5FYLL

Crystal structure at 3.7 a resolution of fully glycosylated hiv-1 clade a bg505 sosip.664 prefusion env trimer in complex with broadly neutralizing antibodies pgt122 and 35o22
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
210
structure length
210
Chain Sequence
b'APTFVSVAPGQTARITCGEESLGSRSVIWYQQRPGQAPSLIIYNNNDRPSGIPDRFSGSPGSTFGTTATLTITSVEAGDEADYYCHIWDSRRPTNWVFGEGTTLIVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BG505 GP120 ENV ECTODOMAIN
publication title Trimeric HIV-1-Env Structures Define Glycan Shields from Clades A, B and G
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 33
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2016-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fylL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fylL01
2DQIH 2EE9A 3DMMD 3KVQA 2NZ9D 5EU6E 2OZ4H 3ULSB 4NWUH 5CLWA 3MRFA 2CRYA 3B5HA 3P9MA 5HDBE 3TBSA 1QBAA 1CLOH 1JFQH 2Z31D 1FFRA 3HG1B 3LKPA 3PQYB 4EUPH 5IJKA 3LEVH 1NKRA 2MPAL 4UQ2B 1HSAA 3WHXB 3OKDA 1KG0B 4M4PA 5EU5A 5F7FA 1JZ6A 1EV2E 5SWSE 1WC7B 1ES0A 2XZQL 4X7EC 2FEEL 2FHBA 3VXQA 2AERT 4WUUD 2HRLA 15C8L 3ARFA 3UTZA 1W72L 5F3HB 2O5YL 4GKZA 4KRLB 3IXTB 1YNTB 3L3JA 5E08H 5KS9B 2HN7B 5DMKB 5EOTA 5HHME 4PRAA 4CAGA 3EO1A 1CL7L 1G6VK 3P0GB 3TV3L 2BRRH 4W4OA 4CKVX 2BVYA 4WWKB 4D8PB 3UXFA 4KPHL 1FO0A 3JWDL 4OM1L 4PJXA 1W0VA 4U1JA 5EN2A 3UC0L 5TF1L 5EU6B 3O41B 4KY1L 5CGTA 1Z9SA 5C71A 5T33L 1S9XB 1HKLH 3G6JF 1P4IL 2R0LL 4OD1H 5IBUB 1MJ8L 5CJQL 3RWFB 5ID1B 1IVLA 5CLTA 2BNQB 5C0NC 5EZJA 2H26A 2AEPH 1T03H 1S7RB 5SWSB 3LHPH 2CKBA 1R5WA 3QR2A 1N5AB 4LRNL 3VA6A 3GSWB 1CDIA 2A0LC 4NQCD 4M02A 4O4YH 1MRDL 3H9SA 5HGHA 3T0ED 4YR6B 2ICWJ 4OV5A 4YPJA 4NBZB 7CGTA 4GBXB 3RNQB 3SPVB 2PTUA 2VDQL 1H0DA 3IDGA 2E8ZA 3ZDYF 1INEL 3MOBL 3NN8B 3NPSB 2FIKB 5ILTH 3KS0J 4LLQA 4NFBA 5I1JH 4JM2F 1GZPB 2A0LD 3QDJD 1NBYB 2NR6D 4M1CC 5ANMB 4N9GA 5J11B 5HPMB 2B1HH 5GJSH 1O5DT 4RAHA 3RY4A 1MCDA 4EI6B 1JPSL 3DECA 2H9GA 2UY6A 5D7KD 1JGVH 2YKLL 2F19L 4N1HB 1DBAL 3G6DL 3I6GA 5D4QA 2IAMB 4G6KH 4JO3H 2GFBB 3IXAB 5KSBF 5FGCB 1I9RL 5T3XH 4RRPA 1GPOL 2DWEA 1GGBL 1RZJL 4YPGB 5GSRB 3NZ8B 3MREA 1TCRB 4P23B 4GQPH 3VFMA 3I3EA 3B2VH 5H94A 1EVTC 1DQTA 1JV5A 1BVLB 5GGQH 2Q86A 3QHFL 3E6FA 1ZTXL 5A16B 3HKFA 3WIHL 2FCBA 1QLRA 2K7PA 4R8WH 2Y5TA 4F2MB 1JK8B 4NQSA 1BOYA 3QXDB 2DQGL 2JF1A 1RU9H 3CGTA 2E7MA 3E3QE 4Z7VF 3I02B 2VQTA 2QTEA 1Q38A 3EFFA 3JWOH 3NH7L 3ZL4H 1I8KA 1OAKH 2J8UE 1Q9LA 3ARXA 3SE8L 1U36A 2F58L 4OUOA 3VRIA 1JWSB 4KTDH 5T1MA 3UBXI 3MLTB 3HLAA 4J8RB 5L2JA 5T3ZE 1KGCE 4YE4L 5GGRA 1PKQE 4N90D 2AK1L 4ELKB 1EMTH 4KJPD 3VFSA 4H1LG 4RWHA 3ZDZE 5DD3L 2C1PB 1NKOA 4QRTB 5DHYA 2PF6A 3T09A 3UTSB 5IQ7H 3BPNB 4ENED 4QNPE 1A6UL 5AYUL 1HHHB 4KU1A 5HYFA 4TQEL 2GJ6E 3T0AA 4HSQA 5EBMA 3CC5B 1NLDL 3UTTA 5C07E 1CFSA 3OKOB 3JTTA 3S5LA 2J8UB 4H25B 5C0JB 1Y18A 5D6CA 1T7WA 5AZ2L 4Z7OE 5ERWA 1UKTA 2DOCA 1U8IB 1S9VA 3IAPA 5KVGL 3HAEA 3L3KB 2LV4A 2IAND 2XI9A 3SDAB 2XQYK 1PKQB 5D6DA 2FYYB 2I25N 2DF3A 1A22B 3AMKA 3EJZC 3QDGA 2JK5A 3NGBB 4I13B 5DSCA 4BUHA 3C60C 5CKGA 3RY6C 5CEZH 3FRUA 4R7NB 1OM3L 3F7VB 3PHQB 4NQEE 4KJYA 5JXEC 1HOCB 1MF2L 3QRGH 2G5RA 1I7UB 2GTWA 3BIBX 3MV8A 2XWTB 1XIWB 3QIWA 2WBJD 3R1GH 4EXKA 2ZG3A 3MRDA 4Y2DB 3Q5YA 1EHLH 1RY7B 4YDVB 1GJIA 3OGCB 1YJDC 3VFRB 4OUUB 2R39A 3EJZD 2PCPA 3GIVA 3RVXC 5BXFB 1R5VB 5LCVL 2NY6C 3RGHA 3C60D 4OIIL 1TIUA 5TDPB 1AC6A 3FCTA 3NIGE 3OJDB 1FAIL 1YEDB 4CN4A 2X42A 2E6JA 5C0GA 4XRCA 2E27L 2ZCKH 1FHGA 5I9QC 1I9JH 4FNLH 1A6VL 3PWLA 4O51B 1QBLL 4HBQA 1H9VA 3WIFA 5EDXA 4XP6H 4TTDC 2YD6A 1KB9J 1P6AB 1BX2B 1S7TA 3IJHA 5DT1H 1BVKB 4XWOD 4M61B 5C0CD 1JNHA 3ZHDA 5I8CA 1B6UA 4HUVA 5FHAH 3SE4C 1RUAL 4OGYL 3KNBA 3RTQC 1K8IB 4OQ1A 4RA0C 3CK0H 2HWZL 1CLYL 4MAYC 4TTDD 3IDMB 3RWGA 4GH7B 4WJ5A 4OQTL 3STLB 2H3NA 4OCMC 2NPLX 3KPOA 1JVKA 1KEGL 2WUBL 1LP9E 1N2RB 3MFFB 3VFWB 2LE9A 5LWYL 5LXGH 4GW1A 5DEFA 1C5BH 3AS3A 5I71C 1KCRL 1G9NL 5CMAA 4LFHG 3IJYA 4ONHA 1T2JA 3RWIA 5FF6A 3WFEL 3G08A 5EO0A 4JVWA 4NUJA 3P77A 1PEZA 1TJGH 1VKXB 2VTFA 2VXVL 5FIEA 2Z92A 4Z7QF 3BH8B 1XF3B 5H2BB 1MWAH 1F13A 2GSIB 5KS9F 2VDRL 4P3DB 1BBDL 3WN5A 4G9DB 2Q8BH 1J87A 1MFCH 3QEUA 5IF0A 3P4OB 3IVKB 3WFDH 4IMKA 1OB1B 2Q7NA 1AQKL 4XC1L 1OT1A 1HQ4A 4HBCL 3HPJB 2VXTH 3NCBB 3S35H 5JHDA 4NN7C 2VO5A 2IPUK 3H7BB 3S36H 3V7AE 4EN3B 2M8XA 4L3EE 3TIEB 4L9DA 1LP9B 2A6JB 3QA3B 5LGJA 5ALCH 5HDBF 3BWUC 4I2XA 1R3IL 1U8QB 4HH9B 4YBQC 2P4AB 3KPMB 3NMEA 5E2WH 2R23A 1QLFB 2IALA 3CVHB 4PRNB 2VLJD 4XPAH 3OKMA 4WFFE 4YDKH 3LS5L 4WV1C 1HEZA 3B83A 3O11B 4CNIA 4FZEL 3U0WH 2HJFA 4LLYA 4W68A 4ODUA 1W72A 1OQOA 3EGSB 2WIIA 4OT1H 4ALAH 3FHQA 2BOCB 1K3IA 3PWPB 1JCKA 1K4CA 4L29A 3INUH 1KJMB 4MZ2A 1ZMYA 1WAAE 5J1AB 3G6JA 4JHWL 2VZ1A 3O0RH 3LSOB 4RCAA 4PJ5D 1ROWA 2VUYA 3GI9L 4GAGL 3MV9E 2ZP0T 2DLHA 3JVGA 1LK2B 4MJIB 3S37H 1EPFA 1BM3L 1EAPB 3DX7A 3Q0HA 5F6IC 4ZAKA 3BWAA 2I07B 1NEZB 4LLUA 1RUQH 2E7CA 3VJ6B 4CVXB 3O8XD 2V9QA 4YGVA 1JHTA 4QWWC 3ABZA 2ICES 1N5YL 3PP3K 3UZEA 2HJLA 1SBSL 1IILE 3IKCA 2JJVA 4GSDH 2FX8H 4Z5RA 3PNWA 5SWZA 1O7SA 4JM2A 5D72L 3PP4L 4KJQC 2PXYA 4LCUA 1B0WA 4JPVL 4HQQH 4HKBA 4HV8B 4NOFA 