5FYLL

Crystal structure at 3.7 a resolution of fully glycosylated hiv-1 clade a bg505 sosip.664 prefusion env trimer in complex with broadly neutralizing antibodies pgt122 and 35o22
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
210
structure length
210
Chain Sequence
APTFVSVAPGQTARITCGEESLGSRSVIWYQQRPGQAPSLIIYNNNDRPSGIPDRFSGSPGSTFGTTATLTITSVEAGDEADYYCHIWDSRRPTNWVFGEGTTLIVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BG505 GP120 ENV ECTODOMAIN
publication title Trimeric HIV-1-Env Structures Define Glycan Shields from Clades A, B and G
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 33
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2016-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fylL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fylL01
3IGAB 4KJPC 4JFZH 4WI9A 5F93C 4F7EA 1I1AC 1PX4A 1F2QA 2QADC 4FQCH 3MBED 1MLCA 1CDYA 4WUUD 3ZE2E 2CDFA 3SCMD 5EUKA 3WHE1 1FZKA 4G9FD 1NCAH 1GVIA 5BZDB 5C0CB 1RUML 3BH8A 2RCSH 1T3FA 2V2WA 3VFRA 2B4CC 2CR6A 4M03A 2X4OA 4L3CB 3MACL 3RY5A 2ESVE 2EDFA 4LCWA 2VZ3A 2D7PA 3E2HB 4QRPE 1A1OA 3VWJC 2P24B 5E6ID 1FV1B 3D18B 3BW9A 4LSUL 4XCCH 1U3HC 4EIZC 2XICA 2G2RB 2HFGH 2FD6L 2OTPA 2PN5A 1YEIL 1KIPB 3K46A 3MACH 1I9IL 5JIHA 3ZSSA 1N6QL 4UT6L 1JV5B 3TO2A 3QCUL 1U8NB 1XF3A 1N0LA 3RL2B 5CGTA 5H35A 1FP5A 5IWLC 1AGBB 2Y6SD 3CK0L 4LSUH 2E27L 4OV5A 1NKRA 1BD2E 1HHIA 2PYFA 1M1SA 4OQ1A 2FD6H 2GJZA 2V6HA 3V6OC 4F2MB 3Q0HA 1I9IH 1N6QH 5ILTL 4XVUC 3VFGL 3VDCA 2HFFB 2LV4A 1YY8B 3K80A 3O6ML 4RZCB 4EQ2A 4X0KB 1IL1A 4MA8L 3CK0H 3BP5A 2E27H 2P46B 4L3EB 5C0JB 3BZFA 4QOKD 1AGEA 1L6ZA 5AUMA 4MZ3A 2QHRL 2VWEE 4HWUA 5ILTH 1NCCH 3MV9E 2IALA 3VFGH 4L8SA 1VKXB 2OJEA 3R8QA 1OAYL 3O6MH 4NRXA 3QT2A 4NJ9H 4PJHB 4MA8H 5EUOF 1CT8B 3MCG1 4S1DC 1UB5A 5F3HB 3FO1B 4X7TA 3QDJB 4NQEB 1NC2A 2ARWA 1H8NA 2NY7L 5FAAA 5CJ5A 2QHRH 3ECBA 4HJ0D 5HHOD 5KVMC 1OAYH 4AQ1B 2HJLA 4N90E 4KMLB 4PJ8D 3IVKB 4NFDA 4M9PA 1EA9C 3E6HA 2NY7H 5IB4A 1B3JA 1XF1A 4LCCB 5IMOA 4FQQB 5DC9B 3KDMA 2NZ9C 3RU8L 2EICA 3IDNA 2BCKA 4JDZA 4LKXA 1EHXA 3MV7E 2A77L 2YPLA 3DI3B 4RIRA 5BOPA 5J8OA 4NC1C 4N0UE 3S34L 4U1SB 4O4YL 4PJIE 1E6OL 1JZ2A 5D1ZD 1JP5A 1UEYA 4K9EC 3RWDB 1IAOB 1HNGA 2H45A 3TPKA 3WD5L 2GFBA 2XOTA 2YUZA 2IFFL 5GGQH 3LV3B 1BGXL 1F2XK 4Y16A 5EZJA 2A77H 1KT2B 3QO0A 1N5AB 2BXYA 4Z8FL 3S34H 1E6OH 3CAFA 3LEYL 5IHBA 1KJ2L 2VSCA 4JPWH 4Y5VB 4LVOC 3H9SE 4JZOB 1BZQK 3FRUA 3QUYA 4LDEB 1H8OA 2VH5L 3WD5H 1NGXB 1X5IA 1BGXH 2NY4D 4TNWF 4FTVE 4OB5L 5KS9B 3LKPB 2NCMA 3QUKA 3AU1A 5J13B 4Z8FH 3DBXB 4RDQF 3LEYH 1KJ2H 5D7JB 5DTFA 5I1GL 4YHNA 3HHRB 4AENA 2YPKA 3ARFC 3EAKA 1XH3A 4GRLA 2B5IB 1HCVA 1RAMA 3RVVC 3PGCB 4HH9A 4OB5H 2E5EA 4N9GA 4UT7L 1JN6B 3MFGB 1XGUA 2OQJA 5HGBA 4ZSOA 1UXWA 1UA6H 3S36X 2Z8SA 4LLVB 4WU7A 5L8LB 1ZLUK 1RJYB 2DQEL 4OCLC 3T8XA 2O61A 4LPUA 5D7IA 2MQCA 3T4AA 1G7HA 2ERJC 5I1CH 2I26N 5EG6C 4JRWA 4UT7H 2P42B 5EU6E 3GIVA 5E1AB 1KN2L 3D39D 3TJHD 2OMNA 2DWDA 1JL8A 1MCBA 2DQEH 3MJ9L 5JPNA 3ARED 3SDAA 5DJXB 1VCAA 2CXGA 5D8JL 1RV6X 3RIAF 2DRUA 3VFVA 4MLSA 5FYKE 3ULVD 1KYOK 1MFBL 5EO0A 1LQSR 1D5IH 1JF1B 5FGSA 2PKDA 4PJ7E 5L2KE 4NYLB 4YEEA 4JFDE 5J1AA 3EYSH 5BRZD 3CX2A 2XA8L 4HWZA 4M61A 3P0VL 5DHXB 5IK3B 1KJMB 1X5HA 3S98A 4HIJA 5KAQF 4F7PA 5F96L 4JHWL 1CFNB 3N85L 1MFBH 5DMGD 4JFYB 3H3PL 1C12A 1GZQB 2BVOB 2EDJA 1GGCH 2XA8H 4MQ7B 1KJ3L 4JY6A 3P0VH 5FGCE 3JTTA 3KYMA 4DKFL 4JFED 1CFQA 1CGYA 1AGCB 3E1F1 3O0RH 2ZOKA 3FT3B 4JHWH 5F96H 3SEPA 2F74A 3N85H 4C55A 1QLRB 3QO1B 4P2YA 1YDPB 3BP4B 1ZKAA 3H3PH 3VXUA 3KPRD 1SJEB 1M7XA 3ARGB 1G0DA 5SX5K 3MA7B 3LB6D 4JKWA 1KJ3H 5B38A 3M45A 4QWWD 3GHEL 4DKFH 4LPTA 4UV7L 1P84K 2KBGA 4NN5B 2QR0B 1AGDA 2GYSA 5J3HC 3S3SA 3S5LG 2AK4E 3RY6A 1AP2A 3STBA 4CMHC 1NAML 2W0FA 3WNKA 3A6BL 1I7UB 4GJTB 1I9JH 5C1MB 1BFOB 4LIQE 3WSQL 1JFQH 4V2BA 3GHEH 3MQIA 3MJ6A 5CWSA 1BQHB 1G6RL 2DM4A 4UV7H 3GUTA 2F54A 4GAYB 2XNAA 4XNZB 1KFAL 4M3JA 4XPFL 4LBEA 4EN3D 3KNBB 3A6BH 4KJYB 4J3WA 5F6IB 3GSQA 3V6ZB 2OL3B 3QG6A 5HHMD 4IS6B 1G6RH 4FXGA 4HMEA 1RK0B 4E42B 4P2CG 1MNUL 4IHOB 2F5BH 5MEPA 1KFAH 1T20B 2VR5A 2JB6A 4XPFH 3WN5A 3QFJB 3VRJA 3F62A 2VXTL 1F11A 2HKFH 3UO1L 4QXGL 2VABA 2EE6A 3DVGA 4R97B 1HN1A 4X99A 2HVJB 2NW2B 5JHDE 1AQDB 1KENL 1MNUH 2IJ0C 4OZGB 3UTQA 4P57A 2W0KA 3KYOB 4UU9B 1U8MB 2OTUB 2VXTH 1I9RL 2P49B 2E7LA 3PJSB 3UO1H 4QXGH 3OKLB 3HAEA 2DYPD 3Q1SL 2R4SL 4U3XA 4P23D 1NBZB 4AIZA 4ZFFB 2BNQE 1KENH 1OD7A 2PW1A 1C7SA 3L7FB 4YIQA 4LCUA 1QEWB 5DO2C 4LVHC 3PIQB 1GYAA 1J8HD 4LFHD 4RDQG 1I9RH 1VSCA 2DQJH 2IH3B 3Q1SH 2VB5A 2R4SH 4HIHA 2KQNA 2XTJC 1U36A 4M6OL 5K9JL 4WO4B 5JLZB 2XG4A 5DRZB 3DJ9A 4YDVB 2NY6D 4C59B 3ROLA 3MOAL 4U1LB 3WFHB 3SO5A 3WJJA 2QKIA 3QFDB 5ITBL 3DXAE 4NKDA 1ORQB 3FOLA 3HR6A 4V1DE 3HE7C 4Q2ZA 5DHYB 3C6SA 1GGYA 2ZUXA 5K9JH 1F97A 3T0AA 3HB3D 4EQ3A 5IB5A 5IW6A 4UI2A 4JFXA 4OZHF 5ANMA 4S10A 4JFOA 3IDMA 3QNYB 5ITBH 3SY0B 3TBVB 3TO4D 3L3GB 3MRRA 5BW7A 1P7KB 3TA3A 4ZAKD 1KPVA 3KLAA 3DRTB 3SGKC 2NX5D 5FYJD 1YPZF 1VB9A 3E3QC 2LABA 4TVPE 2A6KB 2J7LA 4P3DB 2ICWJ 4WU5B 1VACB 3MRKB 1A6ZA 3GBNL 2IF7A 1U8KB 1CICC 3O45A 4I18B 1UJ3A 2C3HA 2W07A 3BISA 4Q9BA 5GISH 1EUTA 