1QLEL

Cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
b'DIELTQTPVSLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQFLVYNAKTLGEGVPSRFSGSGSGTQFSLKINSLLPEDFGSYYCQHHYGTPPLTFGGGTKLEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE POLYPEPTIDE I-BETA
publication title The Cytochrome C Oxidase from Paracoccus Denitrificans Does not Change the Metal Center Ligation Upon Reduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/immune system
total genus 24
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1999-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qleL00
4XPFH 4RQQB 2C3GA 4PGCB 2DM7A 4Y2DB 1WFNA 3ARGB 2ITCB 4N0UB 2FL5A 4ODHL 4X6EB 3CDGA 1OAZH 5DMIH 2WIIA 4L8DB 1YEIH 2JE8A 4M5ZH 5DK2B 3VD7A 3VD9A 1P7QB 4ALAH 4Q6IC 2R29L 4HUVB 3S5LA 4GG6B 2DQUH 4IHOA 4JFFB 4BYHA 1XF3A 5F7KC 2MTPA 3ARFB 4S1QL 5ADPL 2FHBA 5KOMC 5ICYB 2OK0L 4M93B 1UB5B 2JCCA 1RK0A 4PRIE 1Y18B 3FB8A 4U6VL 2DJSA 5BJTB 2BOCA 5T3XH 4LLUA 1B3JA 4AH2A 3KYKH 4NUJA 2E7CA 4JGMA 4ODWA 3FB6A 4PTUB 4ZYKA 3EUUA 4EI5B 3MCLL 4ELKA 4JFXB 4H0GA 1CICD 1R3IH 1IGIL 3D0LA 1AXSA 5HYJB 5ESQA 2CKBL 4IOSD 2E27H 4OGYH 3KLAB 3G08B 2D7OA 5L0QC 5CZKA 3E2HB 4WHYH 1BLNB 4X6CB 5I19L 4EDXB 3TZVC 4AT6A 4PRNB 3T04D 3GSOA 4HS6A 4TTDC 1DBAH 1WC7B 5TPWH 1MWAA 2VDKH 2H26A 5ITFA 1U8QB 4L1DA 4ZNEA 2ATKB 1MWAL 4KVNL 4PJGA 5HGBA 2QL1A 3SPVA 1T3FA 1KPRA 3F58L 4H25A 3C09C 5E8DH 3H9ZA 4JG1L 4JPVH 1EBPA 1N64H 2KUTA 2GFBA 2P5WE 3VW3L 4QF1A 4HUNB 4KDVA 2ADJA 3QRGH 3VFMB 4HIEB 4PLKD 3INUH 2AVGA 2GTWA 4K07A 1RUKH 3HLAA 5ILTL 4N0YH 2R0ZL 5GRZA 2X4UB 3BN3B 4PJDA 1D6EB 2ZUQB 2CDEA 4LSQL 1GGIH 3ULUC 3TT3H 4NZUH 5D1XB 5GIRA 3UTSE 1R24B 2ZCLH 4L4VB 4WEBH 3TN0C 4FTVD 1ZVYA 4NQXA 4Y16D 3EYUL 3EOTL 3DMMC 1AO7A 2VXUH 5F1IB 2VDLH 3ES6B 3ZKMD 1S7RB 4HH9B 5EFIA 2X4QA 1LEKB 1LP9F 2XV6B 4X5WA 4LPTA 2V5MA 1OAKH 4MVBC 5FV1L 3ETBF 4QXUL 4LKXB 3HG1B 4XAWL 1BZ7B 1NBVH 4LCWD 5GRXG 3D18B 3C5ZC 4RGNC 3BSZH 1UM5H 3HMXA 4NDMA 3VD4A 3GNML 2RCSH 4TTDD 1VFUA 5L2KB 3GSNH 2HJFB 3HMXL 4JFEB 3DVNB 1FH5H 4POYA 3V79C 1QSEB 1ORQA 5HYIA 2F74A 3OG4B 3A0OA 1K5NA 1IAOA 4XP9L 3LKQB 2OP4L 5GGQH 2DBLH 5BO1H 3KPMB 4HKBA 1S7TB 1XR8A 1MCFA 3BI9X 4PJXE 1G7MA 4NNXA 4G9DA 4PJ8B 1R3JB 3VG9B 1A7OH 1T22A 4F7CA 3MRGB 5FDWB 1YECH 5L88H 4BK5A 1MFCH 1AQKL 5F8RC 3GMQB 4WU7B 3O3AA 3OJDA 1H5BC 2VZOA 1PG7H 1TQBC 4XC1L 1JHLL 4LSTH 3K4DA 2XNAA 1J5OH 1FCCA 3C08L 4P59L 3ARXA 4MJID 3O6FC 5CEYB 3K8KA 2Y6SD 5DRXA 4L1HA 1RZKL 3EO9H 2ZCKL 4KTDH 4I77L 3DMMD 5LKNA 4O9HH 2D9CA 2V17H 2ZG2A 1WIOA 3L1OH 5DJCB 4HWNA 3UROR 3R4DA 5CP3A 1PJ9A 2BFVL 1X4ZA 4KQ4H 3OJVC 3OAZH 5F7DB 4G3YL 3TCLA 2VLKB 2A74A 4FG6C 5E8OA 1R5VA 3KPSD 4RGND 3QG6B 1X6NA 9CGTA 3NGBB 4BQ9A 2HG5B 1S3KL 4P48A 2UWEB 5E9DE 5JXEC 1QFUL 3VWJD 2XY2A 2VL5A 3HC3H 2VXSH 4L4TB 1RK1A 4DAGH 4GAYA 1FVCA 3MNVB 2BOBB 2QQNL 2RB8A 2Q86B 4G8EA 4P2CG 4F3FB 1OB1B 4X5LA 2MCG1 4LEOB 2MSPA 3U4BH 2BVPA 1MCLA 3SE3C 4HBCH 2FJFA 1NBZA 4M93C 2O5YH 2Y06L 4XC3H 1TETH 2R4RL 4JFDD 4HGKC 3MC0A 3V5KA 4KMQA 1GHFL 5T33H 3QUZC 5KVGH 4X9IA 4HPYL 1XCTA 2BNUA 3IFNH 3I3BA 1RIVH 2RIKA 2XACC 3MLZH 3L9RB 5I30H 3UZQA 4EI5C 5JTWA 4KUZL 3H0TB 4N8VA 1NEZA 1JFQH 3BW9B 4KDTC 4OCXH 3WJLA 5JOFB 2DLIA 5T3ZH 4FOMA 4TSBL 4ORZC 1S78C 4HDIA 5D2NB 4A6YB 2E6JA 1U8JA 4PR5B 1MFEL 3V6OA 2BX5A 2A6KA 2HKFH 3ECBA 4PIRF 3IU4L 1NGWA 4PRBA 1X6LA 3E6FB 5J13C 4GAJH 2CUMA 5C3LD 3RWCA 5I17A 4YHNB 4Y2DD 4YE4H 5HY9A 3HB3C 3EFDL 3LSOA 4KJPD 4BZ1H 3OHXA 3BXNA 3ZE0F 2LU3A 4JJ5B 4PJEB 1CYGA 5JXED 1KG0A 5B3JE 1LO4H 4WUKH 4JFZH 4OB5H 1P7QD 1ED3B 3UPCA 3BGMB 5C6WH 3D6GA 3EJYD 5CLWA 2CO6B 5JA9A 2E8ZA 2IF7A 4JFFD 1JPGB 1OWWA 2D7PA 1P4BL 5JPNB 4OUOA 2PTTB 3ARFD 3JV4A 4YQXH 2FO4A 4OZFG 1N6VA 1MCJA 1Q94B 2F8VA 1G7IA 2JJVA 3QNYB 3QISA 4HXAH 1SEQL 3I9GH 2HTKC 4AL8L 3VXMA 2EH7H 3L7EB 3PG2A 4KVCH 3VFRB 3OKYA 2RR3A 2Q76B 2Q6WA 1N6QL 1ZLSL 2EE2A 4CW1B 3QAZB 3CSGA 3QIBB 3FONA 3W0WA 1N3NA 4EI5D 3OAYK 3P77B 1EO7A 3L5HA 5HYJD 3VXQB 2FHCA 2F54A 4Y19A 1S78D 5ALCL 1KJMB 4LOUC 2HMID 5F7YC 1HWGB 4JRYA 4A6YH 1OY3B 1YDPB 3OKLB 3FQWB 5IWLC 2X1XR 1L6XA 6FABH 1A02N 3AC0A 4QRRE 4RISL 4PRIB 2IPUG 1U8KB 5IQ7H 4KZEH 3BVNA 2FHFA 2VLMD 4OUUA 1AHWA 5E24E 5CEZE 3GSQA 2NZIA 3KPOA 5ICXB 4LL9A 4PY7B 4JHAL 5HJ3B 3NPSC 3TNMB 4QHNB 3HZMB 5JNYB 4F80A 3WDIA 3DGGB 3EDKA 5GHWH 1R5WB 3MZGB 1NCWL 1QHOA 5GGUB 1KEMH 5T1LB 5CEXB 1VADB 3MRPA 1XMWA 1X5HA 3NIGF 1F3RB 1Q9OA 5IBLC 2HTKD 1JNNL 4UINH 5D1XD 3MRRB 4Z7VF 3IJYA 1BP3B 3RAJH 3MXWL 4L4VD 3U0TB 1E27B 5DJ2B 1IJ9A 4NZTL 1ZANL 1WZ1L 2CRIA 5KOVC 2Q8BH 4CDHA 1QSVA 1W8OA 3FRUB 1UCBL 1QYGL 1JBJA 2VRAA 3G5XA 2IG2L 1AGBB 2P5WB 4K3EH 3LMJH 1XF2A 4JO4L 2OR7A 4OD2A 1JWUA 2HLAA 4DW2L 3QXAB 3HG1D 1OCWH 2CQVA 1FFNA 3RGHA 3MBEB 4WHTA 4DFIA 3WJJA 1CG9A 1FRGL 4EOWL 3DSFL 4P57B 1PZUB 4ERSL 3IU3A 4V1DE 2J1KA 1BOYA 4PGBA 4LRNL 5L2KD 2C1OB 3WEXB 1A6TB 2VDQL 4KJWC 1MHEA 4OSUH 4K8RH 3QIWB 3KPRA 4JFED 3V4VH 