1QLEL

Cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
DIELTQTPVSLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQFLVYNAKTLGEGVPSRFSGSGSGTQFSLKINSLLPEDFGSYYCQHHYGTPPLTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Cytochrome C Oxidase from Paracoccus Denitrificans Does not Change the Metal Center Ligation Upon Reduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/immune system
molecule keywords CYTOCHROME C OXIDASE POLYPEPTIDE I-BETA
total genus 24
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1999-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qleL00
1GH7A 4JVPA 4X6DA 5KVEH 1KCRH 4OLVH 2CDEA 4OCSH 1SYSB 3RAJH 2FZ3B 4OGAC 3K8MA 4Z7QF 5FUCE 4MA1C 3IJYA 1NLDL 3O41B 5TF1H 4IOIB 4HS8L 4FXKB 5DQJB 3IXTB 3PGFH 5FK9B 3AC0A 2R56H 5DF0A 4RISH 1AGCB 2WBJB 5E5MA 4Y4HD 1H5BC 3HNTL 3T77B 2ZJSH 1A22B 3MNVB 2GSIB 2XTJE 3KNBA 3HG1E 2IBBA 3QCTL 1OWWA 3VFOB 1BQSA 1YEEH 4H20H 5EU4A 5I76A 2I25N 4R0LA 5HXMA 1AGBB 15C8L 4XXCA 3ARBD 4O2EB 3TNNB 4PJHA 2DDQH 5B38B 2Z91B 1ZHLA 2OQJB 4ZAKA 2Q76A 1NC2B 3AU1B 1GZQB 2W1NA 3NA9L 1VGKA 5DT1H 1JI2A 1EJ6A 1QFOA 3E2HC 4LIQL 4O2FA 5DJ8A 1OHQA 5JO5A 1FL3B 2VB5A 3VGAC 5KSUA 3VI4E 2VR4A 4FZ8L 4R26H 1DBKH 5CD3B 5MHSE 3G5YB 1LO0H 2G9HB 4D8PB 1E4KC 3MRNB 4ODHL 5EPMB 4MSWB 4ZSOB 3RKDD 5DC0A 4YFDB 3QPQD 1QFWI 1U8MA 2XNAA 3TC9A 4ONHA 3C2SA 3TIEA 1DBMH 5HVWA 2V17L 1RMFL 2RIKA 2O5ZH 5FYKL 3TPUB 2DKUA 3LQAC 1KB5A 2KQMA 5D1ZA 2PXYB 1SJEB 4PJFA 2ICEA 1BPVA 4TULL 3MTRA 4P23A 2P48B 5DC4B 1YDPA 5GRYA 2Z31C 1F8TL 3BT2L 2DLTA 4LQ1A 1CFVL 3T65A 4YJZL 1IGCH 2XPGB 2WINA 3UZVB 5IT2H 4GS7C 2NX5A 4R3SA 4MXQC 4P59L 1KTLA 3ZZ1A 1Z9OA 3N1GC 2BVQA 2APXA 2A9NL 3VGHA 2Y6SD 5ENWB 1Y18B 3V2AR 3ULUD 4OGAD 3FN0H 3JTSB 2WP3T 2GK0B 2CUHA 4ETQB 1T21B 4DN4H 1U8PB 5JHDE 4DCQB 1A5FL 4PGDB 3QXVA 1NAKH 2B1HL 1MHHA 3OR6A 3SDAC 2UZIL 2X1QA 5GSRB 1BX2A 3OAUL 4D0CA 2EYRA 1JYWA 1UWEL 4EI5D 4YNYA 4M7JH 4NWUL 5EBLB 4HKXB 1HHHB 1WFTA 1NGYA 4LEXL 1I9JH 5IVXB 3CJJA 3O4LD 4OKDA 2Y1VA 3OAZH 1ETZB 3VFVA 5C07A 1FV1A 5JW4M 3OF6D 2GKIA 1J11A 4U1GC 4Z7OE 1CIUA 1F4AA 5D70L 1J0YA 2D7OA 1QRKA 3D1MC 5E7FA 2X4UB 5E99L 3H7LA 2M8XA 1U3YA 2FO4A 3MBEC 1BZ9B 3D5OF 2FJFA 1VKXB 4QRRE 5K9OB 4X7FC 3H0TA 5C6TH 5C0BE 1R5WB 3C9NA 1RUMH 2FJHB 1RVFH 4K2UH 2AI0L 4FOMA 3RY4A 4NN5B 4X7CC 1N5AB 1HQRB 2HLAB 5GRJH 4YHML 4XRCB 4PJ8B 4AIZA 4ZAKC 1AD9A 3ZSTA 1C08B 5FOBA 4BM7A 5L2KD 5GS3A 4FFWC 2Z4QB 2B4CH 2BNUA 2CUMA 1F00I 5H35B 1Y6NR 4UILH 2IJ0C 4CNIB 2IH1B 4XPBL 2DAVA 3PNWB 4KRMB 5F93C 3C2AL 5ILTH 4FTVE 4RMQA 3VXRD 4JY5H 3O3DB 1NCCL 1CVRA 3GKWH 2IFGA 5DK0B 3DBXA 1NMBH 5JMRA 2ARJA 4G43B 4XMKH 4NN7C 1IQDB 1HZHL 5F7EL 4NGHL 2HJKA 2YKLH 4K7PL 4HFUH 2EIZA 3CH1B 3EO0B 5F3BA 5ALCL 4ONFL 2B8OT 1TNMA 3HFMH 1HNGA 1NGPH 3LB6C 4S2SA 1JGVH 4K3GA 4XAKE 1WK0A 2CK0L 4ACPA 4CL7A 4PRPB 4OLUL 1B0RB 5KSUB 3MNVA 4DCQA 1Q9KB 1H8NA 5SWQA 1FZOB 1T5WA 4DGIL 2IAMD 5GZNC 5HPOA 4GAYA 5E94A 5KS9E 2F53B 1V05A 4R97B 3FQTB 4ZPTB 1N6QH 3DGCR 2R0WL 1KEMH 3OJVC 2IAMB 2VZSA 1XGYL 5I1DA 4KKCD 4D0DB 3N06B 1YUHA 4XTRD 3ROOB 4P2QE 3VCLA 3T0VA 3WBDA 3EW3B 1G7MA 5A2IH 4M43L 4HEPG 1KIRA 4ZUTB 1T2QH 1WBZA 4YDJB 1KPUB 5GS0C 4KJYA 5J8OA 2HWZH 5K59F 5DK3A 3V52L 1FRGH 2GSGA 1LE9A 3GSOA 1XEDA 2OTPA 1JTTA 3GMQB 1T89A 5FHBH 1A7PL 5JA8B 1EPFA 2H2SD 5AYUL 3ZTJG 2ICEB 1I9RL 4MZ2A 3UTPE 3S4SB 1P4BL 2XNAB 4HXAH 1VACA 3D39B 4PRHE 1QFWL 4G8GD 4W6WB 3G6JE 1ZGLP 1RUKL 5E56A 5SV3A 3IVKB 3GI8H 1D5MA 4LF3B 3IJSB 2AAVA 3HUJF 1UEMA 1NMCC 3TA3A 1LDPH 3IDGB 5ESQA 2RJMA 1UA6H 2FD6H 1DQJA 2GTWB 2G2RA 4WGVB 2Q87A 1N59B 1JF1B 1D5IL 2PYFA 3OJ2C 5KSVA 2QQNH 4HUXA 1NCNA 2JB6B 1ZS8B 1OAZH 3WIFA 3L6FA 1QKZL 1FSKC 1JHKL 1MCFA 3V0WH 1KTLB 4M7LH 3QUMB 5LCVL 3DV4A 4M7KL 3KPRD 4PRAB 1XF4A 2BZDA 4LLUB 5C6PB 4EXKA 3FFDA 4PJDA 4FG6D 4U49A 4PB9H 3DSFH 2Q86B 1EBAA 4PLNC 3FFCD 1LO5B 3RUGB 5JXEA 2ICWA 5HGDB 3MYJB 4HF5H 3GM0A 1TJIL 2Y25A 2XKNB 1BQHG 3MMEB 3ARVA 1Q9LB 2Y07L 1KUMA 1MCOH 1JVKA 4BZYA 3BKCH 3SE8H 3TA3C 3VGEA 4Z7OF 3GMPA 2OTUA 2W91A 1DE4A 3I6LE 2EO9A 3MRIB 1DLFH 4CN1A 1A6PA 1INEL 1CLYH 2EDEA 4OM0H 4WUUB 1MCJA 5BS0E 4D2NA 5I74C 5IMKA 3TWCL 1HH9A 4HKJA 1CBVL 2ZG2A 1EEZB 4I48B 1IGIL 5JPMA 4MQXD 4NJ9H 1A6WH 2LAGB 1G7HB 4XPAL 3L7EA 1HKLL 2A1WL 4WHDA 4JHAL 5E8DL 3W9EB 5I2IA 1BIHA 3QJFB 3LZFH 2R69L 3ARYA 1UM4H 4KPHH 1FFRA 2VLRB 2J88H 4AH2B 4XCYB 1FZMA 1KLGB 1Z3GL 3SDXE 5L88L 4LPWA 1CR9H 4XMPL 3I9GH 1NUFA 1HWGB 1G9NH 1N4XL 1BF8A 3MLYL 1A7QH 2HFEB 1RZ7H 1CDIA 5F97E 5TGBA 1NCTA 3GI9L 2HP4A 4GLRH 3VXQA 2NY6D 5JQ6L 3MO1B 3AFLA 3OJMB 4LVHC 4X8JA 4L3CA 4D9LH 5IROA 3U4BL 1IZJA 3MLSH 5EC2B 3SDDB 4FQQA 4HLZG 2E7CA 4XNQB 2YUZA 4NO2A 4QNPE 3L3JB 3A6BH 4I2XB 3ILQC 4KV5E 3RGHA 5C0BD 3LDBC 1MNUL 3WLBB 1J10A 1LK3H 5JHDD 4QNPF 2ITDB 3VXUE 2HFFB 3RIAK 4L8SB 3VRLE 4UT9H 1NEZB 2EIBA 5MENE 1CDCA 1BHGA 5IB2A 1MCBA 3ZE2F 1C7TA 5EC1A 4ZTPH 5I1JH 2JCCB 4I0CC 4I1NB 3ZDZE 1QRNA 1QOKA 3QUMH 5E6IB 5TQ2L 4KXZI 3WYRA 5CSGA 3DMMC 1G7PA 1VB9A 3EO1A 4YHIA 4Z76B 1OB1B 3S96B 1EO7A 4XB7A 4LEOA 5HDOA 4JRXB 1BEYH 4KUZH 2YR3A 4HUNB 4Y1AB 1DQJB 2GTWA 4X9GA 3B5TA 2OL3A 3WIIH 2E8ZA 1WF5A 2HLFC 