3HC3H 1BEYL 3SOBH 4BFIB 1KCSL 3MLZH 4LLVB 2WM0A 2BCKA 4ODXB 3MV9B 2Q76B 3V5KA 2I60H 4QWWD 2JB6A 3LQZB 2J7LA 1E4WL 5CUSH 5JLZB 3CPLA 3K74B 4Q58C 4NNYB 2RAMA 1LEGA 4F15C 1FZKB 4FP8H 1GOHA 2HRPH 1UWGH 1JPFA 1T7VA 4LAQH 5GRUL 2VQUA 2VDML 4EBQH 4L4TB 1WFTA 5FO7B 4EI5C 3BI9X 2HFTA 1IARB 4P2OB 3GO1L 3GUTB 4G8GD 5CJXC 2GITA 1B9ZA 1IGFL 5EC1A 2DQJH 4LOUD 5BV7B 4LNRB 1YEJL 1IAIH 3FT3A 3DO3A 4JGUA 1PZ5A 5EG6C 4XPGH 5EO9B 2FRGP 4HCRA 3WIHA 3AS1A 1XF4A 1M7DB 1QSEE 3GMOB 2VLKA 4XWGL 3T8XB 1C5DA 1A6ZB 1ACYL 1CIDA 3GHEL 4ZOAA 4KMQA 4X6FB 4JFPA 5EOCL 4X0KA 4PV8A 5T3ZL 4C56B 3WD5L 1JUFA 3ES6B 5C2BL 2J8UF 1V05A 2V5SA 4JFQA 1OWWA 4HD9A 2G9HB 4JPIB 5ESAA 4ZXBC 1XGUA 5ITBH 5HI5D 2YBRA 3EYQC 2OK0L 4MA3A 1NUNB 1FNGA 5M94B 1V7ML 5IM7B 3LV3A 5E00B 3PWJA 3ZDZF 5MI0C 5DVKA 3T3PE 1ZVSA 4QNPF 1S7XB 4YXKH 1QSEB 2LTQB 4K8RC 4L4VD 1S7VB 4MNGE 2O93L 3DSFL 1HH6A 4G9FB 4ZXBD 4KHTL 4YO0A 5IW3A 5JNYA 5GZNC 3ARQA 3EYQD 3EJJX 4NNPL 1GGTA 4CMHB 4AEHH 3R8QA 2VAAB 4X99A 4PJDE 5L8LB 1MI5B 2J4WH 3MLWH 1KJ2B 1QR4A 1FZJA 1CG9B 2AK4A 4HXBH 4OFPA 5IJVA 2XWBA 1JZ4A 1NAML 5I1IL 2X4OB 2CRMA 4Y5XA 4B0MM 4LBEA 3O9WA 4K8RD 1QP1A 4NQDA 1B4RA 4C54A 4TPRH 3P0VL 1T5WB 3WKMH 4QGTA 5EB9A 4U6XB 2KZ1B 2JB5L 2EIDA 4PJGA 3MBXL 5HSFA 4X8JB 2NNAA 1JRHH 1AI1L 3TA3C 4HGKC 4DVRH 5I2IB 1P4LA 2EXYD 4IMLB 1F90L 3DUSB 3D0VA 3RWDB 5F9JA 3S88H 2VR9A 4PJDB 4ZUUA 3BPCB 4PGEA 4OKVB 2M1KA 1JTPA 5F1KC 4OLVH 3HS0B 4YXHL 4M6MH 3SQBA 1ZWIA 5K9QI 2XYCA 2CGRH 1J11A 4JE4B 5FGSA 1QACA 1CTOA 3NIGF 4PB0H 1VGKA 4JVPA 5TPWH 3VXNA 1PLGL 3F7RA 1OPGL 3HZVA 5C09A 3V4PH 4PR5A 3MGOA 4GFTB 3SDDC 2GCYA 2GJZA 3WUZA 4RBPH 2YN5A 2ZJSH 4RZCB 3ARZA 4UNVA 4BZ2L 4AEIH 1U8JB 4U3HA 3QEGH 5FOBB 4DVBA 2EE3A 3MCG1 1DQQB 4XH2B 2XICA 4D9QE 4KGLA 5K9JH 1OAYH 4LSSL 5DJDB 5CBEB 2D4FA 3EDFA 3HRPA 1MNUL 4O58L 5DD6B 1I1YB 4LGPB 3QB7C 5FYKE 1S9KC 5K9OB 2P1YA 2YRZA 3H9SD 3ULSA 4BQCA 4LNVA 3PQYA 2WUCH 3CVHL 3HG1A 3LB6D 5HGBB 4KK5C 1PSKL 1AXTH 1EX0A 1CICB 1MCWW 4QTHB 4UQ2A 2AJXL 4K3GA 3WHXA 5IKCB 4OQTA 1KG0A 4AJ0A 5CBAB 1T1ZB 4H8WH 2FECI 3MRIB 1WC7A 4BA8A 3BDYH 3KPQB 5JIHA 2W9EH 5F3HA 1F00I 4YHLH 1UACL 1MVUA 3MXWL 5HDOA 3IXTA 4TOYH 1IGIL 1ZLSL 5KS9A 3ARDC 4TNWF 2HN7A 5DMKA 2BSSA 1WCBB 1DTUA 3FQNB 2VR5A 4WTXA 4KVCL 3EYVB 1IFHL 1WIPA 4G3YH 4LSQH 1UCBL 3T2OA 2A9NH 7FABL 4WWKA 5B38G 4D8PA 2IMMA 4CL7A 4XNQB 3ROOB 4M93B 2CK0L 5EU6A 3QXWA 4GJTB 1YY9D 4Z95H 4OD2A 3U9PH 3O41A 1NMCB 3KYAA 1S9XA 4XNZC 4FG6C 3OQ3B 3RWFA 5ID1A 4ZFFB 2BNQA 1WIUA 4H88H 2EDJA 4OLXL 1S7RA 5SWSA 5AWNL 1N5AA 3DI2B 4IOFD 3PJSB 3GSWA 1SEQH 4KKBC 3CH8A 2VXUH 2FATH 4LSTL 4YR6A 3RIFK 1NLBL 2F53B 4GBXA 3RNQA 3SPVA 5JA8B 1DDHB 3BT2H 5AAMA 5KSAB 5F9OL 1F2XK 3NN8A 2FIKA 3RHWK 1WBYB 4JR9L 5E03A 1J1XH 1L7IL 5TFSL 4KKBD 1GZPA 1WAAF 1NBYA 5ANMA 4JVUA 4KKAC 5HPMA 3C6LB 3MV7D 4EI6A 4CJ0A 3FRPA 4L9LB 5CIPB 3KPPB 4OZFH 2FWOB 3BP5B 4PUBH 2IAMA 3HNTL 2GFBA 3IXAA 3M17B 4ZFOB 3FO1B 3GJFK 1XZ0B 4YPGA 5GSRA 1MUJB 4UB0L 3NZ8A 5DJZB 1TCRA 2OS7A 4M6NH 3TT3H 3MNVB 4P23A 1VESA 4XCCL 3UTTD 3D85A 2JJTC 3UAJC 4KKAD 3SY0B 4X4ZA 3GSNB 1CT8B 2DLFH 1BVLA 1MIMH 1ZEAH 2F8XC 5A16A 1DQMH 1DLFL 1UM4H 5D1XB 4F2MA 1JK8A 1P9MA 5FEBA 3HI6H 1WSST 1VFUA 2NY2B 3AM8C 3QXDA 3WFCL 3I02A 1X5YA 3QDGD 4L1DA 4LVHC 1DANT 5D70L 4JHAH 3MRCB 2XNAB 1RUMH 1ADQA 2H8PB 4LVOC 1JWSA 1K3ZA 5C6TL 1L6XA 3MV8D 4PB9L 3MLTA 4XP4H 3QIWD 3KHOA 3QJFB 4FMKA 1GGCH 4J8RA 5IFAL 4KKCC 2WW8A 1WBXB 4JFHD 4ELKA 3ILPB 3CUPB 4ZFGH 4BM7A 3FB5B 5IP4A 2C1PA 1PX4A 4QRTA 3UTSA 2WK2A 4MAUH 1TTUA 3NIFF 3CNKA 1HHHA 2VISB 4KKNA 4IRZL 4NHCH 3RGVB 2A77L 4IS6B 3CC5A 4HXAL 4BZ1L 4P0DA 5HDQL 3C8HA 4WY7L 2XY1A 3OKOA 4MXQC 2J8UA 4H25A 4KKCD 5ALBH 2DQEH 3CMOH 4OI9A 5C0JA 4I18B 1ZE3C 4DGYL 5E24E 5L7XL 4NKDB 1DZBA 4PIRF 5JIKA 1S3KL 4MWFB 4X9FA 3BE1H 1U8IA 2YXMA 1ZV5A 3L3KA 3MUGB 3SDAA 1PKQA 2FYYA 4KFZC 4MLSA 3AROA 2IEPA 3KR3H 4G6JL 3BKCL 4OLUL 5DK2B 4R7NA 4OGAC 2D0HA 4OV6F 3F7VA 3PHQA 1HOCA 3D6GA 4M43L 4DGVL 1I7UA 5JTWA 3TT1L 2GJ6A 2XWTA 1XIWA 2ZCLL 1MHPH 3T3PF 4Y8AA 4MZ3A 4Y2DA 4LDLB 4YDVA 5F9AC 1RHFA 4RGMB 5DD5H 5C07A 1RZIB 4R0LB 3OGCA 4L8BB 4PJFE 3AREC 4OUUA 3VFRA 2MHAB 5BXFA 5D93C 1R5VA 1BAFL 1MCBA 2VE6B 5TDPA 1EA9C 4OGAD 2NY0B 4JKMA 3OJDA 1ZGLB 4O5LH 1YEDA 2OBGA 3QCTH 4K94L 4JFOB 5H37H 4O51A 5I76B 3ULUH 3N85L 1Q8MA 3D18B 4J12A 3ARED 1JNNL 4DN3H 2BHUA 3SDYL 4IJ3C 4EDWH 1BX2A 4TSBL 4HS3B 1BVKA 4JM4L 5JHDD 4M61A 3ULVE 2J5LC 2APBA 3RU8L 2F9BT 4WVRA 1B4JL 4PJFB 2FHCA 5JW4R 4DKEL 5EUOE 2EDDA 5JW5B 1PG7H 1K8IA 1MY5A 1DQDL 2W65B 4XPFL 1H8SA 1WT5C 5DRWB 1EK3A 2Y36L 3RPKA 1I3VA 2Z93B 3JWDC 3IDMA 4X7FC 5BW7A 5F7EL 1CWVA 5E2TH 3STLA 4X4XB 4YHOH 4KJWC 1N2RA 3MFFA 1CE6B 3VFWA 3IFNH 4GO6B 4NJAH 4AIZB 4ZAKC 5BOZG 1QLEH 4GT7A 4Z76B 5I66B 2PYED 1ITCA 1ZT1B 1TNNA 3V4VL 4CW1B 4A6YH 4DWHA 1HHKB 5FUZH 1VKXA 1X4YA 1XF5B 3MQIA 2EECA 1SM3H 1U91B 1XF3A 4PGDB 2CR3A 3HI5L 4Y16C 5H2BA 1U92B 2ENYA 2GSIA 4ZOEA 3BYYA 4P3DA 5DZOA 3V7AG 1JGUH 1RIHH 4G9DA 4GRLB 3TBVB 4JM2C 3P4OA 3IVKA 4XAWH 4JG1L 1OB1A 5D96B 1F58H 4Q9QL 1U8PB 4ZAKD 4JEGB 1JGLH 3HPJA 4PYGA 4XPTL 3H7BA 4EN3A 5ISZB 1MAJA 3TIEA 5HHVH 1ZGLM 1LP9A 2A6JA 3QA3A 1XGPB 4I8DA 3O6ML 