5FYLL

Crystal structure at 3.7 a resolution of fully glycosylated hiv-1 clade a bg505 sosip.664 prefusion env trimer in complex with broadly neutralizing antibodies pgt122 and 35o22
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
210
structure length
210
Chain Sequence
APTFVSVAPGQTARITCGEESLGSRSVIWYQQRPGQAPSLIIYNNNDRPSGIPDRFSGSPGSTFGTTATLTITSVEAGDEADYYCHIWDSRRPTNWVFGEGTTLIVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords BG505 GP120 ENV ECTODOMAIN
publication title Trimeric HIV-1-Env Structures Define Glycan Shields from Clades A, B and G
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 33
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2016-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fylL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fylL01
4PJIF 4YC2B 1GC1H 1S7SA 5IVZB 4BJLA 3EDEA 5BMFH 4R0LB 5FYLL 4APQA 2Y5TA 3MBEB 1XGRB 3DSFL 3FHQA 1BJMA 1YC7A 1UKQA 3TP4A 4BZ1L 4CDHA 4Q7DA 1FO0L 3VU2A 4X5XB 5SX5K 1JE6A 5HSFA 3OGCB 2MKWA 2NY1D 2IC2A 4XBPA 1L0XA 2YC1B 3IKCB 3W11D 5A2FA 4OCRH 3MRDA 2YOCA 4N8VA 3SDDB 1X7QA 3JTSA 4F7EB 3B9EA 1EGJA 3EYFA 1ZT1A 4WHYH 1E27A 1M71A 5GGRY 4I3SL 5D1QD 2VZ3A 4JY6A 1U8QB 3KPNB 4YAQA 3RWDB 3VWKD 1A02N 4LVHB 3W5MA 1N3NB 3VXNB 5C1MB 5EU5A 3DMMA 2FL5A 1CICD 4NWUH 4G8FA 4ELMA 4HJ0D 1K4DA 1T04A 1X6NA 4OLVL 1FVDB 2VDQL 2VC2H 3MNVA 4NQTA 4C55A 1I1AA 4TULH 1D5XB 2B1HH 3L3DB 5F7NC 4O4YL 1NCDL 4UU9A 4YHZL 3NIGF 3PWLA 4YBQD 1T5WB 5ESQA 3IDXL 4MNGE 4MNGB 4LAJH 3S96A 3EO9L 5IM7B 3AM8C 1RFDL 1TQBB 4M6MH 3FCTB 4XH2A 5L2KD 2NY4B 3BJ91 2C1PB 5JIPA 1DSFH 4GS7C 2K9UA 4G6ML 1INQA 3KPSD 4K7PY 3BGAA 3L3HB 5F6IB 4X5LA 5GS3A 4YEFA 4ODWA 5EUOA 2EXYD 2ZSVB 4M7KH 1NSNH 4GAJL 3MLYH 1B90A 1NGYA 1G7QB 2WUCL 5EFIA 1A9EB 4OZIB 2OK0H 2CUIA 3DOSA 4KDWA 4G5ZH 5DWUL 5C09D 3DVIA 1I3RA 4X9FA 3C6SA 1LO5B 4HWUA 4Z7NE 1FHGA 3BKML 3S3JA 4PD4K 1HHHA 3SO5A 5IFJB 2FZ3A 4DWHA 5JIHA 5JNYA 4N0UE 1BBJA 1ORSB 3BISA 4N0UB 1Q9KB 2AAVA 4RZCB 3SQOL 1CTOA 3ARFA 3MNZA 3BZFB 3P4NA 2NY0D 3D69A 1RHHA 2DMCA 3CH1A 4JM2C 1CLYL 1DFBL 4JFQA 2GJ6E 3B8SA 5FYJH 1SYSB 3OAYK 2GJ6B 4HG4K 4HWNA 2YD4A 1GXEA 3DX8A 2RJMA 1CIUA 4GBXB 2P42B 2XG5A 3DIFB 1U8JB 4D0CA 4YC2C 3PABA 5DMIH 5FM5O 3SN6N 1FDLH 1P1ZB 5EO9A 4MA7L 5EZJA 4HBCH 1ZSDB 1C8PA 2O61B 1J05A 3MBEC 4PRHA 3TESA 4ZS6D 3TA3D 2IQAA 4OAWB 1B0GB 4PG2A 3B5HA 1T22B 4GW4A 3TZVB 1VDGA 4MD5B 2R1XB 3HR5A 3ARGD 3L3GA 1X3DA 3TEUA 3TNMB 3RWFB 1KTLA 4PGDA 4BQBA 2GI7A 4HEPG 1HWHB 5CEXA 2GTWB 1FNSL 4EN3D 1KYOJ 1A6ZA 4Y1AD 3Q0HA 5LGHH 3U0PA 2A6DA 2MPAL 4JRXE 3SCMD 1RJCA 1I4FA 1ZTXL 4NRYB 2BY2A 4JRXB 5DJAA 3G6DL 4M1GH 4O2FA 3BQUB 1KTDA 4JG0H 3L1OL 1NLDH 5FUOH 2W0FB 1F00I 4LVHC 2AK4D 4BQCA 1UWEH 4QXTB 4QRUB 4HS3B 5FM4A 1I7TB 1FCCA 5KVMC 3HMWL 4J8RB 3X12B 2H32H 1ROWA 2YPKB 4GO6B 2OTWA 2FO1A 4NT6A 1D5MA 1IGFH 1MCFA 2BVQA 1FFNB 2H8PA 1YN6A 3L3IA 1NLBL 3TBVB 2VO5A 1NBQA 3NCYS 2B7DT 5IEHA 5BZWA 4Z7UA 2NR6D 1TQBC 2HRPL 1FVCB 2NY4C 2AJXH 1YY8B 4P59H 2XTLA 4LLQB 5F6IC 1QRNE 5E8NB 4CNIB 1JFQH 1L9MA 1QRNB 4G6JL 3NGBC 4Z18A 5HI5C 2F53D 1NCNA 3WKMH 2Z9TA 5F1NB 4JDTL 3RVTC 2IPKB 3SE9L 1D6EB 3P9WB 1ZHKB 4W4NA 3HB3C 1QA9B 4FQ1H 5DT1L 1HHJB 4P5MB 4P4RA 4JQVC 1IGYA 1A3RL 2O5YH 1FJ1B 2DB8A 3NA9H 4WWKD 2NY5L 3LQMA 3LY6A 1UVQB 4UOJA 5C0RH 3MV9A 2AK1H 3DVNB 3MLZH 4XNYL 4CJ0A 2XWJA 2WP3O 1KGCD 1TFHA 4PJ9A 3GMQA 5BVPL 5GRXG 1FVEA 2G5BB 1YMHB 2NXYD 4G6AD 3IVKB 4WHYG 2YUVA 3QRFM 4E42A 5IB3B 1AHWB 2Y7QA 4DGVH 4WHDA 4P4KC 1D5BA 1ND0A 2FNBA 2EE6A 4LF3A 4GKSB 3L95B 3X17A 2EDYA 2XKUA 4RAUB 4YHLL 4RBPH 5IVNA 1G7MB 2BSSB 1NC4B 2X4OA 1C7SA 5HHQB 4R4ND 1AFVH 5D72L 1YEEH 3TZVC 2ADFL 2OL3H 1WEJL 1B4RA 5C9JA 4QTHB 1S9VA 1A4JB 1LO0H 3TLRA 4I0PB 2CJUH 5BS0E 4JN1H 3G5VA 1XGYL 3U79A 3V4UH 5BS0B 3L6FA 4IDJL 1AXIB 3BPNB 1JVKA 3RAJH 3ZTJH 5IJVA 4NJAH 3WIHA 3D39E 3WLWD 5JQHC 2DQTL 3D39B 1BFOB 3KG5A 1FRGH 6FABL 4IRZL 4F37F 5BZDB 3BQUC 4TOYL 1UKSA 1I3UA 3I3BA 1JPGB 4JKPL 3EFFB 4LFHD 5E1HB 1Z9MA 4OCWH 4ONOA 1FFOA 4C56E 4H1LH 3U46B 4C56B 2CH8A 3D48R 5HHOD 4AEHH 2QJDA 3CXHK 1C1EL 4HT1L 3T2QA 3TVMB 3OPZH 1U42A 4O02H 4XVUC 2VITB 4FQIL 2G60L 3MRMB 2RFXA 1CXIA 3K8LA 3IJYA 2EIEA 4O58H 5GSVA 2WW8A 4I0KA 1RIVL 2G2RA 2AJYL 1IKFH 4YXKL 1XGUA 4KVCH 4GAGH 4HHAA 1QLFA 3BHBA 2P5EE 1JTPA 2P5EB 3TJEH 3VXSB 1MFBH 1UFUA 4OI7A 5AWNL 5JW3L 2NLJB 3CLFL 3FQRA 2UV3A 4P2OD 2JCCF 5I75B 5FYJU 2YD2A 3QG6B 4BK4A 2VNCA 3KXFD 1WZ1L 1CFVH 4R97B 1T1XA 1GZPA 4HG4J 4OLWH 1FN4B 3PV6A 1MCQA 1MRDH 2OI9B 4N8CH 4P46D 5HYJE 5F7LB 3CFDA 2OJZH 3BGMB 5IFHL 4WUKH 2M8XA 3UTQB 2HT4D 4ZO8A 1KT2A 4K7PX 1A6PA 2WINB 4JKWA 2FBJL 4X6EB 2J5LB 1JCKA 5B3JE 2Q7YA 1FPTL 5D6CB 5C0IB 1HINH 2CKBH 4LHJB 3MJGX 3ZSTA 5DMKB 3V6FB 5ELIA 5E8DL 1WUNT 4MWFB 5DRXB 4P23D 5E0QA 5IP4A 5JHDA 3VXMA 2F5AL 4KROD 1DQQA 5ITBL 1DQDL 1JPST 3JV4B 5MERB 5I1GH 4PGBA 4PJFA 5KSUB 1LGVA 2F54D 3WO3B 1XIWB 4G3YH 3N1FC 1LEIA 3INUL 2D03H 3N0PB 5FGBC 5FO9B 4XPBH 2VDPH 3SPVA 5AD0B 3HPLA 5DQJA 3GK8H 5GGQH 3ARVA 3B2VL 4GOSA 2G9HB 4QO1A 4RFEB 3V4VL 1A7BA 4DKFL 5HGDA 1XGQB 2K1MA 3TBSB 2L7UA 4PJXE 1K85A 3UTSD 4HCRL 4WY7H 4PJXB 2O5ZL 4Q9BA 4N5ED 1RULH 1S78D 4N8PA 2ESVD 