1QLEL

Cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
DIELTQTPVSLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQFLVYNAKTLGEGVPSRFSGSGSGTQFSLKINSLLPEDFGSYYCQHHYGTPPLTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE POLYPEPTIDE I-BETA
publication title The Cytochrome C Oxidase from Paracoccus Denitrificans Does not Change the Metal Center Ligation Upon Reduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/immune system
total genus 24
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1999-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qleL00
1WQVT 4O51A 3RHWF 3QEQB 1CDYA 4HKXB 4U1SB 5GHWH 4LGSB 3PNWA 3LKRA 4OLEA 5C7XL 3BN9D 4K71B 4JPKH 1P9MC 5IIEA 3QXTA 2DQCH 2NY5L 2WINB 3LKNB 4CW1A 3B2UC 2HT4D 4MNHB 4RGNE 4N8VG 3QNYA 1MFCL 1VA9A 4K8RH 4TVPD 4F9LA 4Q9QH 3RKDD 3ULUE 1M6OB 4LEOA 4EI6A 2FNBA 4M8QB 4TRPH 2Y06H 4XPAL 4XP1H 5IJVB 5KOVC 1MCNA 4Z7QE 1HINL 1HYRC 1XIWD 4LLUA 1AY1H 4GLRH 2YKLL 1OARH 4LSSH 1NUDA 1ED3B 4HLZH 2NZ9D 5F72S 2R69H 5HDQH 4XVSH 5C0CE 4QRUA 5JHDB 1NL0H 4QY8B 1JI2A 4OFYD 2IQ9H 1CLOH 3TPUB 4IOIB 4R7NB 1A6VL 4OBRA 5JPNA 1RJZB 2J4WH 5I15L 1LO0H 3NFNA 3BDBA 4CMHC 1HHKB 1B2WL 5D9SB 2WBJB 4F3FB 4WTZG 1U8KB 5C0RH 2FWOA 4JZJA 3CUPA 3IFPA 3MLXL 3OGOE 2FEEI 4ZFZB 1PZ5B 2EXYC 4OI9A 4TUJB 5JTWA 2ZUQB 5KJRL 3D0VB 2VKXA 1UA6H 4I4WA 4Y4FB 1IC7L 2JE8A 2APXA 2AABH 3CXDL 3HAEH 3VXTB 4JKPL 4ZNEA 2C1OB 4Y2OA 5CZVL 2G5BB 3MV8A 3U30C 2RQ8A 1NGYA 2FEEL 3UTSD 1FC2D 3UPRB 3DECA 5GRUL 4L9LC 4FTVD 1YECL 3PV7A 3KGRA 4R3SA 4MA3A 1OTTC 2R1XB 4X7SH 3P9WB 3I6GB 5SX5H 1RZIB 1YJDH 3I02B 1GGIH 4RFEA 1IAIH 3DO7A 4PUBL 1T21A 2R0LH 1N5YH 5ACMA 1FRGL 4Z77A 5I1KH 2C4FT 5DMYA 4TNVF 4M7JH 1J8HE 4HWBA 4Q0XL 4WW2B 1RD6A 4ODVH 4HKBB 2C4XA 4OLWH 1F4XL 1FL3B 4L4TB 5IHUL 2HH0L 4OIBA 4YDJA 4JG1L 5D7SL 4JFYB 3BAEH 3QUZD 1UKSA 4BKLA 2AXHA 4JPIA 1U3HA 2W07A 3DRQA 4FQJL 3RVVC 3OBAA 4UOJA 1FZKB 2NY3B 3UZEA 5HI4C 4QT5B 1KJ2B 2XA3A 5D2NE 4D9QD 3KXFB 4XXDA 3WKML 2P49B 3HC0B 4RAUA 4HG4K 4PRHD 2XI9A 3LQAH 3O3EA 1BVKB 3BVNB 3RZCA 3B3IB 3FONB 3BZDA 4YHPB 1SQ2N 4HBQA 1CZ8L 1EHLH 5FYKD 4HH8A 2DL2A 5ISZB 4X8JB 5DT1H 5IB2A 3KPSE 4G8FA 1C08A 2NTSP 4JDTL 2FB4H 4OLYL 1FAIL 1EJ6A 1ZLUK 5IMMB 4QHKJ 4L8BA 3C6LA 4DN4L 2ENSA 1TVHB 3LN5B 4KU1A 2R2EA 2HKFH 1JPFB 4BSWA 3NIDE 2X6MA 2W91A 1JE6A 4JFDD 3FFCB 1TJHH 5CP3H 1KNOA 5HHPA 4P2YA 4PJ9D 1U8QB 1I9RL 4KPHL 1S7WB 5GGSY 2VN7A 5ITBL 1ZT1B 3KLAB 5EG6C 2DQJL 1OGAE 4WHCA 2BZDA 5EU3A 5KSAB 1P7QA 3NBNA 2KDGA 3IVKA 1RK1A 1PKQB 1MVFA 1C16A 2ILLA 1CDBA 4ZUVB 1OGTB 3PP3H 2N7AA 2R39A 1IC1A 2A77H 1MI5B 2XKNB 4U4BA 4N8CH 1T1WB 3D25B 5DQJB 4EQ2A 3GK8L 2V9RA 3TN0C 1NEUA 4ONFH 4HZAA 2KZWA 3K4ZA 3GHEL 3OKNA 5I8CA 2CRIA 4ZS7L 4GS7C 4U6XA 3X11A 4NQCD 3BKML 4EN3B 4HZLB 2K1MA 5IVXB 3QEUA 1TQCB 4M48L 4EIZC 4V1DA 1CFBA 1FZMA 4JQIH 5HI5D 2HTKD 5IBTH 4CN6A 4DUWA 1BOGB 2X7LB 5BVPH 2VQTA 4WI6A 1LO5A 3WIIH 4KY1H 3VI4E 1J7VR 1KIRB 1QTYT 4HC1A 4JRXE 4R4FH 3LEVL 5L8KB 5K9KB 4JFPB 1NDMA 3OXRA 3GB7B 5DK3A 5H37G 3CFKB 4JLRA 4L3ED 5DD1L 3OF6A 5EIVA 1EXUA 2DMCA 3T2PA 1NFIA 3EYOA 4NPYA 5C86A 1HHJA 1K6QH 2BNRB 5IFHL 1EJOL 3E3QC 4DKAA 5TQ2H 2DQDL 4FFYH 4U1NB 1JNNH 1DN2A 3EHBC 2V7HA 2BX5A 1CL7H 3D48R 1SEBA 2B1HH 1BQUA 3MV01 2NR6C 1HEZA 3HPLB 2CUHA 2A6JA 1N3NA 1ZSDB 5BRZE 1SHMA 3P0YL 4MWFA 1VEMA 4WTXA 1UWGH 3PHQA 5CJXC 2AJXL 1MREH 3G6JA 4OLZH 1AGDA 4H25A 4WCYH 1CR9L 3V6ZA 2W9DH 3RVUC 1ERNA 1DEEB 4GRMA 2APVA 2D7QA 3MA9H 3NPSB 3S8WA 4RNRA 2CK2A 5DRNB 3LCYA 1DUYB 1MIEH 2QLVB 3L5XL 1D6EA 2DICA 1D3CA 3VCLA 1YQVH 3VG0L 2I9LA 3QNXB 1V7ML 2XQYG 3SQOH 3OXSB 3DROA 1N6UA 1A0QL 3PHOB 2V5TA 1OP3K 1FZOB 1T89A 3GMNA 4ZQKA 5BS0B 4LFHG 1S3KH 2HFGH 4O9HH 5JHLH 2V2XB 3ES6B 3I85A 4YHKH 3C5ZA 3UO1H 3WL9B 3WNKA 4RIRB 5FM8A 1MHHB 4LCCC 3LV3B 1HSAA 1D5MB 3BPOC 1DQJB 5T3ZD 1CFQA 4YX2H 5D96C 3GMLB 1JIBA 5D93C 1YY9C 1ZTXL 3BJLA 3MRJA 2PUQT 3ZMRA 4IRSA 2VH5H 2YD4A 1IEBA 4UIKL 5JXEC 1E27A 1J5OH 5EU6B 5E0QA 3BWAB 4Z7UA 5MENB 5DA0B 4KDTC 2VUYA 2JKXA 1BP3B 1U8OB 4JR9L 3NCCB 2FBOJ 2EEBA 4LOUC 3VA6A 4P2QB 4Z7NE 2HJKB 2UYLB 3EFFB 3V52L 3MLUL 3Q6GH 4GMSL 3FO9B 3C60B 2AS5M 1PD6A 1GJIA 4HWEH 1G7LB 3MGAA 2A9NH 2QL1A 1WCQA 4Q97A 3N1PC 2GSGB 4XP4L 1CDUA 2ITCA 3AROA 4NQDD 1EHXA 5HHME 1B6UA 3TO4C 1ZHNA 4DZ8A 5C0GA 4EOWH 1OD9A 3TNMA 3DMMC 1RI8A 1KCSL 3FFDB 1IGTB 4F7PB 1VDGA 5GIRB 5C07A 3QXVA 5IR1A 4BM7A 5GJSL 3I75B 3H9SE 4TN9A 5KVEL 2AXJA 1CDJA 3CC5A 4PJ7A 5GPRA 4N0FA 1F6AA 3SJVA 2BOBA 2LQRA 1ZLSH 5HGBA 1NKOA 4NP4L 1C5DB 1NGPH 1ZGLM 5C0BB 1QZ1A 4KKCC 5GS3A 1N64L 3QJFA 4TVPE 3OB0K 3DRTB 4P9HC 4KRMB 4W6WB 2MOVA 1F4HA 1DBBH 4OZGF 1KEMH 4GKZB 1R3IL 5C2BL 3G04B 4K3DH 3UYRL 2V17L 3VRIA 4D9LH 3RBGA 3ULUL 4PGDB 1NMCB 2AQ3A 3AVEA 1UM5L 3VDBA 3TBWB 4XB8A 2PTTA 1CXFA 3GMMB 4MQTB 4RAHA 4LDOB 3JWOH 4PGZA 1CXEA 3CX2A 1RZKL 2FJFB 2UY7A 4W6XB 2VITB 3SGJC 4KHTH 1U6AH 3CPLA 4CRPA 1FNSH 4QOKE 2CDEA 4NOBA 2CJUL 4AMKH 2VDPH 4MQXC 3BSZH 3N06B 1N7MH 1KTDA 5E4EB 4CDHA 4R90H 4HUWA 2DYPB 3LH2L 5FA3A 1ZE3C 2J6EL 1S7SA 3D3VB 3MNZA 2DI7A 4Y16D 3ZTJH 4ODWB 2FJGA 3RI5K 4GW5B 4ZOBA 4P9ML 2ARJA 3RY4A 5HJ3B 4Q6IB 1A7OL 2C5DC 4OTXH 