1L9PA

Crystal structure of nitrite soaked i257g variant of the copper-containing nitrite reductase from alcaligenes faecalies s-6
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
336
structure length
336
Chain Sequence
b'ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLGGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Directing the mode of nitrite binding to a copper-containing nitrite reductase from Alcaligenes faecalis S-6: Characterization of an active site isoleucine
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 94
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9pA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9pA02
1ZPUA 2VSKB 2I7OA 3FSZA 2IH8A 4AX3A 3EH4B 5LDUA 2GC4C 2VW7A 3FQ2A 4X4KA 1PNCA 2BHFA 2Y69B 4M3HA 5I5IA 3FU9A 3NT0A 1SFDA 2VMJA 4RH4A 4NAJA 5I6PA 1QLEB 5B1KA 4Q8BA 3NJHA 2GB2A 4DPBX 1KDJA 2J57A 2LLNA 2XV3A 4YSEA 2QT6A 1N68A 2X87A 2CJ3A 2JFCA 1PY0A 4A2HA 3UGEA 2CUAA 1AOZA 4YSOA 3AG3B 1OV8A 1SF3A 2WO2B 2FNWA 4YVNA 5F7AA 1JZIA 4KOCA 2PPFA 2DY2A 4N4YB 1L9PA 1GW0A 2CCWA 1PMYA 2HXAA 2GC7C 2QDVA 2W8CA 3UAEA 2PPCA 1KCWA 3QQXA 2W88A 3QJTB 1GYCA 1E67A 2XYBA 4DPCX 1KBVA 4HCGA 1IC0A 2YAFA 3MBWB 4G71B 2BP8B 4DP6X 3QPKA 4P5SA 1HAWA 4YSUA 3QJUB 3UADA 2VW6A 2PPAA 3NSYA 6PCYA 1IUZA 1BAWA 2AANA 3FYIB 5I6KA 7PCYA 2AVFA 2GSMB 2HX8A 3H4HA 3FU7A 1JVOA 2BWDA 3NJNA 3EH3B 4YL4A 2CBPA 4HALA 3ZX1A 5TK2A 5I26A 3D12B 1OE2A 1W8EA 1V54B 4WKXA 1QNIA 3TASA 3PAZA 3S8GB 2QPDB 1W6LA 1FFTB 4MFHA 5I5JA 2P80D 1RCYA 3ASOB 1SFHA 3HEIB 4HCFA 5B1BB 1AZUA 2ZOOA 1KBWA 3JT2A 3UABA 3S8FB 1BYOA 1AZBA 2XVBA 1NDTA 1GSKA 4N8UA 4BK5C 1JERA 2BZ7A 1BYPA 2J55A 4DPAX 8PAZA 1PLCA 2YQBA 4QKTA 2YAQA 2FT8A 4ZK8A 2ZONA 4AKOA 3DTUB 4DP9X 1GS6X 1JXGA 1AIZA 2FTAA 3CDZB 1EHKB 5AKRA 3AY2A 3UAAA 1BXVA 2PPDA 4KNTA 1HAUA 2YAPA 4YSRA 1J9SA 4JKNA 3H4FA 4HCIA 1L9OA 2VW4A 5IY5B 4KNSA 2XV0A 4UANA 1OCCB 1M9WA 1AR1B 3ZBMA 4G7QB 1RZPA 3CVDA 1PAZA 1A4AA 1M56B 2FT7A 3SBPA 4YSSA 5I6OA 2ZWNA 2CALA 1I53A 4F7KA 9PCYA 3CDZA 3GYRA 4E9VA 3AG1B 2H3XC 2EIJB 3TA4D 2HZHA 2XX0A 1NPNA 4DP5X 4E9TA 5I28A 2MRYA 1A8ZA 4NB7A 2HLEB 3FSVA 5B1JC 2WO3B 2YAOA 3OMAB 2PLTA 4AZUA 1KV7A 1WS8A 2UX6A 2R7EA 3C75A 3NJKA 3KW7A 5D4JA 3IN2A 2OJ1A 2BZCA 4HHGA 2RACA 1NIDA 4YSDA 1OCRB 3X2QB 3FQYA 3PXLA 1NIAA 2GI0A 2UX7A 2ZXWB 1JZEA 1ZIBA 2FJSA 2PP7A 2VM4A 1TEFA 1J5CA 3FU8A 4BWUA 1IBYA 2BW5A 2E86A 1TKWA 3TBCA 3NP4A 2YXWA 2IDQA 1E65A 1QHQA 4DP4X 5PAZA 1ADWA 4E9QA 1NWPA 3IEAA 2GHZA 3ZDWA 2OV0A 4YSTA 3QJSB 4EF3A 1J9TA 3FU7B 4DP0X 2Q9OA 2FQFA 5A7EA 2XU9A 1BQKA 1AZNA 4DP1X 2IDSA 3NSDA 1MDAA 1AG0A 1ASOA 1UATA 1NPJA 3GXUB 4E9SA 3CVCA 1OF0A 2J56A 1ASPA 3L45A 3CG8A 1SF5A 1WA1X 1L9RA 4A67A 1V10A 5B3SB 1CYWA 1NIEA 3CZUB 4JHUA 4PAZA 2VSMB 4YSAA 3OM3B 1BXUA 1J9RA 4E9RA 4YSPA 1WA2X 4G7RB 3FT0A 4M4RB 1JVLA 2AZUA 1JXFA 4A66A 1MG2C 4A2GA 1XB8A 1HFUA 1PF3A 1JZJA 3H56A 3DKHA 1PZBA 1X9RA 1A4BA 2YAEA 2BO0A 2QPEB 2YAMA 3BQVA 1URIA 3SBRA 2FQDA 3N2JA 4FA7B 3PPSA 4AKPA 1AQ8A 1DYZA 5B1JA 3S3DB 2I7SA 3NYKA 2XV2A 3QJRB 1BXAA 1XB3A 1L9TA 4JHVA 3S3CB 3EHBB 1KGYE 4UF7C 4NERA 1AS8A 2TSAA 3FPYA 4F2FA 1SDDB 1WA0X 1M57B 4E9YA 3QJQB 2Y1AA 3FYEB 1ETJA 2BP0A 4GXFA 1OE3A 4A68A 4GY4A 4BXSV 3ABGA 2FQGA 2IDFA 3QJVB 1WS7A 3X1FA 1JZHA 3HB3B 1KDIA 3WNJA 1GS8A 1ET8A 3NJGA 4GP5B 2VN3A 3FQ1A 1PLBA 2XLLA 3PAVA 4W9ZA 1JXDA 2FQEA 2R7EB 1E5YA 3RYMA 3U25A 3IBOA 1ZV2A 1RKRA 1SDDA 2JXMA 1N70A 1R1CA 1V55B 3ZIYA 1NWOA 1YLBB 1VLXA 2PP9A 1FWXA 4TXVB 2YXVA 1L9SA 3PLYA 5AFAA 3AG2B 3NSFA 4ENZA 5I5MA 1NZRA 2H5UA 1NTDA 2DYRB 2BW4A 5FC9A 3SQRA 4A2EA 1OCOB 4CSZA 4DP8X 5TK4A 1MZYA 1PNDA 2IAAC 1GY2A 1OCZB 3EF4A 1GR7A 3AW5A 1L9QA 1B3IA 2B3IA 4CSPA 2QDWA 1XMEB 4BXVA 2J5WA 4KNUA 1AS6A 4UAHA 2XWZA 2B08A 2CAKA 1ID2A 4DP2X 1GY1A 2AFNA 3WKPA 1OE1A 3X1GA 1ET5A 3WI9A 1F56A 2FWLB 2HRHA 1MZZA 2IWKA 3GDCA 1BQRA 4GYBA 2X88A 1AANA 1X9UA 4YVUA 4F2EA 5I6LA 4KO5A 2YAHA 3OQRA 3TBBA 4G70B 1RZQA 4BDVB 1CUOA 3T6VA 2PP8A 2HRGA 2IDUA 4KO9A 1IKOP 1FA4A 1SHWA 4WTQA 3FSAA 3G5WA 4HHWA 1BQ5A 3DIVA 1ZDSA 1PZCA 4KO7A 3WG7B 5I6MA 4HZ1A 3EH5B 1A65A 4PCYA 1ZDQA 1PCSA 2IDTA 5B7FA 3PAUA 2DWTA 3MX0B 1DZ0A 2PCYA 3ABKB 5F7BA 1NINA 1JZFA 4BDVA 2OCCB 3FPXA 2HX9A 2UXFA 3IE9A 3NJLA 1GS7A 2BWIA 2P80A 3TU6A 3FS9A 3ERXA 2WSDA 2A3TA 5E9NA 1A4CA 1SHXA 3SBQA 2XXFA 3X1EA 2IH9A 2EILB 4P5RA 1TEGA 1A3ZA 1TU2A 1IBZA 4DP7X 3NSCA 5EHFA 3V9CA 3WKQA 3X1BA 4BWWA 2BP0B 3ABMB 3JTBA 2YARA 2UXTA 2HX7A 3PCYA 2PCFA 1J5DA 1ILSA 2GBAA 2JKWA 4GP4B 4K9JA 2DYSB 4FAAB 7PAZA 3AG4B 1AG6A 2EIKB 2BP8A 1JOIA 3OMIB 4L0PB 3UACA 1OOWA 2EINB 6PAZA 1ET7A 5D4HA 1AACA 2UXGA 1AS7A 2GIMA 5AZUA 3WNIA 3WIAA 2UXVA 4BWTA 1PZAA 2AZAA 1NIBA 3KW8A 4AKQA 4E9XA 3OMNB 3OD3A 5ANHA 1CC3A 2FT6A 1SNRA 2DV6A 4KOBA 3ABLB 1EZLA 5B1AB 1PLAA 1XB6A 1JZGA 4HIPA 5PCYA 1NIFA 4AI7A 1CURA 3NJIA 4YSQA 1WAEA 4HAKA 2XXGA 3BVDB 3N55A 5I6NA 4G72B 2I85A 2NRDA 3NJMA 3CVBA 4QLWA 5B7EA 3T6WA 3NJJA 3T6ZA 3T71A 1T5KA 2DWSA 3AZUA 5B7MA 4E9WA 1J9QA 1ASQA 1SJMA 4GP8B 4W1TA 4YSCA 2N0MA 5D4IA 1AZCA 2H47C 1CYXA 2XX1A 1BEXA 1NICA 1KCBA 3X1NA 3ASNB 3T6XA 2EIMB 3NP3A 4A2FA 4A2DA 2MTAA 1AAJA 2IWEA 3NJFA 3T9WA 1KYAA 3V9EA 1E5ZA 2IWFA 2Q5BA 2TSBA 3S3BB 1ILUA 1MG3C 2XUWA 4G7SB 1ZIAA 4Q89A 2VM3A 2PPEA 1AZRA 3FSWA 3IN0A 1E30A 4KO6A 1W6WA