1SY6H 1BAFH 1YEHL 3O2WH 1I7ZB 4EZMA 5TE4H 2EEAA 4OCRL 3GMRB 1DANT 3BEWA 1G6RB 2NY0C 4I5BA 3LS5L 4LHUG 2CLZB 3VFTB 5ICXA 3LD8C 4RX4A 2K9UA 4LAJH 4NRZB 1NGQH 3V6ZB 4XVSH 4PJBE 4MCZB 4LKXA 5J6HA 2HH0H 3CSBA 4OLWL 5EWIL 4LKCA 3MLXL 2OTWA 5JLZA 2R2BB 1H5BA 5JHDB 1KJMB 1JTOA 5GSVB 3IS0X 3MLSL 3O3BA 3DYMA 2APVA 1JV5A 2PW2A 1HILB 4KJQC 1PZ5B 5JQ6H 4BFBD 4X6EB 3P9MB 1N3NB 1TZGL 3BD4A 4YWGL 1JNNH 3L3DA 4JDZB 2VWEC 1RJYB 3MLYH 3CVIH 1YJDL 4J3SA 4XMPH 3RVUC 4P46C 5IFHL 3CU1A 5A43C 3DUUB 4FFYH 5HYSG 4G8IA 4M8QB 4WHYH 2HN7A 1ZVYA 3CLEH 2P5EB 3C6SA 3VGFA 5DHVB 2C1PA 1IEAB 4XVTL 2DQHH 5J9PB 3OV6A 1V3JA 3C5ZC 4GW1B 1ZT4B 4W4NA 1IARB 4W81A 3DO3A 3VXRA 1A21A 4WWKB 4JJ5B 1IRAY 1CIDA 1Q0YL 3U0PA 3C6LC 4Z7QE 2FHFA 3MRQA 4M61B 2ICWJ 2UYLA 4OM0L 4P4KD 1QO3A 4YC2B 3RVXC 2P42B 5CD5C 6FABL 1S5IH 2AXGA 5I1GH 1JE6A 3FB6A 4KVCL 5HGBA 3SE8L 2WW8A 3HZVA 1YY9D 4GOSA 1W72A 2DBLL 1RZIA 2FWOB 3ARBC 4NKOA 2ORBH 1ZA3B 3OB0H 1CGSL 3DMMD 5E4IA 4V2CB 3TVMD 1T3FB 1CLZL 3BXNB 3OKLB 4AEIH 1ULVA 1JIBA 5HI4C 4N0UE 1NKOA 3ISWA 4IRSB 1RIUH 4U3XA 5E1AB 1OARL 2FRGP 5F6HI 5T3XE 2Q6WB 2OI9C 2PN5A 2YUVA 2PXYA 3MLVL 2PUQT 4EVNB 4OV5A 4HGWB 5LCVH 3B5GA 3QB7C 4AH2A 1NMAL 3BGMB 3BWAB 3QEGL 2AJSL 3GEWB 4M4PA 3QIBD 3FO2B 3BGFB 4MVBC 4I8DA 1V3LA 2W60A 1QKZH 2FYYA 4XXCC 5F9WC 1DL7H 4K3JL 3KGRA 3W81A 5D7KD 5CSBA 4MJIA 2WAHA 3ARDA 3GK8H 2CLRA 1GGIL 4U1MB 1IGYA 2VDPL 3N1FC 2E6PA 1Q94A 1ES0A 1R5VB 2H1PH 1EUUA 32C2A 3QCUH 2FD6L 3ULVD 1G84A 2WLZA 4H1LH 1OGAD 5HHOD 5EORH 1P84K 4MJ4A 3NGBB 1RUKH 1CQKA 4N9GB 4JFDB 5L2JB 1QFWH 4MD5A 1QRND 5J57B 5BO1L 2IALB 3CFKA 5GGRB 3O6LL 3UO1H 3JWNC 1E28B 5BRZA 1L6ZA 3OSKA 2XZAH 1NDMB 4QY8B 2HAZA 4X98A 1Y6KR 4K3EH 3H0TB 2HFFA 1ADQA 3MACH 2DJUA 1T2QL 4XNMB 4WNQB 2HMID 1FVEB 2DQTH 1UVQA 1UWGL 3DUHA 5TDOB 4W4OA 1I1CA 1SJXA 3T0AA 5I73C 2YN3A 2DN7A 2ZWLT 2OCFD 4U1JB 3WNNA 2VXVH 2R0WH 2Q3AA 3HI5H 3ES6A 4PRID 5DFTA 3SDAB 2E27L 4MLSA 3ZTJH 1F4YH 4JRXE 1I8IA 5FUCC 1QACA 5JMOC 2VR9A 5M95B 4UOJA 2CK0H 1GIGH 2NW3A 2PW1B 1RJYA 2NXZC 4HIIA 1KOAA 4F7EA 1E4JA 2P8MB 3L3KA 4MA7L 1JV5B 4KTEL 4RSVA 4GAJH 2OMBA 1DUYA 3MNZB 4RMWA 3CLFL 2J8UF 4NQTA 3RBGA 4XNYL 3U36B 5JHDA 3MOBL 3TYFB 3WXWL 3HKFA 4NHCH 3JZ7A 2MHAB 4QHUA 1KEGL 1XH3A 3UTTD 5C7XL 5SWQB 4WHCA 1SQ2N 1I3UA 2APWA 1RAMA 4DW2L 2FGWH 2LU3A 5HYJD 3I3EA 5FHAH 2F54D 5AG9A 3ARRA 1I7TB 1P1ZA 3QXDA 5DMKA 2AJYH 3QIBC 1HNFA 2DQDL 4MJ5A 1ZLUH 1AI1L 5LGJA 3UAJD 2B7DT 1AXTH 3QA3A 2EH8H 4I0PC 2R2HB 2Z31D 2V5TA 3G08A 4ZS6C 1RVFL 3MROB 5FYKE 3VXRB 5ERWA 2FH8A 3GZKA 3MRKB 2WWMD 4RGNC 5I1CL 3BQUA 2A73A 4XZUB 4GMTL 2HYMA 4Z78A 2C3XA 1BIIA 4QXWA 1KNOA 1XGUB 4OI8A 2F58H 3U79A 4FFVD 3GJFH 4TNVF 4R2GC 2HLAA 1JRHI 4G80B 2E9BA 3QDGE 4LSPL 3P4OA 1FNFA 2QQLL 3CGTA 4LLDA 1A6VH 4HGWA 5DJZA 3O2DA 5IFJB 2E6JA 1NFIA 5IV2B 4JZJB 4R4FL 5MI0C 3SDAD 4NWUH 4M7JL 1I1FA 2VLJA 1EO5A 4Y5VC 1R3LA 1UWEH 4FABL 1F6LL 5F7DA 5C86A 5LWYH 1N7ML 1BVKB 2UZIH 3QIBA 3SJVA 4S1DD 1WC7A 2PO6D 3PV7A 3HPJA 2EXWD 4LK4A 3F62A 3KJ4C 3ULVH 1F3JB 3UTTE 2GI7A 1XF4B 1PLGL 1U0QA 2NYYC 4GO6B 3IVKA 2Y4SA 2GIYA 3QPXL 3VXOA 4MD5B 2P44B 5IW3A 4OQTL 5HHOA 3MNZA 3RWJA 3QDGA 4PRPA 3G04B 3TYFA 4Z7WF 5HI5C 4UNTA 5E94B 2BHZA 4L4VD 1CFVH 3GSQA 4LCCA 1I1YA 2WNGA 3QG7H 1FLTX 4KK5C 4HUKB 4U7SA 2FLRT 1MPAH 1QP1A 3GJEA 4JM2D 5F1NB 1EHAA 4GFTB 3ROOA 5T5FL 2XWTB 4PRAA 3QDJA 1I7UA 3SGDI 5D1XB 3K2MC 2UWEA 4LBEA 1YMMD 3MJ8A 3OKNA 2GFBB 3CFBB 3VGGA 4PS4L 3SDCC 4R8WL 2FJGB 5KW9H 3L5JA 5ENWA 1G6VK 1G7HA 2VISA 2HJLB 3O6FD 1J9CT 2FEDC 4L3EB 4OLXH 4PRIA 1TZHA 5AWNL 2DMBA 1W8NA 3F7VA 3F7RA 4MNQA 5F7YC 1BVZA 1T1XA 1A1OA 1J5OH 1OP9A 3FTGB 3OXRA 1OD9A 5SV4A 1D5MB 1N2RB 5DT1L 1AR1D 3BDXA 4M7ZC 5IB3A 3BRGC 3VD3A 4ZUWA 2P1YA 1HHJA 3H9HA 3IFPB 1QRNE 3QIWA 5FA3B 3QZWG 3HG1B 1GGTA 2P5WE 5FF6A 2ZCLH 3P30H 1MIML 2AK1H 1A9EB 1BM3L 3ET9F 15C8H 2AXFB 2C4FU 2FL5A 2D2OA 2HG5A 3VFMB 1GOGA 1OAXL 5E08L 1C16B 4QOKA 3FB7A 2BHYA 3HAEG 3V5DA 3R4DA 4ZOBA 1BMGA 1DJSA 3NPZB 4LP4A 3V6OE 2W0LA 5I6XC 4JJHA 4NQDA 5E5MB 2MQ0A 2B5IC 4NPYA 4XPTL 2EYSB 2V6HA 4HW6A 3QQ9D 2WUBL 3HUJB 4Z9KB 5KSAA 3UP1A 2NTFB 1FGNL 3RAJL 5FYJD 3TCXA 4CVUA 1UJ3C 2OBGA 2X42A 3GBML 3V79C 1S5HA 5JORB 4LSQL 1P1ZB 3QXDB 4GRMB 1NC2A 1K4DA 3AU1A 3H9YA 1BECA 4HWNA 1FE8L 5FOBB 4HK0A 4DTGL 1U6AL 4ODVL 4EIGB 4APQD 2XRAL 4RFEB 3VXPA 3V9FA 4I18A 3O3EB 1CFTA 3UJTH 4OLEA 1NUGA 4G7VH 3SQBA 1E4KA 3B9KB 2H6PB 5FYLL 3A0OA 5E8NA 2OSLA 5KSBF 4L9LA 3RUGF 2XZZA 1AC0A 3UCRA 4AIOA 5IBUG 4PBXA 3TBWA 2CIIB 3GHEL 4X6CF 4MQTB 1FDLH 3EUUA 1JJUA 2W0FA 4OD3L 1QBBA 4RAUB 3TPUA 3V4UL 1HSBA 4U1SA 1QYGL 3S4SG 4XP9H 1DQQA 2P24B 2HKHL 4YHLH 2VL5A 4JPVL 4MAUH 3U9UB 2KDGA 4HSQA 1Q9WA 2YPLD 3C60D 4IRZL 3KPSE 3BIAX 5CBEB 3QDGB 3VXMB 2YA1A 3MRFB 3MV7D 2LU7A 4GUPB 2EECA 1TNNA 2J8OA 4BH7A 3NOIA 1U91B 1AXTL 1LDSA 3VFGH 1IEHA 3WFEL 1CG9A 1HHKB 1BZ7A 3MRLB 2EDDA 5HI4D 4JO1H 3REVA 1T7WA 2HT3C 1ACYL 2DQDH 2V9TA 4F9LA 3UTSD 5JTWA 3SCMA 3DMMB 2C5DC 1S7VB 3AB0B 3HCVA 3ZE1F 4JQIL 4R90L 1TJGL 2H41A 1N5YH 1MCPL 1T21A 5T1DH 3PHOA 3S5LB 5DURB 4FTVA 1N8ZA 4QWWC 4KJPD 2X4QB 3LN5A 1YEJL 2VXUH 4DW2H 3OKKA 3DROB 2Z31A 5EZIL 4NKDA 3G5ZA 4JHWH 