3UTSE 2ERJB 1JGDB 1PAMA 1QHOA 3H3PL 5DVOA 1HZHH 2H2PC 5EORH 1KN4L 4HF5H 1Q9LB 1VPOL 5DYOB 1GGUA 2IAND 1QA9A 4QXGL 5EN2A 2HFEB 3RIAK 2DQGL 3GBNH 2ZOKA 4EEEA 3OKYA 3MBEC 2OL3H 5B8CB 3MXWL 4MAYC 4KJWC 3V6OC 3VMPA 1UZ6F 3OJMB 4OGXL 4IDLA 1I9EA 3EYFA 2P5WE 4I3SL 4JO3H 1EVUA 2JJUA 3DXAE 5IFJB 4R4BB 2DTSA 2IH1B 4H88H 1MVUB 2ADFL 5DHYB 1ORSA 5KS9F 2XY2A 4U33A 4XCEB 5IROC 3QEQD 2UUDK 4OIIH 3ARTA 2ADGB 2CUMA 4IRZH 1F58H 3KYAA 1QFWL 5BXFA 2VDNL 5AYUL 4D9QE 3NTCH 2KL6A 5CSZB 4KVCL 4PRHE 4ZDHB 3LZFH 1MHCB 4JFXB 2BSSB 2W0LA 3WCYA 3GMRB 3IS0X 3O3BA 1EHNA 3I6KB 3V8CA 3HNTH 4V2CB 5DGRA 5DVKA 4GRWB 5BJTB 2UZIH 2HMID 1MFNA 3C9NA 4NZUL 4XPFL 1CDHA 4HXBL 4I2XE 5GS1C 2I07B 3FO2B 2JIXB 5E99H 1A6AA 1GGBL 3MGOB 1Y18B 2D31A 5F88A 1V3JA 3HN3A 5ALCH 4JFDE 3TBVA 2IBZX 5IW3A 1BEYL 5JLZB 3EOAA 3HE6C 4GRWH 3QPQD 4HS3B 2EICA 5JHDD 4P2OB 3MRNA 1INDL 5GGTA 2WQ8A 1PQZB 4E42B 5IK3B 2PCPB 1ZLWH 1Q0YL 3RWHA 1T0PB 2V5MA 2WBJD 1LDSA 3QG6B 1RUKH 1NEZB 4PB0H 5E8DH 4FQXA 4L8CA 3BI9X 4LLQA 5J9PB 2Z9TA 2X70A 3FOLA 2EDOA 4UT9L 4OZGE 5TE4H 3KPMA 4P4KC 1NCBL 4PRPB 5FYLH 2ZSWB 1KC5L 3QCUH 5JDSB 1KLGB 2NZIA 1EMTL 1A7NH 4Y4FD 5F7WC 3VXUA 2EECA 4TSAL 1F2XK 4JHWL 4N0UB 3MRRA 1T04B 2DBLL 3MLTA 1S7XB 2AGJH 2DLEA 5HGDB 2R2BA 5ICYA 5DZOA 1I8LA 1I4FB 4GXVL 2VDKH 5E9DB 1IL1B 4X9HA 3EDKA 3L95B 4MA7L 4Z7VA 3EO0A 3BDYH 3CNKA 1QFOA 2IQAA 1INQB 2YBRB 3ARFC 2Y6SD 3GHBL 1MFBH 3HLAA 4OLVL 3S35H 3S7GA 3MRCA 4NWTH 1DLFH 4HK0B 2DKSA 6FABL 4ONOA 1JYXA 1DLHB 3T08A 1UCTA 3EDFA 4L3EE 4GAGL 3CMOH 4L4TD 1MFEH 1I3GL 4HGWB 4B7IA 1HHIB 4AIOA 4XWGH 5F8RC 1A4JB 1CYGA 3OAYK 4ONGL 3VXSA 3SKOB 2NY3D 5J13C 4NKIH 3AREB 3KHQA 4YWGL 4DTGH 3KXFD 2IWGA 5K9QG 1R5WB 4J6RH 3O6LL 1MCLA 1T80A 1S5IL 1SY6L 1YDPB 2FYYB 3GI8L 4L29B 1KXTB 2GSIA 3QDJA 5EH1A 3MRIA 1QNZH 5ISZD 4Z8FL 3V7AE 1IILE 1P4IL 2EKSA 1I1CA 3TIDA 4B50A 5A2JH 4BH8A 5J1AB 1N6QL 4FNLH 4NJ9H 3FB6B 2ENYA 5E2UH 4F58H 3QUYB 1GC1C 4F8QA 4A6YH 1D9KB 3BIKB 3FFCD 1VGKA 2QHRH 4HJ0D 1YC7A 2W65B 3FN0H 1HQ4B 4ELMB 1GVIA 1IC4H 4X99A 5I8EA 1AC0A 3QIBA 3T09A 4PRIB 1FHGA 1IFHH 4U3CA 2A9ML 1YYML 3G5VB 4MA8H 3AAZB 5KSUB 5E6IB 3QFJB 2ATPA 3MUJA 3MREA 1JL8A 1J18A 3TT1H 1VADA 2PYEB 4K94H 1NFDA 4X6BA 3REWA 5D1QB 2AKRA 4R97C 3ZZ1A 4Z7WF 3OAZK 4FFWD 2FECL 4JM2B 5IVNA 1MI5D 1U8MB 3VFWA 2VSCA 3FQXB 1OP5K 2GK0B 3IJSA 2D0FA 3HZKA 1BAFL 2R29H 4KGJA 7FABL 2YPKB 4IJ3C 4MCYB 5KVGL 4LASL 3UDWC 4EN3D 3WKNA 4U1HB 2XTJC 5L2KA 3GO1H 3HE7A 2QQKL 3AS0A 4TSCL 5EU4A 4X6DE 2A6IB 3O41A 5EC1B 4NQDE 4WUUE 5LVEA 2EYTA 4N8VB 3WLBA 4NM8L 3QO1B 5C0EB 1BM3L 1M7XA 5FOBB 1X5JA 3AS3A 4BK5A 3U36A 4E41E 1BFVH 5T33H 3WLWD 2C7UA 4YDLB 2FJHB 3C2AL 3H7BB 1DBMH 3EO9H 5TF0A 2B39A 4W6YB 1YMHB 3GDBA 1DQLH 2BNRD 2X4QA 3ULSA 4PJ9C 1ITBB 1JV5B 4XNQA 1FL6A 1F4WL 3V79C 1QR4A 1T4KA 3MXVH 2FEDC 3NA9L 4J2XA 2WNGA 2B4CH 5HYQA 5EBLA 2VLRE 1T5WA 5EO1A 3KYNB 2NW2B 3LS5H 4HV8B 1FVCA 1FGNH 2OXGA 2E3VA 1I3RB 3GSWA 5A2KH 1MCKA 1CTNA 1FYTB 5IW1B 2GJZA 1I1AA 4TVPL 1QFUH 5FCUL 4JJHA 4PS4L 4HPOH 1MQKL 2IFFH 1Z9MA 1S5HA 4LLVA 2DN7A 3ZTJG 4MB5A 5IGXH 3BEVA 3RGVB 2E8YA 3RNQA 2IC2A 2Y9RT 1KG0A 2UWEA 1ZA6B 4X4XB 4WRLA 1ZV5A 1H8OA 3DX8A 3MRBB 5BS0D 5IEHA 3U9UA 3TVMB 1WBZB 5B22A 5LG1A 1JF1B 1WUNT 2C3GA 4RFNC 43CAA 4XWOC 5CHNA 3W39B 4XBEH 1W72A 2M26A 4L3CA 1ZWIB 4IOSD 2WUBL 1MRFL 1JHTA 3FB8A 1QEWB 2LU4A 1RZ8B 1CD9B 4MDIB 5F9DC 5IKCB 4LSUH 3TH2T 3TA3A 4BH7A 2FL5A 3RNKB 3GSQA 2AEIT 4Z5RB 5EZOH 1KXQE 3RVWC 3G6AB 1H3PH 4WNQA 4CMMA 5EU6D 4NIKB 2JB6B 2X4PA 4H20H 4HUMB 1T2QL 5MEND 1JYWA 1RHFA 3KPOB 4EVNA 1UM4L 2OJZL 1Z0NA 4LSPH 4OD3L 5TDOA 1G7QB 3FQNA 3SBWA 3KPNB 4P2QD 2VTFA 2D9QB 4WFFD 4MNGE 1FH5L 2DJUA 2GK2A 4HXAH 5GGRA 1YUHA 5KSVB 3C60D 4NWUH 1MLCA 4S1SL 4NO5B 1BIIB 1JI1A 1ZOXA 2VC2H 2X4UA 3VWJB 3JVGC 3RGHA 3ZKXC 1NKRA 3MZTA 1IJ9A 4N1CA 3MLSL 2Q1EA 3H9HB 3JV0A 3ULVC 3RL1B 1I7TB 5FDWB 3ZKMD 1DANU 1P2CA 2IFGA 1IGML 3MRFA 3DUSB 4WFEE 1S8DB 4Y4KB 2UZXB 4FOMA 1UH2A 5KAQG 4CVXA 1CGYA 4OGZA 3MR9A 1OPGH 4KUZH 4F37K 1QSEA 3N85L 5C0BD 1ADQL 3IJHB 1NAMH 2R4RH 3UTTB 3UXFA 5C09A 3C8DA 3OKDA 4OKDA 5H2BA 3DNKA 1I9JL 5E2WL 1NCWH 5E2TH 1YY8A 2YUZA 4XAWH 1KELL 4LPXA 1U91B 3MODH 5HVFB 4KVNL 3SE8L 1IQWL 3MA7A 5B38G 4M7LT 3QRGH 5T5FL 3MJGX 2RAMA 1KPUB 3HMWH 1T0NA 3T0EB 4PGBA 4ISVB 4HBCL 1FNGB 1IKNC 3QIWA 4TTDD 1NBZB 1G6VK 2QQQA 5AZEL 3MJ9L 3WDJA 4OKVB 4WTWA 3U7YH 3L3OB 3BIAX 2DYPD 3W9EA 5DJYB 4QHNB 4P5MB 2IPKA 4O51B 4D9RD 3D3VD 2BHUA 4HS8L 4PJ8A 3PNWB 4FFZH 3BP7B 2M2DA 2EDHA 3WXVH 4CGTA 5E94A 1GPOH 5CKAA 1LK3H 3EFDL 4S2SA 5IIEB 4Y2DA 4JHAH 3GSOB 3QWRD 2OJEA 5ACZA 1R5VA 1WICA 3TYGL 4B0MM 4CW1B 2R15A 5EUOE 2E7LA 1UH3A 5DJ6A 3IDJA 4ODXA 5D4QA 2HTLD 2KQMA 4I48A 4JO1H 4KWUA 3F8UB 3OWEA 3QNYB 4M4RA 1NMBL 4KKAD 4DQOH 3MV9E 4NQEA 2GITB 2LVCA 2R9HD 2Y23A 4NC2B 1TVDA 3E1F1 5JO5B 3UYOD 4LEOB 1XZ0B 3EZ8A 2GUOA 1JPSL 1YN7B 2DOCA 4HAGA 1KBGL 4DEPB 3LDBC 4BFEA 4ZUTB 4NSKB 1MCDA 2XQYK 4OD1H 4LLUB 1WWCA 1FNEB 1G7PA 1RFDL 3JV4B 4PR5A 2J6EA 1KGCE 4S1RH 4O5LH 2D4FA 4N5UA 5IHBA 4BUHA 2JJTC 4ZFGL 5F7DA 1KCUH 5I6XB 2VOTA 4QRUB 4JPVH 2O5YL 3STZA 4OLXH 3T8XA 5BW7A 5A1AA 3NFNB 2J8HA 3D85A 2VDOL 4PG9B 5F70A 