1L9PA

Crystal structure of nitrite soaked i257g variant of the copper-containing nitrite reductase from alcaligenes faecalies s-6
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLGGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Directing the mode of nitrite binding to a copper-containing nitrite reductase from Alcaligenes faecalis S-6: Characterization of an active site isoleucine
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 94
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9pA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9pA02
5F7AA 4N4YB 4AI7A 2OJ1A 7PAZA 1RZPA 1SF3A 2CUAA 1SFHA 3PCYA 2YAHA 4HHWA 1JZGA 3H4HA 1OCZB 1AOZA 1M9WA 5I6MA 3TBBA 1OCCB 5I28A 3T6WA 4HCIA 2IDSA 4P5SA 1L9QA 3T71A 1NIBA 3X1NA 3ABLB 1M56B 2BP8A 2IDFA 1NWOA 4NAJA 4UAHA 1E5ZA 4YSUA 1ET5A 3AZUA 4G72B 3FQ1A 4JKNA 1ASOA 2FT7A 4YSEA 2DV6A 1KDIA 2ZXWB 1NIEA 4BWUA 1F56A 1X9RA 4HZ1A 2HRGA 1IBZA 3CVCA 3PAVA 2LLNA 3IEAA 3S8GB 5I6NA 1J9QA 3KW7A 1NIAA 1PMYA 5ANHA 3SBRA 2H3XC 4DP7X 1YLBB 2VM4A 3NSYA 3QJSB 1KV7A 3X1FA 2IDQA 4E9XA 4JHVA 5B1JC 5AFAA 4P5RA 2IH9A 1ET8A 4E9VA 4A2EA 2VW4A 3FU7A 4KO7A 1RZQA 5B1BB 3WNIA 2Q9OA 1ASPA 3PAZA 1NINA 3FSZA 4F7KA 2AZAA 3NJMA 3G5WA 2XV0A 1A4BA 2PPDA 4BXVA 2PP7A 2FQEA 4K9JA 1GY1A 1JZHA 4KNUA 1ADWA 3NSDA 4KO9A 1A65A 2XXGA 3WI9A 2UX6A 2XYBA 4A2DA 2I7SA 4A67A 1T5KA 3JTBA 3NSCA 3NT0A 4DP6X 1SHWA 3FYEB 4E9RA 4YL4A 5I6OA 3NJJA 1JZFA 1E30A 1V54B 4HCFA 1PZAA 2R7EB 2AANA 1TU2A 2QT6A 2OV0A 1MDAA 2A3TA 2HX7A 1UATA 1VLXA 3QJVB 1CYXA 3CG8A 1AS6A 5AKRA 1JXFA 1AZNA 2GHZA 1ZDQA 2XV3A 1JVLA 3S3CB 2W88A 2EIMB 3AY2A 3GYRA 1DZ0A 4KOBA 1PLBA 1DYZA 1BXVA 2YAPA 1FFTB 1XMEB 4PCYA 2HZHA 3FPXA 2ZONA 1OV8A 1JZEA 1B3IA 2BWDA 4YSSA 3UGEA 2IDUA 1WS8A 1OF0A 3ZBMA 2XWZA 2BP0B 3TA4D 2QDVA 1OCRB 1SJMA 1V10A 3X1GA 2FT6A 1ID2A 4G7RB 2BZ7A 2FQDA 1JXGA 1NIFA 4FA7B 3EH4B 4DP4X 2J55A 2BW5A 2WO2B 1CURA 3WNJA 4ENZA 1W6LA 2BHFA 1PY0A 2PCYA 5B7EA 5F7BA 2Q5BA 1NTDA 1WS7A 1ZIAA 4MFHA 1BEXA 3BQVA 1A3ZA 2N0MA 1L9PA 3NJFA 4DP5X 3ABGA 2AFNA 3WG7B 4F2FA 2B3IA 4DPCX 4NB7A 4WKXA 3ABMB 4DP2X 4HIPA 3OMIB 1JERA 1JZJA 2FJSA 1WAEA 4E9YA 3BVDB 3X1EA 1PCSA 5B1AB 2R7EA 4N8UA 3N2JA 1PF3A 1KYAA 3QPKA 4W9ZA 1CUOA 2XX0A 3NJGA 1NICA 3OM3B 4GYBA 5I6KA 2FWLB 4BWWA 5D4HA 4AZUA 2CBPA 4TXVB 3OQRA 2FQFA 2IAAC 1A4CA 3H4FA 1ZIBA 1JZIA 2ZWNA 1JXDA 3AG1B 2MRYA 2QPDB 3FSVA 2VMJA 2UXTA 1TEGA 3GDCA 4YVUA 2PPAA 3FU8A 4YSPA 2X88A 2I7OA 4G7SB 4G70B 2CALA 2BP0A 4L0PB 5D4JA 1X9UA 1AG0A 1AZRA 2XVBA 4AX3A 4BWTA 1KBWA 1L9OA 3JT2A 2JFCA 1KCBA 3PAUA 5PAZA 1FA4A 1AS8A 1KCWA 1QNIA 4QLWA 3S8FB 1OE2A 1HAUA 3ABKB 3SQRA 2VM3A 3PXLA 4AKQA 1CYWA 1J5DA 1NZRA 1N68A 1SF5A 1PNDA 1SHXA 4BXSV 1GR7A 7PCYA 1WA2X 2H47C 1GS7A 2OCCB 2QDWA 2PPFA 1PZCA 2YQBA 1QLEB 2UXVA 4GP4B 2PP8A 3FS9A 1EHKB 3FT0A 3TASA 4A66A 6PCYA 2RACA 5B7MA 1L9RA 2Y1AA 8PAZA 4M4RB 5B3SB 2B08A 4UF7C 3NJKA 3UAAA 2XV2A 3QQXA 3N55A 4M3HA 4YSRA 1KGYE 3UAEA 5I5IA 1BXAA 1HFUA 1MZYA 3HB3B 6PAZA 1OOWA 4FAAB 3NJNA 1QHQA 1GY2A 1NPJA 2J5WA 2GI0A 1KBVA 1XB8A 3FSAA 1HAWA 1SDDB 3SBQA 3ERXA 3DTUB 3QJUB 4Q8BA 4YSQA 3NJLA 5I6PA 1FWXA 4G7QB 2WO3B 2GB2A 3IBOA 1GSKA 4GP5B 2QPEB 4E9QA 1IKOP 1IUZA 3OMNB 2JXMA 2PPEA 4YSOA 1RCYA 1AAJA 4DP0X 3DKHA 4DPAX 1E65A 4DP9X 1ETJA 1JVOA 5I6LA 3EHBB 9PCYA 1A8ZA 3FPYA 1E5YA 1AZCA 3EH3B 2DY2A 1ZPUA 3OMAB 2BP8B 1BQKA 3UACA 1JOIA 1PLCA 1AG6A 1J9RA 3EH5B 4KO6A 2J56A 1BQ5A 2AVFA 1V55B 1NPNA 3ZIYA 5B7FA 1OE1A 1ET7A 5D4IA 2DWSA 2FNWA 2YAOA 1AZUA 1NIDA 2UXFA 3AG3B 1NDTA 1URIA 2MTAA 2HXAA 3V9EA 2FQGA 3QJTB 2YARA 3UABA 1BXUA 3ASOB 1TKWA 3WIAA 1GS8A 2HRHA 3V9CA 1ASQA 1E67A 4BK5C 4HHGA 1N70A 2AZUA 3T9WA 4KNSA 4GY4A 3U25A 4AKPA 4CSPA 1MG3C 4F2EA 4HCGA 1CC3A 1AIZA 3WKPA 1MZZA 4GXFA 3CDZB 1J9SA 2CCWA 1BQRA 3X1BA 4YVNA 3IN2A 1BYPA 1W8EA 2EINB 2WSDA 1SDDA 2P80D 1AZBA 3AG2B 5FC9A 5B1KA 3TBCA 1XB6A 2Y69B 2GC4C 2XLLA 4EF3A 3MX0B 3AG4B 2VSMB 3NJHA 5E9NA 1AANA 1NWPA 3WKQA 1WA0X 4KO5A 4JHUA 4A68A 1J9TA 3PPSA 2EIJB 2EILB 3IN0A 2DYSB 2IWEA 2CJ3A 4YSTA 1GS6X 5TK2A 3FU9A 3X2QB 2HLEB 4Q89A 2BZCA 4X4KA 1MG2C 2YAFA 2PP9A 2XU9A 3IE9A 1OE3A 2BWIA 2DWTA 3DIVA 3OD3A 2IWKA 4WTQA 5TK4A 2VW6A 2E86A 2FTAA 4HAKA 2VSKB 2ZOOA 1AQ8A 1W6WA 1ILUA 3CVBA 3C75A 2TSAA 3CZUB 4NERA 2HX8A 3NJIA 2BO0A 2TSBA 4G71B 3ZDWA 1RKRA 3HEIB 2FT8A 3SBPA 5EHFA 3CDZA 1TEFA 4A2GA 4DP8X 2GIMA 4DP1X 4UANA 2W8CA 3S3DB 2IDTA 1AS7A 3NSFA 2GSMB 2PPCA 4PAZA 1AACA 1L9SA 2GC7C 2YXWA 1A4AA 3FYIB 1PZBA 1ZDSA 4BDVB 1PNCA 4KOCA 1SFDA 1GW0A 1ZV2A 3FQYA 2UX7A 1AR1B 3L45A 2YXVA 5PCYA 2BW4A 2XX1A 1SNRA 2XUWA 3NYKA 1IBYA 1J5CA 4HALA 3RYMA 5B1JA 2EIKB 3H56A 3FSWA 2VN3A 3QJRB 3S3BB 4YSDA 3GXUB 3ASNB 1R1CA 1IC0A 4W1TA 3EF4A 1EZLA 4E9SA 2P80A 3KW8A 2H5UA 3UADA 1ILSA 3NP4A 2PCFA 2PLTA 3AW5A 4E9TA 5I5MA 3T6ZA 3ZX1A 1I53A 2JKWA 2YAEA 4A2FA 1GYCA 5A7EA 2HX9A 3PLYA 1PLAA 5I5JA 4DPBX 2UXGA 2I85A 1XB3A 3CVDA 2YAQA 4AKOA 2NRDA 4ZK8A 1L9TA 4KNTA 3NP3A 4QKTA 4RH4A 1BAWA 2DYRB 3QJQB 1M57B 3D12B 1OCOB 5I26A 1KDJA 2X87A 4CSZA 2GBAA 2YAMA 5AZUA 3FU7B 1BYOA 2J57A 4GP8B 5IY5B 2IH8A 3T6XA 4E9WA 3T6VA 4YSAA 4A2HA 4YSCA 1WA1X 5LDUA 2IWFA 2CAKA 2XXFA 4BDVA 2VW7A 3FQ2A 1PAZA 3MBWB 3TU6A