1KC5H 4U3HA 1JWMA 3RZCB 5CAYB 3UTSB 1G7PB 1QSED 2V7NB 4HCRA 4FMFA 2DKSA 5DQ9A 2E9WA 3SCMC 4HCRL 1HDMA 3V6FB 4NQEA 3WL9B 4EUPH 1LD9B 1OT1A 3EO0B 4PJ8D 4P5MA 4KKLD 4PRPE 1JZ6A 4X98A 1JK8B 5TH2B 5SWSE 1A9BB 3VFPB 2HFGH 4Z7UA 2WBJA 5TDPB 5IHZB 3CUPB 3QDGE 3HMWL 1UADC 1OW0C 2YMXH 4PPTA 3T09A 3OZ9H 1T0NB 4MS8D 1UVQB 3U2SA 3HE6A 3WFEL 4EXKA 3M07A 4OZHA 2V2WB 3MSPA 3ARDA 1YEJL 2R1YA 4P2OC 3S35L 3PGCB 4S2SA 3B43A 2F9BT 4NIKB 5D2NC 1JRHL 5C7XL 5ETUB 3CPLA 5I1KL 4UTAH 2APFA 4PJXB 2OMNA 4I9WE 5EH1A 1NGXB 1XF5B 1CIDA 4UNUA 3RWIB 4Y4KB 5FUOH 4M6OH 1BD2A 4PJBF 2DYPA 5BRZA 3TIEA 3TH4T 1ADQH 2VLKD 3C8DA 3PWLA 1VHPA 3IF1B 4W6XB 4WUUA 2YPLA 5SWZE 4JY6B 4LMQI 1QBBA 2Q8AL 4CN6A 3U6RB 1C5DB 1PSKH 2OQJA 4G7YL 3OAUL 4IRJA 1MCQA 1S7XA 1HINH 2NY0B 1N8ZA 1RUAH 4KJWD 4L4TD 5FK9B 3PL6B 3NCJL 4HFWB 1S7QA 3I02A 1CFNA 4XNMB 4OJFH 5FUZH 1YN6B 4KHTH 2P7TB 4KQ3H 1OOAA 3VGDA 1LO0L 3C2AL 4X6CF 3F62A 5A2FA 1T1ZA 8CGTA 4RAVB 4YHYB 2OSLA 3KDMB 2IH3A 3VD5A 3A67H 4K2UL 1N2RA 1WT5A 1QLFB 5DI8A 4Z8FH 5H35A 5HDOA 3WFHB 3WNLA 4LARH 2F53A 5FM5O 5IUSA 2P1YA 1IKFL 1VEPA 1SJVA 4U1NA 3RVTC 4GJTB 5E9DB 3TWCH 5EC2A 4BA8A 3OXRB 5E6IA 3QIBC 4R4BA 5C9KA 3BKJL 2ICWA 1JPSL 2A1WH 2OTUA 1R3LB 4YO0B 2I5YH 3SGKC 5F88B 3C8HA 3QCTL 1NLDL 4E42A 1XZ0B 3QHZH 5DJAA 1IGYB 3AS0A 2NY5H 3P73B 1D5XB 4QRPA 4K8RC 3W82A 4JE4B 2XRAL 4UV7L 5EOQH 4XCEA 1HHHA 2F19H 3PP4H 5FCSH 4D9QD 2GAZB 2FYYA 5FYLL 3KYNB 3SO3B 5EBMB 3L3JA 1I7ZB 3I3EA 2VABB 4KRPC 4Z95H 5D4QA 2YEZB 3GIZL 4UOW0 2G5BA 3KLSA 3P11H 3N06B 3DUUA 1FE8L 1F4XH 1KT2A 1KXVC 2KZWA 1RZGA 1BPVA 2X44D 3U0PA 3O2WL 1IT9H 5K59E 5D9SB 4ZTOH 1U3YA 4FQ1H 1LWRA 2FECI 3MFFB 4F37K 1ZLVH 4WU5A 4J23A 3BP5A 4WWID 5IB4B 3FRPA 3O3EB 1CLOH 4GAGH 1P84K 4EBQH 3TVMB 3QDJA 3UTQB 2XIDA 1C5CL 2VZ1A 1E6JL 1QFWH 1RU9H 3CCHB 4P5TB 2HN7A 2R23A 3QIBD 2COQA 2PKDA 1KIRB 3D85B 2A77H 2DIBA 2X4SA 4X6FA 2ID5A 4ODSH 1P4IH 4K7FB 2AXJA 3BMVA 4NC0B 1WBXA 3MJ8A 2J8UA 3H7BB 4FQLH 2L7UA 5LVEA 2AJUH 3MRMB 5IW1B 4XBEL 4F7TB 4PRID 4JPWL 1JZ8A 4L5FL 1AR1C 3DVGB 3RZCC 3QEUB 4N0CC 5GGSB 3SDCA 5I0ZA 3ZYOA 3CK0H 3P9LA 4RFNB 1SHMA 2I9TA 3TESA 1YUHB 4G6AC 2ARJB 2Z35B 3ULVE 4NGHL 4G6JL 1AY1H 4R2GC 1GSMA 2AXGB 4WI7A 1A9EB 4YGVA 3JV0A 4KRLB 4PGEB 5ACZB 5LBSH 1HWHB 5C0DA 4AEHL 1DLFL 4HJGA 1KYOJ 5T1LD 1N4XL 3DOSA 3LB6C 2GSGB 4LQFH 2ADFL 3BGFC 3P9MB 1U36A 1UM6L 4QRRB 4Q0XH 4WI2A 2R2HB 2NW3A 2IGFL 2PTUA 1QBML 3MR9B 2UUDH 1A3LH 4FNLL 3QWOA 2ZP0T 4XP4L 5FO7B 2NY5C 2HFEA 3TV3L 3PABB 4LCUB 1FIGL 1FZJB 5C6TL 2W92A 2QSCH 4Y1AA 1I9JH 1DQDL 2P24A 2P5WD 5J8OA 1ZLUH 1G7QB 1JMXA 5D8JH 5DHVA 5DVLA 1BZ9B 1J05A 1EMTL 1FDLL 3CDCA 4OFVA 3MBED 5DK0B 4LSUL 4ZUVB 4HMEA 3ZT5A 3EKCA 4EN3C 4CMMB 1DQTA 3TP4A 4BFBD 3QIWD 4R0LB 3VGFA 2ZWLT 3H6JA 3QULA 1UXSA 3UTSD 3RZCD 4NQTA 1ACZA 2OJEB 3MACL 3M45A 2OTWB 1B0WA 5HGDA 3ZL4L 2FIKB 3HFML 2O5ZH 2L4OA 3RBGA 3WXVL 4ISVB 4YWGL 3WCYA 4PGDA 4K94H 2JELL 2D4FA 1BGXH 4MJ5B 3UTOA 4UV4L 5DD3L 3X13B 3JWNC 1ZEAL 2QLVB 5KBNC 5CJQH 1MVUA 2LE9A 1JPTL 3LB6D 3FT3A 2YD5A 5E99L 4G80B 3QEHA 4V1DB 1ES0B 3DRTA 1HZHL 5EUOF 5I9QB 2D03H 3OKDB 4FQCH 3HC0A 2JJSC 3T0AA 2EKSA 1KSRA 1HILA 4BZ2L 1S9YA 3U36B 4NJAL 4CRPA 1ZT1A 5FFLA 1I1FB 1NCBH 3BDYL 1QEWA 1YEGL 3IETB 35C8L 5CEZH 4AG4H 2X89A 3SKUD 4PRPB 4OIBA 4Y4KD 1K4DA 5FV2A 4PRAA 1AKJA 2PETA 5SWSB 5AG8A 4ZS6C 2GW5A 4N8CL 2FB4L 1QFWI 3QDGB 4U6HB 5IB5A 1TZIA 3QXDA 1LK3L 1VFOA 5KVEH 1KJ2B 2NY0D 1MRFL 5B38B 4RMVA 1MCWM 1NGPH 3PL6D 4QXTA 1JV5A 2Z93A 4YH6A 2B0SL 5TE4L 3LZFL 4QT5B 5C0BA 2AJ3A 2VQUA 2DI7A 4LP5A 4X5XB 5JOPE 1GCFA 2AJSL 4FQHB 2H2PD 2CIKB 3FZUD 2LAGB 4ZPVB 3ROOB 1S7UA 1CXEA 1PD6A 1YEDB 4WI6A 3O6LL 1EVUA 1I9IL 3TVMC 4ZOEA 1MI5A 1CT8A 3S4SG 5SWZB 4X83A 2QKIA 4UIMB 1X5YA 2BJML 5E9DD 2V2TA 1AXTH 1RZFH 5CGYD 5CHNA 5CFHA 1YEEH 2O26U 1W72H 4KAQH 1BBJB 4U1GB 3R8QA 1HH9A 3EAKA 2BRRL 3MLYH 1RUQL 3BT2L 5F9WB 4XHJC 5JOEA 4OLUL 4TPRH 4UDUB 4OTXL 4RX4A 4EDWL 4OGAC 1PY4A 1CFVH 4FA8A 1A14H 4JM2A 3LIZH 1YMME 3NABL 5BMFL 4X4XB 4MA7H 3WFCL 5BS0B 3DRQA 4JN2B 5F7NC 1DANU 4OV5A 4PREA 1DUYA 3REWB 5IP4A 3PJSB 4U1JA 4C83A 1DN0B 5GS1C 4X4YB 4RFNC 1K2DB 4K94C 1A4JA 4MHHG 1XEDA 2EDFA 1OAYL 1T2QL 3VXPA 3WYRA 1VFBA 4OGXH 4OFYA 2YPKA 3KXFA 1B4JH 1S7SB 1F90L 1SYVB 1EHAA 1MIEH 1Z0NA 4TQEH 5FYJU 5L9DH 1UJ3A 3GMLA 2RJMA 5KZCB 3F7RA 2ZUTA 3BIAX 4MNQA 1OP5H 2W0LA 4XPTL 1FLRH 4PB9H 3TVMD 1FIEA 4YFLF 1FV1B 3C5JB 1J88A 3RWGA 1E6OL 32C2B 4LPXA 1FYTE 4OT1L 1ORSB 1JVKA 3QNXB 4P5TD 4YBHA 5I1LB 1YPZF 3VFNB 3D85D 4LRIA 4YHIB 5F9JB 1B0GB 3WIFA 2H9GB 3DUSB 4NC2B 1LP9A 5MERA 3BRFA 4DEPC 5DMKB 1E4WL 3RWFA 5EU4B 4CU7A 5TDOB 5JDJA 4OGAD 4YDKH 1ROWA 4KI5E 1UACL 4JHWH 3WFBL 5J56B 1RZ7H 1BWMA 1YQVH 3GHBH 3HCVB 4XVSH 4RBPK 5J1AB 4HLZG 4R0LC 2VIRB 1I75A 1R3HB 2APXA 2M8XA 1FNGA 1MAKA 2P47B 5IMMB 3MNWA 1IARB 3ARBA 5IBUG 5I1GL 1A0QH 5C0CA 4HKZA 3HZKB 2I25N 2VMFA 4MDIB 5C0RH 2A6DB 3GJFA 4BSVB 1E4JA 3R06A 1UFUA 5ID1A 2IPKB 1RJZB 3D25A 