2YSSB 4HIEB 4P48A 5KAQG 2H8PA 1D9KB 1EHAA 2C1PA 2JCCB 2A6JA 4YPJA 1IJ9A 1KCUL 5JW4Q 4LCWE 4KI5F 3K7UA 5IOPA 5KVDL 1U8QA 1WT5C 3GBNH 4XWGL 4EI6B 3MJGX 3V52L 4HIXL 5HI4D 3K4DA 4POUB 4ZXBC 1HI6B 3LS5L 3MBEB 1EX0A 3E8UL 1A9BA 5AWNL 4WUUB 4MAYB 1I8IB 2CRMA 2GI7A 1A4KB 4G9FB 4WW2B 5KANG 4WHYG 1S5HB 3MUGA 5ID1B 1KCUH 3SDCC 1IEAA 1BZ9B 5JZ7C 5KVDH 3BRGC 4XWGH 4NO2A 1CXFA 3V52H 4HIXH 2C7UB 1WAAA 3SJVA 5EIVA 3CDGB 3LS5H 1IGYA 3E8UH 4KZDL 5AWNH 2DKSA 1KPUB 1CLYL 3U4BL 1T1WA 2Z91A 3AY4C 1ACYH 2YKLL 3HNTL 1TIUA 3NPSB 1SMAA 2EECA 1X5AA 3MRDB 4RRPA 1NEZB 4KKAD 4EXKA 3ZE1F 3G5YA 1KTKE 2PYEA 2X89D 4LRIA 3VXPA 1UZ6F 4FG6C 5HVWA 5IV2A 4DVRL 4KZDH 2D0GA 4R0LC 1I8MA 1W0VA 4PJGB 1B90A 1CLYH 2YZ8A 3U4BH 3G04A 3O81A 2Q7YA 3DI2B 3HNTH 1MCHA 3BKYL 4PJFA 2NR6D 3FAXA 3WNPA 4D0DA 3BGFC 2ZSWB 2Z8WC 2FLBT 4XZUA 4RQQB 4LCYB 2Q76B 5GRVK 3MFFA 4DVRH 3QPXL 5IF0B 1XFPA 3QQ4A 4Y4KD 1MFNA 2FIKA 3SKMA 5GRJL 3BESR 3DX6B 1XIWD 3BKYH 5GZNC 2WIIB 5FA4B 3HMWL 4P46A 1FLRL 5C8JB 4LSDA 2JJVA 1M7IA 4Z7QF 4IIQA 1FZMB 4ETYA 1MUJA 1W2KT 3ARXA 2N7BA 4ZFGL 3QPXH 1OTUC 2FATH 2DM2A 2CDGB 4PJDF 5I1DB 3HUJA 4R2GB 3ZHKA 3G08B 3GJEB 2G5BB 1IBGL 5GRJH 3LEXA 3EJZD 3HMWH 1FLRH 3P4NA 4MCYB 4ZYKA 1A5FL 1LE5B 4N9OB 4ZFGH 5CCKL 3LPWA 3LS4L 3DURB 2CLZB 2VR4A 1G7IB 1IBGH 2YOCA 3LEVL 1QQDA 1U58B 4PJ8B 1RUAL 4UUJA 1P4LB 5BS0D 1NFIA 2P45B 3NCBB 1ZT7A 3MO1B 1A5FH 1GZPA 1UEMA 4WUKH 5E5UB 3GSWB 1CGUA 4Y4FC 4MS8C 2AXGB 5CCKH 2YA2A 4HPYL 5C7XL 4GW4B 1NGZB 4XH2A 3ILPB 1CE1L 1EZVX 3LEVH 4OQTH 2GTWB 4M7JL 5EU7E 4P5MA 1SJXA 4Q97A 3FFDA 2JJWA 2DBJA 2B0SL 3P3YA 1N59A 5T1MA 3IFPA 3KWWB 5K59F 1U2CA 1CE1H 2B1HL 1NCDL 2E9WA 4M7JH 1FL3A 2A6DA 4FFWC 1FG9C 3OGCB 3FN3A 3RWFA 4F3FA 4Q7DA 4OAWB 4BQ8A 5J57B 4ZSOE 3L6FB 3SKJL 1NCDH 5TDOB 4A6YA 1KCLA 2NY4B 2F9BT 1RZ8A 3O3AA 1IQWL 2ZCHL 5D7IE 2WWMD 4F7CB 1C5CH 2FJHA 2VQUA 2Z93A 3NIDF 1ZLUH 5GRUH 2MSPA 2EE9A 3PDOA 3SKJH 4U49A 4Z0XB 4FNLL 3BDXA 1IQWH 1OTSD 4Z76A 1VGKB 2ZCHH 3UYPA 5DHVA 2O5XL 3VXTB 1QKZL 3LRHA 3ARQA 4Q9RL 4LAQH 4ONFL 5LWYL 4PJBF 2E9BA 1YEFH 4QF1B 4UDUA 4ODUB 5KSAB 3C08H 3P11L 3B2UD 4FNLH 5FOJA 3U0TA 3O3BB 2VQ1B 1DP0A 3FT2A 3MV01 2WQRA 4A2LA 4KJPD 5DSCA 4LHUG 2HT3C 4EIGB 4GRWB 5E7BA 2VLLA 2O5XH 3QUXC 1NDMA 1QKZH 2CIKB 4JGMA 3D39B 2QADD 4YDJB 4Q9RH 3ULUE 4ONFH 5LWYH 4XNUH 5CJQL 3NAAL 1DJSA 2IG2L 4TSCL 3N1PC 4WEBL 3AREB 2JJTA 3PWNB 2CKBB 2HLAB 3O8XC 3P11H 2NXYD 4PB0L 4G80B 3BPLB 4YHML 5EB9A 4MA3A 4NQTA 4HUXB 5BCAA 4FQHB 4R4FL 5JIIA 4R8WH 4W4NA 1J11A 4HFWA 1HHKA 2VN7A 4KDVA 4R96B 1RZKC 4HG4K 4JKPL 2BVPB 2MWCA 4GOSA 4KHTL 4C56D 3FO2A 2EYSA 1ZHLB 3EDJA 3CDFA 2V5MA 5CJQH 1F4YL 5CEZD 3LAFA 3NAAH 2DQCH 2IG2H 3K3QA 4H26B 4WEBH 2W9DL 4GG8A 1HHGB 3VXUE 1EEYB 3WS3A 3RL1B 2A83B 5B38G 5JDSB 3UPCA 4GG6E 4YHMH 5E9DD 4EDXB 4R4FH 1MAJA 3P9MB 2J12B 3ES6A 4XBPA 4Y7MA 4HIIB 3RDTA 3BMVA 2IQAA 4GKZB 5I73B 2I07A 5CP7B 5SX5H 1OCWL 5IVOA 2QEJA 1F4YH 5T3XD 3AXLB 4NHUB 5GSRA 3IU3A 3RX5A 2W9DH 4Z6AT 4PJEB 1MCPL 4F33A 1FYHB 4XXDA 4U1JA 2D31B 4DW2L 5HD8C 1OD9A 5IJKA 5HTSA 1AY1L 2VR9A 1DE4A 5JNYB 1J0JA 3KPRB 2F54E 4M8QA 4G8FA 1KPRA 1LP9F 2F53A 1R6VA 3D0VB 4XVUD 5DZLA 1QSED 4XAWL 1NJ9A 4GXUN 2H41A 2BVTA 3B9KA 4ORZC 2HG5B 2AABL 1ZEAL 4DW2H 5J1SC 5E08L 1AY1H 1DVFA 3KPTA 4JN1L 3MJ9A 4UQ3B 2XQYK 4YO0B 1CFBA 3DRQA 3RWJA 1MVFA 3KPOA 2MQ0A 3DV6B 4XAWH 4HZLB 4OSUH 5FO7B 5D7KD 5EIIB 3D85D 4XCYB 3MLTA 3T0EA 2YS4A 3VXQB 4APQA 5A2FA 2AABH 5E08H 4K8RL 4GW5A 3MX0A 3G5VA 3H6JA 4EN3B 4JN1H 2ADIA 1UQSA 3A67H 1I3RB 5MHSE 1GGIH 5D2NB 3CVIL 1A7QL 3T4YB 2XPGA 3IYLW 1LE9A 3HAEG 1ES0A 1NC4D 1HQ4A 3HI1A 3VH8A 5HHXL 3OKOB 5GJTL 5IROC 1KLUA 4K8RH 1QBMH 2RAMA 3C5JA 4DQOL 3HPJA 4JG0L 3UDWA 3D87B 2LU4A 4UQ2B 1QFPA 1TPXC 5TGBB 5CJ8A 3CVIH 1A7QH 2BSSA 2HA1A 2QSCL 2UZYB 4IOIB 4HXBL 5CZVL 3INUL 4U1GB 1RZJC 2I9TB 3AAZA 1OLLA 5GJTH 4F37F 3KYAA 4ELMB 3BGAA 4DCQA 3QIUA 4DQOH 5CEXA 3N1MC 3VWKC 5I8CB 1P1ZA 2ARJB 4YH6A 1UWEL 3QNZB 1X4XA 4MJ4A 1AHWA 3CLEL 5MEOB 2QSCH 4P23B 1WZKA 4HXBH 3T1FA 1TDQA 3WXWL 1QACA 1KB5B 2FB4L 1NAMA 2OL3L 4I0CC 4TTDC 3S36L 1K5NA 3KPPB 4PRHA 2UWEF 1D5BA 1J8HB 5C09B 1UWEH 1FVCA 1DBML 4XCFH 3CLEH 4CVXA 3AGVA 3TBSB 3M8OL 1CQYA 3RGVA 1MIEL 1QHPA 5ANME 4L8CA 3WXWH 5FK9A 1J0KA 3TP4A 1W0YT 2FB4H 1PG7W 5HHPA 2OL3H 1DN0A 4RMTA 1WWBX 3S36H 1Q38A 4J8RB 2HMIC 3QIWA 4I0KA 3RTQA 1LMKA 4X6CA 4ODHL 1DBMH 1QBLL 5E8PB 5M94B 4MD5A 2X1OA 3M8OH 2R1WB 1MIEH 1WIUA 3ARDC 2VDPH 3PHOB 3IJSA 4PYHA 3EYQC 1A7RL 5GGRY 2FECL 1U91A 5GGRB 3FTGA 4P9ML 3KPSD 5EO9B 4HKBB 1QBLH 3PWPD 2DWEA 2MCPL 3BKML 3L3JA 4X4XB 4F8TA 4QRRA 4L4TA 5EN2B 2H2SC 3DHMA 3VD7A 5DRNA 1A7RH 1HSBB 3AB0B 4MNGB 4J23A 1MCRA 3D1MC 5EO1A 3MROB 4P9MH 2GHWB 2C1OA 3LY6A 1NBYB 2YD2A 2EC8A 3GZKA 2PR4L 1IAKB 2FWOA 2W9EH 3FQTA 1O7VA 2MCPH 4N1HB 3WFEL 3BKMH 5GGTL 5GS1C 3NFNA 4X6BA 1QBAA 2XN9A 2M8XA 4Y88A 3UEZA 1A21A 1K8IB 1RIVL 3DX8B 1L9MA 1WAAE 2WANA 4Z5RA 1SMOA 3HZVB 3ZMRA 1Y6KR 4PRIA 5ESAB 3R1GL 2PR4H 5A16A 5KTEH 3WFEH 3RI5K 5GGTH 2Y25A 2BRRL 1FNSH 4IRSC 3CFCL 4PRBA 3BSZL 2R56L 3MYZA 2BC4A 1WK0A 1XF4A 2AJUL 1RIVH 4UOJA 2PYEE 4JY4B 3W82A 1S3KL 1RSFA 4JREB 4XX1G 3UJIL 4OFIA 1TZGH 5LGKA 4OFDA 3EYUH 3C9NA 1FO0A 