chains in the Genus database with same CATH superfamily
3T3PF 1N7MH 3K2MC 4KTDH 2ENJA 2I7OA 2WBKA 3KBEA 3ZRCC 4O2EB 4LOEA 4YFLI 2GC4C 4PLKC 5LAXB 2YJQA 4MCZA 1PNCA 1XF4B 1JFQL 1DDTA 1KXQE 3L2NA 2BNRE 1CGWA 2ADIA 2CWRA 1WZ1H 2FX9L 3CFJB 3FH8A 2C26A 1T2JA 1QTSA 4PVLA 1KGUA 4L8DB 3VDAA 4M1DL 1JPTH 3RVUD 2JK5A 2CJUH 1PIGA 3FONB 2D0FA 2HMID 2AAAA 2QHRL 5JQHC 1RJYA 3BT2L 3F5WA 4DJMA 2CUMA 1CLOH 3RDTB 1XH3B 3WXWH 1THCA 2E5EA 1TFPA 5GS0C 1MIEL 1N0XL 2ZYHA 1CVRA 1EEYB 2OL3L 3EHBC 3O9WB 4I2XB 4RMVA 4WDIB 2QDVA 3OKYA 2DB8A 4M02A 4ZX4A 4OZIB 1U8CA 1KXQA 4Y9EA 1A3LL 3D09A 1E67A 3ECVA 1MCCA 4CU7A 4UTBL 1LL1A 2DYPB 3QSKB 4ZJ9A 4MDIB 1IC0A 3MBWB 5G4MA 2ZF9A 1U3NA 4PJ5E 5IBTH 5JOFB 2RTTA 2NY5C 4HYTB 4LHUB 4OW6A 1EO8H 4I85A 1TQBB 4ZMLA 3BFWA 4XMLH 1CICD 1RZIB 4UOW0 2ICEC 3UADA 1MELA 4JG0H 1N64H 5DEJA 5E95B 1UURA 5BVPH 5A1AA 2IADA 1O5DT 2UZXB 2M1KA 2HH0H 3JUZA 4F58H 3H4HA 1MOEA 2OMVA 5HDBE 2O6CA 3BKJL 3RWJA 1FJ1A 3SKMA 1YJDC 3HHMA 5B8CA 4S1DD 2IG2H 4N2GA 1VF5C 4JQIH 3BUYA 5GS2D 2WB7A 4FQQA 2ZXGA 1Q38A 4LCCC 1Z6JT 4I77H 1QA9A 5DC0A 1AGEA 5HDOA 1AHWC 3O4LA 4WGKA 3WFEH 5DHXB 5I1DB 4MYPA 5E8DL 3FQRA 3TC9A 2EZ0C 3ZMEA 1AZBA 4XPBH 4F7EB 1G7JB 3G6JF 4PUBL 3MFFA 1E3ZA 3VD3A 2C9AA 2ZT9C 1XH1A 4PREB 2DD8L 1XBDA 1LILA 2YGPA 1IGTA 4NJ9H 5JYLA 5FDWB 4ELKB 8PAZA 2YQBA 4NHCL 2L04A 1FNEB 4AKOA 2DIEA 3WGUB 2EE3A 2Q0ZX 3OQ3B 2VZ1A 1H5BC 3QHZL 4AYGA 4LVNB 3L3OC 4UT6L 1TR7A 4RFOH 3CDZB 4HWEL 4BKLB 4Z7UF 3RWFB 1P84J 2CHXA 1BXVA 3U9UA 1LO0L 2H26A 4QOKE 3GZPA 4YSRA 1I7UA 1M9SA 2G4GA 1U8OB 1FZJA 4DOHE 3HUJB 1YMMD 2ZG3A 3QWQB 4XAWL 3WHE1 5TH2A 2X4NB 1A7BA 5SWZD 4P4KC 1FVEA 4FXTA 2OQJB 1AVAA 2I5YH 2ZX5A 2J4WL 4MVBD 1AQMA 1AR1B 4KDTC 2AV1A 2CK0H 3X3GL 2QR0A 3FO0L 1Z2KA 2FT7A 2DQDL 3KS0J 3HZVB 5ESQA 3VG9C 1G7HA 5IQLA 1U58A 2XWBA 2IH3A 3UG5A 5KVFL 5TQ0H 1WPCA 4V1DB 4JB9L 4AV5A 2H3XC 4X4XA 3FBQA 3CVHH 1FLRL 5DA4A 2FEEI 4GBXB 4TUOA 3B2DC 3HR5A 3UC2A 3NCFB 4UQCA 5T5NF 3GJFA 1LYQA 1A7RL 1UG9A 5DFVC 5F3HB 2ICEA 4RISH 3CXHK 2BNUB 3O6MH 4GSRA 5JPMC 5GZOA 2CRMA 5C2BH 3DIDA 5KS9B 4BINA 3BHBA 3VFRB 5K69A 1NIDA 1IBBA 2WQAA 4KKBD 5F7LB 1LD9A 5IKCB 5B3JE 5JW3H 4FYRA 1CYGA 1J5CA 3K3QA 1ZGLP 3EJTA 2IGTA 2Z7UA 4ZX3A 3P9LB 5GPRA 1AJ7L 1UCBL 2R56L 3IMRA 3QFJD 4NI3A 1S46A 1CDUA 5D93B 1HNGA 4Q9QL 4PV8A 3SCMC 2PO6B 3AROA 2AKRB 5JLZB 4LCCA 1QFWM 1NGZB 4KQ4H 2FJGB 1AHWA 1YEDB 2G2RB 2Z8RA 2OCJA 1QFWI 3VQMA 5E5RB 2SEBA 3FB8B 5FF6A 5GGTH 4YHKL 3NZSA 2B0SH 1IC4L 1FG2A 5TGBB 1AKJA 4TSBH 1FO0B 1P6FA 4QHKJ 4J2QA 2FR4A 3D69B 1TJXA 3N42B 4N90E 2X70A 1UQSA 2WY3B 2YD9A 2HMIC 1A3RL 1H5BA 3NCBB 1XSKA 3L3OA 5SX5K 5I0DA 2GYSA 4PJIA 4M8UA 2YR3A 3HVNA 4FFYH 1MFBH 3VXNB 1V10A 3TWCL 1GW6A 2OJEB 1YNKH 3CZUB 4K7PL 2ZNWA 1EJFA 1KCUL 1DSYA 2DL2A 2V8LA 4XP5H 3OLDA 4P4KA 1F0LA 2A4ZA 1NUDA 4PRNA 1E2WA 4Q9RL 1T1WA 1MQKH 1X4ZA 3F7YA 3E1ZA 2BOLA 2IOIA 3S88H 4MAZA 1UJ3C 1T6BX 4XNMA 3H56A 3HE6B 3DKHA 4A7GA 4FFWD 5FO9B 1DL7H 2ATKA 1T7VA 3GRWL 2WXFA 4YDKH 1JYVA 4JN1L 4GUPB 3D39E 2VDPB 4YUEL 4AZ8A 1H15A 15C8L 4PW3A 4AM0Q 5F72S 3WSQL 3VM5A 1WIOA 2W9DH 4X7TA 5G4OA 3REWB 1G6RB 2RMNA 3TT3L 2I07A 3HIZA 5CR1A 1A5FL 3WO3B 1I7ZA 3FTGB 2YPLB 5DHMC 4AQAB 1YEIL 5JZ7C 2ZUTA 3GIVB 4LLDB 5BVJA 3KG5A 3BISA 4WVRA 2BP0A 4KZDL 3VE0B 3VRJB 4K8RL 2DRUA 3RY4A 2NQDA 1SMOA 2VAAA 3L4ZA 4ZQKA 3DVFA 3MV11 1W0VB 4FHBD 4S1SH 4FQHA 1T4KB 1M2VA 3SCMA 2QQLL 4PI2A 1NL0L 1JD9A 2QVIA 3KM1A 1B4JL 1G5AA 4YGVA 2ROYA 3IMTA 5JUEH 4XE0A 1NDMB 4BFNA 4ICWA 3Q1SH 1KJ3H 5GRYA 3E1F1 3GO1L 1E4XI 2AXHA 2EDBA 4IHOB 5FO2A 2Z35B 3SY0B 5E6YA 3R4RA 3MU3A 1PQZB 4ZS7L 5JOEA 5KWYC 3DUUB 4HMCA 1QPKA 5LN4A 1HS6A 2G2NA 5JXAH 2DYRB 2BW4A 4CW1B 3ARRA 5BZDA 1F8TL 1ZLEA 1SJHB 3L3KB 4ATWA 3I6GA 3ATAA 4U1LA 4XVTH 3SBWC 4JM2F 3DWTA 1SDAB 4XMXA 1DQJB 1AHMA 1C7SA 4JFOA 1E42A 3BP6B 1BBJA 1TEYA 4MVBC 4LOUC 1XO8A 4DP2X 1Z3GL 3ZL1A 1IC1A 4EAEA 3PWPB 2GTZA 3MCKA 2VN4A 4PSRA 3JV6B 1UZ6E 1OB0A 5T1LD 1BQRA 3C6LB 3S5YA 2PCPB 4HIIA 4UDUA 2BY0A 3B34A 5EDXA 3BYYA 3CHPA 4NUJB 3HN3A 4FFZL 4WCYH 2OMXB 1UJ3A 3QXAB 3P9MB 5KSAB 4FTVD 1LMKA 5IB2A 1ZS2A 1KEMH 4TKWA 1QVOB 2D31B 5KVEL 3VH8B 3EUDA 5FYKL 3F00A 4NM8L 1MI5E 3SY6A 4HKJB 1MW1A 5I8KH 3QNYA 1CICA 4PW4A 1RIVL 4G8GE 4OZGF 5DZOA 5EUOE 4KO7A 4UV4L 4QT5B 3BWSA 1IKFH 3D4YA 1VFOA 2C5DC 3EH5B 2D7TH 3IDMB 3HNSL 4WFFD 1PCSA 5CJ8A 5IR1A 5DMKA 4KKBC 2GT9A 4CVZA 3IK2A 4H88L 4ZFQA 1BJMA 1VZIA 4NCC1 3QUMA 3GTTA 1MH5B 4PJDF 3HE7B 5T3ZH 1F3DH 3FPXA 2OMBA 3FRUA 2ZG2A 4WHDA 4FNLL 1UVQA 3Q2VA 3ZDZF 5LQBL 3ERXA 4TTGA 4OB5L 4H5SB 1KPVA 3V5KA 2A3TA 1YMME 2P49B 2H3NB 1SHXA 3U4AA 2WLJA 2FYYA 1XCXA 3C9NA 4K9EL 5SWZE 2EUVA 5EUOA 1BDYA 3IS0X 5GRJH 2X40A 1U9KA 1TEGA 2A5UA 2XZZA 5C0BD 5DTFA 1TTCA 1BFOA 2VH5H 2MKWA 5K39A 4L5FL 3LNDA 3D2UB 5KZCD 1RV6X 3ZE0B 1PDKB 1UA6L 3GJFK 2YD1A 3VSVA 1NM9A 3JTBA 2IVFC 2B7DT 4G5ZL 4Z7VE 4BKTC 2A9MH 3PCYA 2IPUG 3O3AA 3PPEA 1I8LC 4P04A 1AMXA 4XVUD 4I9XA 1J5DA 1HCFX 5CD5C 1UD4A 2WZPD 5CFAA 4QY8A 5EZOH 1A6ZB 2C34A 3K6SB 3O11A 1RFDL 