1L9PA

Crystal structure of nitrite soaked i257g variant of the copper-containing nitrite reductase from alcaligenes faecalies s-6
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLGGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Directing the mode of nitrite binding to a copper-containing nitrite reductase from Alcaligenes faecalis S-6: Characterization of an active site isoleucine
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 94
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9pA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9pA02
3NP3A 1TU2A 1ASPA 1VLXA 3PLYA 3QJSB 1JZHA 1UATA 1AZUA 3NJKA 2IWEA 2J57A 2MTAA 3CDZA 5F7BA 2FT8A 2FT7A 2JKWA 4A2HA 2XUWA 2GC7C 2QPDB 3FS9A 3PAVA 1FFTB 4FAAB 2GHZA 2H5UA 5AZUA 5AKRA 2ZXWB 3GDCA 4HHGA 1PAZA 3FQ2A 1AQ8A 1V54B 3AG1B 2I85A 4E9RA 2BWIA 4KNSA 3DIVA 3T6XA 2FTAA 1JXGA 2HXAA 1ILUA 2J55A 3CVBA 4UAHA 2FT6A 2TSBA 2FQFA 2BP8B 4G7SB 1JXFA 1QNIA 1NICA 2PPCA 1J9QA 2XV3A 3KW7A 1PLAA 2XU9A 1XB6A 1SHWA 5B1JC 1L9PA 4Q89A 2PCYA 3OD3A 3L45A 1TKWA 2WO3B 4YSRA 2PLTA 4CSZA 1AOZA 1KDJA 3AG4B 4NAJA 1NIBA 4A67A 1R1CA 3FU9A 1E5YA 1WA1X 1XB3A 3DTUB 1IBZA 3NSFA 2CAKA 1OCCB 2XV0A 3UADA 4HAKA 3QQXA 1ZIBA 2GSMB 4DP4X 4YSPA 4PCYA 1EZLA 2YARA 2N0MA 5TK4A 2IAAC 2CCWA 5I6OA 4L0PB 3ZX1A 3UAEA 1N70A 5I6NA 1AG6A 2HX8A 1KYAA 2W8CA 1NDTA 3EH4B 1PY0A 3OMAB 2IDTA 1SJMA 1AZCA 1JZGA 5PCYA 1ADWA 1AIZA 1BYPA 3TBCA 1NTDA 5I6MA 5I28A 4W9ZA 3FPYA 1BYOA 1NIAA 3AG2B 4JHVA 3V9CA 1E67A 1GR7A 2UXTA 3CVDA 2IDUA 3X1NA 3NSCA 5B7FA 1T5KA 4YSTA 2EILB 1SDDB 4E9XA 5EHFA 4FA7B 1RCYA 4G7RB 2QT6A 3QJUB 2ZOOA 3X1EA 2BHFA 4ZK8A 1J9TA 1NIEA 4A2DA 4A2EA 2OV0A 3ABMB 3X1FA 2EIJB 2YAOA 2J5WA 1JVLA 1ET5A 2AFNA 1DZ0A 2R7EA 1E5ZA 1W6WA 1JZEA 3ABLB 2PP7A 1HFUA 3NSDA 4KO5A 3S3DB 1PMYA 3OMIB 5D4JA 3G5WA 3RYMA 1GY1A 5PAZA 1NPJA 2GBAA 3BVDB 1AZNA 1OE2A 4BDVB 5I26A 3H4HA 1J5DA 3H4FA 4X4KA 5B7EA 3JT2A 2XX0A 4GYBA 3N2JA 4G72B 3MX0B 4F7KA 2XLLA 1PNCA 2VW7A 2EIKB 2AZUA 4HHWA 3TU6A 4EF3A 3ZDWA 4E9YA 1GSKA 1ET8A 4M4RB 3GXUB 3NT0A 3PPSA 3S8FB 2YAQA 4RH4A 1OE1A 4YSSA 2X87A 2AZAA 1KCBA 1PLBA 1OOWA 1L9QA 4G71B 3FT0A 5I6PA 2OJ1A 3TBBA 1JOIA 2VMJA 1SF3A 2BP8A 1PF3A 1OCRB 4WTQA 1AANA 1KCWA 3WKPA 2PPAA 3NJNA 3AW5A 5AFAA 2Q9OA 3T9WA 1MDAA 4YSDA 1AS7A 3NJHA 3AG3B 1OE3A 2CALA 4GP5B 1QLEB 1NWOA 2HX7A 2BP0B 2PPFA 4DP8X 1L9SA 8PAZA 3AY2A 4DP7X 5I6LA 1J5CA 2NRDA 1HAWA 3IN2A 5FC9A 2H3XC 4HCGA 4PAZA 3EF4A 2A3TA 2IDQA 1NIFA 4Q8BA 4DP9X 2ZONA 1JZIA 4YL4A 1L9OA 1A4AA 1JZJA 4UF7C 4KO9A 3EH3B 3X1GA 3UACA 3FU7B 4KOCA 2YAEA 3WNIA 3NYKA 3FSVA 1CUOA 1BXAA 1MG3C 4YSUA 3QJVB 1BEXA 2QDVA 3U25A 3NSYA 2Q5BA 5B3SB 2DV6A 1KDIA 3T71A 2DYSB 3QJTB 1JXDA 3KW8A 3FSAA 7PAZA 2HRGA 3ABGA 3QPKA 6PAZA 2EINB 1GS8A 1J9SA 3WNJA 2GB2A 5ANHA 3CG8A 2P80A 2UX7A 2IH8A 1WA0X 1BQRA 5I5IA 5I5JA 3ASNB 2XXFA 4AZUA 3FSZA 1DYZA 3ZIYA 2BZCA 3FPXA 1W8EA 1SDDA 2UX6A 3FYIB 1NWPA 3NJFA 4GY4A 1RKRA 1WAEA 4E9TA 1RZQA 1FA4A 1WA2X 1MZYA 1AR1B 5D4HA 1ID2A 2W88A 1GY2A 3TASA 3SBQA 4BK5C 3EH5B 2PCFA 4DPBX 1CYXA 1ET7A 3T6WA 3FYEB 2UXFA 6PCYA 3NP4A 5B1KA 1JZFA 2FQEA 4E9VA 3JTBA 2HX9A 3MBWB 4GP4B 2VM3A 4KO7A 1ETJA 1F56A 4P5SA 3ASOB 4DPAX 4YSCA 4BDVA 1WS7A 3S3BB 3T6VA 3UGEA 2QDWA 2E86A 2YAHA 1E65A 4GXFA 1E30A 1A3ZA 2I7OA 2AANA 2VN3A 2B08A 1XMEB 1ZDSA 2OCCB 2IDSA 3BQVA 1XB8A 1BAWA 4CSPA 2GC4C 4BWTA 1A4CA 1OV8A 2YXVA 4G70B 3X1BA 4YSQA 3FQYA 2FQDA 1OF0A 3WKQA 1BXVA 1ILSA 1NPNA 1W6LA 3FU8A 4MFHA 1MG2C 4HCIA 3QJRB 4DP6X 5A7EA 3QJQB 4YSAA 2BZ7A 3WIAA 1GS6X 2JFCA 4DP5X 4YSEA 1ZPUA 4QLWA 3UABA 3TA4D 1L9TA 4F2EA 1KGYE 3N55A 1J9RA 2BW4A 3OQRA 1CYWA 2AVFA 3ABKB 4P5RA 3C75A 4DP1X 1M9WA 4M3HA 1A8ZA 4N4YB 2BP0A 2TSAA 3WI9A 1X9RA 1AG0A 2GI0A 2CBPA 4QKTA 1QHQA 1ZV2A 2UXVA 1HAUA 3S3CB 4YVNA 2DY2A 1NINA 4JKNA 4DP2X 4E9SA 2ZWNA 1BQKA 4F2FA 1KV7A 3SBPA 1X9UA 4HCFA 1JVOA 2Y1AA 3FU7A 3CDZB 4W1TA 2EIMB 2Y69B 1CURA 5B1BB 1KBVA 2PPEA 4A2GA 3CVCA 3IN0A 5TK2A 3NJJA 2I7SA 1GW0A 2RACA 3EHBB 4NB7A 1AAJA 4DPCX 2UXGA 5B1AB 4HALA 2VSMB 5D4IA 2FWLB 2H47C 3S8GB 2QPEB 2CJ3A 2IDFA 1IBYA 1OCZB 3GYRA 4AKQA 4A2FA 4NERA 2XVBA 4KNUA 1N68A 5I6KA 4E9WA 1ZDQA 2IWKA 2PP9A 1ASOA 1A4BA 2WO2B 2YAPA 4A68A 3T6ZA 3X2QB 1ASQA 1IC0A 1BXUA 3OM3B 2XXGA 3HEIB 1SFHA 2IH9A 2HZHA 1EHKB 1TEFA 1YLBB 2FQGA 2PP8A 4YSOA 2J56A 3IEAA 1PZCA 1BQ5A 3AZUA 1PCSA 3PAZA 2XX1A 4AKOA 2MRYA 3UAAA 4TXVB 4UANA 3PAUA 1SF5A 2PPDA 4K9JA 1PLCA 3CZUB 1MZZA 2HLEB 2LLNA 2DWSA 2XWZA 2DWTA 2HRHA 2VW6A 3H56A 3NJGA 3NJIA 4KNTA 3HB3B 4GP8B 1V55B 2GIMA 2XV2A 4AI7A 4KOBA 2IWFA 3FQ1A 5E9NA 3WG7B 4WKXA 3ZBMA 2YAFA 2P80D 4BWWA 9PCYA 1M56B 1A65A 2VM4A 1AZRA 1URIA 3NJLA 1GYCA 1KBWA 2BW5A 4E9QA 3ERXA 4N8UA 3PCYA 2VW4A 2X88A 2YAMA 1JERA 3IBOA 3SQRA 3OMNB 4HZ1A 3FSWA 3V9EA 7PCYA 2JXMA 4BXVA 5B1JA 4A66A 1GS7A 2FJSA 1RZPA 1IKOP 4JHUA 1PNDA 1M57B 1ZIAA 4AX3A 4BWUA 1I53A 1CC3A 1AS6A 5F7AA 1SNRA 2VSKB 1PZBA 1TEGA 2B3IA 2FNWA 1SHXA 4HIPA 4BXSV 1B3IA 4KO6A 1SFDA 3SBRA 5I5MA 5IY5B 2DYRB 2YXWA 3DKHA 2R7EB 5B7MA 1NIDA 2CUAA 1PZAA 1OCOB 1AACA 1AS8A 1FWXA 4ENZA 2BO0A 4AKPA 3D12B 2WSDA 5LDUA 2BWDA 1WS8A 2YQBA 1NZRA 1AZBA 1L9RA 4G7QB 3IE9A 1V10A 2XYBA 1IUZA 3NJMA 3PXLA 4DP0X 4YVUA
