1QLEL

Cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
DIELTQTPVSLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQFLVYNAKTLGEGVPSRFSGSGSGTQFSLKINSLLPEDFGSYYCQHHYGTPPLTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/immune system
molecule keywords CYTOCHROME C OXIDASE POLYPEPTIDE I-BETA
publication title The Cytochrome C Oxidase from Paracoccus Denitrificans Does not Change the Metal Center Ligation Upon Reduction
pubmed doi rcsb
source organism Mus musculus
total genus 24
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1999-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qleL00
5CEZE 3O4LE 5C09D 4KRNA 2OMBA 3RNQA 3QG6B 1MRFH 2F58H 1CFNA 5GGSA 5I8KH 2VXVL 1RUPL 4U1SA 2I5YH 4D8PA 5DTFB 3MLYL 1JFQH 1HXYA 1A7QH 4WVRA 3FQWA 4WCYH 4OTXH 4KZEL 1NCBL 3T65A 3VWKA 4BQ9A 5GS0C 5KVGH 1B0GA 4NC1E 1DBML 2H8PB 3LY6A 5SWZA 4GAJL 2CD0A 3QNXA 5C0FA 4PB9L 4NQEE 1S9VA 2NY5H 1GL4B 1LO3L 1URLA 3RY5A 1BLNA 1RV6X 1WWBX 1HKLL 1T03L 2IPKB 3VXQB 2HFFB 4X98B 5ISZE 4ODHH 3DO7B 5T33H 3FONA 2KBGA 4KK5C 1SJXA 3UTTE 4X8JA 5EIVA 1DE4B 3FFCA 2ZKHH 3M17B 2D03H 2AEPL 2AJZA 3GI9L 5CJXA 5HYJA 1WZLA 2HKFH 2Q1EA 2A2QT 5HGHB 1RPQA 3PL6D 4KJPC 3IDXL 4ZFOA 5CHNB 1FO0L 2A0LD 3QI9A 2DS4A 5ICXA 1GIGH 3BDXA 3VRLF 5JIPA 1RVFH 1CF8L 2NY6D 3ZHLA 2FJFA 2C5DC 5DURB 1UYWH 4O4YH 2P8MB 4HWBH 1KSRA 1DCLA 2R4RL 2AJSH 1RHFA 3DARA 2G75B 4N0FB 2VDML 5HVHB 4KJQC 3F7YA 3THML 2ADFL 5KTEH 1I7TA 3Q6GH 1T83A 3WDHA 5J1SC 3FOLA 1DBKH 4KKAC 5T1KD 2NY1D 3MR9B 2C9AA 5IIEB 4KKCD 4DCQA 4XHJD 2WBWB 2KZWA 3QT2A 4POUB 3GO1H 1IE5A 3BN9D 2NY0B 3IKCA 4UV4H 5D5MB 4AY0A 4S1RL 1EJ6A 4FQQB 1FSKB 2PYFA 5I76A 1OY3B 2UZYB 1PY9A 4WDIB 4XC3H 1JZ6A 3BXNA 4ZO6A 5IW6B 1N0LA 4OGXL 4MXWH 3QRGH 3LN5B 3GFUA 3DVIA 4FQXB 1I3RB 4L4TD 1DL7H 1EGJA 1W72B 1MCSA 3S3JA 4NZUL 3I3DA 1TZHA 4JHBA 3T0WA 1RZGA 3D9AH 3E8UL 3FFCE 5HGDB 3TO2A 3RWHA 1PJ9A 3CVHA 4M8VA 5E8PB 1EDQA 3CIQA 5BW7C 5CJ5A 1X7QB 5CSZB 5HYJE 1NDMA 5KOMC 5AUMB 3EHBC 5JW5A 5FUZL 5F7NC 4JRXD 3DUHA 1PW3A 4DVBB 1WBYB 5H37G 1HIML 3F5WA 4XNQA 1WAAF 1RIVH 1MRFL 5T5NG 1IAOA 1YEKL 5I8KL 2CDGA 4X6CB 1HOCB 5DJ8B 1INQB 3VXRB 2I5YL 3DBXB 3S97C 2X4OA 1JFQL 3BPCB 1D6VH 2GJ6A 3EYSL 4ZPVA 1Z2KA 5HJ3A 1J8KA 4ODWB 3BYTA 2E7BA 3O45B 5I1HH 2RCSL 2ZCKL 4TUOA 3OKEA 4QOKD 1WFTA 3V7MA 5C0DB 1IKFL 1YPZB 1KEMH 2K9UA 1MRCL 4GT7A 3D2UA 4P5TA 5MEQA 4APQA 2CRZA 5BXFA 3MRGB 4U6YB 5T1LA 5IQ7H 4MA1C 4BZYA 2P46B 2OR9H 1UB5B 4LLUB 2ZUXA 5F7KC 3P9WB 4WY7H 5TF1L 2E27H 2EKJA 1HEZB 3DX8A 3F7RA 3L3IB 1IAKB 5F44A 5DJAA 1IT9H 2MCPH 3JV6A 3RTQB 1UA6H 4GLRH 4QXGL 2GYSA 1MH5B 2LVEA 4L5FH 2D03L 2QL1A 2N7AA 2J88L 3CX5J 1J88A 1F6LL 4LCIH 3IJYB 4NSKA 4PJDB 2EDQA 5J3HD 4TUJA 1YEJH 4YFLI 4QHLA 3BHBB 3RPKA 5C08A 1RZKH 3TN0B 1E27A 1CDUA 2H9GA 2X4UB 3OAYH 1TQCB 5SV3A 1T3FA 1U36A 4PJ9A 1Z9SA 4XVTL 4O02H 3LQAC 1MQKH 3TEUA 1FL3B 3RVUD 1A1OB 1A6WL 2B2XL 4AIXA 3QQNA 3PL6C 3Q6FA 3GHBL 3QFJD 3ARGD 4D9RD 3B5HA 3NIGF 1I1AC 4JB9H 1ES0A 4H8WH 4Q58C 4X4YB 4S2SB 3H2WA 3LPWA 1PKQA 4P2RA 4ZUTB 2R2HA 3BPLC 4Y19B 4XNUL 3MLSH 1P4IH 4Y1AD 5IVXE 4YDLB 5DZLA 2W60A 3S36H 1ZLVH 1VFAA 5SWSB 2AXHA 4OIIL 3MJ9L 2BSTB 5CILH 3L9RA 3IJHB 1KPRB 3VFOA 5ISZD 3WJJA 3X17A 1T04B 3ILQD 4LCYB 1MY7A 1AGEB 3NGBC 1JYWA 4KKCC 5DD5H 4EDWH 2P42B 1HXMA 2Y9RT 4RFEB 1I1RA 3SBWC 3TVMD 4XB7A 4BH8A 4XMPH 2WIIB 3HC3L 4WO4B 4AYFA 5IMMB 5AG9A 1A6ZB 4MJ4A 5J56B 5A40E 3QAZC 3M1BB 2VDRL 1FORH 4ZUUA 3D9AL 4Y4HB 3RNKA 1PFCA 2MQCA 3KGRA 1RIHH 1T4KA 5DZNA 1OLLA 2Q6WB 5E8NB 2R1WB 3R06B 1KG0A 3D0VA 5BCAA 1GPOL 1QLRA 3VD4A 5AAWA 5TDOA 3I2CL 4R2GD 3P0VH 3IFLL 4LPCA 3X13B 1OAXL 1V7NL 1R24A 1X4ZA 1CXKA 4Q6IB 3PV6B 3JTTB 4I9WD 3SJVE 3ZE1E 4JFQB 1CGYA 5JA9A 1UACL 1AGBA 3NIFF 1YEIH 1Q72L 2ADGA 1JZ7A 1MCDA 3WYRA 4R90H 4JM2C 3K1KC 3RZCD 1D6VL 4JFEB 4Y5VA 3FRPG 1XIWA 2EYSA 2FBJH 35C8H 4Z7NE 3CDYA 1MCWM 4PG2C 4N8PA 4X5XB 2CLRA 5J6HA 2XWJB 4Q9QH 3CCHA 1GRWA 3WNNA 1JPTH 3T0XA 4P23A 1HHIA 1PKQE 4L3CA 2XACC 1U92A 4P2RE 3DTXA 4WHDA 2FO1A 1KEML 2DBLH 3MZGB 4MXVE 4EIGB 1IILE 3CX2A 3K8KA 2HLFD 4M6OL 5FYJE 4HXBL 1JRHH 3OBAA 4CN6A 4WENB 1P84K 4P5MB 5TH2B 2IG2L 1U8HA 1MREL 1UT9A 4UAOB 1JIBA 2DJUA 2RHEA 4HLJA 5HHVL 3TFKC 2E27L 5HHOB 1EEYB 2X4NB 4YH6A 3H7BB 2YUVA 2OLDA 2VLME 2R4SL 5JIIA 2OMNA 4PREB 1CDGA 2MCPL 1IAII 5EU4A 4R3SA 1FZKB 2NX5D 1H0DB 1JMZA 1T66D 4RFOH 1T21A 4QHUB 5EZIH 4HDIA 3BZ4B 5D70H 3JWDH 4LCIL 5E7FA 3X3GH 5HYJD 1R5IA 4OGYL 5EH1A 2QR0A 5F3BB 2HMID 3MGOB 3GUTB 4KPHH 4F9LA 3WS6C 1X3DA 3IDYB 3QI9D 4HKZB 1DLHB 1I8MA 2AAVA 1P1ZA 3H8NA 1CFVL 1E4XH 4PJ7F 4O02L 4D0BA 4LLYB 5DMKA 1DUYB 4DVRL 4HF5H 4Z6AT 4W68A 2EYTB 2CDEA 4MWFB 5ICZA 4MX7A 3RL2B 3WDIA 4RDQF 4JGUA 4ZXBA 3LH2H 4MNQB 3CC5A 4XPAH 2B4CH 2E9WA 5F71A 1FRGL 1UADC 1P4IL 3EIFA 4OD3L 4GFTB 1FNEA 1TZGH 5CZVH 3ARGC 1T1ZA 3K7UA 3CNKA 4HCRA 3E6FB 4KQ3L 1M7IB 1K8IA 4UQ2A 3SGJC 3TCXA 1I7ZA 2FSEA 3DMMD 3SGKA 3MLUH 5CZKA 2B5IC 3BOVA 4FQCH 4ODXB 1OAZH 3RY6C 5C9JA 2X09A 1BFSA 3HAEA 4XBEL 1I8KB 3GHEH 1JGLL 4OCRL 3VFWA 5B8CC 3BRDA 3C8KA 3VGAB 3LRSA 3MV7D 3OGCB 4BZ2H 1MCBA 5BO1L 4MJIE 1A7NL 4K3DH 4ELKB 3C60A 4XI5D 1S9WA 4UU9B 5JPMA 4Y2DA 