 4ABUA 5MI0C 1EJFA 1NGWA 3BW9A 3HE7C 3P0GB 2VSMB 3SDAB 4BSJA 1CI5A 1YVLA 3X3GH 1S9YA 4PJ5B 3QG7L 4JO8A 1WTGT 2JMRA 4MAYC 2L04A 5DD6B 5TPWH 1MIEL 2Y7NA 2QHLA 4W9KC 3IPFA 3BQVA 1SJVA 2HFGH 1JZJA 1NCCH 2I5YL 5D7IF 5IQLA 1I7TA 1SNRA 3DX2A 3T4AA 3OGOE 2APWA 4RGOH 2G75B 3VX0A 2XX1A 3D3VB 3HUJE 3NRFA 3JZYA 5EF2A 5BUAA 3KLQA 4FQJL 2CGRH 4FYSA 2GKIA 1HSAB 4OCRH 4Y8AA 3CZEA 2GW5A 3WFHB 4MDJA 2J73A 4PS4H 3OXSB 3FBQA 3QQ4A 2FYYA 1TVDA 4NBZB 3ZDZB 1B6UA 2WXFA 2EICA 1NCWH 3BFQG 2E74C 2KDYA 2OJEA 3BVNA 2WQWA 3COOA 5AOIA 2YUVA 2CJSA 4XC3L 5DJ6A 3S5ZA 3KD4A 3BDXA 3FSAA 2R4RL 1S7WA 3NAAH 3QJHB 3SCMA 1JWMB 1KPVA 1XGZA 3NIGF 4PHZA 5CZXD 3SGKC 3VSQA 3CDGB 4E42A 2F15A 1NAKL 2ICWA 4LDLB 2DJ4A 2QBWA 2A6IB 4PJXA 2P43B 2V3EA 3DUSA 3BCFA 3KPSD 2VMJA 2FTAA 2TAAA 4I3SL 3ARFC 3QNYB 4V1DE 2IWEA 2B4CL 2NNXA 1KPRB 3CN3A 3KPMA 1JZEA 3QZBA 3RDTB 1T7YA 4TKWA 1VSCA 2NNAB 5I2IA 5DGQA 5TE7H 4R96B 5FCUH 3MRJA 1BSIA 4K5OA 3PL6C 2WXRA 4GQQA 3PGCA 1COBA 1IAOA 3OG6B 4LPVA 2XRAL 3RPIB 5IJDC 3G6AB 2ENJA 1WZ1H 2DIJA 4U7MA 2AQTA 4UZUA 3H3KA 2N0MA 4PY7A 4NQTA 2YEQA 1C5BH 3L16A 2HJKB 3GI8H 1BF8A 4F37F 5FDWA 1X9QA 3BQUC 4XXWC 4F91B 3QPKA 3ULSB 4XCEA 1UOVA 3TNNA 1QSEB 3OR7B 4XWGH 1BXAA 2DLHA 1BZEA 4UBDD 1WG3A 2WQAA 3LD8B 3MV9D 3SE9L 3NCXA 2GJ6B 1QLEL 1SRDA 2FZ3B 1FWXA 4R4BA 4RA3A 3SE4C 5I17A 1JWUB 4MXQD 3RPIA 3VFWB 5JORA 1TXKA 4B9FA 3V0VB 3U46B 2PTTA 3B2VH 3RHWK 2R29H 1FPTL 2WUBL 1HQ4B 4N2MA 1MJUH 1L7TH 2IGLA 2BNRE 4XPFL 2BHUA 3GI8L 1ZK9A 5JUEL 2FO4B 4NC1C 1Q94A 4YHZH 3JTBA 2R1YA 1KV3A 1XH2A 4JM4L 2RALA 3RY6A 1XCTB 4W9GC 3DTUB 3VXRD 2YUZA 1SN5A 1S78D 2EDTA 2DQJL 3DGDA 1NM9A 3MRDA 1B0RB 1NC2D 1SDDA 5DD3L 3UC2A 3DLQR 2OP4H 3F05A 3U6XA 3X1GA 1MAKA 2VR7A 4LPCA 3EYFA 4IEFA 4JFTA 3OKEA 3H56A 2BNRA 2BSSA 5T5FA 3WKMH 