3NZHL 5J9PA 4QTIL 4LCIH 5BOZG 4J3WA 4NHCL 1TZIB 3BKMH 5D93B 1RJLA 1T03L 3P4LA 4QTIH 2VOTA 1DQTA 1GGBH 1I1RA 3P4NB 5IB1B 3X14B 2BHUA 3MRDB 3QEQB 4CMMB 1B2WH 1B4JH 1LEKB 4MA7H 4X6DF 3X3GL 2APTA 3LSOA 2DQJL 3G5XB 1K4CA 2FEEL 2H2PC 3O3AB 4Y19B 3PJSB 1PKQA 3RTQD 4OM1H 1M71B 5EUOB 1B4RA 4PTTB 4Z77A 1N5YL 1DQMH 1DQDL 1GGCL 3BSZL 4RZCB 3MA9L 1K8IB 1V7ML 5DD0H 4APQC 2NY1B 3SGJC 1F4YL 1XCQB 4X0KB 1J8HD 2BOCA 4WY7H 1KC5H 2B39A 3C9NB 2NY1D 4L9LB 1VEOA 4PJEF 4Y5XB 2O61A 1TVHA 1ZAGA 3SE9H 2V5YA 3WLWD 4MAUL 4XT1C 3I2CL 2VXQH 4M8VA 4NT6A 5DC9B 1TVBB 2XIDA 1QYGH 3CVHL 4EI6B 3QRGH 4Y88A 3F7YB 1CF8H 1H0DA 1IAOB 3HE6D 5B38A 5DD5H 2GT9B 1FDLL 1K3ZA 3VXMD 3LS4H 3MV7E 4HG4J 5D5MF 4OZGB 2ENSA 5I71C 4M5ZH 3O2DL 4JKPH 2BSTA 2VQ1B 3C6LB 5DJ2B 4HHAA 4MXWH 4OFVA 3QFJD 1S78C 1WGOA 1U6AH 4DTGH 1D5BB 2V7HA 3ZHDA 5C2UB 4HDIB 2X6MA 4FHBD 4F8TA 2X9YA 2YOCA 1GGIH 4BK5A 3IJYB 2DWEA 4LLYA 4CVWA 4EN3C 3K1DA 2NQCA 1Q38A 2EDRA 4H5SB 3JWOC 1DL7L 4K3JH 4LSQH 2J2ZA 1A0QH 4HT1L 2JJTA 1MCCA 2H8PA 3NCBB 3BVNB 4HCRL 4GAGH 3TBWB 1XF2B 4YZFE 4JKKA 1TZIA 2A6KB 4F9PC 3MLVH 3JV0A 4XHJC 3BKJL 2GK2A 1YN6A 5L8KB 4U1NB 2KPNA 1DP0A 2FX7H 1TETH 4NC1C 4AENA 2CSPA 1DEEB 1OAQL 3DIFA 4KRPB 5ICYB 4QTHA 4AYFA 2VLMD 3ZO0A 1T04A 3BN9C 3L5XL 1MFBL 2F54A 5JNYA 4BFEA 3WFBH 1ZT7A 1W72B 5IB5B 3LKOB 4L4TD 3OR7A 1BM3H 4HKBB 4PJIA 3BD3A 1UENA 2IEPA 4ZO9A 5TF0A 1XZ0B 3N1QC 4PJ7F 1LVEA 4I2XA 4BSVB 2NY3B 5F44A 4NQSB 1MWAA 5CGYD 3ZE0F 3D3VE 1KTRL 3N50A 1TQBB 4P9MH 1YYLH 1T7XA 4YPGA 4NQDD 4UV7L 4KGLA 5JOEA 5L7XH 1HN1A 2AABL 2BC4B 3MRFA 1OGAE 1VSCA 4J7RA 1XIWA 4Y4FA 3B4NA 3CFDA 4IOFD 4LCCC 3WEXB 4ZTOH 1JL8A 5HHQA 5IG7B 4YHYB 4OZGE 5A2LH 3R06A 2ICCA 1FVCA 5KW9L 4HIHA 4R8WH 1J86A 4F80A 3DVIA 2CKBH 3IXAA 5FM5O 1ADQH 5FYJU 1LMKA 3WHXB 1S7VA 1S7TA 1KLFA 3LEYL 4GRWB 1QFUH 1MIEL 4P9HC 4EUPB 1Q72H 1TQCB 3I6LD 5IHLB 4ZUUA 1FCGA 2P5WA 5SWZD 5IKCB 4BH8B 3UYRH 1NKRA 2NNAB 4N9GA 5IFHH 1P6AB 4X83A 2OL3B 4PG9B 5JIKA 3CVIL 1DVFC 5HHPB 4LSSH 4YWGH 5IQ7L 3QG7L 3LN5B 3HAEA 1MCWM 4AQ1B 5FM4A 1IKNC 1Q0XL 2OJZH 1MJJA 1HH6A 5FECA 2UWEF 3MSPA 5DR5L 4M6OH 3AREA 5JUEL 2AKRA 1J1OH 4KY1L 2VNCA 4FA8A 1TENA 3PWPA 2R2BA 2OK0L 5I1IH 5TH2B 1T0NA 3PABB 4NFCA 1EERB 1P5VA 2D7PA 1MCDA 1PLGH 1S7WA 3VFRB 4N8VB 5DD3H 4JZNA 1I7RA 3EKCA 2VAAA 2VTFA 4NCC1 4OCRH 1MAKA 2EO1A 1F4WH 2D4DA 3MODL 1BAFL 1YEHH 2I9TB 1SY6L 3PWPD 1T83C 4Y5YA 3BJ91 5EIVA 5CZVL 4Y5XA 5LWYL 4HV8A 2VLKB 4LAQL 2EH7L 4QYOB 4YAQB 2OMNA 5B3JE 1BEYL 4XP5H 5C0EA 2W0KA 2XI9A 1I3VA 2QQLH 1KPVA 1AJ7H 4HWEH 4WU5B 3STZA 1J8HB 1J0KA 1JGLL 4I13B 2F58L 4WI9A 2VYRE 3CXDH 4C56B 1FIGL 1ZT4A 2Q8BL 4AMKL 3O0RL 2HRPH 4FZEH 3BKYH 2H26A 4LLYB 1QEWA 4LLWB 3ARPA 3HMXL 4MAYB 5IOPB 2CH8A 3FKUS 4O51B 3HAEH 4XCEB 1JGEB 3NFNB 1ETZA 3MYZA 1FL6B 3QISA 2A77L 5B8CC 3UYPA 1NCDH 5C0AD 2E7MA 1ZLWH 2R4SL 3BPLB 3ULUH 2QSCH 1RUQL 3FRUA 5MEOA 2GJ6E 2DMCA 2HJFB 5GGSY 5DJAB 2FGZA 2XA3A 3KWWA 5HTSA 2M26A 4HWBL 2MTPA 2FGWL 5IUSA 2P7TB 1A7QL 1JRHL 2OP4H 4FQ1L 2WUCH 1KBGL 2ZUWA 4QO1A 1YN6B 2R0ZL 1FC1A 2R0KH 3VXSB 4OFIA 4XRCA 4AIZB 4PJHF 3ILPA 3LEXB 1J0ZA 4MNQB 1I3GH 1U42A 5E4EB 3GUTA 1MUJB 4PJ8C 4WO4C 4HXBL 2R69H 1X5JA 2KL6A 1G0YR 5ICZB 3TT1H 5E8DH 1BLNA 3JV4A 3RDTD 4ZFFB 4MZ3A 4D0BA 1KCLA 3AS0A 2AV7A 4O2CB 5DFVC 1TLKA 1BWWA 5FF6B 3UYOD 4RAVA 3WN5C 2W0PA 3KVQA 1EXUA 5FDYA 3R06B 1YPZB 3VE0B 1J05A 3H3PH 3KHOA 4JO2L 3H9SE 1JNLL 3EO0A 4M1DH 2E7LC 3LKSA 4NWTH 4KI1A 5E00B 1IAMA 1QZ1A 2BVPB 1IC5H 1NL0L 4S2SB 5E8EB 5IVXF 4HS6B 3KLAB 4HIJB 3PIQA 2F74A 4HIEA 1MRDL 1MFNA 2DTSA 2X4RA 4P4KC 1MCOL 2FR4B 2LFGA 4KAQH 1HQ4A 3MMEA 2Z93A 3QI9B 4ZS6D 4XGZA 5J89A 1ROWA 2ADGB 4NQEB 4PJXA 5K9KA 4U1HA 5B39A 3TBVB 1RURL 4P46A 5ACZB 4A2LA 4ONOA 4DK6A 3IXAB 1LNUA 4Q6IA 4ZOAA 2B2XL 3FRPG 3OAYH 4KTDH 3U6RA 1G9NC 4MD0A 1B0GB 1X9QA 1C5CL 5IGXL 3FOLB 4WI4A 1EMTH 3PDGA 2I9LA 4U2YA 5F72S 2X89A 4OTXH 3RX8A 1JZ4A 3JTTA 2UWEE 3VJ6A 4UIMA 5HVHC 1OAZL 3MPCA 4YH6A 3WL9A 3K7UA 1B0WA 3IXTA 2VDPH 3DGGB 4MJ2A 3BAEH 2B20A 2DB8A 3KPLA 5DJ0A 2NYYD 1FG9C 4M93C 3T0EE 1JYXA 5D1ZC 4PRIB 2VLRA 1LDPL 4V1DE 2W0FB 2QTEA 1N64L 1RZJH 5I18L 1KG0A 2Q3ZA 3M17B 3NCMA 4WDIB 3BH8B 3AMLA 3E6FA 5F7NC 3U36A 2WP3O 4UOW1 4DOHE 1OARH 3KLHD 1AHWA 4U6TA 4KK8D 1GZPB 3CC5B 4YDVA 1RIUL 1EDQA 3S88L 5AYUH 4N8VA 1YQ2A 1KIPA 5LGHH 3VFUA 5D2LE 4UNVA 1MF2L 3IAPA 3WHE0 5KOMC 4G7YH 1P4IL 5JDSA 2JJWA 2IG2H 3QIUD 3GSVB 1Z9LA 5D1QC 3SO3C 4M43H 4ZAKB 4W6YB 1FZJA 1J05B 1YNLL 1KELH 1GZQA 2CKNA 5F1KC 5F7HA 3VWKC 3C6LD 5SX4H 1KEML 2NY2C 1TJHL 1U8MB 4ONHB 4UDUB 4PJHB 3KYKH 1RU9H 4G6ML 4NRYA 5IB2B 5KSAB 5ELIA 2MKLC 3G5YA 4D8PA 1MRFL 4OLUH 5CBEA 3OG4B 3TN0C 3DTXA 2HKFL 4XP6L 5IROC 5I1AB 3ESUF 3GNMH 3UTSE 1HHGB 1S3KH 3MGOA 1QLFA 5ALCH 2R23B 2CIKA 1AE6H 1UADC 5F7EH 3CLEL 1I8MA 1U2HA 2UUDK 1NMBL 1PKQB 4WENB 1BJ1H 1YC7A 4POZC 3UJJH 5DHYB 2F8XC 1YMHA 1MHPL 4FFYL 4ZSOA 4KVNH 4OUUB 3KPMB 5I1HH 1OP5K 3REWB 1KENL 4LHQB 4EQ2A 3RIFF 3QNXB 2FIKB 1G1CA 3QSKB 3K3QA 3KXFA 1HSAA 3LEXA 4IMLB 4KZDL 1MCNA 4Z7VA 3BP4A 1HCVA 2XZCL 2Y36L 3NFSH 3INUH 3IDNB 4N0RA 3ZDXF 4E41B 5C0NC 1ZTXL 1OAYH 4MXVF 4QRRB 3TYGH 4HJ0D 2H32H 3MLRL 3QUYA 5F70A 1KXVC 