1U8QA 4HH9A 3KPMA 4TUJB 1QLFA 5AEAA 3TYGH 3CVHA 4PRNA 2PNDA 3KJ4C 4JM2D 2UZIL 1DBKL 1A4KB 3O11A 1MPAH 3MGAA 5IGXL 4AMKL 3RAJH 1CF8H 4HKXB 2EDEA 3EGSA 4Z78B 5E5MB 2IGFL 2E7LA 2BOCA 3PWPA 3SE3A 5L9DH 1K6QL 2XZAH 3LEYH 3LDBB 1KPRB 3NACH 4XBEL 1KJMA 3CXDH 5D5MF 5D7JB 2QSQA 4PJBE 3FN0H 5F7YC 3IJSB 2DL9A 43C9B 5J1AA 4M1DL 2X40A 3O3AA 5DWUH 1I8LA 3S98A 3TH2T 3CDGB 3LSOA 2ARJB 3VFTB 4ZFOL 1F3RB 3CFEB 2XA8H 5D71H 2HLAB 1FSKB 5KG9B 3Q6GH 5EORH 1UWXH 3GI8L 1LK2A 2ARWA 4MJIA 3OL2A 4MD4A 1A02N 1CDJA 4ZUVB 4EJ1C 1EAPA 1F02I 3DURB 4M7LT 2I07A 1NEZA 1C7TA 4BYHA 3VJ6A 5T1DH 2ERJC 2EH8H 3JUZA 4CVXA 1X5JA 1CI5A 3FTGB 2VLKD 3UDWA 3C2SA 2HT2C 1ZHLB 2N56A 4UNUA 4JY5H 1N4XH 1HINL 3VXUB 2VZ3A 1QRNB 1VPOH 1KFAL 4HF5H 5DC0A 1WAAA 5GRVL 4LCCC 4HV8A 3U48A 3BPLC 3MRRB 5LGHL 4BFIA 1FYHB 2ZKHL 4J4PA 4LLVA 4FOMA 4ODXA 3MV9A 4XPBH 5DZNA 2Q76A 3UROR 3LEXB 3LQZA 2RIKA 3F65A 3RUGE 4XZUB 4K7PY 5JLZA 1O7VA 4PS4H 2E8YA 4NNYA 1A3RL 1S7WB 1UVQB 2R29H 5I1KL 1FZKA 4APQC 1S7UB 5L8KB 3T0DA 2ADIB 2J8OA 1IGMH 3MO1B 3O9WC 4FZ8H 5A2IH 2JIXB 4L4TA 3V79C 5FO7A 3HA0A 1LWRA 1KT2B 1OAZL 4FQQB 4P2OA 3GUTA 3IRZA 1TJHL 4MA1C 5DFTA 4LNRA 1KV3A 2X4RB 2AK4D 5IVNA 2UY7A 4ACPA 2LU4A 5EO9A 1CLZL 1MJ7L 2X4NB 1JZ5A 4APQD 5L6YL 2W38A 1M7DA 3GMOA 3T8XA 3O9WD 5FDYA 1A6ZA 1RK1B 4NQDD 4M3JA 3TO4B 4R96B 2CDGB 4WDIB 4ODWB 4X6FA 1YEIH 4PRHE 4YWGL 4C56A 3ES6A 4Y0GA 2G9HA 4JPIA 1CFNB 2OP4L 2WLYA 1GYAA 3VFNB 3WO4C 5KJRH 5KVEH 1A5FH 1VFAB 1BZQK 3IDYB 5DGQA 5IM7A 3O2DL 5E00A 3LMJH 1I9EA 2RR3A 2E9BA 1A14H 2HA1A 4LIQH 1PYWB 3VFGH 1KEML 1S7XA 2DDQH 5CP3A 1QSEA 1FAKT 1S7VA 4HS8L 4HC1L 3PV6B 1LO4H 4G8IA 4G9FA 5CHNB 1PX3A 4FQ2L 4R90L 1MFEL 4RGOL 2A1WL 4LVNC 1QFWI 5C09D 4PRHB 3QDMD 1G7PB 2VAAA 3BKYH 1KJ2A 2GW5A 1CG9A 1HQRB 2EDHA 2AJYL 3TLRA 3WXWH 2X4OA 2DM4A 2Z91B 2VZVA 2CR6A 4YHIB 4NQXB 4PREB 1G9ML 1BECA 4Y5YC 4RMUA 1ZLUK 4TVPH 2DRUA 4QRRD 4TRPL 4RIRB 1T5WA 1AGDB 4NM8L 4JANB 2JTDA 1J9CT 5A2FA 3D25B 2JCCE 4U1NB 1G9NC 4U6XA 1KPUB 3HHRB 4NC0B 5HVGB 4X8JA 3RZCB 3PQYD 3HG1D 5I2IA 5FA3B 3M8OL 4WIQA 4IMLA 2P8LB 3DUSA 1OAQH 3RWDA 5GHWH 3OR7B 4PJDA 1VFMA 4KI1A 3BPCA 4G5ZL 4OKVA 4PJFF 3HS0A 2NY1B 3LPWA 5B3JE 1C1EL 2HMIC 1MQKH 1MFAL 5C7XH 4I77H 2FBOJ 1MCRA 5GS0D 4ZMAT 1F3DJ 1RURH 4YHYB 3NTCL 4M1GH 1T2XA 3ULVL 5H35B 2EDRA 3RA7L 5DR5H 3LZFH 1HCVA 4N8VG 4RZCA 2OJEA 5FUOH 5EU6D 1U8JA 2HAZA 3C08L 4D0DB 5FOBA 3RL2B 3RWHB 3QI9C 4Y5VC 3RX5A 3S4SG 1DQQA 1IKFL 4XH2A 3ULVF 3U7YH 3V6FB 1IZJA 4OD3H 5DJDA 4KKLC 5CBEA 3NPSC 1L0YA 8CGTA 2BNQD 5DD6A 1I1YA 4OCYL 5SWSD 5B8CB 1OD7A 4UINH 5EUOF 3ZZ1A 5K9OA 1DR9A 3DYOA 3QO1B 4WTWA 4BFGA 1WLHA 2F74B 2O5ZH 4ZTOL 5KSVB 2R4SL 4FQLL 4KTYA 4E41E 5HGBA 3QPXH 3A6BL 4LF3B 1CICA 2VQ1B 2IAMC 5D1QB 3WJLC 4QTHA 1AXIB 5IKCA 3EFDH 5CBAA 1T1ZA 2VH5H 4P3WA 1IAOB 3MRIA 2X9WA 3KPQA 1FH5L 3EOAB 5D1ZC 5JQHC 2AS5M 3X3GL 1ZA3B 1RFDH 4CADB 5CJBA 2CSPA 2Z8RA 4RQQB 1T1WB 1REIA 4WW2B 3RKDD 5EC2B 3ARSA 5I74B 1WCBA 3FQNA 5KTEL 1H8NA 3SGEI 1IGTB 1NCDL 3CSBA 3EYVA 5BVPH 4PJCB 3KPSE 2DBJA 2QQKH 3MNWB 2IAMD 4X7DC 3UYRL 2MCPH 1VGEL 3LIZL 3OV6A 4R97B 4XNQA 3ROOA 4JPWL 1D7FA 4IEFB 12E8L 4PRIB 5D1ZD 5LG1A 4M62L 3UO1L 4OLEA 4CN1A 3C9NB 3QUMB 2HG5B 5AAWA 4YNYB 4KQ3H 4I48B 4E41B 2GK0B 3D85D 1BREA 2CIKB 4X7TA 4ZFFA 5C0RH 5I1CH 1FIGH 4QKXB 2VRAA 1SMAA 3D9AL 3EOTL 1Q1JH 5KOMC 3PJSA 5E99H 3ZYIA 1MAKA 1B88A 2WIMA 5TQ0L 1CCZA 3CVIH 3O2VL 4QOKE 4UT9H 2F53A 4I0PB 1DDHA 4M48H 4KROB 2AJUL 4K7PL 5KSAA 1UM6H 1GGIH 1NCBL 5MEOA 4YFLI 2C26A 2BDNL 1WBYA 4PLNC 1A3LL 2VZTA 3HMWL 4RWYH 3E3QC 3OKLB 2KDGA 4PJBF 3AY4C 4D3CL 2EH7L 4PLKC 3FFCE 2BY1A 3V0WH 3QHZL 3BFOA 2XWJB 3C6LA 4GKNB 1JE6A 4L9LA 3FQUB 5CIPA 4XNUH 3KPPA 4KV5E 4JZJC 2FWOA 3BP5A 4RDQF 4KK9D 5GQBA 2B2XH 4UILL 1FL3B 3M17A 4BZYA 3K4AA 4ZFOA 1M4KA 3IAQA 3FO1A 3IF1B 1XZ0A 3L6FB 1MUJA 4MHHG 1YNKH 3NABL 1IGYB 1QHOA 4QOKB 5DJZA 2YD8A 4XP9H 3MNVA 1FRGL 4WO4C 3MOQA 1TETL 4HH8A 4XMLH 1A6AB 4PLKD 1CGXA 3SY0A 2D3VA 1CT8A 3GSNA 3MA7A 4NP4H 1PAMA 3WUWB 4B50A 1B3JA 3P30H 2WINB 1DQJB 5D1XA 3QDAA 4F7PB 2MMXA 3SQOH 3FFCB 1KNOB 4HPYH 5T3ZD 1EHXA 3HNVH 3SDAD 5HYSG 4N8CL 1DJSA 2PTTB 3MRCA 2XNAA 3IRPX 5CCKL 5T3XE 1WWAX 1RZKL 4IRSC 2H8PA 2XXMB 3RUGF 3QDHA 1CL7I 1IC7L 1NCNA 4Q97A 2GJ6D 1XIWD 3QJFA 1RULH 8FABB 3F62A 1QG3A 3OZ9H 4Y2DD 5C07D 3KJ6H 3SDCB 1WBXA 4K23L 3ILPA 3CUPA 3FB5A 5J12B 5E94B 5IV2B 4LCWE 1U41A 1TQBC 5B3NA 4QTIL 4FFWC 4ZTPH 2VISA 1UADC 1UB6B 1A7PL 3RGVA 1DVFC 5KN5B 2CK2A 2X4PB 2I9LB 2LQRA 4M5YH 4IS6A 2EIBA 2OR8A 4ODVL 4I9WE 3T2NL 5EOQL 3HNSH 1U58B 2OM5A 2BHYA 5IQ9B 4NQED 4I18A 4MNHB 4NKDA 4P2RE 4MWFA 4ODBD 4KZEL 3IDUA 3UX9B 2FGZA 3FAWA 3MUGA 3ZSTA 1JWMB 1MRFL 1HZHL 3NFSL 3HZYB 1DFBL 4UDUB 3SO3B 1NSNH 4OBRA 3VD9A 4M6OH 5DK2A 4LCWB 3BN3B 5E2VL 4RMTA 4JRWA 2DYPB 4WI8A 2VLRB 3L5WB 2AXJA 3H42H 1I1RA 3FT4B 1RZIA 4IDLA 4R0LA 4U0RC 3Q6FB 4L8BA 2MHAA 1FFNB 3QEQB 3P4LA 4MX7B 1OWRM 4HC1A 5E8OB 2VE6A 4JPKL 4XNYH 1FE8L 1ZGLA 3W5MA 1YEFL 4ZO9A 5CP7B 4OB5H 2V2TB 4JFOA 5EPMA 4QO1A 3WXVL 4RISH 2AVGA 2J3SA 5I76A 3W11C 5CEZE 4PJEB 1T7XA 3O6KL 2QSTA 3D18A 3CX2A 1Q0XL 4GRMB 4ODSL 2CPCA 3UCRA 2G60L 2H1PH 4HS3A 3VXSE 1QVOB 1Y6KR 1Z3GH 2JCCF 2OI9B 4HIIB 