chains in the Genus database with same CATH superfamily
1D5BB 4YDVA 5AZEL 2WQAA 4HW6A 4M1DH 2V6HA 3F7YA 4PMEA 4PRDA 4ZD3L 1AIFA 4P2RA 3VXMB 5AWNH 4KI5C 2OMVA 4A7QA 3KYOA 2JV6A 1G4RA 3N1PC 2K9UA 3EFDL 3OXRA 3D85B 1TU2B 1WHOA 2VDMB 1WFTA 3CHOA 4GUCA 4JFSA 1N6QH 1F3RB 2CK0L 4GUQA 4WO4A 4P3DA 3F04A 2XKNA 3RWHB 4MLIA 1NIBA 4L8SC 5C08D 4G82A 3F7QA 3I9GL 1H9VA 3EKCA 3G5YA 4H0IA 1R3IH 4YDJA 3T0BA 3ZRCC 4EUPB 2IDFA 3HHMA 4ZFOL 4X6CF 4R90H 4KUZH 3ZOAA 3TF7C 1NLBL 3PP4L 5FLVA 1WT5C 5AW5B 3AT9A 4XXWA 1YJDH 3TP4A 2H32A 4YBLC 5IHZB 3TPUA 5J6SA 3CFQA 4AEIH 3BPNB 1G7PA 5AW3B 4A7TA 1WP6A 3NK4A 3RPIA 2Q2EB 3PQYB 3ZKMD 5E8OB 3HN8A 4U6XB 4UQEA 4WI2A 1QFWI 3RVVD 1MCDA 4WI6A 2Z7ZA 3L8QA 3S96A 1Y18B 5J13B 4DP7X 3QJSB 3OSKA 1MFCH 2DBJA 4CNIB 3DHJA 4FFZH 4RVBA 5EFIA 1XCQA 3X14A 5KVEH 1DVTA 2CHZA 4G9FB 5AOLA 4HAGA 4NGHL 1ET8A 2W0LA 3KPPB 2V9RA 2VLKB 4H8PA 4XP9H 3KPMB 4KAQL 3SYCA 3VI4B 1NFDA 5ICZB 5FXCH 4OFPA 3FSZA 2ZXEB 5JQ6L 3PABB 1V7MH 2YXFA 1KCSH 1ZMYA 3GXFA 3MUGA 3STLB 3L3OB 2A1WH 1QVOA 3KDPB 3QQ9C 4KX8A 4PGJA 3VFNB 5GS0L 4GQPH 5E2UH 3MBWA 1DCEA 1T5KA 3D6GA 3IMTA 4XMWA 4JK0D 3QJXA 1HH6A 4FMVA 2VLJA 1V54B 2G3NA 4PI2A 4XCCH 4XCNA 4AUYA 5I75C 5ALCL 1VLXA 1ADQA 4PJDB 3UBXB 1LO3L 2APVA 4H88L 2PCXA 4QCIA 3N1FC 4NRYB 3UH8A 4MQXC 2ICCA 4UUJA 1BYNA 2PABA 4WUUE 2JCCA 4FNLH 3IGKA 4RDBA 4TSCH 2OA9A 1G7JA 1G7IB 1KCVL 2IDUA 4R96A 3X3FH 2LFGA 3EDFA 5I1DB 3T0EE 1PDKB 2E56A 3NIGE 4I3SH 4GSDL 4K5PA 5GGVH 2APSA 4UI2A 4UNVA 4UINH 1DQVA 4BFFA 4V1DB 3QEGL 4ZS6D 3UYPA 4A38A 2WN2A 4I5BA 1NIFA 3FO0H 4FA7B 2CJTA 2J55A 2R2EA 1BAFH 5C1MB 1W6LA 3MREB 1RZKL 1NMBL 2NYYC 2Y2TA 4XPGH 3ARGC 4WQOA 4ZUTB 1XSIA 5D7HA 5IROC 4BH8B 4XPBH 5HHXH 3G5ZA 4Y1TA 5AB0A 4HZAA 2AHIA 1UXMA 4LOVA 4NB7A 4WKXA 3WIIL 2D03H 2BXYA 4F37F 5GRZA 1TUPA 1E8ZA 3FUNA 4B41A 1J5OH 2FJSA 4RZCA 4Y4KB 1AFVL 2E9BA 3X17A 2NCEA 3QIWB 2XY1A 5M94B 5IW6B 2YIHA 3IETB 1XSOA 3DWTA 4GXUN 5INDB 3WNMA 4N68A 1PY9A 1AOHA 3GSRA 4C83A 2R69L 1NCCL 5G4OA 1IC5H 1RZJC 5GQBA 5C0RH 3X12A 2ZWNA 4J3SA 4AMKH 1E42A 5CZVH 1DJXA 1CTMA 1TQBB 1BD2E 1Z9PA 2R0LH 4G59C 4KI5E 1OM3H 5HGHA 1MHEB 4WK0B 4JGMA 1UFUA 4X6BB 5IG7A 2ZNWA 3R0MA 4UTBH 4QJ5B 2X88A 1Y0LB 3D2UA 5L2KD 4HSCX 1WCBA 2OMBA 3ZTNH 2GTZA 3QI9D 2J25A 4IIQC 4TVPE 4N1HB 1AS8A 4HK3N 3BEVA 2FUQA 4IKKA 1HU8A 1HAUA 3RIKA 2OXGB 4J27A 3HAEH 1P4LA 1QRKA 5HD8D 3BLBA 3V4UL 2K3TA 4OY9A 4Z3TA 1J5DA 4Q56A 3SE3A 4NUPA 3QJHB 5D7IA 4FJYA 4P2QD 4HKZB 5GRXG 1VDGA 5IVXA 2C9PA 2UXVA 3FT0A 3SDXB 2R69A 3CSGA 3REWA 1GYWA 3V6BR 3ZDYB 5JLZB 4M4RB 3TJEH 4G8GD 5DUBA 3W2DH 3IJSA 4EDXB 1RHHB 2NDGA 1OGTA 4APQC 2YD3A 4PJHB 2PO6D 3NA4A 4KY1H 5H2BA 3TS8A 3QXUA 3NESA 1MZYA 3HB3B 2ZPKH 4OM0L 6PAZA 3D4YA 2P5PA 1Z32X 4PB9L 2R0WL 1I8KA 5SX5K 4RAHA 4J23A 4I0PD 4OT1H 3GRWA 3NFPB 4GSQA 3PL6B 3ZYZA 5AW2B 3DSNA 2YGPA 1WD8A 5A2JH 3V4PA 3WL9A 1I8MB 3B5TA 2XN2A 3RGVC 3C09B 4Y5YB 3ZT5A 2DQGL 1N8ZA 4OI7A 1JDDA 4MD4B 2PTVA 4MBRA 4OZIB 3H1ZA 3QWRD 3NCBB 2OJZL 3CLWA 4M3KB 4LSVH 3KYKL 4W81A 3OMNB 2PPEA 4R7NA 5CU5A 2AV1A 5AZ2L 4GIOA 3A24A 3OZLA 5KYYB 2Y06L 5DHYA 2XTLA 4GNKB 4DP9X 2A7BA 4JEGB 3QSKB 3MJ9H 3EFOB 1K3ZA 4PJCF 5FKAA 1KENL 2HVJB 3KJ6H 5I1IL 2AXGA 2XG4A 2BJMH 1J88A 3D3VD 4NN6B 4UWQB 3VWJA 3K6FA 1KGWA 2YBGA 3CZKA 5L8LB 3FO1A 2F1AA 5BV7B 3IU3A 4UNIA 2WXOA 3FRPB 4KHXH 1KB5B 1UJ3B 1TKWA 3L3DA 3ETTA 5EN2A 3MUHL 4Z8FL 4C54A 4F9LC 3U9PH 1JYVA 4B96A 4BK5C 3R1GH 4HUVB 2HH0H 5F7DB 2R2HB 3HHRB 5HGAB 4HISA 1EH9A 4P8QA 3I2CH 3T0AA 3UP1A 3MLUL 5IIEA 3ASWA 5FGBC 4EI6A 3VFTA 3L48A 1BQRA 4E0RA 1M71B 3BH9B 3MLYL 4JHZA 2QVKA 1GGIH 4QRPB 5EEVA 3WNJA 1DQQA 3TCXA 4ELMB 5I30L 1FO0A 1Q90A 1ORSB 1GOGA 5HYQA 3RVUC 5ITFB 1XB6A 3DYOA 2ATKB 1ZGLP 1T89A 3DJ9A 4AEHL 3FB6A 4AQAA 1XCWA 3ZL2A 1NAKH 3SJVE 1DEDA 4RLDA 2P5ED 1JV2A 3IFOA 2JELL 2XY2A 1BQUA 2OMZA 4RFNB 1OTSD 1RFDH 2X3AA 4GO6B 3MLXH 4YHOH 1GC1H 3ARDD 4HEPG 3F83A 4AT6A 5TF1L 3S2CA 3LZNA 3J27A 4CN6A 1XGYL 4Y16B 3X2QB 2D0HA 4QPEA 3NZHH 1CZ8L 1KFGA 4NS0A 3LEXA 1MG2C 1MXGA 4EN3D 4NFBA 2HFEA 4D0CB 4LGSB 4JPIB 3P40A 4XZ4A 2HJKB 4X99B 4ETYA 3V79C 1U8HB 4AYID 2DBLL 4DUXA 3D39A 5J11C 5TE6L 2VSKB 5EORL 2R4RL 5CEZH 4RSVA 4ZW8A 5T1LD 3SO3C 2D3LA 2GITA 3LY6A 2HX8A 4NZTH 5DR5L 3B2MA 3FB5B 4S1RH 4CDGC 5FYJL 2CIKB 2W5PA 2V2XB 1HL4A 4NP9A 1KLUB 3SGJC 1JPSL 2ADFH 3NN8B 5HYJD 2AQ2A 4UIKH 1KNOA 2FT8A 2PW1B 2FEDC 4JFDE 4KVCL 2CLVB 3SBPA 1TEFA 4WWPA 5IB3B 3BAYA 1A1NA 3BAKA 2EDXA 3ZPDA 2ZXQA 5C2UB 1MCOH 1FJ1B 3S37H 2DWEB 2RFXB 1FBIL 3MI6A 4UANA 5EZOH 1Z6JT 2KL6A 2ZAIA 3IKKA 2E9IA 1AS7A 2CM5A 4GAJL 2NY2C 5I18H 3AADB 4OCWH 1T1YA 5DFVC 1CFSA 4X4XB 2ZKXA 5EBMA 3RWIA 4CRPA 1O6TA 1JAEA 2D7OA 3WFBH 5DMKB 5LVEA 2WY3B 4KKBC 1IBDA 3UTQA 3DLQR 3N42B 2YXVA 3EJZC 4PJAF 4EN2A 4FYQA 4QHMB 2FBJH 2ZSWB 2CGYA 1M1XA 5AKSA 5CN2A 5D6DC 1L9MA 1IBYA 4HALA 4G42A 4KZEH 3QXTA 1KTLA 5DK0B 1AVAA 2QQQA 4YXHH 3FSWA 1ODAA 1DEEA 5HYEA 3GXUB 4HVBA 2NUTB 3GMNA 1KXVA 1A3QA 1S9XB 2AEQH 4O4YH 3TBSA 4GI8A 1W0VB 3KM1A 3VNYA 2AK1L 5EU3B 5FCUH 5D2NA 2ZJSL 3QIBD 3L81A 5CCJA 1JWSB 4MMXA 2XKSA 1UXLA 3L7FB 1MFDH 3MRDB 