1P7HL 1KTDA 1WAAE 3R0NA 2F74B 2WINB 4X6CE 3MLXH 3T2QA 4OT1L 4WDIA 4QHLA 4Y16D 4PY7B 4XVSL 1PFCA 1NGQL 4GXUN 3QO1B 2CR6A 3LS5H 4AZ8A 1UXSB 3R8BB 4N0YL 4RGMC 5K9KB 4OZIF 3O2WL 2ZPKL 3QCVH 4M3KB 3VRLF 3WO4B 1MQKH 5F1NA 1NMCB 3BRDA 1CE6B 5J56B 1X3DA 3MV8B 3BRFA 2BNRD 5D1QD 5IW1B 3MLUH 4YGVB 3RZWA 1MJ7H 1IEAA 5F9OL 4ODXB 2A6IA 3JVGC 4LEXH 5E8EA 1R5WA 5I8KL 4KROD 3QUML 1B88A 2QQKL 1TCRB 1CXKA 3QFDA 4PFEA 3R0MA 2F5AH 1B9ZA 4FTVD 3VXRE 4M48H 3QEHB 4MCZA 5ACZA 1ZA6B 3HNVL 43C9B 2YD3A 5C07E 1LNUB 1QD0A 2ADGA 4UT9L 4Q6IC 1A1OB 3AVEA 3ZE2E 3C5ZD 3OHXB 4OQTA 3LQAL 1PYWA 1KCUH 1CDBA 1T22B 3TBVA 3SGKC 4P9HH 3M8OH 1CN4A 1LK3L 4OJFH 1K2DB 1XGTA 1DFBH 1PZ5A 3FN0L 4RBPK 1ZLSL 1UH3A 2VDKH 1A6UL 4NC2B 4U0RC 2PO6C 2BSSB 4FQJH 1P5UA 5DRXA 5EUKA 2BRRL 2BVQB 2OL3L 1AHWB 4X4YB 5C08A 5ERWB 4L8BA 2AJZA 5KN5A 1QSFD 3U4BH 4D9LL 4G6JH 3TP4A 1IM9D 4YE4L 3WDIA 3D3VD 1KJ3L 3FB7B 1ZHBA 4GLRI 3LKRB 3LKOA 2IH3B 4N5EC 1JMXA 5CSZB 2KZ1B 3ARUA 3BP5A 3B2UD 5FXCH 4PJ8A 5IESL 4KJWC 4HKZB 2CDGA 4POZD 3IFNL 2D7TH 3HE7B 1LEGA 3NCCB 1FN4B 1G7LB 2O5ZL 5FYKH 5DQDH 5F3BB 4LHUD 3SDDD 3ME0A 3VRIB 4OUOA 2I07B 3VFSB 1INQA 4G8EB 3IU3B 3ALPA 3L3IB 1N3NA 4Y5YC 2BC4A 4PJEE 1P4LA 3BZEB 3WUWB 3B5HA 3CFDB 3L1OL 3WEXA 2ID5A 4Z7UE 1P7QA 5CZXD 3QYCA 3GB7B 3BH9A 4ODHH 5DJXA 2F8VA 3AMKA 5HYJA 3MCLL 4QF1A 1R3KA 35C8L 3EYQD 3RTQA 1JBJA 4GBXD 1UEYA 3CFJB 3ARTA 1KIRB 2B4CC 3PP3K 3MLZH 2HT4C 4I2XE 5A16A 4NKMB 4S11A 1EFXB 3QT2A 3AY4A 5JXEC 3N0PB 3U83A 4GKSA 4JFFD 1I8MB 2ATPB 5GJTH 5DDHB 4PJCB 1I9EA 5BV7B 5ID1B 1YECL 4PIRF 2F53A 4NRXA 2NTSP 4UU9A 1LILA 4HLZH 4DOHB 3P0YH 1RK0A 1PY4A 5CEYB 3QCTH 4H88L 4G6FB 1TJIH 3TA3B 3VG9C 1NEUA 3NCYP 4P2OD 3EJYC 5BVJB 3TZVD 3GHBH 3S4SA 5D5MB 4NM4H 4X9FA 4KKLD 4ODUB 1N59A 3UBXI 4HUVB 3GSWB 4X7DC 2W60B 2XA8L 3QUZD 1DBAL 3RIAF 4ZNEE 3QEUA 5EO1B 1NFDB 5E2TL 1TTUA 1KJ3H 4QTHB 1NLDH 4M7KH 4M5YH 2DKSA 4WW2A 1RIHL 1E6JH 3UPCA 4QKXB 5DSCA 1DSFH 4WFHE 5L2KB 3PQYB 2VABA 4YBQD 3C8HA 3F6IA 1MCSA 1PQZB 5E6IC 3IDNA 1ZLSH 3B9EA 4UV4L 2RCSL 4UB0L 5DJDA 5CILL 1F6AB 4JRYE 1D5IH 3M8OL 4P9HL 3BO8B 1T1XB 3DXAD 4E41D 3KPQB 5SX5H 3BP5B 3DNKA 3LQAH 4NZDA 3OTTA 2YD7A 4MLIA 4JY6A 2GY7B 4WUUD 1M7IA 4LMQI 1C1EL 3ZKMD 2X89D 4PGCA 2VMFA 4QHUB 4TTGA 1OAKL 4YBLC 3VFRA 1P4BH 3EO9H 3SOBL 1I9IL 4ZUVB 1T0MB 3GBNL 3P4NA 1ZE3C 1MCQA 5F3HA 5IB1A 1JPSH 3VRJB 5FGCE 1RQ5A 4WUUA 2YD8A 1UCBL 4GG8A 4RCAA 1EEYA 1FRGL 1GOFA 3SDDC 4Y89A 2HWZL 1BOGA 4EI5A 1P2CB 2ZPKH 3ILQD 3VW3H 1K2DA 1XGTB 3F58L 1FNGA 4BFIA 4FXLA 5GGSB 1NDMA 4JFXA 2C3GA 3HUJA 1A14H 2M1KA 3K4DA 4S1RH 2MSPA 1WLHA 1N6UA 1FAIH 2DOCA 3LRHA 3ULUF 4L29B 4OT1H 1OD7A 2XTJB 5F9DC 5GGVH 4BSWA 1UXWA 1FVEA 1X44A 2HTKC 4U33A 2FLBT 4F7MA 5I17B 1SJHB 1OAYL 4NO0D 4F7TA 5C0JB 4WFHD 1MCEA 1NGPL 5BVJA 4HUXB 4N0FB 3NTCL 4TSBL 4FQXC 1WT5A 4ONFH 2FIRT 5ICZA 4HFUL 3VXQB 2YKLL 4K7PH 1I7RB 4GXVL 3T65B 4M02A 3LRSA 2D3VA 4PJDF 1WFOA 2YA2A 4KVNL 2AGJL 3QXAA 4YK4C 5LAXA 3K46A 2VABB 4PJAA 3QRFM 2LTQC 4P2RB 4M3JA 5FKAB 4RDQG 3GNML 3NTCH 3BPLC 4YXKL 2HKFH 4WFFE 4XP6H 1XGPA 3D39E 2YD5A 3ARGA 2XFXA 2FECL 3BQUB 4XZUA 2FX8H 5EN2A 5B3JF 4JDVB 5EZOL 2AJ3B 1VESA 4NM8L 5ITBH 3AXLA 2AI0H 4K2UL 1BFVH 4XCNB 4PJCF 3BVNA 3SHSA 5F89B 4ZDHA 1W2KT 2Z91A 4XCEA 4P46B 3MLWH 4PLKD 4R4NC 3HLAA 5D7JD 2VUOA 2AQ1A 1S7XB 3ULVE 5C2BL 3MJ9H 5A2KH 1F11B 1G9EA 4JRYA 4KROB 4R7DA 2RAMA 2IPUK 5D70H 1P4IH 1VGEH 3U46A 4P2OA 4P5MB 4L8CB 3DECA 1MF2H 3SKJH 1UCBH 4KDVA 2Q8AL 3ZSSA 1FYTA 5EFIB 5DFVD 3T1FB 1PKOA 2EDYA 1I9JL 2NY3D 3S88H 1PG7X 2GY5A 2B0SH 4LKXB 2BSED 4Y2DC 3MLPA 4DGYL 4HQQH 1JZ2A 1F3JA 2WBJD 4QXTA 4HK3J 1H5BB 2FJHA 1MH5B 2EC8A 4FG6C 3KPLB 4GKNA 5DJ0B 2Y23A 2XZQL 5CIPB 4WV1A 1NAKL 3QEUB 1N64H 5E95B 5DVMA 1HHJB 4R2GB 1TMCB 1IGMH 3GRWH 1XIWB 4P23B 1QSED 3GSWA 1FNAA 3NIFF 3WS6A 5CILH 2G75B 1BLNB 3JV4B 4ZFFA 1B0GA 3QUXC 3CU7A 3PGDA 2K3TA 2A9MH 3HZMA 4OTXL 1NCWL 3ZL4H 1P7QD 2HFTA 4PUBH 1O7VA 4ODSL 1RIHH 3VI3E 5CBAA 2OTWB 3GJFB 3WXVL 3H9SA 3HC4H 1IGCL 3OGOE 4P3DB 1FH5H 4MB4A 1LP9A 2X4OB 3GM8A 1T1YB 4OFDA 3VMNA 3S35X 4KC3B 1HK6A 5JPNB 3MJ8B 4C54A 4TTDD 3BO8A 3VI3F 3ARXA 2NTFA 2XTLA 3KPSA 3U0TA 3SDXB 3QQ4B 3D3VA 4KAQL 5FDWB 5I9QB 1JN6B 4HS3A 5K9JH 5IBLD 3TJHD 4TPRH 5C07B 5KS9A 4C57C 2OLDA 5D7SL 3WFCH 4LEOB 5TFSH 2BSTB 5EOCH 4RMTA 4M93B 5DQ9A 2ADJA 2QADD 5C0CA 5FO8B 5JHLH 5MEQB 3UBXG 1F3DH 5GS1A 1TVDA 4NP4L 3VWJD 3EDEA 1U8OB 1I8LA 3NACH 2O5YL 3S34L 2W9EL 3OKNB 4RFNB 1F11A 2FATL 1PJ9A 2AXGB 1OLLA 3NA9H 1KULA 4GJTB 4JCLA 4I5BB 1NLBL 2A83B 1BZ9A 4U4BA 1AGDA 3MCLH 3REWA 1AY1L 3LN4B 1MRCL 3LQZA 4MDJA 3RL1B 1GAFH 3H7BA 1L9MA 4UTBL 2D0FA 5KAQG 3OKLA 1DEDA 4JG1L 4OF8A 1MHCB 1AGEA 1RZFL 5HI3C 3RVVC 1AP2B 3IFNH 2KH2B 1K85A 2XV6B 2OP4L 5J6GB 5IESH 4G6KH 1YNKL 2IFFH 2FWOA 2LVCA 2R56L 2YC1B 4ZQKA 5CS7A 1GZPA 2Z4QA 5MP6H 3OKMB 5H35A 4LSRL 1RK1A 2ARJQ 1RUQH 2EKSB 3MGTA 1CYGA 3QAZC 3C60C 2AJUL 5E1AA 5IVOA 2IAMA 2WBWB 5DEZA 4BK4A 4Z7VE 4C83A 2NXZD 2R4SH 3L95B 5HDQH 4UOW0 2VL4A 2UY6A 4PJIE 1ZVSB 4HPOH 1DFBL 4JO3H 1PW3A 5D2LF 1P53A 4X6FA 4GW1A 3N85L 2OSLB 4QY8A 2Z31B 4JFDA 2E9WA 4LCUB 3U46B 1T0PB 1UKTA 4MQXC 4D3CH 5FO7B 1MCIA 4CJ1A 1MFDH 