4R4ND 3VGAB 4DVRL 1BFOB 3QPXH 2FZ3A 5DDHA 2A9NH 2W59A 3B8YA 3QWRA 1G0YR 2HTLD 3AB0B 3S4SB 2G2RA 2X4TA 4XNZC 3TYFA 4OF3A 3LS4L 2E7MA 3EYSH 4QRRD 5I9QC 1W2KT 3GBLA 3WKMH 2QSQA 3X11A 2P48B 3O11B 5F1SA 1G9ML 3N9GH 1NDGB 1QFPA 1G7LA 4HC1H 4X80H 1V5JA 4P23C 3WO4B 1L0YA 2IANA 1CGXA 3P4OA 5CIPH 3RGVB 1J8HE 3UO1L 5CEZD 4HH8A 5ENWB 4M5YH 2YD9A 2BSTB 5LQBH 3BRGC 4PJFF 5EBWB 5GZOD 3H3PL 1HOCA 2X10A 4WTZA 1UWXH 2XWBA 2N4IA 1EEZB 3STBA 1L4IA 2F5BH 1RIHH 4TVPE 3UPRB 3MLVH 3KJ6H 1P7HL 3HC4H 4NWTH 3RNKB 2CDGA 3TNNA 1S9VA 1F8TH 1NMBL 1FNAA 4HUXB 1CU4H 3F6IA 4G6KL 3SGDH 2VTFA 1KIPB 3TO4B 3MV7E 4LSSH 3BPNB 4M03A 3FO2A 2IFFH 2FR4A 1V7ML 1ZMYA 1CICA 2W65A 2W9DH 5FYKE 4Z18A 1C08A 2ZSVB 4TUJA 2HT4C 4BH8A 5DJYA 3GRWH 4LCCC 1N0LA 1JPFB 4PJHE 1B9ZA 1K8DA 1UZ6E 2YSSB 4ONGL 1F2QA 2HVKB 1BJ8A 2EDDA 2JF1A 2P8PB 5J3HD 1P4LB 3UBXA 5JW5A 1T4KA 3IAQA 4WWKC 4W6YB 4IRSC 2Z4QB 3MA7A 4GLRH 4V1DD 4H5SB 4AQ1B 2YC1A 4ZXBB 4NN5B 4R97B 3T3ME 2YUVA 1CF8L 1JNLH 3SE4C 5DT1L 1ZKAA 1ZS8A 1U8HA 4U1GC 4ELMA 5IMLB 4ODVL 1JF5A 5JR1H 5F9WC 3FFCE 4IS6B 4D0BB 1Z9MA 3THML 4L3AA 1KENH 2NZ9C 1KUMA 3TBSA 5FHAH 3MODH 5L7XL 5H37G 3HAEG 5IG7A 4PRPD 4LLVA 3DSNA 3NIDF 5SWSD 7FABL 3S97C 5CJXC 3EGSB 3MJ9A 4LEXL 3C8KA 3GK8L 3N1PC 4LLYB 1GRWA 2B2XH 3QDGD 4JEGB 5HDLA 3OJMB 2R69H 1A7RH 3MJ7A 3O2DH 5IV2A 3MJ9L 1WBYA 3OSKA 3CFCH 2PCPA 1BBDH 5F3BA 4Y16A 2APVA 5IQ9A 4PLJD 2AABH 2O5XH 3E6HA 4ORGA 3OXSA 2WW8A 3MRFB 4K23H 3T2NH 2E9JA 1HCFX 4N1CA 1YNKL 1DBML 4UU9A 2JK5A 3F7VA 5ESVA 1D6VH 1JTOA 1MCKA 4I9WD 1JGUL 1OPGH 3NMEA 4ZAKB 1JPST 3MLWH 4JQIH 4JFQA 1L7IH 3CSYB 5D1ZC 1KCRL 1IGML 1I7TB 4UILL 1AGDB 5FO8A 5KVDH 2VDOL 5SWZD 1GZPA 4ZFOA 3VXSE 1ND0B 2JJTA 4DN3H 2CK0H 5E5MB 4KK9C 3IS0X 4ZFOL 1A64A 3G5ZB 5DJ0A 5F6HJ 3WIIH 1UA6H 4I2XE 1MAML 4M6ML 3GMMA 1MHPH 3CX2A 1CFQA 4M43L 3X14A 3MPCA 2GITB 3T77B 1DDHA 2NZ9D 1G7JB 2FATL 1IEBA 4Q9BA 4NJ9H 3V2AR 5F44A 4KY1H 4S1RH 3PV6B 2P8LB 3PDOA 1MRDH 3GMNB 3FQTB 2C3VA 1MJ7L 4OCMC 4MJIA 3D3VE 5DR5L 4R3SA 1A1OB 4HUUB 1MQ8A 3G5VB 5CILH 2VISA 3IFPA 5KSAC 5JPMB 4G43B 3IFLH 4ZO7A 1DUZB 3LRHA 1DQJB 5C9JB 3P0VH 2PR4L 2RBLA 1G6RB 1SJHA 4RFOL 4DTGL 4S10A 1HIML 4BQ8A 2VQ1B 3CVHH 5ECJE 1U8PB 4OIIH 5JXAL 3P4MB 3SGDI 1FL5B 2A0LC 3BFOA 4M8QB 2VE6B 5C0GB 1LNUA 3FHAA 4LF3A 2LVCA 2YUZA 3O8XA 1INQA 1YMMB 5DVKA 2NY7H 3KPSA 5KZCD 3HHRB 3LEXA 4R7NB 5D1ZD 4MA1C 3VWJA 1MLCA 3P0YL 3MRIB 2WK2A 4W68A 4HK0B 5DFTA 2CIIA 3P4NB 4O58H 3LQAL 1MIML 1ONQB 1IAIL 1XGQB 5IW6B 4POUB 4LAJH 4P3CH 4LP4A 1UQSA 4I4WB 1MCHA 3FO0H 4KKBC 1F3DJ 3RY4A 1RJCA 2A6JA 4YDVB 3KWWA 3IAPA 2KBGA 3C6SB 3SDAA 4GLRI 5J6GB 4U7MA 1CGVA 2BP3A 2NY4C 3MQIA 4JFDA 2AEPH 4U0RB 5EO1A 4DKEL 4JFHE 2B1AH 4JZOA 3PQYE 2VDNH 1IAMA 2R0KH 1H5BA 1NSNH 4KFZC 4WDIA 1QACA 4K7PL 2CD0A 4WO4B 4CNIB 1FAIH 2GCYB 3PHQA 5FYJE 4JKPH 4XGZA 5T1DL 1ZWIB 2PW1B 3MLSH 2NLJB 5DUPL 4N0FB 4P9ML 4E0RA 3BPLB 5CUSL 4I3GA 1QP1A 4CVXA 1PY9A 3DNKA 4OD1L 1OSZA 1XGTB 1FYTB 4ODXA 5KSAD 1U8MB 1IGFL 1FZOB 4OGYL 2R9HC 5E2VL 3RI5K 5IOPB 1I7RB 4OZIF 1OLZA 2XXCB 1CDYA 1I4FB 4QNPE 5I15H 3HA0A 3NIFE 1G6RH 4LSVL 5EZJA 1U8OB 2YA2A 1F4YL 2A0LD 4RQQA 4PGCA 5C09E 4Y2DA 1MQKH 4X7TB 4MD4B 4JFPB 3ARGA 4KV5F 4NN5C 3MRLB 1ZSDA 1CGSL 2ITCA 1DE4A 3M8OL 4X6EA 5JXEA 4RZCA 3L5XH 1F58H 4KKNA 1U95B 3GM0A 1M05B 5DK2A 4MXWL 3VGHA 4P5KB 4RGMB 5IHUL 1YEKH 3S8WA 4KPHL 1P7QA 4X4ZA 3RGVD 1ZTXL 1OT2A 4HUVA 5DD5H 3FQNB 3LOWA 3QRGL 3ULVD 4JFFA 3EYVB 3GM8A 1T0MB 4NYLA 4KKBD 3RKDD 3SE3A 4NRYB 3RIAF 1QSZA 3ARFA 3H2WA 3Q5YA 1ZGLM 5ICYA 2DQGH 3MJ6A 1UB5A 1IKNC 4FN0A 4WI3A 2QSTA 1Y18A 4NN6B 5C0IA 1NQBA 4PJBA 5FOBB 4QY8A 4MQ7B 5C0JB 3WHXB 3FO9B 3CFBB 4F7PB 2J6EA 2XPGB 4XRCB 3DETC 4PG2C 3TO4D 3HNSL 4PTUA 1A5FL 2J6EL 3MOBH 3LKPB 4HKXB 3SKJH 1Q0YH 3MREA 3U7WH 4EI5A 1I8IB 4JFXA 1NC2B 4KDTA 1J8HB 3B9VA 4C56E 3BOVA 2R9HD 3G08A 3KLAA 3S37L 3UEZA 3RY6A 1BLNA 5ANME 3SO5A 4X6CA 3B5TA 4EDXA 1CD0A 3IXAB 4PRNA 3BUYB 1IZJA 1WC7A 5INCA 3X17A 1MCPH 2XN9A 1U8QA 3CLFH 2ATKA 2BDNH 2X2YA 3JVGC 1NCAH 2QSVA 4ZXBD 1CR9L 2HFTA 2F58L 3GKWL 1QR1B 1Z9OA 1PZ5B 1KCSH 4NUGL 3MV7B 3V0WH 4XVJL 3VFUB 4OM1L 5IVXF 1GGBL 3I84A 3QZWB 3BZEB 3SKMA 5L88L 1WZMA 2OZ4H 1TZGL 2CR6A 4XBPB 4HIEA 5JW4N 1DBKL 4PJHB 4U6YB 4JQVA 1PG7L 1WVZA 5HHQB 3KPPB 1KFAL 2DI8A 3NN8A 5FGSA 4PLOB 1D6EA 2BCKB 4AIZB 1RUML 1I1YB 5F7EH 1J5OL 5D1XA 3ESVF 2FEEI 1R24A 3MGOB 1UENA 4L4VA 2AXFB 4QKXB 5I73B 4Q9QL 4AEFA 2RFXA 4M7JL 5J89A 1SBSL 4P99A 5F1IA 3OPZL 5AZEH 4LU5L 5IFHL 4WV1C 5FEBA 2V17L 5IJKA 4YBQC 4XMPH 1LEKA 3FFCB 2OS7A 3O3BB 1OTSD 3I3DA 4OLXL 3GUTB 2Q3ZA 1FJ1A 2ZNXA 2ZSWB 2E7BA 3HG1A 3QUMA 2HKHH 3MUY1 4XCFL 3D18A 4ZAKD 2YUWA 3HRZB 3C60B 3CMOH 5FCUH 2PW2A 5I8EB 2HJFA 3NA9L 1MHHB 5JUEH 1JZ5A 5J7CC 1JNHA 1TJGH 4JFEA 2GUOB 3B4NA 1QSEA 2V9QA 3KYOB 4X4MA 4Z77B 4B7LA 3WS6A 2UY7A 1IBGH 3LKQA 3RWEB 1HHIB 1DP0A 3WLWC 3KPMA 4ZPTB 1S7TA 3CFJB 4PJ8A 1R3JA 3O41B 3MRGA 4RAHA 1IEAB 5FDWA 1TETL 1I9RL 1U3HB 5JOPD 