1NBQA 3R1GH 5IVXB 2W92A 1CFVL 4XX1E 2Q7NA 4XBEH 1WFTA 5ELIA 4M5YH 2BRRH 2X4QA 5GRVL 4PJFE 3BSZH 3QUZD 4ZUWA 2R56H 3TPUB 3V5KB 4NQSB 4BFEA 5HYSA 1CVSC 1J1PL 1S3KH 2VMFA 1HHHB 1CQKA 1FE8L 4GRMB 2DKMA 1GL4B 4OUUA 4KRLB 4YZFE 1PJ9A 1BJ1H 5GQBA 1YMMB 1T4KA 1BJMA 4ERSL 5C0EB 4OF8A 5E8DL 3CSYB 5I76A 5J3HD 5IHZB 1YECL 3GSXB 5DC0A 3TJEL 3MGAA 1P53A 4I13B 1FE8H 1NMBH 2XIDA 4LLYA 1J0YA 3HUJE 4O2CA 5CHNB 4BK5A 1VFAB 1DQTA 2P5WA 3O3EA 4YLQT 4Z7UA 4OZIA 1UM5L 4JPIB 3BP6B 2F58L 1IAII 5TFSL 4LLUA 4K07A 2OZ4L 4ERSH 2CRIA 2JELL 2XYCA 2BFVL 3B9VA 4P99A 2FHCA 5HYJD 1YECH 2YN3A 1MWAH 1XIWB 1ZXQA 1OAUH 1QFUL 2J8UB 5CJBA 3TBTB 3WKNA 2F58H 3L9RA 3UTTA 3MUJA 3UJTL 2JELH 4PG2C 2BFVH 2W1NA 3KJ4C 5FUOL 2YK1H 4PGCB 4Z78B 3EFFA 3O4LA 4PGZA 2C4FU 2C3XA 1QFUH 2OI9C 3QZWA 4PRAA 1MHHB 2DQHL 5CEYB 1R5VA 3D25B 2DI8A 5LXGH 3DPBA 3NACL 4PLNC 3WE6B 3UJTH 5FUOH 5F7DA 3JWNC 2VIRB 3T08A 5CJXA 5GS0L 5BS0B 1T2JA 1AQKL 3R8BB 2DQHH 3IGAA 2OYPA 2CIIB 5CKGA 2L4OA 1TNMA 3C6LC 3BIAX 3H3KA 1J8KA 4H20H 3O2DL 1TCRB 4PR5A 4AEFA 5DVLA 3NACH 1HIML 4ODVL 2UY7A 5C0DB 3QXDB 3EFDH 2P44B 5DO2D 5FHBH 4LQ1A 5GS0H 2HH0L 3M1BB 1T0NB 1AQKH 5BZDA 5C0CA 3DV4B 2VWEC 1I4FB 2FH6A 5GIRB 3W11D 1HHJA 2VAAA 5F6HJ 2XTJD 2AJSL 3O2DH 2JB5L 4HWEL 5HGDB 2CDEB 4U0QB 1HIMH 4ODVH 1N26A 1EH9A 4L3CA 4YHKL 2GTZB 1AJ7L 3CCHB 4WV1C 4R4BB 4JJ5B 2HH0H 5EOTB 5F44A 2P24A 1S5IL 3IAQA 1FV1A 3D18A 2FEDC 3D5OF 4RSVA 4HULB 3LKRB 5CSZB 5HHNB 2NY0C 2AJSH 2G2RA 4HWEH 1FAIL 4HJGB 4X6CF 2YHGA 1KCVL 4KV5E 4YHKH 1FVDB 1JV5A 1AJ7H 1IKFL 4OT1L 4ZO7A 1YEGL 4N0YH 3RL2A 5HYFA 4JEGB 3B4NA 1S5IH 1AGBA 1MCKA 3MUY1 4OCXL 5LGJB 1WICA 1I1CA 4BKLB 1KIUA 1IQDB 2V17L 5FA3A 3C09B 5ADOL 4CU6A 5D72L 4MJ5B 4QEGA 3MRLA 4X7SL 2BSTB 1IKFH 4POZC 4OT1H 4XAKE 2HFFA 1YY8A 1FG2A 2Z8RA 4RZCA 4X0KA 4OCXH 2OX5A 1X5GA 1P69B 1UJTA 2X9YA 3FN9A 2R23B 2IAMD 4JAMA 5C0JA 3O4OB 2V17H 3FONA 4KK6C 4GLRI 3ZHDA 4DK6A 5D72H 5ADOH 3U4AA 2IC2A 2K3TA 4X7SH 3OKEB 2EDWA 4HS3B 4P5KA 4OKVB 4BSWB 2E6PA 4L9LB 4PJCF 5JXEC 1VKXA 4MQXC 4NUGL 1FLTX 3H7BB 4PJHA 4JQIL 1CT8A 4Y0GA 2V7HB 5T1DL 2GITA 3VXNA 1QLEH 1I1AB 1JPST 3EW3B 5F3HA 2QADB 3FO1A 5AZEL 5DC4B 4UNVA 2DLGA 3QDJA 4K7FB 4NQEA 4FQXD 3IFOB 3ZZ1A 5ACZB 3OR6B 2NXYB 1Y6NR 4UTBL 3SDCD 1A7BA 3IDYC 1CXHA 4NUGH 1MCCA 5D93C 4JQIH 5JZ7D 3IVKA 3BH9A 3ZDXE 1TTGA 4C56B 3I3DA 1F4WL 1SEQL 1HZHL 4NSKB 4HH8A 5F8RC 2CUMA 4LCCA 4LF3B 4FQQA 5IBUG 3VWJB 1AGFB 2F53E 4NM4L 4UTBH 3FQRA 5E9DB 1MREL 4U0RB 3WLBB 2R1XB 1U3HB 3TGXA 1YZZA 3QIBC 5LCVL 3D9AH 1SEQH 1HZHH 3IDJB 3S4SB 1R3HA 4U1SA 2WNGA 1F00I 2J5LC 4U7KA 5JHLL 2FX7L 1IAOA 4M43L 1CXEA 1MRFH 1J0HA 4UIMB 1X44A 4NM4H 1MREH 3LV3A 4XTRC 5LKNA 2NNAB 1KT2A 1OP9A 5LCVH 3ULVL 3LN5B 4IDLA 4UNUA 4IOFC 1Y0LB 4Y5VA 5JHLH 4GRWH 2FX7H 4JZOA 2Q6WB 3T3ME 4Z7UF 3ISWA 4M43H 2LAGB 3OX8B 1NGXA 4DGIL 3LSOA 1IGTA 1L0XA 3KGRA 2IAND 4WFHD 2UYLB 5KS9A 4JO3L 1C16B 4Y4HC 4KKCC 3MA9L 3DBXA 4I48B 2AJZB 1OSZB 3D85B 1IGML 3SBWC 2VRAA 2RGSA 1JZ3A 3MODL 2Q87A 3U2SB 5ETUB 4DGIH 4LPYA 3BGMB 3ARYA 3OKMB 5JIKA 3A6OA 3C60D 1JPGB 2QL1A 4MD0B 1NCUA 1KC5L 1JN6A 4G8GD 4O9HL 3MA9H 3C8KB 3RZCA 5DMJB 4LLVA 1IGMH 1RJYA 1NC4B 3MODH 2CK2A 3ARPA 3ZT7A 3CFKB 2APVA 3QEQD 4KK5D 3SE3C 1WBYB 5HDBE 2DLHA 1NMCC 3HI6L 4HK3N 4UB0L 3L1OL 4WTZA 2DD8H 4GRLD 2FIRT 5EBWB 1KC5H 4RWYL 4O9HH 3Q6GH 4ZQKA 5CD5D 1H5BC 5E1AA 5D9SB 4L1HA 4PRHE 3DMMD 1Z0MA 1RJLB 4KKLD 2CUHA 3D3VD 1JGDB 5DJXA 3R06A 2DLFL 4OIIL 3F8UB 4X5WB 3PE9A 5JIPA 3HI6H 4UB0H 3L1OH 3PL6C 4NO5B 4RWYH 1JF1A 2VZUA 1OOAA 4YGAB 3QXWA 1P5VA 4OI7A 3VGEA 5IK3A 1KJMA 4E0RB 2DLFH 4OIIH 1MY5A 4JGJA 4FQPA 1ROWA 2VISB 1CFNA 5DJAB 4FFWD 4HV8B 2X5PA 5BVJB 4KI5D 1JZ4A 4JFYA 2XZAL 1D6VL 2BVOA 4LVOB 2VLKB 1Z0NA 4KY1L 4MQ7A 2X09A 4BM7A 5KOMC 1VENA 1T7WA 3GSNB 1AXSB 3STZB 1WBZB 4QRRE 3FT3A 3GO1L 1W72B 4TRPH 1QLRA 1X5XA 3QO1A 1YDPA 4P9HH 1NSNL 2XZAH 4LHUD 5GGSA 1QR1B 1SJEA 3ARGA 3LVEA 3MA7A 3FB7B 4KY1H 1G9ML 4X5LA 2ZSVB 4L9DA 2XKNB 4GS7C 3PHQB 3KPSB 3V4UL 5L2JB 2QR0A 2HLFC 2MQ3A 3GO1H 1A14L 4RGNC 1CN4A 4LQFL 4S1RL 2ED9A 2XN9E 3ARTA 1A3RH 2ATPB 1NSNH 4I4WB 5IMMB 3WJLC 4DZBA 1KB5L 4JGUA 5DK0B 1S7SB 1I7UA 1R3IL 1G9MH 1SM3L 4PRIE 3CD4A 4XCEB 4HX1B 5EA0L 1B0GB 4MCZB 4J3UA 1KULA 4CAGA 1K3ZA 3TVMA 3V4UH 2E7BA 1A14H 1N0XH 4S1RH 2ZG1A 3DUSA 5FGBA 1AD0B 1LEGB 1KB5H 1PAMA 1CD9B 2ZWLT 5HY9B 4JQXC 3KNBA 4KJYA 1R3IH 3V6ZA 2VLME 3RVXC 2OL3A 1AKJD 1NLBL 2XT1B 4QGYA 1LNUB 3CFBB 5EA0H 4IS6A 1RK0A 4E42A 4D2NA 4IHOA 1U8JB 2B2XL 2DQIL 5HYSG 1T20A 3RGHA 3S96B 3ZSTA 4Z77B 1DBBL 3VDAA 3T65B 5B4MC 1NLBH 5DI8B 1MH5B 4PJ9C 5F8QC 2GAZB 2HVJA 2NW2A 3B8YA 1AQDA 1QFWI 4JZJA 4H1LB 1RJCA 5F3BB 2BOCB 4OZGA 2B2XH 2DQIH 2P8MB 4U4BA 3KYOA 3MLXL 1U8MA 2Z31C 2OTUA 4PV8B 5I18L 4HK3J 1DBBH 3W0WD 3PJSA 5FYJL 3RWCA 3OKLA 5KSBF 6CGTA 4OF7A 3OKKB 4Z7OE 4OGAC 4P4KD 3QUZB 1NBZA 2P5WE 4NKMB 4ZFFA 4OZIE 5EZOL 4L4VD 3L7FA 1QEWA 4ODTL 4WI8A 6FABL 3PIQA 5I18H 4LASL 4RMQA 3GSUB 1F6LL 1GJIA 2IH3A 1MJUL 1IEHA 1DQLL 1S7UB 1TXKA 5D71L 2QQKH 1J0ZA 3BVNB 4GT7A 1T89C 4WO4A 5GZOD 5JLZA 4Y5XB 5DRZA 5EZOH 1NQBA 2R0WL 4YDVA 4AEIH 1SY6L 3GJFH 1L7IL 3PV6B 3UTTE 5E2WL 3WFHA 4ODTH 6FABH 1CGSL 3QFDA 4LASH 2DTML 