chains in the Genus database with same CATH superfamily
2WWKO 5JR1H 1AO7D 2JLLA 5I75C 2N7AA 4FQ2L 5CJQL 5IG7B 1XTLA 3VD5A 3I6LE 4P5TA 3VXTA 4EE2A 4N2EA 2J57A 3CDZA 4UAOC 1N59A 1PX4A 1OGSA 5BUAA 5CR1A 1G7IA 2EC9U 2QPDB 1FFTB 5DZPA 2H45A 4GXUM 3TIDA 2IH1A 4JGMA 3VQLA 4HWNA 2YIHA 4K2UH 4DHLA 3LZLA 4Q6YA 1RJZA 2Y3NA 4UB0H 1IFHL 4TNWF 4X6DB 5JW5B 5H37G 2ZOKB 1QUPA 4BD4A 5DMYA 5T1KB 1IFGA 3EBIA 3T6XA 3F58H 4X6DF 3P73B 4NO0B 4MA1B 5HYJB 5EZJA 4OV5B 1FGVH 2GABA 4N90E 1JXFA 1QNIA 3GMNA 3KM2A 3WIIH 4QGYA 2BNQE 2F0CA 3MREB 1J48A 3N40P 4IIZA 2BK8A 4KUZH 1U8IA 5FYLH 2EH7L 3ETBF 1SHWA 5C07E 3CIQA 3MUZ1 4APQB 2NY6B 3U30B 2PCYA 5HBBA 1FDLL 2ADFL 1DBKH 1ES0A 2KBGA 5D96C 2GJ6B 2R1XA 3HLAA 1KBKA 4F9PC 4WO4C 4TSBL 4XN9A 1KDJA 3HC4L 5JHLH 2MSPA 4OB5L 1G1CA 1GGCL 1CD8A 3U2SA 1SM3H 2V3EA 4GRLB 2ZSVA 2X28A 5KVEE 2VITB 5CLYA 5FKAA 4U1MA 5FYJU 3X11A 2MTPA 4KMLB 1UC6A 5LGHH 3S37X 3UADA 4ZFGH 4R6UA 1A6ZA 1KXTB 5C0CD 1MJJB 1NFDE 3IK2A 4HGKC 2IV9A 3GSXB 1S9VB 4LPVA 4YSPA 3GBML 4ZNCD 4Y5YB 3LN9A 2IAAC 3UC0H 4QRPE 1SVCP 2C5DC 4KK9D 5BV7L 3CVHA 4K9EH 1KEML 5C0EB 2CDFA 2QVKA 4JANA 3UAEA 3WFEL 5D6DC 5E00B 4IBUA 3QZWB 1FIGL 1UT2A 5D7LA 4ANKA 1UASA 2CK2A 5KBKA 2Y25A 3S3PA 5GS1A 2Y72A 1ID5I 1QFUL 2WLJA 4X4ZA 3HUJA 1MVYA 4ONOA 5JW3H 1W0VA 5CKAA 2BRRH 1NIAA 2Z91B 1TFPA 3WAKA 3RIAF 3LN4B 4ODTL 3S3JA 1IEBB 1HOEA 4Y2LA 4PBWD 1U9KA 1YC8A 1RUKL 4UTAH 2WGNB 1E4HA 2F7RA 3IDGA 4K94C 4YHPA 1AYRA 3S6CA 4ZUVB 1HYSD 3BEWB 3WHXB 5IKCB 3D85A 2CJTA 5D1QE 3X14B 4PJ5E 4W9GC 1N8ZB 2VR3A 2BVQB 3DRQB 1MI5B 3PQYB 3TFKD 3WU1A 5AVZB 4BH7A 1KFAL 3KVQA 5SWQB 2X4NA 3IXAB 4XMWA 5FDYA 3RL2B 1OPGH 5DJXB 2BNRE 3T2OA 5I17A 3V4PH 5G2NA 3LAFA 1RIVH 3DX9A 4OCXH 4HKJA 1DUZA 5KZCD 3QEHB 3ABLB 2G3XA 4NP9A 4FRWA 5HGAB 5F3BB 3A4AA 2YEZB 4TUKH 1JD9A 1VCAA 4PJGA 4LGPB 4Q2ZA 3HTLX 5KJ4A 2EDTA 1W0WB 1E43A 3O4LA 4XMXA 4N6RA 2CCVA 1BFOA 3H4HA 4QRRB 3O3EA 4FQQB 2X1WL 4RGNC 3NFPA 2XX0A 5DTFB 1DSFL 3L5IA 3KPSA 2XHNA 5IB1B 4G72B 4BKLB 4KXZH 1BECA 3U6XA 4BUGA 3ARUA 4RETB 2LR4A 3IS0X 4TNWK 5H4YA 3PL6A 5EU6B 3ZZLA 4R7NB 3RI5F 3ML9A 4N5UA 3S35X 4ZS6C 4ETQA 4JKWA 5E8OA 2A74A 1M53A 4RWYH 4KMQA 4AH2B 3TNNB 1QO3A 1CK0H 3QDJB 4QEGA 3MV7B 4G5AA 3F3HA 5A6IA 3BN9D 4J4PC 1TQCC 5C0AA 1OCRB 1ESOA 5I1AB 2R2BB 4AC4A 4JG9A 5HDBB 1V05A 5DJAB 2A6DA 3O6FA 5FUCE 3T9WA 3Q3GA 3LRSA 4EQ2A 1JZ4A 3GJFB 2WQSA 4NPYB 3X3FH 4HETA 2KC0A 2O6CA 4I77H 2Q1EA 4AY0A 5HDBF 5DYFA 1YNTA 4FYTA 4CJ0A 1ZV9A 2BY0A 3IGFA 3K6OA 2VLKE 2ADIA 5HYSG 1MCHA 4MXVF 4NC1C 1HAWA 4F27A 4H8WC 1XBRA 1JFHA 4LLDB 4PBXA 2CR3A 1VACB 3FF7A 1PKOA 3GMRA 1XGZA 4QR7A 3IKCB 2HTKD 2NX5A 2WNGA 4AOFA 3FULA 2Q8BH 2A83A 2AJ3B 3UBGA 1NEZG 1YCSA 1HZKA 2FJFA 5E5RB 4P8QA 5JDSB 1KCSL 3HE6C 5KVEL 3QNXB 4XNUL 3NYKA 2XG4A 5IMOB 4X6EB 2M1KA 4KRLB 1BEXA 1RFDL 3PUCA 3NGBC 4L18A 2CMRH 3N42B 4DSYA 1WDAA 2P47B 3LKSB 3EAKA 2AJVH 3EGSA 5C2UB 3P4NB 4XAWL 2MPAL 3N42F 2J43A 3SJVB 1I9RH 2ZWYA 4XNQB 3ZDYB 2VTFA 3H2WA 2EIDA 2P26A 5FLVA 1WCBB 3ZDYF 4GKNB 1O6SB 5I8EB 2A7BA 3ETSA 1OTSC 2GUOB 4OCWH 4OLVL 1ZK5A 4CMMB 5IFHL 1RZJH 5AB9A 1CI5A 1ZHLB 2IAMC 3ABZA 3FB7B 3PV6A 3QUMB 3RWEA 1NMAH 1ID2A 3Q1SL 1HE7A 1LEIB 3MROB 4O02H 4OZHB 2XTJD 3HC2A 4WV1B 2P45B 4OD2B 2IDCA 4ZDHA 3PFUA 1T7XA 4LK4A 1U92A 4JZJC 2Y5EA 2FQEA 4V1DE 4OZHF 1IBBA 2IANB 5EZLB 4WENB 5F44A 1O6TA 1E6OH 3MBWB 1HJCA 2EUZA 4NN6B 2Z4TA 3V4LA 3FTUA 5E5UB 1HOCB 3LQMA 5C0RL 4PTTA 3TEUA 4WVRA 3IS1X 5EOQL 2GG1A 3PWPD 3T2NH 2ED6A 2VDML 1SOXA 4JFXB 4RDBA 4KNQA 2L7QA 3P11L 3V0VB 1J05B 2I69A 4Y2DA 3SN6N 3RI5K 4GLRI 4XCNB 4S0TD 5CINL 2W0LA 4XO5A 1SJEA 4M5ZL 3ULVF 5EU4A 2N4IA 2EEFA 4FNLH 3FUHA 4ZMPA 1F86A 1OM3L 1MELA 3GRBA 2C9PA 1AP2A 3OGCB 1M05A 1HN1A 4JFEB 1CFNB 1OD7A 1UOVA 3BUIA 5D7HA 3MA9L 5DI8B 2OZ4A 4CNIA 4IDJH 5CWSA 4X7SH 2WZ5A 1MH5A 3ARGC 5JUEL 2HMIC 1MG2C 4W9JC 1LK3H 5TPWH 5LCVH 2BZ7A 2J8OA 2CHXA 4PGBB 3UAFA 3PHSA 4X9GA 3OKDB 2Q6WB 3MOAH 4C56B 3KDMA 3DURA 5DWUL 3V0AC 4BRVA 1J0JA 3Q2WA 1IBGH 3GJFK 4CC1A 1TUPA 4NI3A 4BK5A 5KVFH 3ARPA 3ARED 2F54E 5ISZD 4IGBB 1GRWA 3GHEL 2Z0BA 1FNFA 3FBQA 3MJ9L 4FHKA 4KY1H 4QKTA 3I75A 1XF3B 3BUTA 3TO4B 1XDTT 1RZIB 2YHGA 2X4OA 4U05A 4E0RA 5EO1A 3SDCB 1OAYL 1CLVA 2DY2A 2YUVA 3DHJA 4JZOB 3HS0B 4QF1A 5EMYA 1T1ZB 5TE4L 1X9UA 5H35B 1CO1A 3CZEA 1F11A 4XPGL 1TU2B 1AOHA 3IFPA 4LHUD 4M7KL 3VFTA 2H2SC 2OPCA 2NXZB 4FERA 1QABA 2NY0B 3BGMA 3A67H 1C5BH 3OR7B 3HZYA 5CIPA 4HS3A 4B5ZA 5KYUB 5FECB 1WAPA 2J4WL 5BO1H 5ADOL 2X4RA 3LRLA 2P5WE 3MU3A 3OXSB 5ANMA 1DEEA 3RKDC 5IHWA 4MA8H 1WO2A 1A1NB 2WXQA 3OX8B 4HK0B 4PJ9C 2DQGL 2AGJH 4G7VH 4DGVH 1EXUA 1JAEA 2OQJA 1EQWA 2QADB 3N6YA 5L4FA 2BSBA 3BGFB 3RZCA 4S1QL 1ED3B 3GO1H 3VFGL 3KJ6H 2GK0B 1YEFL 5FF6A 1J10A 1KN2H 5AVTB 3VH8A 2XJLA 3VM7A 2J56A 1BQ5A 5IW3A 1I8LC 3L3HB 4H8WH 4YHMH 3VDCA 1KSRA 4PGZA 5I74B 2FD6H 4FYSA 3D2UB 2ZP9A 2CIKA 3MBEB 4OGQC 2QFPA 1RIUH 1E5CA 4O58H 3B56A 3VD3A 4ESKA 3ILPB 4NHCH 4Z3GA 1SBSL 1EO8H 1DLFL 1U8JA 3T0WA 5T1LD 2ATPA 3NJIA 3QR1A 4JO1L 4U6VH 4NIYE 4HYTB 1DO6A 3HPLA 4LIQE 1UYWH 3S2AA 4ZS7L 4H0LC 4UT9L 3U1SH 1R3KA 5D8JH 5BVPH 