1OPGL 3VMNA 3ULVL 1NCBL 4D2NA 1G6RA 4RIRA 1M7IB 4KAQH 4J4PD 5FOBA 3M8OH 1CT8A 5IHUH 4HXBL 2LV4A 4GSDH 4GW5B 3P0YL 5F9WB 1J8HA 4U1MB 3DETD 4L4TE 2G5RA 3EOTL 4V1DD 2WUBL 4HC1L 3C5JB 2DQGH 3WEXB 1FYTA 1EO7A 2VDLH 5LCVL 1T66C 2JB6B 2HT2C 4PJCF 2Z35B 2VAAB 1CFNB 3QULA 1CGTA 25C8H 5D1XA 3UP1A 4FQJH 4QRTB 5GS1B 3REWA 4YXLH 3O2WH 2ATKA 3ARYA 3OKLB 2NQCA 5I75C 2X44D 4JFDE 2NY3D 5J06A 4NYLA 1IFHL 5MEQB 4KZDL 4JFDB 2F8VA 1OLZA 4LNVA 5D1ZA 1AGEB 1KIRB 4WUUE 4RX4A 2Z4QA 4RGMB 5IGXH 4R97C 3T4YB 4JO3H 4WUUB 4PJ7E 3UAJD 3UTTD 2BOBA 4Y16A 3QUXA 4OLZL 3RU8H 4NZTH 3BJLA 2DS4A 1IGCH 3ULVF 1JZ5A 3MRGB 1IT9H 5J1AB 5E2WH 1KB5B 2ITDB 1QO3B 2UZIL 3U2SB 3DO7B 3TCLB 1OTSC 5HJ3A 4GRWF 4JFYA 1FG2A 4CJ1A 5FA4B 4IRJC 5J13B 3D2UA 4LEXL 2P24B 4PGEA 5BW7A 5D9SB 3ZTJG 8FABA 3LHPH 2HJLB 4N0FB 3OV6A 3VGAC 3EDFA 1IAOB 4BFBD 2XQBH 1EUTA 4WEUD 4HMEA 2HMIC 1UEYA 5DJXB 2C3HA 2VXTL 3AY4C 1WBXB 2W0PA 1QLEH 4LSSL 5FFLA 1G9EA 3ROOB 4Z78B 2MQCA 5FO7B 3FFCA 3BYTA 1W0VB 1EV2E 1XIWC 1MEXL 1FZKB 4ZODA 3DV6A 5J3HD 1JNLL 4FXGB 4PREB 1MCOL 5EZOL 3N50A 1D3CA 1VACB 3MLTB 1QSEA 3CXHJ 3QFJB 1DVFD 1H9VA 1MVUA 2A74A 1H15A 3TO4B 5I30H 4FQHA 1HQ4B 1X5GA 4RFNB 1NCUA 3KYNA 1HI6A 3GRWH 1UZ6E 4FQXC 5DK2B 1EAJA 1JGVH 4TSBH 2XI9A 5DHVH 1ZV5A 3VFWB 4YQXL 8CGTA 1KTRL 1MUJA 3ZE1F 5MEOB 3VXRE 1QFUH 4MS8C 1K8DA 5GGSB 3VXRB 5E9DD 1E0OB 3BIAX 3RFZC 4HS8H 2I9LA 4LKCA 1VHPA 4DGIH 5ERWA 4UQ3B 1KCVL 3E6FB 3G6AA 4RAVB 2EYRA 3KNBA 4PJAF 4M7LT 3W0WE 2MTPA 1SJVA 3FQWB 2CLVA 5KSVB 5FYJE 4WO4A 3H2WA 3W0WB 2D7PA 3ZE0E 1NAMB 3TH3T 1UT9A 3HCVB 1KULA 3BN9C 4DTGL 1MREL 1Q1JL 2DTML 1U8IA 3O11B 3VE0A 3O6KL 1IARB 3CSBA 3ISWA 1INEL 4FZ8H 3BP4B 5GISL 1QBMH 1U8MB 3IAQA 4WTZG 5C08E 3ZYOA 4MJIB 1SY6L 5C08B 5JDJA 4LASL 5FUZL 3LH2H 1Q9LB 1RU9L 4RGMC 4J6RL 3CSYB 1ORQA 2VLKA 4I2XA 3GMMB 3UBXG 1T7YA 4HDIB 4RBPK 4HWBA 4PV8A 2J1KA 4XCNA 3QEGH 4MJ5A 5HPMB 1UM4H 4JAMA 5E8EB 1DQLL 1GL4B 1KEMH 1UACH 1ZGLA 3G04A 3GHEH 5EPMB 2DM4A 5DSCA 2EE9A 3D3VA 1T1YB 3P77B 5K9QI 3WIFA 1N5AA 3VH8G 2F5BH 2NMSA 4UQ2B 4Y89A 2VDNH 3ZT7A 2D0GA 1YUHA 5EH1A 3TNNA 1Z3GL 3VWKB 3QIUB 3EGSB 1VEOA 3QO0A 5EBMB 1KFAH 4YH6A 2DKSA 2CDEB 4C54A 4U6VL 2P8MB 4E0RB 4OZGE 2C3GA 1VERA 3PHQA 4O5LL 4HKBB 3G5ZA 4OFYD 1AE6L 3OJMB 1HH9A 1MNUL 1UJ3B 3HAEH 2DBLH 1KBGH 3IYLW 1ADQH 1MCIA 5F7YC 4H88H 4HJGA 7FABL 1LO4L 1CVRA 5C6TL 3UYPA 4EI5D 4XZUB 5KSAD 4PRIA 1FZJB 4DZBA 4RMQA 3QUZA 2DI8A 4KRNA 1U8LB 3KPSE 3VG0L 5CCKH 2ADJB 1ZT7B 1H8NA 1FGNL 4P3DA 1MCKA 1T0NB 4L4VD 1DJSA 4PJ5B 3F7VA 5IUSA 1OWWA 3MOAL 4OZ4B 3PWJB 2X1PA 4NQED 4WI7A 3KPLA 4KQ3L 3BI9X 1PX3A 5KN5A 1RZ7H 4KVNL 4XNXH 4ODSH 2X89D 4ETYA 3BEWB 5HGBB 5C09E 1OAYH 2ZP0T 4N0YH 2D0FA 5HHMD 4P5TB 4AT6A 5KW9H 4W81A 5F89B 2ARJQ 5EOQL 4NO0D 5HYSB 1OSPL 2FGZA 3MJ6A 3P11H 2ED8A 2JTDA 3T4AB 3ZDZF 2R2HB 2XXCB 2YA0A 2VDRH 4KQ4H 5EBLB 3Q3GA 2R1YB 2R2EA 4G6KH 4XAKE 1ZGLP 1RUML 5EO1A 1EGJL 4CU7A 1GZQB 3RUGE 1Y6NR 4OGYH 1CZ8H 2Y07L 3HI6H 3RUGB 4KZEH 3IU4H 2BSRB 5E8PB 3WFHB 1EBAA 2GIYA 3U30B 4HKZA 1JZ4A 4P2RD 5TDPA 3WFCL 2YXMA 4M7JL 3TA3B 4D0DB 1WWWX 1T21A 3GMRB 3ARRA 4JY5L 5B22A 5ALCL 2VZTA 3L3JA 2PYFA 3GSVA 1IKNA 1UB5A 1P7QA 1E4XI 3QWRD 3QDJB 1RZJH 4G8IB 4RMUA 3WXWL 2YPLD 4G9FE 1ZS8B 4Y1AE 4EN3B 3AC0A 3AROA 4DKEH 4G9FB 3C9NB 4K3DL 3C5SA 2NTSP 5I8CA 5CMAA 5JDSA 1EO5A 3RA7L 4P2QD 3M45A 4MXWL 4K3EH 1RJZB 1G9ML 2AK4E 1NUGA 4ZPTA 3QIUC 2AK4B 3NFPB 4TUKL 1WAAA 3RY6C 1H0DB 1AGFB 3UC0L 4UOW0 1LE9A 3HZVB 1NMCC 3R0NA 1CLOL 1EEZB 1TETH 3BO8A 2GCYA 1G7HA 4PP1C 2X7LA 1MCCA 2HVKA 3TIEB 1QLRA 3AU1A 1UJ3C 5L9DH 5AZEH 3OKEB 4MB5A 3SDAD 4U2YA 3QFDB 4MXVF 5IIEA 1NUDA 4JM4H 3D1MC 3H9HB 4BQ8A 5IMOB 1MFCL 2Z93A 2BNQE 4KK5C 3MV8A 2BNQB 3U4EB 3RBGA 3VRLF 2R0WL 3UCRA 5DJYA 4JPIB 2P45B 1YYMH 3BRDA 1IC5H 3TBWA 2F53E 1DQJA 1Z0MA 3BWAA 4NHCL 1S9KC 2BVTA 2EDNA 2F53B 5DD6A 2X4RA 4FA8A 4PLKC 4OIAA 4NPYB 4HEME 5D7LE 3KPMB 5D7LB 2XWTB 1FFPA 2OR8A 1WK0A 2J4WL 3FQTA 4X6DE 5F9AC 1BBDL 3CPLA 4R90L 3QXDB 4X6DB 1RAMA 2O5XH 1AR1C 5ADPL 4WWKB 5C2UB 5F9JB 2PTTA 4P5TC 1R3LA 2GSGB 4S1SL 5B39A 1VGEL 1CLZL 2PO6A 5IW6A 5EUOF 5MENE 1HE7A 1KGCE 1M05B 1NDGA 1VKXA 1F42A 1IAII 1NJ9A 2NTFA 3VXQA 2AJUH 5MENB 1FORL 1HK6A 5T3ZD 4JFHD 4S1DD 4UNVA 4CRPA 2P5WE 1HYRC 4KKLD 4HIXH 2P5WB 3BH9A 3GSWB 4LCYB 4OM0L 1DEEA 4OM1H 3O2DA 5EU3A 3PG2A 2EDQA 1I85C 4FFZH 4HGKC 3I6GA 1DUYA 4U3HA 3BMVA 3U30C 4ESKA 1CVSC 1PGRB 4PG9B 5DZLA 3RPKA 2BVUA 3HNSH 5BQ7B 1B2WL 1P5VA 3PGFL 4IOIB 5TQ0L 5HYQB 3VH8B 1KPRB 4BFIA 4XTRC 5KJRL 2FJFA 1YEGL 3MOBL 3B3IB 4JANB 3HAEG 3VFOA 1JF6A 2VXUH 1FZMA 2CIIA 1QG3A 2IAMA 1XGPA 4RWYH 2XG4A 3C08H 1NEUA 3WFZA 3OHXA 5EU6D 3IFLH 1R3HB 4Q9RH 4FXKA 1KIUA 1EEQA 3IDYB 2O93L 4H8WH 4O2EA 1BQLH 4ZFGH 1UEMA 4X8JB 3VFUA 2FDBP 2ADGB 3MACH 3PHOA 1U8PA 3G6JE 1U92B 3F7RA 1WIPA 4Y4HD 3G6JB 5FKAA 5HHOE 4LBEA 1HHKA 3L5JA 2E7MA 1P2CB 5TE4H 2V2TB 2D9QB 5GGTH 1F4XL 1V8HA 1BZ7A 3S4SA 2OR9H 5TDOA 2VQTA 4XP6H 1A1OB 4P49A 1VEPA 3IJHA 1VGKA 2DYPD 1TTGA 1QD0A 1HEZB 1G7IB 4NJ9L 5CUSH 4G8EA 1KPVA 3FB6B 1UG9A 1XAUA 1MRFH 3N1GC 3MRNA 3TT1H 1R5WA 4RMRA 4OB5L 5ILTL 4AL8L 3ZSSA 2J8HA 3O4LD 3GJFB 4RDQF 4QRPD 5I8EB 1Q9OA 1RK1B 2DQFA 1T1ZA 1T2QL 5E6IB 3Q2CA 