3ZSSA 5CF3A 4JY4B 5D93B 4PP2B 3TT1L 3V0GA 1TMQA 4DQAA 4DEPC 3N91A 1T2JA 2XKUA 1YEDA 2JE8A 2WTRB 1KIQB 4JREB 4N28A 5ABAA 3A67L 4KKZA 1VACA 5J12C 1INQA 3LKNB 4ZAKD 1MJUL 1I9IL 4OGZA 3WE1A 1KG0A 5CCJA 3WDJA 3NESA 3WHE0 1AHWA 1PZ3A 2X4SB 4HH8A 3L9YA 5E2WL 4AV5A 2XWEA 4F7PB 3HB3C 2PYFA 4X83A 2CBMA 2YD1A 4Z7UE 4KK6D 3HZ3A 3GRWH 2HRGA 4XNUH 8CGTA 4CUCA 3NJKA 4LIQE 3KS0J 5I1EH 5E4AA 1MCWM 2F53B 1GZPB 2DQGL 2W9DL 3CFCH 2APSA 3IWUA 2H8PA 3WFBH 2Q3AA 1LTXA 2C9VA 3NSYA 4PRHA 2EVHA 2C3WA 1BFOA 2IADB 3MLVH 2UY7B 1WFUA 4JRWA 3L54A 3QUKA 5KBNC 1PY9A 1L7IH 1X4ZA 1JZ8A 2N59A 4MJ4A 2YA1A 4E2OA 1R3HB 4TYUA 3N3EA 2D3NA 4U7KA 2DL9A 1BCIA 2YAQA 5LJYH 5HHPA 4YHOH 3ZTJG 3QGVA 4N86A 4WWPA 3SOBL 5EEYA 3B4NA 4ZQTA 4EIZC 4DGVL 4LIQL 3HZYA 2W94A 4GG8A 4RCAA 5CGMA 3BHBA 4PREB 4A37A 1UTDA 3PFUA 1HK6A 1L6XA 2H5UA 2VKWA 4XXWA 4NQEE 2A3TA 4EN3A 4Y19A 2B5IC 2IDQA 3LEXB 4M6OL 5E5MA 2QL1A 4MMYA 3RIKA 4CNIA 2SODB 5E23A 3FOMB 5BJTA 4XVSH 2W9DH 3TYFB 3BDYL 2ED9A 4P57A 4JFFA 3IDXH 1U33A 3FF8A 2HUEA 3B7SA 1WISA 2CPCA 3RVTC 3HPLA 4MMZB 3VXNA 4DUVA 2N1KA 3VD0A 4OZHA 3OGCB 2B0SL 5B3NA 3ZKND 1K5NB 1L7IL 1XSIA 2BLFA 3H9SA 5HDBF 5HYJE 3J7HA 3F7YA 4YHOL 4CBZA 1OZTG 3OQ3B 2WSPA 2H2PC 1CXLA 3UEZA 5KBPA 2Q1EA 5CCGE 4JCMA 5FEBA 3GMPB 3IGKA 4M5TA 2E4FA 3I9AA 3ZHLA 3DX7B 4UUJB 5CN2A 1ACCA 1DVFC 4XO4A 2O5XL 4GAJL 3IDXL 3S5LB 3V55A 2D3LA 4PWGA 5IJBC 4UOW1 2JFCA 3VRIA 1PLAA 4IRJD 1DBJL 2AEPH 2OMWA 3O11A 3SQBA 3VFSB 3TFKD 2KBGA 4NBYB 1EZLA 1NANI 2DM2A 3ZKMC 1CFNB 4WKZB 4XXDA 5IHUL 3EJUA 4CKVX 3EJCA 3L48A 4P46B 1FVEB 3PNRB 3FB5A 5AB0A 5KSBB 4R7DA 4YC2C 5J0BA 2NX5B 1ORSB 2NZIA 4TVPE 2WLLB 3WLBB 1KIUB 4L4TA 4JO1H 4KRLB 4YUEL 1MY7A 2ITCA 2XZAH 1JV2B 4H20H 1OE2A 1UUSA 1YUHB 1MNNA 4HPHA 4X5RA 4P2OB 1AGEB 3FQRB 1IV8A 1N68A 3CFUA 