2PCPB 4FZEL 4FQ2L 2XY1A 5TQ0L 3CXDL 3NCFB 4FS0A 1WAAF 1UJ3B 5JW4R 2MQCA 5TPWL 3QO1A 3HHRB 5E2VL 3ZTNH 3BZ4B 3BZDA 2Z0BA 1AJ7L 5HGAA 5TE6L 4OLZL 4CJ0A 4TTDC 3MV9B 4OAWB 5D7IA 4ZDHB 3GMNA 4MWFA 4XP5L 5FAAA 3MLUL 1N0XL 1XF5B 5IMMB 4LAQH 5DQ9B 5DO2D 3RBSA 5BS0A 2ADIB 1MHEB 2UUDH 3O4OB 5EU5A 3PDDA 3Q48A 4KKNA 2JB6A 3NA4A 1LE9B 2EZ0C 1D6EA 1EK3A 3B9KC 4I4WB 3TBTB 4J4PA 1VFOA 3KXFB 3IJSA 2E7LA 4RWYL 3NCJL 1YYMH 4WW2F 3CDFA 3VA6A 4U1IB 3DRQB 2YHGA 4CMHB 1BJMA 5FUZL 1T5XB 4KKLC 4POYA 5IK3B 2X4OA 1EVTC 1KN4H 3FN9A 1QG3A 3VFOA 4BFGA 4Q9BA 3WIFB 4G5ZL 1Q0XH 3TN0D 3MYJA 2XZCH 4B0MM 5MENB 4WEBH 5D9SB 4CU7A 3C87A 3H2WA 2C1OA 3U30C 1E0OB 5B39G 1NC4B 5DRZB 4KHXH 4G42A 4HHAB 2V5MA 2DQUH 1CFQA 5GRUH 4NUJB 1KN2H 4Q6IB 3BP6B 5T3ZH 4NN5C 3WJJA 4K23H 4WCYL 1JF6A 4J4PC 4PJBF 1FAKT 1BQLL 4Z7WA 1QNZL 3WFHA 3LEYH 2DBJA 1AE6L 1UWXK 2JK5A 1FIEA 4G9FE 4UQ3A 5I8EB 3IDYB 1S3KL 4OZFG 3RPKA 1JPTH 2AEWA 5B4MC 1HH9B 5GQBA 2EDXA 4MSWA 4R0LB 4TSAH 1IM3A 3NFPB 4LCYA 1GVIA 1MRFH 1QEWB 3O6ML 1UVQB 1P84J 1P7QB 3BPCB 3W9EA 2VIRB 4QOKD 1IFHH 1Z2KA 1JHTA 1ZHNA 1TJHH 4Z7UF 5D7JC 4JFQB 1QRNB 3KPRE 4KRPD 1INDH 4HZAA 1EHNA 4XPHH 1KFAL 4ETYA 4AEHH 1VCAA 1P7KA 3W5MA 5DZOA 1XR9A 5H2BA 4JDTH 4O9HL 5D7IB 2DLIA 1YNLH 5HBBA 1QLEL 2ENYA 5JR1L 1DVFA 3JV6A 2NY5L 1AO7A 3WFBL 2IG2L 5KSAD 1Q1JH 3Q6GH 4JFDE 5CKAA 4F15C 2X4PA 2EICA 2J8UA 4CUCA 5HYQB 4QRTA 4L4TE 5ABDE 1OAQH 5GHWH 1OTUC 1CDJA 3ULUE 2FX7L 3ULUC 2JKXA 1AP2A 3FQUB 2VN7A 3IU4H 4PJ7E 5IHUH 1D6VH 5KSBE 4LSUL 3ZE0E 1LWRA 5I18H 4MB3A 3OKMA 4M6AA 2IADA 5GSRA 5J6GA 4LHJB 4PLJC 4O02L 4PR5B 4GQPH 3D2UA 4D9RD 1IAIH 1XCTB 4QXGL 4ZQKB 2QL1A 2GAZA 2HVJA 4JB9L 5IQ9A 2YPLB 4JDZA 4YXHL 2MCPL 5CJ5A 3SGKA 1QUNA 4K7FB 5BZWB 3STLB 2RR3A 1WVZA 3LN9A 4ZFZB 4X6FB 3JTSA 5DJDB 3BPOC 3MROA 4MJID 5IBTH 5IHUL 5GRWA 1T4KB 4TNWF 5D1XA 5IP4A 3LS4L 4Y8AA 1RURH 4PGCB 3CSYA 1NANH 5HGAB 1NEZG 2X5PA 3MJ9A 1Q1JL 3Q6GL 4HCRA 1H3PH 3QPQC 3KYMB 1JNHA 1WIPA 1QFPA 2N56A 1FBIH 4HGMA 3KG5A 5H37H 5KVFL 3EOAA 3WE6A 2DQFB 3RNQA 4Z5RA 2F19H 1AD9B 2PYEA 3HG1A 4AEHL 4IMKA 2VLJB 1QSVA 1KC5L 1RJZA 3O3BB 1XGRB 1RZ8A 3QEQD 4M1DL 4ZUWB 4G9FA 3D9AL 3WNPA 3QWRA 5EIIB 3QDGD 2VH5H 5DD0L 1V7MH 3S7GA 3IYLW 2P5EE 2HJLA 3ZYOA 3PQYA 1VKXA 4NN7B 4TSAL 3OBAA 3UZEA 1DQDH 4IDLA 4M1GH 3LEVH 3PWJB 3KJ6H 5CGTA 2V5SA 1K6QL 5K93A 1IBGL 5D7LE 1XGQB 4C4KO 4K71C 3TT1L 1EVUA 1I1AD 2VDLH 5DLMH 4XWOD 4HXBH 3RVWC 1TQBC 5FYKD 1U8LB 2JB5H 3O8XD 3VDBA 5FO9B 3AM8A 4YLQT 2NXYC 5BCAA 2DQUL 2HT2C 5ALBH 4LCCB 1HILA 4FQ1H 3NIFE 1OTTD 4GRMA 4B7IA 3QWOA 4YNYB 2IAMC 4NZTH 3MV7B 2YUWA 4NZJA 5D9SA 2YPLE 4GKZA 4NHUA 4QGTA 1OOAA 1EO8L 3S6CA 2YMXH 3MBEA 1QSEA 2AJVH 1HXYA 4G5ZH 1LD9A 3G6JF 5AAMA 2WK2A 3NPSC 5DA0B 5GZND 1XAUA 3D85B 1ITBB 3N1PC 3EDFA 4JN1H 2EE9A 3TH2T 1DQLL 2NY0D 1H3UA 5TE7L 4ESKA 4EIZC 5AD0A 3O11B 1A7RH 1XR8A 2DTML 4Z95H 5L2JA 1CDUA 3GSOB 4KDTC 1JZ7A 1HHIB 1DVFB 4NKQB 4CAGA 5ADOL 4PJ7B 4NYLA 2WIMA 4J3UA 4HJJL 4MYWB 5DQJA 4AG4H 1IC7L 4IBLT 4UT6L 3IDXL 1FIGH 2MQ3A 2VC2H 1JGLH 2ZSVB 2IC2A 4HWEL 1N0XH 3CMOL 2ZOKA 4IIQC 2HVKB 4EVNA 1S7XA 4O58L 3QUKA 3RA7L 1S7UA 3KDMA 2X4SA 4OFKA 4OLZH 1FNSH 1J8KA 2FSEA 3BW9A 4XX1G 4CNIA 3PGCA 1NGZB 1CICA 3G6DL 1HHKA 4P4KA 5TPWH 4E42B 2FCBA 5FYJE 4JY4B 1FZKB 4X9IA 3S37L 4XVJL 3FT3B 4FQ2H 2OXHA 3T1FA 3UJTL 4U1MA 4F9LC 25C8H 3V8OA 1ZA3A 1MFDL 4DKAA 1VGKB 2YUXA 4ODVH 4DVBA 4Z7VB 4BH7B 1L0YA 2HFGH 3K4ZA 1FE8H 5D72L 2X4QA 3N85H 4PJAE 1MI5B 4WU5A 5GGTH 5FGBA 5K9QG 5DJAA 1OAUH 2VDML 2E5EA 3LVEA 5TJWK 3DMMA 1Q9WB 3HCVB 4JGMA 4L3ED 5HDQL 2Q86A 3O4LB 3T4YA 4ELMF 3GBMH 5CP3A 1J1OL 3GMLA 5F71A 2AJUH 1BBJB 4HWZA 3CX5K 3TBSB 2L7JA 4DUXA 4KHTH 3AXLB 3KYAA 3HNSH 4P5KA 4NCC2 1SJEA 3FQTA 4ZPTA 4XPTH 5FGSA 3LD8B 4G6KL 1WWWX 2CO7B 3MFFB 32C2B 2A0LC 3PHOB 3UYRL 4ZPVB 4TUOB 4ODWA 4QT5B 5F88B 3X3FH 1CDHA 1OAXH 2IMMA 3WHE1 1FLRH 1LEIA 3HE7D 2IPKB 2IPUG 3CFKB 1GAFL 4YHYC 4HEME 2CIIA 2W9DH 4EN3B 1OM3H 1FYTE 4JR9L 3WS3A 4NNPL 3ZKNC 3D3VB 1NLBH 3TVMB 4PRHA 3VD9A 2OI9B 1RZKC 4RIRB 4YXLH 4Y19A 2CRMA 1G6RH 5DRNB 3RWDB 4KV5F 1T22A 3S3SA 4Y0GA 5EBMB 1YYLL 4XP1H 5T33L 4P9ML 5DUML 4OIAA 1B90A 5EOTA 3QI9A 5C0AE 1DUYB 1P69B 5EOCL 3T8XB 2BOBB 4WW1B 2DQEL 2YN5A 4NFBA 3RY6C 1RIVL 1ORQB 2DI7A 2YSSB 1M7XA 4LVHB 3C5ZB 5KTEH 5TGBB 1IQWH 4HIIB 4PJEB 4FP8H 4UTAL 5TDNA 2FSEB 3EYVB 3FN3A 4RRPG 3FQNB 4WO4A 3UEZA 3EYSH 4RMVA 3FQRB 1FG2B 3CDYA 3QUMA 4K94C 4FXGB 5CMAB 5T1KD 4UT7H 3T3ME 2Z92B 1WFUA 1S9VA 1WIOA 2X9XA 1J0IA 3HE6C 4KZEH 5D2NE 5EULV 2P5ED 2ZCHH 3S5LG 4XNXH 3QR2A 2R2HA 4YO0A 4JKMA 4Z8FL 5I19H 1UACH 3MV7A 3UPRA 4XCCH 4FQIH 2NY4C 3ARBB 2GUOA 3ZL4L 4OB5L 3HB3D 2JCCA 1F4XL 1AQKL 5E6IA 2V2WB 1I75A 3OZ9L 1GGYA 3RX7A 1NFDF 2BERA 3NH7L 4GW4B 4GRLB 4X7TB 4NKMA 2BNUB 5IWLC 2F54B 3BOVA 4P99A 4MXWL 2XZQH 1S9XB 5IMKB 3WDJA 2LABA 3PXJA 2H2SC 2G9HA 4QT5A 1G0XA 1NFDE 3WFDL 3O2DH 2GJ6D 3QA3B 4M5ZL 5JDSB 4MAYC 2P46B 5F8QC 2NY0B 1AFVH 1X5FA 3O3DA 4G6FD 1FNEA 2LE9A 1L4IA 4CDGC 1SEQL 3D18B 2A6KA 4XC1H 3RNKA 1LO4L 1RHHB 1IAIM 4KRLB 3V6ZA 3EHBD 3VI4F 3HPJB 4MNQE 4TUJB 2AJXH 3DRQA 1ZWIB 4ODUA 3DHMA 3MJ9L 4PBWD 4YHKH 3SE9L 1Q9KA 1QQDB 5J13B 4GMTH 3VXOB 