1R6VA 2EIEA 3OJDA 4HJ0D 5E8EA 4GKNA 1YMMA 3F64A 3SBWA 2CJSA 4PGZA 2R0ZH 3C08L 4HX1B 3V0IA 4TMPA 1H8SA 4N8VA 1K6QL 2C3VB 2COVD 3DX7B 3RA7H 2R29H 2EH8H 2ADJB 1SNRA 5CNHA 5E8PB 5FFOA 4RRPM 4EO5A 1T5WB 4X6CB 2Y07H 4XVSH 4ZFGL 2NY6B 1F90L 5I0XA 1E4WH 3NJIA 5I16B 5IZ7A 3ZQXA 3QFJE 1KG0A 4H2AA 1KGJA 5DJ2A 1ACZA 4GKOA 4R4BB 1KY6A 4YL9A 5DK3A 4LVOB 3BIAX 5C07D 3OHXC 2ICWI 1HDMB 4Z7IA 1P4BL 3T2OA 3RILA 1XEUA 3H3BC 2DEXX 3EJUA 2AXGA 4FGMA 1TQCB 3D3VB 3QPXH 4W6XB 5T1MB 5I23A 1A4KA 1C5CL 3DJSA 3E3QC 5DJCA 3VI4B 3WDHA 1MFVA 1OSPL 1SJVA 2J1XA 4WFGE 4M5SA 3RL1A 5KANI 1CYXA 4Y16D 3BAEH 3LNIA 4NPJA 1UB5A 5E5LA 3V55A 1BP3B 2QPUA 4QUOA 5H4YA 1QSFD 4KKLD 4RGMB 3QFJA 5AW6B 1PG7X 4YO0A 1WRFA 3P1VA 4BFRA 2YIHA 4FI8A 3B1TA 4WJ5A 2E59A 5EOCJ 5HHOE 4M5ZH 4KKPA 3TYFB 2H2SD 3IN0A 1I1RA 3T8XA 1U8JB 4YDLB 1J05B 4KO6A 5E6ID 1ZPUA 3MCG1 3BH9B 4P2OD 2IGLA 5H2BA 4AX3A 4MMZB 3BVNB 3PV6B 1XGPA 4LSTL 1TFHA 4OCWH 4Q6IB 2QLYA 4HXBH 1G7MB 4R26L 1FO0L 1G7PB 4DQOL 3CTTA 4ZOAA 3FAWA 5IVZA 5D8JL 2GB2A 2NDFA 3CPLA 4LLMA 4ADIA 1KJVB 1I8LA 2RGSA 1NCTA 2G3MA 2YC1A 1OIOA 5CU9A 3L3DB 5I74C 4AQOA 1DSFH 2RHEA 4LSRH 4DPRA 2DBLL 3U6RA 1EX0A 4GO8A 4PBVC 2Q7YA 1QSEB 1J1PH 4P9HC 1AXTL 2CUAA 4WI4A 4S10A 4XCEA 3EYFB 3MOBL 4PJ9D 3RNKB 4YVNA 5C7XH 1JZIA 1S3RA 1NBYA 5C0AD 4KOCA 4Y5YB 1D5IL 4PIBA 3E3QE 3WIHL 3QYNA 1QX1A 4PWKA 5CWSA 3OJVC 3VRIB 1B0RA 1F4WH 4PTUB 2ITEA 3T0BA 5F7WC 3MA7B 4CADA 3ZTDC 3QJTB 4UNIA 3ASWA 5DQJA 2OTWB 4KI5F 3E6FA 3RZCD 5FYJH 3B2VL 2OX5B 3PJSA 5I76B 5IQOA 3MQIA 1KXHA 2E47A 3NMEA 3VYPA 3NSXA 3OHXA 5KVDH 2KS0A 2AV7B 3U2SB 5DRWB 4BRJA 1HINL 3AMKA 3Q2NA 4UOQA 5AOLA 1KCVH 4X99A 2VC2L 3BMWA 1BJ1H 3CFEA 1BAWA 3EGDB 4OJFH 2VRAA 1DO5A 3NIFE 1ZVNA 2H8PB 1H6UA 5D96B 5JOPD 1NOLA 1G6RL 3DVGB 3M1BA 3IRZA 4C4BA 4LRNL 3RWCA 4FA6A 2AAVA 3VFUA 1UOLA 1OE2A 1SYSB 2AJVH 3PHQA 4BSVB 3IDNB 4MAUL 4MFHA 4AV0A 3UH8A 2FZ3A 1KPRA 2PWGA 3HEIB 3CH1B 5DD0H 5DJXA 4L3CB 3BRFA 1CGVA 3TO4B 2F1BA 1MHCB 1EHAA 3OZLA 4TSAH 2J8UE 2XVBA 1TZ8A 4NUPA 5EZPA 1FYTD 1QNZH 3WN5B 4DSYA 4R2GD 4Z7QE 4BK5C 3QNZA 1JERA 5EEYA 2B4CH 4JGNA 2TAAA 1UWFA 5CBEA 1L9MA 2YAQA 4FTVE 3KWWA 4XVUC 4ZK8A 3BKML 4K73A 1OGAB 5C97A 5MP6L 3FKUS 3ZKNC 5AKRA 2FO8A 4TQ8A 4DCQA 2VXUL 5JPNC 1CFSB 2YAPA 4ZMTA 1J9SA 2EDKA 4JZOA 4PY7A 5AYUL 4ZW3A 5A6LA 4WFFE 5HJGA 4XP6L 4LLYA 1BECA 5F1IA 5KJ4A 2VQ1A 2X89D 4WK0B 3V0EA 1X5KA 2J8UA 1LK3L 1NAMB 3DGGB 4L8CB 4IK6A 5T1LA 3CZJA 4ZFFA 1CL7H 1FGVL 1I3RA 2WUCL 4AYFB 1XF2B 4M7ZB 1JG9A 2BDNL 4JPVH 4LOFA 3Q9PA 2RJMA 3UPCA 5I0YA 3DPDA 3U1PA 3GSRA 4OD2B 4UYQA 3FOMA 2E9IA 2VDRH 5I24A 2XN9B 3RPBA 1TVHB 2XVLA 4NQDB 5C09B 1GC1H 1GJWA 1VEPA 3H9ZA 3RU8H 3O45B 3VX0A 5D6CA 3LDBB 1YEFH 4GW1B 4I0CC 3PV7A 5AG9A 4R9HA 3FSVA 3CHOA 4W9EC 5C7ZA 5AOJA 2WO3B 5HYSB 4JQVC 3NIDE 5JQ6H 5C0BE 5IMKB 1QKZH 4FYSA 3KW7A 4Y16C 2EUXA 3HNVL 1CZ8L 3I84A 1GAFL 3CC5B 4U0RB 4KKLC 2PTTA 2FJSA 1TEFA 2A73A 1N5AA 4MGXA 1JPEA 2ZJSH 3CQPA 4KC3B 4TUKL 3EFDL 2R1YB 4DVRL 2R69H 5KW9H 4ONGL 5IOKA 1ZSDA 3NCYS 1EA9C 3RWHB 2NY1C 2H2SC 3D0VB 4Y4HD 4HD9A 3G08A 4WO4D 5I6XC 5CEZD 3G6DH 1Q9KB 3CFUA 3H9SD 4RA0C 4J8QA 3VXSB 1UWYA 5C0BA 1HOEA 4YHMH 5IMMB 2P8PA 2NXYD 1MRFL 3G5VB 4J5VA 3N0AA 4BK5A 1VFUA 2WYHA 3FO9A 1K5NA 1KJ2A 1PY4A 1URZA 4CSTA 2IDSA 1WISA 1FIEA 5E0FA 4KTEL 4R97C 3GXUB 3ZE1E 1YC7A 4F9LC 4OTXH 5JIQA 3NFPA 1J11A 4JO4H 5C07E 2WZPA 3UYRL 3TFKD 3S37X 1AY1H 3VXPA 3ETBJ 4MB3A 1CD1A 5HVGB 1OT4A 3EH2A 1ETB1 3DV4A 1FNLA 5JPNA 2OPCA 1ZVSB 4WUKH 4ADGA 5FX3A 3QQ3A 4APXB 4PJ9C 4K3GA 1ORQB 1N5YH 3CU1A 2V33A 1BF5A 2FHFA 3Q7JA 3K4AA 3CHRA 3LMJH 1DE4A 4W9FC 1IKNC 1AGBB 3RZCC 1EVUA 5E00A 1MG2C 2WOBA 1T22A 5GJTL 2YMXL 4HHAA 4F33B 4IBUA 2E6QA 4M62H 5DD1L 1CDBA 2VXTH 1MWAH 4BD4A 1TENA 2QPEB 5C07A 2X2JA 3BQVA 1QG3A 1XL6A 3CLWA 5KVGE 4RCAA 1DTUA 4M7LH 1FC1A 4DK5A 3CDCA 3GBMH 2MQGA 4LLQB 3U2JA 5DLMH 5AUMB 5EZJA 4JQVA 5HY9A 5I1GH 1OGTB 2I27N 4B9YA 3BP4B 4Y16A 1EGJA 4AYID 5K1JA 4QYAA 4KWUA 5JHLL 2HVKA 1KFAL 1QSFA 2WTRA 2HFEB 2YEZB 1NLDL 5GGUA 1VGEH 2ZSWA 4DGUA 4ZMNA 2VM9A 1A02N 3GS0A 3KPPA 3IF1B 2WV3A 5BZWA 3WE6B 4EVNA 2IDFA 3V0VA 3DSFH 4XVJH 3WLBB 5EC1A 3GM0A 1IC5H 5J9PA 2R4SH 1GS8A 2E4TA 1A7NL 2GVYA 2XPZA 4MXVF 5DJ0B 1UTDA 3DMMD 5A6MA 5C0AE 4P2OA 3QQ9D 4ZMWA 2YFOA 4R2GC 4EI6B 3KYKH 3X3FL 2NLJA 1RKRA 1SDDA 4MD0B 1UH2A 3MODL 1V55B 1VAHA 4NDMA 4A2MA 3ALPA 5JMRA 1G7IB 4M6ML 4FULA 3SHSA 3U0WL 3BEWA 3N1QC 2PR4H 2V2XA 2MCAA 4GW5B 1DANU 1TITA 3HAEA 3SQRA 1VFBA 3D08A 5DD3H 4CSZA 1EAPA 4ACTA 1MW2A 1AZVA 3AW5A 1RZ7H 1KWKA 1U8KB 2PXYB 3D18B 4Y19D 3VGFA 2JB6B 2FLRT 3BC9A 4PJ9A 1CLZL 2MPAH 4F80A 5C0AA 2ODIA 4L9LC 3D4GA 5JOPE 1BA9A 1QYGH 5BO1L 5M7QA 1SVZA 1UKTA 2ZKHL 3TM6A 5A40E 1F58H 4YXHL 3RHWK 5FUZH 2X4UA 5A6IA 5K9JH 1MZZA 1FH5L 1IKNA 1AANA 2ARJB 4M8QB 3RZCA 2DQFB 4HETA 1UFUA 4KRNA 2KT6A 1IFHL 1SY6H 2H0FA 5L7XH 1S7QB 3RI5F 2GJZA 5EU5B 3QUZD 3UERA 5AG8A 1L0PA 1P1ZB 3D30A 1NFDF 4TTDD 2IQ9H 3G5WA 5INCB 2VR8A 1IX2A 3WG7B 3QI9D 4CBPA 4PR5A 3EO0A 5DMIH 4XN1A 1IJNA 5F9DC 3CE1A 1ZE3C 3EJJX 3WAKA 1SXSA 1LP9B 3QP3A 2EIDA 1JI1A 1Y6MR 4BDVA 3ELAT 2JLLA 3BKYL 1D5XA 4U2ZA 4PGDA 4WI5A 4HIEA 2VDKH 4Y4HC 4YIQB 