2ED7A 4OZIE 1FFQA 4WW1B 3VXME 1VHPA 3B9DA 3FQXB 4PJFA 1OSPL 1PVHA 4P9MH 1A6WH 4Z7UB 3RVVC 5DD0H 5JW5A 4YIQB 1KBGL 4HZAA 3WLWD 1BJ8A 2BY3A 2W65A 3PDGA 2QADB 5DRWA 4LSPL 5GS0H 2Z93A 3ME0A 2YEZB 2ADFH 3TVMC 3QRFM 1CGTA 3ALPA 1PEWA 4X4XA 3TPKA 4YDLB 4MB4A 2FB4L 1CE6A 2DQCL 4HWEL 3PWPD 3UEZA 3P11H 4AIZA 1G0DA 3U0PB 1K5NB 5I66A 4Z76A 3H6JA 4K9EC 1QKZH 1R3KA 3IDXH 1BMGA 3MR9B 1ZT1A 2EDWA 4CW1A 1HHKA 2JJSC 1MCWM 1A9BB 1XF5A 4L3ED 2O5XL 4NUGH 4OZIB 3TVMD 1RUKH 1U91A 3VXMB 1XF2B 3MOAL 3RL1B 5F7UA 1U92A 5D8JL 3A67H 3TBVA 4GRLA 3CAFA 4PJAF 1E27B 2FDBP 1U8PA 2COQA 5ESQB 3QBTB 4XMKL 4NWTL 1JF5A 2I26N 5ISZA 3P0YL 2VKXA 2GI7A 1XGPA 3GRWH 2N4IA 3B6SB 2DD8L 1S5IL 2FEDC 2CQVA 3PGFL 4QHNB 4TUJA 2OR9L 1HIMH 1U0QA 1H5BB 4HFUL 3TESA 1A4KA 2IPTH 2DQIL 4U1KB 3VH8G 4X6BB 5CD5C 1JMZA 4HKXA 5F72S 1GC1C 2OZ4L 4UU9B 4NWUL 4Z78A 3MV9D 2F8OA 5E5MA 2YUWA 2NW3B 4GXUM 4JRXB 3RJQB 1CLOL 1JFQL 5DF0A 2J2ZA 2FEDD 3LEVL 35C8H 4YBHA 1FPTH 5D7JA 1H3XA 3U6RB 3IJSA 2EE6A 3QAZC 43C9A 4AG4H 2DM3A 2QR0B 3DUUB 3CDGA 3CXHK 2ARJA 3VFTA 3CFEA 2W1NA 3VDAA 3WNNA 2HLAA 5I0ZA 4UV4H 3A6OA 5KG9A 5IROA 3WV0A 4ZUVA 1U2HA 3NZHH 3DURA 5JO5B 5GGTA 1BIHA 1G7HB 1I7RB 5BRZE 3NCYS 1J10A 2YK1H 4HX1B 3FTGA 4LSDA 4TNWK 4U3CA 4DQOH 1N6UA 5IB4B 4UBDC 1GVIA 1T0NB 1ZHLA 3VG0H 4XI5C 2BJMH 1LD9B 4U1HB 1WZKA 1HKLL 4ZQKA 3VXUA 1QRNA 5D2NE 1FC2D 1TJIL 2AEPL 1T03L 2LTQC 3L3HB 1IZKA 3LHPL 3OSKA 2EDOA 3MRRA 2QJDA 5GGVH 3MRGB 1T2QL 1I7ZB 4O4YL 5L2KE 2K3TA 1VSCA 2Y5EA 4NQCE 4KV5F 1R3LB 3LEXA 1L7TH 4XZUA 4XI5D 2D7TH 3N06B 1UVQA 1J8HE 4WHYH 4G8EB 1S7UA 5ILTL 2ADIA 5BRZB 3MUZ1 3MO1A 2A83B 1QSED 2JIXA 5JDSB 2B5IC 2EDFA 5I1JL 1FGVH 1KT2A 2X09A 1ED3B 2AQ2A 4KMLB 2OYPA 3OF6D 5D2NB 1IL1B 4X5WB 3ETBF 2XACC 2X4RA 3X17A 3TN0B 4RFNB 3WE6B 4AQOA 5D7KE 4G6KL 4JO3L 2X4NA 5T3XL 5MEPB 1BWWA 1UH4A 3K46A 3VFVB 3RI5F 2Y4SA 1RK1A 4JQVA 2GIYA 3TO4A 4R96A 2CDGA 4R4FH 1EBPA 4ODWA 4WDIA 3B2VL 2CIIB 3EDDA 1JZ8A 2X1PA 3I6LE 4FFVC 4LAJH 4EVNB 2HLFC 1CFNA 1TITA 3PP3H 5DQDH 5GGQL 4LHUG 2ZG1A 3VWJC 3FMGH 4R8WL 3VFNA 1GL4B 5I1GL 3ECBB 1HYSD 1VFAA 5FA4B 4K94C 1RU9L 4KVNH 5F1SA 2ZCHH 2V9RA 5C0BE 4WI4A 2I5YH 3AAZB 1OD9A 2VABB 4JCLA 4OI7A 1A3QA 3JWOL 3ZL4L 1PYWA 3OWEA 1OAKL 4DK3A 5JIPA 5L0QC 3Q2CA 4XMPL 1YMME 4KTDL 3PV6A 5CHNA 1DE4B 4S10A 4D94A 5JMOC 1BF8A 4R9HA 4U2ZA 3CU1A 4WNQB 5C92A 4K71B 4PRHA 4B41A 1G7PA 2HH0H 5CJ5A 2ZWLT 4M3KB 5DJ8B 3PDOB 1HQRA 1EMTL 4KUZH 5IQ7L 1SY6L 1CICC 5IMKB 2Z91A 5DTFB 2APWA 4YHIA 1E6JH 3MX0A 4FTVB 4NQXA 4PREA 4OFYA 1C12B 5C0BB 2V17L 3QXAB 4RIRA 3DV6A 1AGDA 3RVWC 4JANA 3D25A 4U1NA 2IFFH 3LAFA 1KPUA 3RZCA 3V4UH 5FA3A 2VLME 1CICD 2P8LA 4PJ7E 3T1WA 3PHSA 3OR7A 1AC0A 4AZ8A 5HHXH 3QUYC 5I6XB 3MUJA 3NCJH 3NA9L 4PY7B 4NKOB 3QG7L 4JO4H 4TSAH 3RVWD 2ZUSA 3HI1B 5CEZL 4QXWA 1JI2A 2D0GA 4D9QD 3QRGL 1RZFH 5EULV 1MFDH 2WQ8A 1B0RB 4C4KT 5H35A 4M9OA 1T5XB 1EHLL 2F8VA 4OCSH 4P59H 3JZ7A 5FYKD 2Y25A 2BXYA 1IC4H 4D0DA 1Z5LB 1UH2A 3AB0C 3RL2A 3RWHA 4MQSB 1A7OH 4L3CB 3V6FA 2Z4QB 3BRFA 2VITB 4OCXH 3BSZH 3BX7C 5B8CA 1IBGH 2QEJA 3KYOB 1I9JL 1F5WA 2KH2B 5BZDB 3IGAB 2Z8SA 1NBQA 1XCQB 5HYQB 4XP6L 2F74A 5KSVA 3LD8C 4KDTA 4LF3A 5DT1L 2VQ1A 3JUYA 5D1QA 3C5ZB 4OBSA 5FHAL 3DSNA 4XVUC 1IAOA 2ESVB 2WQRA 3EOAA 4UT6L 1ZA3A 1IAIM 4CADA 3UZQA 3O4OB 4RQQA 1T1WA 4WW2A 1CXHA 5EC2A 3CK0L 5HHOE 3C6LD 4F7TB 1IGTA 3NCFB 4PJCA 4EUPG 3MNWA 3BKJL 1CXFA 1G6RL 2HT4C 3QIBC 5LXGL 1C5BL 4XVUD 4PRIA 4DKAA 5BO1H 1UKSA 5CAYB 4XXCA 3C9NA 3QUMA 2HG5A 2B0SH 2CD0A 4YNYA 4I48A 3LN9A 3S3JA 2ZZUT 4E41A 4Y4FB 2CIKA 2YD7A 3FONB 1TJGL 1F4WH 4RFOH 4O2EB 4J3WA 5JIIA 1MWAL 5D1XD 3X11B 4EEEA 1ZHNB 2Q8BL 2HT4D 4RAVB 3QIBD 2YOCA 5MERB 5I1EH 3RRQA 3C8DA 5HHOB 4BH8B 4I0PA 4AQ1B 3SCMB 2VXTL 5IHUH 1V3MA 1OSZB 3S36L 1T89A 4MS8C 4I3SH 4HMDA 4HUXB 4YDIL 4G8FB 3OKLA 5IBTL 4NC1E 4JZNB 4JQXC 2BSRB 3V2AR 4ZUSB 2XWJA 2BOBB 4XPAL 1U8OB 4YDKL 3IDNB 4OSUH 4GKNA 5BV7H 2VLJE 3FQUA 2WLZA 1DL7L 4WFHD 4YDJB 3IU4H 3U30B 3RVUC 2Z35B 3GB7B 3VMPA 1FL3A 3LKSB 4OT1L 4ALAL 3IF1A 4Z77B 1G7QB 3L6FA 2P44B 4PP1C 4QOKA 3RGVD 1IGYA 3INUL 3VWKC 3SEPA 2CRZA 4L8SB 4G6MH 3C09B 4ZS7H 1A6AA 5INCB 4ZNEE 1LO0H 4IIQB 3O0RL 3WUWA 2HYMA 4IM8A 2WINA 3TP4A 1DQJA 3FL7A 4H20L 3RVUD 1AXSB 4F7PA 1I7TB 2A9MH 3WDJA 3TJHD 2D03L 3VCLB 5FK9B 3FFCA 3S37L 1KNOA 4YBLC 4UI2A 1RUQL 2PTTA 1AO7E 4NQUA 3MZTA 1BFSA 3VFUB 1V5JA 4H0GA 4L5FH 5CP3H 3DVNB 4QHLB 4GSDL 2FX8L 2UV3A 4BH7B 4F9PC 5GISH 8FABA 4C55A 3F7QA 2R2EB 2WWKT 4NZUL 4BQ8A 3ZTNH 5IMMB 1KB9K 3SDCA 1KJ2H 3HC3L 3SOBL 3OB8A 3ZHLA 3MLZL 1G9MC 5E94A 5IV2A 4U1MB 5MHSD 4D9LH 2I60L 1UFUA 1UB6A 3WNPA 5KN5A 2CJUH 1ZVHA 5E5UB 2X4PA 1OGTB 2I9LA 4OZFB 4BKLB 3D1MC 4B7IA 4LHQB 1UWGL 1AO7B 1Z6JT 4LAQL 1U58A 5E6IB 1QPXA 4EBQL 2R4RH 1H3PH 5GRVK 5IQ9A 2P5EE 4RAUB 4MNHA 1CFVL 2VZOA 3QUZB 5CILH 3STZB 2VNCA 1CXEA 2DQJL 2OTUB 3TBTB 1ZT7B 3EO0B 2OLDA 1JWMA 1IAIL 5C6PB 5K33A 1SVZA 3PABB 3HZYA 4XPGL 4UDUA 5DK0B 3GSOB 1GHFH 1OARH 5DJ6B 2Y07H 4LCWA 1J8KA 2DYPA 2VC2H 4HW6A 2VLRA 3L5WA 3CFDB 4P4KB 3KLHC 4W70A 4PLJC 5F7WC 3FT4A 3ARGB 3Q6FA 4XBGB 1FFNA 3QEQA 4MX7A 2P5EB 2FIRT 1WITA 3V7MA 5E8OA 1O0VA 2NXZC 1CDGA 2XV6B 4XP1H 3T4AB 1FCGA 3ULVD 3WSQH 5CP7A 