4WKXA 2HMID 5DJ2B 5AUMB 1JGUH 2H4EA 5DJ6B 5HYJE 5AYQA 4BWWA 4M62H 3QORB 3V52H 5CJBA 1AXSA 3IMTA 3ZL2A 4KI5D 4E9QA 2KS0A 5DT1H 4ZFOL 2A4CA 1JUFB 1IBDA 3P30H 3TEWA 3HI5L 1R0AH 5EEUA 1JNNH 4ODSH 2KQMA 5D5ME 5FO7B 1LK2B 3OAYK 3DXAB 1HINH 5LNEA 15C8H 3PUUA 1RERA 1G6RB 3LMJH 4XVTH 4CRPA 4LRIA 3QUZA 2A6JA 4ZO7A 2IQ9L 2ZJSL 4PG2C 1NSNH 2AQ3A 3O3BB 3DIDA 4ORZC 2K9UA 4NNXB 5D2NA 5C6TH 4F33A 2PW2B 4OJEH 2IOMA 3RHWF 1PZBA 1H6FA 4FQIH 4QOKB 1NL0L 2QBWA 4YS4A 3RVXC 2NDFA 3IDUA 1MHHB 3OR6B 1YHPA 4P4RB 2NUTB 3SPHA 2WV3A 2VQ1A 2VL4A 4KZCA 3RTLA 1MNUL 3OKNB 1OP9A 3FQWB 3UJJH 1L0YA 2IPKA 2XNAA 4MJIE 3IF1A 5ITBH 4ENZA 3QNYB 5EBWB 2A38A 3QFJB 2F1BA 1YEHH 4AEEA 4PIRF 5HJGA 1I85C 2AXWA 3LXUX 3S5YA 5JHAA 1IM9A 4HD9A 4TOYH 1PS3A 3KPRD 1OT2A 2VUKA 1DQML 1OCWH 5F7EL 3HHSA 1S9YA 2AP2A 1MHCB 3HHRB 1UATA 3QAZB 2A6IA 4U6TA 4WW1A 4UV7L 1XF5B 5FECA 4AQAB 1SEBA 1NCAH 1MFEH 5FLUA 1RZ7H 4F92B 3VG9C 2Y1VA 4LHJB 5DQJB 3V0JA 3N1FC 3WLBA 4X6CE 4NZDA 1MI5E 1WT5A 4P23B 2CO4A 1KCKA 3NH7L 2WTPA 4HUUB 1XXFC 3BJLA 4KZDL 3IJYA 3HC0B 4R2GD 2JB5L 3VFNB 4XMZA 1UB6B 4WEBH 2VXQL 1NGYB 3JZYA 3TWYA 1WWCA 1JZ8A 4ZOBA 4HUVB 3PGCA 3V4VL 3L9EA 3OVUB 5CJXA 1W80A 4HW6A 4TNEA 3ZUCA 1U2CA 3P3UA 4MQ7A 1JZ5A 2HKHL 4Q89A 2WMPB 4H40A 1EZVY 1L0QA 2X89A 3AWFA 3Q6FA 1R5WB 4KROC 4AZ8A 4AIZB 4LSUL 4MDIB 4QXTB 2O5XL 3B5HA 1KPRB 3GMMA 5F89B 3A6OA 4CSZA 2R0KH 1FYTA 3AG4B 3EGDB 4R26H 4P57A 4ZMTA 3ZRFC 4A67A 1YNLH 4H1LG 3TM6A 4JRXD 5CR8A 5FO8B 4B96A 2VLRD 3REVA 5CLTA 1CJYA 4NQXA 2XQYG 4JQVA 2TRHA 1KN4L 3HNVH 3LEXA 2NZIA 2CR0A 1WRFA 3G9AB 3RWDA 1FAKT 5I8KH 4UZSA 1HWWA 5AW9B 3G6JA 1MW3A 1EHLL 3C6LD 4Z7QB 1M2VB 2JKIS 2VLJE 4JFDB 3QDJE 4NKDA 3MV7E 4PBDA 4UM9A 4BA0A 4Z7QF 1KYAA 3C5ZC 3RY4A 3CDGA 1I7TB 3EH4B 3G5XB 3QJHB 1S7QA 1QSFB 3UIZA 2NCMA 4P9ML 3RVXD 3UYRL 1UA3A 1QSZA 3MV9D 1BJ1J 2LVCA 4J1UA 5I1KL 4N2FA 1DQIA 4IS6B 4HF5H 3VD0A 3KXFD 2UZXB 1T5KA 1AE6H 5L6YH 4U1GB 5EHFA 1ZVNA 2IGTA 3BN3B 3RHWK 1SJXA 3O6LH 3EHBC 3VDBA 4L2YA 2BRQA 4X0KA 5H94A 1KYUA 2H3NA 3AT0A 2XVLA 4J27A 5AZ2L 4NO3A 5L2KB 3QE5A 3P0YH 4IMKA 4AV4A 4GXUN 7TAAA 2L7JA 3BHBA 5DZNA 2Z93A 1OSYA 1LNUA 1YMMD 3X1FA 3ZKMD 4HC1L 3NOIA 5C1MB 2KL6A 2R7EA 5HI4C 3ISWA 3MLZL 2UUDK 1QI4A 1RULL 1XSOA 4RMBA 2DYPB 1CU4H 1XR8A 4L23A 3S3DB 1U93A 2BY2A 5DVOA 1EGJH 4F15B 2DICA 2MMXA 1D2OA 3LDBB 4G8FA 4LO9A 2F7IA 4PJXA 4EPSA 4ZZFA 5JPMB 2QQLL 1I1YA 1ZLUH 1NBCA 1RZGA 3ZZQA 4ZBJA 5HHQA 2ALWA 5GS3A 5C09E 2Z1PA 1KCRH 1HWHB 4OTXH 3NCCB 1Z9SA 2EUWA 4YE0A 4Z6AT 1LILA 1A6TB 1IM3D 2VXVH 4I48B 5DK0B 5TF1L 2KUTA 2R69A 1QRNE 4G42B 3BQUD 4OI9A 3SDYL 3BYYA 1FVDB 4K8RD 3UTOA 3MRMA 4HS6B 4F24A 4KMTL 5T3ZE 1JDCA 1JFQL 1MF2L 1S7VB 1MAKA 5B21A 3NJXA 5EPMA 4B6ZA 2NQCA 3LKOA 2VQ4A 3BI9X 4J2QA 4LHUG 3C6SB 3RUGE 1J5IA 1A0QL 3O8XD 2JELH 5IR1A 1SY6L 3EF7A 4WFED 1PF3A 2ZXDA 1QW9A 1U8KB 4PJCA 1HEZB 3TA3D 4RAVB 2FBJL 4G80A 3SKJH 5LHDA 4NDMB 3FMGH 4Y4FB 5KG9B 3QYNA 2MKLC 3UDWC 4GP5B 2EXYC 4OZGA 1NAML 3KWUA 4QTHA 2L7EA 2E46A 1DL7L 4GKZA 3U0WL 1L9SA 3UG5A 5JOFA 1UWYA 4ODUA 3COOA 3KYNB 3ECBB 4GKSB 3B5TA 4LEXL 3IN2A 4JFYA 4L29A 2NXYB 5GRZA 3DX0A 3UGXA 3UYPB 3EYFB 1BM3H 4U1LB 4ZQTA 3HG1D 2AEQL 2Z92A 3QHZL 5EOTB 4FFYL 3RWCB 3MLYH 4NBYB 2B1AL 3D4GA 1A4AA 2LHAA 4HPYH 4P5TD 3MRJA 2P5EB 3ZE2F 2ADYA 2ATKA 3QO0B 4RISL 5FO9B 4RNRB 4B41A 4B5EA 5C0NC 3PWNA 4YSUA 1KGXA 2FWUA 3MRNA 3NSYA 4NQED 3ZTJG 4UV4L 5I1EH 4PJHB 2WAQA 5A16A 3CC5B 4IU2A 1JWSA 1QSEA 1BP3B 3ENEA 2EVFA 4GMTH 4GO6B 4PJHF 1P1VA 4QNPF 5ANHA 2NNAA 2BHUA 2IH8A 4S1RH 1WA0X 2A4ZA 1U2YA 2XXFA 2CKBL 3LKRB 5CEYA 1NGXA 1YEGH 1XH3B 2H0PA 4O5LL 4WI6A 5GGTA 5ENWB 3WY3A 3FPXA 1AY1L 4JHBA 4JMXA 2A74C 3UTZA 4WEEA 1XSKA 4NZRH 4PJIB 5C08A 4Z5RB 5KBPA 4K7PX 3PGDA 2XFGB 5LKNA 1ZWIB 2VE6A 3KEHA 4H8VA 4Q14A 1E4XH 3REWB 1Z6JT 4PJIF 5FOBA 2XKNA 2HPTA 1S8DA 2ZT9C 1ET7A 4YR6B 4FLSA 1KIRB 3CU7A 2NY7H 4I1NB 5D7KE 4PD4J 4YDLC 3UP1A 1YUKB 1Z66A 3O6FC 3MV8B 4PP2A 1AGFB 2HT3C 1TCRA 4MTMA 1SHSA 2H41A 4PS7A 4EXKA 4ELMF 3K4AA 2FR4A 4HJ0D 4LOUC 3PY9A 1F90H 3AADB 1I7RB 3HR5B 1W16A 4PB9H 4WNJA 2DI8A 4BH8A 3CN4A 1RZKC 1ZD6A 5MEQA 2ICES 2VUYA 2XIBA 1A7OH 3BE1H 2BJML 2Y1ZA 1J1OH 3NQIA 3CSTA 5A3IC 2E7HA 3FB6A 3EH2A 2X2UA 4WWKA 5DMKA 3T1WA 3MX0A 1XMEB 1OP3K 5BMFH 1YYLH 2WLIB 1S4IA 4AM0A 2IDSA 4MAYB 2BSEA 4PSRA 4ZW7A 2ZKHH 5D7JD 1XIWC 1BAWA 5L9DH 4K73A 3ZHKA 2V8LA 4MSWB 1CXHA 1JGIA 3WNPA 1BEYH 3RDTA 4XI5C 1KWGA 2NTFB 1N0LA 4FLRA 4NFBA 1X7QA 4B27A 2A4EA 4HK3N 4WEUD 5F7UA 3OKEB 2YOCA 3UTSE 3FHAA 3O11B 1J0KA 5C0JA 4L8SA 5DC2A 3KJ4B 4N1HB 2EEDA 3ZIMA 3QRLA 2DS4A 3B9AA 2JLPA 3NTCL 4YBLB 3RVUC 4W70A 4F2EA 3EO1B 4FI6A 2OL3A 5DD5L 5I30H 2DQHH 4LKCB 4U1IB 4J3OF 1B9ZA 5EU3B 3E3QE 1U0QA 2ZUXA 4F58L 1JPTH 3BKJL 1WITA 2Q2EB 3ARBA 3EH1A 3MUHL 4NBXB 4X2UA 1CICA 2AV7A 4H8HA 1MIML 3K2IA 2JB6A 2XTLA 2EYRB 1O7VA 1SDYA 3NIGB 4XVJH 5T3XE 2ZAHA 4IBYA 3KPSD 4KHXL 1GMIA 1G9NH 3ARDB 1BQKA 1RK1B 1LWRA 2C8NA 1NC4B 1HI6A 1WBYA 3NIGF 5HGDB 4HCRL 4PI0A 4I3GA 3PL6D 2AXHA 3APDA 3VXNA 1XZWA 3ULVC 5D7EA 3WTWA 1P6AB 4QO1B 1FYHB 4RGOL 3CVCA 3BEVB 4ZMOA 3QARA 4NGHH 2ZCKH 3CVHH 4QOKE 2PNDA 2Z64C 4N2LA 4UQ9A 2APFA 1UTDA 