4WU7A 4N1HB 3MTRA 4ZUUB 5TGBA 4AMKL 5B4MC 5FYKH 4MWFA 4KXZH 4NKOB 5L6YL 4L29A 5E5UB 4DJMA 3VFGH 1DVFA 1TENA 3DXAE 4MB3A 5E2WH 1CXKA 4JM4L 3IKCB 3IFNL 5CEYA 1ZV5A 3GSXB 3MLZL 5I74B 2PN5A 1CDUA 3NACL 3HRPA 3VXSB 2H1PH 4OFKA 3V7AE 1BQSA 1G1YA 1BOGA 1MREH 3T0VA 5MEPB 1F4HA 1WEJL 1NEZG 3PWPA 3MLRL 3Q0HA 4I2XB 4IIQC 4B53A 4QEGA 3B2VH 1P84J 4XCCL 4IOFC 4QYOA 5F7DA 3G6DL 2VLKA 2ADGB 2D7TH 3G04B 1YMMD 2C4XA 4MQXD 1KELH 2DIJA 3QG6A 3VGBA 2HG5A 4NBZB 4N68A 2QQLL 3W2DL 2UWEA 1QSFA 3HI1B 3LHPL 1WWBX 4L4TA 43CAB 4XP6H 4Y5VC 4RGMC 2WSKA 3D3VB 4H1LB 5I71C 3MNVA 4G6MH 2BOBA 5I1IH 2Q86A 2BNRE 4F3FA 1CVSC 4LEOA 4YK4B 2R2BB 2PXYB 4UI2A 3VG0H 2D0HA 2GY5A 2DM2A 1G0XA 2E7HA 4J1UB 2R2EB 5CGTA 1GC1L 4O02H 4YX2L 1UEYA 3QXWA 1NFDF 4XPAH 2YS4A 4NN6C 4NNPL 5HGHA 4K9EL 3CX5K 1CQKA 3W81A 2UYLB 5LGHH 2ESVA 3TBVB 4WO4D 4F57H 3VH8B 4TULL 2HAZA 1ACYH 1S5HB 4QHKJ 5EPMB 3U7AA 1WFTA 4OFIA 2JIXB 2EXWC 1ZGLB 2R4SH 1KV3A 3QCVH 3ZDXF 2AJYH 2XICA 2VR4A 3L9RA 2DKUA 2V9RA 1YC8A 4PB0H 2ZKHH 3H0TA 1LE9A 3BW9A 1FYTD 1DL7L 4M1GL 4DUVA 25C8H 5CZXC 3BO8B 1OGTB 1KN2L 4PR5A 4RMUA 1Q9LB 3MGTB 4A6YL 4F33B 4NP4H 1F2XK 4NO3B 2B5IB 3PE9A 3E6FA 2DWEB 3C6LB 1HXMA 1AE6L 4HSQA 4ZQKB 3VE0B 4IOFD 3PQYB 4YHNA 4KI5D 2CXGA 2J12B 4Y4FC 4NO0B 4OZFH 4JJ5A 4PJEA 5EUOA 4UT7H 4PJIE 1NAMB 3TCXA 3SY0B 3KPQB 1ZGLP 1YEHL 1ED3A 2JTDA 1GL4B 3BGMA 4NO2B 4PG9B 4H1LH 4M48H 1RD6A 3VXOB 5GHWL 4JG0L 3L95B 1JPGA 1JWSB 4NM8H 5HVGB 5JPNA 1MJUL 5DJ6A 2IBZY 4JRXE 3BPOB 4Y5YC 2I60L 3TGXA 5GS2H 1J0ZA 5DD0H 2LVEA 1Q94A 3RJDA 4OM0L 5HYSB 3GJFK 3L7EA 4R8WH 5E1AA 5JHDE 5C09B 2FSEB 4XX1G 3VFRA 5FIEA 1E4KA 4AEIH 1IQWL 1YZZA 2Q76A 5CGMA 5GZNC 4DN4H 2EXWD 4HJJL 1CD1B 2KZ1B 5IFAL 1HHJB 4OZGE 2EEBA 1SJEB 4YPGB 3H9SE 5CLTA 3QIBA 3VCLB 3P77A 2QQKL 4KXZI 1NC2D 4PYHA 1J8HD 2V2XB 4PYGA 4GSDH 1UWGL 3VXQA 5TE7H 1KJMA 5CZXD 5DD6A 5GGRB 1MY7A 2YD3A 4XTRC 1G6VK 2NY2B 2VLJD 4JQXC 5EORH 1YDPA 3OKLA 3FQWA 2IBZX 2V6HA 1G7HA 1SYSB 4MNHB 3C60C 4TVPD 1BQHG 1SY6A 4P46B 1U8KA 1VGKB 5EB9A 1KC5L 5GS0H 3R8BB 2BY3A 4JHBA 1BVLB 2GK2A 6CGTA 4DK3A 4Z7OE 3MV7D 4BELD 4HG4K 1NGZB 3VRLF 5ICXA 3SQOL 1WTGT 4NC1C 5HJ3A 4YHLH 4QHNA 1ZK9A 3HZMA 5JNYA 4YXKH 1U3HC 5FYKD 3VFTB 4C56B 4H0HB 3DGGA 1BAFH 1LO2H 3CD4A 3KPTA 4GKZA 1R5WA 5GJSH 4JN1L 1XF4A 2AJVL 1N0XL 5CEXA 5T1LA 1VADA 5ANMB 2OCFD 3QCUH 1LQSR 2B7DT 2ICEB 5F7MC 5T1KB 1A22B 2EDXA 2F5AL 3MRRA 3HS0B 5I74C 4AY0A 4JY4A 4MCZB 3U0TA 4BH7B 5DJ2A 1C8PA 3HPJB 5GZND 4ZOBA 1I9EA 1WICA 4HIJB 4XHQA 1N7ML 4UTAL 5D6CB 5EOTB 3VXTB 3MO1B 3FFCD 1L9NA 5BZDB 2P5WA 1D9KC 3QXAA 4YHPB 4UUJB 5DMJB 3QSKB 5E8EA 3ARZA 3RL1B 3I6KB 2HJKA 3MBEA 2VZUA 3KYMB 2Y5TB 4J4PC 1RY7B 2HP4A 3FMGH 3NOIA 4P57A 1JZ3A 3C60D 3I6LE 1PSKL 2BVTA 4ENEC 4DK6A 2C1OA 3WEXA 1A6TA 4WW2B 3UTTE 3QIWA 5IIEA 2DQTH 3K3QA 2V7NA 5FB8A 1EEYB 1KOAA 2KKQA 4JY5H 4OJFL 4RNRB 3V6FA 1FGNH 3NAAH 5K9JH 1UZ8B 4YFLI 3QI9B 3MV8E 4WHCA 3WL9A 4OF6A 1G9NH 1YPZA 1FNFA 3EO0A 4M1CC 2CUHA 1JK8A 5TH2A 4DQOH 4RGOH 1A9BA 3VFPA 1U3HD 3BKCH 2BY1A 5TDPA 2NX5E 5IHZA 5GRVL 3CUPA 2KPNA 4YBLC 4KI5F 3WNNA 3LAFA 2AEQL 2VXVH 3UC0L 3VXRE 5DLML 3IXTB 3LH2L 1TVHB 4GBXB 4MAUH 1IQDB 1S5IL 1T0NA 3CVIH 1UVQA 3WLBB 2EIDA 5FECB 4JHZA 2V2WA 2YRZA 4M7ZB 3S6CA 3VXSD 2H32B 3QIUB 1QBLH 3NH7H 4WGVB 2D0GA 5JORA 5D5ME 4MXQC 3IVKB 2C3WA 4PJXA 1NGXA 1XF5A 3RWIA 1H3PH 4Y4KA 2B5IC 2G60H 5JW3H 1A4KB 5GS0C 4XWGL 2P5EE 4ODUB 1UYWL 3GGWB 4QWWC 4P2QE 2V5SA 1QKZL 4J4PD 4JY6A 1OGAE 1YN7B 4JZJB 3U6RA 2UZIH 1C5DA 3DXAB 1ZHNB 2ZUUA 2AK4E 1IC7L 4F37F 1HCVA 1YNLH 3D3VD 2A6IB 5FK9A 4ZFZA 4FZEL 3PL6A 2Z8RA 4HFWA 5DRNB 1YY9D 2PXYD 3VFOB 1UWXK 3HTLX 5HDQH 3EO1B 1PKOA 5DQJA 2XG5A 4G5ZL 5F7FA 3BPOC 4FQ1L 4XPBH 4JO2H 4BFGA 5D7IF 4RWYL 2GT9B 1IGJB 5EN2A 2RAMA 3KDMA 3SKNB 1QLFA 5JQHC 1FPTL 3RX7A 2H2SC 3WFHA 3WUWG 4CMHB 4HZLB 1PKQE 5DJZA 3O2VL 3MRCB 4URTB 4OV6F 1LHZA 3FRPG 4UQ2A 2JIXD 5HHOA 4LVHB 4ZUWB 1R0AL 5TE6H 1NKOA 3MRHB 2DQDL 2ZCHL 1RU9L 3OXRA 1EZVY 3VWKA 4XNQB 4U05A 3U83A 2A77L 2VH5L 4M1DH 4FQQB 2BNRB 1R3LA 4YO0A 4MXQD 5SV4A 2NY2C 3O45B 5F88A 5I18L 4WCYL 1PVHA 3QHFH 4QHMB 1FL6B 3NCEB 4PUBH 1V7NL 4JJHA 5A2IH 1IGYA 4LLAA 3SGJA 3P73A 1D5XA 3C6LD 1RFDL 4JFHD 4H88L 2NY1B 3RDTA 1UG9A 3PQYD 3H42H 4N5UA 2GAZA 2G75B 4PTTB 3FFDB 5C08A 3KYNA 1MF2H 2CMRL 4FFYH 2C3XA 5E4EB 3EOBB 5GSRB 5HD8C 1I7ZA 2VABA 3P30L 4NO0D 4YZFE 5FYJD 5DC9B 3GJEA 2VZ3A 5EA0L 1IL1B 2V7HB 4X9HA 3JV6B 1OAQL 5I76B 3PP3H 4TYUA 5BV7H 1EJOH 1EZVX 3UCRA 4GS7B 5D7KE 1WCBB 4KK8C 3UAJC 4TRPL 1YMHA 4HT1H 4NKDB 5D9SA 1KF9B 5C70A 3QBTB 2EDRA 4LQFL 1QR4A 3MFFA 5IB4A 2WV3A 1W8NA 4PJGF 5JLZB 1J10A 4WI9A 5DFWH 5C09D 1KXTB 2H2SD 3TVMA 5KW9L 3MRQA 1YEFH 1QVOB 5MI0C 3I6GA 4PJIB 1EGJH 3CCHA 4P5TA 4GRMB 3UYRL 3QQ9C 1KIRA 3D85A 2OL3B 4JPIB 3OKOB 5FO9B 3GSUB 4YHML 1ERNA 1IGCL 5J9PB 2E8YA 4K7FA 3MYZA 2Z31B 1J1PL 3P3YA 2DQHH 4Y4HB 1JGVL 2NY2D 4PJDF 4CUCA 4JRXB 3H7BA 3MRMA 5IW1A 4F7TA 5TQ0H 4M6AA 3G9VA 5INDB 3T8XB 