2V2TA 1F4AA 3TGXA 1QFWH 3TBWB 1AE6H 4GRLD 4XBPB 4PJEA 3TM6A 3X13B 3HTLX 2YZ8A 4GRMA 3LH2L 4NBXB 3QCUH 4AEHL 1UJ3C 5FM8A 1KCLA 1QVOA 3BDBA 3MLWL 1OTSD 4HIIA 5CINH 5F88B 4HXBL 2VR4A 4WW1A 4XVSH 4YFDB 3LVEA 1X3DA 3FQXA 2DS4A 4Z7UA 3VI3F 5C0DB 4PJ7F 4YIQA 2OJZL 3Q48A 4U4BA 5F7NC 1BQSA 3N1QC 1D5BB 1DN2A 1EO7A 3WIIH 1J5OL 4ZS6C 3ARVA 1NGXB 2YEZA 3WKML 4PPTA 5J1TC 2XG5A 2QLVB 5FFLA 2RFXB 4AL8L 3ULUE 4FQXB 5IROC 1JRHL 3WS6C 5JQ6L 4LQ1A 3U0PA 4DVRL 1K5NA 1YQVH 3AS2A 5D7JD 5DJ0B 3MR9A 2R2BB 3WJJA 1MCOH 4OLVL 4M6ML 1A9BA 4OZIA 4NQVB 4JREC 3VXMA 3RL1A 4XTRD 4NM4H 3BGMB 4LDOB 2ICWI 4QXUH 3MLVH 1CR9H 1B90A 1IGJB 1E27A 4U31A 5IEHB 5TPWL 1G1CA 4ZOBA 3CFCH 3LKNB 25C8H 5CSZB 3NVQA 4NYLB 2MWCA 3V4PL 3BVNB 5ESQA 1NCCH 4I5BB 4Y1AB 2ZJSL 3QEGL 2EC9U 2IMNA 4PJXE 3K1KC 3B6SA 2FX7H 2Y9RT 4QHNA 2DQFB 5K9JL 3QFJB 3PL6C 1AQDB 1QNZH 1H5BA 5DMIH 2VDKH 5CIPH 4H1LH 4U1KA 3L5IA 1GZQB 4X6BA 3L5JA 4V2CB 4UU9A 1KTDB 4YUEH 5B39B 4HWBA 2NW3A 4JRXA 5F6HJ 2HJKB 3ZE2E 1CXLA 3U6RA 4H8WL 4HLZG 2DWDB 4E0RB 1TQCC 3GSNH 1UQSB 2W9EL 2QR0A 2JIXD 3DUUA 3TO4C 3TPUB 2AKRB 4YHLL 1YECH 4TOYL 3U46B 4P48A 4NGHH 4A6YB 1WQVT 5JO5A 4LSQL 4G3YL 4Y88A 1RZKC 1CDHA 2A9NL 2DQDH 1G7HA 1I7RA 2B8OT 3ZDXE 2VERN 1WBZB 3N9GH 5IOPB 4HX1A 4GXVH 4HUKB 5HHNB 1NUFA 5JA9A 1S9WB 3R0MA 2X70B 4FN0A 5IB4A 4YHNB 4J6RL 4Z95L 1T0NA 3TO4D 1LD9A 4U1HA 4P5KB 5KW9H 3D2UB 3O4LB 2E6QA 4GAFB 2E9JA 2J88L 4X6DF 2EIZB 4U2YA 1R24B 4Q0XH 3L3HA 3K7UA 3I3BA 1SEQL 1D3CA 3MLUH 3S35X 3MRGA 5IWLA 4IRJB 1ZS8B 1I7ZA 2R2CA 2VXUL 4G42B 5KBNC 1RD6A 2FATL 4MD5B 1R3LA 6FABH 1FGNH 4Y4HC 4HK0B 3BT2L 3SGJC 1YA5A 3QZWG 1P5VA 2DTSA 4G8EA 4PTTB 5BRZA 1XFPA 2A83A 5JDSA 4P46B 1J1XL 5DZLA 1RZ7H 2FHFA 1H3GA 4TN9A 2APTA 2L7JA 3P9LB 1ED3A 3GZKA 3G5ZB 3PV7A 1QR1B 4PRHD 5D2NA 3S97C 1IL1A 4X5WA 3MA9H 4BK4A 4PUBL 3TN0A 3WE6A 4ZD3H 3QQ3B 1DLHB 1T83A 2ADJB 3VFVA 4NCC2 5HGGS 1FVDB 4M6NL 4JQIL 4K55A 5IESH 3VMNA 1OW0A 1IAMA 1TXKA 5DYOB 4C83B 1INQB 2AXFB 2CIIA 4HK3J 4FXLA 2DLFL 4EVNA 5T1KB 5BS0E 1ZEAL 1DQML 1UM4L 4YHYC 3RZCD 1ZT4B 4RMWA 3HI6L 2O5YH 1XCTB 3ECBA 1AR1D 5FA4A 4KRPB 3BGFB 1M6OB 3IU3B 1KYOJ 3FO9B 5ELIA 1PY9A 3AAZA 4GAYB 1CL7H 2VABA 1WWCA 2NY1D 3F6LA 4JHAL 3FHAA 3KYKH 5C86A 1KXQE 3WDIA 4U6YB 1RUML 4A2MA 5FM5O 4BSJA 1OTTD 5E6ZA 2CKNA 3GMPB 5TF1H 1DE4A 4WHTB 5FM4A 3BHBA 3KYMB 3OTTA 2YS4A 4QHUB 1R3HB 1MJ8H 3PDOA 5BS0B 4ZFGL 3S3PA 4OAWB 1KB5L 2WSKA 3MRKB 4ONGH 4TTGA 4MAUL 1QSVA 3MRJB 5IMKA 4X4YB 5DTFA 5HVWA 2FX9L 4P2QB 4FTVA 1WJ3A 3RJDA 5BMFH 1C12A 5C0BA 3QXAA 3OJMB 2EEDA 4QY8B 4NN5C 2V5MA 2VDQH 4LIQE 3VGAC 5ALBL 1D9KB 1Q72H 2DQEL 5FUCE 3LPFA 2IFGA 3R8BB 5DS8B 5GS2H 2D7MA 5D7LB 3BE1L 5D1QD 2H32B 3GBMH 3WNOA 2BVUA 3V0VB 4MHHI 4AIXA 3EIFA 4PJ8C 2L0DA 4PY7A 5DO2C 4NKOA 3G6DH 3KR3L 2D2OA 3HI1A 5HYIA 3HE6C 2YUVA 4TVPE 1MHPL 1B0RA 1WZLA 4BSWB 1NFKA 4MQ7B 1T5XA 3UBXB 3NPZB 1INDH 4XB8A 4PRID 4PJ8D 4NN6C 5DO2D 2Z0BA 1Q9KB 1AD9B 1II4E 3E8UH 4L3CA 4E41D 2Z4QA 2NY3C 3ROLB 3HE6D 4O5LL 2VITA 4K3HA 3QCTL 4QXTB 4JFYB 1U8HB 3KYOA 1RJZB 4P5TC 5BZDA 3IGAA 3O6LH 3ULUL 1XCQA 1CGUA 4R2GB 5HYQA 1N64H 3NH7H 4LMQI 1NCAL 2R2HB 2VWEE 4K3JL 1ZLUH 4JDTH 4DN3L 3QH3B 1MCSA 4YK4B 4EDWL 2FSEB 3HCVB 4I0PD 3ARBC 4JGMA 4KROD 3DLQR 3C5ZA 3KPSD 5F96L 3ULUF 5B22A 5JHDE 2ESVA 4YE4H 2J12B 4YQXL 4NRYB 2MCG1 2AABH 3GIZL 1QHPA 4I2XE 2O61B 1GRWA 5DD3H 4LL9A 1KN2H 4DZBB 4U1SB 3V52H 1FC1A 1A6UH 5IIEB 4F7TA 3VW3H 2D9QB 5FKAB 5E2TL 3WNKA 3G9AB 1IT9H 2GSGB 4YHOL 1NLDH 2K7QA 3ZT7A 2UYLB 1FO0L 4RGNC 5HPOA 2C7UB 2YD3A 3IFNL 4NJAL 3SKNB 4QOKD 1QLEL 2VB5A 1MH5B 4ZO8A 5JORB 4ZUWB 5AZ2H 3CU7A 1WUNT 5HBBA 4Y4FA 1LVEA 4A6YL 5FUZL 3FONA 1EFQA 5KVGH 1CQYA 5LAXB 4G7VH 4PJXF 4U1LB 2YWYA 1SM3L 4O2EA 2CKBL 3X11A 2VDLH 1JGUL 1ZHNA 4J3UA 4OZ4B 5I30L 4RAVA 5MERA 2EDQA 3FFCD 5FV1L 2HT3D 1F58L 5HHOA 1JGLL 4BH8A 3SCMA 2CDFB 4QRPE 4PJ9B 3LRHA 1OSZA 4MXVE 2YHGA 5HXMA 5HHVL 4DW2H 5IBLC 3DV4B 4HUXA 4D0BB 3MRQB 3B9KB 4G8FA 4A2LA 3G04B 3DPBA 4JZNA 2DMBA 5LCVH 3TYGL 1UT9A 4OCLC 2BSRA 2NX5B 1L0XA 1ODAA 4H0HB 4ZUSA 2BOBA 1U8OA 3IDNA 5E2JA 2EDBA 1KLUB 5SWZE 3M07A 5E2UH 1MPAL 3ALWA 3SDCD 1E4KA 2WMPA 4YDJA 2Z35A 3RAJL 3GB7A 1CF8L 2V2WB 3HR5B 3LKSA 1X5KA 3BQUB 1CDBA 4QRUB 1QFPA 1G7QA 5IBLD 1XR8B 5L9DL 2XZAL 1ZKAA 3NACL 3GHBH 2AAVA 3TZVB 4L8SA 4MD0B 5T5FH 3SO3C 4QRPB 1TPXC 5INCA 1KJVB 5DWUL 4IIQA 5T3XD 2Y6SC 2XA8L 1UXSB 1RUAH 2YPVH 1CD0A 1AXSA 4FFZL 3Q6GL 1I7TA 4JB9H 4GQ9H 5FCUH 3V0AC 2ED9A 3VCLA 5FK9A 3JWOC 5DJCB 4Y8DC 5C9JB 2NXYC 5T1DL 2EH8L 1G7MB 4PRDB 1PGRB 4LCWD 4G7YH 1KEGH 3UTPE 3VFUA 1K8DB 4M9PA 1VEOA 5J13C 3DVNA 4QHLA 2VLKE 4JY5L 5F1NB 3HB3C 2EYSB 1KCRH 1N4XL 4BH7A 2BFVH 1VPOL 1U3ZA 4HF5L 5MENE 3BIKB 1NAKL 2R2EA 4I9WD 3V6OA 4ZNEA 3L7EB 5IMMA 4GKOA 2IH3B 3E1F1 2Z8VC 4U1MA 2VDRH 3E2HB 1BBDH 4LP4A 4P2RD 4XPBL 3GMRB 2IQ9H 1AJ7H 1QA9B 1T4KB 1T1XB 2W91A 3ORJA 5F89B 5EU3B 4PS4L 4HJJH 1OGTA 4KK8C 1AQKH 4FABH 4OZFA 4XC1H 4BKLA 4RFEB 4HBCH 3SGDI 5FECB 1AO7A 1IGML 3RWCB 1LO3H 4FZ8L 2ENSA 5E6IA 2F54E 2YC1B 2QQNH 4XB7A 2O26U 4RAUA 2XA3A 3QUZA 3STZA 2R0WL 2OTUA 1HI6B 3TBTA 4E5XB 1ZT7A 3EO0A 3CXHJ 3QXTA 3ZKXB 5MENB 5D7IB 1KACB 2ZUQB 4Y89A 3SKMB 4YC2B 2H45A 2CUIA 