1KLFB 4NZ8A 4LSVH 3S48A 3HRPA 4NERA 1I8MB 4YHIA 4UINH 3WFHA 4QCIB 2XVBA 5E8EA 2AEPH 4XBPB 1OHQA 4AUUA 1D5RA 3FQRA 1A4BA 1A6AA 3HMXL 3CHRA 1E8WA 3MLWL 3VAEA 1KJ2B 1FH5H 3I3BA 5DMGC 2PKDA 2OSXA 3GHPA 4JN2A 2CZNA 3L4YA 4M1DH 4NLAA 4YSOA 3MV01 2NUPA 3X3GL 4BFFA 5I73B 4UQ2B 2Z65C 3N40F 4IGBC 4QTIH 1UA7A 3TNMA 1PG7H 1WBXB 1PPIA 5FHAL 1RJCA 2PPDA 1W2KT 1F0LA 3FOLA 5IREA 1JNHB 3ECWA 2XWZA 3LQAL 5CZXD 3FSOA 3FTSA 1PD6A 3THMH 2BLFA 1TQUA 2BNQA 3P54A 5E9NA 5BRZA 3D39B 5IV2B 5BRQA 2NXZC 4YHKH 5C07A 2FYYA 2CHWA 4Y4KA 2VNCA 1BOYA 2WUCL 1GL4B 3QJFB 2P4AB 3RJDA 4OIAA 5IFAH 1M42A 4U1NB 4OAWA 1MRDH 4UILL 2FBRA 2F8OA 4D7BA 1LP9E 4Y16D 3CN1A 1R24B 1JERA 1IGYA 2ZIDA 3FSWA 3MNVA 3V9EA 4KVNH 1LMKA 4BGLA 4XGZB 3FT2B 2HLFC 3W0WD 4KTEH 1COBA 1NFDA 1P4LB 5C0GA 3OLEA 4GRWB 4G6AD 3EDDA 4FQLH 3HZKA 1WIPA 3FTYA 4QRPA 1JN6B 5M95B 4OGYL 3RNKB 2C7UA 5DJYA 4M6ML 5LN8A 4CAGA 1LDPH 4GRWF 3TESA 3DC0A 4EEEA 1DFBL 4RCAA 1I1RA 3V0HA 1R19A 4ZSOB 1I3GH 4PWKA 1EDHA 2K78A 3TV3L 3OB8A 1C12B 1AACA 3RZCC 4XPBH 2HSIA 2VDQH 2Y7QA 4JFDE 4XNXL 3UZEA 2VM9A 3L5JA 1HZHH 2VSCA 4FQXA 1CF8L 2J73A 3QBTB 2O5NA 5ILTL 2WSDA 4AMWA 2VUOA 5F8RC 3SB3A 1KXHA 1P7KB 4S1SH 3SDXB 1WISA 3RPKA 1WIUA 4AG4L 1G5AA 4Y2DD 3SQBA 3VJ6B 2WPGA 4YFDB 3A23A 3SDXF 3NCJL 3RWJB 4APXB 1E4KA 5GS0D 3IU3A 2E75C 1RZKH 4KX9A 3RL1B 4PV1C 3NP3A 2OS7A 5J6SA 1O9VA 3FU5A 4FMFA 4PJ5A 5D1QA 4D3CL 4MD0A 3WE1A 2B1HL 4G6KH 4A2HA 2WXHA 3QORC 5EIIA 2ICWJ 5DRZB 2OXHB 1R46A 1JIBA 5HI5D 2BNRA 3BGAA 3TVMD 3OV6A 1V54B 1ZT4A 2JF1A 1F13A 4HKXA 3MRLB 3RFZB 1GH7A 3SO5A 1RSYA 4M5TA 4OCSH 4ODHL 1NCBH 1YEDB 3FFCE 5CUSH 3UTTB 2AJYL 2X4PA 4LSTL 2HXAA 5IOPA 5L4IA 3CVBA 5E5LA 3BW9B 3NFSL 3PP4L 5K69A 3BUYB 3FH7A 4NRXA 3RVWC 4JO8A 2MNUA 3L5HA 1FHNA 2VDMB 3I2CL 3L2LA 3EDKA 4LRIC 4DUWA 3QUZC 5DZAA 3HBGA 4R5VA 4E68A 4GNKB 3RE0A 4Q56A 5D2NC 4K7FA 4YSRA 3IDIB 3D34A 4NAJA 2H26A 2Q7NA 5ALBH 3NSXA 8FABB 2CLZB 4M1GL 3AAZA 2FO4A 3FU0A 5E4EC 2EIZB 1F3JB 2J8UE 4XCCL 1KJ3H 3S4SA 1TJGL 3T0EB 1LE5B 1C8PA 2N1KA 2PXYA 5I66A 1KPUA 5KW9L 4G6JH 3BZFA 2R0LL 4ZUWA 3GQFA 4NHUB 2CIIB 4FFZL 4NWTL 3D9AL 3FTGB 4QHKJ 4AYFA 2HUEA 3RTQA 1U42A 4NQDD 2YQGA 1NOAA 5F7MC 3MJ9A 1PG7X 2X4QB 4POUB 5EN2A 2V5MA 4QAMB 4I8DA 1BXXA 3OMAB 2BSSA 4QT5A 5DC0A 5ESAA 4BZ1H 2O61B 1RURH 1RZ8A 3NEOA 2FX8L 3MNWA 2XWEA 1BYOA 5AQ0A 3K0YA 1JZDC 4P23C 2NY4D 5BOPA 2VLKA 1IAKB 3MLXH 4XCFH 1HJBC 1KT2B 2EE3A 5LAPA 1JWUA 3TGXA 1GYUA 3TEYA 4Q0XL 4YSTA 4MJ4A 4F37K 1I9IH 3E2HB 4DVBB 4NNYB 4HIIB 1CGWA 5IEHB 1UJTA 2V2XA 2E4TA 3I74A 1FRGL 2OZ4H 2R56L 2FHFA 1EIBA 4KHTL 5JW4Q 2P5EE 3WELA 2P8LA 3CTTA 1TTBA 5CJXC 3I6GB 1BQHB 3GZOA 2VDPH 3Q13A 4OBSA 1WFNA 4LVEA 2HH0H 1MVUB 3OMIB 4MA3A 2NZ9D 4PRIB 5CSBA 3FDWA 3QULB 3WKMH 1QFPA 2ITDB 4G1MA 5I26A 2VXSL 1TPXC 1T21B 4LSDA 4ALAC 1FFOB 4KWUA 4JQVC 4CMHB 1BMWA 5KSUA 5B7EA 1KTLA 1A02N 4LSQH 1EHNA 3P4MB 3TXAA 3CSYA 3MRKA 2RFXB 3NPSC 5I2IB 1DJGA 1AKPA 4P2OB 4OCRH 1O7DC 1SN0A 3CXHK 1CXFA 4UT6L 1DSYA 4W9EC 4PJIE 2L04A 3PWVB 1TT6A 1UM5L 4E9YA 3NESA 1E3ZA 2WKLA 2WXLA 4U3SA 4GEIA 1TVHB 1CE6A 1HL9A 1X5MA 5JIDA 1V8HA 3NCMA 4NI6A 3MRCA 1VHPA 5CJOL 3BP6A 4HKZB 5CIPH 2IWGA 2WVVB 2F1AA 3OMZA 3X12B 3DX2A 2W65B 4ORGB 5LGJB 4G71B 1K8DA 1OD9A 5TQ2H 4LBEA 2WWOA 3VXUD 2W9EH 3EBGA 3CSBA 4JKPH 4XMLL 3QEQE 2PPAA 4BK4A 4AIOA 1C9SA 1LLAA 4LL4A 4G8IA 5T5NG 1A47A 5D93B 1G7HB 5IHUH 4RFEB 3TBVB 4KZ0A 2CALA 2JKTM 4ZFOA 3CFMA 4BHUA 3TCLB 4DP8X 2JJSC 1IM9D 2E8ZA 3AY2A 4HFUL 2N7SA 4IMKC 1I8IA 1M3JA 5FC9A 2OMTA 1VPOL 3H3KA 2VDOH 1M7IA 2IDQA 5EV7A 2NTSP 4EVNB 1DJHA 3LV3A 4X4XA 2M83A 5JPMC 4DW2H 2XBTA 1JZJA 3KLAB 5DHYB 2Y06H 4LCCB 5IBTL 5IQLA 4ZUSA 2A9CA 3LZFH 2E59A 3WIHL 3ESMA 1BD2D 1OLZA 3RRQA 1KIQA 4W9DC 1L3WA 2YA2A 4AV0A 1MCRA 3AROA 2PCXA 4O2FB 4G5ZH 2K0RA 4WDIB 4YNYA 1L0XA 5HGGS 3RWHA 2UWEE 1ZT1B 2F54A 2DMGA 2WYZA 3B3IB 3FSZA 1ZLWH 3DYOA 1DQLL 2WBKA 3QPXL 1YDPB 3R06A 5EWIH 3SPCA 2ORBH 5HGBB 4IBWA 3V7AE 4YXHH 2Z31D 3WFDH 2AS5M 1NGQL 2XZCH 1T22A 1FYTD 2RQ8A 4FQHB 3NIGE 4X8JA 1KBBA 4BCYA 1GY2A 1AD0B 1G7LA 1MPAL 3BCDA 4UT7L 2YJLA 1NUFA 1LD9B 1MFDL 4G43A 4QIRA 3V5DB 1K4CB 3BLKA 4FLQA 2K9FB 3SO3C 5IESH 2VXQA 4F8OA 4Y9FA 1CBJA 3SBWC 1SEQL 1HH6B 2NXYC 3PG2A 3V4VA 1CTOA 3MOBH 3P69A 4KI1A 1J11A 3UTQB 2G60L 4JKMA 4QI3A 3VXRB 4Y9CA 4XMPH 2VDKB 2XZQH 3VWKA 4YBQD 3FRUB 5B8CB 1EZUA 2J6WA 1RUQL 4L4TB 3KDPB 2EE2A 4MD4A 5DUPH 4X9HA 3ZDZE 2Y3AA 3VWJD 4N0CC 3QXUA 3QUGA 2J2ZA 4EI5B 5F0PB 1MFAH 3EUUA 2FO1A 4QXUH 3V5HA 4BSWA 1GW6A 3FQNB 1UQSA 3TJHD 4W9IC 6CGTA 5I1JL 4IEFA 4YHNA 3FB5B 1P4BL 1YUHA 1A1OA 4M8QB 4LPTA 2MEJB 2C3XA 4KC3B 4HEPG 3VFMB 4X5XA 3U0PA 3P4OA 3PABA 4M4RA 3WEBA 1H15B 1TYEB 3F62A 1PSKL 4CU8A 4G1EB 4ES9A 3K71B 2DRUA 1SXSA 4PTUA 3KPNB 4H4NA 4CVZA 2VZTA 3H6JA 1GS6X 2G3ZA 4MNQD 5K1JA 1G9HA 3GMPB 4QLWA 1K8IB 2HJKA 3UABA 4U0RB 1P53A 3V6FA 4LKXA 3MO1B 4TVSa 4P3CH 3UMTA 1S9XB 1AXIB 3EO9H 3DTXB 4CDHA 4M3HA 3K6SA 5HYJA 1GZPB 1W72L 2IALA 5ECGA 4ZMVA 4HEME 4O4YH 4AV5A 2F58L 4JEGB 5GZOA 5F21B 2H0EA 1A9BB 4FQCH 1OLLA 4UBDC 3WS3B 3CHPA 2F18A 4O2EB 1HHIB 1KJVA 2LAAA 3WSQL 4D9LH 1I9JH 2AC0A 5D5MA 2Z35B 3PU7A 4MLSA 1V7MH 3MLRL 