1SVZA 3VCLB 1CN4A 3QDMA 5L8JB 3H3BC 4Z7UF 4ERSL 4PJEB 4Y4FD 3C60A 2NXZB 4FNLL 2WANA 4WU7B 3W82A 2YRLA 5T5FH 3RIAK 1FNGA 3PQYA 1OLLA 4JJHA 3ARBB 1NGZA 5F88B 1X5KA 3NZ8B 4I3GA 3SOBH 5GZOD 4PV9B 5DVNA 1IAMA 4Z77A 4GAYA 2BSED 3E1F1 4M1DL 1L7IH 2A6IA 5I76A 1U3ZA 1X4XA 4WENB 5TPWH 1IJ9A 1NMBL 3T65A 3A6CL 3WIHL 2V2WB 3LQAL 3WNKA 1I1FB 1S7WB 3OBAA 4G8GD 5J6HA 3TWCL 4XC1L 2MOVA 3I02B 3THML 5HYFA 5T3ZH 1F45A 4Q2ZB 3JBG7 4YNYB 4ORGB 1CDHA 1JRHI 3BH8B 3PWPD 3QIWA 4YGVA 2DQDH 3B6SA 3IFNL 3G5YB 4NRZA 1NAKH 3C5ZA 4NFBA 3QYCA 5IBTH 5KOVC 1HSAB 4PTUB 1RZ8A 2JE8A 4ZUVB 4QXUL 5DJZA 5CINL 4MMZC 1U8HB 4LQ1A 1A1NB 4XRCA 3ZT5A 2OX5A 5D7IB 4ZFZB 3IDYC 1ETZA 3UTSE 3FMGH 5JHLL 3UTSB 5CEZE 5DJ8A 5GIRA 2APTA 4HX1B 1M6OA 1S7QB 4F80A 2P7TB 3RWCA 1ZA3B 5IMLA 1Y18A 1CYGA 1QFWL 3WN5A 3ROLA 2LU3A 4UV7L 3BRFA 2H2SC 3PNWA 3OKOB 3QHTC 2D7OA 4HAFA 1TCRA 3VRJB 4K2UL 3UO1H 5I1EH 1FYHB 1I1CA 5GRVL 3UDWA 1GGBL 3KHOA 4I4WB 3V0VB 5FYLD 1MWAB 5DK3A 1UM5L 5C0BD 3SDCB 1RD6A 4Y5YA 3SY0A 1OAXH 4M6NH 4BK5A 1YNKL 3HFML 1ZHLB 3LPGA 3STBA 4JFEE 5HGAA 4JZNA 4JFEB 4Q0XL 3RVWC 2I5YH 1ZVHA 1Z5LA 3OL2A 3BGFB 1A64A 2NY3B 1QOKA 5IW1B 4DAGL 1KIQB 4XHQA 5GZND 3V0AC 5DHYA 1WFTA 1FNEB 3NCMA 2ZOLA 5C07A 3LKSB 1A6UL 5E6IC 3HTLX 1T20A 5CJOL 4OV5A 2IAND 2ED9A 3JV5A 2NXZC 1S8DA 4B0MM 3ZDYF 3GJEA 2VR4A 3HZKB 3WO4C 1NBZA 3PDGA 5DGRA 3OR7A 5EN2A 5D7JB 1HH6B 3NCJH 5DA0B 3VW3H 1F58H 1A6VH 3ARBC 4FS0A 5IKCA 1AJ7H 2VERN 3H7BB 3HRZB 4MQSB 4POZC 1IE5A 1AKJD 4JREB 5DF0A 3C8KB 1JGLH 2A83A 3NACH 5DRZA 2H26A 1S7XB 4ZXBA 1KCKA 1MCPH 2YS4A 4U6XA 5AZ2H 2YWZA 4XVSH 1CXKA 3B9VA 5IBLD 1KLFA 3HKFA 4OD3H 3VA2C 3QXAA 4L29A 5T1KB 1ZHBA 3MRCA 1WZMA 1RJYB 1YEKH 1N6UA 5D5ME 3FO9B 2WV3A 1G6RL 4AG4H 5D5MB 2IH1B 1JZ7A 4JFZH 1R5VB 3O3DA 3ULSA 4F7TA 3X13B 4MLIA 1GIGL 3GMNB 4LSVL 1YNTA 2YXFA 4ISVA 1DBAL 5T33H 5JUEL 1JGDA 5HDBF 1XCTA 3HC0A 3F6IA 4GXUN 4WU5B 3LMJH 3ORJA 3ZT6A 1QKZH 5IQ7H 4R96B 3RDTA 4A6YH 4NM4H 2NY2D 2ZNXA 2R4RH 4PJFF 2E9JA 3HMXH 4M1CD 4YLQT 5EZLB 1NUFA 4NC1E 1RVFH 2AEQL 4KK5D 3NZHH 4LPVA 1JTTA 2IADA 4LIQE 2H1PL 1RUPL 1A7NH 4EUPB 5E9DE 3MO1B 2XTJC 4LEOB 3M1BB 1QEWB 5E9DB 3HLAA 5DK0B 1BZQK 1U6AL 4ONFL 4XPHH 1IGJA 1C16A 4EJ1C 3VXTA 1U93A 4JO2L 5JTWA 5TJWK 2L4OA 4BFEA 1DDHB 3D85D 4KJQD 3MLSH 4RFOH 3O6FB 1MI5D 1U95B 5GJSL 2R23A 2V17H 2IGFL 4JZJA 3MCLL 2I9TA 2X4PA 5E1AB 3JWOC 2X4TB 3Q6FA 4LNRB 4N0CC 4NWTH 5FYLH 4GQPH 3IRPX 1J5OL 1GPOL 3K3QA 3DSFH 2FATL 4DGYH 4YX2L 1UWGL 4BZ1H 1J0KA 4YHYB 5JXED 4RGOL 1CDBA 3FN3A 3CDGB 2D31A 2B2XL 1E4XL 4U1NA 4NQCD 3WNNA 3BD3A 3WBDA 3T1WA 4I3SH 4UTAL 5D7JC 3RPIA 2HFGL 5A1AA 2NCMA 4MD4A 3HPJA 3KHQA 2B39A 4XI5C 4JREC 3DURB 3O45B 1Q9WA 1HQRA 1E4KA 3GO1L 2BHUA 1BP3B 4AK1A 4L8SA 4OLVH 2VDQH 5CBEB 3P9LB 3QR2A 2DN7A 1L6XA 3LQZA 2DM3A 4O4YH 4YHZH 4Y2DA 3C6LB 4LCWA 2BVYA 3IDXH 1BOYA 43CAB 3QJFA 1JPFA 5C71A 4WFHD 1IL1A 4U1HB 3EO9H 3JVGA 4K3GA 2BNUB 3RTQC 1RFDH 2AQ2A 1MJ8L 3CDCA 2HTLC 4G6MH 3HE7A 4NKDB 2BSTB 1DANT 1LE5A 3ECBA 1RZKH 1KC5H 4HFWB 4HIIB 1IGTB 4HPYL 2J6EA 4KGLA 3CUPA 4GAJH 3DX7A 1GYAA 2WUCH 5E94B 1HHIA 2GJJA 1TIUA 5ENWA 4OCXH 1AO7A 2YWYA 4N90E 4XCFH 5F93C 4XCYA 1PKOA 1LQSR 4JY4A 2YBRA 3F12B 3BKMH 3FL7A 5ID1B 1XH3B 4KK6C 3STZA 3S97C 2QHRL 1EFXB 3VD7A 3GNML 4BSWB 4JQXA 4OCSH 3WS3B 4J1UA 3SQOH 1HSBB 1F3JA 2ERJB 4KUCF 4H20L 3O6FC 2IFGA 1CLYH 1DFBH 2R4SL 4HWBL 5CHNA 3FT2A 3MV7A 5E7FA 1I7RB 4TQEL 5IB4A 3NN8A 5ABDE 2VABA 3BDXA 2WQ8A 4UT9L 4MA7H 3MCKA 1EAPB 4HW6A 1CBVH 3A6BL 3PWNB 4WV1B 4MSWB 3TBTB 5BCAA 3T0EA 3KPOA 3L3OB 2DWDA 3P9MA 5EO0A 5JORB 2FSEA 3HNVL 3L9RA 3R06B 1NKRA 1A47A 3GSQB 3T09A 5IV2B 4P2RE 3IF1B 4NQDB 5I6XC 3K2UH 4P2RB 3IDMB 3W39B 1FNSH 5DEGA 3R8BB 1TPXC 5EZIL 4L8DA 5TE6L 5F7DA 2MPAH 5DEZA 1ZTXH 3G6DH 3KLHC 4ORZC 3AUVA 3NA4A 2EH7H 5AYUL 5HVFB 4LPWA 2QQQA 4JGJA 3QRGL 2HKFL 2X4SB 1IQDB 1RZIA 3DUUA 3HMWH 4R3SB 5HI3D 4WJ5A 1X5ZA 4GQ9H 1H5BC 1PVHA 4ZDHA 3ULUL 4O2CA 3FQNA 2ICWB 2FD6L 1NLBH 2VISA 3C6LC 2H3NB 5JW5A 2V7NA 1N2RB 4DQOL 3UZVB 4LLYB 2HRPH 1OVZA 3QHZL 5CJXA 5I1LB 1DN0A 4QHUB 4PBWD 2Q86B 3JV6B 2NPLX 3QCVL 1WGOA 3AS3A 4NDMA 3SDAB 1IM3B 2G75B 2W60B 1BVKA 3FT4B 3KPQA 5C3TA 1B0RB 3KPRA 3SE9H 2JK5A 3V7MA 4JO1L 4E9LA 5DUPL 2A1WL 5ISZA 4MJ6B 5FHBL 2XNAB 4R6UA 5DT1H 1P9MC 2WBJB 4I0CC 4NNXB 1A3RH 1ODAA 3GKZA 5TF0A 2E6JA 4JLRB 2NY5H 2ZNWA 3GIVA 4KV5F 5C0CA 2VLLA 3VFMB 4PRNA 2A6JB 5DURD 3SGKC 4E41D 1RIHL 5CSGA 5F9OH 3G9VA 5C0JB 5CD3B 4XNYH 1JZ8A 1F6FB 4LLUB 1R5IB 4KI5E 3CMGA 1CD0A 1KEGL 4GRLC 5BVPH 3ULUF 1V7ML 1W2KT 2ERJC 3AXLB 1C12B 5J9PB 1KCRL 5CGTA 4LSPL 4H0GA 5SWSD 3VXUA 3H0TA 1CTNA 4LKXA 4F7PB 1L6ZA 5T3ZE 4JFHE 4KRPD 1HOCB 4OZHA 5FGRA 1CD1A 4WV1C 2FO4A 4WNQA 2AV7A 3EDJA 5D72H 3AM8A 5C0EB 3ILQD 1WEJH 5E5MB 4OFPA 4CVUA 2BNRA 2VXVL 2FWOA 1QHPA 3CVIL 5CP3H 5I1IH 5DMJB 1XGYH 3LN4A 5EBWB 3SE4C 3ULVD 1S9WB 4IDJH 2EIZB 3MLWL 1N8ZB 1J0ZA 2QKIA 2C5DC 1OOAA 4LQFL 3BUTA 5HDQL 5IBUG 2DQTH 2P8PB 1N0XL 6FABH 2F74B 4IRZH 3QEUA 4N9GA 4DOHB 2EH8L 1OGAB 4TOYH 2AP2A 4NFCA 4JKPH 3CFKB 4X7TA 5A16B 2ICWJ 3GMOB 4PIRF 5KSBE 3LRSB 4X7EC 3QJHA 4B41A 1RJLB 5KSBB 1X5FA 2BX5A 1G7LB 1RIUH 5I2IA 2WWKT 3S5LG 1C1EH 3EO0B 4HT1H 4AENB 5HGHB 5INCB 