4P2OD 1Z5LB 3O4LE 1YNLL 2VZVA 1ORQA 4JHBA 3QZWG 4PGEB 3WS6C 4UBDC 2PW2A 1DQLH 4HHAB 5D71H 5DHYA 2V5SA 1TETL 5BZWB 4Y1AE 2R0WH 1YNTB 2MMXA 5IW3A 5HYJB 2VKWA 1L7IH 1H0DB 5E2WH 3DVIA 2BHUA 4XHQA 5I2IB 2XTLA 1CGSH 1UB6B 4OF6A 4DUWA 4KTEL 4MDJA 4HC1H 3HC0A 3QNYA 4RX4A 2RFXB 4YQXL 1YNLH 4MGXA 3L3GA 1IAIL 2VLRB 4I3RH 3CFJB 3SGDI 4Y89A 2J8HA 3DRTA 2A6KA 4P3DA 4KTEH 3MOBL 2WWKT 1VACA 1YYMH 2R29L 3MRKA 1F6FB 1YNKL 1PZ5B 2P5ED 43C9A 4MXVE 1U8KA 4I18A 1E4KC 1IAIH 2E6JA 4PRDB 5C0CE 4N8VB 2YSSA 1K4CB 1IRAY 5KW9L 3HC3L 3WHXB 4BFIB 1X5FA 1LEKB 2G5RA 3HNSH 2JE8A 3LQAC 2XRAL 1J86A 1ADQA 2R29H 1HCFX 2EDRA 3IS1X 4EI6A 1BWMA 1JCKA 4DKDC 1HI6A 3MBEA 1INDL 3RKDC 4WUUA 1I8IA 4LVHB 3SCMA 4JHAL 4G9FA 1A4KA 4WW2A 5I8EB 1S5HA 4X6FB 5ID1A 5ICYB 5EWIL 1JYXA 2OZ4A 1BZ9A 4CU8A 2XTJB 3EOBB 4GAJL 2C7UA 4ETQB 3CDGA 5HVHC 3JZ7A 1INDH 4W6XB 5C0BD 1EHLL 1KPUA 5FB8B 2HMID 1I7TB 4GFTB 1L0YA 4JHAH 4UTAL 5ALCL 3VW3L 3HC4L 1KELH 3GI9L 4E5XB 5E6IA 3MRDA 2ZG3A 3WIIL 3ZYZA 4GAJH 4RFEA 3L3IB 4JDVB 1UKTA 2DOCA 4ZPTB 1EHLH 4PJGA 5LVEA 2IH1B 3OB8A 2KQMA 3RPIB 5ALCH 3VW3H 3GI9H 1E6JL 4DOHB 3WIIH 2ZSWA 3GSOA 2EDXA 2EEAA 4RQQA 4LCYA 3SO3C 4PJHE 3NABL 1RFDL 1CDHA 4D0CB 3VGBA 1LO0L 5E5MB 4TOYH 5IF0A 3CX5K 4NQEE 3U4EB 3DETC 4NKIL 3QR2A 3PP4L 4X8JA 3ZT5A 5E1HB 2WIIA 5C8JA 5J6GA 3BAEL 3MRMA 1P84J 1FZMA 5CP3H 3NABH 3L5WB 1RFDH 1A47A 5C3LD 2EC9U 2WP3T 4NNYB 5GGUA 3RJDA 2CDGA 5I1DA 1LO0H 2CO7B 3G08A 3GJEA 2G5BA 1QD0A 3ZDYF 2KPNA 5BJTB 4NKIH 1XCQB 1UWGL 3DYOA 2QQNL 3CC5A 4XBGB 1LEIA 1MI5B 5L0QB 1UH4A 3BAEH 4OUOA 4J3VA 4MCYA 1LE5A 4FQXB 4WI3A 2OSLB 4D9LL 5HHOA 4DZ8B 2J1KA 3SDCB 2CLZA 1RU9L 1U58A 1UWGH 4PJ8A 2QQNH 1P4LA 2AJXL 3OJDB 3BPNC 2LAAA 4QGTA 4ZUTB 3P0GB 5I8KL 3MO1A 3ARUA 5DRWB 3GSWA 2AXGA 4D9LH 5J11C 4WFGD 4Z7VB 1YJDC 1EO5A 4GW4A 1NGZA 3ILPA 1JZ5A 1FSKC 1RU9H 1I1RA 3ZKNC 3O41B 1DLHB 2GTWA 5F9DC 4XNQB 3U83A 2AJXH 4OIBA 3FHAA 1DQJB 2X1XR 5I8KH 2VZ1A 4R0LB 5D1ZA 5KS9E 1U6AH 3KWWA 1Z3GH 4DAGL 3JV0A 1V7NL 2EIDA 3JV4B 4AZ8A 4HUWB 4GBXC 4MQTB 3ULUC 1SJHB 1F8TL 3BGFB 1FNAA 1T7XA 1L0QA 1KTDB 4Z7WB 5DA0B 3W39B 3ALWA 3BWAB 4NCDA 4N1EA 2X4SA 1F3JB 2B4CL 2OM5A 1EO7A 4JANA 4DAGH 5HSFA 4ONHA 1V7NH 4PP2B 2KUTA 3L6FA 5CEZL 5TDOA 1BVLB 3FJTA 3G9AB 1K8DB 2IANB 4UDTB 1F8TH 1KV3A 2COQA 1F45A 4WTZG 4QRPD 4TN9A 2ZUYA 5DUPL 3ZTJH 4F7CA 1RMFH 1KEML 2B4CH 4N1CA 4OGYL 3Q48A 1P7HL 1JGEB 3BFOA 5CEZH 1EFXD 4Z0XA 2D7OA 3C60B 5T33L 3NCEB 4OLWH 1IC5L 4D8PB 1YMHB 1VGKA 5D5MB 4ZG1A 1TMCB 5DUPH 4OKDA 4LK4A 4OIAA 3IS0X 5DVOA 4Y2DD 5D7SL 1KEMH 4LSPL 5DFWH 5B3JE 3EOAB 4ODUA 3QEQB 5SX4I 2X4UB 4YHIB 1QA9A 3O3BA 1WBXB 2VQ1A 3PWUB 1D5ZB 1IC5H 2VERN 4GKSA 4JB9L 4J4PD 2JCCF 2CIKA 1S7XA 4C58B 3D39A 4GSDL 4NJAL 1P4IL 3HE6C 5D7SH 3DMMB 5J4MA 2ZKHL 4U6VL 1FH5L 3AREA 4LSPH 3D3VB 3PWNA 2CKBA 2HLAA 3O6FD 3BXNB 4MJ2A 4RBPK 5EPMB 1FYTD 4QRTB 5E5RB 3TF7C 4HUXA 4FQHA 3WN5C 4R96A 1UFUA 3B8SA 5CJOH 5M7QA 4G3YH 1BMGA 2BVPA 2AJYL 1E27B 2APXA 4GSDH 4NJAH 1P4IH 1BQLL 1ZHLA 4U1MB 1FGNL 2ZKHH 4CVUA 4U6VH 1FH5H 4H26A 3BIBX 1HHGA 1EEYA 3RL1A 2A83A 1YEKL 5JDSA 4B5EA 3TV3H 1AIFB 2FEDD 4EDXA 3NIGF 3VXSD 1TZHB 2AJYH 2M26A 2R4RL 4UZGA 5CP7A 5C07D 1BQLH 1FGNH 4ELKB 5IHUL 3AXLA 4NHUA 3TBWB 4LLWB 4PJEA 4JFEA 5EIQA 3RVWD 1YEKH 4PLKD 1BQHG 4X6DA 1LVEA 1LK3L 1KNOA 1A6PA 2X7LB 2D31A 4GO6B 4Y19E 3SE9H 3IDIA 3KPRA 1MLBB 2R4RH 4PJXF 4OCSH 5FKAB 3D0VA 4BSJA 3BZEB 2ADJB 3DLQR 5IHUH 1VFOA 1BIHA 1URLA 1U9KA 4K9EL 2EDBA 1EEQA 1DZBA 4I9WE 2HG5A 1ZHBB 1BFSA 2B8OT 4FFVD 2QQLL 1Z6JT 5I9QC 4KK6D 3MSPA 4UQ3A 4NKQB 4YO0A 2WUBL 1CTOA 2EO1A 3RX7A 4NQUA 1R3KA 4HZLA 2YRLA 5JXED 5EIIA 3VFNB 3NIFF 5KVEL 1S7TB 4K9EH 3CUPB 3MRGB 4KRNA 2JLLA 1BJ1J 1NCTA 1S7WB 1Q1JL 2DM3A 5CSGA 2QQLH 3CFEA 1XR8B 3GSNL 4CN1A 1DBKL 4EN3A 3BD3A 1I3RA 2WUBH 3V8CA 4OZGE 5D2NA 1W72L 1AKJB 5TDNA 4QXUL 1RHFA 3TIEA 3T2NL 3PABB 5BW7C 3TA3C 2PF6A 3V0VB 3OKOA 1YC8A 3IDGB 1HXYB 1Q1JH 3GSNH 3T0ED 1DBKH 3F58L 4UQ2A 1W72H 3QI9D 5J06A 4IOIA 5KSUA 4PJDB 3T2NH 2L0DA 4MX7A 1Z9OA 5CFHA 2I9TA 1F5WA 1ZAGA 3F7QA 3WFBL 4ELMA 3GMRB 3MV8D 3QIBD 1X9QA 5I8CA 1R3JB 2NQCA 3F58H 4MAUL 3QNZA 1KIQB 2EIBA 3W0WB 2HJKB 3VXRE 1HILA 1VEPA 3RRQA 4LOUD 2DYPA 4D9RE 3SE4C 3MLZL 4P23A 1F6AB 2EE2A 4Q9QH 1A22B 1KCSL 4K55A 4L4VB 1KB5A 4L8BB 1QFWL 3WFBH 3G6AB 3KPPA 1J8HA 1QLFB 3VE0B 4MAUH 4F7TB 2NLJB 4ZO8A 3CSGA 3U30B 3TBSA 3RKPA 3MLZH 4XP5L 2YBRB 5DEFB 2ZOLB 4W6WB 1KCSH 5FO8B 4LLAA 4HJJL 1QFWH 1MY7A 4J8RA 4ZUSB 3GFUA 4YBHA 4KKCD 5F7NC 4OM0H 2QJDA 5EU3B 5E8PA 4L8DB 4LRIC 3VI3E 3C5SB 3BQUC 2R1WA 3C5ZC 4RFNC 3PHOA 3WIFB 1OW0C 2P7TB 4HJJH 3RGVD 4CDGC 5DD0L 3WL9B 2D7QA 5GGRA 4LCIH 4OFPA 4G6ML 4G6KL 5EO9A 1GIGH 4BH8B 4A2MA 1OQXA 2ILLA 4H1LH 3I3BA 4X4XA 1SBSL 1YN6A 1DUZB 3H9HB 1MPAL 4ZAKA 1CF8L 4MNGA 5DD0H 1S7QA 4XMPL 5AD0B 3MROA 4AQOA 5IB2B 4Y5YB 2NX5A 3P9LA 4G6MH 4CN4A 32C2B 4G6KH 1NBYA 4PJ5B 1TPXB 4WUUE 3OXRB 1N6VA 1JK8B 5E2TL 4JKKA 3QCVL 3GBML 1OARL 1JTOA 4G9FE 5GSVB 4ZD3L 5F9WB 1MPAH 3G6DL 2K7PA 1CF8H 4OGZA 1K8IA 4XMPH 4HS6B 3DX8A 3PL6D 5H94B 3VWKB 3GSRB 3EJYC 5FM4A 5F89B 1ULVA 4U6XB 2FR4B 3BOVA 4GAFB 5ESAA 5E2TH 5GJSL 5I1AB 3QCVH 3GBMH 4TULH 1OARH 3ILQD 1MFAL 1NEZG 1SY6A 4ZD3H 