1EH9A 1ZEAL 3O4LA 3T4YB 2ICES 2XPGA 2HT4D 1X5KA 3DTXB 4OCYL 4MDIB 4P57B 3DVNA 1UT9A 2ZNXA 1N0LA 1T66D 2ZP0T 1YPZE 3QIBB 3RJDA 4X5XB 1T83A 4JFPA 4WO4B 4PG9A 2N4IA 4W4OC 3DVGA 3EZ8A 1ZANL 5FHAL 2MOVA 2P49B 2DQJH 3QQ3A 4IOFC 4NO0B 1O7SA 4RMUA 4ZUUB 1A02N 4H1LB 1IKNA 4UI2A 3X3GH 1B2WL 1B4JL 3QNXA 1WTGT 2NXYD 2NY2B 5DYOB 2CXKA 2XKUA 2JTDA 4MA8H 3SKOB 4CKVX 1GGBL 2PO6A 5CHNB 1BQHB 1MCWW 2W65B 2DM3A 5J12C 1BGXH 2EDBA 3FCTA 4NQEE 1QBMH 3WXWH 1VACB 3D39A 1HHHA 2QSTA 3HAEB 5JQHC 3CLFH 4JHWL 3GSXB 4YGAB 4GXVH 4KK9D 3RZCC 5IMOA 5CIPA 4KTEH 1QVOA 1QSFB 3T3PF 1E27B 3FZUC 1EEYB 1YEJH 2VXUL 3T2OA 3FTGA 4FQHA 3GMNB 4QLRA 5T1DL 3RVXD 4KMLB 4G9DA 1MCRA 1VA9A 3G5VB 5DTFA 1ZHKB 5GIRB 5ESVA 1C5BH 5M7QA 4K9EH 1WBXA 1MVUA 1VPOL 3JV5A 3HZVB 1VDGA 2VLRD 5GGVL 3LMJL 3T0ED 5MEPA 3CX2A 2D7MA 5HGHB 2YZ1A 2YSSA 4OCXL 4K8RD 2R29L 3BEWB 3DLQR 5C0EB 3HR5B 4LGPB 3DX6B 3H9SB 4X4ME 3LKQA 1S7QB 3WKNA 4XWGH 4IOSD 1UWGH 4OSUH 3MRQB 3F58H 4YAQA 1ZT1A 4FXGA 5CMAA 3QIWB 4J4PD 5F96H 3GO1H 5HHOE 2F5BL 3DPBA 5CJBA 3HMXA 4RIRA 3RZCA 4NPYB 3L3GB 4XP9L 1HYSC 1AIFB 1KYOK 3OL2A 3KPSB 4TSCL 3GIZL 4X7SH 5CCKL 4U3CA 1KB5L 4H25A 5JIPA 3QQ4A 3MC0A 1UXSA 4Z7UA 5CP3H 3V5DB 4C56A 3G6AA 3GBNH 4HJGA 3F5WB 1XF3B 5IHZA 1YEGL 2BY2A 2UZYB 5JORA 3D48R 5C07D 4WGWB 4ZFGL 5IHBA 1KCSL 5EU3A 5B22A 1I85C 5DO2C 3NGBC 3M07A 4MB5A 3OKOB 3DUSA 4PJAB 4Q9CA 4M62H 5FO8A 3EYUL 4X8XA 5DMYA 1SBBA 3TO2B 5C09D 1NBQA 1U8QB 4EKXA 2FEDD 1A8JH 3Q1SL 3GK8L 4KTYA 2A6JB 4MHHG 1M7DB 1NDGB 3JWOH 5FK9A 2Z8WC 1T7ZA 4KUCD 5HDLA 1E6JL 3QUZB 3QIUA 1FN4A 1GXEA 3IETA 5E2TH 5C8JA 5CEXB 4JFQA 1IC4L 2XA8H 5L8LB 3BZEA 4RBPH 4LPYA 1QR1B 3U9UA 4ISVA 3PJSA 5HGBB 4DKFH 4IS6A 4I18B 1NC2D 1XGRA 3A6OA 2P7TA 1ZHKA 1E4XH 5GIRA 4WWKD 3TN0B 1B6UA 4YX2L 3UC0L 2PXYC 2AK1L 1MIMH 2XYCA 4QHKJ 1PG7H 2ERJB 3LRGA 4EDXA 1S5IL 5I1GL 5ISZE 5DRWB 4B50A 3MCKB 4LCWD 1KXQE 3ZDYE 3STZB 4GKSB 5HY9A 3MXWL 1H15B 1NCBH 4KK6C 4UBDD 1J18A 1Y6MR 4XCFL 1MCKA 2VDNH 3U2SA 1BFSA 5IOPA 5I30H 1YPZF 1H3VA 4LGSB 2X4RB 5FV2A 3OKDB 4ZAKD 2DQHL 4MS8C 1BZ7B 5EUOE 1TIUA 4Y19E 5IVXA 3ARDB 3CFIC 2FBJL 1QBAA 4JFPB 5F7WC 3EO1B 1G7PB 3V6OC 1I3RA 1QFHA 2PTTA 4JLRB 5T3ZD 4KI5D 2H3NB 3SKMB 5KJRL 5ESAB 5EIQA 3OKKB 2EDLA 5DQDL 3ULVC 2FO4B 3WS6C 3FHQA 2EEDA 4BQ8A 5T5FH 3O3AA 2D7TL 4WTWA 1MPAL 5E2UL 3B6SB 3KR3L 5DSCB 5FGBC 4JPKH 4JRWA 3BPNB 4YHOL 4PJBA 1TZGH 5I1EH 2YD4A 4AM0A 1HHIA 5CIPH 5KSAC 3S97C 4KMTL 5D1XD 1LE5B 2RGSA 5L8JB 4O4YL 1GCFA 2OL3H 3SCMC 4YFEA 1Q9OA 5T1KA 4UINH 3VXTA 4FQJL 3TO4C 2VZ3A 3U6RB 2ESVE 5HHNA 3D2UD 1G9ML 4OLYH 4IIQA 5L6YL 2YPKA 3ULVL 4MJ5B 3U82B 2OZ4L 1KCUL 1CI5A 2E9JA 3MRHB 4LLQA 3BWUC 4P2OC 3GSNH 5FB8B 2JE8A 1GSMA 1OL0A 1IGTA 3U9PH 4G8FB 3VE0A 3ORJA 3SDAA 3G9AB 3K4AA 3AUVA 4QRQA 5BZDA 1ZT7B 1NANI 2I5YH 1CFQB 4F57L 2JF1A 1BOGB 4KKCC 4DEPB 1MCHA 4TOYL 4DVBB 5DD1L 1F6FB 1QBLL 1I8LC 1A6VL 3LKQB 3CMGA 5TQ2H 5GS0D 4HGKC 4HX1B 4CVXB 1JK8A 3RWHB 3FT2A 1AHWC 1CD1A 2EDOA 1X4ZA 4HMCA 3OWEA 2ZOKB 3QCVL 3D87B 3EGSB 2QADC 2GJZA 5JXAL 3SDCA 3QUKB 5BVPL 3AS3A 4RNRB 3SEPA 3CFEB 2H2PD 3LKPA 3B83A 5I1CH 5LQBH 2L0DA 2QJDA 3MRCB 3RWIB 3MRRA 2EEBA 4UUJB 4QCIB 3K81A 1LO3H 4EI5B 1HXYB 3T0DA 4WJ5B 5CKGA 5E8OA 3BE1L 2Q1EA 3SKMA 2EIEA 3RHWK 2CLVB 1MELA 2AJYL 2IANA 2NW2A 2A38A 1S9YB 1D9KA 1C12A 2XG5A 2NY1C 3MRMA 4YEEA 4ISVB 2VO5A 4O5LL 2H8PB 2X4TA 4P2RE 5EU7C 3DBXB 3OB8A 3GSNA 4FMFA 1WCBB 1R24A 1U92B 3T0EA 1N4XH 3Q0HA 2EXYC 3IETB 3HRZA 4KKBD 3M1BA 3KS0H 3BZ4A 2Y06H 4AENB 2Q6WA 3ZHKA 4CW1B 1XFPA 4HUMB 4BUGA 4XBPB 5KJRH 1OF2B 1B0RA 2J5LB 4PJGE 1WT5C 2D03H 4GAJL 5DGRA 4S1SL 4LLDB 5C92A 2WV3A 4J8RB 1A6WL 2V2XB 1K5NA 1ND0A 2PF6A 3MBED 1WWBX 1GIGL 1HDMB 3DXAA 5IF0B 3U7AA 4L4VA 4IS6B 4JANB 1X6LA 1XIWD 1JPGA 2GITB 3TWCH 2E27H 2FJGA 4YGVA 5J6HB 1NBYB 4BQCA 2VXVL 3IDJB 3ZDXE 1DLFL 7CGTA 4BSVA 1X5LA 3X11B 1T5XA 2ZUUA 5IR1A 2VDRL 3WIHH 1PG7L 1CL7L 1KELL 4JFFB 5MHSD 5C09A 4YX2H 2R0LL 1FYHB 5CJXC 2Y7QB 1YEFL 4JVUA 4HX1A 5F7FA 2RFXA 2DIBA 1T1WA 5J3HD 4AL8L 3FQXA 3QO0B 5C0CD 2AERT 4HUWA 2OS7A 5I8CA 3ZKND 5KVDH 1RI8A 4YIQB 3SGEI 1RZGB 3EYVA 3DWTA 3MRPA 4Y5XC 4H8WC 2VDOL 4R7DB 2V2WA 3EZJB 1VFAA 3JBG7 5C3TA 3W39A 5I15L 5C08B 4KROC 1IVLA 2OX5A 4XH2A 3JWOL 2UWEB 5IBUB 4MJ6B 4F33B 4E9LA 3QCUL 4F37K 1R0AL 3Q1SH 2EC9T 1UZ6E 1Q9OB 5T1KB 1NCAL 4WWKA 5C0FA 1PYWB 1NBZB 5CEZD 1D7FA 5ETUA 4P0DA 4TUKH 1G7LA 2YWZA 4PLJD 1CGWA 4L4TB 4FXKA 1S7WB 1C5CH 5DVNA 4M1CD 1WTLA 3BYYA 2XACC 5A2JH 4X6CA 1KCSH 2P24A 4HXAL 3HN3A 1T0NB 3PABA 5AAWA 4GSDL 5FYLD 2L4OA 2CDEB 1JK8B 1FP5A 3P0GB 5JOPE 4QF1B 3OJDA 4AEIL 4ALAL 5D5ME 4D0BB 2GJZB 4G8EA 1KB5H 1CGSH 1OT1A 3WUWA 2ZUTA 3DV4B 4AL8H 1UKSA 4U6XA 4RRPA 4U6HA 4F2MB 2F5BH 3S3PA 4K07A 1QLRB 2R0LH 1EA9C 1MRDH 4NJAH 3FHAA 4MMXC 1PX4A 4HFWA 5I66B 5IWLA 1H3TA 5LGJB 3CUPA 1CXLA 1JWSB 1BJ8A 2FB4L 4O2FB 1CXFA 1N6QL 1KCVH 1HYRC 4NWTL 3G9VA 3U0TB 1OQOA 5E6YA 4OCXH 2P43B 1ZA6A 1SEBA 2WANA 2JJSA 3K8LA 4PP2B 2DD8H 3EYQC 5C08D 4YBLB 4F8QA 2Q76B 2QQQA 2XN9E 1C5BL 2E9IA 3DETD 2GJJA 2NY7L 1Z5LB 1F42A 1AXSA 4LASH 1CGYA 1A1NA 3DVNB 4HUWB 1JGEA 2EE6A 4IJ3C 2SEBB 4S10A 1BJ1J 2K1MA 3ZDYF 3QJHA 4OF5A 1T2XA 3ARFB 4PJ5A 