1F6FB 1M1SA 5DXWA 3BZFB 3DVGA 4UT6L 3QEUA 5JHDB 2M26A 4OQTA 5HD8D 1PEZA 5GGSA 5BOPA 1ZA3B 3ZDYE 3DHMA 4OQTL 4S1SL 4E41A 1YUHA 1INDH 3ARYA 3EYOB 4OZGB 2ARJA 3H9SB 1FO0B 1T7YA 4OLVH 2AXGA 3GI9L 1A9EA 2R0WL 2YK1H 5IMOA 3UAJD 3RUGE 4C56D 4PGEA 5ACZA 2EDNA 3LKOA 5MEOA 3O4OB 5D7JB 3WUWB 1JP5A 3UDWA 4DZ8B 4O2EA 2GSGA 2XG4A 3P9MA 1V3MA 4MX7B 4Y8AA 4QRRA 4ZS7L 5T1KD 2R2HA 1OAXH 1VEMA 4XH2B 2E6QA 4M7ZC 1M7DA 1OSPH 3MR9A 4HIXH 3GBNL 1L9MA 3QIUC 1U6AL 1P6FA 4P2RE 5IBTH 2W9LA 3CLEH 5FO7A 4LIQE 1QO3A 1BMGA 4LCUA 1FZJA 3QQ9D 3HR5B 5EDXA 5CEZL 1AI1L 5IVNA 5F9AC 4J3OC 3WFZA 1BQLL 4LVOC 3IFOB 4OZ4B 1BZ9A 4BQ6A 4C55A 5I8CB 5DK0A 2DKMA 3JBG7 4ZUVA 1UXWB 1J9CT 4K71B 1FNSH 4GKSB 3KJ4B 3V4UL 5KVEL 3MA9L 4ZD3H 4CMMA 4R0LA 5IR1B 2I27N 3D9AL 3GHEH 2OJEA 2VZTA 2OTWA 2FIKA 2VITB 1I8LC 3B2UD 3LEVH 3SBWA 3QI9D 2XWJB 2OYPA 3S36H 1EO8H 2MCPH 3F65A 4ISVA 1VPOL 4WTWA 1FLTX 2Y07H 2DWDB 4FS0A 3BP6B 1IM3A 4X7DC 3X13A 1E4XH 5KTEL 4I18B 5BQ7B 1JN6B 1YQ2A 4GBXD 1HK6A 1C1EH 4G80A 4V1DA 2DQIL 4XNXH 1HKLH 2DJ4A 4GW4B 3OKDA 3UTTB 1W0YT 1JYXA 3TA3C 3QIUD 1Q72L 3OMZA 3LKRB 4QRQB 1HH6B 3I2CL 5EIVA 3HN3A 4GRLB 4OKVB 4DZBB 5JIHA 3MV8B 2ICWJ 1I1FA 1Q1JH 3IETA 1CDHA 1UWEL 1I3GH 4PRPA 1T1XA 2A9ML 2GEEA 4B0MM 1WISA 1MFAH 2NX5B 4PJ5E 1WF5A 3QDGA 3O6KH 1A7NL 3ZYZA 4IJ3C 3S3SA 3VXRB 5E4EC 4F9PA 4X99B 1RZ8B 1BFVH 1UM4H 3DXAD 3RTQB 5EU7E 1BEYH 1X5AA 1KJ2A 4M6NL 3H7LA 1CZ8L 1EAPB 4IM8A 2J4WL 5B38A 5EC1B 1KJ2L 1Q9KB 1UB6B 2XZZA 3STZB 5JQ6H 4GS7C 3T4AB 4PV8B 4OGXL 4XPGH 4XB7A 2GK0B 1U42A 4QT5A 5D5MB 4X5XA 5GRYA 1KLGB 3SDDB 2NXZB 3K7UA 3S3JA 4FQHA 3BYYA 2CIKA 2Y36H 3QFJE 3FTGB 4H26B 4ZPVA 3ROOA 4H0IA 4S1DC 1YEDA 2YD8A 4OFDA 3MXVH 1NGQL 2P5EB 2Q7NA 3DLQR 5MP6H 4O51B 4PB9L 2DLFH 1MNUH 1S8DB 1ZHBB 5SWZA 1OGAB 3MRKB 4UIMA 4F2MB 4LSDA 4RMWA 1XR9B 4YDIH 4FXGB 2AK4B 4XCYB 1NUNB 4F58H 3SE4A 1BBJA 1EV2E 4UIKH 4Y5XC 2C4FT 2BNRD 1NEUA 4R90L 2ORBL 2Z31C 4PJAE 4UTBH 4Y4HC 2AI0H 3DX8A 4LVNB 1P7KB 5DS8B 3FAXA 3GMPA 3RL2B 1MSPA 4JDVB 1H3XA 4NM4H 4X4XA 5EZIL 2NY1D 2CJUH 1OARL 4I0PB 5BS0A 4LPVA 1VFMA 5C8JB 3NFNB 5E2TH 5I1EL 1PKQB 3REWA 1RURL 3QH3A 1DN0A 3CH1A 5EZLB 4X4YA 5D7LE 3C87A 4V2CB 1K2DA 2EDTA 4B5EA 4OLWH 4LASH 3V0VB 4MA3B 1VCAA 1FL3B 5CWSB 5HXMA 3I50H 1DFBL 5IVXA 4G9FE 4MAYC 4JDZA 5JA8B 1S7SA 1SYVA 5HI5C 4ONFH 2EIZA 3CAFA 3IJSB 4PJ9C 3FKUS 5I1CH 5CZVL 5GISH 1M7IB 4HKJB 2MPAL 1JGLH 3WXWL 1RZJL 1F3DH 4CN1A 3ULUE 3DPBA 2JB6B 2X5PA 3QPQC 3V5DA 4LVEA 3L3HB 1BJ1J 4KU1A 3QUXC 4MQSB 2Z91B 5C2BL 3N9GL 3BIBX 3DGCR 4KJYB 1FV1A 3C5JA 2K7PA 1MPAH 32C2A 1ORSA 3QNXA 1I3VA 4HLZH 5I1LA 3VFNA 4YHIA 5F9JA 5E1HB 1B0GA 2H9GA 5E2UH 3DUSA 3IDMA 3ZLQC 5B8CB 2Z31D 5DMKA 4Y4HD 4NZDA 4NCC2 4WTZG 1AIFB 2HT3C 2EIBA 5TDOA 4JRXD 3HC4L 5EBLA 2BSED 1B6DA 4LPUA 4K71C 4HUKB 1NCTA 4R4FL 1IC5L 4M4PA 4J6RL 3RY5A 1CU4L 3HNVH 3REVB 5J1AA 3JTTB 1LDSA 2VIRA 3LN5A 2IQ9H 1R3HA 5JHDD 1NL0L 2NR6D 5IK3B 4N9GA 5IMMA 1CDCA 3O6MH 3ARVA 1BECA 4Y8DC 4Z7QF 2FIRT 3HZKA 5DYOA 2CUIA 4NQSA 3H9SD 2LABA 2X4PA 4GW5B 5CSBA 3PWJB 4BSVA 1TVBB 1TJIH 2IPKA 1RJZA 4TSCH 5T3XE 2A83B 1BFOA 2DQJL 4FABH 4TNVF 2Z92B 1WIPA 5D7JD 1YYMH 2XA3A 3S4SA 4I18C 3R1GL 4GMTH 1RI8A 3JWOL 3UBXG 1TJHH 2AV7B 3O11A 3V0AC 2WINA 3RNQB 1NDGA 1J1OL 2DLHA 4KRNA 1FC1A 1MFNA 3KYAA 5GRUL 1AC6A 1DSFL 5F6HI 2VDPH 3V5HB 5J1SC 3PUCA 1ZOXA 4OCRL 3RGVA 4GRLC 5ENWA 1FGVL 5I1JL 3ZO0A 2BSTA 3LS5H 5ERWB 3DBXB 2DN7A 5EBWA 4IDJH 3UJTH 4ZSOA 1GOFA 4Z7UF 4R26H 2CKNA 1D5MB 1EEZA 1IM9A 3ARQA 4RA3A 1YYLH 3ULVL 3JWDC 3RUGB 1URLA 1I85C 1T5XB 3VI4E 3UPRA 2OTPA 4F15B 4X6DF 4LLWB 2GJ6E 3RNKA 3RWHB 1T1WB 3TPUB 1BIIB 4HUXA 4LAQL 4LPYA 2FGWL 4BUGA 3M17B 2EO1A 4XI5C 4YDJB 1KIPA 3TO4A 4MHHI 3RVWC 3ZE1F 3AY4C 2EDYA 1CE1L 1TPXC 3DI2B 4P2RB 4LKCB 4NKIH 4Y7MA 3PWNB 2DDQH 4XNYL 2ZSVA 1C7SA 5IGXL 1JPFA 3DARA 1HQ4B 2XZQL 2HVKA 1FORL 4U4BA 3O9WB 5TFSH 1HN1A 4FXLA 1JGDB 1P4LA 2XZCH 4XZUA 3EDDA 5F9OH 1EERB 1N59B 5E5RB 1MJJB 4KTEL 3HAEH 3AREC 4XP1H 3I6LD 5IVZB 5LXGH 5D1QB 5GGVL 4H5SA 4ZXBA 2UZXB 4L4JA 4KC3B 3UTTD 1AD0B 5IMLA 4O5LL 4OF5A 3OR7B 4W4OC 3BQUB 4IS6A 2FBOJ 4AEEA 1CK0H 4GRLD 4LLQA 5KVFH 3GI8L 4U2YA 4DOHE 3BRDA 3MV8D 4FFZL 3MMEB 4LVNC 2YKLH 1WAAE 4ZODA 3WNPA 3MRDB 4ZO8A 5K93A 2NX5D 3EGSA 5CINH 1T04A 1H9VA 1O7SA 3FQUB 2Q7YA 3V95A 3VXRD 4I3SL 2O93L 1L7TL 5GRVK 1RUPH 4GOSA 2YA0A 4TUKL 3RTQD 4P3DB 4QCIB 3L3OB 4XI5D 2WWMC 3LN4B 3MLXL 3ZKNC 1PX3A 3WIHA 5BOZG 3MRFA 2OBGA 3CDYA 3CX5J 4KK5C 5GQBA 4NWUL 4LPWA 3WIHL 2FX9L 3SDDD 2NXZD 4TOYL 3UMTA 4F8QA 3FQXB 4M7LH 2F54E 4Y19E 1NLBH 1U91B 3OWEA 1LILA 2VQTA 4CN4A 1AFVL 4IHOB 4LIQH 3B9KB 4ZAKA 1PLGL 2IAMC 4HFUL 4X9FA 3TFKD 4PJ5B 2P5ED 3FL7A 3CSYA 3K2UL 4CVZB 5LWYL 1AQDB 1I7TA 2EYTB 4P2QD 1AGDA 2X1QA 3GMOB 5HHXL 3MV9A 1OGAD 1ND0A 1NMAH 2WUBL 2IPUK 2BOCB 1ZT7A 4MXVF 2AK4D 3VRIB 1A6UH 5E5MA 3G5ZA 2FBJH 4AH2B 4NUJB 4Q6IB 3SJVE 4KHXH 5D6DC 1KN4L 4HXBH 3U7YH 4CL7A 3OF6D 1OAUH 2PYFB 2VR9A 3U82B 2NNAB 5B8CC 