4LASL 5FOBB 4WO4C 2WSDA 3H2WA 5DUJA 4GQQA 2Z31D 3V5DA 1QP1A 1OF2B 2UZYB 2Q7NA 1YEEL 3MYJB 1HH9A 3P73A 4HC1A 3N44F 3SBQA 2NY7H 4MLIA 5T1DH 3OB0H 1FYTA 2NXYC 1NDGB 1FAKT 1TU2A 3CFMA 1C5DA 3O2DH 1GZQA 4NNXA 1JV5B 3WKQA 4LSVH 4RETB 5D7LD 5D1ZB 4OCSH 4YQXH 1M05B 5J89A 1FORL 2VB5A 3SDDB 3TFKC 3HI6H 3FQXB 4ODWB 3SSGA 4NRXB 1P7HL 4P2RE 4NC2B 4PG9B 3AG4B 3LPFA 1INEH 3S0PA 3J27A 4MBOA 4MHHI 1G0DA 5EA0H 1TO4A 3GGWA 5FA4B 2AJSL 2FWOB 5EWIH 1A7PL 2WNGA 2X89A 6TAAA 1MCRA 4WNQB 4M7JH 1EBPA 1GIGH 4YK4C 4KXDA 1TJIL 4NO2B 2AZAA 3RVTD 4AKQA 1I7RA 2AGJL 3GEWB 4M7KH 4GAGH 1W0YT 2JCCF 1KBPA 4ZNEA 2DKMA 1QBLL 4NKOB 1NAML 3D6GA 3BWZA 3PNWB 3RE0A 1DVFD 3RWIB 4Z3HA 4PRPB 4DGYL 4P57B 2PW2B 3KPMA 4DO6A 4YSQA 2HFGL 4G6AD 3MREB 1HIML 5AB0A 4LVEA 2X38A 1EHNA 1MXDA 3HHRB 5B7EA 5KOMC 4PHZA 4ANXA 2BJML 5CEZE 3WL9A 3NJJA 3H9SE 3HBQA 4Q0XL 2ZG1A 3C87A 4WHCA 1DBAH 1FL6B 3L1FA 3IWVA 1ZTXH 1GYUA 2YQGA 1N3NB 1PD6A 2QVMA 3IU4H 4LE8A 5BV7H 4NENA 5IJCC 3QO1B 3WTVA 2VISA 4UOJA 5IVXB 2X0WA 4JHBA 5JDJA 1AZCA 4CVXA 2APSA 1INQA 1NBQA 3SE8L 5LGHL 2ICWB 3FOLA 2ZWLT 3VDCA 4PMEA 4LCYB 3FO1B 4AQEA 5DHDA 4JBSA 1V3KA 2E7HA 2DQTL 2Q5BA 4Z7WB 1P4LB 4M93C 1SOKA 3FHQA 4MA1C 3MCYA 4Y1AD 4Y4HA 4DW2H 5F70A 4Z7OF 5J6GA 2AQRA 3FFCD 4P48A 4WO4A 2P43B 4LEBA 3DMMC 5E8OA 1GGUA 3GSWA 3H9SA 3QQ9C 4PHXA 2BSTA 4C4KO 5IJKC 5I1IL 4YXKH 1U21A 1IBHA 2X09A 5KYUA 2MCMA 3ZQ9A 1D2OA 1U92A 2FSEB 5HHNB 5EF0A 2F53B 5J06A 4W4NA 2YUZA 3GC3A 4FQLL 4PJ8D 1OD9A 1PZDA 3FU9A 4ZMZA 4QHNA 2XWTB 3I02B 3DVIA 4X4ZA 4Q97A 2YGVA 2Z8SA 1KTJA 3VU1A 4DUXA 5B39B 4I4WB 4ELME 1MCOH 4AL8C 5K5YA 4U1IA 4DPBX 3T4AB 4D8PA 1I8IA 5EU4B 2JTYA 3KYMB 1ZLWK 4Z77B 3RX9A 1BVLB 4OT1L 5FHBH 1JZ7A 3W81A 1R0AH 1DBJH 4X0KA 2CKBB 5BJTA 4B41A 2A6JB 3KPTA 5LWYL 3KBHE 4OQTA 2HYMA 2Q6WB 3UC0L 1DCEA 1MN4A 5J57B 3LOWA 2JQZA 1PMYA 2HXAA 1AZZC 2IALB 4PJAE 2EIZB 4HWUA 5DVMA 4FCHA 3LYRA 3MGAA 2X4QB 3P3RA 1R3LB 1FZMA 1WFTA 3KWXA 5GGRA 4QLRA 1Z7JA 5GJSH 4TNEA 5L4IA 3TCTA 3GK8L 4X5XB 4ELMA 5T1KD 2X0UA 4HP5A 4BZ1H 4TTDC 4HUVA 2IXQA 4XNZC 5CGTA 1HAWA 2PCXA 4HWBH 3CBRA 4W6WB 2HFFB 4Q2ZB 1ZVYA 2W81C 2Z4QA 3G5ZA 1ZPLA 4IDLA 5E99H 3WCYA 4GUQA 3PWJA 5I9QB 5BUAA 4MD5B 1K4CA 1ZSHA 4B7IA 1FGNL 3UROR 4GEIA 5TK2A 4PJAA 1TG8A 4N24A 4BCYA 3TX4A 2GTWB 1OPGL 4W9CC 4FJZA 1W8EA 2MKLC 1V54B 2X4SA 3IFPA 2IJ0C 2Z31C 5CP3A 1KC5L 3LX9A 5KSUB 2HTKD 3T3MF 4Q74A 2YPVL 5I1EL 3CU7A 1T0NA 4PJXB 4Y19E 3GSXA 3G3LA 2QBWA 1EJ8A 4FXGC 2D9QB 3DMMA 3T3PE 4N0UE 1QEWA 4UNTA 5MEOA 2CIIB 1ZK9A 5IJKA 3T2NH 4JZNB 3PFUA 5AVVB 2MCPL 4B5ZA 5ELIA 1YMHB 3JUYA 4XP1H 1HXKA 1TETH 5HHXH 3FUHA 3L9EA 4IJTA 1FVCB 3C5JB 3CFKB 3OAZK 4PSPA 3FC8A 5DEFB 3ZTJG 1TQSA 5IESH 4JFYB 4C56A 5AOKA 4JM4L 2MJWA 1BBDL 1CFBA 3BP7A 1P2CA 1TYJA 1XXDC 2F74A 5J1SC 2XFXA 1EZVY 5EBLB 1W0WA 5D72H 3OV6A 5IV2B 3L5WA 3QEGH 2IGFL 3GMQB 1GZHC 3RVTC 4YLBA 3OKMB 5CKGA 1QSVA 1OKEA 5EN2B 4P2QB 2TRHA 3SO5A 4AIZA 3IMSA 2UY6A 1RZPA 4ZUSA 4Z8FH 1ZRUA 3PF2A 2YA0A 4G6AC 4L1TA 4RDQF 1YEGL 3SOBH 3HPJB 1KLGA 5HVHC 5IUCA 1KBGL 1TJGH 1RUMH 5EH1A 2YWYA 3X13B 3FN3A 5FO8B 4KVNL 1IM3D 3FQWB 4YHNA 3QUZA 5I28A 5GRWA 3IPBA 2NQ3A 3FCSB 3QHFL 4RGOL 2EXWD 4DZ8A 4R8WH 1XR8B 4JM2D 1XGZA 3BAWA 4HMEA 1OP4A 3CBKB 4JREB 3K71A 2BXYA 3V0WH 4F8OA 2PLTA 4UT7L 3U7YH 3GHBL 5BRPA 3IN2A 3GTNA 5T5FH 3VYNA 1VIWA 5D7LE 4HHGA 3QRBA 4TNVF 1R5WA 4N6QA 2XXCB 4UQIM 3HKFA 4JY5H 4YEEA 2NY4D 2XIIA 5D7IF 4IHBA 3T1WA 4A55A 5D7SH 3FQUB 2YXWA 4ZUUA 4RSYA 2Z31A 1KYDA 2WQ8A 3ESMA 4J3BA 2I9TB 1LNUB 1QFPA 3IFOB 4LSUL 4MA3A 4TSCL 2X3BA 4FXGA 5SWSD 3LN5B 3PS6A 3G6JE 4YSTA 3TCLA 3MNWB 5CCHE 5AZ2L 1B6DA 4JHWH 2JWYA 2EEFA 4PJ8C 4OFIA 5D70L 5AVXB 3H3PL 4LPWA 1XGQA 4PVMA 4XNBA 2V2WA 3T4YA 3TNNA 4AENA 2X6VA 2FQFA 2CDEA 5D7LA 1IGJA 5ENWA 2CMRH 4FP8H 3VXQA 3PWLB 3LS5H 2DQIH 4KQ3H 3TURA 3PGFH 1YYLH 2Z7YA 4H8WL 2FWUA 5HSFA 4Z7UE 1KN2H 1KPUB 4FL4C 5IFJB 5E9DD 2AJZA 2MOGA 3SPVB 3NCJL 1OANA 4TPRH 4UB0L 4AGPA 2K8QA 3OXSB 2YZ1A 1HHIB 4JM0A 4OAWB 1BREA 2P42B 1GZHA 1I8KA 2O93L 3CAFA 2OW6A 4JFZH 2WLKA 1F45A 3B3IB 2EXYC 3IJYA 1IBGL 3V0HA 4D9QD 5CZVH 1DVFA 2DQHL 3F6LA 5IW6A 2AZUA 4JKMA 4XWGL 5IBUB 3D0LA 4HV8A 3NCMA 4P59H 5BOJA 3UJJL 4RBPK 5D5MB 3DX6A 2YKLH 4G8IA 3MRRA 1IEBB 3BJLA 4Y1AE 3S37H 4PM1A 3V0GA 1NCBH 2PTVA 3FFCE 4H25A 4JO2L 4Z7UA 3P40A 4UMSA 3KLAB 3N06B 1KLUB 3F84A 4LDCA 4N3TA 3WUWB 2WWMD 5HGBB 3WNOA 5EEWA 4OD3L 1JFQH 4FX5A 4JLRA 3S3DB 5D1XD 5FFLA 5EIIB 1TJHL 5FR3A 2FX9H 2XV2A 3PP4L 2M83A 1MCSA 4XCFH 1BXAA 3BSZL 1PU0A 4M1DH 4U49A 2BFGA 1H9DA 1HHJA 1CG9B 3U9PL 4XBPB 4XP9H 1GPOL 1MLCA 4YR6B 3B3BA 2QHRH 3IGUA 3ML9A 4DO4A 1B0GA 3CVIL 3BT2H 1RI8A 3CFBB 4PGEB 5DJAA 4ODSL 2YPKA 1FN4B 1HZHH 5FGCE 3FFCA 2WQXA 1WS7A 2DQUH 3TV3L 3HBZA 3GSQA 2F58L 4D2NA 2NW3A 1X5AA 3O3EB 3QXUA 2OL3H 5EU6B 4F7CB 2NXZB 3V0AC 1R5VB 1SXCA 3QDMB 3AB0C 2YWZA 5ABDE 3LB6D 1A3LH 2PKDA 4N9GB 1Y6NR 2CGRL 2YHGA 4PJ8A 1N70A 3FTZA 1R1CA 3VGAB 5DXWA 4UNUA 2R1WB 4ZUTB 3IVKA 3PP3K 3KGTA 4KJWD 1JHKL 4G1MA 5LKNA 1NZRA 3HBGA 3L4TA 4X9HA 4HGWB 3GXNA 3QPQC 4AGNA 5ITBL 1OCZB 3JWDL 1GR7A 2DQMA 3OAWA 4KKNA 2JJSC 3U36A 3ZTJH 1XMEB 2CCLA 3TF4A 4LSQL 2B08A 4OZHF 1WBXA 3LCYA 