3F7RA 4OB5H 1Q94A 1QBBA 2FWOB 1G9NC 1EEZA 4PTTB 4P23C 5C0JA 2VLJE 4IIQA 3ZHKA 4YAQA 2DIBA 4YZFF 4B53A 3WFBH 2ARWA 1NANI 2DJSA 4EI5A 4BSJA 5F1IA 1N59A 5KVDH 5AG8A 1FBIH 1JVKA 5EBGA 1JMXA 4XPTL 4I3GA 2ZKHH 3LEYH 1L6XA 3T2NH 4R3SB 2JIXD 4APQC 3A0OA 3VFUA 3O81A 2LFGA 1J8HA 3FFCE 5J89A 4UU9B 1FP5A 1HQRA 4P2CG 4ALAH 3P30L 4D3CH 3CSPA 4L9DA 4XZUA 2AERT 1T21B 5FYLD 4P2OD 1K8DA 1N0LA 4RISH 2P4AB 4Z77B 4YHIB 3AXLA 3LKOA 3SDCA 5F6HI 4MXQC 5B3JF 3EZJB 1T22A 4YC2C 5I71C 4YDJB 3IF1A 5FGCB 4M5YL 2BJMH 4ZNCD 2VDMH 4JPIB 3U4AA 2WWKT 1U3HB 5FA4A 4Y19E 3DRQB 3PABA 4PRPD 4I9WE 5HPMA 3VRLF 1D6VH 4XVTH 3K1DA 4S1QL 3X3FH 1EEQA 4K8RC 4XXDB 4RAUB 1B9ZA 5T3XH 4XNXL 3O3EB 2B7DT 3RZCB 1DDHA 4NRZB 1QD0A 4P3DB 4PJGE 4HX1B 5A43C 3VD9A 5EZIL 1T0MB 5E9DD 1F8TH 4OQTL 3GRWA 3NZHH 1U92A 1CGXA 1MJJA 1C08B 1K2DA 2P24A 1RUQL 4XMKL 2P47B 1BZ9A 4UT6L 4L8BB 1OLZA 3C6LB 3VFRA 5FO8A 4YXHH 2R2EB 1QLEL 3KLHC 2HMIC 3GIZL 3U4BL 1OGAA 3CH1B 2H6PA 4PJEE 3VXRD 2GFBA 1KACB 4N5ED 4NT6A 3I6LD 4I8DA 3E3QE 4G6JL 2A1WH 4P5KA 5SX5K 2DLHA 3W81A 1P7QB 3IVKB 1RK1B 4G8GE 2D3VA 3ARED 5EFIA 3UJTH 3IRPX 2H2SC 3VFTA 2J88H 1KULA 2DWDB 5DS8A 5IB1A 3GUTA 5F1KC 4G3YL 1FO0L 2F19L 2FX9L 4U6XB 3X11B 3V4VL 4FG6D 4GG8B 1NUNB 3DTXB 1YJDC 3K80A 3QEUB 4JRXA 2Z93A 4KROC 5IFAH 3QUYD 3V0AC 3RWFB 3BGMA 1D9KD 1U8NA 1DSFH 1LO5B 3L9RA 3P4NB 4YUEH 2C1PA 3IAPA 1A6WH 2KH2B 4NJAL 5FDYA 2YN3A 3VU2A 4PRID 2DLFH 3RU8L 1NLDH 3CZJA 2ZP0T 2A83A 2V9QA 1NDMB 4L3AA 4PRDA 5DUPL 4P46B 5E6ID 3QFJD 4CADA 1CF8H 4ZO8A 4LSRH 4XP6L 1QSVA 4PJHE 1SY6A 1IGFH 4JLRB 2YS4A 2PYED 2X9YA 2X4RA 1FN4A 5D1QD 1SMOA 1XFPA 3EYOB 4NPYB 1EGJH 4NO0A 3NMEA 2VWEC 1QSFB 4JM2D 2HG5A 2X89D 4U05A 4D0DB 2Q8BH 3LQAC 2VE6B 2V7HB 4JFZL 2EDXA 1P1ZA 2GJ6E 2H32A 3PQYE 2A6JB 2OZ4H 1N3NB 2XWBA 4QTHA 4MWFB 3O11A 3PHQB 5HHXH 3G6JB 5KSBE 1AGDB 1FVDA 5KW9H 3S96A 4F2MB 2G75A 3V6ZB 2VZUA 5IBUB 5J11C 4XCFH 1G7HB 4GRMB 2FX8L 4RNRB 5I1HL 1F90L 3O6ML 2MHAB 1D6EB 3IGAA 3VCLB 3GSVA 5BQ7B 2I9LB 4FQLH 3RTQB 5ID1A 4WV1B 4KJYA 1RHHA 4ENED 2R0ZL 1B0GA 2WWKO 5D7JB 3VRLE 4ZQKB 9CGTA 2H26B 5DEGB 2NY6C 2Y07L 1T89C 1IC5L 1SBSL 4UB0H 3IJYB 4YR6A 1TJGL 2P8PB 4YGAB 5EOQL 3C5ZC 2DAVA 3E2HB 2OM5A 3GSRA 1CFQB 3WMSA 5CAYB 4KHXH 5C0NC 1A6ZA 1CG9A 3MRJB 1CT8A 2DD8H 4IRSC 4Z76A 2H3NA 4R7DA 4QNPF 5E6ZA 4BELD 4DFHA 2IPUK 5ADPH 1FYTD 4Q6YA 4BYHA 5DEZA 4BFBD 4XGZA 4UIMB 1BREA 2V5RA 3VFNB 2ZUXA 1UKQA 2RJMA 3SDXE 3MX0A 1KUMA 1FFOB 2EYRA 3O0RH 4WWKA 3RGVD 5JZ7C 4YBQD 3OAUL 1M7IB 2O5ZL 5LWYH 3WBDA 2E7HA 2Z31A 3OKEA 4JM4L 3TVMD 3H9SA 2ITCB 3UPCA 3H6JA 1OB1A 4DZ8B 1ZHNB 5C0GB 3TNMB 1N8ZA 5HYSA 4L4JA 5C07B 1JTOA 2YHGA 5IR1B 1H8SA 4KI1A 2OYPA 2W60A 2D7OA 3CFJA 4PJ7B 3CC5B 4HMEA 4Y4HA 4LCUB 4YQXL 1MCSA 2WWMC 1DVFA 2BOBB 1YNLL 4PRNA 4OUUA 1A9EA 4M1GH 4AEFA 4NO2A 5GRJL 3S34H 4H0HB 4MD5A 5AUMA 4KZEH 5J6HA 1YNTA 5DMGD 5I1AA 3QJFB 3LVEA 3WSQL 3UZQA 4CDGC 5CEZE 3GFUA 4XT1C 3RA7H 2ZG3A 3VRIB 3UBXI 2JCCF 5SV3A 4WEUD 1RULL 4QOKA 1IM3A 3BE1L 3VWJD 3DX6B 4UBDD 4O00A 5FF6A 4HQQL 4M6OL 5L9DH 3QXUA 3WHXB 3CPLB 4O4YH 3RVXC 4KKBC 3T65A 3TP4A 4JG0H 4K9EH 3D18A 4F57L 3QXAA 4R0LB 4LLWA 4BQ8A 5INCA 1CE6B 1FNFA 3SKJH 4HUWB 5CD3A 4N0YL 1XGYH 4Y4KD 5HSFA 1ZHBA 1IGCH 1NBVH 5FA3B 3MNZB 1DUZA 3ROLA 4S1DC 2QADD 1TETL 5JUEH 4ERSL 3UTTD 1N4XL 2O61B 2NY1C 4OCWH 1KJ2L 2ARJB 2DMKA 2NY4C 4J3OC 2VIRB 4J4PD 1WEJH 3K8KA 4OD2A 4X5XA 4IOFD 3U83A 3BRFA 3WS6A 4BK4A 3C5SB 5E8NB 1MJ7L 1IAIM 4PJDE 5C8JA 3TNNA 1QA9B 4M7LH 5D8JH 5EN2B 3L3KA 5LCVH 4MXWH 3CFCL 2QQNL 4HD9A 5E2JA 5DC0A 1GZPB 3P0GB 3DXAA 4NN6C 5C6TH 5IQ7L 3T0ED 3WD5H 5JQ6H 3HC3H 2FBJL 2JB5L 5I1DA 1TQBB 3E8UL 3P73A 2ICWB 3OG4B 5ENWA 2CDGB 3WFHA 3OPZL 1ORSB 3THML 3BPLB 5DFTA 2IPTL 1UWEL 2EDWA 3O8XA 4PRPE 2E27H 2EDFA 3I2CL 1IGIH 4K3JH 5JW4N 2IG2H 5BXFB 1G0XA 5I1CH 1KB5H 1T03L 1V3LA 3HMXA 4Q7DA 3VGGA 2P8MB 4U6HB 1X7QB 4OZIB 4WFHD 1WZKA 3O3BB 3SDDA 3B8SA 4O02H 4DN3H 5F6IB 5IB3B 4G7YH 1A6TA 4GSDL 3KPLA 2ADIB 5FYJD 4LCWA 3ARDA 4X7FC 2MCG1 3C9NB 5LJYH 4GAFB 1PJ9A 5EOCL 1EK3A 3MJ9A 3QISA 4H1LH 4HCRA 1WITA 3B6SA 3L6FA 5AWNL 5F88B 2D31B 3GJFH 4PTUA 4TQEH 3TBVB 5DQDL 1DL7L 4YDIL 4NCC2 4XB7A 5FOJA 3EOAB 2Z35A 1UWXH 2K9UA 1ZANL 5MHSE 3EJZD 4HGKC 2A74A 4OZFA 2Q3AA 3BKJH 2Q7YA 2QQLH 4KKLD 3RDTA 5GISL 4OZGA 3M1BA 1U8PB 2IAMB 4QRTA 4M43H 2XACC 3RWHB 2XNAA 3SOBH 1HXYA 1G6RL 5B21A 2AV7B 3SDAA 3H42L 4X83A 1GIGH 5I1LA 2X70B 2WBWB 1JN6B 3FOLB 3QI9C 1MH5A 3RBSA 4PLJD 3KPMB 5E5MA 4P2RE 1AR1D 2X9XA 4LFHD 5FV1L 5HGGS 2J8OA 2DDQL 2JCCE 1BBDL 1K5NA 2J5LC 3NZ8A 3BGFC 5L7XL 4MJ5A 2GCYA 4NOFA 4M6AA 3VXUB 1MFCH 3Q1SL 1RPQA 3QUMH 1GGCL 2YSSA 4OCRL 4NDMA 3MLTB 1OWRM 4LCYA 3QRFM 4P5TA 3NIGF 3LPWA 4XPAH 1I8LC 5HYSG 4XP9L 4Z7VB 2WIMA 1XGRB 3QEGL 5HD8C 4JAMA 5FGBC 2HTLC 3QAZB 4OSUL 2NYYC 3KNBB 4LVNC 3DYPA 3QT2A 2WBKA 4PYHA 5AZ2H 3OHXA 2YPVH 3LPFA 3MRCB 2RCSH 2OP4H 4I13B 3HB3D 4U1MB 4OZHE 5I0ZA 4LLDA 1M71A 2PYEE 3F7QA 4E5XA 3IFLH 4NN7C 3TIEA 5CILL 4ACPA 3RWEB 1IM9B 1B2WH 3ULVF 1RJYB 4QWWD 4XNYL 4ZD3L 1P4BH 4HDIA 3VXSB 1KJ3H 4PPTA 2AJ3A 2MPAH 3PWNA 1FC1A 4S11A 1MRDH 5IBLD 4NGHH 1R3JA 5FHBL 2CK0H 6CGTA 1WAAF 5KJRH 4HUKB 1ZLWK 2QJDA 