5SWQB 1G7MB 1G1YA 3G6DH 4DVBB 5FYLL 3UYRH 1YQVL 3ULSB 1T66D 1ND0B 4EI5C 4WNQB 4YBQC 2YD3A 3KJ6L 4PJGE 2H9GB 5GJSH 3IXTB 1JHLL 3HZKB 1MFAH 1WC7B 3KHOA 4M1DL 4MNQD 2E7CA 4L1DA 1KN4L 1JNNL 3TPUA 1RK1A 3V5KA 4NQSA 5FYLH 2HTLC 1YQVH 4D3CL 2WV3A 5E70A 1R24B 2QSVA 3FFCB 1HHHA 2XQBL 3V4VL 4GRMA 3KJ6H 5IQ7L 4MA1C 1KOAA 1EV2E 1JHLH 3B6SB 2F19L 3ARDB 2X89A 4OJFL 5J12B 4M1DH 4M62L 1OB1B 3S35L 1JNNH 5C0EA 1U8IB 4TSBH 4MNHB 1E4JA 4QOKE 4D3CH 4RGND 1NGQL 3GI8L 5IHZA 3GSXA 2XQBH 3V4VH 2UVEA 3X12B 4OD3L 5KVGL 5IQ7H 1Q9LA 2MPAL 4S2SB 1VHPA 2VTFA 5CHNA 1VFAA 2Y07L 2F19H 5IEKB 4X83A 4MLIA 1N8ZA 5EC1B 4OJFH 4JPIA 3BP6A 4M62H 4KROC 2AEWA 3S35H 3U7YL 2EH8L 2YWYA 1TLKA 2X4PB 1NGQH 3GI8H 1XIWA 5IM7B 2VXSL 1U41A 5TPWL 2MPAH 4ZS7L 4ZS6D 5GS1B 5HHOE 5CMAB 2J8UA 1X3DA 2Y07H 1LP9B 3QEHB 4NQVB 1V7ML 4I2XB 3TBTA 1E4XI 5B22A 5EZIH 3W5MA 4HDIB 4QNPF 1TVHB 3U7YH 4JM4L 2EH8H 4R3SB 4PGCA 4Z78A 5LGHL 2VXSH 1A1MA 5TPWH 1BX2A 4ZS7H 5I0DA 4WFFD 1MHHA 5B4MD 5CEYA 1V7MH 5DD5L 5CBAA 4YK4C 3D25A 4PJ9D 3W81A 1FZOB 4Z9KB 3ZE0E 3WE6A 3ME0A 2AXHA 5JOPD 5J89A 2A2QT 2VIRA 2XI9A 1I85A 1EJOH 1DN2A 2Z92B 4ONGL 5BS0A 4QKXB 1Q9KB 4OFVA 1A02N 1NCWL 2D9QB 3LCYA 2CIIA 5DD5H 5I6XB 1FC1A 2SEBB 1TCRA 3VD5A 1OLZA 5I71C 1HOCB 4R26L 5C0DA 4BSVB 1U2HA 2O93L 2JJTC 2FSEB 1MAMH 1A6WL 4M00A 4WHDA 5IB1B 2E3VA 2X4TB 4O5LL 4ONGH 3M1BA 1T0NA 5CP3A 4U6YB 3DV4A 2DLTA 1NCWH 1I4FA 5GIRA 3UTZB 1N2RB 1M7DB 3RNKB 5I66B 4DKEH 5HGDA 2CDEA 2ZUQC 3CFDA 4R26H 1NLDL 1M6OB 1HSAB 1ZT1B 1JF6A 2D3VA 2GTZA 1TZIB 1UENA 2B1AL 5B8CB 3CCHA 4K7PX 4DEPC 4ZNEA 4O5LH 1MCLA 4JJ5A 3HFMH 3T0WA 1W8OA 4ODBD 4UBDD 1K4DB 3DVFA 3RUGA 2CPCA 3FQXB 3LKRA 3Q5OA 4K23L 5CSZA 5HHNA 4PTTB 1EGJL 25C8L 3LMJL 2CK0L 1DDHB 4HJGA 1NLDH 1FVDA 4JFFD 4EVNA 1F02I 3ABZA 2UWEB 3TT1H 5T3ZL 2Y5TA 5IJKC 2XQYG 1MRCH 1MCWW 5LGJA 2VE6B 4QRPB 5DVNA 2Q1EA 4K23H 4BKLA 1EGJH 1IQDA 1U8HB 3KHQA 3KJ4B 1Q94B 3LMJH 2CK0H 4MJ5A 3X13B 4GRWE 4FZEH 3QXTA 1HE7A 2BSTA 3B9KC 1EFXB 3D39E 3LKNA 4I77L 2OI9B 4LEOB 5F88B 2MKLC 5T3ZH 2X4RB 1DVFC 1OAZL 5I1IL 1FIGL 1YEHL 4R90H 3WXVL 2R23A 1RIUH 2IEPA 3ULVE 2ZNWA 4Y2DB 2X70B 1PEZA 5C6TL 1BD2B 2HYMA 1JI2A 3OKEA 2J88L 4IMLA 4X4MA 4OKVA 4BSWA 4P59L 4I77H 4RBPH 4L9LA 3T3PF 5BRZE 1T1XB 4D0BB 5E94B 1QRND 3H7BA 3C6LB 1OAZH 2D7NA 2DM7A 1FL5B 2V7HA 3LN9A 4JPVL 1FIGH 2YD4A 2X41A 3BRDA 4HUUB 1YEHH 1WFUA 2BY2A 1I1AA 1P2CB 1KXQE 5EFIA 2V9TA 5MI0C 4K7FA 4HCRH 1U3ZA 3RVTC 5C6TH 4L3ED 4XNMB 2J88H 5FO9B 3V79C 1H3UA 4P59H 4FA8A 4BZ2L 4NC0B 1FYTB 4QHUB 1RZFH 4F8QA 2DMKA 1FBIL 3MV9B 1OTTC 3QEGL 4DUXA 4Z7NF 4PJEE 4JFEE 3UDWC 4JPVH 3UTPD 1FZJB 4C56A 4X6DE 4NSKA 4OCNC 3AROA 4NNPL 4QCIA 5D1XD 5DJCA 4WV1B 4EXPX 5DJ6B 5IVXF 3TNNB 2E8ZA 3GMMB 3KPRE 4LF3A 4Q74A 1JPSL 3ZKQD 3VWJA 1SBBA 1AGFA 4M48L 5E56A 1Q0YL 5SX4H 2WM0A 5E9DA 3WLBA 2R1XA 1AXTL 3FO9B 3QIUC 1U3HA 4AT6B 5C0NC 2NY0B 1OGAE 4C57C 1WZMA 3F12B 4P9HC 3FQWB 1KJ2B 3WIHL 3IDJA 4KQ4L 3S4SA 5ICZB 5CS7A 4NNPH 4KKNA 3QDGD 3UPRA 1UCTA 4UIMA 4K7PY 4M48H 4K71B 2HJFA 1Q0YH 5IWLA 4X5XB 1TJGH 2KZ1B 1AXTH 2NNAA 4RAUA 5FHAL 5I16B 3FB5B 4NOBA 5FF6B 5EBLB 3EJJX 3U46B 5L8KB 3MV7B 2NY1C 3WIHH 3ARVA 4KQ4H 3LN5A 4BH7B 1Y0LA 1QSEA 2Q6WA 1I3UA 1ZLWK 5GXBB 3OX8A 3DETD 2GJ6D 4PD4K 5FHAH 3DSNA 3QIWC 4WDIA 5HHME 3TBYA 3RTQC 2UYLA 3FN0L 3VGAC 5F7EL 3QJFB 1C16A 2JJSA 4I48A 4U6HB 4LLQB 5C0GB 4NGHL 2WWKO 2AJZA 2J8UF 2IBZX 1OSZA 3WO4C 3D85A 3U2SA 5ETUA 4MWFB 3BGMA 4M7KL 5D70L 1INQB 3OKMA 5TE6L 1EAPB 4JRYD 2IPKB 1JPGA 4MD0A 4DN4L 5F7EH 4QY8B 5C86A 2K7QA 3CSPA 3O9WD 5HVGB 1QSFE 3OF6D 3C8KA 4ELME 4F80A 5C9KA 1VFBB 3OKNB 4NGHH 2A0LD 3LPGA 4O00A 1DLFL 4JCMA 1NC4A 3IDYB 5ID0B 5D7JD 5D93B 3CFKA 4M7KH 5D70H 1D5XB 1WBYA 2UV3A 4JN2B 1BVKB 1VESA 1AD9A 4K3EH 4ACPA 4DN4H 5EBWA 4LVEA 3S37X 1IM9B 1IARB 4LFHG 5E4EC 5D9SA 2DQDL 1BF2A 2R1YB 1J8HE 2HT2D 3V7AG 4X6EB 4YR6B 1RJLA 2GY7B 4TUKL 4XT1C 4F7MA 4X5WA 3O2VL 4MMXC 5TH2A 3MV8B 3QIBB 1ERNA 4NO5A 4M7ZC 2J5LB 3FQNB 3MGTB 1CS6A 2HP4A 2Y1VA 4NC2B 2DQDH 4LSRL 3PWVB 4XC3L 4ZFOB 4GBXD 4E0RA 3O2VH 3LIZL 2VISA 4P4RB 5A40E 3QSKB 3THML 3H3BC 2JJUA 5BVJA 1ZS8B 1RZKL 3EHBC 3MRIB 2NTFB 4LSRH 4KK8D 4PJ7B 2HT4D 4NPYB 5DS8B 1AXSA 3VJ6A 1WBZA 3N06B 12E8L 3LIZH 3SDDD 3TN0C 3THMH 4J1UB 2XKSA 4MNGE 2BZDA 15C8L 4WHTA 2NX5E 5FYJE 1RZKH 4XNYL 3FB7A 3MGOB 5ESVB 2WLZA 4YFDB 3HLAB 2OS7A 2EDYA 3LZFL 3PHQA 3KPSA 12E8H 5MERB 5L2JA 5JPMB 1UT9A 3L3HB 4K8RD 3B9AA 5FGCB 2FL5B 4PP1C 2LTQC 2ATPA 1Z9SA 4LGSB 15C8H 3PWPA 2ZG2A 5DK0A 1S7SA 1NCNA 1KLFA 2QBWA 5E7FA 3H0TB 2IBZY 1XGRB 4XCEA 1NMCB 1B0GA 2LU3A 4H8WC 3MR9B 3SQBA 4YDLC 2DMCA 2ZJSL 1X5KA 4Z7NE 1LEGA 3HE6D 3HS0B 4FABL 4WTXA 1NGYB 1DQQB 4JFPA 4LNVA 1LNUA 5FV2A 5D2LF 3PL6B 1U8JA 2ZJSH 1L6XA 3S96A 3KPNB 4Z77A 1MCWM 2ITDA 5DGRA 4HUVB 3T65A 4FABH 5BV7C 3QQ9C 1NDGB 5DI8A 5CILL 3RFZC 4YHPB 1MH5A 2MOVA 3FT4A 3P40A 1WISA 4PJCB 5F3BA 4H1LA 5FECB 3K81A 1KXVC 2BOCA 5EUOA 4HGMA 2W91A 4UT9H 4PV8A 4WJ5A 5F7MC 3B3IB 2VDQL 4O2FA 5SV3A 3IDUA 4MNQB 3EGSB 3QFJD 4GW1B 3OKKA 4OCRH 5CILH 3QUZA 3D2UD 4ZOEA 4KJWC 4NZTL 5DXWA 4TVSa 5I75C 4NKMA 1H8SA 1WZ1L 1RZJL 2ARJQ 5IMKB 1KBGL 2MTPA 4U05A 2VDQH 3GSUA 3BJLA 2K1MA 4LKCB 5C0FB 1S7UA 