2CKBL 1DJWA 4ENED 2A77L 3AITA 3ARGD 3LEXA 4PP2A 1A8JH 1OP3K 5J4MA 2V5YA 2EO9A 4YVUA 3CK0L 4XOCA 5AAWA 5IIEA 4LCIL 3FTVA 3X14B 1B4TA 4JGUA 3FB5B 2NNCA 3ISRA 3IE4A 1ZEAL 2EXWC 1BFSA 4GW4A 4PUBH 3BW9A 4JM2C 3LH2L 3SDXB 1QO3B 1SDYA 2BRRL 1BM7A 1RK1B 4G7YL 2DD8H 4OF8A 4DTGH 1SHWA 3FUKA 3GFUA 4NJAL 3AJ7A 3QR1A 4AM0A 1IVLA 2BVEA 3GMLB 1DP0A 5JORB 1K4DA 4NHCH 2R2HB 3H1ZA 4DKEL 3ZMNA 5GS1C 2Y2YA 2DWTA 3B9EA 5FXCH 3QORB 4KTGA 2NY4C 2V5MA 4JDVB 4UT6H 3LHPL 1CMOA 1RMFH 1NINA 1ZLSH 1JZFA 4PV1C 1LO0H 2GJRA 1MFCL 4X5PA 1N8ZB 4ODBD 1G6VK 4KI5D 5DJZB 3MRGB 3JZYA 3MXVL 2E7LC 3FB7A 4K55A 1CTMA 4S1QL 4O2CA 3QIUB 5ID0B 5ABZA 3HRZC 3EYVA 2J4WH 2GFBA 2JLPA 2BMKA 3WOVA 5K33A 4P2YA 3X3GH 4E2OA 5KBPA 2CLVB 4LHUG 2DQDH 3LIZL 3NJVA 1JWSB 4ZTEA 2EILB 2WAHA 1HYSD 3C5ZB 1QRNB 1UENA 5KVFH 1Z32X 3NSCA 1V3JA 2YSSA 2XFGB 2XICA 1YPZB 2Y0SA 5TFSH 1DJYA 4LL9A 3ABMB 5FECB 2MNWA 3TIDB 1DUZB 1YVLA 1A7RH 1AKPA 5E1AA 1O75A 1A21A 1P5UC 4IBLT 3QDJD 4JDEB 2VLMD 1UOVA 4LSPL 1QR4A 2APWA 5SV3A 2B1HH 4K7FB 2PWFA 1GGBL 4X4ME 1E5CA 3UJIH 2AS5M 1AO7B 2V7HA 3B8SA 5D2LF 1R19A 2NY3C 1K72A 3NFNB 2JJSA 2ERJC 3RKDC 3RY5A 2N1KA 5F0PB 4NKMB 1AJ7H 2R56H 4L4VD 5DT1H 2GG1A 3IKCA 3V10A 3F7LA 4OKVB 4Q9QH 2X4TB 2OMNA 4AI7A 4JG5A 2E46A 2R4RL 5CJOH 3ESNA 1J5OL 1IAOA 1HNYA 2WM0A 2PWEA 4DKAA 5ESAB 4F24A 4FXLA 3VMNA 2LU3A 3BUIA 4OZGE 4GPVA 4XBEL 3VFGL 4YHKH 5TQ2H 4JM2A 2O5XL 4RAUB 5SWSE 1UWXH 1IC4H 3MOAL 4TLKA 1SXBA 2F1EA 4YXLH 3NZ8A 2PW1A 4X4MA 2NT1A 3MRMB 3MNDA 4W9DC 4WI0B 1OAXL 2Z4TA 4LEXL 4FN0A 3A67L 4I5BA 5BMFL 4MNGE 4PJDE 4DZBB 5GS1A 1A3RH 4JL1A 2XX1A 2KZWA 3NA4A 2OMZB 4B9GA 5I75B 2OXHA 3EFOA 3NJFA 4OY9A 4XC1L 3ZDZE 5E9DE 3GMNA 3TWCH 3FCGA 4L9DA 1JVKA 4AEHL 2E7LA 4K7PH 4DF9A 1PX3A 3U83A 1DJGA 2EYTA 1FFRA 4OZGA 3HRZA 4Z3TA 1AZRA 1HILA 1M7DA 4RGNB 2JIXB 5SWSA 3N9GL 4Q9RH 2VT0A 5F7UA 1W6WA 3VWKD 3C09B 4XPTL 1MJUL 1KLFA 4JHAL 4X4KA 5DYOB 4KJWC 3JQOB 3SYAA 3GRWH 3N40F 1S7XB 2IMMA 2HJKA 4PJ7B 3D9AH 3LQAL 2V7NA 3L3GB 1DJSA 3D5OF 15C8H 3TCXA 3UTPD 1E9PA 3MLTA 3QUXB 2GK0A 3SE6A 4MXWL 5E9DA 2OMUA 5AYQA 2RA1A 2DI8A 1P5UA 2P47B 2F7QA 3AT8A 2BCKA 1NA8A 3GI9L 3TT3H 1LLAA 1A5FH 1I75A 5D1XE 3K8LA 2JKJA 1R24B 3ZPDA 1YEIH 1KCRL 3AG3B 1CPUA 4JZJB 3ARGC 4KZDH 3OX8B 1TVDA 2ZQKA 3NH7H 2W38A 5DURB 5TE6H 1T21B 2DY2A 1L9PA 1IQDA 3WLWC 2PYFB 4X98B 3HZKB 1COBA 3S36L 3SJVB 1LO5A 2QQLH 1DBKL 1GYCA 1NL0H 2UVFA 2NSXA 2XYBA 2WKOA 2D2CC 4UOZA 4ZMQA 2PR9A 5KSBF 1B4JH 1X7TA 4ZFZA 4X8JA 1SLVA 1U8LB 1VACB 5B38B 5C0GB 4PG2C 1T83C 4Y4FD 4PMFA 2K7QA 3RJOA 3GO1H 2ATPB 4PB9L 2FL5B 3I3DA 3NSYA 3QC5X 1R3JA 5B21A 5SWQA 1KTLB 4JFDB 2ZCHL 4FLHA 2AJYL 3LNEA 2C9QA 4NFBA 1XEDA 4XZUA 1K9TA 1F8TH 2FX8L 2VE6A 4KI5C 4NWUL 3EYQD 4RAHA 3II1A 5F9JB 3BRDA 2CRZA 1QEXA 2Z93A 3EW3B 2XJKA 3LKNA 1FL3B 1SN2A 4NPYA 3KYOA 3CHSA 2P80D 3MLRH 1E7UA 1MCLA 3LXCA 1YEWA 1BOYA 1WVZA 4IGBD 2OSWA 4KUZL 2WLLB 3RNQA 3JT2A 2XKNA 4G6FD 3SPJA 1TZHA 5K9QI 1HYSC 4YZWA 4DHLA 1H8NA 2BP3A 5D2NB 2X7LA 1QTPA 4BE6A 4N8PA 3VCLA 1TSRA 5EBMB 1EEQA 4JE0A 5CHNA 4AXWA 5KVEH 5F0JB 5FYKH 1NMAL 1E2VA 4JDTL 4JRXD 5HI5D 3C5SA 4EXKA 2VWEC 4ZO7A 4DP9X 3GIZH 5DJYA 4GXUM 2WXIA 3EOBB 5EEVA 3OF6D 5BRZD 3QZWA 5HTSA 2VLJD 2O6PA 4H88H 4HOMA 4W9GC 4J3OG 5CGYD 5DGRA 3IDGA 2GK2A 3D51A 2OZ4A 4N8CL 2V5RA 1BFTA 4MQ7A 1QUPA 2WBJD 3P0YL 3QWOA 3QZMA 1OCCB 4MCZB 1C16B 3ARGA 4FNLH 4J3WA 3ARQA 3ZBMA 1ID5I 4KUCD 1DVSA 3MRNA 4KI5E 2RAMA 1RP9A 3ULVL 1O9ZA 4HULB 1I53A 2JK5B 2VDQL 2VABA 1AFVL 2WSPA 4IIQC 2ED6A 4DN4L 7TAAA 1KB5A 1RJYB 1FQ9C 4XB7A 3F5WB 4Z3FA 2GY7B 4PG2A 1T83A 3ULUL 1GGTA 3SODB 3AQYA 1PZUB 4OIAA 3F7KA 2VXQH 2Y5TA 3QXDA 3TP4A 4N2LA 1UA6H 1J8HD 1H8LA 3PYCA 4YX2L 3GSOB 2Y22A 4ZUVB 4DEPC 3SGDH 2RD0A 4NUGL 3HZMA 4ANWA 1U8CB 1OCRB 4B60A 2V17L 1I31A 2UX7A 5KTEL 1RFDH 2HKHL 3AC0A 3KM2A 4F15C 1IBYA 2WXNA 4JKPL 3QDJE 3C08H 2VLME 3FT3A 3NP4A 2P5EB 2ZXBA 3QBTB 3J07A 1E65A 1K6QH 4IMKC 4W9LC 2ZKYA 1EANA 3K0YA 3RGVD 3W39B 1ADQA 3GLZA 2WXHA 3VWKC 3VH8G 4XE5B 4YMPA 1F90H 1U4FA 4OI9A 1Z9SB 4L4VE 4HEPA 3E0GA 4CSSA 2OMVB 4ZAKD 4WUUB 3UJTL 3RWJB 1N12A 4UINL 4HIHA 4Q14A 4ZW7A 1MAJA 3SKMB 5B8CB 3BUYB 2DDQL 2APXA 1P4BH 4QTHA 3O3BA 4FQQB 4MJ5B 2J44A 4U3SB 4HZLB 2XTJD 3QDJA 3R1GL 1WP6A 2AJXL 1HJBC 1INDL 1C5CH 1DFBL 1QA9B 4NCC2 5CLZA 1AGEB 3O4LB 2WQWA 4X7DC 1OSPH 3FQRB 1JS4A 2N01B 2BY3A 3VM7A 2XA8L 1BV8A 2CR0A 5IQ9B 5JIPA 5L88L 3RG1C 4YSAA 4L4VA 2YFNA 2AK1L 1J9RA 1I7TA 4HG4K 1KNOA 4HH8A 1LE5A 2F61A 4F27A 3KBFA 1DJHA 4KXAA 4QGYA 3L5HA 3LRLA 3DNKA 1VEOA 3O0RH 4LU5L 4Y2NA 5TF1H 4I1NB 4EI5B 3GLEA 4TVUA 1CD8A 4Y4FC 4IIQA 3U9UB 2H26B 1P69B 4XZ4A 4MCYA 1I7UB 3LXUX 5I1LA 3BDYL 1U8QB 1KENH 3EO9L 2Z92A 5DUML 1FZJB 4LSTH 4N86A 4P8QA 5F97E 2NSMA 1FVEB 5TPWL 4XOBA 5H37G 1FO0H 5E5UB 1SYVB 4TQEL 4DQOH 2AV1B 1WC7A 2VXSL 5D8JH 3EHBB 2QR0B 3EYQC 4RWYL 4Z3GA 4WGVB 2TSAA 5LGJA 12E8L 1BXXA 1JGUL 2G30A 1Y0LA 3ESUF 1G7HB 5D7KD 1U58B 2DQCH 3ZR5A 5HVFB 3UTPE 2DBLH 3CN1A 4OLYL 4Z3JA 4MJ6A 4GRLD 4X4XB 4X8CA 5EZLA 5F7DB 4G6KL 1AXTH 3FTYA 4I3GA 3MOBH 5F1KC 5I19H 1SEQL 3HR5B 4IGBC 4WFHD 2B9BA 1EVTC 1F97A 3AU1B 1KYFA 4IMKA 3D52A 5H94B 5I1JL 1J5IA 1ET8A 2W9EL 5DZAA 4DKFL 