4I0PA 2P44B 1GC1H 3D3VE 3HHRB 5HD8D 4HFWA 3PJSA 3NBNA 3FJTA 5JORB 1T5WB 3P0VL 3ULUL 4NQVB 5D7LD 3WL9A 2VSDA 3O3DA 4XPBH 1RIUL 2VTFA 3OB0K 4LVHB 1FL5B 2BFVL 4PS4L 5D2LF 3TA3A 4YXKH 1KN2H 1YEIL 1AKJD 4U6VH 5FM5M 3BIBX 3NPSC 4LPUA 3FB8A 4R2GC 5CGMA 3HLAA 5F6IC 3OKNA 4HWUA 1Z5LB 4X7TA 4LCWA 3EYQD 3KPRB 2R56L 3VFGL 35C8L 2FBJL 2OX5A 3L3KB 2ZOLB 3SDCD 4X9GA 4TOYH 5IFAH 5H8DA 5FO7A 5EOQL 3R1GL 3WSQH 3PQYE 4OUUB 1QQDB 3V4UH 1NAKH 2NYYC 4YHPB 1FSKC 3RDTD 2J5LC 2D2OA 2ZJSH 3OJDB 5C3TA 4UDUA 4ODVL 3D2UD 3T4YA 3GRWA 5AZ2L 5E2UH 1JRHL 5KS9B 1DVFB 3MV9B 3QCUH 4LLVB 3SKOA 3MRFA 1HDMB 4OFYA 5IGXH 4HIJB 3LD8C 2ZWLT 1IM9B 4GRLB 2W9EH 2R0LL 1NBYA 5E7BA 3C5ZA 3P4MA 2IBZY 5GS0L 5JO5B 1CN4A 1CD0A 4Q2ZA 4LNVA 3KPLB 3MMEA 1SEQH 3ULSB 2CUMA 1S8DA 4YO0A 4K8RD 5D70L 5JZ7D 3LB6D 3MREB 5GS1B 1X5XA 3QB7C 5M94B 2FNBA 1PG7X 3DIFB 3SJVD 4AEIH 5B39B 5ERWB 2F5BH 4MXQD 4Y4FC 3TESA 5BZDA 2DYPA 3G04A 1T66C 3CMOL 1AD0A 4M7LL 5HYSB 3PWJA 3U7WH 4QY8A 1A2YB 4X6BA 3H0TB 4HS3B 3FMGL 2HMIC 1OW0C 3VD9A 1J0JA 3AGVA 3E3QC 3P0GB 3LH2L 4WW2F 3CSGA 2XN9A 4XBGB 1N59B 1T20B 3EJYC 3QZWA 4JPWH 4P2RD 5DD3L 3LEVL 1J5OH 3GMNA 1XGPA 4LCWE 2CK0L 4JKMA 3HMWL 5F88A 2IANA 1TZGL 4NM4L 2FX9L 1DSFL 1KTLA 1ZE3C 3FOMA 3QQ3B 1LEGA 2AJXH 5DI8A 2YA1A 2Y06L 3QJFA 2Q8AL 4M5YL 4LHUB 4WW1A 1KULA 4NO0A 3MLWL 1BZ9B 5FFLA 5FGRA 4KWUA 2VLMD 1FNGA 5J11C 1FBIL 6FABH 4FFZL 5DHVB 3QIBA 4PLKC 4PGEB 1RZ8A 3MRQA 4NHCL 1XAUA 3QEGL 1GC1L 1F02I 2ATKA 1KNOB 3MTRA 1F00I 5E56A 3N06B 1NGXB 3WNMA 1S9YB 4MNGA 4BYHA 1XGQA 2AV1A 5H2BA 1N4XL 1CS6A 5DQ9A 3P9LA 1TNMA 1T7YA 2F15A 1CTNA 4XI5C 4TSBH 4V1DB 1ZANH 4KKNA 3G5YB 4L8SC 4OCYH 2LFGA 3AMKA 4U0RC 3BP6A 1XFPA 1BHGA 4ISVA 4WIQA 3W82A 4GAFB 2X6MA 1NFDA 4V2CB 4M7ZB 3VXNA 2BRQA 3OF6A 5DLMH 1HCFX 5DEFB 3T4AA 4YDLC 5E08L 2XN9E 3TBVA 5TQ0H 5IFAL 1VEMA 3N0PB 4G9FA 2R2EB 3NA9L 3H3PL 5EIQA 5KSAB 2XRAL 1MCLA 4TUKH 4JCLA 2HTKD 2IANE 5CD3A 3EYQC 4UBDD 1K8DA 1AQKH 1ZWIA 1L7TL 5HHPB 4K7PL 3C08H 4HK0B 5IGXL 3EJJX 4MA3A 1KB5A 1EERB 2W9EL 5I1DB 3RDTC 3RIFF 1JYNA 4MJID 4P2OB 4JO4H 3F62A 4JQXA 2BJML 3GSOB 1YYMH 2YZ8A 5E8EA 1NPUA 1IL1B 4ZUSA 3D3VD 3ARFD 3GMRB 4D0DA 4XMKH 1AD9A 1T2QH 4POYA 4LSPL 1A3LH 4IMKC 1F3JB 4IIQA 2R69H 5JUEH 5H35A 3QCVH 4Y16C 1KEGL 3SDAA 1BM3H 3VRJB 1E4WL 4LRNH 1UXSB 2YPLA 5LBSH 3MRRA 4U1JA 2PTTA 2HT3D 4MSWA 1BIIA 3VRIA 3RVTD 5BJTB 1ETZA 1ZHLB 2CO6B 4U1GC 3RWFB 2NXZD 3U4EB 1V3LA 4DQOH 4KRPB 1BREA 1YDPA 3FFDB 2YRZA 2JELH 5KBNC 3M07A 4PJHF 1UJ3A 1FP5A 5ALCH 1J5OL 3N9GL 3PQYD 4XWOD 4M48H 4YE4H 3V6FA 2ZP0T 4NKOA 3V0WH 2VDPL 3LQAL 1F42A 4YGAB 3DVGB 4LSTL 2BY3A 4JZJB 1DBBH 1RHHB 2GK0A 4G80A 1QFWL 2Y6SC 3DETD 1LNUB 3G5VA 2B0SL 4QRUB 4AEEA 1IGFH 5DRWA 4PJXF 1M7DB 1U8LA 2QTEA 4TYUA 5EU6A 4S1DC 4C56B 3NH7H 1M05A 1PBYA 4LPTA 5FGCE 1Q0YH 4PJIA 3A6CH 1C08B 6FABL 3KLAB 4OZFG 1OGTA 1W2KT 3UTZA 1RUKH 3IAQA 1EV2E 1Q1JL 2W65A 4OLYH 2WUBH 1CU4H 3HE7B 3ZE2F 1R3IL 3B6SA 1H3XA 3LRGA 1SBSH 5CBAA 1HQRA 1S9XB 4AIZA 3C60D 3HI5H 3MFFB 1FYTB 5DUPH 3RIAF 1NMCB 1F4WH 1WWAX 3O9WB 5BV7B 4AT6A 3VGHA 3O8XC 3K2MC 4HWBA 5IHZB 3WNLA 3MC0A 5AWNH 4X9FA 1PYWA 1VACB 5C09B 2UWEE 1SY6H 3NCJH 1N3NA 4HMCA 4U3XA 1C12A 1ZANL 1QTYT 2HVJA 3HR5A 4KUZL 4WUKL 2BDNH 4OFKA 2JB5H 5GHWH 5BVPH 3EFDL 2BOBB 1A14L 4QNPE 3CLEL 3TP4A 4HLZG 2YD8A 4OLZL 4Q9RH 3PIQA 1UWGL 5CIPB 1KT2B 3VU2A 1DQMH 1A6UL 4JN1H 3TBYA 3HKFA 1U8JB 1H9VA 8CGTA 5DLML 1FH5H 4JG1H 1JYVA 4LASH 1RI8A 2EO1A 4P9MH 4WI9A 2NNAB 2JJUA 1LK2B 2R1XB 1MFBL 4UT6L 2O93L 1T2JA 1BQHB 4RA3A 4LCCB 3C5JA 2DF3A 3SDYH 2WWMD 3DVNA 1KGCD 4IDJH 5EZLB 3F7PC 3C2SA 1DZBA 2Z93A 4PTUA 3ILPB 1OOAA 4Y4KD 5EU6E 1UJTA 1I7UB 1ZA6A 2PXYB 4JO4L 4MMZC 1UENA 2EKSA 4PJIE 2IQ9L 4ZUVA 3T77A 1YYML 3QO0B 4BSVA 1ORQB 1FYHB 1RZIB 3D39A 5D1QA 4Q0XL 3VXPB 1I9IH 1MAKA 5J9PA 2FB4H 1REIA 3RVWD 1FL6B 5C0BA 2AGJL 5F8RC 2CLVA 4K9EH 2AJVH 4LSQL 4E41A 5BS0B 3BUTA 3RA7L 4J6RH 3CH8A 5CINH 3F58H 4XGZB 3QCVL 4R8WL 4EI5A 4Z78B 4G8EA 5L8LB 2OSLA 3OKDB 1BM3L 2OI9B 4LRNL 3UBXB 1D7FA 1BD2A 4KVNH 5C0CD 3ARFC 1G9NH 1W72H 2P5ED 3L7EA 1FJ1B 2CH8A 1RZJH 3FL7A 1U95A 4WTXA 2QEJA 3MGAA 5E2JA 4BQ6A 3GMPA 5EOTB 5E00A 2BHZA 2V6HA 3BP4B 1ONQB 4X4ZA 4WUUB 3B2VL 4AM0A 1A47A 3WS3B 1KOAA 4XNZB 2NY1B 4F33B 4KI5F 1AR1C 2HT3C 2MQ0A 4KDWA 3RVTC 4M48L 2FEDD 4OGAD 5D1ZD 3O41A 4NUGL 3X14B 3QO1A 4X0KB 4P4KB 1NUGA 3CDCA 5E8DH 1KPVB 2FJGA 5D93C 4IJ3B 4PJBF 4WHTB 3HG1A 1DBBL 2IH3B 3JBG7 4YDIH 3SE4C 1EHLH 5KN5B 2EDFA 3GEWB 1UZ8A 3N1FC 2XICA 2JB6B 4NN7C 4DKAA 2NY7H 2Y72A 2VAAB 4F37F 1NGWA 2OXGA 3EO0B 1UKSA 3QUXA 3L95B 3NH7L 2YRPA 1SJEA 3A6CL 3QEQA 5GRJL 1UGNA 4L4TB 4ZYKA 2Z4QA 2EE3A 4N68A 4TN9A 3L3DB 4XVSH 1AIFB 1AJ7H 1NCWH 3UAJC 2YMXL 5HYSG 5ESAB 3W2DH 4M4PA 4U1IB 3BWAA 4XNYL 5B21A 1TQBB 3CD4A 4RWYL 1PDKA 3D39E 3MRIA 5TJWK 1QSVA 2AJUL 3MZTA 2WUCH 2AEIT 4M5ZH 4U2ZA 3BE1L 4FXKB 4JRXB 1NANI 4LHQB 4E41E 2R8SL 1S5HA 2APWA 2ZSVB 3MCKA 4ODBD 3V4PH 5BQ7B 4JZNA 4Z8FH 1BGXL 4TSAH 2BC4B 3ARXA 2V5MA 3H3KA 1QA9B 2VR5A 4WFED 1XH3A 2VJXA 3L5WA 2BDNL 4X5WB 3RWCB 2JB5L 3OKLA 1BD2E 1M6OA 1I9EA 2VXSL 5IESH 5JXED 2H2PC 4FZEH 3E2HB 5DWUH 3DWTA 3O81A 1KIPB 1DQML 5C0JB 5JW3L 5JDSB 