3EOBA 4FQIH 2G60H 1QSFA 4K7FB 4OKVA 1JF1A 4P57A 4H5SB 1LEGB 1U8NB 1A6AA 3UJJL 1RIVH 1QFOA 2AJYH 4YXKH 1BD2D 4JM2A 1JPSL 3KYMB 1OAQL 1NDMB 1MHCB 2OZ4A 3MJ9L 5TGBA 5AWNH 5JW3H 4HUKB 4KJWC 3CLFH 3OXRB 1D6VH 5C0AD 3MBEA 2EC8A 1SMOA 5LAXA 3BPLB 4NN7C 2VIRB 1EO8L 3DV4B 1BX2B 2XZAH 1WAAF 4M8QB 3V9FA 3OGCA 1YDPA 2FEDC 2XN9D 5AG9A 3HRPA 3O4LE 4WTXA 3VWJB 3O4LB 4QRPE 3MGOA 5IFHH 1BFVL 2WSKA 1U58B 3A0OA 2XQYG 1U8QA 2FBJH 5LQBL 5J7CC 4X99A 5L8KB 1FPTH 4Y4FB 1N3NA 4KI5C 4X0KB 5DRNB 3GDBA 3VXNA 3SE8H 3UTPD 4X5WB 2B1AL 2H6PB 1YPZE 3S37L 1YPZB 5DD5L 1K5NB 2F5AH 3UTZB 1D5XA 2DJSA 5ITBH 5I17A 1YN7B 3L3DA 3QWQB 4XNZB 1DQDH 1LO2L 1ZE3C 4R7DA 5DJ2A 2VXQL 4KMTL 4PS4L 5ACLA 3I6LD 3QBTB 5IM7A 1G7PB 3BDBA 3INUH 3HS0B 3OAZH 3FCTA 4Q9QL 4G8GE 4YEEA 1J0YA 3EYOB 4ZFFB 2C1PA 4NQUA 1CFTA 5DRWA 1G0XA 3L3HA 2Y9RT 3B2VH 3LVEA 5GQBA 3RL1A 3V4VH 4DKFH 2ZSVA 1BMGA 1YEDA 4YDVB 2FX7L 4HCRH 1FIGL 1G7QA 1A9EA 2O5ZH 4OZIA 3D0VB 1B6UA 4J3UA 4JFFE 4JQVA 1OPGH 4JFFB 1NCBH 3H3KA 3TJHC 4HKXB 2BFVL 5C3LD 3PDOB 1XF2B 4GRWH 5IFJA 3CC5B 4HXBH 4XPGL 3MLUL 5SWZE 4P9HL 3RVUD 1KN2L 5SWZB 1KJMB 3PJSA 3OXSB 1Q9KA 1FAKT 3EOTH 2WUBH 3KLDA 4HC1H 3MRPA 4S1RL 4JDZA 4Q6IC 4L3EA 3QP3A 5LCVH 1J87A 3RWGB 1MPAL 3V4PL 3NCCB 2GJ6A 3T77B 4K9EL 3ZKMC 1VFMA 5DFVD 3UJIL 4P4KA 3DIFA 2QHLA 5DYOB 5FYLE 1W0WB 1P1ZA 4U0RC 4IOFC 2MWCA 2MQ0A 1IFHH 3U7AA 4KZDH 1B0GA 4PJ8D 1T22A 5CJBA 3TZVA 5TFSH 3FRPA 2HFFA 4MD5A 2X2YA 1P6FA 2R1XA 1TITA 2CLZA 3TNMA 3RWFA 1CR9L 4YK4C 5DD3L 3F7QA 4LPTA 2XT1B 2MCPL 3BPOB 4OLZH 3RY5A 1Y0LB 3Q6GL 3VWJC 3FJTA 4L9LC 2D7MA 4YUEL 4G6FD 2ZUSA 1GOHA 2P47B 5A3ID 4NRYA 2UZIH 3E6HB 3BQUA 4U2ZA 2W0FA 4FG6D 1LMKA 3ARQA 4LP4A 4ZUTB 4GKNB 4U49A 3LKNB 2OLDA 4QRUA 4HS3A 4LHUD 2EEBA 5E00B 1BVLB 2R1WB 4I1NB 2YA2A 4QT5B 3TH4T 2UUDK 4J8RA 5LG1A 3X12A 2AVGA 5F3HB 3RHWK 1D9KB 4AMKL 1R3KB 5IMKB 5KAQG 4J3SA 4X6FB 1T03L 1VPOL 1DN2A 1FFNA 4XNZC 2VXTH 4MVBD 3TBVA 1UENA 3OKDB 4LSSH 1EEUA 4MNQB 3ZMRA 1ZANL 5IBUB 1MEXH 1X9QA 4IMKC 1JNLH 1MCOH 5EZOH 2JIXB 3KJ4C 1ZHNB 3EHBC 4H0IA 1CDYA 3NPSB 1KF9B 4UI2A 5E8NA 4QF1B 2E5EA 1QRNA 1W8NA 2AABL 5F1NA 4JG1L 2IPKA 2RGSA 1D6EA 1ZHKA 2GT9B 1PSKL 3QNZB 1KPUB 1QA9A 3S5LB 4TPRL 5IJKC 5IMMB 3V5KB 4OBSA 2R56L 1HHJA 2P1YA 3E3QC 1FJ1A 2HT3D 3BSZL 4APQD 3F6LA 2X6MA 4EI6B 1P7KB 3KLAA 1UVQA 3K7UA 2GFBA 3F62A 3OQ3B 4N68A 1T2XA 5ACZB 5FCUL 4OF5A 2V5YA 2EDHA 1KCVH 5TF1H 2EYSB 1HCVA 1EHLL 3RZCB 1C5CL 4O00A 3I3EA 2IEPA 2G5BA 4F37K 3RKPA 1YMHA 1OTTD 4X4XB 5CP7B 5F6HJ 2FGWL 2VSCA 2V2XB 5IB3A 3T04D 2XRAL 2X1XR 4NZRL 2K3TA 5EIQA 1F4YL 1ZVYA 4JZOB 1TXKA 4GKSA 4DTGH 3L95A 1MREH 1PW3A 1Q1JH 2DTMH 3B83A 3DYMA 1MI5E 3O6KH 1EIBA 4RAUA 3RJDA 1INEH 2BOCA 1G7MA 3DMMD 5GISH 2BSSA 2I60L 1WJ3A 1SY6H 3IJSB 3CX5K 3WKNA 1L0YA 4LASH 5FUZH 1UKTA 3C2AH 3RNQB 2YUWA 1RU9H 5FGBA 3RVXC 2VL4A 4QTHA 3ZO0A 2X10A 1I1AD 1EX0A 4MQTB 3GBNL 4XPTL 4ZQKA 1J18A 3BPOC 5BS0A 2CQVA 4NKOB 1P7HL 4M5ZL 3MFFB 3S7GA 3IDJB 1DQLH 5BZDA 4JHWL 3MFGB 1NGPL 4UTBL 3WL9A 4NQCE 1JPGA 3N9GL 3EFFA 3IGAA 4NQCB 1A14L 3S98A 1EFQA 3U46A 1DTUA 5FDWB 1D9KC 4QNPF 4WHCA 4XB8A 1QZ1A 3NAAL 1T89C 2VITA 4XCCL 3MRMA 1JNNL 3B9AA 4M4RA 5IK3A 3RWIB 3WFEL 1BQHG 1SM3L 4DUVA 1IEBA 4P3CL 4U6VH 2OSLA 4O5LH 2FCBA 3ALXA 1AE6H 3FQUB 1BLNA 1MNUH 1EPFA 3Q1SL 2GTZB 4WEMB 3VXSA 1RUAL 1BFTA 1PZ5A 3NPSC 4LMQE 1K3IA 2NLJA 3LN5B 1LO4H 1RZKC 7FABH 2YPVL 4ZOEA 3CSGA 3ARFD 4P9ML 4Y4KB 4M4PA 3LSOB 4XBGB 2NYYD 3VGBA 1OAKL 3VG0H 4X80L 3FN0L 1FGNH 1NFDE 3OJDA 5I73B 4YHPA 4H0HB 1NFDB 4JHBA 3MOAH 1NGQL 4JKLA 4PRHD 2JF1A 4QXWA 3BGMA 3PL6B 4KQ3H 1H3WM 4K8RL 3O3UN 4OI9A 5J8OA 3CZJA 3MRKB 4Z7WE 4KXZI 5C0IA 4IRJA 3RZCC 3LDBB 2EO1A 4TVPL 4Z7WB 5DMKA 4NO2B 5EOQH 3MJ8B 2CD0A 1XMWA 1OSPH 5DRXA 4IRSC 4UUJA 5TQ2L 3DARA 2X4QB 1MFEL 3BZEB 3LS5L 4X9BA 1AGBB 2BVPB 1FNFA 2J8UA 3AY4A 4U1LB 3JV4A 1RUMH 1IILE 1EGJH 4KY1L 3AS2A 3WHXB 2XY1A 1XIWA 2DLTA 1DL7L 2Y07H 4TYUA 3V52L 5GHWL 2NZ9C 3ARZA 5EU6A 1E6OL 1KCSL 4LVOB 4TUJB 4QRRE 2ARJA 1CDJA 4QRRB 4OLUL 2A6KB 4S11A 5L7XL 3BKJL 5GS0L 2LQRA 4FXLA 4FN0A 2G9HA 4M7JH 4FFWC 2DL2A 1OARL 4RFEA 2E9WA 3MNWA 1XGQA 2J88L 4FQXA 3BZ4B 4PJXA 4RMSA 4J3VA 2WLZA 4QHKI 1AGCB 2LVEA 4ZOCA 3WXWH 4YZFF 1YEHH 3R4DA 4GRMB 4NM8L 1M7IA 4K3DH 1UZ8B 4TNWK 4NSKB 3RA7H 1LK3H 4MXWH 1G9MH 2F58L 5B8CB 4GW5A 4TUKH 4U1MA 3CXDH 1S7UB 3C5JA 3GHBH 3WEXA 3UC0H 3QDHA 1SJHB 5SWQB 2J6EL 2BJMH 1CFNA 4CDGC 2MJWA 3IFPB 3TJHD 2I24N 5L2JB 4Y88A 5ESVB 3WJLC 1HKFA 3WXVL 3MUGA 2AERT 4PJ9D 1MFCH 3HZMA 4QGTA 4Y4KC 5JOEA 1IM9B 3FKUS 4JFDA 1AGEA 1KIRA 2PW1B 2R0WH 2YSSA 1A4KB 1TJGL 3T4YA 5LVEA 2ICCA 3BE1L 4HMDA 4NHCH 1G9NL 1V3MA 5DVLA 5L88L 4PRBB 3NFSL 1OAZL 2AS5M 3PL6C 1RZGB 3MRGA 3QIBB 5J1AA 1KB5A 2J4WH 2ITDA 3JV0A 4S0TD 1BBDH 1QO3A 2HG5A 3CX5J 4HGWB 4R90H 3TCLA 5JQ6L 1A8JH 5ADPH 1FQ9C 3GMPA 1U3YA 2FB4L 3LDBC 2EXWC 4S1SH 1UA6L 1VGEH 1CLZH 2Y72A 1F3DH 1MIEH 5I1JL 3MROB 4WW2C 4OF6A 4G43B 2AJ3B 4OJFL 2VN4A 4Z7VA 3WFBL 1FORH 3CFBB 1VFAB 1WBXA 1J1XL 1VSCA 1PEWA 2APFA 3IXTB 4PB9L 3GM8A 4Z78A 1I8KB 2Y36L 4OM0H 4NZUL 4OZFA 3V6BR 1W0VA 3RL2B 1FZKA 4PREA 5CJ5A 4ZAKB 5H2BB 1AQDB 1S5IL 1VACA 3MLTA 5IVXA 3QFJA 3QZWB 4KRPB 1NUNB 1A21A 3BW9B 