4G6AD 3Q6FA 3L5WB 3MLTB 3BQUC 4KFZC 4JY5L 4R4BA 4RDQF 3L9RB 2QSQA 3MO1A 2VSDA 3ARGD 4NDMB 4K3HA 5J13C 2PTUA 1AGDB 4XPBH 3TEUA 1KBGH 2XY2A 4UILL 5E8NB 4EBQL 5ICXB 1A9BA 1JRHH 4UIMB 4PRNA 3VFNA 3RVUD 1ZANH 4O5LH 4F7PA 4PJGF 3D18A 1JPGB 2GITA 1FJ1A 4M6NL 4FQCH 3ZYJA 4YHMH 5GRJL 1TQCC 5D7JA 3WUZA 1IGFH 3AY4C 2V2XA 3ULUL 1R6VA 4X5WB 3CDGB 2EDFA 4FQXB 2IMNA 1RUML 5EWIH 2BJMH 2HH0L 4OLWH 3G04A 2A77H 4OCYH 3LQMA 5C6TL 4PJ5E 5BOPA 5GXBB 4YUEH 4LPXA 4HBCL 4XI5C 3RU8L 3E8UH 5LGKA 4X0KA 5D2LA 2UY7A 4AMKH 2Q8BH 4CRPA 3V8CA 4XP4L 1JFQH 4X4MA 4Z7WB 4PJXF 3WLBA 5HI5D 4Q58C 1A6TA 5EU5B 4KK6D 2NX5E 4PJIF 1NGXA 4NFDA 1RFDH 4V1DB 4PRIE 1KIQA 3CAFA 2I9LB 3MR9A 4F57H 1VEMA 5DYOA 4JE4B 1CS6A 3EJZC 2X44D 4H5SA 5I75B 2YXMA 4NRYB 5CZVH 2GT9A 3VG0L 1AKJA 4FFZH 5J1AB 3NN8B 5DD3L 3MRDA 4ERSH 5IIEA 4MGXA 3GSRB 2ZG1A 2G5RA 5FYLE 3ZT7A 2AP2A 5DJ2A 2QV2A 3QUYC 4GBXB 4OB5H 3VD5A 4BZ1H 5I9QC 3C5ZA 5L9DH 1OSZB 2VITB 2P4AB 5DR5H 5C0FB 3IF1B 4ZSOE 4Z8FH 5IT2L 4KMTH 5ID0A 3BXNA 1DDHB 2ZCHL 2CR3A 1H3WM 3GSUB 3BT2H 1FG2A 4NO5A 1RZ7L 4LSSL 5D7LD 4JPKL 1Y0LB 3ELAT 4Q2ZB 2XT1B 5MERB 3GMOA 5IB4A 1ZXQA 3I9GL 3PUCA 3PP4L 4NBXB 4PY8I 1PBYA 3DO7B 1EEUA 4QHKI 5DXWA 5KS9F 3HZKA 3MNWB 1D9KD 4YPGB 3RIFK 1KTKE 1KJVB 2EDQA 1XMWA 1W0WB 3BISA 2JCCF 4MJIE 1QFUL 3TIDA 3AS2A 3TJEH 3UTSB 1U93B 4D94A 1RIVH 3FONA 2RBLA 3QXAB 2FBJH 4JHAH 3QUXB 43CAA 3CC5A 1BP3B 1T6WA 4XPAH 1FC2D 2BSRA 1FCCA 1UB6A 4IRSC 4LOUC 4NN6B 4PYGA 3U30B 1U8NB 1GJIA 1PEWA 2CJUL 1IGIH 3QQ9C 2K7QA 1PSKH 1U58A 3QUZC 1G6RL 1MSPA 4XCFH 4UQ2B 4RFEA 3VXPB 1CE6A 3HLAB 5E4EC 2AW2A 3MXWH 1BD2B 1MWAB 1INEH 1CLYL 3IDMA 4LU5L 2LAAA 5CUSL 4CADA 3IFLH 1QFWM 1GPOH 4GRWF 3UC0H 1FNEB 4I18C 2HA1A 2R1XB 4YQXH 1IAKB 3V6FA 5C0DA 3QAZB 3VXNA 3CZFB 2R1YB 1IL1A 4EN3D 1HCFX 3WN5B 4TN9A 2VIRA 5E8PB 1E4XL 1QLFB 4W6XB 2ATKB 2IBGA 4B41A 4DKFL 5EU6A 1E4WH 9CGTA 1U41A 1CD0A 1FPTL 4D9QE 2IGFL 3HNTH 4HWBA 5HVGB 4UZGA 2EC9U 2EYTB 3NAAH 2VL5B 3FO0L 3P0VL 4RISL 2EDNA 3BIKB 3C5SA 3VH8G 2EDJA 4OZIB 3VWJB 4PJAF 3IDGA 4HS8H 1J1PH 1XCTA 4U6YA 4PRNB 5BRZD 4GUPA 1R5IA 3QUYD 1KYOJ 3TZVA 2ARJB 4PRDB 2R15A 1UCTA 5E24E 1D3CA 3KPMA 4LRNL 1AH1A 2GYSA 1LO2L 4RA3A 1LP9B 1V5JA 2QQNL 2YD6A 3CSGA 3O6FB 5T1MB 3TFKD 1F45A 1RHFA 2O5XL 4OD2B 1J1XL 1EAPA 1JGDB 1QHOA 3MV8A 1UA6L 1HOCA 4K94L 5CWSB 5CJ8A 1N2RA 5IB3B 4XHQA 4XPGH 4M62L 5DI8A 4HS3B 4G3YH 4JKPL 3QXWA 3VFSA 4KQ4L 4ZFOL 5HHQB 2NXZB 3RI5F 2RHEA 4O58H 1U93A 1CVSC 1A7PH 5IVXE 3CMOH 3KPPA 5GS1B 1P9MC 2YPVH 4NQCE 4TSCH 1LGVA 3FQRA 3NABL 2VC2L 4J3TA 3ZLQC 3TO4B 5ISZB 2VXQL 4NQDB 2VDQL 3PWLA 3NCYS 5F96L 5E0QA 1Z0NA 4AG4L 5ACLA 1A4KA 4ENED 2Y5TA 4NSKB 5D7IE 1ZLVK 2NW2B 3MOAH 1A6TB 1XGYH 4Z7WE 1JGUH 1JN6A 3S35L 3LQZB 3IS1X 3RL1A 2OR9H 3ZYIA 4YFLF 1BOYA 4IRJD 4HJ0C 3TH4T 4OF3A 2JJSC 3LMJH 4PP1D 4AY0A 1VPOH 1IAKA 3SY0B 3V6FB 3VXNB 1MVFA 4UBDC 2F9BT 3MA9H 4K9EL 5E2WH 43C9A 3SO3B 5H8DA 1GGCH 3KPTA 4PGEA 3OPZH 4N5UA 5KSVB 3HFML 3L3HB 2AJZB 3VWKB 8CGTA 1IMHC 5CJOH 3BIKA 4R0LC 2UVFA 4WFED 3X12A 4HC1A 4MA3A 1VADA 3O4OC 1NCCH 3GKWL 1T03H 1II4E 3SDDA 2XN9D 4RGMB 1BGXL 1SMOA 1WBYB 1AGCA 2WBJA 4G8GA 3PWJA 2BSRB 3VD7A 1PG7W 4MA8L 4PRDA 5D4QA 1TITA 3D85A 2P8MA 3V6BR 2H9GB 1CLOH 4NNXB 4DUWA 1UH4A 2ZUQB 3VXSA 2FNBA 4EI5C 2DL2A 1KLUB 3I85A 4LVOB 4HKZA 1TJGH 4JQIH 3GMOB 4R90H 3NMEA 4HBQA 3ULSA 1FVDA 4EJ1C 1BD2A 1UZ8B 1ACYH 4JEGB 3BI9X 1CXEA 3RWHA 4Y5VB 2ZKHH 2VH5L 4CBPA 3UX9B 5C0RL 3GMPB 3MZGB 4P5TA 3TIDB 2AK4A 5DVLA 5D6DC 4WHTB 4NQUA 4PJ9C 3TIEB 1J87A 3A6CH 1IL1B 3D25A 3D69B 4LPVA 2BRQA 3C5JA 4YBHA 4L8DA 5F3HB 1YQVH 3VRJA 4KGJA 4YHNA 5KVFH 1DBBL 4YHKL 3LCYA 5D5MA 5J06A 1FBIL 1BFOB 5F88A 5E00A 1VFAB 3FAWA 1F58H 2CLVA 5J4MA 1X5XA 5HVHB 4OZIA 2A6DA 2VE6B 3MA7B 3TV3L 4OD3H 3MRBB 3T09A 5JDJA 4BQ9A 3GHEH 2ATKA 3WFZA 3EYOB 1EUTA 1FFPB 2BMKA 2RFXB 5CLWA 3P11H 1AFVL 4WTZA 3CVHB 2W9LA 5DRWA 3WFDH 4OZ4B 3FOMB 3OF6A 2R1YA 3AREC 3RGVB 4KQ3L 3K80A 3QEQA 3IDUA 1F6AA 1A1MA 1A5FH 4PG2C 4P2QD 1KB9J 3NH7H 5F6IC 4D9QD 2YC1A 1U8PA 5JLZB 4PJGA 3U2SB 5E70A 3W39B 4F37F 4NZRL 4LDOB 3O2VL 5AUMA 1NFDA 1MVUB 2DLHA 1Y18A 4JM4L 3ARWA 5C0GA 3FT4A 1R3JA 2W59A 3P9MA 5HHVH 3BP6A 3LHPL 4PLKC 5CP7B 4U1IA 1D6VL 2XWTA 1YEKL 1PQZA 4XNXL 2P5EA 3C6SB 3PWNB 1NC4A 4PGDA 4Q0XL 3W2DL 4R7NA 2EYSA 4G8IB 2C3VB 4NNYB 4OD2A 2BVEA 2GK0A 2YBRB 1NEZA 4PRPD 1WWCA 4JFFA 4LL9A 2C26A 5I8EA 3L3DB 4TVPL 1TPXB 2NY5H 3W9DB 2Z93B 2GUOB 1IEBB 2V17H 5FCUL 4PP2A 4Y4HC 1QLEH 5JR1H 1IQWL 3G6AB 1ZHNB 2XQBH 5I8CB 5JA9A 2DQEH 3GJEB 1U95B 4XBEL 4URTB 4PGBA 5HI3D 2VLJE 3HI1A 1ZV5A 3H9HB 4FZ8H 4U7KA 4YDLB 3ARSA 1JNJA 4Q9QL 5ANMB 1S9XA 5FGCB 1NH6A 2D9CA 3Q6FB 1A3LL 4RAHA 5CLTA 1G6RA 1YMHB 3VFMA 4OLXL 2CMRH 4Y5YB 3MFGB 4ZXBD 4BSWB 1JPTL 3SY0A 1OM3L 3RWCB 3RNKB 4X5LA 1JWMA 2D31A 5DHXB 3L3OA 2A74A 1CTNA 5INCA 1QNZH 5IK3A 3DX7A 3TVMC 3ARDD 4I3SL 4MS8D 3X3FL 2IQAB 4ONGH 3VXUA 4Y4KB 4C55A 5J3HC 2C3WA 4DQOL 1KJ2A 3JVGA 2BOBA 4WW1A 4MJIB 4X6BA 5JW4Q 3O4LE 2V2TA 3OXSA 3PGFL 1X5AA 3MV9D 4H0HB 1ED3B 1GL4B 3HNSL 1JF1A 5DWUL 1T3FA 4G43A 2G75A 4MVBD 1OGTB 3MRCA 4K7FA 5BZWA 2XWJB 5FKAA 3QHFH 3BGAA 3MUGA 3WNKA 5E2JA 2I60L 2QKIB 5KVEL 1KLUA 