4LQ1A 1Q38A 2XTJE 1IC7H 4MNQE 4JFOA 3CXDH 4LHJB 1NGQL 4JKPH 5CZVH 5KS9A 1AO7A 2HLFC 2EE2A 3BH9B 2XZQH 4UV7H 1MCWM 3J8F7 3QDJB 2CKBA 3GJFA 5GRUH 2A73A 2XICA 2PO6B 5IMKA 3CFDB 3MNWA 1JGVL 1MCBA 3C6LD 4PJIE 4MSWB 4BSVA 3WO4C 5I73C 1EFXA 3KPRE 4WU7B 1NJ9A 1GXEA 3LD8C 4ODTL 4PUBH 2BY1A 4PJBE 1NBYA 1FRGH 4PJXF 3HNSL 4X99B 2XN9A 5FECB 3QIBB 3QQ3A 4DAGL 5CLWA 5LGKA 4CVZA 3B9KC 2E9IA 2ATPB 1EUUA 5IHUH 3BIBX 2HH0H 4JG1H 5D7SH 1P7QD 1VADB 3ARBA 2FD6H 3DSFL 1NFDB 3REWB 4U0RB 3MJ7A 3T77A 3ILQD 5DJZB 4FQJH 5FYJU 4OQTA 1WWAX 4Y1AE 5JIIA 3RWCA 4JQXC 5EWIH 2OCFD 2EC8A 4DUXA 3VFWB 1RQ5A 2XRAH 5I16A 3WKMH 2D03L 2XQBL 5JXAL 3ETBF 3HZKB 1FYTE 2GIYA 1XF5A 5TQ0L 3UYPA 35C8H 4X5WA 1TENA 1CZ8H 3MYZA 3HE7B 4JDTH 2J8UE 4OLYH 3HFML 4DN4H 3GMOA 4YBLB 4E41A 5EU4B 4AQOA 1GOFA 2F8VA 3O41B 4GBXA 5INDA 2EYTB 2CIIB 2RIKA 1I9RH 4X98A 5ITBH 4LEXH 1FCGA 1UGNA 4P46D 2FGZA 5C0AE 1QFPA 4OGYL 1OM3L 2C7UB 3KYOA 5FXCH 4LQFL 3OF6D 1HYSD 2GKIA 4X7TB 4HH9A 3ULSB 1FNLA 2X4QB 3QDGA 4KGLA 1PSKL 1QSFD 4ZUSA 1Z3GL 4I0PA 1YMME 3DV4A 1Y0LA 1JTTA 1KIPA 1T3FA 4HEPG 2Q76A 4O2CB 4YO0A 3DIFB 4YH6A 5E1AA 1H5BA 1T5WB 5FV2A 1HHGB 2BCKA 3GK8H 1P5VA 1L6ZA 1FVCB 3P77B 1ZT4A 4K2UL 5C08E 5D7LA 5B39B 3GHEH 3ALWA 2PW2A 4OZFG 2Z0BA 2GJZB 2JLLA 2VXSL 3BKMH 3CDYA 5A2FA 3HG1B 3V4PH 1I1AC 3D87B 3RIFF 5I19H 2X09A 4HIEA 4M48H 1K3ZA 2BOCA 2EH8H 4HUXA 4ZXBC 4F7EA 4LLVB 4PJCF 1S5HB 4CBPA 5CEZL 3X14B 5FO7A 3BEVB 5HHQA 4XC1L 3RNQB 2AVGA 4MD4A 3IU3A 3RTQD 1MJ8L 1KG0B 4OT1L 1K4DB 2HLAA 2UWEB 4A2LA 2B1AL 5D7JD 4LBEA 1J0HA 5ETUA 3ILPA 3LEVH 4AH2B 5IEHB 3C5JA 4NBZB 2JJVA 1SYSA 3CVHL 3K7UA 2YRLA 1SJHA 3PWPB 4K94C 1WAAE 4HJJL 3AGVA 5FGRA 2GY5A 5CHNB 4LIQH 3AMKA 5I75C 3VXME 1JHTB 2QHLA 3BGAA 5TDNA 5IFHH 1EJOH 3TBYB 2I60L 1DFBH 3TA3B 4BH7B 2FL5B 5D7KE 3GSQB 5LGHL 1IEHA 4LF3A 4PP1D 1RIVH 4KK5D 4D8PB 3O6FA 3FB5A 4CMMB 3HR5A 5HGHA 4ZSOE 1LE9A 5BZDB 5IHZB 4O58L 4YPGA 4MNGA 1QACA 2AJXH 1LP9F 3O2DA 4ZFOL 5TDOB 1CR9H 4ZO6A 5KBNC 4RMUA 4Z7WA 3UPAA 2ICCA 3E6HB 2X41A 1ITCA 5K93A 3T0EE 1FNAA 1VEOA 4J3VA 3VG0H 1V7MH 2X4UB 3P9LA 1BVZA 3I3EA 1A0QH 1UB5B 4M6ML 1P9MA 1X6LA 2IALA 3KVQA 3S97C 4PJAE 3FAWA 3U46A 1WWBX 5ESQA 4JFFA 2IMNA 3AMLA 4PY7A 2BK8A 5C07D 5AAMA 2IBBA 2O26U 5JMRA 1T66D 3CH8A 3Q0HA 1KPVA 3CFBA 3DYMA 4CVXB 1WK0A 3MR9B 1FCCA 4KI5D 3S9DB 1ZTXH 4K3GA 5F44A 1QSEB 3G5ZA 3HI5L 4GMTL 2ESVB 5JA9A 1IGJB 4X7DC 1WFUA 3OKDB 4M1DL 1X3DA 5DJ2A 2IBZY 1OAYH 4P0DA 1YY8B 3D2UB 2P44B 4FS0A 4JRYE 1EBPA 5DHXB 5HDBF 1P53A 4DKFL 3OMZA 1F97A 5F9OL 3V52H 2CGRL 3IDYC 4QRPE 1K9TA 1TJIH 2NNAA 2C3HA 3GM8A 4Z7OF 3S37X 3SCMD 5EO9A 3QIWB 4XP4H 3TGXA 4Z95L 3GGWB 3AS2A 4GXUM 4L4VA 1EV2E 1WTLA 3B5HA 3RGVC 2JK5A 4JKLA 2K7PA 1C1EL 1KCSH 4WO4A 3MMEB 5GJSH 4UTAL 2IPKB 3ZKSD 3BEWB 4L9LA 5KVEH 2APBA 2PYFB 4PJ8B 4RGNB 2VL4A 3NPZB 2DQUL 4NP4H 3DOSA 4Y2DB 1PY4A 4DKDC 2OJEB 2CXGA 3MV8E 1R5VB 4KQ4H 5ACZB 1N64H 5DJ6B 4ODXB 5MERB 4I48B 1U8IA 1A1NA 3UBXA 1ZHLB 5K59E 5GGVH 1FPTL 1R3IH 5C2BH 4BA8A 2XA8L 3S37H 2GUOB 2RGSA 2HFFB 3UYRH 1PG7X 4POZD 4U7MA 1PY9A 5KVFL 5C0CB 3DYOA 4K3HA 5EOTA 1AHWA 3VFVB 3F7VB 2VLKA 1UM5H 1KPRA 1NCAH 3FN9A 2CR6A 1UFUA 2YD9A 4PR5B 1NLBH 3UROR 1H9VA 1U8LA 4MDJA 5DMKB 2SEBA 4U1GC 5F7DB 2EIZA 5T1DL 4MXVF 2CJUH 5AD0B 3QJHA 1UCBH 1ZGLA 1F3RB 5CEYB 2VLJA 5MEQA 5BW7C 4LSQL 1NSNL 1LP9E 1A7RH 2D7MA 3LH2H 1Q94B 2AK1L 3DLQR 4RA0C 1EDQA 3PJSB 1EEZB 1FFPA 4O2EA 5C0JB 4IIQB 4YAQB 1OTSC 3MLRL 2GJJA 4IRJB 3UJIL 4XTRC 1QSZA 4EI5B 1CQYA 5GRYA 3IDNB 4G6AC 3BQUA 3OZ9L 5HPOA 3DJ9A 2V7NB 1MHEB 2QADC 3FT4B 1VPOH 4M03A 3ZE1F 3OX8A 2VXQH 2B20A 4LDEB 2FX7L 4RWYL 4MAUL 4LLAA 3RX5A 1JPST 4LP5A 3RWIA 5GZOC 4J4PC 4WY7L 1J8HB 4IOFC 3OJDA 4PREA 1HQRB 5GGRY 3QXDA 4K7PX 1WBXB 3IFOB 3QWQB 1T20A 4GKNA 3W11D 2NY0B 3MV7E 1K8DB 5ESAB 4KZDL 3AXLB 5K9JL 3LKOB 2IAMD 4Y19A 3BKCL 1I8KA 3SDCC 5IVXF 3TN0A 2Z4QB 3I50H 1T22B 4U3XA 1J0ZA 1BZ7A 1RUAH 3HNVH 3QG7L 3L3HA 4WU5A 5DA4A 4HWZA 3G6DH 3EJYC 1QFWH 3B4NA 2VDNH 5AYUH 1A5FL 5LQBL 5HPMB 5LXGL 5DJ8A 1XF4B 4YXKL 4X80L 4KVCH 5TH2B 2JJSA 4U6TA 2CRZA 2WANA 3TWCH 3P4OA 5GS0H 4LARL 1QQDA 3VGDA 3KPSB 3VXUD 5ILTL 2XV6B 3WUWA 1DDHB 3H9ZA 3QZWA 5FUZL 4NZUH 2PR4L 4V1DE 4XPFH 1LO3H 1QRNE 3PF2A 3IS1X 2YD8A 5DFVC 3MSPA 1U92B 1BWMA 1MJJB 4KUCF 4XP5L 1GGBH 1G6RA 2BNQA 1OF2B 4MZ2A 3VFRB 3Q3GB 2B0SH 1BEYH 1OGAB 2GFBB 4ZTPL 3DURA 3FRPA 3F58L 3QHZL 1INDH 2AK4A 3QXWA 3UZVB 1FE8L 5FIEA 2Z91B 4EBQH 4KK9C 4QRRA 2AEWA 5CJXA 3IDIA 1Q0YH 4LPTA 3CLFL 1IM9D 2NXZD 3NN8B 2VWEE 2F58H 4P5KB 2VXVL 3IAQA 2EDJA 5T1MA 4Y5VB 1RZFL 2AV1B 5LAXB 1YC8A 3L3JA 3VXSD 5I6XC 4OJFL 1NCBH 1T83A 1XF3A 1B4JL 1KC5H 1JRHI 3I9GH 3OSKA 1S7UB 4HFUL 5FM5O 3G6JE 4LRIC 3FRUB 3SY0A 1EMTH 2YA1A 4YXLL 4TSBL 1TCRA 5DS8B 1YEEL 2H1PL 1L0QA 2X4OA 3DV6A 5J0BA 3QDJD 4NZJA 3FTGA 1JRHL 2YD7A 1AR1C 2PO6D 4NFBA 1BBJA 4HHAA 4HIHA 1AJ7L 1BQLL 4MXVE 3DX7A 5A3IC 1CFVL 4JRXB 2WUCL 5FGSA 1W0WB 4LCCA 5CGYD 1U8NB 5SWSA 4N0CD 3WFZA 1JK8A 2VYRE 3GSNA 1KT2A 4MS8C 3FZUC 2C1PB 4UDUA 3QIBD 3H0TA 6FABH 2HN7A 2XZZA 5HHOE 1S7VB 4N90D 5JXEA 2A83B 4PRDB 4GAGH 3IDGA 4CADB 5F9AC 1INEL 2ID5A 4KDTA 1MRCH 1QBMH 4WUKL 3DVGB 3UBXG 1FN4B 1OHQA 