5DQDL 2AW2A 5CGYC 1B2WH 2AJSL 2HAZA 3PGFH 4LPUA 5TQ0H 3W9EB 5B38B 4F9PC 3U1SL 2EDBA 1YEGH 1O0VA 1F8TL 5DK2A 3RWHB 1BGXL 3HI5L 3UTOA 4LCIH 2Q3ZA 4LPYA 1KSRA 2H2PC 1H3UA 1BQHB 3VFWA 5MEOA 3CVHH 2AGJL 4QKXB 1YC8A 2XYCA 4GRWE 5GGSA 4I9WD 3TBYA 4GRWB 5ECJE 1QR1B 4UQ3A 1ZXQA 2JJUA 4HV8B 4K55A 1FO0A 3EYQC 3UYOD 3MXWL 5JPMB 1MVFA 3C09B 3FQWA 5KSVA 2NY6C 4UAOB 35C8L 4UBDC 4XX1G 1HNFA 1NAMA 5DMGC 2QBWA 4GH7B 1NEZB 1U2HA 1N6QL 2AQ1A 3QNYB 4EDXA 5CD5C 4YHNB 1F4XH 3D25B 4QRQB 1UCBL 4KUZL 3NBNA 3O11A 1FAIL 3VXOA 3U36B 2RIKA 3P4OA 3BP4A 1I1YA 1U8MA 1QP1A 1T83C 2XFXB 4MJIA 1TZIB 3L7FB 4NJ9H 5JW4Q 1CIDA 5JHDD 3BWUC 3OTTA 5KZCD 3VXMD 1YY9D 5T5NF 3O8XB 4OB5H 5ILTH 3PWUA 5FB8B 4AL8H 3SJVA 4N8VG 1YEIL 5H94B 5GSRB 5H8DA 2APXA 1P5UA 3RBSA 5CZXD 5HPMA 3QIBC 2WWKO 1T2QH 5E8EA 2XN9E 1PYWB 3VI4F 1JN6B 1ACZA 2XN9B 4FNLH 2ENYA 2ZJSL 1T0MB 2CDGB 3MBXL 4EXKA 3DSNA 1T1YA 3MGAA 4XP5L 3P77A 4WGWB 5BVJA 3EYSL 4UQ2A 1WCBA 4PJAE 2HWZL 2J8OA 4PJAB 4P5KB 2A0LD 3T2PA 3QIUA 5CZVL 2V5RA 4R4BB 5EBMA 4K7PL 4U1KA 4LCUB 4M1DH 3RY6A 3UTPE 2CDEA 2GITB 2C4XA 2K7QA 2P8MA 3MR9B 3DHJA 4DZ8B 3OF6A 4HKBA 1QFHA 3WIHH 3LQAH 4ZAKC 5IOPB 3BESR 5C0GB 3V0WL 3DRQB 1UJ3A 4UOW1 5K9KA 4XC1H 3IDUA 3V6OE 1J8HD 1VFOA 4HF5L 3I6LE 3E2HB 4YR6A 1FYTD 1WZLA 1FZJA 3IFNH 1MOEA 4PJBA 2A73B 3NOIA 2FBOJ 1P69B 2GEEA 4JPWL 3JTTB 3NIDE 2HFEB 4KWUA 5D1XD 1ZT7A 3ZKND 3U7YL 4QXUH 4PJ5A 5CINH 3MRRB 1MF2L 4OZ4A 3SQBA 3PWJA 1I7UA 2KKQA 4F7CA 3PP3H 2NX5E 4POYA 4OZHF 5JHLH 5D1ZD 2NX5B 4YWGL 4RX4D 3BEWA 5HGBA 2OZ4L 1LDPL 3TN0C 3KS0J 4Z5RA 4OLXL 1DR9A 4P5TA 4Y16D 3GI8L 3QUXD 5IF0B 4UV7H 5HYSA 2IBGA 3QPXL 3T4AA 4DVRL 2Y23A 4FQLL 4K2UH 3D18B 3ZTNL 4G7YL 3H9ZA 5EBLA 1KG0A 1UM5H 1IEHA 3D2UD 4K3HA 3CGTA 2VAJA 1GZQA 1I85A 2HTKC 1RUKH 1YNKH 4QTIL 1KB9K 1IGML 2BRQA 4DJMA 3CMOL 3O3EA 2BSRA 3O8XC 4Q0XH 5DFWH 5HYIA 3AMKA 1P4LA 3QUYB 1JPTL 1PKQE 4DAGH 1PKQB 2VLRE 3DUSA 3QNXB 1A6UH 3FZUD 5I8OL 2GY5A 2VLRB 4IEFB 4K94H 4CUCA 5CEYB 1OT2A 4JM2F 4ZPVB 1KENL 1MQ8A 1QSED 2EE2A 5HY9B 1K4CB 3QDJA 4G8IA 2X09A 3O9WB 1H3XA 5L0QB 3AREC 4TRPH 4G6FB 3E0GA 4HKJB 4G9FA 5L6YL 3C9NA 4PLJC 12E8L 3LRGA 5CZKA 1J1PL 2Q8BL 4KUCD 4JFOA 4RDQG 1JF5A 1I7ZB 4QYOB 2BZDA 5C9KA 3GBML 1UH2A 3S3SA 2Y4SA 3VD3A 1H0DA 1AGFA 1RSFA 2N7AA 4QHMB 2EZ0D 1EEZA 1QQDB 5ITFA 4JRYD 2AJZB 3TIEA 1CGWA 5E8OA 2XPGB 3V5HB 3QEHA 3OKEA 1LK2A 5E56A 4XVTL 3IDIA 4B7IA 3H9HA 5IMOA 3MQIA 3E2HC 1G6RH 3RJQB 4CVWA 4WO4D 3U4EA 1OTUC 2VUYA 1GIGH 4LSVH 1ED3A 4WI5A 4Z8FL 1DBAH 5JUEH 4OD1L 4OUUA 1N26A 4BQ6A 1HWGB 3F7PC 4NPYA 3I3DA 3PGCB 3K81A 3KLSA 4FTVA 5D7LA 1OF2B 4QY8B 4ODXA 4IMLB 1TVDA 4MJ5B 2E7LA 4X6DA 2AEQH 4D9LL 3K80A 4EQ3A 1S7SB 2VLKD 1MCJA 4Y7MA 1RUPH 2JCCA 4QWWC 2Y5TB 2GSGA 3P4MB 5HI4D 1YYLL 3ES6A 4YHKH 2X05A 1SMAA 1U6AH 2ZKHL 4MA8L 3MRQB 5IW3A 1M05A 5MENA 4XBPB 2B20A 4OZIF 4HK3N 2P5WA 2EIDA 4LCYA 3O41A 2A38A 1ZT1B 5GJSH 2OJEA 2WQRA 3IETA 2IGFH 4BH7B 3MCLH 2Z0BA 2EXWD 4YJZL 4KKBD 4OGXL 4Z7NF 5BRZD 3VRLE 5CWSB 4F3FB 1J5OH 3QUYC 1GPOH 1U3HB 2FATH 4MX7A 3WMSA 5BQ7A 1UB6A 2FL5B 4YX2H 1UWGH 4IOIA 4ELME 1KPRA 2YEZB 4G8FB 4ELMB 1HIML 4NP4L 3B3IA 4RGOH 2XY2A 4JANA 2B2XH 1E4XH 2J2ZA 5D8JL 1W0YT 4KU1A 1I9RL 4FMFA 1IBGL 3MLXL 3PWLB 3O9WC 5ESQB 5L0QC 4UTAH 1AIFB 3S96B 5BJTA 4PRID 2BMKB 4W70A 3QUZD 5EC2A 3ULUD 1FLRL 4X8JA 3HG1B 2AXHA 2ADGA 4OF7A 3SKNA 5I8KL 3GO1H 4JE4B 4NNYA 1MY5A 4ODWB 2Y06L 5CGMA 2EDFA 4RQQA 4F15B 2V2TA 5C0ND 3T3ME 5MHSD 1FNHA 1G6VK 3F7YA 3P30L 2DQHL 3QPQC 3SDYL 2P43B 4NO3A 1QBAA 4WTWA 2KDGA 3MUZ1 5A2IH 3BIKA 1AP2B 2Z8RA 1X4ZA 1MJ8H 3GI9L 4HZAA 2FZ3B 1AR2A 4ETQB 3K46A 1MJUL 1QYGH 3NH7L 2WZPD 5DMGD 1Z6JT 3P4NB 3GJFA 4GKOA 3KPPA 4HPYH 4OFKA 4FFVD 1RHHB 3CH1B 5I8EA 1RK1A 4PJCA 5DDHA 1TVHA 5E6IA 2XZCL 3DX8B 1TTFA 4D0CB 4PJEA 1KB9J 1L4IA 4HUUB 1BQSA 5EO9B 1M7DB 1T2JA 4PRHE 2DM7A 4UV4L 1J05B 1JWMB 4I77L 4PRHB 5F1KC 1YEJL 2X4UB 3GGWA 4MAYB 5EG6C 2QHRH 3VFRB 5I0DA 3ARBA 3GNMH 4JGMA 5E03A 1CK0L 3HR5B 4ZTOL 4I3RL 1P7QD 3TT3L 4PGDB 4H20H 2AXFA 2R4SH 2PW2A 4HWBH 2VLJB 4K71B 3V6ZA 3P3YA 4DUWA 5DQ9A 4TQEH 1C08B 3U0PB 3GUTB 3QXVA 2V2WA 1I1FA 1I4FB 1S7WA 4NHUB 2OCFD 5DJAB 4ZS7L 2VYRE 2CRZA 3A6BH 3FO0L 4C58B 1U3HC 4I8DA 1UXSB 4ORGA 2ZCKL 3BH8A 2YR3A 5L8LB 2Y5EA 3KWWA 3HNVH 2UZXB 4EIZC 4ODVL 3OGOE 5F7EL 1Q72L 2H8PB 4PTUA 1YN6B 2BVEA 2EDEA 4NOFA 3CVHB 5BOPA 5EZIH 1U8HA 5TE6H 1NCAL 4Z7UE 4U3XA 5D7IA 4ZFZA 3BN3B 2ICEA 3MV8D 4Z7UB 5F1SA 3B4NA 2RB8A 4U6TA 4TTDD 4L5FL 4XT1C 1SVCP 1WISA 5AYUH 1S7QA 3LS4L 3RIFF 2P7TA 3QRGH 1L7TL 2HKFH 5C92A 3ARPA 4N9OB 3VMOA 4P48A 1VADB 4F15C 2YK1L 3ULUH 3VRJA 3L7EB 2YHGA 1S7RA 2OMNA 2ZG3A 3CFJA 3DX9A 4UIMB 1GAFL 3V0VA 4I4WA 3MUJA 2EC9U 5KS9E 1MWAA 3ARDB 4X6BA 1AI1L 5KS9B 2P46B 4ZUUA 4DQOH 2WMPA 4Q6YA 5I1DA 3MV9E 3RVVD 2X9WA 3MV9B 2PO6D 3QHZH 3TN0D 3QCVH 5GRVK 2Z8WC 5DLML 4UIKL 3GMQB 4LAQL 5K9JL 3S34L 5IW1A 2QV2A 3ARTA 3BPCA 5DUPH 2A1WH 4F58L 1FNEA 5FHBH 3HUJA 4MLSA 2Y7QB 1F3DJ 1IZJA 5I19L 1D5BB 1ND0B 5J57B 4LF3B 1WF5A 4XC3L 1C5BH 5E08H 2NNAB 1SEQL 3HZKA 4J7RA 4BELD 3V5DB 1KJ2B 1RIHH 3LB6D 5D7JA 1HH6A 4MAYC 2ITCA 4ONHB 32C2A 3QQ9D 1ZLUK 5IROC 3H7BA 2DQJL 2FJHA 1KEGH 4X98B 4FP8L 4R9HA 3C8KA 1V7MH 5IT2L 