3L3OA 2P8PA 4NWTH 4JG1L 5IVZB 2A9NL 2G5RA 4QOKB 4JRYB 1QFPA 4M1DH 4U0QB 4O2EB 4BSWB 2OJZH 2EYRA 3EOAB 2GKIA 1SMAA 2ESVB 4Q9CA 1RURH 4FXLA 4QRTA 5I15L 3D87B 1TETH 1DQJA 1JPGB 1BBJA 1OSZB 2Q86B 3GJEB 1MWAL 4LVEA 5C0AE 1IBGL 4Z7QF 3MROB 3MLVH 3VXUB 2GIYA 3OJMB 4UB0L 2FBOJ 4JREB 3STLA 1CGTA 4JQVA 5I6XC 2Y5TA 1A7OH 2IALA 1YYLH 4UZGA 1A9BB 1EFXA 4XX1G 3QEQE 3X11B 2ORBL 4Y5YB 1G1YA 4ELMA 4UT7H 3RWJA 1MHHB 1Z3GH 4K07A 4H25A 4KDVA 5CINL 3O4LB 3U0WH 3CUPB 4Z0XB 4KTDL 4I5BA 1KXQE 4WGVB 4JHWL 3IFOA 5DQDL 3MOAL 4J3WA 2CKBB 5ACZB 4L8CA 1VGEH 1MCRA 2CJUL 4TSCL 5GGUA 2V5TA 5F9OH 1AGDA 2DWDA 1VPOL 4X9BA 5IKCA 4B7IA 5KJRH 1RZJL 2EDBA 5D72H 1LO4H 4XMLH 1PLGH 2BVOB 4OD1L 3QDME 2BX5A 1JMXA 3LVEA 3R0NA 2XTJD 3U7AA 5E6ID 3IDNA 3G6JA 4I18C 1FZMA 5EO9A 7CGTA 5HI3D 2VISB 1A6AB 4NQCD 1CFTB 4J1UB 4YDJB 4J3SA 4NQEB 3C09B 5AEAA 3CH1A 2WNGA 4HPOL 3D48R 3TC9A 3ZDXE 2YD9A 3LDBC 4NNPH 3FN9A 2NY3D 3KXFD 3UZQA 4NO2A 5ISZB 1Q9LA 4X6EA 1DQQA 4NGHL 3QIWC 5TE6H 4YBQD 4HUKB 4YHNB 1XGRA 1QSFA 3TVMB 5ID1B 4QXTA 3UTTB 4HIHA 1NLBH 1T7WA 1CDYA 2NLJB 5F7WC 4UNVA 1W0VB 2DB8A 3ULVF 1CBVH 5INCB 1HYRC 4JHAL 1JRHI 4H88L 3UCRA 1A9EA 3M45A 2Q76B 2VL5B 3PHQB 1JF6A 1NCWL 1CDIA 2VMFA 2XZAL 2Z92A 3DUUA 1TCRB 1U6AL 4R97C 4RRPA 1CVSC 4HXAL 4ONOA 1CD8A 3VXSD 1CDBA 2LU4A 2ADIB 1DQDH 2ARJB 4FQJL 4Z76A 3VH8G 3GB7A 2Q7YB 3HZVA 4UIKL 4XZUB 4ZUWA 2QLVB 4JPKH 4H1LB 4TNWF 3LIZH 3FAWA 1FZOB 3BD3A 1KCRL 4DGYL 4Z8FL 3VFUA 4TSAL 3RNQB 5E94B 3O3BA 5SX4H 1M7XA 2YN3A 1CFNB 1MCPH 2V2TB 1R3LA 3OKYA 3D0LB 4Z9KB 4LGSB 2X1XR 1OGAD 2IC2A 1NGQL 1HXYB 1SYSA 4OZIA 4P59H 4CVXA 3MNVA 3SDXA 5IESL 4KMLB 4FZEL 1AGCA 4OLUH 4YC2C 3BQUA 1EVTC 4NWTL 4NNYA 4QEGA 3T65B 3VWKB 4BSJA 3VD7A 3T0EA 2CXGA 5HY9B 1B0GB 1J1OL 1NC4A 1UH3A 3G6JE 3QQ9D 2ED9A 2SEBA 3QNXB 3U79A 4XXCA 5JXEC 3AM8A 4PLNC 1VGKB 3FQXA 2R39A 1S9VB 4KKLD 4WW2C 4BFGA 3HC0B 1AC6A 4QCIB 1BLNB 1F8TH 4HKXA 1JGUH 5GPRA 4DW2H 1G84A 1V7MH 1H3PL 5DD1H 2EIZA 4OF5A 4OT1H 1RU9L 1WC7A 3ZE1F 1ZS8A 3BJ91 3FONB 4OF3A 4BA8A 2X7LA 3MRCA 2EDHA 3FQTB 3H9HA 1QSFE 5D96B 1FGNH 5I1AA 4M93C 3EDEA 4GRMA 3FFCB 4OZHB 4M1GL 5I2IA 3TBTA 3NAAH 4HLZH 3SGEI 2AJZB 5HYJB 2EZ0C 3D39D 5D1QD 1WV7T 1G7LA 1KENH 3MNZA 3RQ3A 3HMXA 2R0WH 5F7MC 1I1CA 5FO9A 4ZFOB 2CDFA 2BNUA 4BZ1H 2YPKA 4GAGH 3QI9B 5D71L 3IAGC 2FYYA 2J6EL 2ENYA 2VB5A 3VW3H 4B41A 5EO0A 4Z0BH 2AABH 2Z31D 2PO6D 5D7IA 3CFIC 3WLWD 1K4DB 4R26H 2XZQH 2YZ1A 3WE6A 2EIBA 4LU5H 1LK3H 4CKVX 1LO4L 4XMLL 5MI0B 3F7YB 4GS7C 5EG6C 2AJ3B 2DIBA 5I1KH 1JJUA 4LARH 2CQVA 1WBXB 5CP3H 3UTPE 1TJGL 3OHXA 3ZKQD 4OZIE 3SDXE 3CK0H 4NOFA 3BN3B 3GDBA 3VFPA 5T3ZH 1S78D 1IFHH 3QNYA 3IKCB 1TIUA 1F6AA 2QADD 3QQ4A 4NNPL 2OK0H 3GJFK 4OI9A 4KGLA 5C0AD 1IGYA 3DMMB 4Y5XB 2IAMA 2PYFB 5I76B 3NTCH 3GBNH 3BXNB 2HJLB 4GMSH 1UXWA 3HC4L 4JPIA 2A6IA 2PW1A 2EDEA 1YUHB 1ND0B 2WAHA 3DO3A 3QUXD 1X5AA 2WINA 5IQ9A 3IB4A 2D4DA 1XR8A 1F11B 4X7SL 1JUFA 1IMHC 4U6TA 4ZTOH 5F7YC 5CJQH 4TTDD 4XCFH 1RZGB 4J7RA 4NQTA 2DLTA 3GMOA 3TO2B 3TF7C 1KIQA 4DGIH 3CVHB 4RNRA 4XP4H 4XP6L 1H8SA 1R0AH 3L5XL 3QIUC 4D0CA 4XTRC 4GMTL 4Z5RA 2OI9C 1AXSA 5JW5B 1LD9A 3OX8A 4NCDA 2RJMA 1MFAH 2DTSA 4F58L 3LIZL 1T0PB 3GZKA 4NC2B 3X12A 5CCKH 4FFVD 3ZTNH 2G9HB 3QUZD 4YPGB 4ODTH 1CICA 2A6KA 3EDFA 1AKJB 3ARSA 3QDMD 2AEQH 2OM5A 1IAOB 2CDGB 1NGZA 5FYLD 4WWKD 2GTWB 5IROA 3KDMA 2MKWA 3VFRA 1ACZA 5HJ3B 1G7JB 3DECA 3DYPA 2B1AH 5IVXB 5GRYA 4ZAKD 5IG7A 3SDCB 1P2CA 4TUOB 3NABL 1NGPH 3OKEB 1N2RA 1B4JH 4P4KC 3RJDA 3BVNB 4I48A 4L3EA 5SV4A 2R2BB 2WBJC 1NBQA 3D2UB 5FYKE 1Y18B 5MEQB 4APQB 3WO3B 1VSCA 3CU7A 3A6BL 4NCC2 4NNXA 3HA0A 4U1NA 1S7WA 1CLZL 3RX5A 4DW2L 4F9PA 2DOCA 3GKWH 3BP5A 3LKPB 3ZLQC 2VDOH 3IU3B 4U3HA 4OT1L 2MPAH 2MJWA 2P7TA 3DX8B 3NZ8A 5IHUL 1QFWI 1FGNL 3JV6B 1G7MA 3SKJL 3NAAL 1WQVT 2FATH 1MHPH 2L4OA 2Q3AA 1E4JA 3SOBL 5BZWA 3GJFB 1CYGA 4K71C 2K1MA 4ZOCA 4NSKB 3FO1A 1JF1A 5ITFA 4OCLC 2P43B 3NFPB 2R0WL 4MVBD 2VSCA 4XH2A 3DGGA 4HC1A 3NIDE 3SJVB 4JY5H 5KG9A 1IARB 4G6FD 2VZTA 3LEXA 2H9GB 1AI1L 4MAYA 1KIRA 1T3FB 1WSST 4MJ2A 2IGFL 2VZ1A 2AABL 1EFQA 4G6KH 4R26L 2XZQL 3MXVH 5DHVH 5K59F 2R0ZL 4QT5A 2GITA 4IOIA 4ACPA 4LU5L 4HG4J 3TPUA 3L1OH 4NKIH 1T6VN 2D7MA 1ES0B 2VLJA 3U4BH 1HINL 4HUWA 4O5LL 5I1KL 3GGWB 5IR1B 1PKQB 4LARL 1GGBL 2AK4D 2Y23A 4P2RB 2Z31C 1LO5A 1YY8A 5DK2A 2PCPA 1N5YH 4PJGA 3ARDD 3RAJH 4QF1A 2W60B 1KYOK 3VFTA 3N85H 1QZ1A 4JDTH 4WV1C 3QEUB 4PV9A 3L9RB 4L3EE 1EO5A 1U93B 3VFOB 2X70A 3TO4D 5F9WB 2ZNXA 4PTTA 3ARBD 5DK0B 1YY9C 3F7VB 1LE9A 4GMSL 4JFXB 4Y0GA 3DROA 3MCG1 5IP4A 2HG5A 3KYMA 2KL6A 1RK1A 3WIHA 1YJDH 3ZO0A 4NBYB 2H3NA 1LEIA 5GGVL 3U9PL 4YXLH 3HE6D 3FRPA 1ULVA 2AP2A 5ADPH 3RNKB 5J8OA 4HUXA 3T1FA 2JJSA 4HJGA 1KG0B 3D0VB 2ZG1A 4Z7WA 1QLRB 1KCVH 3I85A 2HRPL 5EN2A 4PRDA 1R24B 4RAHA 3LHPH 1NCUA 1KJ2B 3ZZ1A 2X05A 3UTSA 1AGBB 3PE9A 3GSXA 4XHQA 4XVUD 2Q3ZA 3KPOA 4LEXH 4P4RA 4UIMA 3K2UL 3V4VH 2Y07H 4Z7OF 4NJ9H 5DR5L 1K5NB 4U7KA 2ICWJ 2JJTA 4JFDA 1RJLA 3LN9A 1QBBA 4NM8H 4Y5VB 3WD5H 2CLRB 5J6HB 2VLJE 3CCHB 3QG6A 4P23B 1MFDL 4L3CB 3S5LG 3O2WL 4U1LA 5CUSL 1U92B 2FDBP 1PZ5A 3JV4A 2BNRE 3ALWA 5IJKA 5DTFA 4WWKC 3QUYD 4RAUB 4UI2A 4LHJB 2YOCA 4Y89A 3MO1B 