4PP1D 1ZXQA 4XPHL 2GITA 4XMLL 1CFSB 3T77A 2FEDC 4TUOB 2UV3A 3RA7L 4YFEA 2DQFB 3QFJB 5ESQB 1OM3H 3CDFA 3LEYH 2DL9A 4U1SB 3PHOB 3PV6A 3RI5F 2P8LA 3NFPB 4MA8H 2X9XA 2ZJSL 4L8BB 4I0PD 3RFZC 2DMKA 3FQTA 3GMNA 1KCLA 4AT6B 5BZWB 5ALBH 5C0FB 4WFGE 2IFGA 1A1OA 3RBSA 2H26B 4HUUA 3G5VA 4L3CB 3VFWB 3JSSA 5JPMA 2VYRE 1DUZA 4YFDB 1DQJA 4JREC 5HGBB 2WWMD 3SPVB 4ODHH 5GGTA 3UZEA 2VQ1A 2J8UF 1I8MB 2CGRL 4L8SC 4NT6B 1U8PA 1G6RL 4PJAB 3ILPA 4LCWB 5L0QB 3P4MA 1FL5A 2GFBB 4M8QA 4QF1B 3TZVB 2NXYB 4HBQA 5C0GA 2R29H 3S96B 1YMMA 4S1QH 5ADPH 1X7QB 2VUOA 5T3ZE 4OD3L 2OK0H 1NMCB 4R7NA 4GRWE 3MRIA 1XGYL 4HK0A 4U6VH 1IVLA 3P4NA 4XAKE 3QUYC 5D7LB 3F12B 1ONQA 3C09B 5IB3B 5IW6A 1QLEL 4U1HB 2AXHA 5F1NB 2VB5A 4UB0L 2ERJC 4I4WA 1KB5B 4NQXB 4YDVA 5TF0A 5IEKB 5D7KD 4G9FB 4TSAL 3C6SA 1XH3B 1YNTB 3B6SB 1MVFA 3MCLH 3KAAA 4F15C 3V7MA 4J7RA 4X5WB 1IGIH 1Z5LA 1T66D 2EDHA 1EFXB 3LQZB 4OCSL 2MOVA 4WO4A 4CNIA 1VGEH 5EO0B 3DIFB 1J11A 1ZWIA 2PW1A 2NLJA 1H8NA 5I19H 4NBYB 5GXBB 4N0FA 5DUML 3ULSB 2ZOLB 3WN5C 5F21B 4CJ1A 1NCUA 3TN0B 1FFRA 3QDHA 4OZHE 1AGFB 1FYTA 2P4AB 2Q1EA 1U8MA 4YLQT 1MWAH 3EHBC 4KVNH 1FZOA 5IOPA 2APWA 1I7RA 4JO1L 4PV9B 1ETZA 3JUZA 5EWIL 3F58H 1I4FA 5CKGA 3KLHC 3O9WC 4JG1H 2H6PB 1MRCL 5JO5B 1U8OA 4F7CB 2VAJA 3VW3H 3C5ZB 4FFVC 3BE1L 1GGCL 2DLGA 4X7TA 1SEBB 4JFPA 4LMQE 2EDWA 3MRLA 5K9QG 2SEBB 3W11D 2R0ZH 4YHZL 3KG5A 1U95A 1M05A 4LSQH 1T21A 3BQUC 3T0EC 4JKKA 5IB2A 2OZ4L 3FQNA 4JVPA 1T0MA 1EEUA 4YHOL 4JCLA 1F6AB 3U4EB 3R0NA 1FBIL 2FH6A 1S7WA 1MCWW 2CLVB 5LG1A 3SKOB 5FOBA 2HRPL 3V52L 4LCIL 2W9EL 4QXUH 5C0JA 1F5WA 3FO9A 4XAWH 3CFBA 4F7PA 4XXCA 1P2CA 3HZVB 3SGEI 3O6FB 2XPGA 4XRCA 3ILQD 3PGFL 1CBVL 3KR3L 3GNMH 5E7BA 5AZEL 4LGRB 1X44A 1X5XA 3LKPA 4HKXA 1AP2B 1I8IA 3HMXH 2EDOA 4P2RD 4XMPL 3FCTA 1NC2A 1J8HA 5E08L 1EK3A 3S88H 3CZJA 1U93A 3PGDB 3EHBD 3P40A 3LRSA 1EXUB 1P53A 4G8EB 3F7YA 2A38A 5DMGC 1JHKL 5KS9E 1TTFA 1ZE3C 4XP9H 3O9WD 2OP4H 1QD0A 5D7IA 3BUYA 3UJIL 1NBZB 4QRPE 1AD9A 3LV3A 2GJ6B 2EDKA 5HI4C 5JUEL 4YPJA 4TVPL 3BESR 5TQ2L 5I1HL 4G8GE 4HWEL 5D1QD 2HH0L 1Y6MR 1CQYA 2DTSA 5EU7C 4PLNC 3PIQB 5F89B 1QR1A 4BKLB 1PZ5A 1TIUA 3LPWA 4XC1H 1JHLH 3MV7A 2AAVA 4KROC 5LAXB 3VFUA 2R1WB 2KQNA 1CGUA 3C08H 4P59H 1II4E 3BQUD 4OLYL 3QZWA 3BZEA 2PUQT 2VN7A 5FM8A 2W0FB 4N8VB 4HGWB 4XBPA 1RZKH 3ZTNL 4PJHA 4U6YA 1I7UB 2ZCKH 4I77H 3KPPA 4JRWA 4NKQB 2YXFA 5EOCL 2BCKA 4AIZA 4G8IB 4HHAB 3QUZB 1I1YA 4OCWL 4QHKI 4PRBB 2BFVH 5C0AE 12E8L 3RWCB 3VA6A 5CP3H 3TPKA 4G3YH 1U8IB 2AXFA 3CFIC 4D0DB 1FG9C 2WIMA 1E28B 3PP3K 3LSOB 2CKBA 3DURB 1T20B 3BXNB 1H0DB 3N1FC 4XP5L 3QG7H 4FFWD 1KPVA 1RIUL 5JZ7D 1GGYA 1QFUH 4M61A 2Z8SA 3FFCA 4Q2ZA 4JM2F 4EEEA 1HSAB 3O3BA 2W1NA 1U3ZA 3GUTA 2QQNH 1X5FA 4DOHB 2ZSWA 1NGYB 2NXYC 3GSNB 4JQXA 3DX7A 5J13B 3B9KD 3HRZA 2DBJA 3EIFA 3AXLA 4PJ5D 4OIAA 1NMCC 5I8EA 2Y06H 2R4RH 2EDEA 1MHHA 3HUJE 1K8IB 4P9HL 2GUOA 2Z8WC 3KYOA 2IPTL 4Z77A 1GHFH 5T5FL 4ZOCA 3ZHDA 1CDGA 3RWEA 5D70L 3W39A 4HPYH 4K7PY 5H8DA 3CFJA 4HGMA 2ED7A 2H8PB 3O41A 1IEAA 4KUZH 5IEHB 1U3HA 2OJZH 2ZPKL 1QNZL 4ZUUA 3OKEB 3QFJD 2F54B 4TSBH 4Y19B 5DGQA 3FT4B 1WUNT 1ACYL 1MFEH 1CWVA 1DQML 4I5BB 4NSKA 1H15B 4IRZL 1BQUA 3IU4H 3IKCA 4ODTL 5C0NC 3GSXA 3E8UL 3T2QA 3SDYL 3RIAK 1A6WL 3DYMA 3STLB 3VXSA 5HHNA 3JTSB 4UZGA 3BEWB 3EFDH 1QLRB 3AMLA 5MEPA 4WEMB 1KLFA 3SJVB 4DKFL 3GSQB 4I2XA 4K7PX 3UYOD 3MOAL 5BCAA 1I8KB 3TZVD 2NXYD 1R3KA 3U9PL 3G04A 4XNUL 3NFSL 1P4BH 3JV5A 1M6OA 4JPKL 4RBPH 4KDWA 3F7PC 3HI1A 43CAA 5A1AA 3D3VA 4L3EE 1SEQH 1Q9OB 2EYSA 4AL8H 1RZKC 3OB0K 2BVOA 2JB5H 5D7LD 1Y6KR 4CDGC 2EZ0C 2R2BA 2PXYA 3IYLW 3NPSB 5HYEA 4J1UA 2R2EA 1N6QH 2MMXA 3NZHL 2FJGB 4G9FD 1ZLSH 3GO1L 5A43C 3L3GB 1CLZH 1EFXD 4OD2B 1JWUB 2HLAB 5ALCH 3CIQA 5DHXB 3ULUD 3VH8A 1BHGA 5ISZE 1IRAY 1NBYB 1NCCL 1S5HA 2XA8L 5EPMA 2JIXA 1ZGLA 1VA9A 2Q3AA 4GRWB 2G9HB 5C0ND 3TN0D 2CRMA 1RVFL 3MRNB 4NHCL 1MHEB 4R7DB 1JWMB 1KNOB 5EU3B 2IH1B 3BO8A 3TO2B 1OGTA 4DWHA 2FX7L 1Q9LA 4MVBD 1REIA 4F33A 2EYRB 3MCKB 4NO3A 15C8L 1G1CA 2ZG3A 4JHAH 2DWEA 3C6LA 3L3IA 4ZQKA 3VE0A 1KXQE 3C5ZD 4X98B 3PQYA 1HYSC 4RAUB 2AKRB 2PYEA 5B22A 4JVUA 1T89A 3ZKSD 1NCWH 1TCRB 4NKMB 4NO0A 3T3PE 1QRKA 3C9NA 5DWUL 1HSBA 2DD8H 1NAMA 4KMLB 4Q6YA 5FYJL 3SY0A 3U2SB 3KPQA 4G8FB 3SCMB 4OZHB 1C5BL 1NAML 3H8NA 1CGWA 3MXWH 4MJ6B 4PG9A 1V3JA 3VXOA 1XIWB 1DCLA 4M7KL 5ICZB 2X1WL 1JWSA 4NZTH 3ME0A 1PEWA 5D96C 1ZANH 5GRWA 1WZ1H 4O2CA 1GOHA 3P2TA 5T3XD 4WHDA 4BQBA 1UCBH 1QYGH 3ZHKA 2X70B 2IG2H 4LK4A 3IDIB 3QJHB 5HYSA 1VERA 1B88A 4DW2H 5C09A 2FSEA 3PWLB 4ELMF 3O6FD 3NCYS 1CD1A 1FRGH 3DSFH 2CLZB 4YR6A 1HHJA 4P2OB 3G9AB 4YPGA 1SJEA 4RDQG 3VCLA 1I1AB 2VDQH 4GRWH 3B9DA 2V2XA 1WTLA 1O5DT 2VXQL 1LGVA 4YC2B 5GGRA 2X4OB 1CFNB 4KK6C 4PRHE 4HCRH 4NFDA 2WQRA 5CD3B 5LCVL 3K1DA 1SYSA 3FMGL 1KGCE 1UT9A 1B2WH 3BP4B 2R39A 2CLRB 4P46A 4FG6D 1A6ZA 2GJ6D 5J12C 1VGKA 1HYSD 2IH3B 4JDTL 3MLUL 5TDNB 3HMWH 3ARUA 2AGJL 3IB4A 4FQ2L 1BVLA 5CJOL 2FJHB 4WFHE 4AIXA 