5LXGH 2ICEB 2FWSA 1J0IA 3VWKA 5HDLA 1OTSD 1PTZA 3KEDA 4JN2A 5EU3B 5DQDH 4EJ1C 5BCAA 4TRPL 3JWOC 4BZYA 2FHBA 3B2VH 1LD9B 2FBJL 5DCCA 1MVUA 2ROXA 5HI5C 3WNKA 2Z3FA 4RWHA 3AM8A 4ZPVA 5J3HD 1MF2H 1P0SE 2ZOLB 2VDPH 5FHAL 4XNXL 1F4XL 2AVGA 3EOYG 2PTUA 1HINH 2JI1A 2IFFL 4ODTH 1VPOH 4P5TD 4JPIB 4LCCB 1ZAGA 4ZD3L 4HUKB 3UZQA 4Y2OA 3F7RA 3IMBA 1AHWB 1B3IA 1FIGL 4M5YL 4OBRA 4PP1D 2WBJC 4WEMB 2SEBB 4LRNH 4QCIB 2XWZA 2WVUA 3SDCD 1USQA 2QMKA 5E94A 5E1QA 4URKA 3WTXA 1CXFA 2R59A 1FG2B 4N0FA 1AKJB 2EDEA 4QRQA 4PBXA 4MAUH 3E80A 4N2AA 2OW7A 4NOFA 4QF1A 2WWNA 4XO3A 4J3OH 2X70B 1JRHI 3OWRA 4G70B 1H5BB 5C9KA 3L3OB 1CDHA 4MQXD 4Y4FA 1OAZL 4PJIB 5BQDA 3ABZA 2BX5A 4ISVA 1EV2E 3UIZA 4X5LA 5AVSB 4MMXC 4U3CA 3WUZA 3KLDA 2Q10A 1TTBA 3LVEA 2NTSP 4P4KB 4PCYA 4PWIA 5I73C 3BKMH 4PRNB 5AB1A 1NCWL 1T1WB 1YCSA 2X53A 5MP6H 3UMTA 1J7VR 3F7YB 4AYDC 3GDBA 2F08A 5CEYA 1ZKAA 4JRXE 3NEOA 1G1YA 4H0IA 2VXUH 2FB4L 3VG9B 4XNMB 4O51B 3VXUD 5AYUH 1X7QA 1ORSA 1R17A 4P2CG 4Y9CA 5BRZE 1T1XA 2P80A 2XACC 3EYOB 1RJZB 4XP6H 3RGVC 1HQRA 2VLJE 1LK3H 3IXAA 1L5GA 4IGBA 2QADD 3H9HB 1FGVH 1MHEA 4AEEA 4LBEB 2Q8AL 2BDNH 2ENPA 2IH9A 5JPMB 4ZAKC 5DD5H 1FF5A 2I07B 3NFSL 5I1AB 1I7ZB 1A6TA 3DOSA 3GMOB 32C2B 3GXMA 5BVJB 4D0BA 1LGVA 1T3FB 4JRYD 2NZ1A 2BP0B 4JRXA 5EEXA 4FQIL 2XG5A 3SGEI 4IEFA 3QZLA 4FERA 1CLCA 2VAAB 3LKRA 3CSYA 2HA1A 3OF6A 3ESPA 2GY5A 3LAFA 3NDZE 4FQHB 4PBWD 1D6EA 2D03L 5BRZA 3SCMB 1EK3A 2VLJA 3L4XA 3APMA 3CFCL 1EHLL 2BP8A 3HNVH 4OM1L 3EYSL 1OOWA 4D0DB 1J8HE 4JG1L 3VGGA 4I0PD 1ET7A 2OMWA 4N3UA 1R3KA 2WBJA 3WNIA 4F93B 2BNQD 2CUIA 3PAYA 4DVRH 3CVHB 4ONGH 3PHOA 5KBKA 1XF3A 4OZIF 4ODUA 1ZOXA 2WXRA 2AERT 1DQIA 2NTFB 1ZGLM 3DROB 5BXFB 3HCVA 1R75A 4V2CB 2VSDA 4KMQA 1WSST 1CB4A 4XMZA 2N56A 4NKIL 3I50L 3I6GB 1MJJA 2WBXA 4U1LB 2BOBB 1NFDE 2Y2WA 3LNGA 2H1PH 3UBFA 5JHAA 2GIYA 2DWSA 1V5JA 1J8HA 4JFOB 4MMXA 1BBJB 3CLEL 1J9QA 4HKXA 5B7MA 3TVMD 1Z0MA 5DUPL 1C5BL 2GEQA 2ICCA 4HKBA 1KT2B 2LU4A 4FOMA 4GAYA 2GTZB 3WEBA 2V2TA 5AEAA 1A2YA 4S0HA 2VIRA 4XX1G 3DOHA 4RNRB 5KJ7E 4PRHD 2JJTC 2MOVA 2H47C 3HJEA 3UYRH 5K9OA 4HIIB 4UDUB 4FA8A 2C1OB 3UYPA 4GRLC 3HC0A 3O6FC 2XTJE 3NP3A 2AP2A 3QEQD 3B7UX 2GUOA 5F7EH 5H37H 3N40P 3BE1L 4ZO8A 3E6HA 2EDMA 2ZX6A 3PQYD 3RGVA 1C08A 2N0KA 3QUHA 1ZIAA 3WFHA 3DYOA 1NFDA 5DLLA 2Y7NA 4LIQH 3ILQD 5C0DA 2WXGA 1KIPB 3D8MA 1ZV9A 5GJTH 2YMXH 1R3HA 2GT9B 3FSZA 4ZAKA 2L4OA 1NLBL 5F21B 5HYSG 2VQ4A 2WJ7A 3QUMB 6FABH 2V9QA 2BHFA 3A47A 2I60L 5J3HC 1A1MA 5IHZA 3TH3T 4JFEB 3FRUB 1ZJAA 1QLEB 1UVQB 4TVPD 2GTQA 1OEZW 3NJHA 3ECBA 1KPVB 3V5KB 4YSEA 1PYWB 2ESVB 5IFAL 1UA7A 4K3DL 4PP1C 3WO4C 2XQ0A 2FYYB 1JF6A 1FHGA 3C9NB 3HUJF 2ARWA 3CSPA 3SDCC 4B7LA 3ARBD 1KFAH 1AOZA 4JUTA 2NZ9D 5DTFB 4PJHE 1NLDH 2JCCE 4NNYA 1BFOB 4GSUA 5K39B 3SKOB 4OZFA 4K5LA 1JPFA 5D7KE 1IC7H 2H6OA 4NQED 4NC1C 3IJEA 2GC7C 2PPCA 3TA3D 4S2SB 3O3AB 1A7NH 4MQXC 2CLZA 3ZW3A 4GT0A 1F6AB 3VX1A 4WFHE 5H4ZA 1XAKA 3LKQB 1KYOK 4EZJA 3O11B 3KJ4C 2EDXA 3B2UD 4AUYA 1IEAA 4ADJA 3VGHA 4JCMA 4LNRA 3EUUA 2XKUA 1SMAA 1YMMB 3L7FA 3MODH 1U2HA 4GKNB 5E8EB 4YSUA 2BP5M 3LPPA 4F37F 5C6TL 3MJ8A 4M6MH 1TTAA 2AK4B 3L9YA 3AUVA 3DGDA 3U0WH 5E2UH 2XXMB 2ITFA 4PIRF 1HK6A 4PJHA 4U2YA 5HHMD 3SGJC 5KS9F 4LOVA 3V8OA 2YMOA 1RSFA 4LL4A 2JJTA 2AQPA 3KPNA 3ZQWA 4GRLA 4EKXA 3O6FA 1SXNA 1UACL 4ZZFA 2ZXCA 4Z7OE 4K71C 4IOSD 1YG9A 1RUAL 1CLZH 3H8NA 5C0CB 2QADC 3WMPA 2EDWA 2WC7A 4XOAA 2ZKHH 5JHDB 2NY5L 4JEGB 3R7RA 4YXHH 2AXGB 3O6KL 1OD7A 1FH5H 2EE6A 3EJRA 1A4KB 4QWWD 4X6DA 4DVBA 3R8BB 5DJCB 5EEUA 4Z78A 3NZHL 1UB5B 2ZSVB 1S9YA 4NC1E 2XIBA 4FJ6A 4KK9D 2IC2A 3EG9A 4XC3H 4A1RA 1BPLB 1Y18A 3ZSSA 1HCYA 3QYCA 3QFJB 4NAQA 4YO0B 4IBZA 4KY2A 3H2QA 4BQBA 1SN0A 1GS6X 4P5TA 2FEDC 2HJFA 4WJ5B 4YHPA 1ONQA 4JFQB 4WV1C 1GCYA 4ILDA 2GI7A 3X12B 3T8XB 3U4BH 4N2CA 1X4XA 3KLHD 1XWVA 1IV8A 1AP2A 3SDCA 5CCKL 5E1HB 4IOFD 5H2BB 3BKYH 4N26A 4LASH 4K7PY 2Q1EA 2DI7A 1D7DA 3VXUE 1TDQA 3QO0A 5IBTL 3QEHA 5BZXA 1MWOA 3LKSA 3UBHA 1GJUA 3QJFB 1JYNA 4RSVA 2ZWNA 2J20A 4JFFD 1EO8L 1YEEH 2DH3A 4MDRA 3ZT7A 3BZFA 4LLMB 4M61A 4NO0D 2YC1B 3KCPB 3A6OA 5BVPL 1IAIM 3LPGA 5BW7C 2MRYA 2Y3NA 3DJZA 3FU0A 4MNQD 3U6RB 1IAII 3CMGA 3VXOA 2Q7YB 2CNZA 3H54A 3TBTA 1JYXA 4XCEB 2J3SA 3S4SA 1CBVH 1SVBA 4FQXD 2B39A 2UX6A 3NJKA 2LT9A 3CSFA 2WSKA 4WU5A 1B0RB 5GSVA 1S78D 3SGJA 4JRYE 4MA8L 4M48L 1ZJBA 4CADB 2BZDA 3PGDA 4RIRA 3VXUA 1H19A 4PH8A 4H1LG 1FH2A 3PJSB 3D85B 4J3OF 3T3ME 3C60C 1A7PH 2IDQA 1XGRA 2JELL 3OGCA 4DP4X 1MFDL 1TJIH 4XHJD 3OHXB 3ILQC 2AGJH 5DZVA 4O9HH 4LT7A 4WTZA 4AE0A 4U31A 1NAMH 2YA1A 3BPOC 5CUSH 4NT6A 4OF3A 4XPHL 3WJLC 1RPUA 1FFOA 3HS8A 2HFGH 1UXWA 1ZXQA 3CXHJ 4F2MA 1PEZA 3M1BB 2XKSA 3EAKA 5E2VL 2IBBA 1CK0L 3MGOB 4JRYA 5GZNC 3TS8A 3FQTA 1DQQA 2BJMH 1BQKA 3RWCB 3UZEC 3VFUB 1N10A 4Q0XH 5EORL 4J2XA 2VZ3A 1XX9C 2YK1L 3AS0A 3PHQB 3BZEA 2DKUA 1D9KB 3G7TA 3KXFA 3CVCA 5I82A 5TDNA 2FZ3B 1KPRB 3L81A 1MWAA 2ZXAA 1A0QL 1CFQB 1Y07A 4WV1A 5DJXB 3ARBC 4ALAC 5C3LD 4DH2A 4I0PA 2QKIC 2NZ9C 2CK0L 4TNGA 1ZA6A 3SE8H 5FW8A 1FL5A 2BNQA 4Y2DD 5DDHA 3RDJA 3NIFB 3I75A 4PRHE 3RI5K 3ISWA 4QNPF 3QNZB 4E9RA 4EN3C 1A3QA 5CBEB 3CVHL 3S35X 1W72A 3HS9A 3KWWB 