4MHHG 2Z8WC 3MLZH 3HI6H 4F7CA 4ZAKC 5I1EL 4NQSB 1U8HB 4OLWL 4LLWB 1H5BB 4KI5C 5CD5D 1EHAA 1K4CB 3HNTH 2H8PA 2XWTB 1KCSL 2D0GA 4WI8A 2MNUA 4MJIB 4A2LA 4QRSB 3BISA 4JFPA 1CR9H 4NN5B 4LVOC 3J7HA 5GXBB 1FG9C 4KY1L 3MUGA 5EU4B 2VLKA 3D3VB 1Z9LA 4LSUH 5E99H 2IPKA 3VXQA 1E4KC 4X98A 1MHPL 1T21B 5I9QB 4HDIB 2BVEA 1J10A 1D5BA 1NMAH 5EU5A 4PRAA 4JJHA 2QR0B 4TVSa 3ZL4H 5HHXH 1SY6A 4G6JH 3OXSA 1F6FB 3B5TA 2UY6A 2O5XL 3M17A 1P1ZB 3TWCL 1J0IA 3RBSA 1Q8MA 3K4DA 1VFOA 1W0YT 2UYLA 4K7PX 2I60L 4D0BB 5DMKB 5IBUB 4G6KL 5EPMA 4XCYA 1NUFA 4MA7H 5K9QG 2CDEB 2VWEE 5ICZB 4PP1C 3UTSE 4MX7B 2NXZB 2VQUA 3NA4A 4ZXBB 4LKCB 3E1F1 3CC5B 2GQHA 4NO5A 3EZ8A 5BV7H 2P8MA 4XWGH 3PQYB 5SX5K 1N5YL 2V9RA 4HQQH 1MCWW 1FNEB 4EOWH 5FYKD 1T1ZB 4JDTL 4LMQI 4TRPL 4F80A 4XCNA 3SE3C 2NR6C 4NPYB 4UQ2B 3EFFB 3TYGH 1M1SA 1RUAH 2HWZL 4P99A 5DHXB 1I7ZB 3KYNA 1KJ3H 3MR9A 3QHZH 2BSSB 1KFAL 3ARDC 4N1CA 4OKVB 1CZ8H 3HAEB 5EU3A 3VFWB 4MHHI 5D96C 3C8KB 5LWYH 3LRSB 4N90D 1AQDB 3N50A 4U6HB 2EDYA 5CWSB 4YXLL 3QRFM 3S37X 4WDIA 5ADPL 3C60B 4OZGF 1S9WB 1H3GA 3KR3H 1BPVA 4Y2DB 2HFGL 5EUKA 1I9JL 3JVGA 1PX4A 4QRPE 5DVOA 1FDLH 1CGXA 2VLKE 5DRZA 3LN5A 1B90A 4HFWB 3PJSB 1ZA3B 1NFDF 4PJFF 4OCSL 3QDJD 2CMRH 1I3RA 3U6RA 1W72A 3HE6C 3WL9B 5FUOH 1B3JA 2GHWB 3O3DB 4AG4H 3LHPL 4PRHE 3S37H 3DPBA 4YHYB 4GO6B 4KDTA 4NDMB 5EC1A 5HGDA 4NN6C 1XGTA 3TA3B 3U1SL 4LEXL 1QSZA 5MI0C 1X7QA 3V0VB 2Y07L 1NEZG 3FB8B 4M02A 4NRZA 4PJAF 3OKMA 5DMIL 5I16B 3WKML 1M4KA 3ARTA 3OKNB 5ENWB 4X7TB 4LCWB 4RISH 4DVBA 1VA9A 5LKNA 5K9QI 2CLZA 1QSEA 2YKLH 5DRNA 1R5VA 5FO7B 3O6LL 5KW9L 1HOCA 3VXRA 3DBXA 4GG8A 3P0YH 5A3IC 5L9DL 5F7DA 3O2DH 4R4NC 4UDUB 1KCKA 4WI5A 3HI6L 4PRPE 1KCLA 5F1IB 4GW5B 5E5MA 3TZVC 4LGRB 1SJHA 3SKOB 2CRMA 2W9DL 3SCMD 3T0AA 1LDPL 2ICWI 1D5ZA 4WTWA 2OR8A 4Y4KB 4YHKH 3MRKB 1KBGL 3JUZA 3MRGA 3SGDI 4QNPF 1N6VA 2ZSWB 4Q2ZB 5GZND 5J13B 3MMEB 4LSUL 4LLUA 3IETB 2NW3B 3S35L 4GKNA 1S8DB 1ZT4B 4OAWA 3SDDA 5K33A 1OB1A 1NMAL 1HEZA 4NRXA 3FN3A 5GZOD 2QJDA 3DI3B 3RTQA 1T0MA 3ULVC 2ZUVA 2P1YA 5DSCB 4UT9H 4U4BA 1X5IA 5BZDB 1T0NB 2DYPB 5F7EH 1A3RL 2DQGH 4CDGC 5FKAA 1AD0B 3IJYA 3MRJA 1MJ8H 4PJDA 3BEWA 4X6BB 1F4YL 4I3SL 3ZKMD 1GJIA 3DXAA 4BFBD 5C0GB 5HYFA 1B2WH 1J9CT 4AIOA 2ARWA 2X4UA 5GJTL 4ZS6D 3QG7H 5HGGS 2XN9B 1CLYL 1MELA 2GCYB 5BV7L 1OTTD 4NO3B 4JG0H 1A1OA 3QZWB 4FN0A 1U2HA 2BNRD 3GMNB 5D1ZB 1XGPB 2D7QA 5IFHH 2VDKL 2IANB 3OR6A 4EOWL 4P5TC 1QSEE 3FOMB 4KROD 4JDZA 4A6YA 4APQC 2W07A 4X4YA 1BX2A 1YEEH 3GM8A 1LEGB 5DI8B 4LKXA 3ZSTA 3TYGL 4ZUTA 1DLFH 4BUGA 3KYOB 3SKNA 3G08B 4ZOAA 5T3XE 3EYFA 4JFOB 1UM4H 2Z0BA 2VUOA 3BKYL 5TQ2L 3GIVB 4K7FB 5GJSH 4EEEA 1N64L 3LN4B 1FNGB 1GGIH 1L0QA 3BUYA 3GSNA 5LWYL 1C5CH 5CLTA 3U7YL 6CGTA 5I1GH 3IJHA 4WRLA 1KPRA 5TFSH 1OTUC 1BJ8A 4CN1A 4AL8H 4LCYA 1TJHH 3KLSA 1AGEA 1UVQA 3QWRA 5FGBA 2YPVL 2X89D 1YZZA 3MRQB 1R3KA 5FCSH 3ZYIA 4UOW1 4WO4A 1WK0A 3HUJE 3ZDZE 2ATKB 1V3KA 3G5ZB 3FB6B 1A6ZA 5IMMA 2EXYD 1S5IH 3WHXB 2C1OA 1YQVH 3M1BA 2AV1B 4PJ9C 3OQ3B 5FUOL 3P9LB 1MFEH 4WI4A 3W9EA 2YRLA 4M6NH 4L4VD 4UMGA 1IGJB 4LBEA 5FECA 2X4RA 5A2JH 1QBAA 3R06A 4MZ2A 3B8SA 1MAML 1OVZA 3C6LD 4ISVB 5D9SA 1RZ7H 3INUH 4PD4K 1KYOJ 3DXAE 4HD9A 3RGVD 3VXNB 3PV6A 3JTTA 4YXHH 3AB0C 1J05B 2I27N 2APFA 3T4AB 2AK1L 3B4NA 5DQJA 3BGFC 2CKBH 5I8CB 2AI0L 1QYGL 2JKXA 4IRSD 2KZ1B 3U30C 2I9TA 3WJJC 5CD3B 4EQ3A 1S7UA 4X5XA 1FNSL 1K8DB 2XWJA 5D1XD 5FGCB 1K3ZA 2X2YA 3T8XB 1ZWIB 3BWUC 4WJ5A 1MPAH 3HS0A 1N6QH 3VI4E 1KB5B 4OUOA 3QDGE 4WI3A 4TVPL 4XNXH 2H1PH 4JM4L 4W6WB 1I1FB 4HFUL 5TH2A 1VB9A 5E8EB 4QRPD 2AEWA 4I77L 5E2VH 4D0DB 5FA3B 3NCYS 2Z35A 3OXRA 3QHFL 1AD9B 2QKIA 4RMSA 3H7BA 5C07D 3MBEA 5C2UB 2UWEB 4GW4A 4PGDB 4PRHD 4WI2A 2EH8H 2VNCA 5JIHA 4AZ8A 2OR7A 4UT9L 3RWDA 4JLRA 3UJIH 5F7EL 1A3QA 3BZ4A 2PTTB 3T3PE 2I26N 5I1JH 4QYOB 4MSWB 5FAAA 4M3JA 1JNLH 5HI4C 1ETZB 3HZKA 2A1WL 1YNKL 4OZFA 4HKZA 1DLHA 1XIWC 5CGYD 3HPLA 5E6IB 3T0BA 3C2AH 2HT4D 4XNMA 3I6LE 3FT3B 1LGVA 4I2XE 5D7SH 4H1LH 1DUYA 1PAMA 3HZMB 4NQCB 1BFVL 3PHOA 4MWFA 5D7JC 5CFHA 3V6FB 5T1DH 2F5AL 3RL2A 5I8EB 3LS5H 3QUMB 2GSGB 2NY3B 4PRPD 2RFXB 4MNQA 3EZJB 1YEEL 1IGTB 1RSFA 3MJ8B 1CGWA 4G80B 4ONFL 4WFGD 5FYKU 3VE0B 2Y36L 2CGRH 4HUVA 3G5VB 3QXAA 1SMOA 2FECL 4LLDB 1UM4L 4PR5A 5EU6B 3O0RL 2ZUYA 4CGTA 3OZ9L 5I73C 3BEVA 4PJIB 2EEAA 4NN5C 1OGTB 5L7XH 3D6GA 3UTZB 1ZLWK 3PP3K 5I1GL 2W65B 2DQEH 3QPXH 3BPOB 4W81A 1HH9B 2Z91A 4JHZA 4AL8L 1MLCA 3B6SB 5HYQB 1HQRB 5ITBL 4AIZB 2IMNA 1D6EA 1I8KA 2IQAB 3BGMA 1NL0H 4F57H 5IT2L 4AT6B 3OGCA 4UOJA 1NFKA 1BAFH 1YMHB 4YBHA 4DAGH 2HKHH 1CLOH 3RUGA 2YD2A 1PYWB 2NW2A 2H6PA 2A6DA 1KCUH 4Y2OA 1C12B 4WEBH 2R15A 3HR5B 3IU4H 1SQ2N 5ILTL 1HYSC 4KUCF 4M7KL 4OCMC 1J1PL 4H26A 3PIQB 4R4FH 2O5YH 2RGSA 3R4DA 4Q6YA 3WHE0 1S3KH 3PGFH 4ETQB 4M3KB 3TBYB 3ARWA 1KXVC 1GCFA 5CEZL 3NFSH 2AXJA 1NCCH 2ZPKH 2BNQD 3S8WA 2CRIA 3BSZH 4LRIA 4YGVB 2CKBL 4H20L 5I75B 1QHPA 3KPTA 1MCQA 1CQYA 1A5FH 1XCTB 3DVFA 1Z5LA 4ELMF 1RULH 4OM0H 5TE4H 3SGKC 4L9DA 1Q9OA 5ALBH 2BY0A 2DIJA 1MJJB 2Z93B 4PTUB 3WIIL 3FQUB 3B9KA 3HNSH 1FNLA 1HWHB 4IRSC 4R4BB 3ARQA 4KHXL 4MAUH 2UZXB 3CFEA 1AY1L 4H0IA 1C7SA 4ZUVB 5KS9A 3TV3L 3T77B 4I0PC 