4P2OB 1GYCA 3D4ZA 5JMRA 1UVQA 1DVFD 5B22A 1S7SB 1X5FA 3HMXL 2ZG1A 3BIBX 3MA7A 1OB1B 4YS4A 1DDHB 3ZE0E 3T3ME 3HNVH 4W4OC 1BM3H 5H4ZA 5GGRB 2FJHA 1RPKA 3KYNA 2FEJA 1G9NH 2VQ4A 3EHBC 4JMNA 5D93B 3V4VH 5C8JA 1HOEA 2VZTA 5KUKA 2AMUA 4Q9RH 3DXAD 3PWPD 4TTGA 2E5EA 4BSVA 3ISYA 4TVUA 2XWJB 5BO1H 1X5ZA 3O4LB 4X6EA 4YWGL 4NCDA 4AW4A 4E9WA 4HJEA 4CVUA 3CMOH 1IM3B 4HF5L 1NGWB 3GMQB 2B39A 5TQ2L 1A4KB 3S98A 1AE6H 3CFUA 3D25B 3R06A 3BLPX 2HB0A 3MLTB 1FH5H 4G7VH 4YGVA 1DJSA 1EBAA 2EICA 4TMPA 5F7HA 2P45B 2X4RA 2YAHA 2A9DA 4LCIL 3MLRH 4BCYA 3B2PA 5DC0A 3GKWH 4JDTL 4TL4A 5B8CA 4G80A 3TNMA 3BGAA 2IDSA 1PCXA 4V33A 5DQ9A 3Q2VA 5KS9F 4IRSD 1QBBA 3M1BB 1DE4B 4ODTH 2FWOA 4BZ1L 4E41E 4K5LA 4NJAH 2KBGA 4CC4A 1HE8A 2ADIB 1U8KB 3AU1B 3S37X 3IYLW 1X9RA 4PJFA 4L3FA 3H3BC 4W93A 5GZNC 2V9QA 1S7VA 4AYGA 1UH3A 4P4KA 4NC2B 2XI9A 2CDFB 2VLLA 4HYTB 4PJ5D 5F7YC 1A5FH 2NNAB 5E95B 3IXTA 3APCA 1KV7A 1X4XA 4J6IA 3RBGA 1XGQA 5KSAD 4DOHB 1XR9B 2R4SH 4QDGA 5B1JC 4NJ9H 1OTTC 3CZFB 1R9FA 4M1DL 2X44D 5AWNL 3CXHJ 3JWOH 5LDSA 3AS1A 1N5YH 1NINA 3BMWA 3NCWA 3SQOL 3P1VA 2GY5A 2E6PA 1IGIL 2HTLC 4JVPA 5D1ZA 4H2AA 2FQEA 1N6QL 5EO0A 3G6JF 4NQTA 3BRDA 4K7PH 2VITB 3PJLA 1E8XA 1E4JA 3RPKA 3V0HA 1R3IL 1RXLA 4L4VB 5GGTH 4Y4FC 2X12A 3VFMA 3IGAA 3QW9A 1UA3A 3RTQA 5I6OA 2IGFH 3BFOA 3RZCB 1W8NA 4HUXA 5IHHA 2R9HC 3BWUF 1Z2KA 1WC7B 3V0AC 5B38A 1QRNB 5JYLA 1JXFA 5KWYC 1G87A 2XV3A 4MA1B 4YHIA 4PRPA 3CHPA 4KVNH 3T8XA 5JPMC 1J7VR 5KVEL 4W6WB 3DVNA 3QRLA 4FFZL 3K8KA 5KW9L 5J3HD 1CYGA 4XP9L 3O9WB 3UJJH 3ZBMA 4KDWA 3GZQA 1Q1PA 5KN5A 4AQEA 3O0RH 4YMPA 2E74C 1HCYA 4U1SA 1V7ML 2OYKA 1KCSL 1JPTL 5GRUH 2A1WL 3H9YA 5GRVK 5F7KC 3L3JB 3RFZC 1RUAH 5E2UL 1OTUC 2YD1A 5FDWB 1YECH 1BZ7A 5B7EA 3U4BL 5JR1L 2KS0A 3L2MA 2DQFB 3MACL 4AIEA 3U0PA 3MZTA 4ZMYA 5MENE 4ZAKD 3CXFA 1IC4H 1WWCA 1X9LA 2Q6WB 3ZYIA 2CE6A 3TA3D 4DKDC 4PLJD 2W81C 4DP2X 5AAMA 1IEBA 4JPQA 3GSNA 1QSZA 2P47B 1NFDF 3MRRA 4HUWA 4RAVB 2GJJA 4L9LB 4K5NA 5DJ0A 3P0YH 2L7UA 4X7EC 1D5MB 2BDNH 5DJXA 3G5XA 5AG9A 4TS6A 5EMYA 1FZOB 3DX8A 3KL3A 1CICD 4M1CD 5FUZL 3GJEB 4X4YA 1T22A 2J6EH 1S9VA 1CD9B 3X3FL 1YPZE 3AXLA 2B15A 4H8QA 4NN5C 5G5DA 1M05B 5GGVL 2EUZA 3NA9H 4UINL 1R5WA 1IAOB 2K45A 3LS5H 2IO5A 5JW3H 2YD7A 2X1QA 1RJCA 3BDBA 3FO0L 2WLHA 3QC5X 1SOQA 2J43A 2J2ZB 1T66D 1M3IA 1BAFL 4LHQB 4XPGL 4LEXH 4UQ2A 4PPTA 3QZWG 1CDCA 1TJXA 4BQBA 3GSVA 4K5OA 2JCCF 4XPBL 3HPLB 5I2IA 1PTZA 2ZWSA 5E00A 4K07A 1N6VA 2YA2A 4K7PX 2EO9A 5LGJB 2K0RA 5G2NA 1AC6A 1G1KA 3DK0A 1QNIA 2D03L 3MGAA 3GRBA 5AVZB 5FGCE 1TTRA 3C5JB 3QPQC 5D2LE 4BK8A 3WTWA 4X7FC 1J5OL 2D9QB 2AVGA 2OTWB 5D7SH 4TUOA 3LQZB 4AKQA 1DANT 1HI6A 2L8AA 4RGMB 4WWKD 5JW5B 4WJKB 4HULB 3LN9A 2FLRT 4LSUH 5ICUA 2QDWA 5A7EA 1IKNA 3OLGA 3IDXH 4J6RH 4KJYA 6PCYA 2X6VA 3VFSA 3QFJD 4Z77A 2F74B 2QEJA 3B7SA 4O2FB 1RULH 3BPNC 4OH2A 4UF7C 2QR0A 3MV8D 3NJKA 3FN0H 4BUQA 4AMKL 5F96H 1MW0A 5CZVL 2R0LL 1OM3L 3KD4A 1F13A 1HHJA 2KKQA 1MLCB 4X6DA 3UAJD 5J13C 1CR9H 2FR4B 1N6UA 4FFWC 1ND0B 4F5CE 1OOWA 2ADJB 4UTBL 5CD3A 3SGEH 5DHXB 4LCWE 5IKCB 2FDBP 4N8VB 2J20A 4X9FA 2J5WA 3NCYS 1KBVA 4M29A 3UXFA 1EAOA 3ZT7A 2X6BA 1TO4A 2GTQA 3OHXB 4LP4A 4M9PA 3BP4A 3SPVA 5BVPH 1IT9H 1R3LA 1CFNB 1CLOL 3SYOA 1IE4A 3L3OC 5D9SB 4YDIH 3DVGB 4X98B 3ZUCA 3HHSB 4DTGH 2WBJA 4MASA 4C4KT 1KWGA 4E9QA 4OLWH 5HVWA 3K81A 1N59A 1RCYA 1ZS8B 5BS0E 5JZ7D 3H3PH 3V10A 1K8DA 1MHCB 1II4E 3HA0A 1AZCA 1SJVA 2QQLH 1U95B 4URKA 5D7JB 5FX3A 3W5MA 3ZO9A 4PJIE 1J9RA 1PQZA 5KBLA 1NPNA 2RCSH 3A47A 3LN4A 3WEBA 2WP3O 4JFQA 4KY1L 4PRAB 4F9PA 1OSYA 1TVBA 1N67A 2WWMD 1AMYA 2XBZA 3OVUB 4H0GA 1YY9C 4M7JH 3U6XS 1IEHA 2H4EA 1W91A 2ESVE 3I02A 3GXNA 4YUEH 4APXB 1C08B 2Z0BA 3WNNA 4DKFH 2J8OA 1T3FB 3D4CA 3FQWA 3H9SD 3HE7B 2EABA 5ID0A 5LLIC 2AZUA 3LAFA 1YYMH 5HHPA 4JFXB 3TO4B 5JHDD 2Y3AA 1GMEA 3FT3B 5D7IF 5I16B 4R4BA 2E6JA 4CSPA 1M7DA 3T0EA 1NEZA 2JVUA 1BJ8A 1TQUA 2Z7UA 4DGIH 3MRLA 1EO8L 4X0KB 5JQIB 3SPJA 3QWNA 4QOKA 4PJ8D 5DLLA 4A7VA 4L8BA 3RHWK 3R19A 3WCYA 4WI8A 1KB3A 5BUAA 4LSVL 5L6YL 3WLWD 1FYTB 1RK1B 3FT4B 3OBAA 4QRRB 2K1MA 4LHJB 4N6RA 1ZK5A 2IV8A 4DKEH 2FJFA 3MV7E 3L7EA 3MJ9L 1IQDB 4PG2A 3ECBB 2ZXBA 1NAML 1B3JA 1TOXA 4KJPC 2YSSB 2LABA 5DA4A 3VU1A 4Y4KC 4LIQE 3M8OL 4OZ4B 3C60A 1O9VA 3P3SA 4PJXF 4BINA 1L0XA 3QIWC 4FQHB 5M95B 2DKMA 1GS6X 3KLQA 4Y1AA 1VGEH 3O6FB 3QUXB 3UZQB 2A6JB 1GZQA 3IMRA 4R84A 3E6FA 2WGXA 3I6GB 5KSBE 2YAFA 4I89A 2HH0L 1ZLEA 2CM6A 3LN5A 3IE9A 3PAYA 4L8DB 1EAQA 3OD3A 4WNQB 5INCB 4N85A 4LLWA 4FQIH 2QTVA 3TJHC 3VMOA 4X9GA 5DI8A 1TFPA 3PHAA 1P7QA 2H3NB 2BP3A 1DVUA 4N2BA 2I60H 3QIUB 1BD2A 3CZUB 4XBGA 4XNZC 1JRHI 4F93B 1A6PA 3IB4A 4Z95H 4I77L 3TVMB 2K6YA 3DO7B 3S5YA 4IBLT 4PP2A 5C07A 1SY6H 1UB6B 1UHVA 3QNYB 3DURB 5CGTA 3RA7H 2FX9L 1NAKL 2XWDA 4MXVF 4CSSA 3CDZA 3P4LA 2BOCB 4FC3E 1IM9B 1LWRA 5IEHB 4OJEH 3L1FA 1VIWA 4HP5A 1RFDL 3DUUA 3LNDA 4NQCB 2Y1VA 4FXGA 4TULH 5BOPA 3I6KA 1I7UA 4XAWL 4YHOL 1GC1L 1LP9F 5GGQH 1WT5A 3UTSB 1T0NA 4I48B 1BQHG 3L16A 1UOKA 2OXHB 4FQXD 1ED3A 1VZHA 4ZUVA 1MCPH 4ZDHA 4GH7B 3Q2LA 3BRFA 4YXLH 5KYXA 1A66A 2XX1A 5FA4B 5GRVL 1BSIA 3K72A 2ED8A 2VQ1B 3FCSB 4Z7WB 2VLKE 3ZQXA 3VI4E 