3KGTA 4HP5A 4ZYKB 3N0PB 1R4XA 1AMYA 4ALAH 1QFHA 4HC1A 5FM5M 4WU7B 4HVBA 5IQ9A 4LLYA 4LOVA 4QKXB 2L3BA 1NBYA 1QPKA 5ERWB 3FO0H 3EYVA 1HS6A 5HXMA 1BFTA 3ZO0A 4LBAA 2RIKA 4NKMA 1B0RA 5FA3B 4ZI8A 2WTRA 2VSMB 4ODVL 4WWKC 3FT4B 4MJIA 2F53B 3LKNA 5GGSB 3EJQA 5C0EA 1IBYA 1KLUA 1LEKB 3CQPA 2A9NH 2W07A 3MUJA 3GSQB 4NN5C 4EDWH 2K8QA 3VI4B 3AU0A 3BKYL 1QYGL 3RDTC 1VDGA 1HL5A 4YBLC 4EI6A 1LGVA 2K3HA 2Z91A 1YPZE 2WO2B 1C5DA 2QFRA 5F9OH 3VI4F 3X2QB 4DQOL 1NANI 3KR3L 5I15L 2Y24A 2YD7A 4WTZA 5BV7C 3OM3B 1ZLVK 4L8SC 2DQDL 5FUOL 4HULB 1U8CA 2Z7ZA 1ETZB 1EHKB 5EDXA 4OBRA 1KIPA 5HJBA 2JSFA 4FHBD 1KCVL 3X14A 2ESVB 3DBXA 4JFZH 4Y5VB 3SCMB 2QV2A 4OIBA 4TXVB 4X6CA 1MI5A 1SY6A 3FB8A 4X7CC 1PX8A 2PTTA 5SWQA 2M8XA 1URZA 2HLEB 2VLLA 3EYSL 3AWEA 4EDXA 4YDVB 2E27L 4FL4C 1AMXA 1JNLL 35C8L 4Z3JA 1UM4H 2LU3A 2BPBA 4QRSB 3AT9A 3A4DA 1GZQA 5ADPH 3OZ9H 3VW3H 1YEWA 2KLRA 1JK9A 2RGSA 2GAZA 1NAMA 1QSED 1BLNA 3WG7B 3ZBMA 2OMZB 1HSAB 1QLEL 4L3AA 4NO5A 2DEXX 5FX3A 2QVTA 2YPLB 3QZLA 1PD0A 1UCBL 1ZS8B 2AQNA 2Y5TB 4Z95L 1KB9K 5A2CA 2BW5A 3F2LA 4PRDA 2CCLA 2ZSWA 2X6UA 2SEBB 1OWWA 5BPPA 5K9KA 4FG4A 4LEOB 2YEQA 3GC3A 3NK3A 2QSCH 2X3BA 3A6BL 2R69H 3M1CA 1BJMA 1J0ZA 4G9FB 4HIJB 2KPWA 5CGYD 3MRIB 3APCA 3RY6A 1JPEA 1MFCH 3LVTA 1TFHA 2R9HC 3BPOC 1I53A 1PYWB 4U1JA 4IRSB 5GGVL 3TBSA 1HXYA 5AALA 2O6FA 2CUHA 4GUOA 1SVZA 2VL5A 4PJ8D 3CFDB 3RJQB 1F58H 2CRIA 3QXWA 1TZOA 2VLJA 3AY4C 4N25A 3SGEI 2FHBA 3JWNH 5GHWH 1NIDA 5FUZL 2CKBA 3HG5A 3ILDA 1OCOB 3QDGB 4ISVA 4U6XB 4PS8A 4FTVE 2R2BA 3BZ4A 3TP4A 2B1OA 4PRHB 1R3LA 3OKOB 1OY3B 2PR4L 2W81C 5K9JL 3IE9A 4R4FH 3LH8A 4JFFA 3VI3B 3KZ8A 2OI9B 1BGXL 4LZKA 4LLUB 3PXLA 2WVSA 2BSED 3KLKA 4D0BB 4PJBA 3VI3F 5IB5B 1M1XA 4P2RD 4ZXBD 4Z0BH 1AZUA 4ZQKB 2A99A 2EUXA 1RP8A 3HG4A 4QJ4B 4WFFD 5AKRA 4Q9RL 1RU9H 4HBCH 3QZOA 1AJ7L 2ZF8A 4AMKL 3DVNB 3AM8A 4Y4KC 4ZOEA 3O6ML 3EOAB 1AKJB 1OSPL 3QS2A 3VXME 3WNKA 1PL3A 1UXWA 4TPRH 3CXDH 4YXLH 3EGXA 3MRBB 1MHPH 2BOCA 4TLSA 3MGOA 4GFXA 3P4NA 4ZO8A 2XV3A 4WW2B 5I1HH 4BFNA 1XB6A 1HHJA 3ARBD 4JKKA 4RBPK 3T8XB 3ROOB 4NNPH 5DZJA 5C09A 1VADA 3NJVA 4WW2F 1CICD 1S7UA 4RESB 5E2TH 5GGTH 4XHQA 1OP5H 1V3MA 2JE8A 4GG6B 4FQ2H 4IJ3C 3KS0J 3LS5L 5TE7L 1O6SA 2PWHA 2QKIA 4P5KB 4GG6F 5JO5B 4PLKD 1PDKA 4LCYA 1QRNA 3OKKA 5E1GA 1GJUA 3DO4A 4OJAA 4L0YA 1CDBA 5EIQA 1U30A 3CNKA 5I1LA 3NSFA 4LCIL 3L3KB 1UZ6E 3MCLH 1EJOH 1FVEA 3QQXA 1IKFH 1U95A 5CAYB 3UZEC 3T4YB 5CP3A 5C0IB 2BINA 3N41B 4FQXC 2KLSA 5BW7C 3RUGA 4XZUA 1BIHA 2NSXA 4L9LA 3MVSA 4GW4B 4Q97A 3N41F 1P2CB 3MR9B 5DHDA 5G5DA 1JRHI 3RX5A 5EO9B 4P3WA 3EJSA 4XX1G 1E3FA 3RPBA 3QAQA 3Q1EA 5ESVB 2FIKA 3STZB 4NWUL 1FDLH 2ADFH 3U4EB 1E4KC 2HKFH 1HOCA 1QLFA 2Q7AA 3HZ3A 4W9ZA 5D1QC 1EX0A 1UFUA 4TSBH 4JRYD 2MNWA 2X05A 3AB0C 2CH8A 3QG6A 3BRDA 4LFHD 1NBQA 1GAFH 2ICEA 7FABH 4TNGA 1MWAB 2MOGA 1BVLB 2G2RA 3I6LD 3ORJA 2J1XA 2YD2A 4X8GA 1CFNA 4IDLA 5BV7H 1WF5A 3UL4A 5KSAA 1R3HA 1N0XL 2DF3A 3ABMB 1KEMH 4G6FD 2W60A 1NCWL 4N0RA 1FIGH 2QL1A 2GITB 1T3FB 4Y5XA 2DD8L 4ODXA 2OL3H 4JL1A 4DGIL 1WZKA 3JV6A 3FQXB 3L3IB 5DJDA 1K5NA 3QYCA 3C87A 1ETA1 4ODTH 4N90D 3HMXA 1F5WA 3DVGA 5JIHA 1JI2A 2EVIA 1K6QL 3W5NA 3I50H 4Y4KD 1MXGA 3MZGB 4Y19B 4GYBA 4GKLA 2PXYC 2YZ1A 1JV5B 3T1FA 2XN1A 2RJMA 3OPZH 2IG2H 4WNQA 4XPTL 1E8ZA 1SXNA 4OUUA 3HS0A 1KFAH 1T1ZA 3MLVL 4M03A 1Q9KA 3RTQC 4BFIB 5CBEB 1BG9A 1GSKA 3MRHA 3NCWA 1PGRB 1KEGH 1D5MB 1TIUA 3HC3L 3ZZSA 5AOIA 1EH9A 5EN3A 4YSSA 5F6IB 5F1NA 2ZKWA 2YKLH 4OM1L 2E47A 5KSBA 4QRPD 1ZSDB 1A6PA 3MJ8B 5G4NA 3QCVL 1YY8B 3VXQB 1RIHL 3HMWH 5AFAA 4EMZA 1ROCA 4MVBC 4FNPA 2F2HA 4MB4A 4XXDA 3J07A 4Z7VB 5C0FA 1ANUA 5BZDB 4GIPD 3NIDB 1QI5A 3JWNG 3VG0H 5J7CC 3EFFA 8PAZA 3T3PE 1K4DB 4Z7VF 4QJ5B 5LBGA 3UROR 1ZHKB 3NIDF 2H3XC 2A3TA 2ICWB 2Y0SA 3PIQB 2OK0L 4XO8A 4M5YL 1CD9B 4ONHB 5AENA 1DQDH 4JJ5A 4IKIA 4PJ5D 3CPLB 3VX1A 1AQKH 5TDPB 3UTSA 3CSPA 3B34A 3VU1A 3QG7L 4TUJA 3VA6A 4PGCB 2WINA 1JHTA 3F7RA 4AQ1C 3FCSB 3TPUB 4OJFL 2BNRD 3KCWA 4OIIH 3FTXA 4HUMB 3VGEA 1WZ1H 2ZWZA 2D0HA 2X4UB 1BF5A 1MCDA 2BSTB 3VGHA 1I7UA 1K2DB 4LDLB 5GRJH 1IQDA 1M7DA 2WJ7A 2YFNA 2VGLM 1N5YH 3ZKXC 4X98A 5CEZD 3OXRB 3LQZA 2DQCL 5A7BA 1D5BA 2F15A 5E24E 2R59A 4FG0A 3D2TA 1E9PB 4E9TA 1DBAH 1YC7A 4XWGL 5HHOD 1JNJA 3D4YA 3B9KB 4PMFA 1NUGA 1AR1B 1VJSA 5KVEH 1J1XL 4XNUH 4QGTA 4HJSA 2PCFA 1RFDH 3G04A 2VDLL 1HHHB 4HU8A 2JJUA 1U8LA 4FQJL 1I1FA 2A9DA 2DLFH 2I27N 1MCFA 4HWBL 4NN7B 5E6SB 1D6EB 2XOTA 4NNXA 5C71A 2BCKA 2PXYD 1XV8A 2G5BB 5KYXB 1RLWA 4LARH 4QYOB 3ZGHA 5JORB 2MPAH 4IOFD 1KENH 1BAFH 2PYEB 4QOKA 3FT3B 2WBJA 4N26A 3STBA 1TVBA 4MJ6A 1ETJA 1THAA 5DVMA 1X4XA 3ASOB 2EYSA 3KPLB 2AABH 5KS9E 2CQVA 4FP8L 3HNSL 1U8OB 2F53E 3UJTL 1QWHA 3IRCA 4OLVH 4RGMC 1WD9A 4R5XA 5EBWA 2ZUTA 4C83B 2O93L 5DJ0B 2F5BL 1DE4A 3KPMA 4EIGB 3VI4E 2VLKD 5I8OH 3QIWD 2ATAA 1P7QB 1ZDSA 4WY7L 3Q1SH 3HIZA 4BFGA 4P48A 2XICA 1KTCA 1CLZL 2K7PA 1M6OA 4KFMA 3QIBB 3HFFA 3WS6A 2X5PA 3C60A 5F7HA 5ID0B 2WXFA 4FFZA 3NIFE 1OF0A 4R0LA 2VC2B 5JA9A 2X70A 3VRJA 4M6OH 2WQRA 2ESVE 4IIQA 4BELD 4K2UL 2JFCA 4UB0L 1I1AC 1H3VA 4FKEA 4XT1C 1EEYA 1D7FA 1EAPB 3FK3A 1BG1A 2UV3A 3O4OC 3F58L 5IK3A 3C75A 4PM1A 5I16A 