2UUDK 4KK8D 5EFIB 3PABA 4M7ZB 5CS7A 5DK0A 2AK4E 4FZEH 3GSOA 4NBYB 5DJ6A 2E7HA 1YUHB 1IGCH 4N1EA 5C08E 1YEIL 3T08A 4YX2L 4O9HL 5DRZB 2XPGB 3CFDA 4P4KA 4EOWH 3C5SB 2KKQA 5EIQA 2W59A 5GJTL 3S9DB 3ARGA 4XBGA 5CFHA 4JHWH 5CEZD 2F54B 2AI0L 5CJOH 5E8EB 1JF1B 2MOVA 5KJRL 3BZEB 2P5EA 4JO2H 2X4TB 4PJGE 5FHBL 5KVEL 1A5FL 2A6IB 1PJ9A 4DUVA 4XPHH 3VXSD 4G6FD 3T4AA 4U05A 4LPYA 3LMJL 2WZPD 2ZUYA 4FQJH 3QPQC 3VXMD 1HCFX 4LIQL 3VFGL 2DDQL 3TBWA 2R0ZH 4XBPA 2HKHH 1M7XA 4NO0B 3KPLB 3X13A 1N5YH 1SBSH 2YZ1A 1SJXA 3DHMA 1WICA 5BZWB 5C08B 3AU1B 5EU7C 1F45A 4F9LA 1MIEH 1XH3B 4HIHB 4WUKH 3BKYL 3QCVL 5C09E 1U3HB 5F88A 2AQ3A 1N0XH 2XTLA 4DN4H 3WXWL 3VG9B 4S1SH 5C0DA 4I3GA 4PGBB 3N1FC 3NFNB 4YHZH 1D5BA 4ONFL 3QQ4B 4TVPL 4S0TD 1NGXA 3VXOB 5IHLB 4TUKH 2BZDA 2X2YA 3IFOB 2RFXA 1I1AB 4FQXA 5F9WC 2VDMH 3MYJB 1A7NL 2UWEB 1B2WH 3O6FB 2DQUH 3ELAT 2YA0A 4YHKH 1UXWB 1OAQL 5GHWL 5DJ0A 2R2BA 1ZK9A 3N1PC 3GBLA 4FRWA 4M00A 4GUPB 4X6EB 4HGWB 3DMMC 4NQVA 3T65A 4HWZA 1KPVB 2NZ9C 5HYJE 1MHHB 4ZPVB 5C7XL 4LLMB 3BGMA 1NBZB 1YQ2A 4LDEB 4I77L 3FQWB 1NMBH 4Y4KA 1IGJA 2Z31C 4NKIH 5IEHA 1YPZB 3LKNA 4M1GL 5CSZA 3S3SA 4JJ5B 3WL9B 4YH6A 4NYLA 1AKJD 2R56H 2LABA 3BVNA 5EOCH 5TE6H 4I5BA 1F3JA 4Y1AA 3WD5H 5I75C 5FUOL 5ITFB 5HI4C 1MCPH 5IB2B 5I8KH 5IMOB 4S2SB 2DQFA 3U7YL 2OK0H 3QFJA 1FBIH 1IKNA 3OAYK 1AQDA 1U95B 1G7IB 3ARUA 1V7MH 5KAQF 1WGOA 4UINL 2BNQE 2V2XB 4K3EH 3J8F7 1GZQA 4MB3A 5HYJB 1FORL 5HVHB 1LQSR 5B39A 1KTDA 5E1AB 2O5ZL 5A1AA 5HI4D 1D5MB 2OMBA 2HJKA 4HWNA 2MKLC 5C0FB 3QPXL 4LCYB 1PG7X 3QDJB 4RMQA 3EFDL 5AYQA 2VH5L 3ESUF 2DWDA 5BRZD 4E0RA 2R69H 4QEGA 2YPKB 1F4XL 1UQSA 2EEAA 1RFDL 3TPUA 2AKRA 4UV7L 3FOMB 3T0EC 3F58L 1NAMH 4KI5D 2ATPB 3OJ2C 1FNLA 3U46A 4RRPG 5ANME 5DMJB 4PG2A 4A6YA 4HK3N 5BVPL 3TN0D 4L8DB 4EDXB 4CUCA 3LOWA 1WBZA 4M7LH 5IOPA 5HHNA 5L2KD 4NQTA 1S9WA 5FGCE 2X70A 2FH6A 3NCMA 4YHNA 1G84A 5CZXD 4OCRH 1RJYB 2NR6C 1G0XA 1QSFE 2DLEA 4P5KA 4KQ3L 3D2UA 5DJYB 4P99A 2D7PA 5DUBB 3O4LA 5FYLH 2IADB 1J8HD 2EIZA 1R24A 5C0RL 2V5RA 2VMFA 3QJHB 2Y72A 3W2DH 2KUTA 1AD0B 1Q1JL 4X9BA 5E99L 1BGXH 2ZSWB 4IRJA 1MCKA 1ZS8A 1RJLB 4G42A 3BZDA 2EO9A 3L1OL 4ERSL 1JZ7A 4MD5A 5DFVD 3CSYB 4HK0A 4M48L 1MRCH 1UM6L 3UYOD 1GGIL 1IEHA 2HKFH 4PTTA 4BUGA 1YN6B 1S8DB 3RWJB 4MDIB 3HMXH 4P46A 4RWYL 5HGAB 3U9UB 1IJ9A 1QSFB 3FKUS 1T20B 2LVCA 3P9LA 1QR1A 3G5ZA 3V0WL 1ZSDB 2R0KH 3L3IB 3BRDA 4LSSH 1NCWH 3I6LD 4XNUL 1YYLL 3FB8B 1C7SA 4O58H 5IB3B 3QQ3A 1DLHA 2ADJA 1N7MH 4PJIB 4HCRL 2OMNA 4Z7WB 1VA9A 1W0WB 1YNKL 3FO2B 3UTSE 4JLRB 3S5LG 4XP9L 5C0BD 2EDNA 4OTXH 5C0EB 5DYOA 4C83A 1INQA 2AXFA 5ENWB 1PSKH 4TULH 5LVEA 3C6SB 4NP4L 4KJPC 3R4DA 5T1KA 1XGTB 3P30L 3HAEG 1T0PB 1YMMD 4ENEC 1JN6B 4CGTA 5IUSA 1CE1H 2H6PB 3FB6B 1ZT4A 5JW4N 1XCTA 3KPRB 3SQOL 3RVTD 1IGIH 1ZLSH 1I8IB 4HPYL 4HUMB 1M6OA 3IU3A 3FO9A 2VSCA 4GAYA 3B8YA 1BQLH 5FGRA 1T6WA 1IFHH 3C87A 3L95B 4U6YA 3QIUC 1TCMA 5KVDH 4WHTA 2C3VB 1UJTA 4XGZB 5BCAA 3KYMA 4L8CB 4QHUA 1R3HA 2FJFB 1A1MB 3KJ6L 1E6OH 4LQFH 3H3PH 3FZUC 5BS0A 4K9EH 5ETUB 4OAWA 4MB5A 3MRKA 1BIIB 3MRJA 3QIUD 2VLMD 4X4YA 5JW4Q 4P2QA 2WBJC 2P46B 4M5YL 4DKDC 2NY6B 4QY8A 1ZVYA 5C0CB 3HNSL 3O4OC 4X5XB 4QHKI 5L8JB 3FZUD 1D9KA 4OI8A 3I50H 5DS8A 1SEBB 1G0YR 1QFUL 5I9QB 5D7LA 2ZOLB 2BY0A 3BH9B 1W2KT 2CLVB 5TFSH 4J1UB 3C5ZD 3V0VA 1T7ZA 3QWRA 2ESVD 1XGRB 5LGKA 4O2FB 4PJGF 3EJYC 4LEXH 4M6OL 5LBSL 3DGGB 3HNTH 4Y4FC 4JHZA 1YC7A 1P5UA 1FFOB 4XWOC 1SYVB 3RTQB 5C70A 1GC1H 5E8DH 1U3JA 1KULA 2EYTB 4BSWA 1I85A 3H42L 4MQ7A 3UBXA 3DNKA 5K9KB 4MAYB 5BJTB 5GS1B 4J3TA 4V1DB 3WFBL 4W6WB 3EJYD 1Q9KA 4BSVB 1AD9A 4P3CH 4PD4J 4Y4FD 4XNYL 3ROLA 3SHSA 5I71B 4QXTA 4U6VH 4OB5L 1JTTA 1SJHB 1U8HA 4JFYA 4X9HA 3WFCH 3RFZC 3K3QA 3CFIC 1FFPB 1VERA 1RJZA 2XZZA 3ZKQD 4DKFH 4LSUH 1HH9B 4MJ2A 5I1DB 3NBNA 5KAQG 2OTPA 1NH6A 3QH3A 1EZVX 4HWBH 5HHOD 2FSEA 4H8WC 4U6TA 3HCVA 1XR9B 3SCMD 4PB9H 1X5LA 1JZ3A 5HI3D 1T66D 2RHEA 1ORSB 1E4XH 1I4FB 2OL3H 4XNXH 1X5GA 2Z8WC 4NRYA 4P9ML 1A6WL 1UYWH 5DD0L 4NN7B 2O61A 2UZYB 1RK0B 4DZBA 4M5ZH 4U1SA 5IVXB 5IIEA 5GS0L 4IRZH 1JBJA 5FKAA 1H3TA 1RPQA 3IDJB 2GSGA 4BZ1H 3O45B 3T3ME 4NC1C 2UYLA 4LEOB 2C7UA 1C5CL 4WV1B 1OAXL 5JW3L 3SKNA 5M7QA 1MH5A 2VDOH 5JORA 3PWPE 4LKXB 1CFBA 1MVFA 4ZUWA 4N68A 3IDXL 4WI7A 2BY2A 1MCCA 4NUGL 5LAXA 5D7SH 1KXTB 1XGYH 4JKPH 4U1LA 1RUKL 4X6CE 3W0WE 4MGXA 4OZGB 3A67L 3S7GA 3DBXB 4OZ4A 1BBJB 2EDTA 1KLFA 4R4BB 5DVMA 4MJIE 2RGSA 4LRIC 2CDFA 3TT1H 1V7NH 3EAKA 5DJXB 4PJ9A 3DV4A 1X9QA 3BJLA 4HHAB 5F6IB 1F8TL 4D0BA 3Q5TA 3MRQA 3B9KA 2I9TB 3G04A 5DXWA 4I3RH 5J3HC 3BZ4B 1HIML 2NX5A 3V8OA 1KCUH 3R06B 3SJVE 3BPOC 4I1NB 1KLUA 3CSPA 4CU7A 3O8XC 4J3XA 4ZNCD 4X6CB 2XN9E 3W0WB 1JL8A 2V2WA 3HR5A 1I8MB 4KTEH 3BQUA 5FYKU 4QRUA 1PW3A 1MOEA 3N85H 3TJEH 1XR8A 4RBPK 3W5NA 3I9GH 35C8L 4Q6IC 4KDVA 4ZOCA 4MD0A 3TZVA 5I73C 1D5XB 2AXGB 3BAEH 5J3HD 1MJJB 4QRPA 4AG4L 2EC9T 1AO7D 1VEPA 1U8KB 3VGGA 1KJVA 1RV6X 1P4BH 2DKSA 3LN5B 1UXSA 4UV4L 4L4TE 4PJHB 3O3BB 4F15B 3VRLE 1DQDH 4XPFH 2IC2A 3NZHL 3S34L 2Y36H 3SJVB 4EI5B 3H9HB 5C9JA 4R4ND 5F7EH 3D39B 1HDMB 2XN9B 1G7MA 2YK1L 4PRDA 4LHJB 4DQOL 2CXKA 1K8DA 3HE7B 1ADQL 2X9YA 3VG0L 2BJML 3UP1A 4LOUC 5F1NA 2EYSA 3STBA 4P4KD 