4IRZA 1B4JH 4JE0A 1I7TB 3EYQC 3HI1B 5CCHE 2VN3A 5CEZL 3CN3A 2QBWA 4R3SB 1HS6A 1XSJA 3HFFA 4NZTL 2B59A 4W9GC 3ULVD 3PUUA 4MNHA 4S1RL 2UVFA 4NQSB 3L3IA 2X9YA 2ZOLB 4U49A 1NCHA 3WJMA 3VXPA 4AEEA 4UV7H 4H1LB 2IQAB 3F7PC 3PL6C 1OT4A 1G4MA 4NC1C 3UADA 4UIKL 3C5SB 5TGBB 4F2ME 1XZWA 4NEHB 1PBYA 5I1CH 5IOKA 1M2VA 1QFPA 3MV9B 1MCOL 3C09C 4NQVB 3V7AG 5EZOL 3L9RA 2I85A 4P23B 4JR9H 1E4KC 1IBFA 1LL1A 1DN2A 5I18L 2GJZB 4OCWL 3W81A 3QNXB 1DQML 1XZ0B 2NRDA 3KWVA 3GTTA 2BP5M 2GIXA 4CKVX 4RDQG 2X38A 2Q8BH 2NNCA 4QD2E 3C2SA 3CCHA 3DRTA 1TJGH 1KJ2B 2FBJL 2EYRA 4JFFA 1ZHLA 3ARSA 4XPHH 1S7WA 1SM3L 2F0CA 4XODA 4YSCA 2OQJA 4KZEL 4QI3A 3O3EB 5F93C 4YXHL 5I0XA 4BDVA 2LLLA 5FM8A 3GMPA 3WFHB 1DQTA 2COVD 2VDLH 4V1DE 5C09B 5BV7C 5HHQB 1ORQA 1PZ5B 1XGTA 2AEQL 4O4YL 2OJ1A 1G9MC 3VXNA 5CBEB 1BV8A 1ZA3A 3D33A 2I07B 5KSUA 1P1VA 1U8LB 3BZ5A 4LLQB 1LWJA 3MV11 2NY1B 4Q0XH 5T1KD 4TLKA 2FYYA 2AQPA 2WINB 4POUB 4XHJC 4J3OG 1JNHB 3ARGA 1ZV5A 2PTUA 4CW1B 5HYFA 5K9KA 1QI3A 2KHAA 3EOBB 4X8JA 4EVNB 3V6ZB 3FU0A 1F4XH 2KZ1B 2C1OB 1BM3L 1VF5C 4WFFE 2ICWA 4YHLL 3RY4A 2ZG2A 2FBRA 5E6SB 4NQDB 5EA0H 2F5AL 3LYRA 3V4VL 5BOJA 1HXYA 1F56A 1KOAA 2XICA 2DLIA 3SPIA 2EKSB 5DJ2B 2VXVH 4RFNC 1YEGH 4UU9A 3RY6A 3FH5A 3SKNA 2CJUH 2Q86B 2NYKA 1FL5A 2BMKB 1WD9A 4UBDC 3CTTA 1CVSC 2VM4A 2PWEA 4JO3H 5DJ6A 4X0NA 5CHNA 2CBTA 4PWFA 3UTTB 3TFKD 3O2DH 3BPCB 4YH6A 1AE6L 5AFAA 4ONOA 3FAWA 1EZSA 5KAQG 3QXDA 4WF7A 3MSPA 1G7MA 2BSSB 1OAUH 3OKKA 2DH3A 1LMKA 4RNRB 3LSOA 3MLRL 3GKWL 4AV0A 5E5LA 3FU5A 4WJ5A 5CLWA 3WHE0 2PP7A 3DHMA 3VWKC 1OGAE 1GY1A 1YJDC 4FFYH 3UG3A 2XYBA 1SYVB 3P54A 4JG5A 3E1ZA 3VXRA 4UTAL 3W9DA 3HE6D 3ZL4H 1SHWA 5IQOA 4ODTL 2DD8H 1P6FA 4W9KC 3ZIMA 5FW7A 3FOLB 4IIQA 4LNRB 3OKMB 1MDAA 5IM7B 5LKNA 5I76A 4MQTB 1A6UL 5CILH 5IB5B 1F2XK 4OGAD 2NY7H 2XFXB 3DV6A 5K9OA 4IEFB 2COQA 5CIPH 4S1DC 1F1AA 3QA3A 1MI5E 4NQED 1X5XA 3TT1H 4C56A 4FG6C 1J5HA 4MA7L 1U3NA 2MOQA 3ILQC 1LXMA 1OGSA 1JZEA 3BPLB 1BQLH 3EYFB 1NC2A 2F53E 4PJHE 2HJFA 3QEQA 4XT1C 3JWOL 3VFWA 2C4FT 2WM0A 1XGPB 4APQA 5K33A 2P8MB 5IK3B 3DGCR 2QZ5A 5DU7A 1EFXB 1CFMA 1ID2A 3SGDI 1LVEA 4KQ3H 3SSGA 1GOFA 4UTAA 4G6JH 4PJFF 1YC8A 1CURA 4JFZH 4JPVH 2HVKB 2BHFA 4ZUTA 3W0WD 5GGTL 4HHAA 1I3RB 4KMQA 4G1MB 1T7ZA 4J8RA 4QXGL 4U1GC 1ACCA 4ZMPA 2O6CA 3BISA 4DCQA 2MNJB 2B3IA 3B9KC 1S9KC 2NY5H 3CFKA 1IJNA 3ABMB 4OU3A 3ULUD 2X4PA 2BIIA 4HC1A 4KVNL 4MB1A 1GZPA 3DMMD 3GXMA 4XVUD 5GSVB 4GG6B 4AL8L 3IDIA 1T6VN 2W94A 5CSZA 1CUOA 4MA3A 5EUKB 3ARBB 1HHKB 3B9DA 1TZGH 4GUPB 1QWHA 4IOIA 3ZU8A 2X1PA 3R0NA 3TLRA 5B4MD 5E4EB 5E94B 5I0WA 4ZTPL 1B6DA 2OSLA 3PIQB 3O0RL 3VXUD 1ZIBA 1UADC 5JO5B 5GRUL 4KMTH 1QI5A 1S9YB 3FDWA 4KXBA 3KLHD 2ZYIA 2AS5M 4PJ9A 3O3UN 4FRWA 3FZUD 3DDFA 4DN4H 4F9LA 1H8NA 4TNGA 4MQ7B 1XF5B 2MHAB 4WEBH 4HPOH 5L4FA 4AITA 5EG6C 1MH5A 3WHE1 1KBWA 3E9TA 2VN6A 4HJJH 4CU7A 5GRJH 3FUKA 5DQJA 4QRPE 2UWEF 1IC4L 2IGTA 1E3XA 4Q58C 2OMWA 5FGBA 1A9VA 4PJGB 3S88L 1FNFA 1VFBA 5DFAA 2N01B 2V37A 1ZJBA 1SJEB 3BGMA 1JTTA 3P0YL 4L3EB 1JPFB 4X5WA 1S5HB 1AO7A 2XG5B 3GXPA 2BDNL 4JRFA 1N68A 1DBBL 2N7SA 2W80C 3VH8G 2AAVA 2AKRB 2B9BA 3HNSH 1E9QA 3O3BB 4L1DA 4ZQKA 2UWEE 3P0VH 1H5BA 2IH3B 5DD0H 1GS7A 1UB5B 2X2IA 2EC9U 1YEDB 3AC0A 5DHEA 3VVWA 4JO8A 3WO3B 4LMQE 3DOSA 2X1WL 8PAZA 1KPUA 3NA9L 4MNGA 3QZOA 4OV5A 4OZFB 5JW3L 5IBUG 3ECWA 3UAAA 4EIGB 5FFLA 4PTUB 4WSGA 1KJMB 3QI9B 1URZA 1YA5A 4WVRA 4Y5XB 4MA8H 1HFUA 1FHGA 3QULB 1SXAA 2M1KA 1DP0A 4TLSA 4LEXL 2PTTB 2F54D 4PB0H 2MQGA 3DJSA 5LBSA 5JA9A 2DW5A 4LAQH 3VCLB 3LQAH 1SDDB 5ABDE 1K4CB 2QVFB 5JOFB 5K59F 1IBBA 5LQBH 4XNXL 1VGKB 1TZIA 1A6TA 4P2QB 2MJWA 1FWXA 4G8IA 1GIGH 3B83A 3L95B 5JTWA 3SCMC 4I9WD 2BNQD 4LBEA 5IR1B 2VMCA 5D7SL 4ZUUB 3U7AA 5KVEE 4ODWB 2AJYH 3ZDZB 4BRJA 1FNAA 4QHLB 4IK7A 5DHVH 3SGJA 4TSAH 5IMMB 4LSUL 5J1SC 5L8JB 2PO6B 4LSRH 3RZCC 3IDXL 4J6RL 4YK4B 3MROA 2CDGB 2Q7AA 2HFFB 2F18A 1ZKAA 4ODHH 3FFOA 4J3OD 1QI4A 3VXSD 1YEJH 2BP8B 3N41F 1RULL 5J56B 1AG6A 2JCWA 4YFDB 2C1PA 3FN0L 4I0PB 3ZIYA 5F96L 3CPLB 4F7PB 1OF2A 2YAOA 1FZKB 2MCPH 3CZSA 4LQ1A 1CR9L 1EZVX 1XCTA 5DO2D 1YN7B 1TQCB 5EZJA 2BX5A 1HEZB 2E9WA 4UT6H 1K9TA 2V7HA 3O9WC 2EECA 3KPNA 4O9HH 4PH8A 2OMUA 1JWUB 1S3KL 4MNQB 3GLEA 4QAMB 1U8OB 4N0RA 4OLEA 4H5SB 2X4NB 4A55A 1PG7L 5BVPL 1IT9L 3BKYH 3EJRA 4M6MH 4IHBA 1MG3C 4D8OA 3DX2A 4U1IA 5A3ID 4YDIL 4AE1A 1UGKA 2WXMA 3ZYOA 2OL3L 4KV5E 4BE5A 2YR3A 1LHZA 1T1ZA 4PIBA 3ZKND 4EE2A 1C5BL 4YNYA 4RBPK 1TG8A 4AIZA 3DTXB 3NVQA 3TZVA 2IPTL 2P80D 4GW5B 3RU8H 4QXUH 3TBCA 3S7GA 3H3PL 2XLLA 4MCZA 2DN7A 2QQLL 4IOFD 4L3AA 5F0PB 3VD4A 1M9SA 2LR4A 2VZVA 4FYTA 4DK5A 2EH8H 4AGNA 3CXHK 2WLMA 3GSWB 3HC0A 4L9LC 3PPSA 4ZOEA 1JGEB 3FCBA 3L08A 4LCCB 3IN0A 4W4OA 2DMCA 3KPRA 1JMZA 1WJ3A 1CQKA 4OFVA 3HG4A 2JB6A 4PGDB 3G9VA 3C5ZD 5DURD 3NZ8B 4DKFL 4X4KA 4KX9A 4CVWA 2VAAB 1OANA 1EX0A 4H8WC 5IFAH 2XIDA 1NGPH 3F84A 2P3YA 3O3DB 1A0QH 1YYML 2XU9A 4HIHA 4P5TD 1ZT4A 1KBGL 1L4IA 5F9OH 3MNVA 4N9GB 1YPZA 2EIDA 3GBNL 4WTQA 3H0TA 1LYQA 2A9MH 2M2DA 2OL3A 2XTJB 3T3PF 3BIKA 5LGHL 2PCFB 4HAKA 3ARWA 1N4XH 3WY3A 4DGIL 2QSCH 2P5EB 1GGTA 3MOAL 3QUZB 3C75A 3I9PA 4HUCA 2WC7A 4NERA 4JGNA 