3PQYA 3R1GL 4HKJA 1MAJA 5BRZB 3L5IA 4ONGH 4F8TA 5CWSB 1NCTA 1BZQK 3QIUB 4NO0B 4Z0BL 4QGYA 3N50A 4YWGH 1AKJB 5D1ZA 5A2LH 4RMSA 4Z7UE 1P1ZB 3EO1A 2H32B 3O6LH 2XWBB 3ZDZE 4QTHB 1UYWL 3DPBA 2WSKA 3O11B 2DQFA 1S5IH 4YHOL 1FVDB 5I9QC 3ARZA 1Q0XH 3O4OC 2FZ3B 3N9GL 5CD5C 5TPWL 4TVSa 4AENB 3WFEL 3HE7D 3DMMA 4R2GC 3EOBA 1N6QH 3ZKNC 2DM4A 5E95B 3MGTB 4KJYB 1X4ZA 4LVOC 5I17A 2AJYL 4YFLF 1B0GB 1MWAL 5I1GH 1VB9A 2EYSA 1KLUB 3TJHD 2A9MH 1YYMH 1GHFH 4YR6B 1MFAL 4HUVB 1E4WL 5IG7A 3SJVE 3BXNA 4GW1A 1YEDB 25C8L 3GSRB 1BQSA 3NFPB 3PL6B 1UZ8A 1HI6B 8FABB 1EAPA 5F1SA 1A6ZB 1LEGA 5L2JB 4M7ZC 1CT8B 5EIIA 4PB9L 1BAFH 1FQ9C 4Z76B 2H3NB 7FABH 3RUGF 1JPGB 1YEJL 3SGJA 1H0DA 4LASH 4PG2C 5CMAA 4XGZB 3L3GB 2NTFA 3HG1D 4JFQA 1HDMA 1Z9OA 3GIVB 3O6KH 2QQKH 4JEGB 4YHLH 2EYRB 1WIOA 4OM0L 5DZNA 4UZGA 5J7CC 5HHMB 1X44A 5E7BA 4LGRB 1P6FA 4KK6D 4GOSA 5E6YA 1WFNA 4NM8H 4YIQB 2Z31C 1BM3H 1DBAH 3H9SB 5DDHA 4NKDA 3PWPD 1OB1B 1F4AA 3AB0B 1N8ZB 2DLGA 4C55A 3PGCB 3RWJB 3C2AH 3WUWG 5DJCB 3QZWG 1LNUA 3R0NA 3VFMB 15C8L 3CZFA 5F7FA 3TA3D 1F4WH 4Y4HB 4PRNB 4OUUB 3VGEA 1A9EB 3MBEA 2X42A 1DVFC 4MAYA 3MLWH 2GTWA 3NA9H 3P11L 3V6OA 4DVRL 4NO2B 5J3HD 1KIQA 5HVHB 1HYSC 5KANG 4MD5B 1QVOA 2HKHL 5J6HB 5I1AB 4G8IB 2NXYD 3GEWB 1PBYA 3PDDA 3CLEL 3TT3L 3ZL4H 3S88L 3WYRA 3FRPG 4PJ5E 3W9DA 4TVPH 4Y5XB 5FCUH 3X3GL 3WHE0 3SE9H 5IROA 1JGUH 3IXAB 4BZYA 1RZJH 3MCKA 2BSTA 2FIKA 4QOKB 1IM3B 5JNYA 1JWUA 5HGAA 2PXYA 1YEFL 4ETYA 2BC4B 1UXWA 4RAVB 1CFNA 4GRWF 3S5LA 3QPXH 5D1XB 2A6KB 3IDXL 4KRPB 3MOAL 4DGYL 3ARGC 1TPXC 5CZKA 4PBVC 5GHWL 3T65B 1WCBB 1ND0B 3V6BR 1R3LB 2CIKA 4LLWB 2E9BA 4HK3J 1AQKL 3O45A 4WV1C 4ZFOA 5CD3B 4DK6A 4NNPL 1KOAA 2C3VA 4JPKL 4LNRA 4G9FA 5GSVB 5I74B 5IW6A 1ZHBB 2WUBH 2DQCL 2VDLL 5GS1A 1DUZB 4EXPX 4G5ZL 1QSED 4U49A 5J12C 1JFQL 5GJTH 4K8RL 2ESVD 4PJDA 3O2WL 1T2QH 3R06B 4GLRI 4EIGB 3FKUS 2YK1L 3HE6A 2OJZH 3D2UD 4OD2B 4TRPL 5IM7B 3NCYS 5IMOB 1I8MA 5KG9B 1A3RL 1JMZA 4UAOC 5F9WB 3CCHA 5I18H 4KK5C 2DQTH 3OKMB 5GGUB 1CVSC 1SJEB 2P5WB 3L3KB 1XGUB 3DSNA 3DXAB 4YHNA 1NFKA 2ZCHL 4XVSL 3FQTA 2YPLA 3EYVB 1L7IL 4P4KA 1DZBA 4HKZA 1OOAA 3QIWD 5I1DB 1A14H 3AU1B 2MKLC 3P73B 4UINL 1MPAH 1A2YA 1GL4B 1RU9L 5ENWB 2JJWA 1CK0L 5DRWB 2OTUA 4KMLB 4JKMA 4RMWA 3T0AA 3WFHB 5T1KB 1T1XA 3VGAC 1LEKB 4WI9A 1BFSA 1MLBA 4PJ8D 4RGND 3KHOA 3O8XC 1LK2A 1FORH 3KR3L 1A6UL 4GJTB 2BRRH 4ZAKB 4Y2DD 3ULUD 5DMJB 3N85H 3MRLB 4MJ6B 1D5IH 1BX2A 3U6RA 2RR3A 1E6OH 4I2XB 1QRKA 5E2WH 1IAII 4DW2L 3PWVA 3JWDH 3SDDB 5FUOL 2GHWB 2V2TB 2VLLA 3FT3B 3KPLB 1IAOB 4NRXA 4X7SL 5EOCJ 2DWEA 4JFHD 3ARDB 4XRCA 4Z7VE 1FVEA 5FKPA 4YHYB 5DZLA 1YJDL 2LTQC 2Y5TA 4KVNH 2XPGA 4UV4H 5JOFA 1GGIL 5C0CD 3DGGA 1IAIL 1IQWH 1MAKA 2VL5A 1S7TA 3F12A 4XNZC 3B6SB 3MYJA 4H8WH 3MLYL 3TH4T 5GSRB 4PTUB 4PD4K 4M7JL 4LKXA 5FHAL 2VZOA 4HBCH 3MCLL 4OLWL 5TDPA 1KCLA 4HC1L 4X4MA 2A74B 4K9EC 5DHVA 3W2DH 2Q7YB 2VDQL 3BAEL 3BH8A 5AZEH 1CQKA 4OZGB 3M1BB 1XF2A 4X9BA 2ADJB 3RDTC 3TC9A 4QRTB 4C56A 1YZZA 4YEFA 2JCCA 4QXUL 1HXYB 1TZIA 3SDAB 3SCMC 4FRWA 1CD8A 5I8KH 2JELL 3WV0A 3ZDXF 5E5MB 3LQAL 4ELMF 3L1OH 1KTKE 4R0LC 3LKQA 4IRJD 2EDBA 2X4NB 1JWMA 1SEQH 4XHJC 3LB6D 3NZ8B 1TNMA 3TYGH 5F7EH 4EI5D 1L7TL 4OF0A 3WFDL 3MRDA 1TDQA 4FTVA 4NUGH 3FHAA 1DANT 1Q9WB 1HKLH 2QR0A 2YSSB 4NDMB 2EE9A 4KV5F 3KJ4B 1JPSH 3CDFA 4P5TB 1OD7A 1HH6B 3UCRA 4D0CB 1J8HD 1NC4A 1TJHL 4OZHA 1X5ZA 1JGEB 3B2VL 1CFSA 3EYSL 1B90A 2Z8SA 3JV6B 2FRGP 2NY0D 4OCNC 1RJCA 1P5UA 1ETZA 5F96H 3KPPA 4NNYA 1R0AL 2O5YH 4FQIH 2YWYA 4LLDB 5DWUH 3S36X 2BDNL 1ZS8A 1YEGH 4E5XB 3KYMA 3TIEB 4RGMC 3WEXB 1I85C 1WF5A 3GJFK 3VH8A 1MCWW 3Q6FB 2A77L 1GAFL 2VSDA 1L0YA 4HDIB 2OSLB 2AJ3B 4PV8A 2QKIA 1NGZB 2CXKA 3LIZL 3EYUL 1MNUH 5GQBA 1TXKA 4ONFL 1KEGH 1R3JB 4GAJL 2HJFB 3Q48A 5FAAA 1W8OA 3KPSD 3SE4A 3WFCL 4RZCA 1EERB 3GJEB 2ITDB 3J7HA 5JW5A 5L2KE 3S5LG 1KJMB 2CO7B 2NY2B 4XPTH 2CDFB 2A73B 2P8LA 1QLFA 4IMKA 1NANH 5LGJA 5FFLA 5IMKB 1XGTA 1FNHA 4NQXA 5BVPL 3U0WH 1N2RB 1B6DA 3MNWB 3WIIL 3NCFB 3QQ9D 1JZ6A 4R4FL 3LRSA 2HT3D 4BSVB 1VKXA 2G2RA 3SEPA 4PJ9A 3P30H 1Q9OB 1OGAD 4G6KH 4WI4A 2YR3A 3KDMA 2DTML 3BX7C 3WIFB 1U2HA 2XN9B 1CL7I 2Z92A 3VD7A 1ZK9A 3GMPB 4YFEA 3QQ3B 4M1CC 4R4ND 4CVZB 5TQ2L 4OM1H 3LMJL 2A0LC 1R3KA 3VWKC 4PRAA 1XT5A 3QDME 2K3TA 4M5YH 1EA9C 3OB8A 2A2QT 3MJ7B 5E00B 3ARBC 2VLME 2RFXA 3V0VB 3RWCB 5F1OB 3IYLW 4S1QH 1H15A 4WCYL 1G1YA 4UDTA 2D0HA 4XNXH 3FQWA 1AXSA 4NQCA 4UILL 3WIHA 4X5WB 5EZIH 4X6DB 3ARYA 5DMIL 3H8NA 1YQVL 4WUUB 5C92A 3MNVA 4JRXD 1CXHA 3SQOL 4LLMB 3FOMB 4FQQA 4XMKH 4AIZA 4TTGA 1BFOB 4JREB 5SWQB 3GMOB 2FDBP 1X4XA 4E41B 3FT2B 4WI7A 2HFGL 1LWRA 3U4BH 4GBXB 5CINH 3PV6B 5INDB 3KJ6L 4YHKL 3ZDXE 1JHKL 2XZCL 4U1LA 4X98B 1NCDH 1XAUA 3X13A 5F89B 3O9WC 2PKDA 3RP1A 5DLML 4G6JH 3HC4H 3T0DA 1TNNA 5BRZD 5JOEA 3EUUA 4HH9B 1XGPA 2VLRB 3V4UL 3PDOA 3L5HA 2YZ1A 1NAKL 4NQUA 3QIUD 5MI0B 4ZUSB 4I0PB 5C08A 1RAMA 5F3BA 3MOQA 1AKJD 3MRPA 4GW4B 4KTDH 5CEXA 4S0TD 4OCYL 2NXZC 1QFHA 1MCPH 3BHBA 1AD9B 4YO0B 2MSPA 4KJQC 5E1AB 1H5BB 3JVGA 3GKWL 4NC1E 1ZT4B 3ESVF 3QEHA 5KOMC 4G3YH 1CICB 1FO0H 2F19H 5DD5H 3V4VH 5DJAA 4WDIB 3TZVC 4HIEB 2BOCB 4HUXB 4WHTA 5DRZA 1WIUA 3HCVA 4JPWL 