3QEQE 2A99A 4M6NH 4HIXL 3PQYE 3B2UC 5I1IH 1HZKA 2YAEA 2QFPA 3DXAD 2BO0A 4KX8A 4O5LH 1AHKA 2YAMA 4RISL 5HI4D 4DCQB 5FWQA 5I74B 4JZOB 4PY7B 2FQDA 2OFQA 3IBEA 5BW7A 4LEOA 1SQ2N 4FQLH 4AKPA 1Q90A 2VOTA 3TVMA 3QFGA 1DYZA 3KEHA 2VQ1B 4Z18A 4HH9B 4PRHA 1BW8A 1I3RB 1SJEA 5F0MB 3S3CB 2WK2A 1KGYE 2E7MA 3KWTA 2JKXA 5D7IE 4TVPE 3GSRB 4XN9A 3FOMB 2UVEA 1WK0A 3QEQA 2VNCA 4OT1H 4XB3A 4RMSA 4HOWA 4X5RA 5I1CL 4KQ4L 1QUNA 3JWNG 3PQYA 1HQ4A 1ZHKA 1VADA 3KGRA 5LWYH 5D6CB 3KPOA 2F68X 2HWZL 5GGTL 4NQCB 3UC0H 5KYYA 3FQ1A 4QWWC 2OMTA 1F1AA 4W9ZA 3K72A 4TSBL 5CGMA 3REVB 3WJLA 4NQEE 3CDGA 4KK9C 3VI3F 1DN2A 3GK8H 4G7VL 1YLBB 2M26A 3FCTB 3QUML 2A73B 1B9KA 5D7IA 1XF5B 3UBXI 1L9SA 5AFAA 3EOTH 5EF3A 3UZEA 1UZ8B 2BIIA 5F6IC 3ZRSA 4C4KT 1QLEL 1YNKL 3F6JA 1FV1A 2E9WA 5LUMA 2Z1PA 1SY6A 1CT8A 5CU5A 3KLHC 4XP5L 5A2BA 4TV3A 4JK0D 1T89C 3ARBA 3P4LA 1B2WL 4IOFC 1FGNH 2QKIA 2WINA 1MQKL 3NIDB 4U4IA 5HHME 2CAKA 5KANG 5KYWA 2AI0L 3MLWL 2P8PB 1HWWA 1OPGH 2H0JA 5KZCB 4MDJA 1OE1A 2CXKA 3NCXA 4AYMC 1F2XK 1DANT 4X6CF 3FO9B 1S9KC 2XQYA 1KJ2B 3KGSA 4BYHA 2Z0UA 3GDCA 4EN3A 3TA3A 1MHHB 1WGOA 1LQSR 3MRFB 3VXMD 3KPRB 4IRSD 3HJ0A 3BGFC 3V0FA 1IFRA 4AQZA 3AFLA 4G8FA 1CD1B 1YY9D 2J1WA 4Z76A 2MCPH 5B39G 5JPNB 1AQHA 2PP8A 3IMVA 2IDUA 2NZIA 5F7MC 2DIBA 2D8KA 3GS4A 4FQXC 3RPKA 2HLAB 4EUPA 1C8PA 4LP8A 3O6LH 5BPPA 1S78C 3L5IA 3VI4F 3CZEA 1DE4B 1T1ZB 3T0AA 3DBXA 1EJOL 3MX0B 1DZ0A 1YDPA 4QHKI 2WUBL 4OFVA 2UZIL 1T22B 3OG4B 1WD9A 2IGFH 2A9DA 4IOSA 2JQMA 1TLKA 4QRPA 3ZE1B 4XHJC 3BSHA 3H9YA 3M45A 5ESVB 3FS9A 4ZFOA 2BPBA 3F7VA 3WTSA 1V3LA 1D5BA 1KY7A 1KJ3L 3V7AG 1KIQA 1EFXD 4X6FA 3ZRFC 2IDCA 5EZJB 1JHLL 1ZTXE 1JPGA 4GSDH 5ICXA 1BGXL 3HZYA 4H1LH 1KBGH 4W4OA 5ANME 4Y16B 5DJ8A 1Q0EA 3RFZC 4DP7X 2EDOA 2FECL 4L3EB 1QSFB 1L6XA 5DR5L 4Q9BA 5C2UB 3M88A 2GJJA 5GGUB 4RGOH 3QHFH 2ZSWB 4GRWH 3V9FA 3DO7A 3MRIB 3KPPB 4EVNB 5BZWB 1CWVA 5FB8B 1X44A 1IAKA 4AVKA 4MNQE 3GHBH 4G11A 5EC1B 3QJXA 2NY1B 4GAAA 4Y9BA 5IHBA 7PAZA 4KJYA 3LH8A 5J9PB 1DVUA 5C0EB 3APNA 2Z7WA 4YDZA 5I6XB 1N2RA 3WBDA 1T89A 4Y2DC 1A6UL 3QS3A 4OZHE 2XV6B 4BE5A 3D25B 2NLJB 1JGDA 4KXZI 4NDMB 4E9XA 5ANMA 3OMNB 5CIPA 5ANHA 2OS7A 1WO2A 2GSGA 1KEML 3B7SA 2HN7A 2VLRD 4Q52A 2Y72A 2F54D 3BEWB 4MASA 2V2XB 3ZSTA 4JFFA 4WK2B 2PYED 4LSUH 5HI4C 4NO0A 3APCA 4TSCH 1MW3A 2ED7A 1MEXH 3BIBX 4MNQA 1XCQA 4HS6A 2D7TL 4B9FA 3LN4B 2CBTA 5D70H 3H3PH 2Y7MA 3CSTA 4OIIH 2B59A 1ZLDA 3T09A 4PJ9B 2DWXA 3QH3A 1Q4NX 4PN6A 1L7TH 4FQXA 4OZHA 2W59A 5C0AB 4HJSA 1ND0A 3KLQA 5T3ZL 3DI2B 2P5WD 1J9CT 1U4EA 2J1ZA 1ED3A 5LCVA 1UADC 5JIKA 3L54A 3WEOA 4UB0H 1UM6L 1YNTF 1CF8L 5F88A 1B0WA 4OR1A 4IRZA 1CDCA 4O00A 1NGPH 2GJZB 1KF9B 4PRID 4AYBA 4ZPTA 3PL6B 5GRJL 5LG1A 4G7SB 3N04A 2X10A 3Q06A 1FAIL 1IBGH 5DHYB 3EJQA 4ZXBC 3B7YA 2DQHH 3OGOE 3KHOA 3EO0B 4TF4A 4XWGH 4PQXA 1D5ZA 1P7KA 3CMOH 3SKUD 3JWNH 1DVTA 2RALA 1G7QA 4F8QA 4JR9H 2Y69B 4JO2H 4M3HA 5I5IA 1DVZA 3BXNB 3FTXA 1MRDL 5TE7L 5ISZD 4FNRA 2EO7A 1K8IA 4ZMXA 2EEDA 2XWDA 3GZKA 3SQOL 4B0MM 4XMTA 4HIEB 4OD3H 1MVYA 3DXAE 2DQJH 2EAEA 3W5MA 1TJHH 2AMUA 5IT2L 4OCXH 3PP4H 3V5DB 2GBUA 2GAZA 3BSZH 4GG6B 1NC2D 4AIEA 1UD2A 1HH9B 2EH8L 3P73B 3U9PH 5E5MB 4IU2A 3V4VA 4HWBA 3GINA 4Y2DA 3MA9L 1MY5A 1FYTB 2Y07L 1S9WA 2AF2A 4HQQL 3QW9A 3CVIH 1TU2B 1E4WL 4R2GB 2WO2B 1GZQB 1F6FB 1SHMA 4NNXB 3K6IA 1M6UA 2C4XA 1U8HA 5AOMA 4ODSH 2DL9A 2CPCA 4KV5F 4PS3A 2OTUA 3SKNA 4GQPH 1I9RL 1YAZA 4IRSC 3TV3H 4N85A 2H6PA 1S6NA 5G5DB 1NKOA 1O9VA 1YY9C 3H42H 1GTNA 3DXAA 1DR9A 5JHMA 1U95A 5EG6C 1ACXA 2J5LC 2XZCL 2YKKA 4AC4A 4TNVK 4D9LL 1LDPL 5C9JA 5KG9A 3FZUD 4NZUH 3GGWB 2VLLA 2C3XA 1XR9A 1JK8A 1RHHA 3B2MA 2A6KA 1JHKH 5E4EC 1SLUA 1TQVA 1WBZA 4L9LB 4P9HL 2R0LH 5I0VA 7PCYA 4CMHC 2AVFA 1YUKB 3MRLB 5GHWH 4E41D 3MRKA 4X6EA 1SHSA 1S8DB 3KPMB 4YL4A 3WDIA 2VUKA 3V6FB 3FF8A 3JWDH 3S2CA 3EJZD 3DPBA 4M5ZL 1Q9OA 5HPMA 3N41B 3MNZA 1ZT1B 3HG1B 3ML8A 4N1EA 5IBUG 4WKXA 4DFIA 4CN4A 4EDXB 4LSQH 1FFTB 1RZKC 3WL9B 2IBZY 5I5JA 2CKBH 4XN7A 2XQYK 3M8OL 3QXWA 3F12A 5F9WC 3WDJA 2H2PD 2JKIS 3A22A 3S8FB 4GLRI 4NENB 4LCIH 4OI8A 1GSKA 5EIIG 3LN9A 4OD1L 1CQKA 1DZBA 1OHZA 2DLFL 3VXME 1ZEAH 3FOLB 4DPAX 2QQQA 4RFNC 3LH2H 4AQEB 4WWKD 2DEYX 4G7YH 4A37A 1A14L 1FE8L 4NJAH 1QZ1A 2W9LA 3B4NA 3MO1A 1I85C 3OB0K 4WO4B 1HHHA 5I1HL 5C7XL 5J11C 4DKEH 1MCEA 3GSWB 3H9SB 1WYJA 4KNTA 2NY2C 4PJCB 3ZKSD 1JN6B 5KOVC 4HCIA 3LHPH 4UU9A 4B9PA 4OZ4A 1U92B 3ULSA 2NXYB 3HG2A 5HJBA 3TBYA 3LPWA 4PGCA 3LH9A 3K2KA 3BI9X 3MXVH 3UMNA 5FYJL 5DS8B 3C2SA 2QSVA 4QHNB 3SKJL 1HVXA 3CVDA 4LEEA 5GRUL 1BD2D 3VXMA 5KSBE 4IRSA 1T0MA 2EKSB 4JO8A 5A16A 3Q5YA 4LLUA 5KVDL 3FU5A 4AV4A 3MLUL 4MB5A 3LIZH 4UWQB 4OF0A 1CBJA 4I18C 5LVEA 2XVGA 4PRBA 1CXHA 2DQEL 5DUBA 4U6VL 4X0KB 5BJTB 1GYWA 2D3LA 4JY6A 3OMAB 4BA8A 3KPSD 1T6WA 4YK4B 2CIKA 1WS8A 2KZBA 5AOZA 2OKMA 4HVBA 3L95A 2R23A 3PWUA 2MWCA 4OFDA 4K4KA 1FZMB 2BSCA 4RRPA 4CGUB 5KSBA 3F58L 1GGBH 4BWUA 5DD0L 4ELMB 4FFTA 3X17A 1TT6A 1Z0NA 4HUVB 2IXQB 1YEJH 3CN2A 1A1NA 4TSAL 2KBGA 5AVUB 1EFXA 3GMRB 1ICTA 4G42A 4GFXA 4LKXB 4XNYL 2G3NA 4FZ8L 1VERA 1NC4D 1GGCL 2Z4QB 3G5ZB 2WCPA 1AD9A 5EBWA 1AIFA 3PWJB 1CGYA 1WAAE 3JVFC 4EF3A 3ZZQA 2R4RH 