4GIPD 2E7HA 2R56H 2C4XA 3P4MA 2Y1ZA 4AVIA 2SEBA 4G71B 4PS4H 4DKEL 3ARDB 2C9SA 3KH3A 1DJYA 1UZ6E 2Y5TB 4GEIA 4NWUL 1P4IH 5SWSA 2F5BH 1JPEA 2HLFD 3IJ7A 3GGWA 1HHGA 1MLBA 4PCTA 1D6EB 2VC2B 3LDBB 1HHIB 1Y1UA 4DP8X 3SE8H 1GKEA 3IMVA 4UQCA 5E99L 1EXUA 2DICA 4LVEA 4EN3B 5FECB 3QNZA 2EIBA 3S3DB 1R5IB 4RGMC 5D2LA 3QZLA 3SO5A 4M7LH 4GW1A 1L0QA 2OCFD 2NT0A 4YQXH 3RVWD 1FFPB 2DL9A 1KXQE 1U3YA 2J6WA 3MX0A 5T3XD 2Y0SA 1GW0A 3RDJA 4J4PD 5T1LB 3L3HA 2BIQA 2IANB 3UZVA 4PIRF 2X41A 3ESOA 4DOHE 3CSBA 5BZDB 1DQKA 4KKPA 3VX1A 1TPXB 1MAJA 5DJZA 3KXFD 1MFUA 5EWIL 5B1JA 3TO2B 5HYJB 3KWWB 4EKXA 1RPQA 5DRXB 1F4AA 3OZ9H 4PRNB 5K1NA 2I60L 2XQYG 1YNKL 1DBKH 5E5UB 4HS3A 4Z95L 3CFDA 1HKLL 1UG9A 3MJ8B 4OZHB 1KF9B 2EP6A 2OMTA 2FECL 4FKKA 4LCWA 1MW1A 1XHHA 1HWHB 4AH2B 4R83A 3OHXC 1WH0A 4WAFA 5AEAA 1ZSDB 4TQIA 3RA7L 2PLTA 3AW5A 3VRIA 1SHMA 3FO9B 4S0SD 3VFVB 3NCJH 4RAUA 1D5XA 2VKWA 4Z7NB 4Y4FA 5EU4B 3SOBH 3WD5H 1UWEH 3FJTA 4UAOC 3CVIL 4LSQL 4TULL 1IMHC 5SWZB 5GGQL 3IDGA 4LGRB 4L4TD 4AKOA 1EVTC 3HCVB 3IJ8A 2YRLA 4U1LB 1CPUA 3UYRL 1BAWA 4BZ2A 3VYPA 5F3BA 2FHCA 4MGXA 3EGSA 2H41A 1F6AB 2VH5H 3D12B 5D7JC 2W07A 5EO9B 1YY8A 5EU6A 4Z3HA 5KVFH 5JOPD 1NANI 4LEEA 2IOMA 5CP3H 2OJEA 4A2HA 1B4JL 2XWXA 3NG5A 3U0TB 4NZRL 2VW7A 3BN9C 2EXSA 2IGLA 1X5MA 1NBCA 1WITA 1X5KA 4XZUB 3O8XA 2GSIB 4Y4HB 1WVZA 2LTQB 3AFLA 1BBDL 1DVFB 2OW6A 5H37A 7PAZA 2V33A 2R29L 3HE7C 2JSFA 2WMPA 1RY7B 3MLZH 1S9WB 3Q0HA 1BIHA 1EGJL 4B97A 4MX7A 5F7NC 2YUVA 3HJEA 4XOBA 4MDRA 2Y5EA 4TQPA 5I1CL 1WZKA 2WN3A 4RGNC 5C0BE 3Q05A 2HLAB 2O5YL 4GRWH 2K4WA 1FC1A 1G9NC 3T71A 3STZB 5F70A 1HOCB 3PG2A 5FOBA 2VXSH 3DXAB 3PNWB 3MRNA 2FZ3B 5E8PB 4JR9L 4ONHB 5D55A 3KL5A 5F6HJ 4ODVH 4L2LA 1Y1DA 2OPCA 3Q3GB 3HZVB 4X9IA 4WUUD 3CH1A 4YSUA 3LRHA 3ML9A 2Q8BL 5F8RC 1NFIA 3FU6A 4JQIH 4B0MM 4N2CA 4YHZH 1ETA1 1QLEH 5DUPH 2BSTA 2EUXA 3GSXB 1TJGL 3WE6B 4OAWA 1ESOA 1AY1H 4ZX3A 4XPHL 5B3JF 3FONB 1E8YA 2H0FA 2O72A 3QHFH 3QQDA 1F3JA 3MGOA 2WQXA 3QUGA 4FZ8L 2F15A 5TE7L 5CSGA 3OC8A 3RVXD 2VDLL 1AR2A 4WEUD 1F6LL 2HTKD 4WKZB 3SDCB 1CFVH 2R29A 1I3GH 1MEXH 2PXYB 2F58H 2IH9A 3O6FC 3QUXC 5ICXA 2AXFB 1E7VA 4MS8C 4IRSB 4OCRH 1DTUA 1FGNH 3WNIA 2FBOJ 1HH9A 2HUHA 3STBA 4GBXD 2PPDA 3NH7L 3NSXA 4Q0XL 5C3TA 3GSUB 1HKFA 5KYUA 1MCSA 4U2ZA 4LPXA 2L0DA 1WBYB 4OD1H 1D5BA 3EO1B 1G6RB 1S7QB 5DZPA 4XP5L 2BS71 5DC2A 2CK2A 3QIUC 3VXMA 3IAPA 1F4XL 4PJ5B 4RA3A 2XDHA 4U1JB 1MDTA 3TVMC 5DK2B 1ZLSH 1UXWB 3MN8A 4MAUH 1DDTA 3D85A 1TU2A 3JUZA 1KIPB 2ZKWA 35C8L 4F7CB 2GKIA 5KSAB 4L23A 3RWHA 5JPNB 4EUPA 1E6JL 3GYRA 4L9DA 2IBBA 2CJUL 4JVWA 4DK3A 3VD2A 4Y19E 4W70A 3MQIA 5CEZE 4J3XA 1LO2L 4JO3L 4IOSA 3Q1SL 3IPFA 2IF7A 1OV8A 3AT8A 4K23L 1QBAA 4K3JH 1B3IA 4I0CC 3MUZ1 5IHZA 3NPZB 4YZWA 3PQYA 4F3FB 5E8OA 1OAUL 4DUVA 4U6XA 2YLHA 1UYWH 5T5FA 1VENA 3HZYB 1Y18A 2EEDA 3LIZL 5DYFA 1IC7H 3TURA 2QV4A 4K3DL 4CNIA 4N2DA 2O5XL 1RZGB 2VE6B 2EO7A 2VZ1A 2WK2A 4G9FA 2AXWA 3KPPA 2VLKA 4YPGB 5ICZA 2CIIB 3KPMA 3QDGB 4EI5B 5F7BA 3VI4A 3ZL4L 2DD8L 2B5IB 4QYAA 4AENB 3WTUA 1AQHA 3PABA 4HWBH 2EDYA 2JKLA 3STLA 2Y6SD 3L3OA 5CILL 3VFNA 2OMNA 2OYMA 2JI2A 1VCBC 4JHAH 3WEAA 2OM5A 1QBMH 3CXDL 1WAEA 4F2MA 3EJSA 1URLA 1W72L 2IAMB 3TT1L 5K9JH 2AJ3B 5IB2B 4X7TB 4P23C 1JD7A 3QDHA 5HHNB 2XX0A 2BC4B 3BQUB 5I6KA 1J8HB 4NRZB 4PJDA 1MIEH 2VXQH 3UBXA 3CE1A 4NRYA 2P5WB 3WFCH 2A6IB 2Y2WA 3LIZA 3OQRA 4IU2B 3U2IA 2R2BB 4XXDB 4AYSA 3H4FA 2BY2A 2O26U 2VMJA 4ZAKB 3EXLA 4WSJA 4G6JL 2CLRB 1KN2H 4JPVL 1G7IA 5F1KC 2VXUL 1CIDA 4R7VA 2P1YA 5I1DA 1AGFB 3P77B 4FL4B 4RETB 1PDKA 4RGNE 4MCYB 4Y2DD 3WJJC 3DV4B 4S11A 4V1DA 2J73A 4XVOA 1LK2B 1UKSA 4ELDA 2JKSA 5CJOH 1EHNA 4DESA 4K2UH 4U2YA 1IAII 4K8RC 4MVBD 5AAWC 5D70H 2NY1C 2VDPH 2NY5L 2YK1H 1FYTE 5EOCH 4QRRE 3MREA 4QRTB 4JVUA 4GS7C 2FHBA 3SQRA 1RV6X 5L7XH 2E7BA 3ZTEA 2C9QA 1B6UA 1IZJA 1CGVA 1DSFH 1JPST 1OLZA 1RH8A 2BVUA 3GUFA 3L1OH 3MRHB 4HXAH 4ICWA 4BH8A 4HJ1A 4AQZA 4HWZB 1PEZA 2QLVB 2XVKA 1TZGL 1F00I 1HNYA 5I1AB 4Z3EA 3TONA 1R75A 3QUYD 4Y4KA 4ZSOB 5ESAB 1DFXA 5G4MA 2O93L 1M6UA 3DROB 3QIWA 3QQXA 5ISZD 3IFNH 4KMTL 5HDBB 5IW6A 5I0DA 3IETA 1L7TH 1I1AB 3V0GA 4DFHA 1WAPA 1P5UB 1BXAA 1U58B 4DN4L 5INDA 5EIIA 3T2QA 1QHQA 4WEBL 4UZSA 2UY6B 1GY2A 3BD3A 1MW3A 1RJLB 1UCBL 3NJVA 2OYPA 5DMGD 2XWRA 4M61B 4TNWK 4HJJL 4I8DA 5GRJL 3U2JA 2AXJA 3LS4H 3QHZH 3WDHA 3T4AB 4NHUB 3VTTA 2YPLD 1MHEA 5EU7C 3VGAB 4X6BA 3GI9H 5FHBL 4TV3A 1A8JH 1MNNA 1Y0LA 3WUWB 4N25A 3QYNA 5IBTL 2PYEB 2Q2LA 3OKYA 5KVGH 3MV8B 2VLRE 5T3ZE 3RHWF 3HNSL 4PFEA 4Z7OB 3L5HA 3P0VL 3DKHA 5J7CC 4XB8A 3RVVC 4BUHA 5DD0L 3D05A 1ETJA 2CO6B 5JIQA 1O5PA 1A8ZA 3OAUH 1T0PB 1IL1B 3QZPA 5K1VA 1ZPUA 2OXGA 2Q3ZA 4TUUA 1PLCA 2X4OB 2X2HA 3K2KA 1ROWA 3QGVA 2AGJH 3EYUH 4X5LA 1FNGB 3HG1D 3QJHA 1ZT7B 4HKZA 5HJGA 3ZHNA 3PWUB 2HXAA 2E4TA 2DM2A 3SDXA 4PB0L 2YARA 3BPLC 4ZUSB 1VEPA 1YEHH 1A7RL 1I1YB 4GAGH 5JLZA 1ZHBB 4M4RA 3PJSB 4EDXA 1KCLA 2VQTA 2ENQA 1AZVA 1E67A 3LQAL 1RHHA 4LAQL 4QWWD 1P6AB 4OFYA 2R8SH 4M48H 1GMIA 4PJHA 2WYIA 1QFHA 2N59A 1CC3A 7FABH 3BZEB 1GIGL 1BZ9B 1MFAL 3TX4A 3RZWA 3UTPE 4YJZL 4WI0B 4LXFA 2XHNA 4QO1B 1HQRB 4JKKA 4IJTA 2WSDA 4LKXB 4M7ZB 1YEKH 3NFPA 3PL6A 