4HUNB 1OSPL 3WFCH 3OTTA 4D9QD 3D39B 5D1QB 1HDMA 5E2VL 3VMOA 2DIAA 5J9PB 4HIJA 4GRLA 1RJCA 4E41B 4RDQG 4W4OA 3BPNC 5DJDA 3LKRA 4K3EH 5F1SA 3MOQA 3NN8B 1OAKL 1DTUA 1HI6A 4G8EB 1U9KA 4P3DB 4IM8A 2WM0A 4KC3B 3JXAA 4TQEH 2PO6B 1OM3H 3I84A 3UJIL 1BD2B 1EGJH 5I0DA 1L7IH 3RUGE 3L7EB 3O6FD 3CFCL 3MREA 4X4XA 2CRYA 1BWMA 3DXAD 4LSSH 5E00B 4KZDH 3DIFA 1HZHL 1A4KA 1NJ9A 4AM0B 1KJMA 1NGYA 1OCWH 5HYSA 2M8XA 1EX0A 1A2YA 2XOTA 4ODUA 5E2TH 1F3RB 3H0TA 4OJFH 3T2NH 4HS3A 3REVA 3VWJA 1WFNA 5T1DL 3QO1B 1IKNA 4F8QA 3QISA 4WHCA 2ITDA 5CSBA 5CAYB 5C0AB 4WHYH 1UZ8B 2CGRL 4XPFH 3MA9H 4P48A 4ZQKA 3QDGD 4ZD3L 3QUXB 1GGCH 3OWEA 3C5ZC 3TH4T 1SJEB 3QQ3A 1BZQK 2E6JA 3QEQB 3FO2A 1TENA 1TTGA 4FZ8L 4PGBB 2Z4QB 5J13C 5JMRA 4L29B 4HS8H 5DD6A 3QWRD 1INDH 4ZNEA 3BWAB 4JFFA 4PJ8A 1MIEH 3VDAA 2VXQL 3B2UD 2VLRA 4I4WB 1NL0L 4OZIF 1UM5L 3SDXF 3MRIB 4KKBD 5E2WH 2DTMH 4ZPTA 3GMLA 4J4PD 4X7FC 1GHFL 1D5MB 3RPIB 1GZQA 4H0GA 5DHVA 2PF6A 1QPPA 2VKWA 1S5HB 4JZNB 1OL0A 2R23B 3QUZB 3WXVH 2C26A 3RGHA 4MB3A 3QDMB 5F97E 1XH3B 4UINL 4J8RA 3IU4L 3LKSB 3HI1A 3OKLB 1M6OB 4K8RH 4TNVK 2D3VA 1QR1B 1NGXA 3GJFH 4HEPG 1S9YA 5KAQF 4KQ4H 1JPSH 1A0QH 3QWOA 4R4FL 4Y8AA 4G43A 4ZFOL 4X80H 1S3KL 2P8PB 1XF2B 3G5YA 5JOPE 3OG4B 2MKLC 3BAEL 2MMXA 1QKZH 2XKSA 1OLZA 3IDGB 1S7TB 4X5LA 3QA3B 3WFEL 3GK8L 5EB9A 9CGTA 2NY4D 5A43C 2EYRB 3SE9H 1A5FL 1WUNT 4QRTB 1RULL 1DQJB 2B20A 1I3GH 1BBJB 1CE1H 5HHNA 5DEFA 3CAFA 2ADJB 1OQXA 3GSRA 3KJ6H 2NY2C 3EO9H 3IFPA 4ZFZB 4M6AA 2ZZUT 2R2EA 3LSOB 4JKPH 3ULUE 3HNSL 5CSGA 3STLB 3STZA 1DDHA 4IHOA 2Y5TB 4LL9A 1PD6A 2IALB 3QIBC 3ESUF 5FYJH 3SO5A 1EFXB 3VFVA 5D7IF 2FH8A 3QH3B 3GI8L 4O00A 4N8VB 5DC0A 3RWJB 4HK0A 3PXJA 3FRUB 4LSRH 5KVFL 5CP7B 4N1HB 4H25B 4ZNEE 4Y8DC 2X4TB 4JFFE 4P2OA 3GSOA 2VLRE 5FF6B 5CJBA 1YN6B 1IL1A 3IFOB 3FZUD 3EJZC 4OCXL 3RVXC 1SEBB 2EDKA 2B39A 1EGJL 4PD4J 3MBXH 5IKCB 1JHTB 2CPCA 4ENEC 2EC9U 4LSSL 3TT3H 4N0UE 3NFNB 4KZDL 3P77B 3VRJA 3CVHL 1MEXL 3BDYH 3RI5K 32C2B 3IDNB 1FE8H 2LU7A 2XQYG 4JZOA 4RMRA 3G6JB 1T2XA 3O6FC 1FZMB 3ULVL 1KJ2H 4XX1E 3T2NL 3SQOL 2MCG1 5EFIA 5JLZA 5ANMA 5C0ND 2BZDA 2M1KA 3ESVF 2GSIA 3FFDA 1Q9LB 4X6EB 3VFSA 5E9DA 3LEYL 3TO4B 3ARBB 4NFBA 3QXUA 5GRWA 1MRDH 4KJYA 5HBBA 4XPHH 4O2FA 1QSFB 4QXTB 4HIHB 2CUIA 3T1WA 4KK9C 4JQXC 1QFOA 2HTLC 1RQ5A 1A9EB 4BQCA 2EDRA 1YMMA 2Z92B 3DUUB 2J7LA 3I9GH 1KIUA 4C56A 1MIEL 4IIQC 5BW7A 4CADB 4ESKA 3KLAA 5JHLL 3HZVB 1IM3A 2D7TH 1I9RL 3SDAC 1A02N 3O4OB 4WU5B 1HQ4B 2V9QA 2IWGA 1K3IA 1WT5C 2WP3O 3VFUB 2ZCHL 3AS1A 4XP9L 1PSKL 1FYTA 2KDGA 1AO7A 3BGAA 3B2UC 3W11D 4XXDA 5BOPA 1RFDH 5EOCH 3NCMA 3O9WA 4Q97A 4HIXH 2KUTA 4DN4L 5IHZA 2W0KA 3ARZA 3U0TA 1NUNB 1SYSB 4OZIB 4KQ4L 4CVXB 1A0QL 3MNVB 4P2QA 3SDXB 1VACA 3UZEA 1UJ3C 3BQUB 2FGZA 4NNYB 2ZOKB 3V2AR 2NY5C 3D69A 4PYGA 1G6VK 4M1CC 4G8IA 1E6JH 3ARED 4MQXD 1I1YB 3QUYB 4P9HH 1P5VA 2SEBB 4NRYA 25C8H 5FHBL 5GGTH 3MPCA 5F96H 1KT2A 3FQXB 1F58H 4NKDA 1CDJA 3TNNB 1U8JA 5BMFL 1I3GL 5ANME 4HX1B 4BKLB 3S4SG 3EO9L 1T7XA 5E9DE 3HN3A 1H15B 1L9MA 2NNAA 1WC7B 3B9KD 1ZS8B 1LK2A 2VUYA 2X7LB 3BPOC 3MRCB 4GXVL 4N0CD 1Q38A 4K2UL 3QNZA 1A8JH 5FYJL 4LCCA 1ZGLP 4HCRH 2WMPA 3TBTB 1KC5H 2DQIH 5EZLA 3ILPA 4PYHA 1CXIA 1G7LB 5GISL 1YMME 4JKKA 3OGOE 3I50H 5FO9B 5LJYH 1CK0H 1NDGB 4ZOBA 4MD5A 5JPNB 4MCYA 1JGEA 2GJJA 3WEXA 2FYYB 4OCNC 4R7NB 2JCCA 1UCTA 2QSQA 4PJGF 2J4WL 3VXPA 4BUHA 1U8IB 2E7LC 1FC2D 3PL6A 5L8KB 1EH9A 3WE6B 1EMTH 1N8ZA 1ZOXA 1FYTE 1X5YA 1JPST 1AO7E 4HIEA 4RSVA 4DK6A 2XPGB 5KSVA 4ERSH 2AERT 5JOPD 2VQTA 2YA2A 4OF6A 3UBXA 1MCOL 3FZUC 4OV6F 1BWWA 3P11L 1PQZA 3U2SA 4P2QE 5CJOH 4LGPB 5LG1A 1DQLL 2VIRA 3VFPB 2IH1A 3D18A 3VWJD 5L6YH 4Z7VF 3SE8L 1TMCB 1P4BL 3P73B 1F6AB 3BP4A 3QQ4B 1ONQA 1LDSA 1NCTA 2VDLH 3WS3A 4WEUD 2XZCH 5T1KA 4MA8L 1E6OH 4FFYL 4NKMA 4F33A 2IAMB 4F7MA 2VZ3A 4JQIL 3ULUD 4JO2H 1TVDA 1MRDL 5JHDD 1UXWB 4JPIB 1MNUH 2PW1B 3GNMH 4XPHL 4Z7WF 4XPTH 1V5JA 4QRQB 3P30H 1T22A 1XR8B 4I0KA 3G6DH 1VEPA 5GSVB 1JUFB 1BBDL 3V8OA 4KMQA 1QRNE 3W39A 4ZSOE 3LKOA 4OCWL 4YIQA 4D94A 4HKJB 3DX6B 1V3MA 2VAAA 3I9GL 4DK3A 5JIKA 3L95A 3RX8A 4FQIL 3TPKA 1U3HD 5HHMD 1KIQB 1MCKA 3PP4H 4PB0L 4EI5C 1H8OA 4OQTH 5MEPA 1F4XH 4HPYL 4D0CB 5J12B 2F54D 1AXSB 4NIKB 1OP5K 2Q8BH 3ZDYE 1A7PL 3VJ6A 3BKCL 3T04D 3X12B 4U1IA 1ERNA 3EW3B 5BRZD 5SX5H 4DKFH 3RU8H 1WZKA 1CICB 2JCCE 3WFZA 3UO1H 1N5AA 4YHOL 1RFDL 1NAMH 5EOCL 4LAQH 4RQQA 5FHAH 3UDWC 3MLTA 3CX5K 2W9LA 3DURA 2HT2C 1GSMA 4FXKA 1R3JB 2VYRE 4RGND 5BQ7A 1Q9WB 3HFML 1UM6L 1G0DA 2BC4A 4OFPA 4ALAL 1QA9A 1P2CB 3GSWB 5GS0D 2AQ2A 1N2RB 3W11C 3WJLA 3RWCA 3MRBB 4KXZH 3ABZA 4HIIA 1Z6JT 4I48B 4L3EB 2AJYL 4P46C 4P9HL 3T2OA 3OKKA 4MLSA 3RY4A 5HPOA 3GIZH 1J0KA 4D3CH 1UG9A 1KIPA 3WNPA 1F58L 3RVVC 4KGJA 1U41A 3CLFH 4NNXB 3SKMB 4U1NB 1S7WB 4QOKA 2PETA 4MDJB 3SCMB 5C8JA 3BP5B 2BVUA 1QFUH 5MENE 3TNMB 1FQ9C 2WSKA 1NSNH 2P7TB 3SQBA 3ZT6A 4KK5D 3BFOA 1PX3A 1JHKH 2Q7NA 1JPGA 1G7MB 4QRRE 5DJCA 4KV5E 2FIKB 2FECI 1YEDA 2GY5A 1LHZA 1RZKC 5EUOE 1H8NA 3MROA 2DQIL 4MLIA 1AFVH 4FABH 1C5DA 5BZWB 1UKQA 4YHLL 1DN0A 1S7XB 1P4LA 5ITFB 4CAGA 1CK0L 3DGGB 5IBTL 5KG9B 1A9BA 3U46B 3LEXB 5E4EB 4CUCA 3X11A 1PKOA 3C5SB 4JE4B 1KIRB 4MAYB 