4NQDE 3ORJA 1NGZA 2VC2L 3WFDL 5I8KH 4MD0B 5HPOA 3WFEH 3M1BB 2A2QT 2ZUSA 5EC2B 4PJAF 1QFWM 3VFTA 1YEJH 4KGJA 4JO3L 3S35H 1NDMB 4H20L 4GQ9H 5KS9B 5HHVL 1JRHH 3D69B 2DMCA 4GKNB 1LEGB 2VXVL 5C7XH 5ANMA 5I1KH 5AUMA 3A6BL 1CD8A 3LD8C 2H3NB 5DJAB 2ICEA 2Y9RT 3QUZD 5T1KA 4QRPB 2DLEA 2E6PA 1I1RA 3HS0A 4OF7A 4WTXA 4KUCD 1Z6JT 4MCZA 4G8GB 3BKML 5AZ2L 5F3HA 3HPJA 3HE7A 4D9LL 1AHWC 2Q8AH 3V9FA 3EYFB 4HIJA 2J88H 3QQ3B 4G7YH 3OAUH 3ZMRA 5D6CA 5EOTA 3VXTA 2Y25A 3WO3B 2OR9L 3DUUB 3NCJH 1EHLL 4UUJA 1RZGB 3K80A 4KK6D 4I1NB 4IDLA 3KYMA 2Y5TA 2FDBP 4HMCA 5TF1L 3ULUF 4DGVL 4M62L 1LO0H 1KTLB 5A2LH 4K3JL 2X09A 3HB3D 2FWOB 4U6XB 4OCYL 1BFTA 1HKFA 4KRPB 4WW2A 5C0AB 4EUPB 1N5AB 4K2UH 1JJUA 1EEYA 3O0RL 4WGWB 5F96L 5KJRH 4RNRA 1IKFH 5AEAA 3G5YB 3VMNA 3QI9A 1TQCC 2YRLA 4DVBA 2C7UB 3BKJH 1JPSH 3DX6B 3GBML 4QXGL 4Q97A 2F54D 4Y19D 3OX8A 1MJ8L 3IXTA 5FHBL 3QCTH 3MJ8B 1TVHA 4GBXA 4QHLB 1NLDH 4C58B 5EZOL 3WJJC 1IQDA 5JMRA 3WLBA 4EKXA 3HUJB 5KN5B 4UV7H 5B39B 3EOYG 2H32A 3TYGL 4X0KB 5FYLH 1EHNA 1XAUA 4DKAA 2IANE 3SDCB 3SJVD 3IVKA 3GIZH 1BF8A 3GSRB 2I9TB 2YD2A 4LOUD 1BQHA 2MJWA 1A4KA 1FE8H 2A73B 3IDXL 3IRPX 4YGVB 2CO7B 4ODUA 3GGWA 1ZHLB 2D7QA 4HQQH 3O2WH 3RPIB 4M4RA 3U0WL 3QT2A 1KLUB 4HJGB 1YN7A 1KACB 4JZJA 5E8PB 2YOCA 3DXAA 1ZHNA 1HHKB 5FGBA 4UMGA 4WFGD 3HE6C 2A6IA 2VWEC 2NW3B 1YY8B 3ARDC 5DRNA 5DZOA 4DGIL 3CFKB 1K6QL 1XIWC 4RSVA 4R2GB 1A21A 2D3VA 1C5CH 4MZ2A 1E6JH 2QHRL 3VFOA 1KEGL 3ZE2F 4F7EB 8FABB 4PJCE 4GMSH 2D9QB 4Z0XB 1JF1B 4QRSA 1MY5A 5DJ8B 5DEZA 2ICCA 1IGJA 4Q9CA 3SE8L 3BEVB 3SKNA 1J1XH 3BGFB 4X6DA 4HZLA 4DCQB 1NH6A 4OLZL 5IM7B 5IBLD 4XVTL 5KG9B 5T3ZD 3DROB 5ITBL 5JDSB 2IQAA 4YIQA 5FXCH 4ZUWA 2QR0A 1DEEB 3MRHA 2WLYA 4XBEH 1JRHI 4IRJC 4L3EB 1I1AC 1CL7I 4XAKD 4L5FH 1CL7L 4GG6F 1OWRM 2DL2A 1A1MB 2HA1A 4G7VL 2BNRA 4YC2C 2FRGP 1JI2A 2R2CA 2DAVA 3O45A 3ZHLA 1A2YB 5HDBF 3PDGA 4QHMA 1FL6A 4NQED 3MCG1 3LKSB 4MNGE 1BIHA 4NGHH 4YNYB 4G6JH 3ZDZF 3I75B 4JR9L 4UT9L 4F9LA 1HI6B 4PTTA 3FFDA 4EN3B 3EBAA 4OI7A 3EOBA 5GSRA 4AEHH 5ISZB 1N5YL 1UC6A 4F8TA 1N4XH 3O3DB 4U1MB 1MVUB 4GUPA 2ADFH 3TJEL 5IJVA 2V7HA 3FN0L 5HPMB 2F15A 1UM6H 3JV6A 3ZE0E 2VN4A 3BKYL 1BJ1H 3SCMD 5E94A 2IGFH 2B4CL 5E6IC 1P9MC 1QBMH 1WCBA 3KPLB 5CCKL 1BM3L 2B39A 3DV6A 4BJLA 4K3DH 1FFOB 4FNLH 2DICA 1XIWD 1TITA 3WNOA 4D8PB 3LCYA 1HILB 3BUTA 1HEZB 3N1MC 1S9YB 4XP4H 3QEQE 5ID0B 3TV3H 1FIGH 5C6TH 5BVPL 2V5RA 2NTSP 1DQDH 5EBGA 2CDFB 1EMTH 1FC2D 1FDLH 5IB5B 3AM8A 1XGUB 3WE6B 4LSUH 4YHKL 5DHVH 1QVOA 4P2YA 3OKMB 4P2OD 3CLEL 4MQTB 3D2UB 4GRMA 4RIRB 4QOKE 3BDBA 1I1AD 2OL3A 3OKOA 5FO9A 3GSUA 2ICWI 5DD1H 1TNNA 4MZ3A 5J9PA 1IC4L 2OL3L 3MACH 2R8SL 3HFMH 4JRXA 2AJ3B 2MQCA 2XTJE 4GXUN 4PBXA 4X6BA 3WXVH 5FAAA 3GDBA 1A47A 2OM5A 2QADC 4O2FB 4ZD3L 5JHLH 2JELH 2XWTA 5INDA 3FOLB 4WENB 4J3SA 3BZFA 5JHDA 4JKMA 4UV4H 5DD3H 3X3GL 1ZEAH 3MLTA 1SM3L 4DGYH 4LNRB 1MCCA 3L7FA 1T80A 3SE9L 1JPTH 2XT1B 3CFDB 5E99H 3CXHJ 4LSRL 2AW2A 3EYOA 4OZGA 3H9SA 1HZHH 5CHNB 3EDJA 3S98A 1FO0L 1EAJA 1CI5A 5D7JA 3WUWA 4DZ8A 4PRHB 5IMKB 1A7QL 4NJAH 4NRZB 1GAFL 4ZUTB 5AD0B 5AAWA 3BDYH 4MX7A 1YEGH 3MUZ1 5GJTL 35C8H 1FSKC 1Q38A 4QRPD 2AJZB 4QRUA 1CIUA 3UJJL 4XH2A 4WRLA 5A16A 2WBWB 3RVTD 4NOFA 3AUVA 3NIGE 4G8GD 4N8CH 2FB4H 4BFIB 4HULB 2EH8L 1FFQA 5I6XC 4Z7VE 1DUYB 1LK3H 5B3NA 3TT1L 4C83B 1FNHA 4NQDB 3SDCC 4M9OA 1A4JB 2C1PB 1MRFH 3AAZB 2X42A 5FKPB 4HIHA 1DQQB 4KJQC 4S0SD 3IFOA 2YBRB 2B0SH 5TE4H 4OZ4A 1VFBB 1YJDL 1OL0A 3HKFA 4K8RD 4MDJB 5I8CA 2AJSH 3X3FL 3NTCL 4ZMAT 1JHTB 1QHPA 4KRPD 5C0AD 4HS8H 4IMLB 1U3JA 5GS1B 5IR1A 1J0HA 1MH5B 4NO5B 3O6LH 1D5BB 1Q0XL 4WFFE 3WDJA 2ZUXA 4FQJH 4GXVL 2B1HL 1U8NB 5B38G 2R56L 5C07A 2BJMH 5FF6B 4O4YH 5I2IB 4WIQA 4ZUSB 2DWDA 5IROC 3IKKA 4JVWA 4I3RL 4XBGA 3BP6A 4YUEL 1NAKL 4YDLC 2BRRH 1RUQH 3BT2H 1SMAA 3MRBB 4PJ7E 2UWEF 4Z0BL 4OLUH 4I18A 3RWFB 5BQ7A 2BHYA 1JN6A 4OTXH 4EDWH 2EECA 2YD4A 3OJ2C 1LDPL 3NABH 5BMFH 2CXKA 5ACMA 5AYQA 4U1LB 3PDDA 4YJZL 5FYKU 3WFCH 5J11C 3LKRA 4QRQA 1HH6A 4D3CH 1K9TA 1QA9B 1FNGB 4GRLA 3MNWB 4OKVA 4DZBA 3O4LE 3SDCD 3MV8A 1WWAX 5I8OL 4JGJA 5IKCA 4DEPB 1LO3L 4KH2A 5CSGA 1OAYH 1T2QH 4KJQD 3R06B 3PWVB 4C4KO 2NX5A 3D25B 1R6VA 1MCOH 3JWDL 2LTQC 1F90H 1M4KA 4OF8A 3KHQA 4Q9RL 4X99A 1RZ8A 4PJBE 1AR1D 3IDGB 3RTQA 3TYFB 5JMOC 4N0CD 3N1QC 2OI9C 2W60B 1Q9KA 1UB6A 3STZA 3U46A 3VJ6A 2I26N 4H8WL 4PV8A 4XPTH 1CFBA 4G6AD 1TZHB 2GK0A 4R2GD 5D5MA 5KSVA 1U92B 1K4CA 1E6OH 1KLGA 1T83A 3SDDA 2IANB 3TJHC 4OT1H 4RFEB 3RVVC 4F7MB 3FTGA 4H26A 1NC4B 1ZT4B 2MNUA 2UY6A 1JGEA 3L6FB 1V3LA 3MNZB 5DUBB 1DANT 1AGEB 4XNZB 2P5EA 3BN9C 1GGUA 2WZPD 2OXGA 4PJEF 1W72B 4O51A 3HZYB 4KKCC 5HYFA 1S8DA 1ZHBA 2XN9E 4XXDA 5EIQA 5IB1A 1A7BA 1UACH 3OV6A 5ABDE 1XR9A 3WFBH 5GS3A 5JW4Q 2D31A 2AK4A 4XCYA 4P23B 2YD6A 4L3ED 5CJ5A 3S3PA 2M2DA 1NFIB 3OF6A 1XF1A 2FR4B 3G6JE 1MEXL 3Q3GB 5FUCC 3UZVB 4PJCB 1P7KA 1WSST 5DS8A 5C2UB 3RL2A 4JDVA 2DLTA 5CD5C 4I0PA 4MCYB 4DVRH 1MFBL 2DMBA 3GJFH 