1YYCA 2PN5A 4MZ3A 1K4CB 3M6DA 1J5OH 2VLRE 4U1KA 5AALA 2F54E 4EIUA 4J28A 3V7MA 1JNNL 1EGJL 4PJAB 1ZT7A 3JTTA 2PYEE 1AGFB 4K8RD 2AQQA 3ETSA 4XBEH 3VFGH 1MDAA 4YDMA 1XGTA 2O5XH 2X4SB 4U1JA 3MOAH 4GXVL 4M1CD 1C9SA 4G8AC 3RL2A 4M93B 4GKSB 1YN7A 4MA1B 4UQ3A 2EC8A 4LEXH 2J56A 4NGHH 1T0NB 1I85A 3A67H 5TDPA 1L0QA 1MAKA 2DTSA 5BMFH 1UWGL 4KKCD 3HG5A 3DMMB 5HGHA 3N91A 1QEWB 1XD1A 5MEOB 1CL7L 5B3SB 3Q6FA 2P5PA 2YS4A 3MI6A 2P5WE 1Q9LA 2WGNB 3LEYL 3Q8EA 4QXVA 4DQAA 1WAAA 4XC1H 5I5RA 1K85A 2VDRL 4RMQA 3POHA 3OJMB 4WNJA 3WTWA 2WXQA 4AEHH 2VLRA 3OSKA 4OCNC 2E3VA 2F54A 4I3RL 4H26A 4HJJH 3QWRD 4C56B 3S2AA 1RJLA 1JK9A 1P2CB 3N9GH 4PRIE 1FLTX 4CKVX 1CIDA 2F74B 5FYLL 4Y0GA 1X5HA 5BV7B 3SYCA 4JAMA 4NC0B 2XFXB 4AGMA 5DGQA 4I18A 4X9YA 1W0WB 1MJUH 4XGZA 3KL0A 1KTDA 4JHAH 5ALCL 2IO5A 3T3PB 2CBOA 3ILPA 4MRCA 1OM3L 5T33L 1PKQB 2OL3A 3JYBA 2D4FA 2EIBA 3KJ6L 3LQAH 1S5IH 2P5WA 4IJ3B 3V4UH 4AIZB 4ZUSB 2VJ0A 4LLWA 4MXWH 5ISZE 3S35H 1LP9F 1NKRA 4UF7C 1UOKA 1K8DB 3LJ3A 5DVPA 4UTBA 1KLGB 1WA0X 3CV5A 1C12A 1JV2A 2F5BL 2AXWA 3L17A 5IOPB 4ONHA 2VERA 3NG5A 5FYKD 2ZP8A 5I8EB 4MHHG 4UUJB 2A9NL 3SQBB 1KCRH 5SX4I 4XNZB 3T0ED 3PDOA 1JZHA 1QI3A 2E0PA 1XFPA 1TCRA 2H2PC 3GD1C 4J3XA 1P4UA 2ENYA 3K71B 3NJGA 2IBGA 2WLHA 5DZPA 5IW1B 2RBLA 2GEEA 3UDWC 4PJEE 1TTFA 4QJ4B 1WDAA 1WUNT 3IBOA 3OWEA 3STLB 1WGVA 2JXMA 3Q6GL 4R0LC 1R5WB 5MI0C 4FYTA 5KSVA 4OTXL 1OP5H 4TXVB 2ORBL 3DI3B 3FJTA 3U6XS 4PB9H 4WUKL 1GOGA 1J8RA 1QASA 3FQNA 3LKOA 4XCFL 5BUGA 4GUCA 4CC4C 2IAAC 1NC2A 2BK8A 1SOXA 3VSUA 4MA3B 5E24E 2AJYH 4FXGB 3LMJL 4FHJA 3TCLB 4CSPA 3VD7A 3OC5A 4NWUH 4E41E 5DQ9A 4POZD 3MOQA 4PJEA 3S3SA 1MCFA 1XGQB 1MW0A 4AENB 2WXPA 2CDEB 1E9QA 1UM5L 1IGJB 2VZUA 4UTCA 5ENWB 5KVFE 3VXQB 4EIBA 4CVUA 4GYBA 4Z3IA 1NSNL 2H7WA 3DVNB 2H0PA 2W92A 4M7LL 4B6ZA 4KUZH 2WCSA 1T04A 1RULL 4ATTA 1RZQA 2UZPA 2AJZB 2IFGA 4RX4D 5DLML 1A9EA 2GPZA 1HNFA 1NANH 3QXTA 4XPAL 4OI7A 1T7XA 4UAOC 2X5PA 3TYGH 3OR6A 1I8KB 4HJIA 1X3DA 1NMAH 4HZ1A 5LDSA 2R2EA 1WG3A 4JDTH 5IVXF 4ZMOA 2E8ZA 1BMZA 4P9MH 3ABKB 4AQ8C 5IW6B 3MBEB 2HVJB 3D0LB 1SXAA 4HV8B 5F7BA 4LCWD 4HD5A 5HVHB 3DX6B 1N18A 3SE3C 1IC5L 3MRRB 1LEGB 2R4SL 3R06A 4G8IB 3FT4A 5E70A 4Z7WF 3IE9A 4KHXL 2J6WA 4X7CC 4Z7UB 4AWJC 1CLVA 4CC1A 4KQ0A 4N8CH 4L1HA 5JW5A 2EYSB 3NK3A 1H0DB 3KYKL 1MCDA 3QAZC 4JO1H 2BS8A 3B2XA 4UT9A 5E9NA 2BIMA 5E4OA 5B38G 2A6IA 4AT6A 3PE9A 3SD2A 5J5EA 3ULVH 4PJGA 3UDWA 4YNYB 1HHJB 2WBWB 1H3PL 2G3XA 1MLCB 1MSPA 3PFQA 3CIAA 1AFVH 4K8RC 4NQTA 1BD2E 2R0KL 3MJ9H 1HHKA 4R0LA 3RBSA 2YA2A 4B53A 4O02B 4WWKA 4BWWA 4AJWA 1O9WA 4CNIA 3ULUH 1RZ7L 5DJAB 2IAMC 2YPKB 4ETQA 2H0EA 3W9EB 3FFCB 4IBYA 3P69A 2PO6D 4KKCC 4HS8L 5LNGA 4YX2H 2FYVA 3GSQB 2MPAL 5EULV 2NW3B 3MRJA 2EIKB 1ZTMA 4CC4A 5CEZL 5IB3A 4EZKA 4I1RA 5K9JL 1NBVH 2X05A 2EECA 2V17H 2X9ZA 3IGLA 4XN2A 5D1QB 3QT2A 5B1CA 2HKHH 2UXVA 2RQ8A 3NQKA 4PJ8B 2X6AA 2IMNA 2FIKA 2NCMA 4YFDB 1BD2A 5L7XL 3BUPA 2O6DA 3UP1A 2MNJB 1FVDA 3BPNB 5F8QC 3LZNA 4L0YA 4Q9CA 2IQ9L 2NX5D 4K15A 4FL4B 2NRDA 3AXLA 4D0CA 3IDIA 3BWUF 3G9AB 4MX7A 3UJTH 3U36B 1OZUA 3UX9B 2EYRA 1EXGA 3KPSA 1WBXB 2DDQH 2Q7AA 2ZYRA 1XH0A 4GP8B 3TBWA 4PP2B 2F0CA 4UZUA 3ZT5A 1TVBB 4OLVL 4JANA 1YHPA 5KJRL 1INDH 5ICUA 4AQ8A 5IIEB 1XH2A 3T6XA 3WKYA 2YEQA 2WMPA 3BD4A 2XWRA 4NSKB 4WSGA 5EC2A 3MN8A 4A2DA 4RZCB 3BWAA 5CCGE 3T0EC 4MJID 5L88H 2XA8H 3S3BB 1ILUA 5A2IH 4PJXF 5T1DL 1RK0A 4X0NA 4JMXA 2BVQB 3FT2B 3FSWA 1NC4A 4AM0B 4XCNA 2IIJA 2L0DA 1K4DB 4LSVL 4FABH 4A6YA 4YQXL 3F01A 3RWDB 1KN4L 1SXZA 1X5ZA 1LO3L 5CSGA 1EO5A 1H3GA 3RY6C 1G9NL 3UBGA 3VFTA 3BDYH 3EO9H 3I9AA 1INEL 5DUMH 1IB5A 4R4ND 2KI6A 2NYYD 4OGQC 4PRDB 5EA0L 4XVOA 1VB9A 5EO0A 4O2CB 1CVSC 2IAMA 4J3OD 2DTML 4K9EC 5TPWH 1TPXB 3EYVB 2GFBB 2VXSH 3IDJA 4M7KL 1J1OL 4RWYH 1JGUH 3AB0B 3FB6B 4POZC 3NPZB 3WKML 1REIA 3TFBA 2H4EA 3AXIA 4OLYH 1XF4A 2FNWA 4WW1A 4UI2A 2AJ3A 4OZIE 1B6UA 2VL4A 2YSSB 1BF8A 4U1HA 1HZLA 1M2OA 1RZFL 3CFJA 4QRRB 1SEQH 3QWRA 4PYHA 1WJ3A 5F1SA 2JH2A 5FYKE 5I1JH 2YXFA 2CE6A 1IIKA 2RCSL 3T0EE 4BQ6A 2JKRM 4G71B 1L7IL 4HISA 4XXCC 3GQFA 3IU4L 2XN2A 4P5SA 5BV7L 3ZDYE 3C6EA 1O5PA 3HB3C 4TRPH 1P6WA 2V7HB 2LFGA 3N1FC 1JAEA 2HT3D 2VW6A 5F9OL 2G5BA 3JXAA 3VSQA 3Q1EA 4AEIL 4F1SA 1EEYA 5F1NA 3IKCB 3WJJC 1MIML 5FHAH 2HX8A 4XNXH 2YRZA 4FFZA 3C6LD 2XQBL 3V52L 1TZOA 1WH0A 3WS3A 3EGSB 5M94B 4ZD3H 4MDIA 5HVWA 1FIGH 4M5YH 5KSAD 3QEUA 1S3KL 4MS6A 2C7FA 2WLMA 3H6JA 4IS6B 3EDFA 4EPSA 4BFEA 4YXKL 3T0EA 2Q86B 1A22B 4M9OA 2ITCA 3DHJA 1D7CA 2WNWA 3BUDA 2PW1B 3EF7A 2A9CA 3UZVA 4L5FE 3UTQA 1CQYA 5DVOA 1X5LA 5AENA 4DGVL 3WU1A 1F4HA 3H7BA 1PG7L 3A4EA 3DURA 4NZTH 3BO8B 5GS1B 1JWUB 2YLKA 3HE7D 4BBWA 5E2WL 2BZ7A 4P46B 2ZP9A 1OAZH 1OZTG 1XIWB 3RY6A 2CBQA 2OXHB 3EFOB 2MOQA 2OCFD 3GMNB 3VFVA 2FT8A 3KVQA 4EZMA 1B4RA 3WD5H 5ETUA 4WNSA 1R0AL 1DBJL 5FV2A 1JXGA 3HRZB 1EHKB 2J6EA 4LGRB 1HILB 5SWSB 2MPVA 1HAUA 3OKEA 3MNVA 2ZYIA 4AY0A 3VD9A 1L9OA 1KZQA 3ZTNH 4EN2A 1IJ9A 2EEXA 5L2KB 1K2DB 1XV8A 1KLFB 3CWGA 3RLSA 1HL9A 3QC6X 3D2UD 4G9FA 5GJSL 3LIUA 5EUKB 2HJKB 1NGWB 1PAZA 4BZ1L 4G83A 1QACA 5D5MF 2P9RA 4LMQI 2V3EA 3MLTB 1DLHA 2GK0B 4BFFA 5E9DB 2OMUB 3CBJB 3CDZA 4RX4A 2BVTA 3RWFA