2EO9A 3KLHC 4XVJH 2OLDA 1R3LB 4NZTH 1H15B 5E0QA 4Y5XA 1WZ1H 4MZ2A 4RGNB 3T0VA 3VFWB 1RZJH 3E2HC 4LNRB 3PV6A 1S78C 1C5BL 4PJAE 1KBGH 2GT9B 1Z5LA 4PGEA 3CXHK 3MXVH 3VFPA 1AI1L 1ZVYA 4HHAA 4M1CC 1KCRL 4WTWA 4ZOBA 3NA9L 4XHJC 3BX7C 1UM4L 3MNWB 1RI8A 1YNTA 3TFKD 5HYJA 3B5TA 4G6AC 1H0DA 3R4DA 1C5BH 5I2IA 4M7LH 5ECJE 4YXHL 1UB6A 4CJ0A 3MRHB 3SDXF 2RFXA 3KPLB 4WI6A 1JPTH 1KIRB 4X9GA 5BS0E 1WFNA 2P8PB 3NA9H 1UM4H 1DUYB 2XWJA 1JRHI 2Z8VC 1CG9A 3CFJA 2QQQA 3HRZB 4G6FD 4LSQH 1FVEB 1BLNA 1KTLB 3RVUC 4NT6A 3O2WL 4YXHH 5AZ2L 3DTXB 1WCBA 1PZ5A 3P73B 4PJ9B 5I1KL 1I3GL 2I9LB 1E4XL 1RZIA 4PRDA 4N8VA 5EH1A 3BEWB 3MLSL 4RGOL 2A38A 4BFIA 1D5MB 2Z31B 4NRZA 1LEKA 5IHLB 3O2WH 2J8OA 5AZ2H 5L7XL 4MB4A 5IQ9B 4F7EB 4XWOC 4ZNEE 1VFUA 1I3GH 1MLCB 1JBJA 3RA7L 1FAKT 4KVNL 2CDFB 4FP8L 5H37H 2VZOA 5F9JB 3MLSH 3MUZ1 3RUGE 5IUSA 1FNGB 5HHQA 3I6KB 3D69B 5BXFB 3BD5A 5DQ9B 4RAVB 5DWUL 3VRIB 1IZJA 2PXYC 2P8LB 1N6UA 4FQCL 3BPCB 5I8EA 2AV1B 4LHJB 4TUJB 1T3FB 4X6FA 2V2WB 1D9KD 3B5GA 2FYYA 5ICYA 5L7XH 3E0GA 2FGWL 5DJZB 3EYVB 3EOBA 4BZ1L 4HUMB 3RA7H 1B88A 1OWWA 2RCSL 5ESQB 4ETQA 4KVNH 4FN0A 4FP8H 3NFPB 2C4FT 1I7TA 4CNIA 1CDIA 2DJ4A 3GKWL 2Y36H 5DWUH 5FFLA 4OTXL 4JHZA 4E5XA 2XZCL 5CUSH 4MAYD 4JPKL 4X7FC 2FGWH 3C5ZD 3ARRA 3WEXB 4BZ1H 1H3VA 3L3IA 4XCCL 3ZL4L 4ZPTA 4JFFB 1ZA6B 3NN8B 2G60H 2HFGL 3IAGC 4QRUB 2BNRD 3GKWH 3HN3A 1CVRA 4F9LC 4OTXH 3I50H 2XZCH 1QO3B 4JPKH 1KJVA 3CMGA 2PYFB 5EBGA 4X4ME 2VZTA 4YHYB 2CR3A 4Y5VC 1CFTB 3ZL4H 3PNWA 4NRYB 2DB8A 1VEOA 4D0CA 3SGKA 5E5MA 4JQVA 1ZLVK 3U4EA 4JZNB 4ENEC 3BZFB 5KZCD 4P3WA 1OT1A 2VO5A 3ZTJG 2IAMA 4HBQA 4YAQB 5HDLA 1PYWA 3ZTNL 5JW4N 3SPVB 2VLJE 5EULV 1MVUB 1CK0L 2APWA 4LPCA 3L5WA 1TNNA 2BVUA 4C56E 1EMTL 5GS0D 2B5IC 5CEZE 2V2XB 1QRNB 2B7DT 1NCCL 1XCQA 4L5FL 3K2MC 4XBGA 1MI5A 1IAIM 4NJ9L 3ZTNH 5E9DE 3RZCC 4FQXA 1CK0H 2NY3C 3ECBB 5H8DA 4KK9C 2OSLA 3S4SG 4AIXA 4R7DB 4N0FA 1G1CA 2DDQL 2HJLB 4EI5D 5T1LD 1EMTH 1V3LA 3SDCA 5TE4L 5T3XE 4L5FH 1EGJA 3D0LB 4R2GD 3FL7A 3REWB 3E6HB 4DGVL 3EO0B 3OJDA 2FO4B 1YC7A 4ZUTA 2QHLA 5HVHB 1CXIA 4W4OA 1KGCE 2ICWA 5D1XB 5DRWA 4HBCH 3U9PL 2C3VA 2HTLD 4ZUVB 4JDZB 1XGQB 2DDQH 5CZXC 5TE4H 1WITA 1QSEE 3O41A 1DLHA 4DGVH 4XNQA 1HQRB 4U2ZA 2ICEB 1WCQA 1DQJA 2FBJL 5E8OB 4R0LA 1GGTA 3QJHB 2EDQA 3U9PH 3QDGB 5D6CB 3NH7L 1ZLWH 4WHCA 4F9PA 4HUWA 4NWTL 1PFCA 2A9NL 4WI4A 4WEUD 1SJHA 5D7KE 3VMOA 3G6JF 4I5BB 5GGQL 3SO3B 2FBJH 3SGEI 5KSBB 4R6UA 1KTDA 4Z7WA 3W39A 3QDHA 3FRUB 3VFUB 3BWAA 2JTDA 5MEQB 2XZQH 3NH7H 2BOBB 4KH2A 4PP2A 4JPWL 1FFOB 2GJ6B 5C70A 5J56B 4NWTH 1LO5B 1BVLA 1PKQB 2A9NH 2IANA 3AU1B 4UDTA 1Q9WA 4YHZL 4CMMA 5DTFB 3J8F7 1BOGA 2YPKB 2BX5A 1MJ8L 1ZWIB 5IBTL 5GHWL 1G9NC 5A2IH 3BN9C 2NMSA 4MYWB 3V0WL 4HH9B 3T2PA 5D1QC 4N9GB 1HH9B 3EYOA 4JRYB 2DTSA 3C60A 2EXYD 1XGUB 2OQJB 4D94A 3QAZB 4D8PA 4YHZH 1YMHA 4H0GA 4G8GA 5D5MA 3O9WB 3TIDA 3VXMD 4K7PL 1XR9A 4HUNB 4WU7B 3QHZL 5ITFA 1MJ8H 5IBTH 1A1NB 5GHWH 3MUHL 5E03A 3HTLX 4NC1E 2O61B 3V0WH 3KR3L 3EOAA 2H2PD 3QEQA 1DANU 1QSZA 1MRDL 1UA6L 1T0MB 4YHIA 3TVMC 4OZHA 5DFVC 4XNZC 3WIHA 1WBXA 3PWUA 1D5ZA 4BFBD 4RMVA 4K7PH 1KXTB 1D7FA 5I1CL 3QHZH 5J11B 3V6BR 1GAFL 5JPNB 4NIKB 3DMMA 1T7YA 2X10A 3VFVB 1FSKB 3KR3H 3D3VA 1MRDH 5EPMA 5EO0B 3RY4A 3CU7A 1YPZA 3B9EA 3B43A 4QRTA 2ZUWA 1JF5A 5KSAD 4J6RH 1MF2L 4MVBD 4KWUA 5J1AB 1WFOA 1MIMH 3OGOE 1D5IL 1E27A 1EFQA 1GAFH 1KB9K 5L9DL 3U7AA 3F7RA 3VI4F 2XA3A 3ZKXC 4F7PB 5FYKU 4GBXB 3T0BA 3EYSL 4JZJC 4QRQA 3CVHH 3RBSA 1AIFA 5KN5B 4UMGA 2WZPD 1MF2H 3KVQA 1K9TA 1ZHNB 4YX2L 1TZHA 3VRLF 3PDDA 3KPSE 3QDMD 5L9DH 4LP5A 4RAHA 2EKJA 2UZXB 4ELKA 3TBWA 4LLWA 4LMQI 3PWPE 3TCXA 1T21B 1GGCL 2F74B 5F1OB 4PYGA 3SDDB 2VOTA 2X7LA 3VXUB 3VFSB 3DECA 4YX2H 3O0RL 4LHUA 4GG6B 1MLBA 2XG5A 1EK3A 2FRGP 3BZEA 1UADC 2ADJA 2OR9L 5CIPH 4E41D 1NFDF 2HTKD 4WO4C 5AAMA 1PVHA 4KDTA 1U3JA 5FXCH 1AP2B 1ZHBA 4ZFOL 3LQMA 4F58L 1H3TA 1QOKA 2OR9H 4CKVX 2F54B 2YWZA 4N0CC 5I1LB 4LGRB 1I9JL 3VFNA 1S7TA 3MRCB 3QYCA 3CUPA 1JFQL 3MRGA 4I0PC 5GRZA 1GGBL 1F3DH 2YR3A 3BIKB 4H1LG 3GKZA 4YFEA 3KXFD 5CGYD 5INDB 1P7QD 1XR8A 5HJ3B 1FPTH 3HE6B 1PSKH 3QG6B 3RVTD 4F58H 4DN3H 5EUOE 2EDLA 3CX5J 3HMXL 1AKJA 4FXGB 4NHCL 1GH7A 1OWRM 1QFOA 5FYKH 3N0PB 3PABA 4U31A 3V0VA 3DGGB 1OTTD 3QULB 3WN5B 4GXVL 1GGBH 3IDGA 1HXYA 3KG5A 4U1KB 4XI5C 5CGMA 2H26B 2F5BL 2VABB 1ZVSB 1QG3A 3RWGA 3QP3A 3HMXH 3NA4A 3HA0A 5HYQB 4NHCH 2HKFL 2GIYA 4AM0B 2BNUB 4RA3A 4PJDA 4P57B 4P5TC 1UVQA 4IMKC 3OV6A 4GXVH 2BERA 2H6PB 4Z7VF 3GMRA 1XGYH 1R3JA 4NN6C 3OL2A 5JORB 1T03H 1KIQA 3W0WA 2HJKA 4XPHL 3TYGL 3K1KC 4G43B 1XGPA 3VU2A 2H32A 4AIZB 5I8OL 4R4ND 4P4KA 3OB0H 5DYOB 1PG7X 1F6AA 3AS1A 3D2UB 5K9OA 3MBEC 1I1YB 4PBXA 1CXLA 3RJQB 4L4VA 1JIBA 4L8BA 1NL0H 3SCMC 3U9UB 2EYTB 4WW2C 2NY1D 2MKWA 2V5TA 2APBA 4KTYA 4LIQL 2NLJA 5HYJE 4HIHB 4XPHH 3BDBA 1UXSA 3TYGH 3VDBA 5I8OH 2DQJL 2YBRA 5DEFA 3S37L 2ZOLA 2Z9TA 1IT9L 4NZJA 1AR2A 1ONQB 4Z7WF 5FO8A 5IFJA 2RIKA 4JRXD 1CIUA 3ZKSD 4K3GA 5I9QB 3AS3A 1HDMB 3NPSC 3OTTA 5E6IC 3TNMB 2NZIA 4JDTH 3FOLB 3RPKA 1LO3L 4B53A 1WGOA 4LIQH 4P2OA 1JGUL 4Q2ZB 1XCTB 3C6SB 5IW1B 4GH7B 3C5SA 4C54A 5C09D 5DR5H 5IB5B 3CPLB 4KU1A 3S37H 2NXZC 1IT9H 4ZFZB 3K4AA 3WIFA 2P7TA 