4UAOC 4N5UA 3BIKA 1XEDA 5E7FA 4C56E 4LASL 3L7EA 2A6DB 4MDJB 2IH3A 5GGVL 2JELH 2P5ED 3JV5A 4XXDB 2VJXA 2LVEA 3GMRA 1QA9A 2C4FT 1T4KA 1L7TL 1T1XA 2D7TL 1UZ8B 5F89A 5EU3A 4RFEA 3WFZA 1D5IH 5IW6B 2K1MA 3CH1B 3RWCA 3ARYA 1OTUD 2YC1A 5HI5C 1RJCA 1FGVL 3JWNC 2PYFB 5MI0B 3IT8D 4G9FE 3AUVA 5FM5M 3I6KB 1HI6A 4E5XA 5DLMH 1RVFL 2UZXB 3KPTA 5MENA 5D7IA 4JN2B 1NANH 3L7FB 4HLJA 1MI5E 3SKMA 5KSUB 3RZWA 3GEWB 5EFIA 5IGXH 2R1WB 1T3FB 2YSSB 1N6VA 3GK8H 2PO6C 1HXMB 1YUHA 3ARPA 3MNZB 5J56B 4R4FL 2DM2A 3J7HA 4P2CG 1K6QH 3JBG7 5HYEA 5DRZA 4XBEH 2XPGA 3C5SA 1YN7B 3AFLA 3EYSH 4Y4KC 2MQCA 4DAGH 2VZSA 4FQXD 5TGBB 3FMGL 2F54A 4WI5A 1WK0A 5E8EA 1CYGA 1JF1A 3BZEA 2X4TA 4AM0A 6CGTA 5E8NB 2A6IA 1TENA 4KVNL 2PO6D 1ACZA 3HUJB 4KUCD 1V3LA 1RIVL 4HIXH 2I5YL 1QYGH 3ULUC 3TA3B 1HE7A 3BW9B 3GMQB 4ZO7A 4Y4KD 4Z7OF 5JHLH 5IJKC 2EXYC 4NO0A 3KPLA 4CRPA 5C08A 3SBWA 5BZWA 3AU1A 3WYRA 2HH0L 4BFEA 1XH3A 4HIHA 5FKPB 4Y1AD 1U3HA 3ARFC 3GJFB 4JY4B 3ULUD 4KUZL 5DA4A 3V5HB 3SDDB 1A7BA 5JXAH 1KJ3H 4PGBA 3UZVB 5SX4I 1KTLB 3NFNA 4WCYH 3QQ4A 1D6EB 4W4OC 1JPST 3OX8B 1OP5K 5E4EC 2BMKB 4F58H 3VXOA 3IDGB 1A3RH 3GKZA 3ARFD 3IFOA 1I1AA 2G75B 1EIBA 3KG5A 1JF6A 1YEEH 3MYJA 5JZ7D 3V4UL 2UWEA 3O6FA 4U1GC 2H2PC 1UXWA 1NGPL 2Q20A 1BZ9B 5HHXL 4LCIL 4GUPA 2FO4B 2XKSA 4X6EA 1FL5B 4HGWA 1A1OB 2CXGA 1KPVA 4JO4L 1MHHA 4ZPVA 4LLMA 3WKNA 1NBZA 1CLZH 1A2YB 3FQWA 1RZFL 3LB6C 5HTSA 5JDJA 4OCWL 1YPZA 1NBVH 1MCHA 4JJ5A 3WL9A 3K2UH 5K93A 3GSQB 3TNNB 1FZMB 2H2PD 4OCSL 3ARDB 4P59L 2VAJA 4YWGH 1KTKE 4DEPC 2DL2A 1IC4L 5IBUG 3OKEB 4MQXC 3BMWA 2C9AA 1ZA6B 5ITFA 5IB2A 4WTZG 5IMOA 1LK3H 1A7OL 4S2SA 3QWQB 1U95A 4OCXL 1G7IA 5FO8B 3O2DH 2J8HA 3HZMB 4AH2B 1LP9F 4DTGL 2V2XA 4JHBA 3MMEB 2QKIB 4XNZB 5HYJA 3EFFB 1FZOB 1FNSL 1YY9C 5E1AA 4MQXD 1YNTA 1D5MA 1FDLL 2BVEA 2E9IA 5C0FA 1HXYB 4LCYA 3W9DB 3BJ91 4R90H 4CDHA 2F53E 2OQJB 3KXFE 3QDJA 2DLGA 3T3MF 4JKKA 3CLFH 2C3GA 3MV7B 5EH1A 3VD3A 4IOFC 1CGSL 3ZTJG 4YEFA 5CGYD 2X4QB 3TH3T 2Y23A 3FRPG 3LN4B 3FOMA 2ATPA 4BJLA 5F70A 3PIQB 1F2QA 5HHQB 3TH4T 3AVEA 1NCUA 2QQLH 3QULB 1PY4A 5ACZB 4L8DA 4EDXA 3MCLH 2BVQB 4WTZA 2AEIT 4CU8A 3BRGC 2FL5B 5BO1L 5I17B 2FO1A 4MCYB 3ZE0E 1S7QB 1RJYA 1OL0A 2B0SL 3BKMH 1QFOA 5DJYA 1J88A 5DUBA 3KXFB 3QUXB 4GRWB 2IADA 1CGVA 4PV9B 1F4WL 3QJHA 4RFOL 2LAGB 3OHXB 3FAXA 4GLRI 1AD0A 2VDNH 1SQ2N 1X7QB 4FQPA 4X80H 2ZSWA 3GRWA 1YNLH 4NC2B 2DQHL 1RJLA 3EDEA 2YUXA 5HY9B 1QFWM 5I1EL 4KRPD 4XT1C 1J0ZA 3B8SA 3CSYA 1W8OA 3DXAE 4AENB 3ZYZA 4H1LB 2GY5A 2MTPA 4I3SL 1YN6A 1S8DA 3RWJA 2G5BB 4MDIA 1JPGB 3REWB 5HGAA 3U9UA 2NYYD 4LVHB 3B43A 1QSFA 1T20A 1ZSDA 2J6EH 5DRXB 3L3IA 5D6DC 4GMTL 4OSUL 1N6QH 2WP3O 5BV7L 4LVOB 4KMTH 1D9KC 1A8JH 3G5VB 3FB8A 5IB3A 1EJOH 5JUEL 3UTOA 3IU4L 5BS0D 2Y06H 4WFHE 2X9XA 4PJIA 4WHYG 4Z7WA 1W0WA 2X1WL 3FO2A 4U49A 3H2WA 3QIWC 4JLRA 1R0AH 1NC4B 5KOVC 4G6ML 4FQLH 5C0EA 3SKUD 5ENWA 3DXAB 2EKJA 3C6SA 1LO0L 4P49A 2CO7B 1D9KD 3DX8B 1XGTA 1D6VH 2D4DA 2AJVL 1PBYA 2QHRH 2YWZA 1FH5H 3EO9H 1JN6A 3X3GH 1FLTX 2H6PA 2A9ML 3FB6A 2P24B 3KLAB 3KPRA 3T0VA 2X10A 1I8IA 5GRWA 5FUCC 3ESVF 5E9DB 1DN0B 2H3NB 2XOTA 1KELH 3L95A 4LGSB 3KPOB 3L3GB 5L88H 1VGEH 4L5FL 4N5ED 3EKCA 12E8H 4F37K 5ICYB 2C3VA 1OP3H 1NGQL 5GISL 1H3UA 2DI9A 4XGZA 3RY6A 1CIUA 4L8CA 5MP6H 1JWUB 2FJFA 1A1MA 4OF7A 3MLXH 5JXEA 3ZTNL 1KJ2L 4CN6A 4HG4K 3CLEH 1ZHBB 3DHJA 3PG2A 4OLZH 5ETUA 1WEJH 3D9AH 3EOTH 2ITDB 4D9LL 1XT5A 1VFBB 1BIIA 4JFFE 5LQBH 3SGDH 3IFLL 3O3EB 1YEGH 5MHSE 5DHVH 3AREB 5D93B 1TZIB 5C0CA 1EVUA 2AJUH 4K7PH 4X5XA 1S7SB 4HJ0D 2R4RL 5KZCB 1SEBA 3QISA 1W8NA 2Q8AH 5CILL 3U7WL 1CBVH 1QD0A 2ZOLA 3BH9A 4TVPD 4J1UA 2DTMH 2X89A 4DJMA 3H3KA 3X12B 4AEEA 5FB8B 1PDKA 4YHML 1XGRA 4IJ3B 4O2FA 3WN5C 3EBAA 1KC5H 4CU6A 1NL0H 5EWIL 1GHFL 1OARL 1LILA 3KYNB 1HNFA 1Q9WB 3DGGA 3LQAL 2J5LB 4IMKC 4JFFB 1FG9C 1U6AL 1MAMH 3SE4A 2ZPKL 4N8PA 2VSDA 1FFOA 4PJDF 2VC2L 1VADB 1SYVA 3RTQA 2PYEB 2I24N 1MJUH 5TE7H 1F42A 2YPLB 5E0QA 2EYTA 4RSVA 4OJFL 1R5IB 5K9KA 4MAYA 4LSVH 1SYSB 5BJTA 4XP5H 1HK6A 5GS1A 3B9EA 4V1DA 4BSVA 2PW2B 2MQ0A 4XP1L 4PJ9C 4RNRB 2GK2A 3H9ZA 3LRSB 3Q1SH 1HYRC 1SJHA 1JPTH 1OT2A 1FFPA 4LLUB 1QFWL 1AE6L 3OAUL 2QV2A 2ZUVA 1HH9A 4X4MA 1BQHB 3WNMA 5I1DA 3D0LB 4HMEA 3U0TB 4XCNB 3QCUL 4Y16B 2V7NB 1CTNA 1XR9A 4ZPTB 1BWMA 4PJ9D 2FR4B 1MLCB 3OAZK 3BQUC 1ORSA 1MREH 4XVSL 1I4FA 4HKBB 1FNAA 3TO2B 4Z8FH 5ISZE 2F5AL 1NGWB 3B9KD 1MFBH 4LPTA 3TZVC 2AW2A 3JVGC 3P9WB 4KXZI 2NX5D 1RK0A 3ET9F 5KSBB 5IVXA 4LLWB 2P48B 2D7QA 3MXVH 3EOBB 2FLBT 2WBWB 3IDJA 3CDFA 3BP4B 3O45A 3D87B 3BQUD 4LEOA 3T2NH 2W0FB 3BH8A 5EOQH 2YA1A 5FYKL 4OCNC 3T2PA 1WZMA 1KN4H 4WV1A 4XVTH 2APXA 1YQVL 4YZFE 4LKXA 3EUUA 3X3FH 3TZVD 2PXYC 3QNXB 2NY5H 4QRPD 1DBBH 4LVEA 1MCOL 1H15B 1MRFH 4MA8H 4Z7VB 4NM4L 2EO1A 3QHTC 4OZGA 4UT7H 3V9FA 1NEZG 4F33B 3MLVL 3DBXA 1CR9L 3VFPB 1BBJA 3FQRB 3DTXB 3CFCL 4R4BA 3G5YB 1GSMA 2GJJA 5SWZD 2FGWH 1NCCL 2PXYD 5DJXA 1GAFH 5SWQB 4HHAA 3W82A 1RZJC 4ZUTB 2F5BH 2FX7L 3NCYP 1FNFA 1MCFA 2ERJB 3PWUB 2OCFD 3BZ4A 3QUKB 1KCVH 1CDUA 1IQDB 5A3IC 3R06A 5EO1B 3VXUE 1QRNE 4Y2OA 5DMIL 1FE8H 2VDKL 1L4IA 4X6CA 4FQ1H 3W0WA 2DBLH 2VIRB 4GMSL 4JAMB 1I8MA 4YUEL 4LCCB 3VXRE 3ZKXC 1BFVL 1KENH 