5GZOD 2WV3A 1EXHA 1I85C 2BIMA 2V17H 1DLFH 1I8MA 4ABVA 3MGTB 4N20A 3PHOB 5BUPA 4Y5YA 1DJWA 1YEJL 2XA8H 5HHMD 4IHOB 4B60A 3ULUH 3OG6B 4WHDA 4MD4A 3H9SB 2YUWA 1P7KB 4Z0XB 4JHUA 4NWTH 3ZK0A 4OZIA 1IEAB 2XPGB 3DC0A 3MCKB 4U6YB 3CVHB 1D5RA 5KYYA 3K0YA 4JO4L 5EZLB 4ZS6C 1BLNB 1S5IH 4N0CD 3RGHA 3EFOA 4UT6L 3GHPA 1EAPB 2HVJA 4O9HL 5D71L 4OQTH 1NPUA 3I3BA 4MMYB 5CJ8A 5E4EC 3ROLB 4HU8A 3LJ3A 1A21A 1OE3A 2IWKA 3IGUA 4M6ML 1PIFA 2ZQKA 3RI5K 1EPFA 3FFCB 3ESNA 4MXWL 2ATAA 4Z7QE 4LU5H 1U8IB 2X09A 2ZCLH 3K46A 5EUOF 4ABWA 4E42B 3FRPA 3IWUA 1KB5A 3B8YA 1UJ3A 2FRGP 1B9ZA 1JRHH 1O75A 2WXNA 4HUVA 1IGCH 5F7DA 1L0YA 1CXEA 1B0GB 2R2HA 5HGAA 2CMRH 4GAAA 3RU8L 4QXUL 3BLKA 2YKKA 3N85L 1QA9A 5I73C 5MEOB 1M71A 2AJZB 3BH9A 3E3QC 3IAQA 2EH8L 4QRPA 5I5RA 4NQDE 4ELMA 1J8SA 3LX9A 3CN0A 1ORSA 4YZFE 1WAAE 4QHNB 1PEWA 5JHBA 5ITFA 1IO4C 2ATKA 2HT3D 3ATFA 4R4FL 4WHYG 2YXWA 1G7LB 4N2HA 2HSIA 3FRUB 1C8PA 4YR6B 5FHAL 4M93C 4Z7UF 4DHLA 2ZOUA 5IFAL 2H1PH 1V3MA 1KT2B 3CSFA 1NGPL 3L45A 2Q3AA 3R7RA 1A0QL 2BW4A 1QUNB 5F9OL 3GHEH 3H9HB 4NOBA 1WK0A 2A9ML 4A6YH 6FABH 3B5GA 3KR3H 5E23A 1AC0A 5C08E 3CHQA 1DBJH 4GRLD 4D3CH 3QI9C 1N4XL 3CC5B 1H6UA 2LE9A 4Y16A 4Y5XC 3QJRB 3F7LA 1XH0A 1JI2A 3GS7A 2WAHA 4JRYD 1DFBH 3T2OA 3APMA 3H8NA 3ASNB 2H6OA 5EU7E 3AM8C 5ERWB 3D1MC 4D0CA 3U0WH 4N2EA 1WWBX 3QXWA 5HD8C 1BWWA 2KPNA 4JPIA 4O02L 4PS4L 4GB9A 2HJKA 4X99A 2NDFA 3NJXA 1U8HA 3PXJA 2ZP9A 1P4IL 4ACTA 3BH8B 3V5KB 5IMLB 1CBVH 1JP5A 1FNSH 4NO5B 3GK8H 4M5SA 4XP4H 2WHVA 3MBEB 2E9JA 3FB5A 4JL1A 2UXGA 3ATDA 4M7LL 2V2XA 3DHPA 4Y2NA 4YQXL 1KLUA 3NN8A 3FQRB 3QS2A 1Y6KR 2PO6C 1L9TA 2PW1A 3BCFA 5HI4D 4ZW7A 2CLVA 4FJ6A 5IB3A 1J48A 1P4LB 2B4CL 4J3OH 4P48A 4WFED 3W82A 1KDJA 2OMXB 1FJ1A 4DW2H 2DWEA 2RFXA 3RQ3A 4GMSH 1NGYB 2DQMA 1XL4A 3QE5A 4I0PC 1RIVH 3OWRA 2HFTA 4BYHA 2CAKA 4X4XA 3U2SB 2MTPA 2ED7A 1XH1A 3OZ9L 3LV3B 4LFHG 1A7QL 5DMKA 1TQCC 3BYYA 4ZQTA 1WEJL 3C6LD 2GBVA 4QHMA 5CCGE 2ZSWA 4UM8B 5I15H 3O11B 2EDJA 32C2B 3OSVA 4MB4A 2F8XC 1M9WA 2B0SH 5DK0A 3TBBA 2RGSA 1OCCB 1QBLH 3OKOB 4F7MB 3NCJL 5GGSA 1ZVNA 4L29B 3SOBL 4DQOL 2NUTA 4FA8A 1S9XA 1FL6B 5E4IA 5DA0B 4HWEL 4DKTA 1W0VA 4MZ3A 4L05A 5JHLL 5EU3A 3KVPA 2DQUL 2GJRA 4BUGA 4PJ7E 1KZYA 3EGDB 3EO0B 1JWSA 4BFRA 3L7FA 3ESMA 4TUKL 3TN0B 2QGBA 3MRDA 2ZUQB 5EZIL 4UMSA 2VH5L 1WICA 4P2OA 2HRGA 5EDSA 3KYAA 4DFIA 1S7SA 2GTWB 3IEAA 1L7IL 2RHEA 3S8GB 5LNGA 4CVXA 1J9QA 1OB1A 1DDHA 1NIAA 3HLKA 2OI9B 4LCCC 5GGRA 2ATPB 3BJ91 1Z7JA 4X9HA 4E9XA 1A7PL 1NBVH 5T1KB 5AALA 3IGLA 2EH7L 4LVHB 5BZWB 4ZMOA 3B7TA 5A6IA 2RB8A 3GB7B 1A14H 1GGUA 4WO4D 2O61A 1GAFH 1J87A 2VO5A 1RZQA 4CN1A 4ENED 3LCYA 3F85A 3MLZL 2XWJA 1A9EB 2ZE0A 3Q44A 4QRSB 3O4LA 2BNRB 1A4BA 4DF9A 1IM3A 2JI3A 2WANA 1NGWA 3IU3B 4K9JA 4BXVA 4RIRB 3GMQA 4C59B 1A4KA 1R0AH 1A65A 3D25A 2KMWA 3KHQA 5AVQB 1NUDA 3MLTA 1UKTA 4OKDA 5JHLA 3ZDXE 3NT0A 4PJGE 5MEPB 3QT2A 1HXMB 3E3QE 1OTSC 5J1AB 3WXWH 3U6RB 3VMPA 4KBPA 2I27N 2ARWA 3ARDC 4ZOCA 4JQIL 1AS6A 4YHZL 3C6SB 4PVBA 3LPOA 4XNUH 3HTLX 5DUPL 1CIUA 3QWQB 1AY1L 3JSSA 2CO4A 3LDBC 3NIFF 3M1BA 1DYZA 1DE4A 3QDMB 2YAPA 4EN3C 3A6CH 3QHFL 2H6UA 5J9PB 4FHJA 1SBSL 1CXFA 1U33A 3L3KB 2FHFA 3BGFB 2ADIA 2F68X 4LARH 1U8KA 5L2KE 3AU1A 2JQZA 1CFVL 2J8UF 1I3GL 2EDHA 5T3XH 1MEXL 3MRQB 5FDYA 4MQSB 2XT1B 1WS8A 2C9RA 5CU9A 5L4JA 2CDFA 4XNDA 4FP8H 3S35X 1MCLA 2WOBA 3HE6B 2N0KA 5F7WC 4BGLA 2W0PA 4RMSA 2NNAA 2FLMA 3SGDH 1IZKA 1Q38A 1RD6A 2ZXCA 4LBAA 1TPXC 3W39B 1RZ8B 4X5QA 4FQJL 2CLZB 1XR9A 2J8UE 4OD1L 3CZFA 4ZI8A 3L9YA 1ERNA 3FQUB 4PD4J 4RMTA 4P2QE 3NFSH 4P3CH 3REVB 1I8IB 1AYRA 4XCYB 3UC2A 2O5ZH 4NQEB 3ZKSD 4F8LA 3U7WH 4G8GE 3O6KL 2VDKB 2JJTC 4XVJL 3ZDZE 3CHRA 1NM4A 3JT0A 5CJQH 2VITA 5CAYB 3K71B 4HIPA 3N04A 1D7FA 4L4VA 1PL3A 3FUEA 5GHWH 2P8PB 2QKIB 1IVLA 4E9YA 1N2RB 4NO0B 2Y36H 5I0YA 3RZCA 1EDHA 5GS0D 4KKQA 5F97E 1WC7A 2A6DB 4KKCD 4BFGA 1QRNA 5FW8A 2Y22A 3C08H 1MCFA 1T5XB 4HBQA 2C34A 1BZDA 4F15B 1UYWL 1Q8MA 1DQLH 1JZIA 5EBMB 1HZLA 1X5LA 4AYMC 2YFNA 2EXTA 2X40A 1K6QH 3GNML 5LBGA 3UJTH 3VA6A 3VQLA 2KH2B 4PV9B 3O9WA 3VSTA 4PWKA 2JTYA 4PJBB 1QSFB 3MTXA 3FW6A 2LTQC 4QHUB 2XVBA 1DVFC 4GINA 1T1XB 4LDCA 3SDAD 3BKJH 1MREH 3LNGA 1OARH 1YHPA 4HWBL 1FYHB 2KDYA 1IGMH 5MERB 1THCA 3B7UX 3L3JA 4XNBA 1L6ZA 1OSZB 5D5MB 1O9ZA 2GJPA 5FDWA 3RIFK 2UYLB 5J0BA 4JHAL 3D3VE 3F7KA 2SODB 3W1ZA 4XO9A 3BD4A 3Q01A 4RMVA 1OIOA 2DQFA 5K9JL 5F0MB 2G4EA 3CMGA 3VXUB 5H4YA 4YHKH 3S3JA 2Z35B 4FOMA 4HJSA 1JTOA 2Q6WA 1A2YB 1AGCB 3QB7C 4Z78B 1MIEL 3TASA 1I8AA 2ESVD 5E8NB 3WFCL 4AGOA 5CJXA 1WTLA 1BCIA 4L9LA 4RAVA 5B3SB 5JORB 3L4CA 4XN9A 3HZKB 2LU7A 1T2JA 1YNTF 3S9DB 1D5MA 2PW2B 1HIML 3RB5A 4ZX6A 5TE4H 5A2IH 2DEXX 4U4BA 3ZE1B 3HS0B 5IWLC 1FZOA 1Z0NA 4IBVA 2QQKH 3EJQA 3GJEA 3JXAA 2VN7A 5I5IA 2CUMA 2OK0H 1UA7A 1KN2L 1MOEA 3OGOE 2FVNA 3Q6FB 3GBMH 3HKFA 4NQXB 3SDCC 3D2TA 4LCUB 1M05A 3EXJA 1FAIH 4PV8B 3RWEB 1IKFH 2GI0A 3MCLH 5KTEH 4CKQA 1IAOA 4IRSC 5DVNA 3WNPA 1GZHC 1MFEH 2P5EE 2WXQA 5CJOL 1R17A 3QJUB 2V0AA 4NO3B 4JPSA 2P44B 2J2ZA 2VDPL 5D70L 4LFHD 5LBVA 4PJDF 3WELA 3IBOA 5DHDA 5MP6H 2VDQB 4H20H 4OM1L 4TM9A 5DQDH 5L7XL 2AEPL 2X4SB 5CEXB 3L1OL 4WLCA 3VG0H 