5FM5O 5ANMB 3WL9A 3JTSB 4N8VG 4QRSA 2FECI 1I8KA 2OCFD 1JGLH 1LO3H 1BVZA 3ARZA 1JGUH 1DEDA 4Q58C 5C08D 4HPOL 3TA3B 4ODXB 1MHEB 1DUZA 3MYJB 1YEJL 5KVFL 5D5MF 2YD6A 4YHOL 4OI8A 1MCJA 2NW3B 4G6FB 5AD0A 4Y5YA 5CBEA 32C2A 1LILA 1A6ZB 1P5UA 3OXRA 1JK8A 4OLYL 2P5EA 1CCZA 4HPOH 4U7MA 1ZOXA 5AYUL 3CJJA 5GSVA 1DQML 4Z18A 1YEJH 5AEAA 5KVFH 2C1PB 4YHOH 2WMPA 2A6JB 1OPGL 5E95B 2ENSA 1JNLH 1JRHL 3QHTC 4HS6A 3LH2H 5H94A 3GSRA 5GISL 5F89A 3AS2A 2FR4A 1BPVA 1U8QB 3UTSD 5C71A 1B4JL 3CH1B 4OLYH 3PDGA 4YFLF 5AYUH 1A9BB 3EO1B 4PJBA 1DQMH 1C1EL 1M4KA 1ZA3B 5SWQA 1G7MA 2D2OA 5FCSH 1OPGH 3JV6B 4DVBA 4KMQA 4HJ0C 1JRHH 2YD5A 3ULSA 2YEZB 1HK6A 3LQZB 1ED3B 1ND0A 3GSVB 2A6IB 1B4JH 5HHVL 2V7NB 2H9GA 1J9CT 3IXTA 1KCKA 2DAVA 1WC7A 1AR1C 3PGDB 5JQ6H 1C1EH 4DOHE 5C0BA 3CMOL 1MWAB 4OFYD 5ERWB 3TN0D 2C3WA 1AC6A 4G42B 3WV0A 1R24A 3FFCA 3G5YB 4G9DB 1C8PA 1YN7B 5HHVH 3BQUB 1ACYL 4PUBL 3C5ZB 3E3QE 4G8EB 3ARDA 4RFNB 3QNXB 2EDKA 1I8MB 1T1ZB 5D1ZC 1QFWM 4M6AA 3CMOH 5FDWA 3EBAA 1U8IA 2BNRB 4MNHA 3BPOC 4PJFB 1ORSB 1ZLVH 3X12A 3AVEA 1SVZA 5DQDL 4S2SA 5I74C 4PUBH 4Q6YA 5IEKA 1OGTB 5EC1A 4NFCA 1OP3K 5F1SA 3MJ7B 2OXHA 4LARL 4TVPH 5JW4M 1YMMD 2X4PA 5IM7A 3L3KB 5KZCB 5DQDH 4XPAH 5CMAA 1CGXA 3PQYD 3QEHA 1LP9A 4NQVA 4PJXB 5AG8A 2A73B 1SHMA 2Q20A 3QDAA 3MLRL 2GW5A 4HDIA 4P2QD 1TVHA 3QPQC 4GKNB 4GAGL 4LARH 4R3SA 2FATL 4N5EC 3IFNL 1NGWA 4DFHA 3RWIB 4Y1AD 1WWWX 2DICA 3QQ9D 4YUEL 3LHPH 3NTCL 5F7UA 1DR9A 3MLRH 1FZOA 1JWUB 1H3XA 3AMKA 1FJ1B 2ZUUA 2AS5M 4GAGH 2C4XA 3DARA 4EI5B 5T1LB 4UUJB 1X5ZA 3FZUC 3IFNH 4YE4L 1D6EB 1S9VB 2Z92A 1MCFA 3PV7A 1ZT7B 4XRCB 3SGJA 4HWNA 2AJ3B 1ZTXH 1Q9KA 1CYGA 2C5DC 4YUEH 5E8NB 3NTCH 1IC4L 1J7VR 2SEBA 4XH2B 1M05A 1JHKL 3DX9A 3EDDA 4LDOB 1NPUA 3AREC 4WUKL 4BSVA 2FSEA 1FCCA 2YPLE 1NBVL 5IB1A 4MA1B 4YE4H 1WTGT 2X4TA 2BP3A 4BYHA 1J12A 4W68A 4U6YA 4OQTL 3JWDH 3UTZA 1N2RA 1IC4H 2IANE 1M7DA 4WFHE 3RNKA 4HLZG 5I66A 2PTTA 3IKKA 2FGZA 1JHKH 4XVTH 4QHMB 1M6OA 5A3ID 1ZT1A 1TZIA 1S78D 5B8CA 1NBVH 4NQDD 1ZHKB 3F6IA 2A6DB 4UNTA 3O3UN 3MCLL 4WWKC 5I1JL 1I7ZB 1U92B 1U0QA 1K4DA 2OR8A 1LHZA 3LQAH 2XXMB 5LG1A 3ARSA 1DDHA 3UAJD 4G8GE 3WLWD 4A6YB 1B0RA 3L3OB 4G6AD 1RZ8B 4HSQA 4KAQL 1DBJH 1NEUA 3MCLH 2UWEA 3RQ3A 1LDPL 5I1JH 5A2LH 2BJMH 2CXKA 3QEQE 2VE6A 4QRPA 2LFGA 4G8IB 4OZHE 2YA0A 2LQRA 3LB6C 4PG2A 1Q94A 3X13A 3PDOB 4QWWC 3GGWA 3K0WA 1C5CL 4U6TA 3L5HA 4KAQH 3U48A 1EFXA 3T0DA 5IFHL 4Z76B 4LEOA 4CL7A 3PF2A 5DJDB 5F88A 5GRUL 2YN5A 2X4RA 1LDPH 4U3CA 4YK4B 3D3VE 3VXMB 1X7QB 4LRNL 1E4WH 2V2TA 1UG9A 3SGEH 1YPZE 2EIEA 5MP6L 1FNLA 1NUGA 4Y2DA 2X70A 2R2BB 1BJ8A 3P4OA 4MSWA 5FDYA 1BD2A 4OLXL 4LAQL 1YEFL 5IFHH 1T1XA 1FNHA 1YUHB 2VLLB 5E94A 4HKXB 4AEEA 3C08L 5A1AA 3MOQA 4J4PA 1FL5A 4NQCD 4LRNH 3IRZA 1P2CA 5MP6H 5I71B 4JVWA 5IVZB 3WDJA 4KI5E 3UROR 2PO6D 4OLXH 2PXYD 4JM2F 5JOFB 3O6FA 2EYRB 4XNUL 2AQ2A 1ZGLB 2OTWA 1FYTA 4QHUA 5F97E 2Y7QB 3EO9H 2DQUH 2KKQA 3FO2B 2EYSB 3HCVB 1FZJA 1IC7L 2ZUQB 1KSRA 2AEIT 2HKHH 4H5SB 4R8WL 4QHKJ 3IT8D 4WV1A 1I1AD 5DJ6A 4DEPB 4TNVK 3TNNA 1V5JA 3GMMA 2X2YA 4U1GC 2O26U 5AYQA 2DQCL 3ZDZF 3I6LD 3ES6B 3I9GL 5EC2B 5I17A 4RNRA 2YD9A 4PRPD 4X7CC 5DUML 2VDKL 3VXSA 1QRKA 3V5DB 3MLVL 1IC7H 3F12A 3FQWA 3QDMB 1KJ2A 1RZ7L 5C07A 1I8LA 5ICZA 3I3EA 2LVCA 1P6AB 5K9QI 4P23C 3ZE1E 4XXDB 4U1JB 3BEVA 1UZ6E 4YWGH 3VFTB 1YJDL 1A6UL 4X5XA 3I9GH 2YA1A 4FFZL 5DUMH 1EZVY 4OF5A 2VDKH 3VWJD 5I16A 5FF6A 2F53B 3MLVH 5E8EB 4RMSA 5EBLA 1RZ7H 1C08B 2DBLL 1HKFA 1U3HD 1FCGA 1T7VA 2X9WA 3U36B 3ALPA 4E41B 3B9KB 1A7OL 1MHCB 5JA8B 1SEBB 5E00B 3MLUL 2NY6C 2Q86B 1YJDH 1A6UH 4ENED 2F5AL 3FB6B 4FFZH 3ULUL 3QJFA 3STLB 2A1WL 3KPOB 2C26A 4KHXL 2DBLH 4U6HA 1FORL 1G9EA 3A6CL 4LLQA 5F9OL 1A7OH 4GQPH 1ODAA 5FM8A 5JXEA 4Z7QE 3JBG7 9CGTA 2FJGA 3MLUH 4YJZL 4OSUL 1INQA 3BI9X 2F5AH 3MRFB 1EAPA 3KXFB 3BP7B 2IPKA 4PJDE 1P7QB 1MJJA 3ULUH 3HR5A 4WCYL 4QY8A 4R9HA 2A1WH 5MI0B 4KHXH 3BHBB 3MRBB 2NY3D 1WSST 4KK9D 1FORH 3A6CH 1JJUA 1WJ3A 3TO4C 1VFBA 3HI1B 3A67L 5F9OH 3VH8B 1GGIL 4ZDHB 3F5WB 4ZAKC 5IVNA 3NZHL 1EPFA 3W0WE 3X11B 5LQBL 5ID0A 4BUGA 4V2CB 4JN2A 1BVKA 3MRNB 1S9WA 3VD3A 4WCYH 3TM6A 2BSSB 4L4VE 1BECA 1QBML 4S1DD 3P77B 3QI9A 2R1YA 2WAHA 2E7HA 4G7VL 4X6EA 3NZHH 4YPGB 4YR6A 5LQBH 2GKIA 3LKSA 3NCCB 4XVSL 3MV8A 2YC1B 3QIBA 1WWAX 3UBXB 3PHSA 3GMNA 3GHBL 3MGTA 4JO2L 3LKOB 2RQ8A 4LSSH 4G7VH 3PWVA 4ZFOA 1IM3B 5ENWB 4PRHB 4XVSH 2NZ9D 3W5NA 4P4RA 2NY1B 5K59E 4CVXB 2E6QA 1MCSA 3GHBH 1EO8H 1H3WM 1ZS8A 5EORL 4JO2H 4OI9A 3UBXI 5IR1B 1S9KC 3MRIA 3ZE2F 4XCFL 1G0YR 5HHPB 4PJ7A 4FS0A 1UC6A 2A74A 3C2SA 3L5XL 4FXKB 1FNEB 5DS8A 4JRXB 4JM2C 4KQ3L 2D03L 2NTSP 1QTYT 4OLUL 4IRZL 3HPLB 1SQ2N 5SWZD 3HMXA 3OXSB 3HG1D 2VUOA 4KKAC 43CAA 3TESA 1DL7L 5JR1L 5EORH 2I25N 2W0PA 3MGOA 1T2XA 1G6RA 2R2CA 5D1QD 2NY5C 3HLAA 3L5XH 3M07A 2P5EE 2VLKD 2VDPL 4KQ3H 5JPMA 3L3HA 2D03H 3NIDE 1TFHA 4OLUH 4IRZH 3DVNA 2DWEB 1L4IA 5DK2B 2NR6C 2DIAA 3QHFL 1PBYA 5C08B 4KUCF 2XFXB 5SWSD 2YUWA 1DL7H 3NCYS 1JHTB 1I9EA 2FBOJ 3HKFA 4MMZC 5JR1H 5IESL 1ZK9A 4NWUL 3H0TA 4NCC2 1XGRA 2BDNH 4X7DC 3HAEH 5HPMA 3MREB 3M17B 1JZ7A 2ZZUT 3ARFD 4PTUB 4Y4KC 3MR9A 2NPLX 4KI1A 3ZYIA 4PJBE 3QISA 3O3DA 3RVVD 1XIWC 2FWOB 5DJ0B 