3P11H 2MQGA 3IYLW 3WIFA 4HUVA 2NW3B 3QUXB 4WSKA 1QEWA 5CINH 3EJCA 4WUUB 5DR5H 4WNSA 3SDAD 1G87A 1OAQH 3L4TA 4KUZL 4RMWA 1A3RH 3JWDH 1OM3H 2VABA 1DBKL 4DUXA 1JPSL 5B38B 1LP9A 3W9EA 5B8CC 2PABA 2ZWNA 4ACPA 4G8EB 1OK0A 3EGDA 2V3FA 3NPZB 1ZANH 1ZA3A 4PVBA 2FO8A 4XCEA 2VDRH 3HOGA 4QRUA 5FO8A 1SM3L 3TZVB 3VWKC 5KVGE 5EC1A 1SLVA 3L95A 1TTCA 4ZFGL 1V7NH 3U0TA 4CDGC 1XBDA 3T2QA 3FUJA 5TK2A 1ZOXA 3ARFA 4V1DD 5ACZB 3UC0L 3LIZA 4DPCX 5B4MD 2WVTA 1CN4A 5B1AB 2FWLB 3GHEH 3MJ9H 2OMBA 2R15A 4M43L 4XTRC 4LGSB 2CUMA 3VSTA 4HT1H 1WIOA 3LB6C 3SGDI 3W9DB 3QDGE 5DRWB 4PGEA 2VLMD 3G5XA 3HE7B 3OSVA 4F3FB 1XGPB 4KTYA 5EBMB 3TC9A 5JW3L 4KQ0A 5HVWA 1U8PB 2AK4B 3QXDB 5E08L 2FL5B 3GI8L 4PRHE 1FVCA 2EO9A 3BXNA 4UT6A 4RMUA 3T6ZA 4G8GD 1JDDA 2MQ0A 3F7VA 3QIUC 3CX5J 4OZFB 2C3VB 4HWZB 4PJFB 4UTAL 3ZE1B 4NKIL 5LJYH 3DV4B 2FQGA 2W92A 5E1AA 4PJFF 1WWBX 5F9WB 3ZE1F 5EUKB 4P46A 1OO2A 3L2MA 2J4WH 1FH2A 4E2OA 5ADOH 5KUMA 3F6LA 3FH5A 4EIZC 3MJ7B 3JUYA 1OPGL 3L2NA 3V4PL 1IARB 5FV2A 1VZGA 2DJSA 2NY2C 3FFCA 4L4JA 3QA3B 5GZOC 1J0HA 3RDJA 5ICZA 5JQIB 4N2KA 2E9IA 2GIMA 4XB8A 5LXVA 5HHNA 3FQTA 4FXGB 4QRAA 2QPSA 4XPFH 1RVFL 1IBFA 5CEXB 1R5IB 4HFWA 1TTGA 3UP6A 3VFGH 1LWJA 4BQBA 5AW1B 1AZRA 1UADC 4L4VB 1YEFH 4AIEA 3DTDA 5GSVB 5AD0B 4TLTA 1GYCA 3VU2A 4NRYB 2DBJA 3ERXA 2HRLA 2YUZA 5D1XA 3WMQA 5E0FA 5F1SA 1R17A 5HDWA 2GTZA 4XO4A 2KKQA 1Y07A 1ZHNB 3MLSL 2J8UA 1OPOA 4WGWB 1M57B 1SOQA 3GBDA 3O3AA 3IJEB 3O45B 4ZZKA 3EOYG 2VISA 4L3EB 4JGNA 1FVDA 2XN9D 3CFUA 4JO1H 2VSKB 4MMXB 1T20B 4LCUB 4PR5B 1PKQA 5CMAB 5AVWB 1E9QB 1CK0L 4ZS7H 2C1OB 1QVOA 1LEGA 2F7PA 3KPPA 5B7MA 1WEJH 3D4ZA 5GSRA 2DTSA 4S2SA 2P5WD 2IOOA 4N8VG 2ZCZA 4I89A 5JA8B 4Y5VC 3C8DA 5EBLA 4N20A 3SPJA 5LGYA 4L0ZA 3GIZL 4NDMA 4W9FC 4I4WB 4QY8B 4I77L 2ILLA 4MJJA 2C3GA 1PZDA 3FUEA 3DLQR 3HFML 3JV4A 1E27A 2B16A 5KN5B 3KYNA 5B39A 2IQ9H 4KDWA 4YVUA 3VO0A 2APWA 2IIJA 3PLYA 1WHOA 4CW1A 5KUKA 4U1LA 2YRLA 5F7BA 1NL0H 2FT8A 1QATA 4MRBA 1KCUH 2GIYA 2OXGA 3PAVA 1IE5A 4O51A 4M6NH 2CPUA 2P5EA 2VZUA 3FL7A 4UMSA 3UH8A 1PAZA 2P8MB 1B0GB 2WWMC 1VKXB 4HG4K 1RPQA 4KH9A 4PWEA 2I9TA 3CCHA 3RGVA 1OB1B 4GT7A 4X6BB 2AF2A 3U46B 1T4KA 5JW4N 4X9YA 2CO2A 2YPKB 4HZLB 4JQIL 4KAQH 4NBZB 4XMVA 1V5JA 3MRDA 3CC5A 3DRTA 5T1KD 4HUCA 1EEZB 5MEPA 5EUOE 3BWAA 3GZQA 4NO0D 1I9RL 2FEDD 3OHXA 5HYJD 3L9RB 3UEQA 3LKRA 3RY6C 3KL5A 3OLGA 4LVNC 4Q6IB 5ENWA 4APQD 4OCWL 2NY6D 2R1YB 3D87B 2NT1A 1RZJL 4TQHA 3V7MA 3L3JA 4ZFZB 2PYFB 2DEYX 2GJ6D 4ANWA 1RP9A 1XB3A 1E90A 3FUKA 4XP1H 1R9FA 4BKTC 1U3HB 3NH7H 4TNVF 2A6KB 1MLBA 2Q76A 5ID1B 3FU3A 4GRLD 3C5JA 4O02L 3WUWB 1ZIBA 5INDB 4YR6A 2VXQH 2IADB 5DO2C 4F9LC 3U82B 2OI9C 3V4VH 3CGTA 5KSVB 3UO1H 4X5QA 4CILA 2CDEB 1W72A 1AGFA 2DH2A 2QSQA 3QEQA 1OZUA 4YWGL 2B2XH 3SPVA 2JJTA 2W8CA 2EVJA 4MJID 1CQYA 1PY0A 1MAJA 3W39B 1S7SB 1CXLA 4URKA 4LSRL 4LSUH 4PGJA 4M5SA 3T2NL 4Z7AA 4X8CA 1IGJA 3GSVB 4S0HA 2YD5A 5EU5A 4WI0B 5HVHB 4ILDA 1U91A 2DM2A 1SJHB 2EDFA 3IAPA 3Q9PA 4WTWA 4XN7A 4M3KB 4NQSA 3RWIA 1KN4H 4FNLL 2WLIA 1DQTA 3MDJA 2UY7A 1H3PH 1AR2A 3AM8C 4J3TA 4WW2C 5AW5B 4NENB 1GGBH 2YD3A 4GUPB 4I0PB 4DN4L 1FORL 2C3WA 1EHLH 4UUJA 4OFDA 3JVGA 1Z3RA 2XWTB 1F45A 1MI5D 3PQYD 5TPWL 4J3XA 1E5ZA 1UA6L 5J57B 3MOAL 4GBXA 5SWSB 3U7AA 4B9PA 2WZPD 4LIQH 2DLTA 3VXOB 2FLRT 5I71B 3UYRH 5F6HJ 1J12A 2UWEA 3NACH 4L8BB 2LU5A 1E4WL 4D0DA 5I1KH 1RK0A 2QKIC 4N85A 5KVFL 1Y18B 3UFIA 1QWUA 3GSNB 4U6YB 3T65B 2JK5A 4JHAL 1RJYB 5FK9B 5ELIA 4Z7OB 4QRRD 1YEIL 3T3MB 5DF0A 1BVKB 3V6OE 5E5MA 3N2JA 2G0KA 3HKZA 3CK0L 1AHMA 4P4KA 1BQUA 4LNRB 4X5PA 4Z7OF 4HDIB 3T3MF 5CU9A 4ZFQA 3VVWA 1VRSA 3SY0B 3GKZA 3SQOH 3NBNA 4HC1H 1OAKL 4L9LC 3HB3C 3TU6A 1IO4C 3GB7B 3SE3A 3WFBL 1SOKA 3JVFC 3MLZH 5BZZA 4AL8L 4KRPC 3PJSB 1EFXA 2D2CC 5FYJE 5CBAB 4YL9A 2X0WA 3A67L 2QVFB 1KF9B 4X99B 5AL8A 1C5BL 1S9WB 1E5UI 4J6IA 4N0YH 2QQLH 3S9DB 3QDJD 2BP8A 2APXA 3MV7D 2BOBA 3NJNA 2EDDA 4WI8A 3DGDA 4MA8L 2F8VA 2ICEC 3E0GA 4KI5E 3VD4A 1AS7A 1M3IA 4UOZA 3L08A 1EANA 4ZNEE 1I8MA 1QLEB 2VRKA 1NLBH 4UM8A 3QWOA 4LAQL 2CUIA 4ONGL 4JHWL 3D33A 2GSIA 2QVMA 4LPYA 4XVUD 3ATAA 4XHJC 2Z8RA 4P04A 2J1ZA 3G08B 4TNVK 4XBGA 2LLGA 5KSAC 3K2UH 1YMHB 3SDYH 3EF4A 1A14H 3ZK0A 3QFGA 4J3UA 4S10A 4P2QB 1QLRB 1T1XA 4KMTH 3V10A 1JFQH 1MF2H 4X9IA 4Y5XC 1NGZB 3O0RH 1L9OA 2DWYA 2FB4H 1BWWA 3P1VA 2XQ0A 1BZ7A 5F0LB 2YLKA 4WKZB 4UQ2A 3ULUF 4MCYA 4XP5H 4GSQA 4YHML 1A0QH 4LLQB 2YAEA 5AYTA 4ADJA 1SY6H 4L1LA 4NM8L 4POZC 4OU3A 4V2BA 2G4GA 3U83A 3U25A 4Q9CA 2EEBA 3MV11 1RIUL 2W1NA 5CSZA 2FBJH 3DX4A 4Z7UB 4NHCL 5DMIH 2VH5H 5GQBA 3DETD 1EO8L 4XNZC 4G6MH 5IQMA 2F74B 1Z32X 2HRGA 4HKBA 4R3SA 3RVVD 3WNJA 1NAMH 4QMEA 4Z7UF 5CZVH 5E2JA 1ACYH 3KPRE 3U1SL 4HEMA 3BH9B 4NC0B 5BQ7A 1DYZA 5K39B 5IV2A 5JXAL 2OTPA 5D71H 3V52L 3IDNA 4LESA 1HNGA 3LPOA 2AEWA 5E94A 3Q8CA 3PNWA 5C09D 4WUUE 1F4HA 2H2PD 1HL8A 1SDDA 5F88B 3QHZH 3NJFA 4H25B 3FTZA 3LQAC 2NQ3A 5F7FA 5GJTH 3T2PA 5DJ8B 3T8VA 3CZKA 1FA4A 1R0AL 5L0QB 1BM7A 4ODSL 4RISH 4UQ3B 3VGGA 1HINL 5I8CA 4Y2OB 1R3JA 1QRND 3SSGA 1OAJA 2BIPA 3D0LB 2X1PA 4UQCA 3TASA 1FBIH 3PWLB 5FXCH 1F3DJ 3Q05A 3L1EA 5T3ZD 5L2JB 4DIXA 3FO9B 1D5ZB 5F97E 5GIRB 