1BLNA 1ES0A 5FO7B 2EO1A 3NCEB 1DEDA 1A7PL 1WAAA 5L88L 2PO6C 2HLAB 1QLRB 3OGCB 3P9MA 1PEZA 2AJVL 3BP6A 4LBEB 3U82B 4ZFFA 3C5JB 3FO1B 3RU8H 1VFBA 3QDAA 1SJHB 1ZA3A 2BSED 1R24A 1WBYB 3VMOA 3K46A 3T4YA 5ICZA 1FZJA 2G9HA 1VFAB 5I2IA 3DETD 1T5XA 5A16A 3DVNA 4JQVA 3PL6D 4YEEA 5CJ5A 1YN6A 5TDNB 4LRNL 5DO2D 1BGXH 2NLJA 5C09E 1KTLA 3NIFF 3PUCA 4PJXA 3DBXA 5DD0L 4PJFE 1G84A 3O6FB 5H35A 1K8IA 3HR5B 3HUJF 3UAJC 5HGHB 4XPHL 4YPGB 4MNGB 1KF9B 4YFLI 5GGSB 1VACB 1JZ2A 1MWAA 4OFVA 3LAFA 4QCIA 1AIFA 3D6GA 1HIML 2UVFA 4M61B 5DD6A 3KS0H 1F90H 4GFTB 1HOCA 4Z7WB 3RPIB 4PJAA 3O6MH 5HHMD 2L4OA 4XCNA 4EUPH 3VH8G 3A6CL 2X05A 3RVTD 3MBXL 4DZBB 1BJ1J 1CU4L 2HT2D 4WGVB 3H9SD 2OXHA 3UC0L 4AMKL 2R0ZH 4LL9A 3BZFA 2IALB 4EDXA 4RRPG 5ESQB 5SV4A 1SBSH 5GGTL 3MROB 4XVUC 4PY7B 1RMFL 4HPYL 5EOQH 3OL2A 3DGCR 1XCQB 3DUHA 4U1KA 4Y4HD 3PXJA 3MO1B 1RSFA 4P59H 5F7NC 5IT2H 1ACYL 4OTXL 4OCSL 4NZTL 4KAQL 3G5ZB 4JRYA 1BD2A 1J1XH 4KJPC 4NQEE 4JJ5A 1FIEA 5DJ2B 3VA2C 4JFHE 4J1UA 4JE4B 3IU4H 1UJ3C 2JJTA 2GT9B 3GBNL 4NNXA 2O93L 4QRPA 3GMQA 1V5JA 3QNZA 3BZEB 5DJ0B 3UMTA 4CMHB 1UT9A 4QOKD 4HJGA 3OAUH 4JO3L 2VNCA 2O5ZH 2YRPA 2QSVA 3JBG7 3MZGB 4H88L 5BO1H 5BZWB 4P23A 4LCIH 4JM4H 5EO9B 5D1XD 4KRPD 2CLVA 4OIIL 3VXQA 4IRZL 3MRHB 1F58L 2BXYA 5C0IA 1CIDA 4FXLA 1KENL 3U30B 1AQDA 2DBJA 4WO4C 4PJCA 1I3UA 4Y16A 2OS7A 4L9LB 3K1KC 5EUOB 2EH7L 3LZFL 2XG5A 1Y6KR 1LHZA 4YQXH 2ICES 4APQA 4RMQA 3MV9B 1KLFA 4GRLC 4X0KA 3HNTL 3UTZA 5HTSA 1IARB 5I66A 1QO3A 2WW8A 4NN5C 1FDLH 4XBGB 5F9JA 2O5XL 5JDJA 3BZ4A 4H26B 2VABA 5CP7A 5JIHA 2P5WD 5CJQH 2F8OA 2MJWA 1AC6A 1MUJA 5J3HC 2EDDA 3DXAD 3P3YA 2NXYC 3ISWA 3BE1H 4OGAC 3G9AB 1AHWC 1KPRB 1JNHB 3SGKC 1QBAA 2NPLX 4TUKH 2AJZB 3NCYP 4MDJB 4M6OH 1LP9A 2SEBB 4AYFA 3F7YB 1QPPA 2DM3A 5CIPB 1RUKL 2F5AH 4PB0L 3OG6B 5MEOA 1FSKB 5T1KD 3ZE0E 4JDVA 4F57H 3HUJE 3VMNA 5TE4L 2VLJB 5MEQB 1DQQB 4RMRA 4G43B 5CGMA 3LKNA 3U0TA 3O4LE 4OUOA 4LAQH 4XVJL 1A7NL 4ZAKD 1FFPB 1TETH 1U8JB 3C08H 5CIPH 1YNKL 1RUML 1N4XH 1KJ2H 1A7QH 5E24E 4I0CC 3LKPB 3SDDD 2ZUSA 3VXPA 4M8QA 3CSYB 1T1YA 4MVBC 3ARDD 1J05A 2CKNA 1YEKL 4J12A 3BQUC 3CIQA 3OX8B 2LE9A 3MV7A 4P49A 3CFCH 2QQNH 1I75A 1H3XA 5IQ7H 4PREB 5BMFL 1OTUD 3QXDB 3C6SB 4QY8A 2JB5H 4IOIA 3D39A 3HAEA 1HHKA 5D9SA 2WBJA 4G6ML 4Y19B 4WEBL 3ROOA 1U8KA 3OPZH 4ZMAT 3THMH 3NGBC 4I0KA 3TN0B 1WZ1L 2IPTH 4AEIH 5CFHA 3ZT7A 3PG2A 4YDKL 4POUB 1BZ7B 2J12B 1DQML 5DD3L 4CN4A 1TITA 4GS7B 4HIIB 3I2CH 2WV3A 2FHFA 4TUJA 1ZLUH 1JP5A 4WU5B 4J6RL 4HWZB 3D0VA 1BF2A 4Y4FA 4PJGB 3VXTA 2QSCL 5DJ8B 1I7RA 1S78C 2C1OA 3EGSA 3MRQA 1PZUB 1QRNA 3QA3A 3RY5A 4IS6B 3P4OB 3UPRA 2JJSC 1D5BB 3KWWA 4FZ8H 3WUWB 2EDNA 3F5WA 2R1XA 2CH8A 3QZWB 4NJ9L 3I6GA 5LKNA 2W0FA 4P5TD 2Q20A 3I02A 2KKQA 4PJEB 3NOIA 2W38A 4A6YL 2ICEA 3QCTH 4M02A 2X4TA 3U9PH 3ALPA 5AWNH 5CSBA 1G6RB 1IC4L 2BVYA 5DQDH 4YDIH 1HHHB 5DQ9B 3BKYH 1IFHL 1G7MB 1ZANH 4WJ5A 2NX5E 1FL3A 3D5OF 4KK8D 5ID0A 1X5IA 4N68A 2P43B 3BMWA 5CBEA 3FB7A 1F3DH 4G8GB 1JNLL 2AI0L 1MAML 3IDIB 1BIHA 4HEME 3CSBA 3EDDA 5T3XE 5T1MB 4AZ8A 3H42H 3LN9A 1W72L 3VGBA 5E8EB 2GAZA 3UTPE 3HC0A 3H9YA 2R29L 1BVKA 3BVNA 3K4DA 5HYEA 3B3IA 32C2B 3FONA 2DDQH 1T83C 4J7RA 1BBDH 3QULB 4J23A 5CP3A 2YC1A 5L7XH 3U4EB 1M7DA 2ZCLL 4N0RA 5ISZA 3Q1SH 2X4OB 4OAWB 5EC2A 1GGCH 3QUXC 4OCRH 2NY2D 4KQ3L 4WGWB 1I1RA 3EDJA 4HHAB 4B41A 4HIHB 4UQ3A 3DX7B 4WW1A 3QEGH 4LCCB 4Q2ZA 5HHOA 4OSUH 3BPOB 4FXGA 3T3PF 1S7WA 3PIQA 1PX3A 1JK8B 4P57B 1ZT1A 3KLAA 1EVTC 2YD1A 3GSNB 1BFVL 4PJHB 5D93B 3WNLA 3V5DB 2XN9D 5C6PB 2HN7B 1DBML 3EO9L 3FN3A 1T7VA 1DQLL 2OTWA 2E7BA 5CILH 3VFGL 5F7LB 5HI3D 5B4MD 4ZUVA 1OGTA 2NY0C 3MXVL 2GJ6B 3PQYB 1MCQA 4HKJB 4XNYH 1MI5A 3GBML 2XKNA 1J10A 3NACL 3FQRB 5KSBB 1T1WA 5GS0C 2OI9C 5E4IA 4HS6A 3CFEB 2F15A 5E2VL 4DGIH 4NO3B 5D2NC 3QUKA 5D1ZC 3CVIL 4J3TA 4XAKE 1NGQH 2DQFB 1P4LB 3FO0L 1O5DT 4HPOL 2B5IC 3VJ6B 4Q9RL 3TO4B 4WUUD 2X7LA 4PJ7F 2BHYA 3DMMB 4LHUB 2R56H 3L5WA 4PIRF 3UJJL 3EOBB 1JGVH 3B43A 4KI5F 2FO4A 1KIRA 1FAKT 2BVUA 4E41D 3UTQB 4K7FA 4PLKD 4GBXD 3V5KA 1VFOA 3GB7A 4L1HA 1QKZH 5EZLA 4XBPA 4GG6F 3CFKA 1U36A 3HNSH 4YK4C 4HLZG 2EYSB 3QDHA 4MMZC 2BNRA 4LSUL 4MB3A 2VLRD 4WWID 1ZMYA 2OR7A 3MJ6A 2XFXB 4I0PD 4JN1L 1H3WM 4H20L 5FUCC 4G7VH 3OKKA 1EAPB 3ECBA 2DM7A 4NHUB 3O3DB 4P3CH 1LEGB 4R4NC 1JYVA 2HP4A 5JW3L 2XQBH 3SDXB 1XF1A 3BRDA 3VG9B 3JZ7A 5TQ0H 5GGVY 4OCXH 3WN5B 1JNJA 3EYQC 1YQ2A 1H0DB 1CICD 4JDZA 3HAEG 3WE6B 3RAJL 3ALXA 3MRMA 2EDLA 2ZPKL 5BV7C 3P4LA 3ZT5A 1MCRA 1QYGL 2XWTB 3QNXA 3OXSA 3CAFA 3PHOA 2OQJB 1FZOA 2EO9A 5DTFA 2VQUA 4Q9BA 4F7CB 1EFQA 2X10A 3T1WA 3WL9A 3SGEH 2OR8A 3OB0H 4RIRA 2P7TA 1C5BL 4NKDB 3V2AR 1S9KC 4OGYH 3GMLA 3IETB 4RGOL 4LQFH 4KUZL 2HFTA 1AGFA 4C4KT 1LNUB 5D5MF 2DQHL 1DE4B 4U7SA 1NAML 8CGTA 2R4RL 4UT7H 5EU6A 3QFDB 5C70A 2J7LA 4MLIA 1KSRA 4JB9L 5MENA 3MBEB 3IT8D 4PJ5A 3O6FD 4MAYB 1NH6A 1U8OA 2GTWB 1J88A 4XAWL 4FP8H 5ALBL 2R0WL 1KIQB 3E0GA 1QVOB 4OV5A 4K2UH 2HJKA 5F3HA 1MF2H 2ZG1A 4UNTA 3BD4A 4E0RA 1EO8L 3QP3A 1OAQL 3FO9A 3CVHB 4L8SB 3C60A 4I18C 4ONHA 4JY4A 3MLPA 3MCKB 2FIKB 4BFGA 4XC1H 3DVIA 4XPBH 5JNYB 2VXUL 1JWUB 5KZCB 1MJ8H 4OZIF 4OT1H 5D6DC 4WFED 4IEFB 2PXYC 