4Y5YA 4ZTPL 2GT9B 4H8WC 5E5UB 2DQTL 5L0QC 1T1XB 1J12A 5DC9B 2VXUH 1AXTL 1ITCA 4DEPC 4NYLA 4IOIB 1EMTL 2UZIH 3LRHA 5FDYA 4KJQD 3TPUB 4XP5H 4XC1H 4W70A 3T3MF 3WXWH 2VLJB 1KTRL 2W38A 4R0LB 2EEBA 3S35X 4B53A 4KKAD 3N1GC 4TULH 2BNRB 2VE6B 4HHAA 1LO5B 2E5EA 1JWUA 5CJOL 2PCPB 3IDMB 1L4IA 5D5MF 4QF1B 3QFJA 3ARGA 1BJ1J 5L6YL 2BVOA 5JTWA 4KROB 4GBXC 3R0MA 1OAUH 3SGJA 15C8H 4YNYB 1U3ZA 2X70B 4BH7A 3NVQA 4IRJD 3RY6A 4Y1AA 4JO2L 2VC2H 3KLHC 2VISA 1LE9B 3DRQA 4KH2A 4J1UA 1HHGA 1MNUL 5KVDH 2OP4H 4XPTL 4JQVC 4QOKE 3SY0A 5I1CL 3P30L 3BD4A 1QLEH 4DKEL 5DK3A 5ELIA 5BOZG 2BP3A 1HE7A 5C92A 1MIMH 1VFBB 1JI1A 5ISZA 2QQKH 4N0YH 3AMLA 2AV7B 1KF9B 3GRWL 3TVMA 4JEGB 1G6RB 5ID1A 1FCCA 1AHWB 4MDIA 3IXAB 4HUXB 3S5LA 3T1FB 1W0VA 5INCA 4UV7H 2Q76A 3EHBD 1OAQL 3UTQA 2YHGA 2ZCLL 5CGTA 3PWPA 1J0ZA 4DGVH 3UTSB 4MB5A 3DGCR 5LCVH 5DEGA 4QTHA 1IGMH 1JGVH 3GSXB 4P4RB 1RUQL 1ZSDA 3UO1L 2Q7YA 1IC7L 3LS4H 1TPXB 1K6QH 1FZOA 3HPJB 4Z77A 4EI6B 2ZNWA 3ZKXB 2FX8L 1YPZF 5E94A 1KACB 2EE2A 4K94H 1DQTA 4U1LB 1NKOA 2V2TA 1VENA 4X7DC 3BKML 3D0LA 1PZ5B 3JV4B 5DJ2A 4YUEH 4OM1L 4FP8H 5C0EB 2NXYB 3RZCA 4OI8A 3QFJE 2C7UA 2CIIA 4D9RE 4RGNC 3PHSA 4DOHE 3QCTH 1IC4H 5D1XB 4F7CB 4XAWH 1JNNH 2VH5H 3NACH 1LWRA 4H5SA 5HY9A 5J1TC 4G5ZL 3SO3B 1CXLA 5FKPB 3BJLA 4Y1AE 1QRND 2H32H 4P49A 5GRZA 4G8GD 1JHLL 2XA8L 1VGKA 3JWDC 4JFPB 2P49B 3HC0A 3QUMH 4QCIA 4QRPB 1EAJA 5E70A 1PG7W 3MUGB 4M03A 2VLKB 1H3VA 4PJDF 4UTAL 1KXTB 4D9LL 3ET9F 3O2VL 4CMHB 3K8MA 4G3YL 2HP4A 1D5BB 5DT1L 1XF5B 1IGIL 3D85D 5EU5B 4PRAB 3FO9A 3S34H 3FQTA 4PRHB 4WFFD 3OXSB 3MLXH 5KSBA 3LV3B 4OZHA 1B6UA 2NX5A 4S1QL 4YQXH 1UEMA 3L3GA 4ONGH 1MCFA 2UYLB 4QTIH 1NCDL 4YDKL 4K7PY 4HV8A 5EPMB 3PWPE 3PUCA 4XCYB 2J8UA 2B4CC 1LP9E 2WP3T 4MQSB 1I1AD 4JRWA 2OTUB 3QBTB 3BQUC 2K3TA 5TPWH 4AENB 4NO5B 4NZDA 1Q0XH 2EDTA 3T0EC 1K4DA 2ARJQ 4MMXC 5DDHA 5D6DA 4G6AC 4I9WE 3DRTB 5J6GB 3V7AG 2FX7H 1FFOB 3UJTH 3AM8C 3OKOB 4WFHE 4PRPB 4EQ2A 2R29H 4XCNB 3AVEA 1OAUL 4AEHL 2AJ3A 3GSUB 1U0QA 3TH3T 1MF2L 1WBXA 2PTUA 4PRIE 2DLHA 5MEND 3KYNB 5ESVB 5L88H 5EORL 3D5OF 3MJGX 1ZTXH 2IMMA 1D9KD 2GY7B 4GG6E 5EU3B 2APBA 4QRRD 2OQJB 1NEZA 1T1WA 2YXFA 3X3FL 1GC1C 3L3JB 1MIML 3DMMA 4EN3C 4Y5XA 4HMDA 3CFDB 3VXME 4IRJC 2HJLA 2DQJH 3ZE0F 1BQSA 1YUHA 1ND0A 5EUKB 2A38A 4GUPB 2XA3A 5DRZB 1TZIA 3MV7A 4YHMH 1F11A 2Y1VA 3ZTJG 5JW4R 4CRPA 3U6RB 5E03A 4FQLL 2FGWL 1DANT 4UTBL 1KB5L 4L8SA 2FZ3A 3G9VA 1AP2B 5KSBE 5EC1B 1QNZH 4OZHE 1XGTB 4GSDL 2NX5E 5FOJA 1JGVL 3B5GA 2QHRH 1IEAA 4JM2D 5F9DC 1T5XA 4M4RA 4NRZB 4AH2B 3OKMB 5D7LA 2F53E 4OLVH 3LS4L 2G5BB 2J8UE 2E7HA 2X4QA 4HWZA 3E3QE 1MVUA 3BYYA 2G9HA 1N7MH 2CLZB 4YPGA 1AKJA 1QSEB 2R0KH 5ETUA 4RMTA 3K3QA 2F58L 5DRNB 3EAKA 1R5VB 3T0VA 1Y6KR 1VDGA 1XEDA 2GTWA 4YUEL 3ZT7A 4GG8B 2CSPA 1ZLWH 3PP3H 3FO0H 3MRHB 3T08A 5F7DB 2BSRA 1A7QL 1G7JA 5FDWA 5IVXA 4FRWA 3KS0J 4ZDHB 1IC4L 4WCYL 3SDCA 1P7QD 2W91A 4PJCA 3HR6A 5E5MB 4JN2B 4OTXL 3MACH 5KVGL 1SJHB 5F1NA 1X4XA 4UDTA 1U8QB 1D5ZB 3BVNA 5E1AA 3TFKD 2R2BA 1BF2A 3RDTA 1KLUB 4C57C 1VKXA 3V52H 4U33A 1Y18A 2BXYA 2NY5L 2NTFA 4J2XA 5MP6H 1TNNA 4LVNC 3HUJB 4ZS7H 3LKPA 1RY7B 3WN5C 4GKNB 4ODHL 3IU3A 4YBLC 1OP9A 4IMKA 4OAWB 4PUBH 4YK4C 2PKDA 3SDDB 1OB1B 5T33L 4NRXB 1HNFA 4M8QA 1INEH 1T0MB 3O3AA 5I1IH 2XYCA 3O11A 3QULA 5E8OB 3MV7E 2ZKHL 3BX7C 4DKDC 5CLWA 3WUZA 3DSFH 4S1SH 3GJFA 5FKAB 4GRWB 3MRJB 2HKFL 2H2SD 1KTKE 4DTGH 3BEWB 3NFPA 2QQQA 3DXAB 4LLQA 2LTQB 3SJVA 1U2CA 1GIGL 3V0AC 1RVFL 1MUJA 4UILH 3TYFB 5F6HJ 5D7LE 1UYWL 4O4YL 2UVEA 3VRLE 4HWBL 3H42H 2AJSL 3SHSA 4OFDA 2RQ8A 1Z9MA 2EEDA 4TPRH 3OR6B 1W0WA 4A6YB 4JDZB 2R29L 5KTEL 1BX2B 2I9LA 4BQBA 3GGWA 5FUCE 5IR1A 1Q9KB 5FYLH 3B9EA 3Q6GL 4LKXB 3E6HB 2M2DA 1DBKL 3SKNB 2R9HD 3EYFB 3RWGB 3QDGB 1ZTXL 3KYKH 5DXWA 3I75A 5FK9A 3GO1L 3PGDA 4PJCE 3BUYB 3GSNB 2P24B 3QEUA 3BT2H 4UV4L 5DGRA 3EOBA 1U93A 1ZHKB 2LV4A 3PNWB 1UVQB 1NC2A 2GJZA 5DK0A 1CVRA 3Q5TA 4XC3L 3F7VA 1R3KB 4JFXA 1D9KC 4KFZC 1ZT7A 1OTSC 4MXWL 2HH0H 1JN6A 3QRGL 2CO7B 1I4FB 1JTOA 1S7SA 2IEPA 4YZFF 2C1OB 5TDPB 1DL7L 1AE6H 5DURD 1FAKT 3W9EB 1EBPA 5KVEH 3PWPD 1U91B 5F70A 2ZUQC 1BF8A 2WW8A 4LBEB 4NZTH 5FECB 2X4RB 5GS2D 3VDCA 1ZXQA 1FVEA 3BIKA 4RFNC 4I2XB 5D9SB 4OLVL 2D9CA 3JWOH 4GQ9H 3SEPA 2VKXA 1KJ2A 3RKDD 5DD0H 2BCKA 1L0XA 4YDVA 1LMKA 2HYMA 2NY0D 4WFHD 1RIVL 5DQJB 1TCMA 2NY4B 1RUMH 1K5NA 2EIDA 3IFNH 1WAAE 2NYYD 4PRID 3V95A 5C7XH 5KS9F 1JBJA 5CEXB 2I9TB 1TITA 3P9MB 1S7UB 5I1HL 2X42A 4HW6A 3D1MC 1SHMA 5GGRY 4ZFGH 4WJ5B 3PG2A 3HS0B 4RAUA 3IF1A 4BK5A 3BZFA 3VXMD 5A2IH 3MO1A 3VG0H 4PLJD 2J2ZA 3U36A 2GAZB 4NQSA 5IQ7L 4LLWA 1H5BA 1JZ4A 2AXFB 2OR9L 1J0HA 1K4CA 4O9HH 2O5ZH 4WY7L 2Z35B 3OXRB 2XWTA 3IS0X 3QFDB 5FXCH 5I17A 3S88H 2QKIB 4MJIA 4QRSA 3MBEB 3ZKNC 5DFWH 4GW4B 1IT9L 3RHWK 2V17H 1UA6L 1IEBB 1G7IB 5I30H 2DAVA 3D3VA 4Y4FD 1B4RA 4L5FL 3ARFA 3RWDB 4JLRB 4PRBA 1EVUA 3C8DA 3DSFL 1W8OA 2F53D 1WEJH 3HZKB 1YEJL 4EBQH 2JJTC 3V5DA 5JNYB 3KAAA 4OZFB 1RZKL 3QPQC 1PGRB 3HPLB 4XNMB 3ZKXC 3VCLB 5BVJB 1MQKL 3EJYD 1FLTX 4MS8D 3WFBH 2H2SC 5GGTA 5IJKC 5GRUH 3PHOB 2NXYC 4FS0A 4TPRL 3BP7B 1FFQA 5HDLA 4JB9L 4LKCA 4H8WL 4DFHA 2Z8SA 1Z0MA 3CU1A 2BRRH 3KYAA 4XBPB 