3G5VB 3K4ZA 2IAMD 1BWWA 5J11C 3R8QA 2Q76B 4K71C 1NCTA 1YMMB 1KCRH 1F4AA 4LSPH 2R9HC 3TF7C 1FFQA 3WIIL 4HUVA 4ONGL 4PLJD 3S36X 5T1KA 5IB2B 1JTOA 1RJYA 4XWOC 3RTQA 1FFOB 5D5MA 2IH1A 1RY7B 1R5VA 4JFXA 3TYGL 3X13A 3IAPA 5I1AA 3CVIH 3FT3A 1QPXA 4LLMB 3QDGE 4GT7A 3IJYB 5EORL 2A9MH 3MLWH 4WU5A 1J12A 2RR3A 3P73B 3QDGB 5GSVB 5HD8D 3QEQA 5AAWA 2G2RB 5DO2D 5HDQH 2EYTB 4MXQD 2WWMD 4LDOB 1N0XH 2J8UF 3ZDYE 1QLFB 1IAKA 1FGVL 1OM3L 5EZLA 3LEVL 4ZD3L 2HVJA 1E6JH 2ED7A 4KHTL 5FA3A 4I9WE 4EUPA 4NFDA 5FYKH 2YUXA 4LEOA 1KNOA 4XP1L 1QEWA 3IDGA 4HAGA 4PRDA 5DUBA 1GHFH 1F3RB 4RMTA 3BAEL 1JI1A 4Z0XB 1U0QA 1PBYA 3QDMD 1GZPB 1UM6H 5F96L 1DDHA 3UJJH 3C60D 3RZWA 3ARDC 4WFGD 3O6FA 3F8UB 4PJXF 3QDAA 4OGAC 3OZ9L 5GGVY 1OAQH 3CFDB 1U95A 1DANU 4KK8C 1FL3A 1GH7A 2QADC 1KB5L 1MJJB 1LD9B 5IG7B 3QQ4A 2X4TA 2B8OT 4HULB 1RZFL 1IAIM 3CSPA 4WI2A 4YDIL 1EO8H 5HTSA 5JHDE 1F11B 3FRUB 2AXGB 4FQPA 2ZUQB 3VXME 2X9YA 3CDGA 2EDJA 4PJFE 1QACA 4FABL 1MCWM 1YEFL 1D5ZA 2D2OA 1BFVH 2ZWLT 3O2DH 1I8MA 3T3PF 4KI1A 5LQBH 3WDJA 2PTUA 3C5ZD 2E7BA 4HS6A 4M3JA 3RGVC 1OQOA 3D0LB 2GK0B 1YQVL 2YN3A 3O45A 3BP7B 5I15L 2B1AH 5F72S 1MCWW 4OIIH 5DD5H 5HGDB 3P9LA 3FB8A 1H5BA 2HKHL 1LO2H 4MAUL 3C6LA 4MCYB 2VXQH 4KMTH 4PS4H 1A9BB 4U1HA 3MLRL 4RIRB 2BNUA 2FYYA 5IB1A 4Q9QH 4HH9A 3K1KC 1J8HE 2BSTA 3U82B 3U9UB 2WNGA 1VENA 1CE6A 1J8HB 4M43L 1FYTE 3WD5H 2B0SL 1IGTA 5ANMA 4MQ7A 1FYTB 2ZG1A 4Z7VF 4KK9D 4X4YB 3OG6B 1FIGH 1NAML 1F6LL 2CUMA 1P9MA 1P84K 5ICZA 1CWVA 4RGNE 2EDWA 3HE6C 4RGNB 4BQ9A 5SX4I 3REWB 5A2KH 1HDMB 2VL5B 2BFVH 4HBCL 1O5DT 3TYFB 1DBJL 5IVXF 5TE7H 3SGKA 3HC4H 1XH3A 1AXTL 4PB0L 4XPGH 3QUMB 3MLUH 1MCLA 1F2XK 4P9HH 1NGXB 1KN2H 3H7LA 5C07D 1EFXA 2UWEE 2IG2L 1YJDC 2UWEB 3H9SD 4BA8A 3VD9A 2BOBB 1HSBA 1V3JA 4GRLA 3QUXB 1UZ6F 3NCFB 5ACMA 1MPAH 2DD8L 3QCTL 3V4PH 1IC1A 3QI9B 3B9KC 4K9EH 4OQTA 3UJIH 4ODTL 3KAAA 5DUML 1RV6X 5HJ3B 4JFYB 1MCBA 3DVGB 1NLDL 4ZTPL 1FG2B 3UJTL 3H9YA 5DJ0B 3BZDA 4Q74A 3IDNB 4WV1A 4MSWA 5DHXB 1DLHA 3L3OA 4ZXBD 8FABB 4QOKA 4JFPB 4NN5C 4IJ3B 5JORA 2MQ3A 3GSQA 5IV2A 1CR9H 5DD3H 5DJ6A 5GRJL 5INDA 2HLFC 4NQDA 3IDMA 1JV5A 2MCPH 4XP9L 3SE4A 3Q6GH 4YUEH 5FIEA 4U31A 3FFCE 1OP3H 3U83A 3ZKXC 3UPRA 5F71A 5JW4R 3FFCB 5DS8A 1JP5A 3DV6B 3P0VL 4O51B 4U6HA 2FLRT 3SKOA 4PJHE 4KTYA 3NIFE 1T5XA 4PJHB 1MVUB 2X4SA 4OIBA 1BF2A 4NGHH 1JFQL 4WVRA 1IQDA 5F97E 4FQHB 5F3BA 2CR6A 1JK8A 4Z9KB 3KYNB 3RDTD 3H42H 4AMKH 1PG7H 1LVEA 4NQSA 5GGTA 1T03H 5ADOL 1VPOH 4NO5A 4HPOL 5BO1H 2H3NA 5I71B 3N85H 5FYKU 1MUJB 4F2MA 1N2RA 1ZANH 4R0LC 3BIBX 1WWCA 5ICYB 5I1LA 1JI2A 2I9LB 4LKCB 3WNPA 2VLMD 3JV6A 5ERWB 5E4EB 4YDJB 2W60A 3G6AB 4WI8A 2IQ9L 4HIEB 4OCYL 3KNBB 4WEBL 1B0RA 4JG1H 2CLVB 2VTFA 4JCLA 3SDDC 4KTDL 4K8RD 3NMEA 3T1FB 4TSCL 4R2GD 4M62L 1XZ0A 1M1SA 2D7TH 4NNXA 3BOVA 4RGNC 3RNKB 2PXYB 4KJYA 4NQXB 1QTYT 4TVPD 2FECI 3BSZH 1XR9B 3VE0B 2J12B 1RK0A 4YFDB 4XMLL 5EIVA 1V05A 5D2LE 5C0JA 2VZOA 5HYEA 3CZFB 5D2LB 5CD3A 1WITA 5ICXB 2VLKE 1ORQB 1R5IA 4RNRB 5D96B 2VLKB 4PJBF 4KKCD 1EHLH 1C5CH 4YBLB 3AXLA 3VFPA 3OJ2C 2AV1A 4WIQA 4MQXD 1I9EA 1C12A 5C8JA 3ELAT 2CIKA 2FGWH 3QI9C 3MLVL 4HLJA 5A2LH 2XRAH 4NZRH 2PNDA 1A3QA 4JVWA 3V2AR 2KH2B 1ZT4A 2VQ1A 3G04B 3GKWL 2RAMA 1HOCA 4UMGA 2VOTA 3D3VE 5DSCB 5GS0D 4I13B 1IGIL 3D3VB 2I60H 2EKJA 4KJPD 3WIFB 5JZ7D 5C0EA 1GGCL 1EA9C 5E5MA 4NUGL 4IJ3C 4C83A 2XKNB 1YUHB 2NY7L 1PDKA 1KTKE 4XPTH 2PETA 3DWTA 4Y2DD 5EBWA 2W65B 3QO0B 4K07A 4LCWD 3B2UD 4U7KA 2GSIB 5T3XE 3AAZA 2P8PA 3BP6B 2E27L 2F74A 4AH2A 1OGAA 1NGPH 5LWYL 3HE7D 4UTBH 5C6WH 3RWEB 3N9GH 3JWDC 5A16A 4WRLA 4U6YA 1NL0L 1CL7I 1A14H 1BAFL 3HC3L 2P44B 1OAUL 4PRIE 3LRSA 2I27N 4PRIB 4ZOAA 4DZBB 3VJ6A 3EO0A 5HGHA 3NAAH 4TUOB 4XCCH 5INCA 5KANI 3FONB 4K7FA 1JNNH 5I74B 4H5SA 1LEGA 3S4SG 3WFEH 1MQKL 3WNLA 1P84J 4P3DB 1MSPA 3ILPB 5I71C 4GBXC 4Q6IA 4P3CH 1AO7D 1K8IA 1MRDL 2DICA 4QHNB 3KYMA 4FQ2L 2OJZL 1NDMA 3EYVA 3S35X 5MHSE 2R29L 1MHCA 5KN5B 4ENED 2IPTL 1RUAH 3K8KA 3D6GA 4OFIA 3PWVB 1ZA6A 2YPVH 3OXRA 4P9MH 3U4BL 4JJ5B 2VIRA 3VFTA 3DV4A 3MV7D 1BX2A 1OAKH 4M8QA 2CR3A 4X80H 3FN0H 4JR9L 4OGZA 4KDTC 4LOUD 2PXYC 1A2YA 4EBQL 3Q3GB 2V6HA 1NGQH 3VWJA 4L9LA 2R2EB 5I1GL 3T0ED 5DXWA 4D9RD 4K8RH 1U58A 1QFPA 2Z8SA 2VDPL 3EZ8A 4PLOB 5D96C 4TVPH 4X0KA 4YBLC 2ZOKB 5TDPB 4U4BA 4ZUSA 4X5WA 2H6PA 5B4MD 5AEAA 5JR1L 5TQ2H 3RWJA 1K5NA 2ATPB 1MFEH 4X9HA 3LS5H 2LFGA 3GSVB 3HI1A 4WY7L 1YN7A 1UB5B 2IH3B 5E4IA 5TDNB 4PD4J 4H25A 4KY1H 4NRXA 1MH5B 2R69L 1HHGA 4M6OL 4X6DF 1OP9A 4X4ME 4KGJA 1DL7H 4IMKA 3C5SB 3HS0A 4XNMB 2EDKA 3M8OL 5GHWH 5I8CB 3EYOA 1E6OH 1KCSH 2FX8L 4M00A 1INDL 4OLUH 4ZPTB 5CSZB 3BKJH 5L7XH 5GS0H 1ZEAL 2FH6A 3WYRA 1OARH 4QHLB 2ZUXA 4JHZA 4YDVA 2J88H 2VDLL 4HWEL 3EJYC 1L0QA 2EDXA 2X7LB 3BD5A 3NPZB 4KKAD 5IJKA 2HVKB 5HYJB 3TV3L 3AU1B 4PY7B 4W6YB 1MLBB 4GJTB 3HN3A 4JFFA 2Z92B 5IIEB 5FYKE 3IU3B 1NH6A 1PG7W 4NM8H 3PDOA 3KPRD 5DC9B 2Z93B 2Z91B 2PCPB 3RKDC 5ISZD 4KPHL 4JRWA 2F58H 1I8IA 5DJYB 3MRIA 2IJ0C 4PJDA 5SWZA 4X8XA 5MP6L 3OXSA 1NFIA 2APWA 2BK8A 3ZHDA 1AHWC 2DKUA 3BWAB 4LK4A 2CSPA 3TBWB 4PLNC 2D7QA 3U0TB 5C0CD 4G80B 2DMBA 1CXHA 5DD6B 3VFGL 2J6EH 4P2CG 4M93B 5EU4A 3CIQA 3FQTB 1OHQA 4YHML 1CF8L 4GUPA 5DYOA 