3P4NB 3BXNB 4HZLB 1HWHB 4P57B 1D5XA 2AXGA 1MJJA 1CDYA 1LO2H 1CZ8H 5GGSB 5A3ID 1EEQA 3GSNL 1U8KA 3UTPD 3LN5A 3FOLB 1YECL 4PJHA 3O3BA 5A2KH 4APQB 1J7VR 2Q87A 1M71B 4NGHL 5MEND 3SJVA 5HGDB 4EI5A 1ONQB 3H9HA 2DQDL 3D39A 1HDMA 2XN9A 3GNML 5CJXA 2APFA 3N9GL 3ZE1E 4OLYH 4NFCA 4UTBH 4AYFA 3HE7A 2DQCH 4HFWB 4ZYKB 3VXRB 4HWEH 1NMAH 1C08B 4RMRA 2B20A 5KW9L 3G5XB 1IMHC 3RX7A 4FMFA 1DQLH 3THMH 4JCMA 3VD7A 1AY1H 1UG9A 1KOAA 2A6DA 3CFJB 2F54D 4WEBL 4Y5XC 1UB5B 2O5XH 4MDJA 3MLUL 4MA7H 5DJAB 4XXDA 1V8HA 4NJ9L 4X9IA 6FABL 1FGNL 3OPZH 1I9IL 3WO4B 1UZ8A 4MJ4A 3MRMB 3QDMB 2DAVA 5IW6A 1UZ6E 3CH1A 4XMKH 3I75B 4YFLF 4YGAB 2BK8A 4DCQB 4N1CA 4HULB 2PYFA 5C08D 3I6KA 1AGCB 2VXQH 3MA9L 3EW3B 4NRZB 3U1SL 2H32H 1Z9LA 1F6LL 1I1AC 2XZCH 4JN2A 3WNLA 3L7FA 3EYFB 4QRRB 5KSUA 3VD4A 4EQ3A 4ZD3L 4LVNB 4D9RE 3O6FC 2R1WA 1T3FA 2ARJQ 2YSSA 3W81A 3V95A 5FDWB 3L5XH 1HXMA 5IR1B 2GQHA 3MNZA 5IESL 5CKAA 3F6IA 3MODH 4GS7C 3O2WL 3UPCA 1YN7A 1UH3A 4HIEB 1I1AD 2G2RB 4Y5YB 5TGBA 1ND0B 2BC4B 5E95B 3O6FD 1MVUB 5E8NA 3A6CL 1EGJH 2BSSB 3HUJA 3MJ9A 4K3DH 4ONOA 1MEXH 4OF5A 4LSRH 3TA3A 1MI5A 2RB8A 5F93C 3AMLA 2NY4B 3KYKL 3UJJH 3C5JB 1LE9B 3BW9A 3GMQA 1PZUB 4ZSOE 3HR6A 4O00A 4XHQA 1YMHB 1IAKB 2R1XB 4Z9KB 3V6ZB 4OD2B 4K7FB 3K4ZA 2V9TA 3BEVB 3RBGA 5FKPA 5HVHC 3GJFA 4HDIB 2BNRE 2KPNA 2R1YB 4JY4A 1TJIH 4Z18A 3V5HA 4ONGL 5TDNB 1CGWA 5GS0C 3SDDA 1T2QH 5DEGB 1I3UA 2X1QA 1KTLA 1P1ZB 5BMFL 1D6EA 3QNZB 2UUDH 5HHMB 4WWKC 5C3LD 3QI9B 4Y5VB 1UEYA 3QG6B 3OX8A 2BMKA 5AZEL 4HJGB 1RZGB 1RSFA 5HYJD 1A1NB 3BO8B 5TH2B 1Q72L 4C57C 2G75A 4ZSOB 5C0ND 2P7TB 3KPNB 4J3VA 4QCIB 4QLRA 2WP3T 3GBML 3TBYB 1BZ9A 5B38B 2EICA 4P9HL 4WWKD 2FO4A 2BNRB 1FL5A 3CZFB 1A1OA 1A2YA 3GKWL 4XCFH 4GBXC 3B2UC 3CSGA 4F57H 5EIVA 5D1ZB 3GSQA 3TNNA 1FZMA 3D85B 4M1CD 3ARDA 4PJCE 2DMKA 4LLDB 5CEYB 1INDL 3OKEA 1ZA6A 1CFQB 2HFGH 3RKDC 5J11C 3K8MA 5KVFL 4PRIE 3E8UL 5I1GH 3QSKB 3MROB 3B2UD 4GBXD 5FO8A 3HZMA 4AH2A 4MMZC 2ORBH 3MMEA 5T5NF 2QKIA 1AFVH 3O6LL 1FZOA 2NTSP 1N64L 1KIPB 1ZLVH 4M7JH 2Y1VA 4JDTL 4P23C 4XMPH 2XRAL 5DMYA 5LJYH 1FP5A 1WF5A 3PHOB 2B4CL 1HXYA 4ODTH 3W9DA 5DA0B 2D9CA 2OQJA 3IFPB 1EHAA 3MV7A 4W6XB 2Q3AA 2ZUXA 1P9MC 2X4QA 2YA2A 2AABL 4YZFF 3LN4A 5FAAA 1QSFD 1KN2L 4JFZL 1SY6H 3PIQA 2EXWC 3TCLB 3V52L 5HHQA 4P23D 3QULA 3VW3L 4JFXB 5ACZA 5JW4M 2V17H 1IT9L 3EZ8A 3PWNB 5GGTL 2BVQA 4BFBD 3JTSB 1TTGA 1J86A 2BXZA 2OTWB 1KYOK 2FL5A 5I17A 4JZJB 4MCYA 1S7QA 4PTUB 4TVSa 5F3BB 2D31B 3OKNB 3OB0H 3KXFA 3QUXA 2EXWD 4X7SH 3CCHB 4PV9A 4KK9C 2EC8A 3I2CH 3QYCA 4G7VL 1QBML 1WCQA 3OHXA 4Q2ZB 1IQWH 3D48R 4WO4B 1CK0H 1X7QA 3NA9H 3BPNC 4Q9RH 1KSRA 2VDLL 2JJTA 3QG7H 2V5YA 3KPRD 3OAYH 5HY9A 1ZANH 4XVJL 1DEDA 3C2AH 1EERB 5ADOL 1DUYB 5TQ2H 2GJ6B 4AENA 1YEHH 3AM8A 4H1LA 4DW2L 3QNYB 3SN6N 3X14B 5C07B 4JG0L 1R3JB 2G5BA 1JPGA 3REWA 3UTSD 3I84A 1Y6NR 3JV4B 3SDAC 3PE9A 5FYLE 5DRXA 1YEKH 4IRSB 5DD1H 5JXED 1N26A 5E2UL 4LPCA 3G5VA 3NGBC 1HWGB 4N0YH 2CMRL 4PYHA 5I15L 1IC5L 2XTJE 1NAMB 1GIGH 2AJSL 4YEEA 1XIWC 4NQEB 3GHBL 3RVXD 1NC4A 4Y2DC 3EYUH 5T5FL 2NY6D 2E5EA 3D69B 5I8EB 4ORZC 1TQBB 3DXAA 3ZE1F 3NAAH 2FEEI 4R26H 1JNJA 1YYMH 1DVFB 3DX8A 1CD8A 1I1CA 2K9UA 2YPVL 1NQBA 3ZHKA 3T77B 4UT6H 4JB9L 3ZT5A 4GQ9L 5FCUL 1NGYB 2P24A 1YDPB 3KLAA 4FFYH 1W0YT 2HVKB 5I8OL 3PWVB 2X89D 5FYJD 1RMFH 4CDGC 1UGNA 1JYNA 3P4MB 5GS1C 5E9DA 32C2B 1DN0A 1LDSA 1Q94B 3L3GA 3BKJH 4G7YL 1G6RH 2XTJB 2NCMA 1ZHKB 2R8SH 1GGYA 5ICYA 1UWEH 1IE5A 2BFVL 3SE9L 3RTQD 1UZ6F 4E9LA 2IBZX 2VLRE 1JWUA 4IOIB 1P6FA 3LQMA 4BQBA 4MAYD 4D0CB 1ZHBA 4OM0H 3CMGA 4V1DD 2ITDA 3QEQE 1VFBA 2IQ9L 1AJ7L 3O3EA 4U0RB 4UOW1 5BW7C 4Y7MA 1TLKA 3AREA 1QPPA 4HJJL 1EFXB 4FABL 4NZRL 1TZIA 5I19H 3HFMH 2BX5A 1LO3L 2IG2H 2PR4H 4GKSB 4HT1H 1S7SA 1DBJH 2QQNL 3HC0B 4PJEE 4YDIH 3VFOB 1BD2E 5IBTH 2GAZB 1TDQA 5SV3A 1BQHG 1F3DH 4HLZH 1E28B 1FYTE 4G43B 3X12A 5FB8A 1DL7H 4FQCL 3KYNA 1Q9WA 4LARL 3WHE1 5AUMB 4KHXH 4JFFA 4Z7UE 1IGCL 5DURB 2IWGA 2YD9A 3BESR 1VADA 4YBQD 3GMMB 1QO3B 2PYEA 4EN3C 2YPLA 4EOWL 3OBAA 1WT5A 1R5IA 1P7HL 4L3EB 3O3AB 1SYSA 5CJOL 3TVMB 1BJMA 3WLWC 5AD0B 4JO2L 2QQQA 4JZOB 2PW2A 4H20H 1MCLA 1BD2B 2XG4A 3HC4H 2C4XA 2OSLB 4RNRA 4XPHL 4YHPB 2D03H 1T80A 3LRSA 2DI8A 1MLBB 4MD4B 3MBEB 1T7YA 1FYTB 4FQJL 5GIRB 2C5DC 4EN3D 4YJZL 3QXUA 2R0ZL 2E7LC 5FGBA 3SE3C 2HKHL 5F6HI 4C59B 1BQHA 4L1HA 3D0LA 1AHWB 3U0TA 4XCNA 4Y16A 1KIRB 1Q0YL 2V7NA 5T5NG 1MIEL 4ZPTA 4WUKL 2DQTH 3N1GC 1FV1B 5BOPA 2FR4A 1I8LC 1MLCA 5B4MC 5B3JF 5SX4H 5GS3A 1N0XL 4OGXL 4DN4L 4NZUH 3TO2A 4S1SL 4JKLA 1NGWA 1XGQB 1JIBA 3VA2C 2FJGB 4X8XA 4YHZL 5IT2L 5KSBA 4NDMB 4N0FB 4LLWA 3IETB 4XC3H 3EOBA 2B1AH 4MXWH 3W0WD 2IBBA 4TUKL 2M2DA 2AJZB 4H26B 2XY2A 3S6CA 3UDWC 3BP4A 5B4MD 3S96B 4F3FA 2W0FA 4KJQD 4PGDA 4WW2F 1NFIB 4WI9A 2WBKA 1B2WL 4LU5H 5DMGC 2DQUL 4JRXE 3QUML 4YHKL 1CFVH 3QNXA 4MJID 4PJCF 1NUDA 3NIFE 1U93B 3IS1X 1H15A 3HE7C 4KRMB 4J4PC 4GXUN 4Z7VA 4F33A 3QAZB 1OAUH 1NMBL 3VFPA 3FQRA 4NKIL 3DTXA 3PXHA 5IFJB 4ODHL 4Z0BL 2QSVA 3SJVD 1F4HA 3G5YA 5DMGD 4EI5D 2R56L 5TE6L 3D39D 2XN9D 5SWQA 3HE7D 4ZUTA 4M7KH 4P2OC 3K1DA 1MCPL 4J4PD 5I8KL 5BV7C 2H2SC 3PWUA 1FBIL 3QUKA 4IDJH 4PBWD 4RDQG 1IQDA 4HEPG 1KPRA 5EO1A 1P69B 5HD8C