1NDGB 3NABL 2B1AH 4XMPL 4JO2H 5JORB 1DQDH 3FFDA 4F7PA 4N9OB 3CVHH 4LVEA 3I75A 3SKMA 3B2UD 3ZYZA 4U6VH 1UC6A 2G60L 3MLVL 1W0VA 1PEWA 2DQIH 1FG9C 2VISA 4YE4H 3WXVL 3O45B 4YHZL 4ZFOB 2APTA 1LK3L 2C3VB 3BJ91 5IW6B 1UQSA 2AXGA 5CJOL 4LPVA 2I60H 1MHPL 5C9JB 2OR9H 5LGHH 3NAAH 5IB5B 3DRTA 3FQUA 3NFSL 4JO1L 4PJDB 3AY4C 1HH9A 4LCWE 1CD1A 1U3YA 3HE6B 1EX0A 1M05B 3PL6C 2R1WB 4K7PY 1KFAL 2P45B 1WZLA 2VDRL 1I8MB 5KN5A 1G9ML 2UUDH 3CCHB 2YZ8A 3TBWA 4OD1L 3T1FB 2YA0A 3GMMA 3GRWL 1IAKA 3MCG1 4ESKA 4OCLC 2FJFA 3WNNA 3QI9A 1KCUL 3FQTB 3MOBL 3S35X 4JPVL 1AI1H 5HY9A 3VI3F 4P4KB 4NRYB 4OBSA 2WLZA 2WMPA 3RUGA 2EXYD 2VO5A 5E5UB 1EO7A 2DYPA 1A2YB 4BUGA 1RUPL 5F7KC 2OTUB 1QFWM 4Z0XA 1H3VA 1T1XB 4MQ7A 2EXWD 5D2LF 1OAXL 4HMDA 1OCWL 1MLBB 4ZYKA 1FG2A 3BN9C 2OL3A 2IPUG 3QWRA 1KN2L 3WFBL 3VFSB 5HJ3A 5KTEL 3MV9D 3REVB 4NQVB 2FGWL 4JFEE 5FGBA 3OR6A 5KVDL 2HT4C 3U6RB 4E9LA 1IQDB 3ARFB 4P4RB 3LEYL 3FMGH 3RKDC 2AQ1A 3FJTA 4NRXB 4X7CC 1KGCD 5HHNB 4XRCB 5B8CA 1RZJC 3VXOB 5CZXD 5FKPB 3ET9F 3OKOA 1FGVL 3T0BA 3BRGC 2XPGB 3PGFL 1T2XA 3DGGB 2VL5B 1XIWC 4D3CL 1S7TB 5J4MA 3N1FC 2FCBA 5DVMA 3F12B 2CGRH 1M4KA 4B5EA 1R3HA 3MYJB 3SKUD 4HULB 3RVVD 5D5ME 2IH1A 2NZ9C 4Y5XC 4LKXB 4C4KO 5J13B 3QWOB 3OKLB 5HI4D 3HZMA 4ODUA 4F15C 4JO4L 4EXKA 3ZE2F 5DHVB 4Q74A 1A1OA 4Z95H 1JZ8A 5D71H 4JANB 1XF2B 2OLDA 4P3WA 2ADGA 1YEIL 2VDML 4YNYA 5FK9A 2VLJD 2BMKB 4P2RB 3RJDA 1C1EH 5ADOL 4C56B 3TO2B 3EKCA 1UZ6E 1AGEA 1SJVA 1AGBA 2JCCB 4UTAH 5D6CA 1D6VL 1TZIB 2XT1B 3M8OL 4LSTL 4IBLT 4ZDHA 5T1LA 5K33A 5T3XL 3M17A 1I7ZA 3I6KA 43C9B 3LKQB 5BJTA 1JWMB 1TTUA 3HI1B 3AUVA 3CGTA 5KS9E 1AO7E 4Y5YC 5J1SC 3LHPL 2RBLA 5D70H 3NZHL 3FO2A 3ESUF 2QR0B 2JIXA 1NFDF 2MFNA 4JY5H 2XA8H 4ZOCA 1T2JA 2GYSA 3G5YB 3B9KA 4FQCL 5JLZA 1RURH 4RBPH 3ZDYF 1NC4B 4HS3A 4OZHB 3BMVA 5B38A 5KSAD 5T5NF 3V0WL 5A2IH 5SX4I 1IZJA 3B9DA 4R97B 2XN9E 5IK3A 4W4OA 1GOGA 2PCPA 1S9XA 4JQXA 3B5TA 2ZSVB 2A1WL 4HIXL 1ZHKA 1UH4A 3BESR 4OZ4B 1QR1B 4Y19D 3MUGA 4UUJB 5I1EH 3FL7A 4I9WD 5TGBB 1AFVL 3TN0D 1Q9KB 1ZEAL 3QUZC 4M93B 4LSQH 1ZLVH 4PGEB 1NSNH 3L3IA 2OTPA 4FQPA 3VH8B 3RY6C 4X5LA 5JDSA 1R5IB 4FABL 2XTJB 4MNQB 2J88L 2QKIB 3GNML 4JZOB 3MLRH 3JWDC 1T04A 2EDKA 3UJIH 5HGDA 4ZUUA 4RZCB 1HXMB 1I4FA 3SE4C 1B88A 1IL1A 4LMQE 3MJ8B 2VR4A 5JW5B 4PJIB 3L95A 4MMXC 2X40A 2YXFA 4ZAKC 2FR4A 3KPRB 2DLIA 3VFOB 1J9CT 4H8WC 4NYLA 5EA0H 5LGJB 4PJBB 1XGTB 4NQXB 1INQA 2YBRA 2ZCKL 4HUUB 4IMKC 4RWYH 5E8OA 1DSFL 4MAUH 4MJIE 3OAZH 3ZT6A 4YUEL 5H94B 3LRSB 4WY7H 5D2LE 3VXRA 2FSEB 2G2RB 1QHPA 3EOYG 2DLFL 4X4YA 4R8WL 1DLHA 1NLDL 3EHBD 3QHFL 1H3UA 4I77L 2LV4A 4XCCL 1WT5C 2NR6D 3QDMA 4RQQA 4KZDH 4FXKA 4HK3N 1IGFL 5K9JH 4G8GD 3OJ2C 1A4KB 1TMCB 3LSOB 5D7IF 3K8LA 4Y1AB 2WZPD 1OTUC 3QDGE 2HWZL 3RVUD 1R3KB 4PRAB 3HPJB 4XNMA 3BDXA 2Q8AL 1BWWA 3ELAT 4X6CF 3D9AL 1A5FH 4ZXBA 4LPWA 5LXGH 4A6YA 4TULL 4YXKH 5HHXL 4X80H 1H15B 1UXSB 4KMTL 1JCKA 4UDTB 3DUUB 3BD5A 2IMMA 2Y7QB 5DEFA 5D7LE 3RWGB 3TFKD 5ILTH 3FQWB 1AXSB 2J8UB 5C0DB 2X1OA 4JVWA 5BVJA 3G9VA 4RMVA 3QUYA 4MB4A 2X4SA 5HI5C 4RFNB 4CNIB 1D9KA 4C59B 2HTKC 5EUKA 2QSTA 5C0FA 4XP5H 2W65A 4AIZB 4ELMA 5F7YC 5C0AB 4PRIA 4C58B 1LE5A 4XMLL 3IAGC 2GEEA 5C6WH 1YY9D 3AM8C 3AAZA 4UB0L 4AT6A 3QFJA 1XH3A 1KCVL 4ZTPH 2BVPB 3F58H 3QHZH 5JXED 4J3WA 5EDXA 1FE8H 3X13B 1GRWA 4RDQF 5D1QA 1YMMB 4NCC1 5JW4R 1EEYB 3QR2A 1PLGL 4KHXL 3W0WE 5F93C 2GJ6D 2WAHA 4LOUD 3PQYD 2BSRA 3PDOB 3FQXA 4QRQA 2GK0A 5E7FA 4OJFH 5C08B 1YEHL 5F3BB 2B2XL 2YPKA 3GSXA 4QYOA 5DI8A 3MRPB 5CEXB 1A9BA 1G7IB 4S10A 4MCYA 3FAXA 4YXLH 4TSBH 3ZKXB 3TBSB 3V6FB 3QEHB 3VXNA 3O0RL 4GAYB 4Z7WE 3TO4D 3S3JA 3DMMD 4LHUD 5MP6H 5DF0A 3K2UH 1BQLH 1YA5A 5DVLA 3WJLC 1CFVH 5EC1A 2WUCH 4Q58C 4FQ2L 3HCVB 5DRZB 3QO1A 1BLNB 5C0EA 5GGQL 1ES0B 5FOBA 1J12A 4BQ6A 3S6CA 1TVBA 4JFFE 4MA1C 2FJHA 4KKCD 3H7BA 1VFBB 3VXMB 1NGWA 1ZA3B 1JV5A 5ICZB 1INEH 3T4YB 3DO3A 5J56B 4ZPVA 3RL2A 1HN1A 2G9HB 4PJFA 4U1IB 5EU7C 1QUNA 4ZSOB 4KDWA 1KTRL 5DJXA 2R23B 2VJXA 3KYNA 4JQVC 1EZVY 4WI3A 4Z0BH 5JPMA 1MQ8A 2PW1A 3EW3B 4JCLA 4AM0A 3P4MA 1KTLB 3JTTA 4RX4D 4PJXB 3DBXB 1WZMA 3HMXL 1CGWA 2YWZA 5DSCB 1T7XA 1X6NA 2R4SH 5H35B 5CCKL 1UYWH 4YHOH 3RA7L 2R8SL 1MWAB 5TPWH 1AH1A 3RGVA 4F7TA 4QCIB 2AEQH 4MQXD 1WISA 2VAAA 5EPMB 5D7IE 5DD6B 1ZA6A 1HOCB 4HCRL 4PJAB 4C54A 5IQ9A 3MRBA 3BISA 2DL9A 1DBJL 1WC7A 3C09C 1WBZA 4X7EC 3MTRA 2GI7A 4LIQE 4L4VE 5F8QC 3LKRB 4JG0L 4Z7QF 4X6CE 3BZFB 3TLRA 3CJJA 4I3RL 4UQ2A 1A3QA 3OTTA 3CK0L 1ZWIA 1GH7A 2UVEA 5HYJA 5IKCA 2AAVA 2ZOLA 3SO3C 1WJ3A 3RNKA 2VKWA 5TE7H 4Z5RA 2H2PD 1E4WH 3BYTA 1LO2H 4OLUL 25C8H 1FLRH 2JB6A 3LEXA 4EI6B 3VDAA 5FM5M 3MBED 3KPOA 3LDBB 4MAYD 2XKSA 5CEZD 2L0DA 4Z6AT 4JCMA 1G7QA 4JRYB 1S9VA 4PB9H 4IDJL 1BD2B 5H37H 2Z8RA 4J1UB 5D8JL 1YEJH 3R0MA 5KSVA 4QRPB 1J0YA 4CJ1A 5FYJH 4FQ1H 3SDYL 1BIIA 3VWJA 1HSBA 2VLKE 3RIFK 1HCFX 3HC3L 2Q86A 4N1HB 5JPNB 1I1FA 3GBLA 5KZCD 1IGYA 2EEDA 5M95B 1CICC 1I7TA 1MCOL 1NAMA 1J1OL 2VB5A 4P23B 1JJUA 1UKTA 3CUPB 4JZJB 4Q9CA 3IFPB 2ICWI 1ULVA 2I26N 3DUSA 4YHML 4M6NL 1S8DA 4TPRL 2E9JA 2E27L 1W8NA 4I4WB 1YYLL 4QO1A 1KB5L 3MV8B 1NGYB 15C8H 4Y16C 2IGFL 4APQB 4BQCA 4MA3B 2W9EL 4O02L 3GZKA 4DN3L 