3WXVH 1OW0C 1JHTA 3WLBB 4B50A 4NBXB 4RA3A 1R3LB 1WTGT 4I0PC 2JJVA 3O0RH 2PO6B 3BPNC 1TJGH 4F57L 5IW6B 3VXUD 4PR5B 3BE1H 3GSNB 2EDDA 5K93A 4PRAA 3UXFA 1VKXB 1G9NH 1NJ9B 3K1DA 4IS6B 3VXQB 3WUWA 3NFSH 1OAZH 1BEYL 1EEYB 2R2BA 4DVBB 4CVZB 3BH9B 1L9NA 1DEEB 2ID5A 4CMMA 5E8DH 1CU4L 2BY1A 5BV7B 2BNRD 3I6GB 2FJGB 3TO2A 3FFDA 3DYOA 2FB4H 1RQ5A 2A9NL 3TVMC 1UA6H 1D5IH 4HSQA 2R1WA 3VMPA 3LKPB 4QT5A 3SDXE 2EIBA 4L8CB 5I1JH 3IXAA 4K3JL 5CAYB 1D9KA 3SDXB 5KBNC 1R3KA 4L4TB 3GMLB 1J8KA 2FJFB 5K9OB 1JGVL 1T89A 4X6FA 3WFBH 5AUMB 1LNUB 3U48A 1FZMB 3EDKA 3OKDA 4PB9H 4U1SB 4MNQA 2A2QT 1BZ9A 4YDKL 5I1HL 2Y36H 1XT5A 4NZUH 4QLRA 1O7VA 1Z9OA 2E7HA 2B4CC 4PJEF 4FXKB 4PGZA 3X3GH 2DI7A 1S5IH 2JIXA 1CFQB 3T2OA 3X3FL 4K23L 2CK2A 2IBZY 1XF5B 5FF6B 1QSFD 5CEZL 4NQVA 3EJZC 5DQDH 4QF1A 1S3KL 3QA3A 2AJSH 1XR8A 1DBML 2Z31B 3REVB 5ALBL 4JM2D 3U1SH 4PJ7B 4LBEB 2GT9A 2OI9C 1F8TH 4V2BA 1BGXH 3HI5H 4OCMC 5IMMA 3V5KA 4H26B 4HK3J 5KG9A 3K4DA 1BZ7B 3S4SB 2CRMA 3LEXA 4M48H 1MWAL 1W72A 2J5LC 2BP3A 4GW1B 3MBED 3U9PL 1P7KA 4EI6A 1AGDA 3FQXB 4Z0BL 5KVEL 1AXSA 1URLA 2QEJA 4G8EB 1KPVB 1CXFA 5T1DL 1GRWA 1U41A 4W4OC 2ARWA 3L5XH 4ACPA 3OR6A 3MXWH 2EYSA 1JNHB 2OQJB 3JWOL 3MRNB 3RZCA 1J9CT 1R5WB 5E2JA 4J3TA 2YD6A 3B9DA 35C8H 2X1QA 4X4XA 1FL6A 4IRSA 4X6CE 5DR5L 1Q9OB 4M93C 4N1EA 4X6CB 1OGTB 3VD5A 1MCNA 1UCBH 4H1LG 4JZOA 2L0DA 1DQML 5D7IF 1BF8A 4KUZH 4XNUL 5IESL 5IEKA 4M9OA 4WFGE 1FAIH 4LGRB 2R0ZL 1AD9A 4ZSOE 3PQYE 4ZSOB 3IJSA 1FNGB 2Q8AL 3PQYB 4MJ4A 1M7XA 1CGUA 1A1MB 1NGZB 5HVHB 5M95B 1YEIH 4D9QD 4NKOA 5LGJA 3VG9B 5I76B 4DKAA 1A22B 3IDJA 3GSRA 2YZ1A 2F19L 5BV7C 2NY4D 3LZFL 2DAVA 1MHHB 1NCWL 4CBPA 1JMXA 4JRYA 2ZJSH 3MBXH 4RSVA 5I1KL 4XP5H 4ALAH 5HI5D 5F9WC 1BJ1H 3EYSH 3QIWB 3RVTD 1R3JB 4U1JA 3B6SB 4HUXB 5FDWA 3HB3D 2HWZH 3MC0A 4NRZB 3CU7A 1QFWI 5CZVH 1NANI 4K7PH 3RWIA 3HUJF 4ZO9A 1E4JA 3BKYL 3I6KB 2OS7A 5DJZB 5GS1C 1GC1C 1HYSC 4XRCB 3LKQA 3FQUA 3V0WH 3OKKB 2GUOB 2XACC 3D9AL 3WE6B 3WJLA 4LARL 4HF5H 3LN5A 3RWCB 3FTGA 4IOSD 4L3ED 2Z31C 1A6TB 4Y4KA 5IMLB 4LIQL 1JBJA 3WN5B 3ROLB 3ARSA 4XBGA 2YD3A 3PNWB 1DZBA 2GJ6D 4JPWH 3KYOB 1A3LL 4P4KD 1WT5C 2XA3A 3PGDB 3U7YH 2ZUVA 2FECL 1NFDA 5E2VL 1G84A 1MF2H 4XPFL 3G5XA 2NY1B 4IHOB 3PL6A 3SY0B 5I66B 4YFLF 5J13C 1ZLWH 3RX8A 3TZVD 1DBBL 1PJ9A 2OZ4H 3OB0H 1LDPH 5HGAB 5D5MF 3MRKA 1KJVB 3PF2A 4OLXH 5D1QB 4MHHI 1GJIA 2H32B 4CU6A 4QNPE 4Z7WA 3GI8H 3MODL 5TH2B 4NO2A 4OCLC 3MJ8A 5BRZA 3MUHL 2CLRB 2GJZB 3QPXH 4HH8A 4P0DA 1ITCA 5C07E 4DVRH 2R0LL 4FQLH 2ZOLB 1CICB 4WW2A 2FR4B 3DROA 1BFSA 3ETBF 5C07B 3VXPA 4BZYA 2X4QA 3ZTNH 4A2MA 3BQUD 5IHBA 4G7YH 2CGRL 1AGBA 4OV5B 4BKLB 2BVPA 5T1LA 4OZGB 3T8XA 3GJEB 1H3GA 3WHXA 4NKMB 1NBZB 5J56B 4DKEL 3QH3A 4LFHG 3TO4C 2V7HB 1G1YA 5EN2B 2Y6SC 4QTIH 4HIJA 1N59B 1IGMH 4TUJA 1LEKB 3CMOH 1MHEA 1S9YA 4XVUD 3QWOA 4RFNC 5HVHC 5L2KE 4QRRA 2A6KA 4CADA 5L2KB 1YECL 4EEEA 2A83B 1MCSA 3VG9C 1MLCB 3KPSB 4ZXBB 4F9PA 5E5RB 3CU1A 5I8OH 5GGSY 3LKRA 4FQQB 1KENH 1CL7L 1YQ2A 2DQEL 3K74B 3MRCB 4L29B 1QRND 2AI0L 5L6YH 1UZ8A 3E8UL 3KVQA 5T5NG 3TFKC 4XHJC 12E8H 5C09B 1J1PH 2Q8BH 2E9IA 3ULSB 1YNTB 5ETUA 4AIXA 3OKMA 4ISVB 3GBMH 2DM2A 3QSKB 4CN4A 1MJ7L 1SEBA 4MA3B 3T2NL 4ZOBA 1H3PL 2NY0B 3IFPA 1LHZA 4QXGL 5L2JA 4XVTH 3AVEA 2C4FU 4LSUL 2O5XL 5E95B 2OL3B 4HWZA 1MFDL 1PLGL 1T83A 1ULVA 1IM9A 4C59B 1SBBA 3HLAB 3QQ3A 2VLME 1UADC 1A4KA 4JO4H 1IGJB 1C16B 4Z8FH 2BRRL 4OD1H 1J10A 3VXTB 1CD8A 3EOAA 4HIHB 4D0BA 4DN4L 3CJJA 4LLWA 5DVKA 3ARGB 2NY1C 3QUKA 3W11C 3X14A 2VDKL 5IWLC 2R23B 3QT2A 2IBZX 5KVDL 4HGWA 4OQTL 3G08A 4JZJB 4H1LB 4Y1AB 4KXZH 2X4PB 4D9LH 2C1OA 2VDOH 5D1QC 3SCMB 2KL6A 3MRHA 1UXWB 5BS0D 3VWKC 1YYLH 4U1IA 4XVJL 2ZKHH 3ZDXF 2GK2A 4MA8H 3MRJB 3MROA 3D39D 1CICC 4AEFA 1HILB 4HJ0C 3CFBA 1F6AA 1I3GL 3IXTA 4GG6E 2N56A 3DO3A 4GG6B 4KH2A 5F1IB 3RL2A 5MEPB 3IFLL 1NMAL 4YBQC 4ZAKA 5H2BA 1RPQA 1AQDA 1F4WL 2VH5H 4OGXH 3NTCL 4MD4B 3HPJB 3QZWA 4GG8B 1BQLL 4Z76B 3OSKA 4ZFGL 5HHNA 2X4NB 1HQRB 4KC3B 1Y6KR 1WBZB 5B38A 5HHXL 1P4IL 1T66D 4L8SB 1HIMH 2HT2D 4NP4H 3IB4A 2EXYC 5D8JH 5GGTL 2C7UB 3EAKA 3VXSD 3G9AB 1I9RH 1IBGH 4LCWE 3TH2T 3MLXH 5K59E 4LCWB 2UZYB 3MJ9A 4XB7A 1JPFB 1B4JL 4JDVB 1N4XH 1TDQA 1QR1A 2CKBB 1FLRH 2VUOA 4LGPB 5BXFB 3TN0A 5C0FA 1DE4A 2JELL 5I8KH 4G7VH 5DD0L 2HLAA 5LJYH 2Y06H 3HZYA 1JL8A 3UBXB 1NEZA 2NY0C 4TSAL 3QNYA 3P30H 2NXYB 2DQHH 3MZGB 4G9DB 4XP4L 1OTSD 3SDYH 4RRPG 1AO7E 1ITBB 5KTEL 2NW3B 4IRJD 1AO7B 4D3CL 4MA1B 4XCYB 3U36A 4JY4B 2YBRB 2KQMA 4HK0B 2XFXA 3GI9H 1TZIA 3OAYH 2W07A 1MJUH 2D4FA 2ZCHH 5D2NE 3STZB 3EIFA 3NH7H 4RMWA 3TA3C 5D2NB 3O8XA 1R0AL 2MFNA 2AEWA 2HMID 1V5JA 2LU4A 4PRPA 4J1UB 3OX8A 1F3JB 5H94A 5GSRA 1Q38A 3ARGC 4POUB 5CHNB 2YRPA 1S7VA 5TPWL 1XIWD 1U91B 2EICA 3LD8B 4QCIA 2XZCH 4EN3C 1REIA 3NN8B 3ESVF 4QRSA 2V9TA 2ZUWA 4JN2A 3SCMC 3MCKB 3PXHA 1T0MA 2CDGA 2DDQL 4UV4H 4IIQB 4I77H 3AREA 5H37H 4D9RE 3ARXA 3EO1A 1RURL 1YEJH 3BDYH 1ZAGA 1O7SA 1CDGA 3FB5B 4FQXD 2FSEB 3L9RB 1CK0H 4P5KA 4ZTOH 4I3RH 4R4BA 5HHOB 5IBTL 3TT3H 5F1OB 4LCUA 5D7SL 2GITA 3MR9A 4MS8D 4DZ8A 3DGGB 1PX4A 2D4DA 5K59F 5IHZA 2BY3A 4ZS7H 4NC2B 4KRMB 5IQ9B 2NR6C 3FO0H 4D94A 2D0HA 2XIDA 4JB9L 4Q9CA 1RZIB 3DUUB 1G7JA 