2YK1H 1F3DH 1ODAA 2GTZB 1FCGA 5B22A 4HUVB 3PQYA 1EJOH 3QXAB 3MLSL 4YHZH 4PR5B 4M9OA 1YEGH 3S36L 1XZ0A 3EOTH 3SPVA 1J11A 4JANA 2KKQA 3BEVB 1ZT1B 5F6HI 1CIUA 3I6KB 1JGDB 3BT2L 4NPYA 5CILL 2FD6H 3L5JA 3EFFA 5ECJE 2OZ4H 3GSQB 4IRZH 2Z91B 4PLKD 1MLCB 2R9HC 2BSSA 5SWQB 3ARUA 3QWQB 4OKVA 1D6EB 5DD5L 4EDWL 3BGMB 1SBBA 4WTZG 4XMPL 5HPMA 2G60H 3KPMB 1FVDB 1AQDA 3KJ4B 4QHNA 4U6HA 1J86A 1QO3B 5CWSA 3RUGB 4NJAH 2NW2B 2H6PB 2A6DB 1FORL 1CIDA 5DZOA 1T6WA 1A6TB 1RIHL 3LKQB 1YNLH 3ETBF 1HSBA 4FMFA 5E6YA 1ZA3A 1GAFH 2L7UA 4H26B 5A2KH 2AVGA 3JWOL 1IQDA 3HMXH 3MRDB 4WI6A 3MXWH 4PJ7A 4Y19D 2DM4A 1ZEAH 4NDMA 1WIPA 2NPLX 3AREB 1FIEA 5HVHC 5GRVK 1WF5A 2FJHB 2VR4A 3V0VA 4FHBD 1RUML 4R90L 5TGBA 3TIDA 3IFNL 3NIFE 5I16A 2YC1B 4G6MH 5ENWA 3RKDC 5C71A 3WFDH 1KPUA 4Q9QL 1G7PA 1Q9OB 3ZTJH 1JPTL 5T5FH 5F7FA 2NY0C 2HJKA 1X5LA 3CZFB 4HMEA 3B9KB 4YWGH 2XZZA 2DBLL 4WNQA 4EUPG 5M7QA 5FYKH 4EIZC 1L6ZA 3CFEB 4K9EC 5F1IA 4Y4HD 4GW5A 2XQBH 4XPGH 5AZEH 4CVUA 4Q9BA 3ZYZA 3HNVH 3JVGC 4OQTA 1JPFA 5DHYB 4IOFC 4PBVC 1YEFH 4Y4KA 3Q5YA 4MD4B 4FQXC 3MRKA 5H37H 1G9NC 5DJDB 3LKRB 1RZJC 4Y16D 1HI6B 2ZSWA 4LPVA 4PLJC 5I30L 4JO3H 3VG9B 5FM4A 3JWNC 1NAMA 3IETA 2NW3A 2B1HH 3BH8B 5HVFB 1DEEA 4RFOL 3HZYA 5EZIL 1ZT4A 3LOWA 3JWDL 3QUKA 3X3GL 3PWNA 4X4XB 2PNDA 1QBMH 1OPGH 4NP4H 4KPHL 1XMWA 3WUWG 4JFED 5DSCA 2EC8A 1NLDH 1A4KB 1NJ9B 4MGXA 5HSFA 1E4XL 3VGGA 5C0CA 1T0NA 2P5EA 1KJMB 1NGYB 3LZFH 2APXA 1R3HB 4I18A 5D2LA 4ONHA 1TLKA 3WFBL 2A83B 4DZ8A 4HF5L 4ODUB 5HDQH 5IWLC 3REVB 3VWJB 5C0GA 4PJ7E 5GRUL 4PLOB 1UFUA 5FOBA 1TDQA 3QDHA 1PG7H 2ITDB 2VZVA 5K9JH 2GCYA 4NO3A 2Y6SD 4XPAL 2B4CL 4MS8C 1CLCA 5D1ZA 1BZ7A 4S1DD 4U3CA 5HHOD 4ZQKB 4E0RA 1OT2A 3EOTL 5CZVL 3QDAA 5C2BH 1MJ7H 3FO2B 5MHSE 5T1MB 4JDVB 2FR4A 1UCBH 4K23H 3REWA 2MTPA 3QJHB 1L0YA 3CFJB 1JWSB 3KYOA 3G08A 5ADOH 3MLUL 4JFOA 5DD6B 5JR1H 4FQCL 1OAZL 1GXEA 1NC2D 3SDDC 1P53A 3BH9A 3BW9A 3GIVA 4K7FA 4JFFB 4PJ8B 1U3HB 2QQLH 4P2YA 3GHEL 3LN4A 3UJJH 1KGCE 2VLRB 3RTQC 3Q0HA 1T7ZA 1CXFA 4ZPTB 3GMLB 3O8XD 1BQLH 2D4FA 3O6KH 4BZ2L 4DZBA 1GZQB 3ZMRA 1HHKB 2AW2A 4BM7A 4K3DL 4XVJH 5A1AA 1U8KB 3MV11 2BVYA 4N0UB 4OIBA 4P3CH 4J8RB 3G5ZA 3FB6A 4URTB 3HI1B 1DBAH 3EYUH 3TN0C 2HFTA 3W9DA 1TQCC 3WHXA 4AMKH 3QWOB 3HMXL 4XPBL 1I85C 3MXWL 4G43B 4HC1H 5EC2A 1ZEAL 4B7LA 1IGJA 4YXKL 1KN2L 3KPSE 5C0CE 2P5EE 4U6VL 2XY2A 5LXGH 2DDQH 3U0PB 5D2LE 4M6MH 5HTSA 5JXEA 1IAIH 4Z7UA 4WW2A 5IK3B 3ARVA 5B3JF 3F12A 3WFDL 1A6VH 5HHNB 1J05A 5A2FA 4X6DB 1KUMA 3GSRB 4QWWC 5T5FL 5M95B 4TOYL 3ZDYF 3IFPB 5I8CA 5ACMA 3WSQL 4L8BA 3V4UL 4ZO8A 1NAKL 2V2XB 2JCCF 3ROOA 3STZB 1DDHB 2ZJSL 4IHOB 1OP5H 4MD0A 4JJ5A 5E2UL 3VFVB 5FGBC 5I8OH 3QCUL 3DUSA 1LO0H 3T8XA 3HNVL 2Z8RA 4WO4C 5ESQA 3FHAA 4CJ0A 3ZT5A 3MCLH 2E6PA 2KPNA 2ZG2A 5JXAH 4GAYA 5E4IA 3UYOD 1I1FA 2JJVA 3WIHH 4Y4HC 1SEQL 5B3NA 2A9MH 3TCLA 1QHOA 5FA3A 2KQNA 4LOUC 3JUYA 1OPGL 2C3WA 2UWEA 4LFHG 4NP4L 4PGDA 4X9HA 1A1NA 1G6RH 5IW1A 5I19H 3KPRD 5IJVA 5FA4A 1OARH 4Q6IC 4AEIL 4M7JH 3VFMA 2F5BL 3V5HA 1IQWH 2M26A 1E0OB 4RZCA 1NFIB 5C70A 1UWXK 1AR1D 4QYOA 4JZOB 3U7WL 1IGCH 2E8ZA 5E0QA 4F7PA 4WFEE 1RJZA 5EFIB 4DFIA 5JLZB 5ANMB 12E8H 3VH8B 43C9B 5K9JL 1A7RH 1H3WM 4LLMA 5E6IA 2GSIB 1DVFD 3FT3A 2GK2A 1U8PA 3PWUA 5E9DB 4JO1H 3VFSB 4JPWL 5CJ8A 3HZMA 4Z7UE 2H32A 4NQCA 4KJYB 4O2FB 1MI5E 1MCNA 5I8EA 3QUMA 2GSGA 3OJVC 3AAZB 5C2BL 2RFXA 3KXFA 1MJ7L 2XTLA 1IGTA 3CPLA 2FEEL 2AJXL 3MJ8A 2A6JB 3UYRH 3CXHJ 2I07A 4HBCH 1MHCB 3VE0A 3ARYA 1FN4A 4UAOC 1ADQA 3UAJD 1XF4A 1YMMB 2ERJB 4LLDA 3M8OH 4L8DB 1DFBH 2GUOB 2QQLL 3AS3A 1X44A 2AS5M 2EDWA 1IM3B 4FQ1H 2HN7A 3V6ZB 1HH9A 4Y88A 5HYQA 3VFNB 1HILA 4QHMA 5EA0H 2QHLA 4OIAA 3BKJH 3VXSA 3EUUA 1BEYH 2DQHH 3TT1H 2IQAA 1AO7B 3RWIB 4NHUB 4LQFH 2IBGA 3S4SA 4XXDB 3IDYC 1DBAL 1YMHA 5GGVY 4I0CC 4AMKL 3U0TB 2H2PD 4P2QB 4NQDA 3KLDA 1I3UA 3NPZB 3OR7B 4OLXH 4HC1L 1P6AB 4TSBL 4WGWB 5D2NA 3D69B 4OCYL 1GZPB 2DLEA 2Y7QA 4PGJA 2X40A 4G8IB 2DL2A 3HB3D 3MRMA 1OGAA 5ABDE 5LQBH 5LXGL 3FT2B 4FG6C 1FZJA 2DDQL 3ZYOA 4NRYB 4NZRH 1KJVB 3PABA 4NBXB 4NKDB 2COQA 4ETQA 4MA1B 2XTJE 1A6VL 5HDOA 1CFQB 4FTVE 5TQ0L 4YGVA 5MHSD 2DWEA 1U8NA 1QRNB 1UH4A 4ZSOB 3LKNB 4NQCE 4HEME 1G9MH 1XCTA 4TUKL 3QNZB 1AQKL 3B83A 3KXFE 3ECBA 1LO0L 1MJJA 4PJXA 1U58B 4LIQE 3FQUA 3C08L 3VGAC 3IJSB 3TLRA 2EXWC 5E1HB 4EJ1C 1RMFH 3PDGA 5F8QC 4R4BA 3DX7B 5TF0A 3JTSA 4MD5B 4MCYB 1JGEB 3WEXB 4L1DA 5JXAL 1CWVA 1VADB 3IDIA 4HZAA 2JCCB 3WIHL 4V1DD 3WO4B 2FO4B 4F7TA 2VXVH 1RUPH 4EKXA 2HFEB 4XMKL 1FFPA 3PL6B 3MLYH 4HUMB 1JZ5A 2AQ3A 2JTDA 4YX2H 1T2QL 1JE6A 3VXSE 1A3LL 1N8ZB 2R69L 5JUEL 1I1AB 2DLIA 3S3SA 3NN8A 1CGUA 1G0YR 5I19L 4HIEB 4P3DA 5JMOC 2NY6B 5KSVB 4KRMB 4LVHC 4KZEH 1NCBH 4M7JL 4UNUA 1F4HA 2Z31A 1IQWL 2PO6A 3BPLB 3KPSD 5LBSL 1DBMH 2XY1A 1PQZB 3U2SB 4LRIC 4GAJH 4NQDE 1MJUH 1IGCL 2VIRB 2IH1B 1ZHBB 5IB1B 3D18B 4TVPE 4PB9H 4WV1A 5KSAD 3TJHD 1K9TA 1ROWA 1CFBA 5D2NE 1LO3H 4DQOL 1CL7H 1HKLH 1OGAE 1T03H 5T1KB 5MENB 2JELL 4NKMB 3NGBB 4JO1L 4G42A 4F7MB 3QIWD 5ALCL 4P57A 1A21A 4YE4L 1V3JA 4KRLB 4PJHE 5IVOA 4QRRB 3V0WL 3W0WE 2DLGA 1T22B 4KJWD 1IZKA 5C0AA 3QAZB 2AEPH 1DVFC 5EUOB 2YUWA 4M9PA 3W39B 3LKOB 2BSED 4HUUA 