1ONQB 5GPRA 4GQPH 2OZNA 4PW4A 1JN6A 2P52A 4IRJA 2IAND 2CKBH 4DQAA 4KUCF 1N2RB 3F6JA 1FUNA 2O5ZH 4O5LH 5F93C 1V3KA 4UU9B 1QA9B 4KRPD 3BPLB 4KKBC 5ITBL 5AG9A 1AY1H 5DZ9A 1MCCA 2J1WA 5DSCB 1YPZA 4TOYL 2NCEA 2H32B 3CN0A 2OCCB 1OCWL 2B7DT 2AK4E 3L4CA 3Q06A 2R2HA 4LEBA 3VJ6A 2GC4C 1HHKB 2F68X 4DOHB 1ZSHA 1A4CA 4QXGL 3OLDA 1CXEA 1NDGB 3O2DL 2YRPA 1M71B 1NCAL 5BZWB 1MFEL 5FGSA 3WL9B 1RZ7L 3FU8A 4JFED 4YHOH 5DRZA 1E9OB 3CLFL 1I3VA 3WIAA 1AGDA 2GEQA 3HAEA 5K1VA 5E99L 4XVSH 2WOYA 4NQVA 2UYLA 3V0EA 4CN4A 1TETL 3MRLA 4R90H 4WEBL 4JLRB 4CADB 2IBBA 2OX5A 2BJMH 4C56D 2JNZA 3QI9B 4DP1X 4F7MB 2FSEB 4R97B 4AE0A 2YUXA 3A5VA 3ARSA 3QFDB 2VN5A 3BUYA 4YAQA 5IUCA 2QKSA 3KVDD 3VFSB 2WIMA 3L7FA 1FSKB 2CM6A 3F7LA 3MRGA 2AXGB 3ROLB 1NC2B 5H37A 2VZSA 4XOAA 2IPUK 4F7EB 4B0MM 1F6AB 2CGRH 5DJZB 1MFBH 2R0KL 4KJQD 5DYOB 1YNLL 3SDCD 2AQ1A 1YMME 3P3TA 4HCFA 3A3YB 1D9KB 5ICYA 2WBJC 3LKQA 3NTCH 3DMMA 2G9KA 1SN5A 2HFGL 3GKWH 2XZZA 5T3ZH 3TO2A 1HQ4B 4ABWA 4TUOB 4X7EC 5D7KD 2GBUA 1KBVA 3ALWA 5CP3H 3BOVA 4A2GA 3LPGA 4YDNA 1CS6A 1Q4NX 2B8OT 2A2QT 4JFHD 2RACA 3BWUF 1AAJA 2JMRA 3BKJH 3ZJAA 1S6NA 2CIIA 2NY0D 5GGUB 5IVXB 3FTGA 4PJ7B 1HNFA 4FTVA 3EO0B 3N44F 3VCLA 2E7DA 4AW4A 3LS4L 2V8MA 5IVXF 4PJ7F 1IGFH 5GS2H 3QWRD 3I85A 1KLGA 1F4YH 2AJZB 5C0BE 3EXJA 3L3DA 4KHXH 3NN8B 1T2QH 1LE9B 3WS6C 4FX5A 4HLJA 3C60C 2WQUA 2YAPA 4JPVL 4M00A 4R0LC 1VZIA 2H3KA 2VN7A 4IIQC 3IPBA 2QHRL 2YGVA 2GBVA 3QZWG 5I0XA 3OJDB 4KKBD 1HYRC 3LJ3A 3O6LL 1JI1A 2XPZA 4Y4HC 5F1OB 1DBJH 1I9EA 2YD1A 4RGOH 4TTGA 1IL1A 3IEAA 2CBMA 1XQ4A 5DRNB 3AMLA 4UQEA 5KYYA 4J3SA 1IEAB 3P0YL 3OAYH 3UTSD 4WTZG 2VDNL 3U6RA 2ZP0T 4H5SA 4W9LC 4WTXA 4WFEE 2E9WA 5CLWA 5JXEC 1DBMH 1CE1L 4HGMA 4AEHH 2FEEL 3VXMA 3J7HA 3I6GA 1G0DA 3D2UD 3UZVB 2Y07H 3IJHA 3MBED 1CFQA 2FSDA 3GPEA 4I0CC 5FA4A 2NY3C 1CU4L 1E7VA 3EG9B 1JF1B 4GP8B 4N9GA 5BJTA 5ICUA 1HWGB 3V4UL 1MVUA 2B77A 4KQ3L 2HG5A 3HMXH 3L48A 2SODB 5IHZA 3B3BA 3AXLA 1C16A 4B9YA 5FB8B 3FW6A 2VR5A 1FNGA 2XBDA 3GJEB 3X3GH 3PCYA 5T3XD 3GTVA 3JTSB 3TCTA 3WEOA 4AGPA 2P9RA 3OMNB 2QV4A 2VXVL 5FHAH 3BIAX 4BYHA 5KTEL 3CLEH 4JHUA 1JYVA 3U9UB 3WAJA 1OSEA 3HE7C 1ZIAA 2XCMC 4FADA 2NYYD 1R6VA 1O0VA 1Z9OA 4NQEE 4AVHA 1T66D 3TPKA 1AS6A 2ZOLB 1T83A 4FA8A 3UPRB 4JJOA 2IQAB 2WUBH 3JWOH 4QUOA 3C9NA 4JPQA 5SX4H 3DKHA 4HKZA 4L37A 2IOIA 4QOKD 3NFNB 4HAGA 3VXPB 5LGJA 4I1RA 2WUCH 1I4FA 1IILE 1IFRA 4LCWB 1N10A 1AS8A 1FWXA 4BZ2H 2GT9A 1II4E 2R29H 4UILH 2DL2A 4AYSA 2EKSA 5F7DB 4RFEA 4L1TA 4P46C 4I2XB 2LT9A 4BSVB 1JMZA 3EYOA 3IMVA 1IUZA 1IZJA 3WKNA 4ZJ9A 1KACB 1BM3L 5DEFA 4HLEA 2YA1A 3BUQA 3L3OB 4QRTA 3QCUL 3G5VA 1XD1A 2FT7A 3MLYL 3C8KB 4KRMB 1LO5B 4OGYH 1P1ZA 4FAAB 5IBLD 4M6MH 2HTLD 1S78D 4JM2B 5E2UL 4OFIA 5HYSA 3BVVA 3TV3H 4XNBA 4XNXH 4O2CA 3GSUB 4JM2F 5HYQA 4GI8A 1CF8H 1KB5B 2FNBA 4EZMA 5ILTH 4PJEB 1PFOA 4MQXD 1ILUA 3ULSB 5G4MA 4JVUA 5E23A 3MFFA 3P77A 5JOPD 4ZUTA 5D1XC 4GMTL 5DDHA 2PPCA 4O2FA 4PJEF 1NEZA 1PLAA 1DVFB 2XU9A 5DJCB 4F8TA 4P06A 4GW1A 4S1RL 3U36B 2HVKB 5EOCL 3HNTH 3NCJH 4RFNB 4YGVA 1X5KA 4ZO9A 1BZ9A 3C2SA 4F93B 4MX7A 4H7VA 4D3CH 3O9WA 1QQDA 5T3XH 3FCTB 5KOVC 2FJUB 4Z7OE 2D31B 5J6GA 3ZW3A 2H8PA 3L7EB 5GGQL 4D8PB 4MYWB 2EUVA 2NPLX 5SV4A 2NDGA 3SYAA 3SKOB 1TEYA 2OSLA 2VXUL 5HSFA 3EXLA 5CFAA 1OCCB 2XV0A 4K8RL 2PWGA 3D0VB 4BIKA 1H5BB 1NOLA 2V5YA 3FQUB 2NY7L 1VESA 2AJYH 2ZYRA 2FWOA 4LSTH 4S1DC 2XPGB 4YDZA 2Q3XA 1L5GB 1RHHB 3PP4H 2WWNA 4GRMA 3ARFD 2CA3A 3BP7A 3AS0A 1T5WA 3B5GA 2YN5A 1S7XB 2FDBP 1Y6NR 1N70A 4RIRA 4YEEA 4NQCE 1NCNA 1TNMA 3KBHE 4JFDD 1F90L 3UBXB 1IE4A 2UUDH 4PWIA 4AW7A 4N5ED 3IDXH 5BO0D 4Z76A 4MDJA 3TT3L 5MERA 5F72S 2V2WB 4EI5A 4HJGA 5A6LA 1J1OL 2X6VA 2UXTA 3CVDA 4MQSB 2EYTA 4I5BA 4GFTB 1QTSA 1UT9A 1YYLL 3SODB 4H8QA 1OTUD 4URTB 5I1GH 4LCVA 5EOCJ 1TJGH 3OWEA 3C12A 3S5LB 5IB2A 5L9DL 4JCLA 3RGVC 3F5WA 2BC4A 1BEYL 3DOHA 4UIKL 4U1SA 3WN5C 2A1WL 4ZX4A 1TNNA 2R0LH 4P2QE 4NWTH 1KFGA 4FFZH 2YN3A 5F1IA 3ULUE 2AEIT 4XOCA 4A2DA 3IGLA 4HJJH 4JX0A 4DKTA 5E95B 4OI8A 1AHWB 4XH2A 4AITA 3JTTA 2EXTA 3OHXC 3S8WA 3B8YA 5FFGA 5EZOH 5A40E 2JJWA 5E6IA 4DH2A 4EUPA 5D1ZA 4I9WE 4Z7UE 4AIXA 1NGWB 2DYPD 1T89C 3H55A 3ZRCC 1DBBH 2BXZA 2XG5A 4EJ1C 3KVPA 4Q0XH 4JDZA 1IC7H 1H8NA 4JFOB 1L9MA 1AO7A 2CO6B 3GSRA 4DWHA 4PYGA 2IXQB 4XBEL 2JXMB 3HBZA 4F7KA 1QEXA 1G9NL 2XLLA 5MHSD 1PNCA 1RPUA 4KPHH 1T1YB 1Q90A 1EDYA 5EU7C 4ZYKA 3ZDWA 1PQZB 2BDNL 1MCNA 4NXKA 3SYQA 1CL7L 1S5IL 5IJBC 3PPSA 3S8FB 3CZLA 1UURA 4DVRL 5EEYA 3MXVH 2IJ0C 3GWJA 3MYJB 3TN0A 5DUBA 1RV6X 1TJHL 3KLHD 3NRPA 1I82A 1H8SA 4NGHL 3V4PB 3LIZH 2ZCKL 1HCZA 3QEUB 4YHYC 3GLEA 4XNYH 5SX5K 2VMJA 1SF3A 3LKPA 2K1MA 2ZNXA 4Z3FA 3QS3A 2VXSH 4MD5B 3U6XS 5KS9A 3QUYC 1CGTA 4KJWD 4LSVL 2F53A 5LLIC 1LO4H 2KZ1B 3V0IA 2AEPL 4S1DD 4KKLD 4Y4FD 3BZEA 1CFSB 3NSJA 1UJ3C 2IGFH 4DP7X 1I31A 4UT6H 3W11C 2ERJB 2RQEA 1UM5H 1DUYB 4P5MA 1FH5L 3W0WE 5C0CA 3FBKA 4Q8BA 4AGNA 2CLRB 2ZONA 4B9JA 4M1DL 1KGCD 2COVD 3BAEH 2YO3A 3SDDA 3V79C 4GBXC 3BIKA 5AG8A 2KERA 3DROB 4YHLL 3UBFA 2ESVA 4PY8J 5EFIB 3DO7B 3KYMB 2P5ED 3RIFF 4XMLH 3G5YA 5DFVD 2JCWA 5I9QB 1XR9A 3K5SA 1KDIA 1XGRB 5E8DL 1CDCA 3ECQA 4DETA 1DCEA 3RGVD 