4OQTH 5EZLA 5IQ9B 3QPXH 4LCWA 1JPST 1IJ9A 1OAUL 2VDMH 5JW5A 1RULH 3NCJH 2GTZB 4OCLC 3SE4A 5GGTL 2AJ3A 1CZ8L 1D9KB 1U8IB 2VZUA 5D72H 2IADB 4J6RH 3UPRB 4X4ZA 4ORGB 4BKLB 1T20B 4HIXL 3FB5A 4Y4FB 2NXYB 2NY2D 4JFZL 3SO5A 1RJCA 5HGDA 2CLRB 5D7LB 1IGYB 2XTJC 3VU2A 3S37H 3QQNA 4N0UA 2BY1A 4QRSB 3RVTD 2P45B 5J11B 2NY4B 3QDJD 5IMOB 3VCLB 3CVHA 4NQCB 1EGJH 4KWUA 1VFBB 3LSOB 5BMFL 3OHXA 2BVUA 3RA7H 1FNLA 4I77H 4I77L 1M71A 1HHGA 1EGJL 3CK0H 3FO9A 4RWHA 2VLLA 4PGBB 5KG9B 4I9WD 2PXYD 2DQIH 2WWKT 1EJOL 5CGMA 4O2CA 1BFOA 1D5XB 3CPLA 1YEIL 4RQQA 1IC7H 4JQXC 4HIXH 3SE3C 5F7LB 3H42L 5D93C 4HJJH 2ZCKL 3D0VA 3NZ8A 1M6OB 3MR9B 3PL6B 4NBZB 5SWZB 2Q7YA 5DMJB 3L3KB 4E5XA 1N8ZB 4I3RH 3KLAA 4ZO7A 3KYNA 4JO4H 2I60H 4LARH 3E6HB 2PNDA 4U1KB 1F4HA 3QHFL 3EIFA 2C3VA 5FYKU 4APQB 4IIQB 1HQ4B 2X70B 5DUBB 1AO7D 4LVNC 5D2NB 3T4AA 3RY6A 1NAMH 3C8DA 5IEKA 1R3JB 3UTZB 3OGCA 5C0AA 4O2EA 3IJHA 2XKNA 2IFFL 2X4NB 3I6GB 5KOVC 3HC3H 1G7JA 4J12A 1QSEB 1BBDL 4DFIA 5ID0B 4HMDA 1K4CB 2VKXA 1JI1A 1I8KA 1M1SA 4BQ6A 3CFJA 4ONGL 2R39A 2VZVA 3ESVF 3I3BA 3BX7C 4HH9A 12E8L 3MUGB 3ARGC 3DURB 1XR8B 4OKVB 4IDJH 5EO9B 1FL3A 5FO9A 1MRCH 1XCQA 3SDXA 4BYHA 1MOEA 1AY1H 4GBXC 2GTZA 4H1LG 4M1GL 4H26B 1NSNH 5HDBF 3DVFA 1GC1C 2WSKA 2W9EH 1XT5A 4MQ7A 4JN2A 2XICA 5C09E 3QUXA 43CAB 1AQDB 5HHXH 4JCMA 4N1EA 3CH8A 5JHLL 2FHCA 3RZCB 5EOQH 3DX7B 3WUWG 4XBEH 5J7CC 2F19L 4P23D 3S96A 5AD0B 1WAAA 4R2GD 3NBNA 2DQTL 4OZGF 4TPRL 1KJ2B 2AK4E 4BQBA 3MXVL 5FCUH 5EUKB 5KANI 2ADIA 3MACL 1SBSL 2X4SB 4NC0B 4LDLB 5E5UB 5T5NF 2AEPL 3UTQB 2B1AL 3JUZA 3I50H 4OF7A 4P4RB 1U36A 3O41A 1I7ZA 3QFJB 3FQWB 1TVHB 1AR2A 5SX4I 3W2DH 1PEZA 1UM6L 4NO2B 3O6LH 1CU4L 3MUZ1 3UO1L 3HC4L 3O9WC 5BO1H 1SVZA 3BHBB 3OKEA 3KNBB 5HHVL 4ELKA 5EG6C 5GSVA 2I07A 4LCUA 4JB9H 3MV11 1RK1B 4PJFF 2N7AA 2EYRB 2H1PL 2E8YA 3UTSA 5C9JB 5D2NA 3QIUB 2HFEA 4O02H 1Z5LA 2D0HA 4L4VB 4PPTA 3W0WA 2ITCB 3TZVB 5J1TC 2JIXD 2NY6B 4P49A 1MY7A 3IDIB 1I7UB 3VFVB 1YNTA 2LVEA 4KQ3H 5HYFA 4NIKB 5AEAA 5DJCA 1EHXA 4P3WA 4RFNC 4GAFB 3O3UN 3O8XA 5HD8C 1IE5A 3IU4L 1IM9A 1EFXD 1QSZA 2NX5D 5GGQH 3K0WA 4DGVH 4N0UB 5C08E 1TXKA 3OR6B 3DARA 2Q8AH 5ID1A 2Y5EA 2D7NA 4ORGA 1T20A 2CPCA 3BZFB 1F58L 2H45A 2ORBL 3NZ8B 2ZUXA 3WN5A 1MI5D 3PWPB 4RGNE 1O0VA 5EC1B 3FO9B 4NQCD 1UXWB 2I26N 1I85A 3IAGC 1A7OL 1UH2A 3O6FC 5EU6E 3QDJB 3MLWL 4LLVB 2P5WD 2HT2D 2V9RA 2VLME 5EBWA 1INDL 3BDBA 2IPKA 3T2NL 2DYPA 3QNYB 1BFVL 3QDAA 4HIHB 4M9OA 4N1CA 1H8OA 5FA3A 5ACMA 2ZKHL 1ZLWK 1HXMA 4MA3B 3B9AA 5E1HB 3C60B 3I6GA 3RWGA 1D6EB 3D39D 1KACB 4NOBA 2AXHA 3RY5A 4BH8A 5HYQA 2CLZA 3VFTA 1YY8B 3ZDZF 1CLOL 4G9FD 5F1IB 2DIAA 2EIZB 3CH1A 4LNVA 4K9EC 4PRPE 4JM2A 5GPRA 4X9BA 3GMLB 3KYNB 2D4FA 1KN2L 1SM3L 3V95A 1HH6B 3K2UH 5IG7A 1MJ8H 2DLEA 5F8RC 2NR6C 4J23A 4NUJA 1EZVX 1WSST 4MCYB 1JNNL 4FNLL 3OGCB 5GGRY 4X4XB 3V5KB 4RFOL 4PTUA 3NCEB 4WHTA 1FGVL 3L7FB 3ZKXB 4X7TA 3RKPA 1T66C 4UQ3B 1C5DA 5EH1A 2FECI 5GRXG 1KN4L 5LVEA 4CVZB 1MEXL 3CUPB 1WZMA 4OGYL 4KI5C 4RGOH 2JK5B 2IPTH 5FKPA 1ACZA 4JREC 1R24B 3BPNC 3MREA 2XTJD 2VQUA 4GW5A 2ICWI 2H6PA 5BRZE 4A6YL 5B38G 3MV8D 3ROLB 4GAYB 1LE5A 1L0QA 1IT9H 2J8UB 3QHZL 1I1AB 1NGWB 3DJ9A 1MH5A 4ZOCA 4HK0B 3NABH 4M61A 4F7TB 1BWMA 2EE2A 2SEBA 4WNQA 5FEBA 5GS0H 4DN3L 4LFHD 5F6HJ 3HA0A 1I9IH 3UTQA 5TDNB 4FQXD 3LKPB 3EO9L 1DN2A 5E2VH 3ZTNL 4P2OB 4NDMA 4FQLH 5IF0A 5CJXA 5I1JL 5TQ0H 3PNWA 3K1KC 4OZFA 2F15A 5FA4B 5B4MD 1DUZA 5BJTA 1IQDA 1J1XH 4P5TC 5JOFA 3QQ3B 1MWAL 3ZKMC 1MNUH 3TNMA 3MRMB 2RCSH 4UB0H 4UDTB 4HPOL 3RL2B 5C09B 1LO2H 2HT3D 3FO1A 4LPTA 4N8PA 4P3CL 5JW3L 1IM9B 1UZ8A 4U7MA 3BGMA 1BQUA 3BWAA 3CFEA 4P2RD 4MAYA 4M5YL 4LSRH 3MOQA 5AUMB 2ERJC 1RZKH 3IDIA 3MRRB 4UUJA 4XX1E 5EZJA 5MP6L 1UJTA 1JPFA 4TYUA 4D9RE 1EHLH 1DBJL 2ZSWB 3QZWB 3NAAL 2J4WL 3G5VA 3GHBL 1QPPA 5EB9A 1R3HA 1E4WL 1ZVHA 3UTPD 1WBXB 4CMHC 4H88H 1F2XK 2Z35A 1T1YA 1NUDA 4N8CL 5KANG 1CFBA 3EYFA 3UTTA 4TRPL 3LZFL 1LO5A 5HHMB 2DYPB 4UAOB 4XB8A 3VH8B 3KXFD 2DLFL 2ZZUT 3FCTB 1E28A 5BRZB 3VDAA 1HKLH 2A1WH 3B8YA 4XMLH 3CDCA 2DYPD 4PV9B 1IEBA 5IFAL 5KZCD 2FO1A 1V7NL 3RRQA 3U48A 3TCLA 4FQHB 3S37X 1JUFA 5E9DE 1EEQA 1PSKL 2RQ8A 3P73B 1AO7E 4GQ9H 2CJUH 4YHPB 1RZJC 4Z0BH 35C8H 4XGZB 3DX8B 4MNGA 4ZMAT 1YEDB 4XMLL 2BVYA 5TFSL 1U8OA 5HVFB 2DLFH 3L1OH 3QDJE 5D7SH 3WFCL 3TJEL 3AS1A 3OXSB 3WNMA 3ES6B 4F9PA 3WIHA 2MWCA 3OKYA 1H0DB 1IAOA 5JIHA 3HZMB 3QUXD 1I1FB 3SN6N 1L0XA 1CICB 1NGZA 3SCMB 1J0HA 2CGRH 2P8PB 3PF2A 4HF5L 5CSZA 1XF3A 1Z9SA 2J12B 4I0PA 3CD4A 3S9DB 1MI5E 4Q9RH 4ZO6A 1I7TA 3BPOB 4EXPX 3CZJA 4QGYA 5BW7A 3IFOB 5DMKB 3L3GA 3HPLB 5DURD 1T2JA 4WWID 5F1IA 1FH5L 4K7PX 3HS0B 2FR4A 4YE4H 1RUPH 2GJ6B 4WO4D 3P77A 4J1UB 3G08B 3UJIH 4ODSH 3CFCL 3V4VH 2NLJB 5L9DL 4M7LL 3V0WL 3DSNA 3PDOA 4BZ1L 2A9ML 4F15B 2I24N 1A3QA 1W8OA 3ARFD 1UB6B 1A6ZA 1CFNA 4OJFL 4NBYB 4EUPH 2OYPA 2DQGH 2P47B 3GRWL 1IGML 4PGEB 1CE1L 5ESVB 3X13B 3TO2A 2PETA 4JM2C 4NQED 2QKIA 4KJQD 3PV6A 5DJ8B 1XF5A 3KPNA 4WI8A 3GI8L 3HNVH 4OUUA 5JW5B 3KAAA 1JTPA 4QRRD 2VLKE 2DQCH 5EO0B 4Z0XA 4CN4A 1A2YA 3UTOA 3EYFB 3GSVA 3UTTB 4LSVH 2F53D 3SDCD 5JPMB 5I8KH 3B8SA 3L5HA 4I4WA 3TBTA 3TF7C 5GS0L 5BXFB 1MJ7L 5D7LA 3LN4A