3P11H 4G7YL 4J4PA 4DVRH 1U91A 3UTZB 1TCMA 2HKHH 3HE6D 5I66B 2ED9A 1QO3B 4RFEB 3DO7B 3TT3H 3S88H 5F9JB 1U2CA 2BY3A 3BZ4B 1P84J 2M1KA 2CKBL 1F4YL 5JIPA 4TQEL 3LKSA 4W4NA 1MUJB 4YC2B 4QKXB 1FNGA 5I71B 1NBZA 2QQLL 4BKLB 1MFDL 4P4KD 3HUJA 1YEFH 4P48A 2I25N 4OKVA 4ZG1A 4UNUA 1LP9B 1BVLA 2Q6WA 3IDXH 1E4XH 3MOAH 2PETA 3O4LA 4L5FL 4DGYH 1GIGL 5MEOB 1O7VA 3NIDF 5C71A 4HWBH 4JDVB 2APWA 1P7KA 3BP7A 1AQKH 5FO9A 4NNPH 4K71C 4EDWL 1N0XL 3GSOA 2BVQA 4LKCA 1F00I 2VDLH 4QLRA 5GRWA 3U0TB 4G5ZH 1Z9SA 2D7NA 5IB2B 2RB8A 1JFQH 4G8FB 3QUML 3HA0A 2GITA 5JO5A 3O2WH 4KXZH 4LMQI 3ARFD 4N8PA 1XZ0A 3JXAA 2YK1H 3VXPB 1YN7A 4BSWB 1T1YB 5HHPB 1A3RH 1J05B 1KNOB 4ZUTA 4NSKA 4TNWK 1MSPA 3TF7C 3STLA 5MHSD 2BNQE 1FNEA 2VXTL 3C2SA 3JV4A 3MV7B 1OSPL 5JOPD 5AZ2L 5I1JL 1FIGL 2YPVL 2RCSL 2ZCHH 2OP4L 2AP2A 1OAUH 1RY7B 1A7BA 5EU3B 1L7IH 3QPQC 3IDMA 3JV5A 2ZZUT 3TYFA 2AK4E 3IFLL 3D39B 4QRRE 1C16B 4UINH 4ODSL 3HAEB 3NA4A 1JTPA 1U0QA 1RU9H 4LRIA 4PG9A 1CK0H 3ROOB 4P2RD 2WBJC 4C56D 1P4BL 3HZVA 1KJ3L 3VI4F 2MPAL 4PTTA 1HWGB 4IHOA 3MFGB 1MIML 1MRDL 2RHEA 4NGHL 3OKNB 2CK0L 5I8CB 3KR3H 1A6UH 4ZS6D 1IBGH 3ARVA 2ZUQC 4KROB 1I7RB 3EGSB 4GQ9L 1TZHA 1JYNA 3K0WA 3MRQB 4V1DB 1FZMB 4Y4FC 2EXWC 2XZQL 1QRNB 1U58A 3QA3B 4UV7L 3MFFA 4G80A 4L8DA 3KWWB 4DW2H 5J6GA 5ABDE 4X6FA 5FUOH 1F42A 3F5WB 4DKEL 3L5JA 2W0FB 1FV1A 1OP9A 4LDLB 4UU9A 3OXRB 4YZFE 1J87A 2NX5A 5CBAA 2ICEB 1NC4D 5SWSE 1I9IH 2X4TB 1CXKA 1UG9A 1A1MA 3MLYH 1JZ7A 4YHIA 5GS2H 3ZKQD 2Y6SC 3LQZA 1EXUB 5FHAH 1OT2A 3A67L 5IB4A 1NFIB 3RQ3A 1HHJB 3MCLH 4WJ5B 5CZXC 4HC1H 2FATL 4WW2C 5IHLB 5I1IL 2VDQH 5ID0B 3QBTB 5CBEB 1SEBB 3FB7B 2CSPA 2FD6L 1HEZB 1RIHL 3TBTA 4QXUH 2IADA 1Z6JT 1LILA 3O3UN 4H25B 5D72L 5EWIL 2NY3C 2XTJD 1AGCA 4KTEL 4MNQD 3VE0A 5J11B 2GAZB 2XRAL 2JELH 5JR1L 1FSKC 2X1XR 5FB8A 3ZLQC 1KB9J 2F53A 3VFPA 4NRZA 3PP3K 35C8L 4P3DA 5DJDA 3O2VH 2CMRL 4HX1A 3ME0A 5B3JE 1L7TH 2YC1B 2X1PA 3WFDH 1JGLH 1T0MA 1M7DB 1AXTL 3O2DL 3DROB 4WI2A 5EC2B 3KPRD 5SWZE 1Y6MR 2DI9A 2MKWA 1ONQA 2NY6B 2BXZA 2HRPL 3CX5J 3GMNB 1ZVSA 4PY8J 4UQ3B 3RX7A 1C5CL 2H45A 4WW1B 4DGVL 3CH1A 3C5ZB 4Q2ZB 4XC3L 4Z78A 5HHOB 4EKXA 4FXGB 3CXHJ 3B2VH 3EYSH 4HJ0C 1RVFL 4XPGH 1HSAB 3PIQB 4Z7NF 4LEXL 2AJUL 2FEDD 5EB9A 5GRXG 4M9OA 1R0AH 4UTBL 2CRYA 4IRSB 4Y1AD 2BDNH 2OTWB 1IEBB 5KSAC 5FUCE 1E27B 4AY0A 3MLZH 4Z7UB 4K3EL 4PG2A 3TJEH 2CO6B 1F13A 1GAFH 4FFWC 1NMAH 2W1NA 4NC0B 3WNOA 4A2MA 1S9WA 2OMNA 4DVBA 3LIZH 3EYUH 4HS6B 2DWDA 1V05A 4LU5H 4GAJH 3V8OA 5TF1H 3QUKB 4KDVA 3WFCH 4HT1L 1NCCH 5I8OL 4GG8A 4ELKA 3DTXA 3V4PL 5I19L 4EN3C 2EH8L 1VGEL 1CLCA 1TQCC 3RWFA 5HHVL 3P2TA 2JTDA 1OWWA 4LVHB 3L5WB 4XWOD 4CAGA 3P4NA 1WLHA 4LP4A 1EGJA 2FO4B 5C0AD 5HBBA 1A02N 2VAJA 4K7FB 1FJ1A 4NZDA 3G08A 2R1YA 1WV7T 3V5KB 4P46A 2OZ4A 2DTMH 4N0FB 3RVWD 5EZLB 4XBPB 1F6AB 3SJVB 4ZTOL 5HGBB 3WLWC 1MEXH 2F54E 4LIQL 1YMMD 3WNMA 4M4PA 3NH7L 2D2OA 4MJ4A 5EBMA 4QHMA 1DFBL 3H2WA 1QSFA 4D0DA 3LMJH 1DR9A 2VE6A 1RIVL 5BOPA 4NBYB 3RFZC 4AG4L 3V6OE 5C08D 1U93A 3OKKB 4OF5A 3GI9L 3ECBB 1PYWA 4F2MA 4NM4L 3C8HA 1G7HA 2PTTB 3AFLA 2X5PA 3NPSC 4UILH 3ULVD 4JDZB 2MHAA 3MRMB 5DMIH 3ARGA 3S98A 5BQ7A 2CDEB 3RTQA 1UVQA 4WV1A 3JTSA 3TFKC 1KTDB 1MCJA 3BW9A 5D7JA 3HRZA 5DTFB 2H26A 5DEGA 1JPTL 2I9TA 4MQSB 5FM4A 3IJYA 3SGDH 1S7SB 4C57C 3KJ6H 2P8PA 1JHKH 2XZCH 3ZO0A 3VXMD 1S9YA 1FYHB 2NY1B 2P7TB 2FJGB 2NY4B 5D7KD 5DK2A 5DLMH 4G9FE 1TZGL 1A47A 5FYKU 1II4E 4LPYA 1AGFB 1DN0A 3V4UH 1NAKH 1EBAA 1WFTA 2D4DA 3PE9A 1J1PL 1UJTA 2VZ1A 4NN6B 4OCYH 4PJ5B 1OAYL 1Y6NR 2ZOKB 2XXMB 3CDGA 4UIMA 4AEEA 2DF3A 3VFNA 3GKWH 4OV5B 2UV3A 3V95A 2AEPL 1MCCA 5F3HB 1FFOA 3EYFB 4U0QB 4E0RB 4EZMA 1M7IA 4Z18A 4ONHB 1TJIL 1GGYA 5E1HB 4U1JA 3C60C 4LSVL 2YPLE 4AEHH 3MUY1 4FZEH 4JY4B 4JPWH 3IB4A 3QH3A 4QNPE 1PG7W 4BZ2H 4LPCA 1A7PH 4JHBA 5L88H 1XEDA 2AJVH 1Q72H 2ZUTA 5ANME 3ZKMC 3KPQA 4I5BA 3SKMB 1CDGA 4HIJA 3X12A 3ZSTA 4TOYH 4AIXA 4PLOB 3T04D 1W0VB 3C87A 2VISB 1VERA 4LCUA 3N1MC 5CUSL 1UQSB 2EIDA 1QP1A 2AXGB 4KQ4L 4LRNH 1EO5A 2W59A 4X9GA 4GUPA 4M62L 3U1SL 1EPFA 4UMGA 3EOTL 4I1NB 1IEAA 3FQUB 4JRYD 5DD0H 4GG6A 1BD2D 3EJJX 1A6AB 3JWOC 4R96A 4OI8A 2FLBT 4OCMC 1OLLA 4BFIA 5GGVL 4XPHH 5ACLA 1HH9B 5C3TA 2EIEA 1CD1B 4JHZA 4MCZA 3S37L 4DCQA 2IH3A 2Y36L 4QRPD 5KN5B 1GZQA 1ROWA 5JOPE 5KANI 1HIMH 1NMCC 3DX6A 3MRNB 1NCAL 2YUXA 1IAKB 5DC4B 3VG9C 1NLBL 1WVZA 3WN5C 3SCMA 4L8CB 3A6CH 3QI9B 4FQXB 3WHXA 1E4KC 3A6BL 4X4ME 4LLQB 3MBXH 5HY9B 4TTDC 4URTB 1V3MA 4P23D 1CU4H 4PP2A 3UC0H 1UCBL 5C7XH 4R0LA 3RUGB 1CE6A 4C56E 2J5LB 5E4EC 1A7RL 5L8JB 3WJJA 2NY5H 3BGFB 5GGTH 3V9FA 4Z0XB 2BFVL 4X6EA 4JFEA 4F9PC 2MQCA 4MQ7B 3MV8D 1RMFH 4HPYH 4NBXB 5AYQA 3MRRB 2COQA 4ZYKB 1FG2B 1UM6L 2O61A 2OL3B 2R2BB 4APQD 5ICYB 1ACYH 1PG7L 2VIRA 4OCSH 1A22B 4NZTH 3OR6B 4KAQH 4FTVE 4Q6IC 1P6AB 2ERJC 1HINH 3C5SA 4LVNB 5E8NA 3TM6A 3EO0B 4WHYH 2YKLH 4KKAC 4HFWA 2VXQL 2R9HC 2IQAB 4MX7A 1C8PA 1GZPA 1G0YR 2ED7A 3HLAB 3RWDA 3Q5TA 5D5MA 4MXQD 5MEPA 2VZSA 3OKOB 5B8CC 4NN7B 1I85A 1A6VH 5I15H 1R3HB 5F7MC 1KB5A 2ICWA 1T6WA 2YMXL 4QEGA 2CDGA 1P84K 3T4AA 1U3HD 2P46B 4L8SC 1QFWI 4G42A 3HZMB 4ODUB 3GSNL 5TFSL 5CSGA 1WWWX 3I50L 2D7TL 3MLXH 4K8RD 1A1OB