4YIQB 4MQ7B 3T09A 1IGFL 5T3XH 3IDXH 3M8OL 2IFFH 3DV6B 4GRLC 1M71A 2C4FU 5IW3A 1Q0YL 2NTSP 2OXHA 1CFSA 4PJXE 2NZ9C 1CF8H 5MEPB 4PGBA 1RUKL 2DJSA 4OLYL 2WUBL 1CU4L 4L29A 1VFUA 2R4RH 3FHQA 3VJ6B 1SBSL 3H9SE 3KHQA 4RX4D 3HI5L 5CBEA 3TT1L 2JIXD 5DUPL 5GS1C 4I4WA 3THMH 2ADFH 1J8HE 2O61A 1N5AB 2XKUA 1F4WL 3BRFA 4GLRI 4RQQB 3HRZA 1D5MA 3MLTB 3RPIA 5AWNL 3DURB 5F89B 4XT1C 4EVNB 1SY6L 2R23A 3NCJL 3QUZA 5DFTA 3QDMA 3LKSA 5GHWL 4S1RH 5BVPL 4WWKA 4HIIB 5LQBL 1QR1A 4GRWH 4Q9RL 2FWOA 3P4NB 3OKKB 4F7EA 4ZAKA 4IOSD 4JN1L 1P7QB 2PYEE 1WISA 1XF2A 4OGXH 1FH5L 4HG4K 1MI5D 4GQPH 1BVLB 4PY8J 5C8JB 3IDGA 1S7TA 3QA3A 3HB3C 2YUZA 4LASL 1JZ3A 4HZLB 4P9ML 5KSBF 4NZUH 1ITBB 4OZHF 5DS8B 3HE7D 3B3IA 3QEHA 4N5EC 4PJBA 4YAQA 1JI2A 3E8UH 5DJCB 3SN6N 1YEDB 4A6YH 2ADJA 1E4KA 3SDYL 2J8UF 4IDJL 4ZFZA 3F6IA 5F93C 2EZ0D 1C5DB 1OF2B 3LSOA 3PDOA 1DN0B 1RMFL 1P4LB 2VR9A 4X6FA 2XG4A 4RAVB 5C9KA 1I3VA 3CMGA 3CJJA 1HIMH 3GSNH 3QH3A 2BHYA 3VXOA 4N8VA 4H0HB 4NQUA 4NZJA 1YEKH 1I9IL 5DMGC 3FRUA 2FB4L 5CP7A 5MERB 4NYLB 4YX2L 4K9EL 2AJVL 2A74B 4ODSH 1TJIH 3EYSH 2PW2A 3P3YA 1CDCA 4OGZA 2X4TA 4J6RL 5IF0A 1CCZA 3F58L 5KVMC 3UX9B 3GBMH 2RCSH 4RRPG 5FF6A 2ZCKH 1YN6A 1X5JA 1J1XH 1EUUA 3P4OA 1SEBA 4KVNL 2XIDA 1G9NL 1W72L 1IKFH 3FQRA 4HHAB 1JWUB 1JHTA 1MJUL 2EC9T 1MRCH 3C6SB 3QFJB 3ARGB 2ICEA 4DOHB 5LGHH 3NFNA 4M7ZC 3SE3A 3FB5B 3RBGA 3P77A 2A77H 4KAQH 2EDLA 5FYLE 1CL7L 2AK4A 3EOYG 3OMZA 5EDXA 1WGOA 4O2CB 1YJDC 32C2A 4FTVD 5TF1H 4BH7B 2B5IB 3ARDA 4Y1AB 3IS1X 5B8CB 3DRQB 1HHGB 5KSAC 2XFXA 3TJHC 4KI5E 5GGRB 2PXYD 3SY0B 4QXGH 5E8DL 3QSKB 2J88H 4YDIL 1KB9J 1L6XA 2VN4A 1EHLL 5K9KA 5J57B 3TO4A 3ARBA 2NY7L 4NUJA 4PJBE 5T3XL 2IFFL 5B38B 5BS0D 1ZVSA 1T89C 3QXWA 4MDIB 2X1OA 3S5LB 4P2OC 5KAQG 1U3YA 3QIUD 5AD0A 4CU6A 3AU1B 4XTRD 4KJWC 3HE6A 4XVTH 2F9BT 2XXMB 1A6WH 3UTQB 1TFHA 2B2XH 1J0YA 1AJ7L 1G7QB 4XVSL 3KPPA 3U82B 3PWPB 2N4IA 3W2DL 1LP9B 3GHBH 3U9UA 1VESA 5DEGB 3MX0A 4QTHB 4CADA 3NPSB 2WANA 1MWAB 1ZSDB 4R2GB 3SKUD 5F6IB 1ZHNA 3OAZK 4WUUD 2CR3A 5IVXF 4UUJA 4WU5A 4QHKJ 1HQ4A 2JE8A 2WUCL 4M5ZL 4PJCF 5L2KA 4XNUH 3V4PL 4Z77B 4NQDD 1OAYH 4TVPD 4YJZL 4OIIH 3MJ9H 4P4KD 2V7HA 5DJ2B 2VDQH 3MSPA 4PRIB 4CMMA 1I8LA 2WBJD 4KRPC 2J5LB 3EO1A 5SWZE 3RZCB 1E4XI 2C7UB 2CIIB 4OZ4A 5DWUL 5DJYA 3CDGB 2DICA 4GG6B 3TZVA 2ZOKA 4OZFH 3HC3H 1CQKA 3OSKA 2AK4E 2IPTH 4H5SB 3LD8B 3W0WD 1I1YA 3QUYA 4M1DL 2OZ4A 2F8OA 2P4AB 2OJZL 4JZJC 1HN1A 2VDRH 2EIEA 3VXMB 5LGKA 3BO8B 1RURL 3TNNA 1TETL 2ERJC 4HX1A 5IFJB 4A6YL 4BKLA 1CD1A 1LQSR 2R1YA 1GPOH 3MLVL 4ORGA 1H15A 3I2CH 4POZD 3IFLH 1OAXH 1V7NH 3FO9B 4Z7QE 2IPUG 3HE7C 5F7HA 4L9LA 4GKZA 1RK0A 1A7OL 3H9SD 1YYLL 5KSBB 4PY8I 2ICWB 4Y4FB 1UACH 3GSNL 4K3JH 5GSRA 2NX5B 1Q72H 3L3GB 3UC0H 2FHFA 4UT7L 4IS6A 1J8HD 3W5NA 1RAMA 1NMCC 1BFOA 2F53B 4Z7NF 1Z3GL 4HV8B 3O9WC 5BV7C 1J18A 2J8UB 4ODSL 5HGBA 1TJIL 1NDGA 4GOSA 1HHJA 4PJEA 5JPNA 3U0WL 3K4ZA 3GBML 3PGCA 4R7NA 1J87A 4MXVF 1J1XL 4JRYD 1U8IA 1JCKA 1VGEL 5F9OL 4X99B 5L2KE 5DDHB 3LMJH 5KJRL 4I3GA 4JCMA 1YNTA 1AGFA 5D72L 1OWWA 2ESVD 3MNWB 4M6OH 1S7VB 4HXBH 1PLGL 5LGHL 4C4KT 2XPGA 2A77L 2PYED 2IG2H 4KAQL 4J23A 3PF2A 2Z8VC 1MREH 5B4MD 1P7HL 2DRUA 3HCVA 4LAJH 5HHVH 1WWCA 3VXUD 2DKSA 1YY9D 3AROA 5DVKA 5J11B 2R4SH 3EYOB 4LNRA 3P73A 5EBGA 1R5WB 2C3VA 1NEZB 3DYMA 1T1WB 1HH6B 2W0FA 1NANH 4LCCC 3UP1A 1BVKA 1C16A 5K93A 4Z95H 5TE6L 4OGYH 3CDFA 5F1OB 4QRQA 1NLBL 3K0WA 5IMLA 5CEZD 3O4LD 2PXYC 1TZIB 3MV7B 2D7NA 5GSVA 2DN7A 1CBVL 1CFVH 4Z18A 3TBSA 3WO4C 4HKJA 4XB8A 2ITCA 4PGCB 3DX6A 4DVRH 3ULVE 3V7AE 1DR9A 3H3BC 2GEEA 4L8SB 2FZ3B 5DRXA 3S36X 1FG2A 4MJ5B 2A0LC 1DQDL 4U0RB 3QDJA 2DI9A 1IEAB 2YR3A 2NY6C 1T5XB 3AS0A 5D7LB 1EAPA 4HS6A 4JPKL 4AJ0A 2XWBB 4HWZB 2X4QB 1FRGH 2GJ6E 1BFTA 1MVUB 2W0LA 2X1PA 4PJEE 1OAYL 1ZKAA 4F2MA 4OD3H 3FT4B 1P7KA 2Y5EA 3DX9B 5DUBA 2BVPB 4NQED 3P40A 5ETUB 5EZJB 4JGMA 4KQ3H 1MCPL 2VDQL 2VRAA 1HSAA 4CNIA 4P59L 1R3JA 2BSRB 2P8LA 2NY1C 4XNZC 5FDWB 4OLUL 1Q9WA 4XHJC 4XBEH 4OCRH 1JGLH 3BN9C 1PEWA 3F8UB 4PJCB 3GSWA 3ME0A 5HVGB 1SM3H 4KI5D 3UTTD 4BELD 5F1NB 2IPTL 4UDTB 3MRBA 3GMMB 4QHKI 3O3EA 1JK8A 1ZMYA 5E1AB 4IJ3C 3RDTB 1X4YA 5DVMA 5BO1H 1VKXB 1A7NH 2NTFB 5F9JA 1YC7A 5I74B 4LLAA 3SKMA 2YD5A 1F8TL 1JGUL 4MDJA 3SCMA 1V7ML 3ZHKA 3WFHB 5DD1L 3TNMA 2NMSA 3ULUH 2ED8A 2FEEI 4Y16B 1RIUH 4M8QB 4CBPA 1NCAH 3O3AB 4N90E 5C08E 3S6CA 3Q3GA 3RL1B 3O11B 2BFVH 2FIKA 3QULB 4PS4H 5DVNA 1UWEH 2EE9A 4K3JL 3CSYB 3UC0L 1TQBC 3S96A 3H9YA 4POZC 1KENL 4RA0C 1S7XA 5J0BA 3KNBB 4U1GB 3LCYA 5JOFB 4LLQB 4PP1D 1MSPA 3VFGH 4BZ1L 2R56H 2UV3A 4GAGL 4KMTH 4ZO9A 3U46A 3QDJE 3C5SA 1Y6MR 5IEHA 3VW3L 1MUJB 4NT6B 3VWKD 2GT9A 4Z0BL 5EOQH 3R1GH 2ICCA 1T1XA 3WJLC 5I1LB 5JW4Q 5D7JA 2EE6A 3LMJL 3BIAX 5SWZD 1IC1A 2W0PA 2YSSA 1ZLUK 4ODVH 5H94B 1LK3L 1W0WB 5AZ2H 1WICA 1XF3A 3E2HC 5ICYB 2DM3A 3Q1SH 2I9LB 2NR6D 4R0LA 5DEZA 5IB4B 2BNRA 2VE6A 3CK0L 3IDMA 2J8HA 2R0LH 2EO9A 1B88A 5T3ZL 2ZUWA 4PJ5A 3I75B 4YHIA 5FK9B 3PGDB 1IFHL 3EDDA 5LVEA 5GS0H 4ZG1A 2FL5A 2OK0L 3FFCD 5B4MC 3LAFA 2HJFA 4NKQB 2Z9TA 5JW4M 3EOBB 4YNYA 2X1QA 5FM8A 4Z95L 3C9NA 3NTCL 1NC2B 2GJZB 3GBNL 1S7RB 4JREC 4DN3H 1ZT7B 1JN6B 2DQCH 1S7SB 2E9JA 1HHHA