3J8F7 2E75C 3HPLA 2X9ZA 1V3LA 5LGJA 3BAJA 1JVOA 3F58L 2H1XA 2VISB 3C5JA 1P5VB 5CXPA 5KSAC 1BQKA 2FX8L 2OTWA 2YQ2A 4TQHA 4AJ0A 5JPNC 3LQZA 1V55B 4IMKC 3AABA 3IFNL 2YPVH 5JW5A 4OUUB 4JJ5B 1L7TL 3LQAC 5EIQA 1EJOL 2MNUA 1F4WH 1P9MC 2DIJA 2YD2A 2EXWC 3V9EA 4WZ9A 5CINH 3MLWH 3OAYH 5AD0B 2BNQB 2F74A 2ZYHA 4HT1L 2HRHA 4O2FA 5HYJE 3GSQB 4DGYH 2AEIT 1S4IA 2ZP8A 3GF8A 3LS4L 3QHZL 2Y9RT 2ARJB 1MLCA 5L2JB 2FR4A 2IIJA 2H6PB 4XVSH 1MZZA 1ND0A 3E8VA 2ADJA 4JAMB 4PBXA 5DC4B 5HYSG 3VXSB 5IKCA 1LO4H 4M6AA 4N8VA 5HBBA 1TYRA 1W8EA 1DBAH 4BK4A 4HBCH 3OHXA 1F4YH 4CDHA 2NX5B 1CFNA 4J3TA 3B37A 4NP4H 3VWJD 2D3JA 1E28B 5D9SA 3DVGA 3AG4B 3GJFH 5J3HC 4Q9QH 3HHSA 4TPRH 4XCEB 2IC2A 3I3EA 2AGJL 3T08A 3F2LA 3EIFA 1J9TA 2OR7A 1A02N 2DEYX 3EYUL 4LZKA 1ZS8A 2ZWYA 2IAMC 1KCRH 2C4FU 1CTOA 4R2GD 3PFQA 4MMZB 3WS6A 1R33A 1MHCA 4N24A 1U95A 1CGSH 4GAGL 5D7JA 5B38G 4NNPH 1J18A 1TZAA 4HQQH 4KFMA 4HJ0D 4Q6KA 2R8SL 4M48L 3QXVA 4PRAA 4KGLA 4Z7VF 1JVKA 1XIWD 2E86A 3B2UD 7FABL 1PFCA 2IMMA 4ZAKC 1EZUA 3PYCA 4APXA 1C08A 3TA3C 4PLJC 4EJ1C 1T3FA 3HE7A 4FL4C 1U3HB 4AV5A 4X80H 1T83A 4JFXA 4RMBA 1DJHA 4XMVA 3FT3A 3Q5OA 2X10A 2AITA 2V17L 3TO4A 3CBRA 5I16A 1A3LL 3DK2A 3DXAE 5HGDB 3PWPE 4CL7A 3SDXF 2ADGA 1CICC 4M1CC 3CZNA 4X0KA 2XA8L 5DURB 3BESR 3QYCA 3QZMA 3ZDYF 1NCAL 1HX0A 2BFVL 4OIAA 2FIKB 3ZHKA 2RALA 1CLZH 3OAWA 4KK8D 1FYTA 1MFNA 1RK1A 3FT4A 5DWUH 5HXMA 4QRRA 3VD3A 3NSFA 5J1TC 1HZHH 4PAZA 1F42A 2XZCH 4Y5VB 4JCLA 1TT6A 2FL5B 3FYIB 1S5IL 4OFIA 2D7QA 1IQDA 4PVMA 3JV5A 1T66C 4OQTL 3GM0A 2H7WA 2YSSA 3N44B 1TZOA 4TTDD 2V9UA 4OZ4A 3JVGC 3F6JA 2N7BA 2V8MA 1DVSA 4BELD 4FQHA 5LGKA 3WHXB 2ZCLL 4YLBA 1LEGB 1OM9A 1P5UC 3QPXL 2V9TA 3O6FA 3QUXA 2A6JA 5JIHA 3T0XA 3UZQA 2FEEL 4YSDA 3I6GA 1IGCL 3KPSD 4OZIF 3EF4A 3N5AA 5TQ0H 4L8DA 2CMRL 3CFJB 4GQ9H 1I9RH 2XVLA 1D3CA 1TO5A 3AGWA 4WNQA 5INCA 4WWKC 3O6MH 3NCCB 3OB0K 4IMLB 2NXYD 3T4AC 4PJ5E 3A4EA 3T6ZA 4Z23A 5I1GL 4A2FA 2H3NA 2B7DT 3OLIA 3QIUA 3GINA 2Z3FA 1KIRB 3UZEC 5C7XL 3TVMA 2J12B 4V2BA 4HPHA 1H3PH 2FH6A 1JPGB 3DO7A 2IPKB 5FUCC 4CVZB 1OAQH 2CKBH 3BWAB 3QNYA 1UB6A 3PWVB 3DURA 2G3MA 3KXFB 1DQDL 3UAJC 4X7SH 3VA2C 2BOCA 1IM9A 2VDNH 5CKAA 2YSTA 5L9DH 4JDEB 1SXBA 4HUMB 4NQCA 1K72A 2VDRH 2P46B 4OZGF 5FYJD 2ICES 3CAFA 4OGQC 5K69A 2XBDA 3DIFB 5HGBB 3KR3L 6FABL 4D3CL 4NIYE 3UTSA 3WN5B 1ZANH 2G60H 2FX7H 4I48A 3NAAH 2OXHA 1CCZA 1HCZA 2PETA 3LH2H 4XMLH 5TFSL 4ELMF 5MEQB 5HDWA 4A37A 5FA4A 3ZYJA 1CD0A 4HHWA 2VQ1A 3FCSA 1A1OB 3FBKA 4Z7WA 1PD0A 4ODXB 5DRZB 1L9NA 1J11A 4X6CB 4TVSa 1OAKH 2F8IA 1I7TA 3HI1A 1G9HA 5BRZD 1VERA 1CBVL 5JZ7C 1FNSL 3QEUB 4ZMLA 4R3SA 1MNUH 4OFQA 2AF2A 3TEWA 4YN3A 4NQSA 2ZOLA 2NZ9D 2RJMA 4MXQD 1YN6B 4M7ZC 5J57B 2IQAA 1UD6A 2YD8A 3C5SA 5TGBA 3KEDA 1JHTB 4XOAA 3FQ1A 2FT7A 4Q9CA 1BHGA 4NRXB 3TL5A 2G9HB 3MV9A 1IX2A 3ZJAA 2E7DA 4XMKH 4DW2L 2J3SA 4NQVA 1R3HB 3EJJX 1EERB 1HYRC 1PD6A 1V8HA 3QG6B 2V2WB 1AR1D 1MHHB 1UWYA 2WGNB 4P23A 3GO1L 4ICXA 2GJZA 3KW7A 1GYVA 4RCAA 3QNXA 5DZJA 3VRLF 2NY4B 3ZE2F 5C0EB 3DI2B 1JDCA 5CD5D 4GQZA 3ARUA 1AHKA 3ARRA 3M1OA 4XX5A 4QEGA 3OAYK 1KJ2A 3IRZA 4FTVE 4S1SH 1OP3H 4LLYB 4PJ8C 5I15L 3UBFA 5E1GA 2F7OA 2KZKA 1T04B 3G5WA 2B0SL 3WLWC 3O3EA 4GPVA 4WUUB 3WFHA 5C09A 4UM9B 2UY7B 5IVZB 3SGKC 5DFTA 5HHQA 5DJYB 2XPZA 4OFKA 1PZ5A 3WJJA 3QVAA 4A67A 6TAAA 4KRLB 1WFMA 3NCMA 4MCNA 5CBEA 4P4KD 4MJ6B 4PWJA 3RNKB 4OI8A 2I07A 1IC1A 1U8LA 4LLQA 3US0A 5AAWA 2NNRA 1WGOA 3WDJA 3QJVB 3HBZA 4FEIA 3OJVC 2MKWA 2J6EA 5ACZB 3K7UA 4LKCB 2WINA 3SPHA 1NEZG 1JNHA 4CW1A 1DO5A 3N42F 3TH2T 3EOBA 4HJIA 4IBYA 3P9MB 5ETUB 4EVNA 1YAZA 3V6ZA 5KG9B 5KBMA 3WKNA 2VGLM 3M6DA 2C1OA 3V5HB 2X6MA 2FJFB 4F91B 4ZSOE 3FPXA 3MKGA 3QORD 3APFA 4NQDA 4BQ8A 3VAEA 1F8TL 1QAWA 3OZKA 4F8PA 2A73B 1GAFL 2D4DA 2D73A 3OPUA 2HKFL 1A6AB 2DQCH 2ZXGA 2EKSA 4GMTH 4HWNA 4JQVC 1XXDC 5DJ2A 4YHNB 1SJMA 3OJDB 2Q86A 2YGOA 4D0DB 1I1CA 2FO1A 2BMKA 3HUJE 5B1CA 1NUNB 3O81A 4X9YA 5D8JH 4FG4A 1JXGA 3UTTA 3BPCA 2EDQA 5LWYH 1Z9NA 1AQMA 2PCYA 3QH3B 1D2OA 1MWAH 2BSSA 4MFHA 4PRPD 3ELAT 2E8ZA 3OTTA 3QFJE 4RNRA 5AKTA 1EXGA 3BP7B 3VUAA 3CZEA 15C8H 5L88H 1DJGA 2QPUA 3CD4A 4Z7OE 1N0LB 3EJTA 1U8MB 3DJTA 2GUYA 1SYVA 1YVLA 4FQXC 1B0WA 1EBPA 3OHMB 2WLZA 3VFGH 1J0IA 3FNKA 4U31A 1I3UA 2W38A 1PCSA 5JIKA 1Q94B 1MHPL 4LNRA 1X44A 2EZ0D 3OKMA 4FNQA 4BIKA 1D6VH 5IM7A 4G8FB 4LARL 4L8SB 2XXCB 3LNHA 5T3XL 5IB5A 2JMRA 1TXKA 2XFXA 1A6VH 2ZAHA 3Q06A 4EIBA 4IEFA 1S78D 4HKBB 2FAUA 2M83A 4YFLF 2CO3A 1CGWA 1TTBA 1S7XB 3ULVC 2DM3A 4XE5B 1EJ8A 5KYNA 4RSYA 1XD0A 4GKSB 5E5RB 5E6ZA 4YBLB 2YD9A 3KS0H 3P3RA 4FQCL 4ODUB 3D0AA 1IRAY 2KC0A 2BINA 2YS4A 2WSPA 3N50A 2V5TA 1CG9B 5ITBH 3EYFA 1ZXKA 3GJFB 2JIXB 3FHAA 4NZJA 1USQA 5IJDC 5LCVH 4PLNC 3NFSL 3DX7B 4P3CL 1Z0MA 3B43A 1IFHH 3QUMH 1XGPA 1S7TA 2PR4H 2P8MA 4WUKL 1I9IL 2O5ZL 2VB5A 3H7LA 5IK3A 1EFXA 3U7WL 4TNWF 3MXVH 2JFCA 1KCBA 2VOTA 5PAZA 4ZZKA 4QLWA 1ETB1 1UA6H 5KVFE 1NUFA 3VB9A 2HVKA 3Q7JA 2HT4C 4RMQA 2WAQA 3B1TA 5GHWL 4LP5A 3AJ7A 2VM3A 3V8CA 1I3RA 4BZYA 4G1MA 4QHKJ 3UO1H 1I85A 1WWWX 2Y36L 1KPRB 3WIHH 1SHXA 3PWJB 5C6TH 2OLDA 3WFDL 1QKZH 1WA2X 3H9SE 4BE6A 1XF3B 3HS8A 4L1TA 3TN0C 2RACA 3RL2B 