3MBXH 3QJTB 3QQDA 1UXSA 1Z5LA 3UAJD 2XY1A 3CX5K 1J9SA 2FH8A 5AKSA 3THML 5MENE 3QDHA 3H9ZA 3CG8A 5DEGB 2Q2LA 4IRZL 4P4KC 4F7CA 3NEEA 5HJDA 4P2YA 3BZ5A 5ACMA 1VPOH 1MCWW 4HD5A 4YGAB 3GINA 1Q94A 1ZS8A 2C3HA 3KYAA 3SE3C 5HY9B 5AW7B 5IFAL 1N6UA 1O5PA 3RX8A 1Y1UA 1MRDL 4RZCB 2CRZA 3HG1A 4PGDB 2HFTA 1JGEA 3O41B 3SY6A 5HHPA 4CVXB 5HD8D 1OP3H 3FFDA 4KKCC 4LEOA 4J6RH 4NZTL 2YBRA 3MCKA 4Z18A 1YECH 3P2DA 4Y89A 1CYXA 3H3BC 5IW1A 1PLGH 1X5JA 4JQIA 1BZ8A 4Z7NB 1U8QB 5B1KA 1D5IL 4EN3A 4IRSA 4JO2L 4OGAC 3BAYA 4Z7NF 5KZCB 4Z7WE 2YSTA 4UAOB 4YSCA 4NO2A 2ROXA 2QMJA 5GRUH 1DQLH 3VFPA 1F1AA 5IVXE 4PJ7E 4XPBL 2VDQL 4G8AC 3S3BB 1XF1A 1FLRH 4JAMB 1JTPA 1SJVA 4A7GA 2EE0A 3VYOA 2ZOTA 2AHIA 4X5LA 4J3WA 3GSOA 4Q7DA 43CAA 2YMTA 4PRHA 3OJVC 2QLVB 3F7YB 4Q58C 2F7OA 1KPVA 4HLZG 1IAMA 3V5KA 3D06A 2DI7A 5TDNB 2GK2A 4XE0A 2QZ5A 4YC2C 5FCUH 3EJJX 1I7ZA 2MQ3A 4MAYD 1FN4A 1R34A 1KJMB 5I82A 5IB5A 2BNUB 2KHAA 4G6KL 1XGTA 4RLDA 1ZPLA 4P59L 1KGWA 3VRIB 1GJIA 1W6LA 2JIXA 5GXBB 4NQDE 5DGRA 4WO4B 1RUQH 4E41B 1ITBB 3ALXA 1F97A 1MLCB 1NCBL 4JG0L 2D7PA 4J3OD 5CUSL 3WY2A 4OZIB 1YN7B 3U4AA 4PVMA 3ZOAA 4HGWB 4BK8A 4JGUA 3KPOA 3WI9A 4OZIF 4A2MA 4AUYA 5SWZE 3BP5B 2WANA 3PWJA 2FJGB 1XEUA 5TF0A 3VSQA 3SOTA 1LO0H 5J6HA 5J12C 3L9YA 2UXVA 1HAUA 3I9GL 3R7QA 2HJLB 4OZ4A 5FDWB 3WMPA 2CSPA 3LPWA 4JRWA 4BM7A 3BPLC 1J8RA 2V33A 3T4AA 4IRJC 3FU7A 4JFUA 3WLWC 1NC4D 4W1TA 4Y7MA 3L3GB 3FAXA 3HG0A 2WSKA 3LY6A 4U7KA 3I6KA 3OL2A 5D7IA 2ITCB 1N64H 4KDTA 4PJAB 2C9SA 4DEUA 1GW0A 1ZT7B 1M1SA 2YQ2A 1W72H 4WFGE 2MQCA 3NZUA 4L48A 3EJPA 3K4DA 2GY7B 4GW4A 4H1LA 4PJAF 1KGIA 4OW6A 2WXPA 2CJSA 4ZMZA 2J3SA 2XQYA 4DEPC 4XCYA 1NMCC 4BZ1L 2VO8A 1N68A 1BREA 4UCFA 3KGSA 1KWKA 5IMKB 4JRFA 3MLRH 1VERA 4ELKA 2W0PA 3MLXL 4PY7A 4XCFL 4A68A 1PW3A 1HE8A 1GSMA 1BXUA 4MMZA 1QP1A 5GS0L 3HEIB 4I2XE 1I9IL 4F2MA 3ZGIA 3QXAB 5DZOA 2OR7A 4IQHA 4JMNA 3KNBA 4R97C 2QZQA 1YLBB 3QUHA 4HH9B 2OMYB 2OZ4L 4FFVC 3R1GH 3OC8A 4RGNB 4H20L 3FONA 4AGMA 1JF5A 3PAUA 1IVTA 3IDJB 1EXHA 4AGQA 3BP4B 3V0DA 3NCBB 4A39A 3JQOB 4K9JA 3VXUE 3T77A 3BT0A 3ASWA 1MZZA 1VFAB 2LLNA 3TBWB 4J3OH 1ZA6B 3PWPA 1F4WH 1HHGA 3I9AA 3TWCH 5I1DB 2ZX5A 2HH0L 1QYGH 2CNYA 4AI7A 5EUOA 4I3RH 3GPSA 4DQOH 3B2UD 4W4OC 1NH6A 2HFEA 3D8MA 2WNWA 4ZT1A 3DHUA 5EB9A 2DQDH 4EZJA 5FUOH 1U41A 2IBGA 3DMMC 1CT8A 1G4RA 2E4FA 1T0MB 5DD1H 2BFGA 2HKAA 2X88A 5ITFB 1PJWA 2MIZA 2P7TA 1JV5A 7PCYA 2N1TE 1VFBA 4OCRL 1MY5A 1U8MB 1KTBA 4OLZL 1C08B 1ZE3C 1FNEB 1S5HA 3EYSH 4AC2A 3GLZA 5DRXB 1BD2E 1JNLH 4BFIA 1JVKA 1U2HA 1G7JB 1CXKA 1VENA 5J1AA 2K70A 5C2BL 3VFUB 1D5MA 2H1PH 1JGDA 3S3SA 4D7PA 3AREA 2WP3T 2NW2B 3K6IA 3MJ8A 1CD1B 1UCBH 1ZHBA 1RJLB 1H6UA 4JKPL 4GAYB 1WUNT 3HE6B 2OMXB 1M6UA 3F85A 4Z77A 4JUSA 5LNGA 1Q9OB 1IGMH 5ISZB 3NGBB 1AVAA 3BVXA 4LLVB 1ORQB 4Y1AE 1TMQA 2P49B 1MHEB 4LPCA 5AW6B 3A6BH 4LHUA 4FQ1H 3ZHLA 1J87A 2NLJB 2VDOL 4QWWD 1F1GA 3QJSB 4R7VA 2KYIA 4I0KA 4XX1E 1JXKA 3ME0A 4FG2A 4HJUA 2BCMA 5FGBA 4DW2L 4X7TB 2ZXEB 2ZUUA 3HCVA 3MRQA 2Q3ZA 1D5XB 5B39G 1TCMA 5FUZH 4EKJA 2BVOA 4Y9EA 4E9RA 3P4LA 4L5FE 2IAMB 3KS0H 2QGDA 4OF3A 3BSGA 2WCSA 4PCTA 1JZ3A 3U7WL 3ZZ1A 3BUPA 1R75A 2E6JA 2J55A 3MACL 4OD1L 1A2YA 4M8RA 4FN0A 4U1HB 2FQFA 2PR4H 3CSGA 4UNIA 5K9JH 1A7PH 2B3RA 3GIVA 5E9DB 3UTTD 1BFVL 3PV7A 4K23H 4WI9A 2MNJB 4JZJB 2BIOA 3RNQB 4X4YA 1JWMA 3GMOB 3CBRA 5EWIL 3V6OA 4OVVA 3SZKC 1TKWA 2ORBL 3WKYA 3O2DA 1AOZA 4P05A 3VMPA 1I8AA 3H0TA 4MXWL 4N0UB 1GHFH 3BDBA 1T83C 1R1CA 2XZCL 4Q9RH 5DVPA 4GW5B 3GSWB 4ADGA 2R2EA 4MNQE 1C7TA 4UI2A 4Y8DC 4AMKH 4JFPA 2ITEA 5IESL 4L8DA 2IH3B 1SYVA 1ZTXE 2Q7YB 2V5TA 1EA9C 4U6HA 3MOBL 2CO7A 1DN0B 3MGTA 4A55A 1FV1A 4XMPL 3JYBA 3WD5L 2HX8A 1CFMA 2H9GA 4MASA 2X4SB 32C2A 5DUPL 4FTVD 2IDTA 1AZCA 2APBA 1PX3A 3SIKA 3LS5H 4U1KB 4ELDA 4ZNEA 1BYPA 2HT2D 3FRPB 4JR9L 4C8XA 3DPBB 1S7RA 4ZAKA 4XRCB 4QXUL 4YDJA 4NRZB 3ESNA 2KDGA 4J8RA 1F6FB 2X40A 2WXOA 3EYQD 1AQDA 1DQKA 3OKLB 3QT2A 4H44C 4E9XA 4LCIH 1K72A 1GZHA 1UXLA 3IXTA 1P7QA 4NUPA 3F05A 4HWEL 3KYKL 5T1JA 1PZUB 5LG1A 1G94A 2QT6A 3JT0A 4DNLA 1JHKH 5IEKA 2K6WA 2EDXA 1NBVL 2R0WL 1RMFL 4M3JA 4ZK8A 3LYRA 4DAGH 4AQOA 5DVLA 2OCFD 1ND0B 1JV2A 1JVLA 1NUDA 2GSGB 2ZTBA 4UNVA 2C9AA 3MCG1 1WK0A 2ARJB 1I8KB 5AKVA 2DLIA 4PJDB 3BVNB 4PW9A 3G5WA 3MLUH 5TH2A 2E7LC 3KPRA 3O9WC 3WE6B 3EO9L 3BVDB 3A6CL 3MODH 1XGUB 1OE2A 3IMWA 3QQ9D 3ZE0B 4F1ZA 1O7SA 4PRID 3IU4H 4NUJB 4O4YL 3IVKB 4BQ8A 4ZFFB 1QHPA 4M7LL 4J3OG 2VIRA 4CVWA 1P69B 1INDL 1A9EA 1G9MH 3IMSA 4FQCL 5E7BA 5ETUA 1ZLSH 3ZE0F 1VGKB 1HZLA 5F3HA 5DWPA 1X9QA 1H9VA 2EIBA 2EZ0C 4Y9BA 1Q72H 1YY9D 2CWRA 4AENB 3SKNA 1TZIA 1V7ML 2B0SH 3B2VH 4XC3H 4N24A 3KWWA 1KIUB 2QR0B 3LSOB 2KZBA 3D25B 4P2OD 1ET8A 2OTUA 2YXMA 3MYZA 2X0UA 2DD8H 4GG8B 3OF6A 1SPDA 2E7CA 5ES4B 4DGIH 2GIXA 1XTMA 4RH4A 1OE1A 4FYQA 3L54A 1YNKH 4JNXA 3VFOB 1Y6MR 1HKFA 2N01B 1BVZA 1OGTB 1ZE3H 4WU5A 5JPNB 1TQWA 4L5FL 2EACA 3TIEB 3QQ3A 5LGKA 1OSZB 2D2OA 4K5MA 4MBRA 2OAAA 2Y2YA 4HU2A 1WFTA 2D0FA 1J5OH 2Q9OA 2A9NL 4HOWA 1H0DB 1GPOH 2P28B 3DV6B 3OKMB 1WZAA 3BO8B 3VGDA 3VUAA 1PZ5B 1BVNP 3KYOB 3PDOA 1A7BA 4DT2A 4F3FA 3PE9A 4XPTH 5CD3B 1R33A 3SKMB 1KYOK 4MRCA 2OLDA 5F9OL