4XAKE 5IQNA 1OP5K 1U8MB 3DA0A 4OZGB 1J05B 2Y7MA 4Z76B 5FUOL 1U8LB 3FAWA 1WAEA 2Z7WA 4TF4A 4M9OA 1DEEA 3RNKB 5D71H 5KYUA 3OHXB 3LMJL 4PJCA 3VSUA 1XF3B 2Q5BA 2Z4QB 4JG1L 4X8CA 5IEKB 4HMCA 3GYRA 1JI1A 2HH0L 3H2PA 4JMXA 2YPVL 2FQFA 1F4YH 2VLLA 5DLLA 3QUYD 4YPJA 3VD9A 3L9BA 3MLXH 4DVBB 4JPKL 2WYZA 4U1GB 2OK0H 4JGNA 1VKXA 1TJHL 4FQXC 1ZHKA 2A4EA 3MRMB 4BXSV 2ZWNA 1OB1B 1NEUA 1U6AL 4LVHB 4EUPH 5FLUA 4ICXA 4TQHA 1BV8A 1U58B 4BA8A 3SDDA 1AS8A 2B2XH 1F1DA 1VERA 4MLIA 5BPPA 2H1PH 5LLIC 4NJAL 4XNYL 2WXIA 3AITA 3O6KL 3FYEB 1WAAA 2DDQL 3GSOA 1WSST 5IVNA 4W68A 3MBXL 3ULVC 2ZF9A 1R33A 3IDIB 2AAAA 5EU4A 2WBJC 1CE1H 2A7BA 4KKAC 1IGYB 3M07A 4N2DA 2QSCH 4JFEA 2E3VA 5IHLB 1ED3B 2BVQB 3T8MA 1JN6B 2DBJA 3ZE1E 3ZT5A 2QVIA 3FQYA 4XMWA 4XP6H 5DRZA 1EXUB 4XX5A 4HIHA 1U41A 5FYKE 3KR3L 3RBSA 4AGQA 5HI4C 3G6JE 1CTMA 2PXYB 3MAWA 1BAFH 4XN5A 2Z64C 1FC2D 1LDSA 5GGRA 3FTVA 3IKCA 3PV6B 4PQXA 4FE9A 1ZVNA 4AYID 4ANWA 2E7HA 4NWTL 1Z9MA 3V4VL 4ZFFA 3ARSA 1ZLVH 4ZOEA 4X99A 5C0AE 3LPFA 5IF0A 2PPAA 2ZXAA 3MRCB 4ICWA 1ZWIB 2UZYB 4LMQE 3UO1L 1JAEA 3N40F 3DRTB 4JZOB 2EEFA 4L2YA 3UBXA 1PS3A 4PRAA 3SDDD 3O9WA 1OAQL 4HEPA 1KPRA 3RDTA 5KZCB 1I1FB 1W0VB 3SQOH 3ZJAA 5GZOD 2AANA 1O75A 5DMGD 2XXMB 1AAJA 4OGAC 1WS8A 3M17B 3DVGA 4QRSA 3HI1A 1EGJH 1XR8B 5FYJL 3EBAA 4WWID 3FFCD 4BJLA 2Y7SA 1FGNH 2DH3A 1SM3L 3L08A 5HDWA 4CBPA 2VXVH 5C07D 4LPWA 4H25A 3D3VE 1AO7D 4WFFE 3GO1H 2CDFA 3TM6A 5DVOA 4F24A 4UT6L 4JRXE 4ZOCA 3PWJA 5CXPA 5FECA 4L0YA 1DQVA 2I24N 2BXZA 3FB7A 1FNEA 4N2LA 3GXDA 4IJ3B 2YGVA 2N1TE 5IY5B 2E6JA 5JNYB 5EULV 3V4UH 1I3UA 2VDNH 2V37A 1YNKL 3FO0L 3ZMNA 5K39B 4PJ9C 3VWJD 4IBUA 2B5IB 4S2SA 5FB8A 1FAKT 2JCCF 3B8SA 3KPRA 5CIPB 3SYPA 5FGSA 3SEPA 8FABB 3QJXA 3U6RA 1KYOJ 2X4NA 4WWKD 4UIKH 1RIUL 2IQAB 2E56A 1U2CA 2Z1KA