5JHDE 1VACB 1L9RA 2R39A 1X7TA 2ZUQC 2PN5A 4BFOA 3WENA 3MRGB 1HE7A 5GSVA 4GG6A 4GRWE 1KFAH 2Y07H 1M3JA 5HPMB 3BVXA 2YEZB 3VYOA 3WXVH 5EUKA 3X13B 1DR9A 2QTEA 3ARBA 1HHKA 5FK9B 4JFED 3WYRA 1F11B 1K6QL 5CLYA 1CN4A 1H6EA 2FNBA 3OWEA 1D9KB 4GUPA 4QLRA 1BVNP 1XGZA 5E94A 2NY6D 1FGVH 12E8L 4LVHC 4U7SA 1SPDA 4KQ4H 2CHNA 4PG9B 2TRHA 3PIQA 2WZ5A 1B2WH 3VNZA 1MREL 1CF1A 5JO5A 5A2FA 1IGML 4X8CA 5IOPB 1S9YA 2ZTBA 2CSPA 5GSRB 3VGDA 4RGOH 2E8YA 1FV1B 4PWGA 5ACMA 4MQ7A 1XF5A 2MHAA 1NCWH 1T03H 2LVEA 3TXAA 3DHUA 1NGZB 2H32H 3CSTA 4JM4H 4PJCB 2DYPB 4JFUA 4WRLA 1AD9B 4YHKL 4C58B 5HTSA 4N9OB 1AAJA 3HI6H 1E65A 2B1HH 4ESKA 4J2XA 4PJGA 3FTZA 1VKXB 2Z93B 3TFKC 2E0PA 3NACH 1SJEA 3S5LB 3EH5B 1ML0A 4L3EA 1TR7A 1JPFA 1S5HA 1DVYA 1U8NB 2XG5A 3O2WH 4N5UA 1PGRB 4WV1C 4H26B 2FSEB 3EFDH 4F92B 3A21A 3B3IB 2AKRA 3O3BA 2QKSA 4PWIA 1R3JB 5TE4L 5CGMA 1NIDA 1KEML 2UXFA 2QQKL 3A4FA 2OK0L 2IH3A 1UB5A 2CK0H 1YEDA 2YPLB 3BGFC 3IF1B 1W80A 3D51A 4HGWB 4ZNCD 2ICEB 3GBML 2H45A 2XTSA 3I9GH 3LQMA 2R15A 4NNXB 3MCLL 4OZFA 3SJVB 5KTEL 4B7LA 2WBJD 1ZXQA 1QR1B 1MFEL 4WI7A 2K9FB 1NLBH 1RERA 3HE6C 2C3GA 4OLZL 2YC1B 4PTUA 5DJ6B 5CHNB 1KJMA 3QI9A 1SY6A 3IMSA 4Y5XA 3DX1A 2DJ4A 2NY0D 3QULA 3RI5F 4GXFA 3WTVA 5MP6L 1J9SA 2PTTA 4XVTH 4QTFA 4WJG3 2VDNB 4KKLD 4GFTB 4HS8H 1ADQH 4OGAC 3RUGE 5DGRA 3VG0L 3VCLA 3RX7A 4JRLA 1SDDA 1UEYA 1K4CA 4U3CA 5JOFA 5IQ9B 2NW2B 1AZBA 1VGKA 3HG1B 4PLKD 4P2QA 4EAEA 1MQKH 3GTNA 3NRFA 4NGHH 4OVUA 3L95A 5AW9B 1B0RB 3NGBC 5IR1A 2Y25A 4ZUUA 1JGLH 3QAZC 3II2A 4ODWA 3SE4C 2PMZA 3AROA 3TJPA 3CSYB 1PFOA 4XN7A 3JZ7A 2YGNA 4EZLA 2QKIC 4S2SB 1LQSR 4QHLA 3FB8B 2GHWB 4BFKA 5IMMA 3UIZA 1PX4A 1UM4L 2PO6A 4IRJB 3FF8A 5GS0H 4FMKA 1ZHKB 3ULVE 3RURA 2CDGA 2HFFA 3MLWL 4NUGL 3NCXA 1Q4NX 2XIBA 1PPIA 2QMKA 1WFNA 4HCRA 4JFDB 5G4NA 5F2FA 4BRVA 4QOKD 4DGYL 4I0PA 1MCIA 3CPLA 4QXWA 3IMUA 4JJHA 4F15C 4F7PA 4NT6B 5KANI 4B9YA 4WHYH 5F1NB 4IS6B 3QUKB 4XVSL 1YN7A 2WBWB 1LO4L 1HEZA 4ZXBB 4JM2F 3IDMB 2E9GA 4LT7A 4GOSA 3ZTJG 1E0OB 3UGXA 4MNQA 1JWUA 3GHBL 3ULUC 1AQKH 1U8OA 1DBAL 5CR1A 2R0KH 4H5SA 2X4NA 3V55A 3DMMC 1F4YL 2IFGA 5K93A 1D5ZB 3C60D 4YDMA 4NP4L 3QCUL 3A4DA 5AAPA 5C0CD 5I24A 3WY2A 4M3JA 1G5GA 4X6FB 4Y1AD 4TPRL 5AW6B 3TIEB 2VZOA 4G5ZL 2GIMA 1X5HA 3JWDC 4EIZC 1TJHH 5B4MC 1MCKA 2W0KA 3DTXA 3QEGH 1IVTA 1F1DA 2NY3D 5KANG 4GW5A 3RGVB 4BM7A 5A2CA 1YO4A 4PJAB 2PPCA 1WZMA 3WV0A 2ZCKH 4M56A 2HRLA 4N3UA 2JF1A 1A4AA 5CS7A 1D5IH 3KLHC 3KBPA 4FNPA 1RZKH 1CGSL 3IJYB 1ZV2A 3FZUC 2GYSA 4FQ1H 3EDDA 1A6ZB 4TLTA 1H3WM 4HQQL 4E2OA 2Z7YA 4PD4K 1P7QD 5E03A 3GSWA 4X2UA 3SN6N 4NUMA 2C3XA 3V52H 1JGEA 2N3JA 4JW3A 4LCCA 1J1XH 3RWFB 4AUJA 4FS0A 1MXDA 4W4NA 5EC1B 5C07D 3HS0C 4PGDA 2V3DA 5DEGB 5KVDL 3H56A 3WIIH 3ZE0B 3NZ8A 5IP4A 3FN3A 4UV4L 2VAAA 3UG4A 2PWDA 5C97A 2QHRL 1M7XA 3O3DA 1BW8A 3VD9A 3H2QA 2R1WB 1ZEAH 4KXAA 4N9GA 2ZT9C 3KW8A 5FYJU 4KWUA 2PCFA 2Y3NA 4ZW6A 1NMCB 1MY5A 3SB3A 1I8UA 3DUSB 4WWNA 3TWCH 2P5EA 4A1RA 3QUZA 3SE9H 1CDIA 1MJ7H 2R69H 3BVNB 1CLZL 3N06B 5DWUL 3W57A 4UQ3B 1HZHL 5HDRA 2XZCL 4JG0H 3W3BA 3ARDA 5C70A 1KIUB 4GRLB 2DH2A 4ZK8A 3O2DA 2WUCL 2Y5TA 3LKPB 2ZWZA 2VYRE 2CH8A 3FHEA 1AHWB 4NM8H 1D6EA 1HHIA 2CO7B 3K1DA 2EQDA 3RAJH 5FECA 1BVLB 2HN7B 4EN3A 3F6IA 4G6FB 1BYOA 3EBIA 2J57A 2J1YA 3QFDB 1R5IA 2GSGB 2C3WA 4K71B 3FTGB 5KVGE 1FFPA 4FFYA 4OBSA 4E41B 3SKUD 5IT2H 5T1LA 2WZ6A 4H8UA 5KOVC 2IANA 2X9WA 2EACA 4LASH 5C92A 3U82B 4GQ9L 2WXHA 4LE8A 1I9RL 1E5UI 2CUAA 5BZDA 3RDTD 1KTBA 2YXMA 3O6ML 3SDDD 4LPVA 5FF6B 3TO2A 1YC7A 5HYJA 1XGRB 3QYMA 5DRXA 4JX0A 4PRNA 4U6TA 3KVDD 4NQEE 3MJ6A 2VJ0A 5J4MA 4D7PA 4MQXD 3VQMA 5C0GB 3MRMB 3S48A 1H3PL 1NCBH 5J11B 3MJ8A 4OZHA 2BCKB 2CKBL 1A6TB 3MAWA 4JFFD 4JLRB 4KRPB 3VFPB 4AH2A 3VTAA 1ZSDA 4MYWB 4MAZA 3SO3B 3FO9A 1SXNA 4X7SL 5DO2C 3VFVA 5L9DL 3ARZA 2H2PC 1IBZA 3ML8A 5EU4A 3BWSA 4R8WL 3ZZLA 2VDRL 5I8OL 2G4GA 1W0YT 2LLNA 5SWZA 1UACL 4OSUL 3JYCA 2EUVA 4NDMB 2A38A 1VZIA 3W0WE 3EBAA 3HCVA 2FX7L 4JZOB 4U1LA 3V0WL 3BEWB 3NAAL 4MZRA 4IBUA 4MMZC 4DZ8B 5CGYD 3LH2L 4XMLL 1F6AA 4R4NC 3VG9B 3VI3E 2OJZH 1KV3A 3ZKNC 4DAGH 5EO9A 3ARGD 5KZCD 2Y06H 3ULUE 1FO0H 4PJBE 5DO8A 3MRBB 3U30B 1OAKL 3U0TA 1E6OL 4NUQA 1JZHA 3ZKXC 1MNUL 2UX6A 3K3QA 2GSIA 4XZUA 4IOFC 4Y4HA 5EB9A 3SYQA 5I1IH 3FAXA 2X2JA 1DVFA 2DQTH 4FERA 1EWHA 4OCYH 4E9RA 1S9WA 3HW7A 2R7EB 4JHBA 4YBHA 2R23B 1F86A 3MO1B 2JB5L 2HLAA 3VXUE 2VERN 2N7AA 4XMKL 4WIQA 3STZA 5DHVB 1HOCA 3DARA 3PNWA 3DXAA 1KULA 5E8PA 2FZ3A 1JHLL 43C9B 1AYOA 1BXVA 4ONHA 1MCJA 4Z7WF 3G3LA 4P5TC 2P24B 1XMEB 3Q3GA 3HZVA 3MLUH 4UQ9A 1UT2A 4GW4B 4TN9A 4Y5VC 2ZUTA 2ZUXA 3B7YA 4UMGA 5MENB 3MLYH 1KG0B 3OB8A 3GSXA 4S1SL 3WE6A 3LD8B 1YMME 5D6CB 3N6YA 2FYVA 3FONA 3VXRD 4K9EC 5IWLA 2M8XA 2WNWA 2Y7NA 3PUCA 4Z18A 4UT7H 5FGSA 1N26A 5EOQL 4ODSL 4MB5A 1QYGH 2BW5A 4WKZA 3SDCA 3K6IA 5D72H 3G08B 2PXYA 2C9UA 4MDJB 2AXFA 1HN1A 2HLFC 1Y6NR 4HV8B 1J05B 4IRSA 2WJ7A 5ANMB 4Y89A 3QJOA 3IBEA 3KPLB 4ONGH 2G0LA 4XNYL 4HOXA 3V7AE 3QG7H 4C56D 3GSUA 5BZXA 5LAPA 4G1EB 3RVWC 2BRQA 5EF2A 1WBYA 3KCWA 4DT2A 3EO1A 1G6RA 1S7QA 4RX4A 5TPWH 3D8MA 3RIFF 4YDKH 2H8PB 4ZFOB 3LZLA 3QEQD 4J4PC 2D7MA 4PJ5A 3T2PA 1UTDA 4U1JA