4MJID 5E4EB 3CDYA 3QHFH 3NFNB 4X6BB 3HS0A 2GUOB 3I02B 5IESH 4LLDB 1NGYA 4NWUH 1DQQA 2W9EL 2X1PA 2H3NA 3ALXA 1A4JB 3PL6A 4M7ZB 4XMLL 3QWQB 2DQGL 4FHBD 3UTSB 5C0BE 2XWTB 1HWHB 3KPNA 4HUVA 1CE6B 1NDGA 3AM8A 3BD4A 4YHPA 5KTEL 3NCFB 3CGTA 4IRJC 4PJCA 1FNSL 3GJFB 4HKJB 5FECA 4PBVC 4XMLH 1I85C 2DQGH 3SOBL 1S8DA 3SJVE 5IB3B 3B3IA 1J05B 4RCAA 1TZGL 2O5ZL 3EYUL 4MNQA 3EGSA 4GW1A 1T7ZA 4XBEL 5ACMA 3VGGA 2VL5B 4M5YL 4PFEA 3TN0B 3MTRA 5FIEA 1Q0XH 2V9QA 3ARWA 5DZOA 3GRWL 4QLRA 4OZ4B 2DL9A 3SOBH 4WWID 1F4HA 5IMKA 3O6LL 2BHYA 5FUCE 2O5ZH 4LKCA 1OP3H 3MLWH 5C0FA 1H15A 1LP9E 3MRPA 3DHJA 1XAUA 3L3DB 2LTQB 3VFWA 5DD3L 4LNRA 3F7VB 3GRWH 4I3SH 3MLPA 3JUYA 4PJIF 1MCIA 3O6LH 5T5FH 2GT9A 4M3KB 1NMBL 2Z35B 4PREB 4N0CD 2R2HB 1A8JH 1WVZA 1UH2A 3VD4A 2ED7A 1A6TB 1OSPL 4FXLA 1PY9A 4X4ZA 4I0PD 4U1HB 4YDLB 4TQEH 4PS4H 1BHGA 1I1FB 5D6DC 5DD3H 4ZPVA 4QT5A 1PG7L 1J5OH 3PQYB 1MWAL 2YMXL 3IETB 4MJ6B 4ODWA 3UTTB 2WWMC 1OAUL 3KPLA 4PD4J 1KIRA 3X14B 2P8PA 4P2QB 3O4LB 1OSPH 1DUYA 4IJ3C 4CVWA 4WGWB 4XI5D 4PRAB 1PG7H 1KTLA 1OTSC 2YK1L 4Y1AB 1R5VB 3GJFK 5BV7B 2YMXH 5JQHC 3DTXA 3RNQB 3P73A 4PJ9A 5CLTA 2I9LA 4GUPB 5F7DB 3MJ8A 4LHQB 5FYLD 4UOW0 3GIZL 3BEWA 4IBLT 1V05A 3PWLB 5ISZD 3B2UC 5LXGL 1D5MA 2VLRD 4QXTB 3FKUS 2IPUK 1EXUB 1TVBA 3CIQA 5IQ9A 4CUCA 4PR5B 5CINL 5I75B 5DURD 5DD1H 4ONOA 2PNDA 5F9JA 3GIZH 4H20L 1MOEA 1JZ6A 1FNGA 1NCBL 3KLSA 3D69A 3I6KA 2NXYC 5DQ9A 5BXFA 4RAVA 3VRIA 1F58L 2P8LA 1OVZA 3BPCA 2CSPA 2AV1A 1HHJB 3EFDL 4TUJA 2VAAB 2I24N 4DTGL 1CDCA 2AV7B 5FHBL 3G5ZB 2IPTL 5DJZA 3EYVA 2UWEE 5CINH 1T89A 5FOBB 1TITA 5ESQA 3RHWK 3NFPA 1JMZA 1NCBH 4NQDB 2GSIB 1U95B 1F58H 1XF5B 2J6EL 4GMSL 1RUMH 4U0RC 4PJ7F 4WFED 4CADB 4DTGH 3WS6A 2EXWC 3RIFK 2IPTH 5BVPL 5FCUL 4OF0A 3WEXA 3P4MB 2NXZD 3L95B 2EE3A 4JFFA 1ZA6A 3NN8A 3PXHA 4QRUA 2J6EH 4AJ0A 4GMSH 7CGTA 1T5XB 5JW4R 1EERB 1QO3A 4EUPB 1A6VL 4NDMB 2RBLA 2VITB 5FA3B 4N0YL 3CH8A 5BVPH 5FCUH 1YEIH 4K3DL 1T80A 3MRLB 2GSGB 4UT6H 3QCUH 3HE7D 3V7MA 3BZ4B 1CFTA 5FEBA 4NRYA 3DROB 2F8VA 1FG2B 4FZ8L 1IGJB 1KIPA 4J3TA 2WBWB 4W70A 4WRLA 4M4PA 1U8NA 1A6VH 4JAMB 4JZNA 3NVQA 3FCTB 3FONB 2JJSC 4K3DH 1E4KA 4YAQA 1FYTE 1N64L 3K8MA 4EJ1C 4P5KB 3SPVA 1MVUA 4PY8I 3KAAA 5F1NB 3VG0L 5IT2L 1DCLA 2VC2L 4FZ8H 4X9FA 4F2MA 4OQTA 1UACL 5E2VL 2V2XA 1QRNA 4JFHD 2GITB 3VXNB 4X98B 4A6YL 4NQCB 3CLFL 2YD1A 2D7MA 1MFCL 4CVZB 1N64H 1JGVL 4BA8A 4HZAA 3P30L 4L3EA 3VXSE 1CICD 1T04B 1QLEL 2PO6B 3VG0H 2PXYB 4R7DA 5IT2H 2VC2H 1OAQL 5C07E 1UACH 4OF3A 5E2VH 3BH9B 2HFEB 4A6YH 3D0LA 3REWA 3U6RB 1AR1D 3EO0A 3PP3K 3CLFH 2FO4A 3CDCA 1MFCH 1JGVH 4LEXL 4HK0B 5D1XA 4UV4L 3P30H 1MI5D 1F3DJ 4ZXBD 1XGTB 3FQRB 5F21B 5D2LB 4ZUVA 5JUEL 1XGQA 1OAQH 4PRPB 1U8LB 1HQRA 4KRMB 4RGMC 1R3HB 2ICEA 4U7SA 2G9HB 5E8OA 1G6VK 3TZVC 5DJ8B 5DHVH 4LEXH 4PV9B 3S3JA 1ZV5A 4UV4H 2XWBB 1JYWA 3QJHA 3U0PB 3RU8H 3QDGA 2W65B 3D9AL 5D6CA 5JUEH 2W9LA 4MHHI 4WY7L 5F70A 1TTUA 5T3ZD 3RAJL 3W9DB 1MRFL 2DN7A 4I5BA 4O4YH 1OL0A 3QH3B 5KSBA 1IE5A 3VFUA 5MEQA 4FG6D 1TQCC 3NMEA 2IFFH 3LSOB 4P0DA 1IGTB 2BOBA 4WY7H 1FFOA 2GJ6A 5DEZA 4NCC1 5E4IA 3RWDA 2FX8L 4ORGB 1LO5A 3RAJH 1PKQA 1HNFA 1W0WB 1G7JB 4GXUM 1T22B 1ZWIA 5DDHB 2VH5H 1N5AA 2M1KA 3QPQD 3T0EE 1RZGB 3CNKA 3Q6FB 1JNHB 4N5ED 5IKCB 3G5XB 4P2RD 1MELA 1HH9A 2FX8H 4JRYA 5C0RL 4WW1B 3JUZA 3CXHJ 2EIZB 2G75B 3L7EB 3RZCB 5I1GH 5GZND 2NY3B 3O9WA 3OF6A 3NGBC 3LKPA 4NM8L 1A1NA 3MV8E 1X5JA 1J10A 1OTUD 3IJHB 3FZUD 5D7JA 5DJYB 1T0MA 4P3CL 5C0RH 1IGIL 1BIIB 5E2JA 4OD2B 2DQTL 4ZQKB 3SDXB 3DNKA 3PGCA 5TF1L 2DD8L 4Q9CA 3OKDB 4NM8H 1QUNA 4QTIL 3Q6GL 3R06B 5H2BB 2IADB 5L6YL 4ZO6A 2ZUTA 4UOW1 4ESKA 4P3CH 1IGIH 3D48R 2AJVL 4GKOA 2DQTH 2EZ0C 1WF5A 3WUWB 1KN2H 5C92A 2PCPB 2WBJC 4IOSD 5TF1H 3OZ9L 3NZ8B 4XP4L 3T2OA 3V0AC 3MJ9H 1G0XA 4QTIH 5D8JH 4CW1B 4OCMC 4Y4FD 4MS8D 5L6YH 4L3AA 4GBXA 1U8PB 5DFTA 4PG9B 4WWKD 1FDLL 2AJVH 4IEFB 5KN5A 3FQUB 1PEWA 1ZHNA 4QTHB 3OZ9H 2HFTA 4XP4H 3H8NA 1BQUA 3QQ3B 3D6GA 4HMDA 1LDSA 5M95B 3QUZC 4LDLB 2AP2A 4NYLA 1T21A 2UZIL 3MLYL 1A2YB 1FDLH 5GGSY 4CGTA 4X6CE 2IFGA 3SDDA 5SWZB 4KKBC 5GGSB 3QA3B 3HG1B 3VFSA 1PQZB 2PTVA 5GRWA 35C8L 1VADB 4GG6A 1R5IB 2AKRB 4TRPL 2V5YA 3JVGA 4P9HL 3OAZH 4UAOC 3I6GB 5DQJB 5IG7B 1GZQA 2VDOL 4Q6IC 1OGAD 5D1QB 1L7TL 2UZIH 3MLYH 4Y5XC 5JO5B 3ARBC 1BZ7B 4DZBB 2VXUL 1AGCA 35C8H 4L4TE 5SWSB 5D7LD 4OCWL 1KUMA 1ZANL 1A3RL 3BP4A 4QXWA 4Y19B 1CLOL 2VDOH 3TVMB 5I1LA 4CBPA 1L7TH 3ARFB 3MRCA 2YD8A 1ZSDB 3DUSB 4ZMAT 5CLWA 2DS4A 4HKZB 3BYTA 3BIKA 1NAMH 4MJIB 2EDHA 2VXUH 2BMKB 5INDA 4PJCE 5HJ3A 3HE6A 3UMTA 3WSQH 1N0XL 1G7PB 1ZANH 4OCWH 4B7IA 1JPFB 1CLOH 1ZT4B 1BFOA 3TH3T 2YD7A 3DGGA 4MNQE 3QULA 5FGRA 1BQHA 2BRQA 1Y6MR 2ERJB 4U1KA 1SJVA 4GAYA 3ORJA 2H26A 2HT3D 3QUXD 1ZVSA 1BF8A 5HGAB 3FAWA 3ZKXB 4EKXA 1F13A 4H88L 5HYQA 4JZJB 4AM0A 2BNUA 1QSFD 2Y9RT 1RQ5A 3O8XD 4LLMB 1OP5K 2H6PA 3VGDA 3VGFA 5MEND 3RWCB 3BUYB 8CGTA 5JORA 2BVEA 4RGNE 3MZTA 5J6HB 4G43A 3QFJA 4H88H 3PXJA 4L4JA 5DYOA 3D2UA 5I1EL 1I1YA 1CDBA 4QO1A 2VUYA 1BP3B 2AK1L 2AQ3A 1WTLA 3U9UA 2EYTA 3OAYK 5JMRA 3P4LA 4KPHL 3W11C 5DVKA 4UU9A 3X3FL 3VXRB 5I1EH 4JLRB 1ONQA 5A2KH 4X9BA 4XB8A 2QQKL 2AK1H 3UC0L 3GMPB 4I8DA 4M7LT 4Z7UE 5IMLB 1HDMA