2A73A 4KI5F 1C7TA 3LRHA 4P2OB 3JTTA 2HFEA 4ODVH 1XFPA 1AY1L 4O2CB 1MCDA 1Q72H 5F7EH 3FQNB 3KXFE 3BN9D 2VISB 4L9DA 4Z95L 3MRRA 3SBWC 3KXFB 5FK9A 5EC1B 1NCAH 4E5XB 1S5HB 2V7NB 3DNKA 4ZNEA 3JVGC 4JHAH 4JFDD 4WWKC 4XWGH 4P46B 4XCEA 4L5FH 2NX5A 1QRKA 1GGIL 3SKMB 3LS4H 3I50L 4OD2B 1K2DB 4NDMB 3DBXB 1L7TH 1HXYB 5GRUL 2E8YA 1CXLA 1BVKB 4M8VA 1ERNA 4I5BB 2P8LB 5ISZE 1ZLWK 2YK1H 3EFDL 4GMTL 4J3XA 3HNTH 5ISZB 1PQZB 3DXAA 2NXYC 4G6AC 3D18A 3VRIB 5LBSH 1GAFH 1NC2A 4P23B 2UY7A 2E9BA 1AI1H 2A77L 1FV1B 5C0CE 4KROB 1QPPA 2IFFL 5I18L 5C0CB 1G0DA 4PRNB 3MRBA 5GGRB 2F54E 3NCJL 3FRPG 3DRTA 2W9DL 2F54B 5D2NC 4R4NC 1AJ7L 3ZLQC 5DLMH 2DJUA 2GQHA 3SGDI 2YD9A 4UIKH 4EOWL 4LAQH 3S34H 1CGYA 4LGSB 5DHVB 5AZ2L 4CVXB 3QNXA 2HH0H 3VXUE 3LD8C 2EKSA 2QQLL 2VLRA 3VXUB 5I19H 3H0TB 2CK0L 3WLWC 4LKXB 3QFJD 4XC3H 4OZHE 4V2CB 5EOTA 2PYEA 1SEQH 3O9WA 1FG9C 4IIQC 3MREA 3UZEA 2ESVE 3MRLA 3TIDA 2FO4B 4YGAB 1IVLA 2ESVB 3MYJB 1U8OB 3QG7L 1OD7A 2NW2A 1CGVA 2DQJH 4FP8H 4GS7B 5IT2H 5A2JH 2W0KA 5IB5B 4V1DE 5D4QA 1QQDA 2CRIA 4V1DB 4JPVL 1VFBB 2XPGA 3QEUB 4GKZB 3WIIH 4L4JA 5M7QA 1WWAX 2Q20A 1H8OA 1U8KB 3ZHLA 1DUZA 1LP9A 3BXNA 1F90L 2W0LA 3QJHB 3RX7A 4YO0B 4PTTA 3TYGH 5I2IB 4P2OC 1QSFE 5FDYA 3EOBB 5DVOA 1VA9A 1QSFB 5EORH 2H41A 1A6AB 3VDBA 3UTTE 1PEZA 3GZKA 2BCKA 3MLSL 3H9SA 3UTTB 4WI9A 1FL5A 4MJID 1WFOA 4P46C 4PGJA 5C08D 4DKDC 1OF2A 4QY8A 1OM3H 4IMLA 2V17L 1E28B 2Q3AA 3LEVH 4RA0C 5HVGB 4ZD3H 4Z7QE 5TGBB 5HHPB 2HT4C 1K6QL 4LL9A 2P49B 4KHTH 4CGTA 4NWTL 3SJVD 4XP1H 3P4MA 3VFNA 5LAXB 4DGYL 3KDMA 3BAEH 3MRQA 4AEIL 1J88A 4WI4A 1YDPB 2C9AA 5ESAB 5F96H 5IFAL 5LGKA 1OCWL 4P23C 5GRWA 4M6AA 4XXDB 4KROC 3HAEB 1EVUA 1XCQA 3OZ9H 5H37G 3MGOB 1WC7B 3OG4B 4EKXA 1MFAL 4NUJA 4LSDA 3BUYB 1KB5H 4BH7A 2RQ8A 1UYWL 2EC9T 4X99B 3DX6B 1U2CA 3QIUD 5CWSA 2X9XA 1RZFH 1ES0A 3T0WA 4F3FA 1U3HA 2MKLC 1A7PL 4PJDF 1FLTX 2KZWA 1FP5A 1DVFB 4N1CA 4YDIH 1S9XB 3VDAA 4PJGE 3OF6D 2YEZA 1I9JL 1T7VA 1BJ1J 4PP1D 3NABL 4PJGB 4PBXA 4PGCB 4PY8J 4D9QE 5I17B 1WBYB 5F7KC 4R7DB 1NFKA 4EDWL 4FABH 5DJ2B 1YEFH 5EOCL 5FKPA 4N5EC 1S78C 1AIFA 4OZFH 2BMKA 3MRFB 3W2DL 4J4PC 1CFTB 5DRWB 3HG1A 1YQVH 5JA8B 2SEBA 4PJ5D 1RZKL 1KC5L 4F33A 5I15H 4GMSL 3NGBB 4ZFOA 4AIOA 3RL1B 3VFVA 4W6WB 3DETC 4PLKD 1YEDB 6CGTA 5IR1A 2HKHH 3SDCC 5J89A 4FHBD 4OZIE 2MNUA 2VWEE 4MAUH 1AR1D 3GSOB 4OCXL 2VMFA 4P5TD 3PIQA 4XCFL 4F7MB 5J1SC 3MLRH 5CIPA 1W72L 1B3JA 1AP2A 1OB1B 2XKSA 2PTVA 1MAML 1GOFA 3BGFC 4ETQA 2GHWB 2NY3C 4IDLA 1NBYB 1HNGA 4NC0B 3UZQA 4WHTA 3PJSB 1FO0H 2DIAA 4M43H 5HVWA 4L3EE 3MRPB 4OCSL 4JDZB 2B0SH 4L3EB 1YZZA 3UAJC 3MA9L 4XAKD 1NAMH 2OP4L 3CD4A 4P4KB 1WSST 4HUUA 1M7DA 2WAHA 1A7OL 1CBVL 1DBJH 2PUQT 4ODHL 1JWMA 4L3AA 3WNOA 1AXTH 4PB0H 2X4UA 4XPAL 4MAYA 3FB7A 4XTRD 3VFRA 2HFFB 2IG2H 5IHLB 5IROA 2CLZB 5KOMC 3K2UL 3QDJD 4HQQL 2VLJA 1NCDH 2DD8H 3MA7B 1QNZL 2IALA 3QCTH 2N1KA 4G9FD 3RIFK 1C08A 3GUTA 4ODTH 4NHUA 2KQNA 4HD9A 2MHAA 4LVEA 5DUMH 1C5DB 1P6AB 2I07B 4ZTPH 3UJTH 2EH7L 5J3HC 3RX5A 5SV3A 1UXSA 1DVFC 2UYLB 1PY9A 5FV1L 4EI5B 5KSAB 4GQ9L 5GRJH 3WHE1 3ET9F 3CDYA 4XP9H 4UB0L 4ZYKB 2BC4A 4MNHB 3CVHA 4L4VE 5DWUH 4L4VB 2BNQD 4NC1C 4TNVK 4NQEE 3P0VH 4NQEB 1DCLA 1ZVSB 4YPGB 4WDIB 4J2XA 5EUKB 4XBEL 2H9GA 5HHME 5DTFB 1VADA 5HHMB 4R8WL 3O6LL 2DQUL 2XA8L 4FTVD 3L7EA 3CCHB 4NOBA 5D7LD 5ADOH 4NO0B 4UIMA 2ZUTA 5HXMA 4HPOH 2VWEC 4D8PA 3RHWF 3ARDA 4CW1A 4GLRI 5KS9A 2Q6WA 5D93B 2NZIA 1PZUB 3HHRB 2YUZA 3KLAB 2GFBB 3CAFA 2JKXA 5F9OL 2DWEB 1CDIA 5DI8B 5MEND 4QEGA 2IQ9H 4YHYC 4OCYH 4WEBH 5AAMA 3ZE2F 1CE1L 2P5WD 3O3AA 4KTDH 5J6GA 1S7TB 1RZJC 3C87A 2V9QA 4TSCH 2XWBB 4M62H 15C8L 1SHMA 5JOFA 1FH5L 1BPVA 3SEPA 2NNAA 3L1OH 4XMLH 1EMTL 2BOCB 2C3VA 3V5DA 1KJ2A 4X7CC 5D6DC 1T3FB 2YPLE 1NPUA 1N6VA 2YPLB 4ONHA 3N1PC 1BREA 2Q7NA 3RGVA 3Q48A 1UH4A 4P2QE 4X98A 5EB9A 5I1IL 4Y5XB 4ZQKB 1UQSB 4P2QB 4BZ2L 4ELKB 1JGUL 2Q76A 1YMMA 4OZFG 3MLVH 1NFDF 3L5IA 1QBLL 3AB0B 2IMMA 2Y1VA 5A40E 3RY4A 4OTXL 3OMZA 3GKWH 3ARWA 4OCNC 4QHKJ 3WL9B 5IB2A 3IGAB 1IGIH 2Q1EA 2RCSL 1GGCH 2H2SD 4NUGH 4G6JH 4Z7WF 1RIUL 2VE6B 2AKRA 4EI5C 4JDTH 5KSAC 2NY7H 2QSQA 4LLMA 5IK3B 2YD8A 5JMRA 4WW2F 1TMCB 3QDGA 3P73A 1FSKB 1IEBB 5JO5B 2EYTA 2OSLB 2E27H 3BMWA 2W92A 2EEDA 1BLNB 3AS0A 3VXSE 1PD6A 5LWYH 3HE6A 1PZ5B 4UILL 3FOLB 3RVWD 4YHIA 1NL0H 4HUWA 1BAFH 1D6VL 3HC3H 1BIIB 1OAUH 2XV6B 3JWNC 2XZAL 3QCUL 4Z0XA 5E6ID 2XZZA 1MQKH 4Y19A 3OJDB 2NXZD 4YHPB 5KAQF 4OUOA 3H3PL 4M5YL 4OFVA 4UINL 5D93C 2E6QA 5KVFL 1HKLL 4FQ2H 5I1CL 4YHLH 2R29H 2ORBL 3B9KA 2IPTH 1MJJA 1LD9A 3ARBD 2OYPA 3WS6C 2D9CA 5IG7A 2ADFH 4POZD 5EU7E 4X83A 4IRJB 3TPUB 5CILL 3U4BH 1Z2KA 3OWEA 3SE8L 4JGUA 1F11A 3FRUA 1BOGA 2AXGA 1X5JA 1MY7A 4UUJB 3VGAB 1A6WL 4JR9H 2DMKA 3GIZL 1ONQA 1QBBA 2J8UE 5I16B 4EBQH 2J8UB 4F9LC 1VEMA 4H8WC 1JHKL 1JHLL 1GVIA 4WI3A 1CG9A 4R7NB 2FX9L 2DRUA 4U05A 4HJJL 1AQKL 5EU6E 5ID0B 1K3ZA 2OTUB 4MDJB 2ZSWB 2E3VA 4M9PA 5EU6B 3JZ7A 2ARJB 3BX7C 4ZUWA 1MAJA 4Y5XC 3D0LA 2GK0A 5FO8A 1TJIL 3LPWA 3BP7A 1OD9A 5JR1H 4ZNCD 3MNWB 3DUHA 2V5MA 4L3CB 4Y4HB 4RAHA 4M3KB 3AB0C 4FQXB 3ESUF 5CEZD 5E2UL 3GSUB 4MCYA 2R69H 1SJEB 1A9BA 4M6OH 1CDUA 5IVZA 2XTJD 3SDAC 2CXKA 4R0LA 1II4E 2FX8H 1XGRA 1INDH 2DYPB