3KPNA 3Q2CA 4J3WA 5DEFB 5C8JA 3NFNA 4EN3D 1D5ZA 3ZT6A 5ISZD 1PKQA 3VRJB 5E70A 1FFPA 4CBPA 2WMPA 5EZLA 1D5IL 3LKNB 3HI5L 3BISA 4AZ8A 4QXWA 2KDGA 4PBVC 3LS4H 2DOCA 4HS3B 1DQLL 4PGZA 3V0VA 4U3XA 4MA3A 5CWSA 5JIPA 2XKUA 3BD5A 1G9MH 1JNJA 1RHHB 2FD6L 4LCCB 1DN2A 1MELA 3E1F1 3T0WA 5K9OB 4CJ0A 5FM4A 5DQDL 1YYML 3UO1H 3RVVD 2OX5A 4XMKL 1M7IA 4HKJA 4MNGB 1BJMA 1CLYH 1LE5B 4GMTL 3H3PH 4JM2C 2JB6A 2YUXA 1GZQB 5CBEB 3L3HA 4WWKB 3MX0A 2Z91A 4IRSB 3C8KB 4AIOA 2MHAB 2ATPB 4KJYA 4KKCD 4P4KB 2E7LA 3D0VB 1NMBH 2AK1L 3U1SL 2DTML 3CZFB 3D2UD 4X4ME 4G6KH 4LLDB 3UJTL 5F3BB 3QDMA 4I0CC 3GZKA 5DFVC 1LVEA 5B8CA 3VI3E 1V7MH 2R0LL 1AIFA 2EIEA 1Z3GL 3H3BC 4ZS6D 3QEQB 3RZWA 1A6VL 2AV1B 4UU9B 2YPVL 3S34H 5BVJB 1L0QA 2BVEA 4ONGH 3WS3A 4RDQF 1QFOA 2DM4A 5CD5D 4HWBA 3VXUE 1UJ3C 4LHUB 2XXMB 3JTTA 2WAHA 3NCMA 5IK3A 4HWBL 4HWZB 1XCQB 1ZLWK 2UZYB 2EC9T 4Z7WE 4JAMB 5FO8B 2AJXL 4NZRL 4GAFB 4NKIL 1T03L 1J12A 1GZPB 1UKSA 4GW5A 4QOKB 4WVRA 3PWJA 3S7GA 3T0BA 3V6ZB 1TVBA 1CF8H 3WV0A 5DJ0B 5DT1H 2A83A 4LRIC 3PWPE 1LO5B 4ODVH 1W0WB 2Z92A 4EQ2A 1VB9A 2PO6A 3GMMB 4OI8A 4PRHD 3THMH 3FOMA 1A3RL 2XTJB 2C26A 1KGCD 1OQXA 4R96B 5D1ZB 5L7XH 1IEBB 3CU1A 5CIPB 2V5YA 3OR6A 2AV7A 2HVJB 7FABH 1BWWA 3RNQA 4GG8B 3GK8H 3Q1SL 4HPOL 4LSPL 3CC5B 1QSFE 3NPZB 3EYQC 3V5HA 3MJ9H 2NYYC 1FQ9C 2D7MA 4WFHD 4NQDD 2I07B 5ERWA 3DBXA 3IFPB 3AVEA 4HF5L 4XHJD 5D72L 1EBAA 1D5MA 3SEPA 1GIGL 2DB8A 5F72S 3RUGA 1T5XA 4YXHH 3RRQA 4FZ8L 1D7FA 4BFEA 4LLWA 1TTGA 1DBJL 2CRYA 1EVTC 1YNKH 3FT2B 3RWHA 1T1WA 3Q6GL 5F8QC 1X5LA 3TPUA 1KTRL 1KPUB 1BIIA 1JE6A 3QJFB 5DVMA 4LF3B 1JGUH 1NUFA 2ESVE 3M17A 1INQB 3O8XB 2FX8L 1G9MC 4J3XA 4YDJA 5DURB 3V4PL 5EU6E 5IT2L 5KSAB 1KCRH 1IGMH 2RHEA 4UILH 4P2RA 3GFUA 4LKCA 2VDOH 4PJXF 4Z7VB 3EDEA 3PWNA 3T0DA 3HNTL 4JKWA 4M7LL 1RZIB 3RU8H 1KCVL 3B3IB 5DMYA 3IDNB 4LIQL 5GPRA 3O9WA 1H3TA 1JGDA 5SX5K 3KWWB 1MAMH 2VDRL 4M6MH 5GRJL 5DRWB 2OMBA 3SDAB 2BXZA 4M43H 2MKLC 1N59A 3DTXB 1MJJA 3BIKB 5IVZA 2FATH 1RULL 3IDJB 1NMAL 4MA1B 5D1QA 4WDIB 4LNVA 5ADOL 5D7SL 2HWZL 2DF3A 5IESL 2EC9U 5EUOE 1MJ7H 3OR7A 1P1ZB 1IFHL 3BQUA 2VLJE 4CVXB 5DR5H 2X1OA 4HUWA 1CICC 5AYUH 1A6AA 3MMEA 1XFPA 3PWUB 1G84A 4PS4L 1CN4A 2NY4B 3MRDA 2PR4H 4DTGH 4J3TA 4ZDHB 1HIMH 5HGAB 1F4AA 5FA4B 3FQUA 4ZTPL 3DO3A 1RMFL 3NCFB 4PJ7B 2Z8VC 3QWRD 3T3PF 4Z7NE 3WSQL 4P3DA 4QCIA 1FZKA 3L3OA 2Y7QB 5CJBA 5DJXB 3U30B 1ZSDB 3LN4A 5J4MA 1DE4B 2I9LB 4RZCB 3P0YH 1NBQA 3A6CL 1OTTC 3NZ8A 3C5SA 3F5WB 5KVMC 4CVUA 3LQAH 2IAND 3O4LB 1MIMH 3FQXA 2BMKB 1IAIH 1NC4D 1U91A 2YA1A 1X5JA 3B9KA 1HXYB 3G6AA 4NYLB 4PLKC 1V05A 1J0IA 5DZNA 1FAKT 4PJ5A 3UBXI 2BSRB 3T08A 4CVZA 1AQDA 4NQCE 2EYTA 4DKEH 3GMOA 4KZDL 2BC4B 4P4KC 5C0IB 2XQBL 4PJBB 4LLMB 3OG6B 3SOBL 4QY8B 4K7PH 2X05A 3VRIA 2WWKO 4TNVK 4P23D 4GFTB 2WP3O 1QQDB 4KWUA 5T1DH 3C2SA 4Q6IA 4Y16C 5H94B 5DUPH 2PYFA 4P9MH 2NNAA 1DBBL 3LVEA 5CUSH 4JLRB 2VDML 5IW3A 1VEOA 3N1GC 3ZKMC 5HVFB 4OD1H 1K3IA 1JYWA 3MREB 1CFSA 2BVYA 2GTZB 4TUOA 4CADA 3S36X 2DQFA 3QFJA 4U1SA 1IGFH 4WY7L 3PHOA 5E2VH 3NFPA 1VGEL 1TVDA 4L8BA 4FQIL 5BZWA 4LSVH 4JKLA 5C0FA 2MFNA 1F4YH 4FTVA 1FYHB 5INCB 5B3JF 2XN9B 3QQ4A 3CVHB 4L3CA 3VFWA 1I3UA 4IMKC 2JJTC 4NC1E 1CGSH 1MFDL 3M8OH 1OLLA 1WBZA 5DA0B 2EEDA 2HT4D 5I16B 2PTVA 3ZSTA 1I8MA 4NT6A 4MXWH 1OTTD 3WDHA 5IHUH 4PJAA 4C4KT 3CXDL 4LCWA 4KPHH 4LFHD 3G6JB 3D48R 4NRXB 4MD5B 1ZTXH 3SKMB 3TZVA 3S96A 2HFFB 2XTJC 4NNYB 2DQCH 2E5EA 5BW7C 3IRZA 1X7QA 4WWKD 5J6HB 2N7BA 2VOTA 4IRSD 3NN8B 1SJXA 4P4KD 1K85A 4QHUB 3QEGL 5D7LA 3F12A 4JB9H 5IB3A 2Y6SC 4EXPX 4U1HA 3BAEH 5F1NA 1OHQA 1CFTA 2L0DA 1KB5A 2RFXB 3MBXL 4X7SL 5IEKA 1MOEA 3HNSH 1A5FH 3RIFF 2J6EH 4G9FA 1XH3A 1YNTA 1KB5L 3B6SA 1YPZE 5DHYB 3MGAA 3CU7A 4ZFGL 1L0XA 1VKXB 1EFXA 1WCQA 3QEQD 3LQZA 4EVNA 5KSUB 1FJ1B 3D39E 3S37H 5EO0A 3DIFA 5L2JB 3DYPA 3O8XC 3QUMB 4LHUD 3QO0B 5I1DA 3ULUL 3ULSA 2ZOLA 1OQOA 5HYQB 4QTIL 2PW2B 3TN0A 3GIVB 3VWJC 3LQAC 4E5XB 1AGFA 3DMMA 4ETQB 1JNHB 3S88L 2UVFA 4HLJA 3ALPA 4WV1B 1CR9H 1DEDA 4PV9A 2F58H 3GKWH 4QOKD 1MLBB 2LU7A 2BY2A 4NUGH 5GGVY 4XPFL 3QYCA 4XVJH 2H6PA 4OM1H 1GGBH 5JO5A 3SDAC 3C5ZA 4JZNB 1TZGH 2XTJD 1SEBA 5LGJA 1C7TA 1DBKH 3L3KA 1OAZL 4PFEA 1M71A 5TGBB 5DMIL 4U7KA 1YEIL 4M5ZL 4MWFB 4EQ3A 3VXUB 2SEBA 1KFAH 4HAFA 4L29B 1IAII 4ALAL 1DVFB 1RUMH 4W70A 4KK9D 4Z7WB 3OBAA 4IBLT 2DQUL 2VKXA 3DO7B 4CAGA 2H41A 4Q9QH 4OKDA 4M7JH 1BOGB 3QZWG 1SBSH 2R15A 3RVXC 3OPZH 1F6AA 3U4EA 1D3CA 4OF0A 4LU5H 2YD1A 3PWPB 4PJFE 5IFHH 43C9B 1WFUA 4HX1B 2CLVA 5T3XL 3SKOA 4OLXH 3KYKL 3FO1B 4QYOB 1WFOA 1FN4B 4Y2DC 1NCDH 3HZVA 3O8XD 1VENA 3O6FA 3QB7C 3ARGC 4XCFH 4KJPC 1T7VA 3U30C 5DURD 3UP1A 2DM3A 1R3IL 5KSBE 3QG7L 3QUMH 5HHOE 1WITA 1GYAA 1AP2A 1QSFB 2E27L 3NA9H 3PGDA 4PJCF 5CBAB 3EJYC 1EXUA 3TM6A 4IIQB 2B20A 1VACB 4ZOAA 1DBAL 4RRPA 5TPWL 2VDKL 3ARFC 1FZMB 3FAWA 3SDAD 1UH3A 2GJ6A 1I9RH 4N0UA 1F3JB 5HGHB 5F7UA 3EFFB 4AMKH 5E8DL 3PIQA 4L8DA 5F89A 5C08E 2OLDA 2ESVB 4JPVL 1N64L 4Y5VB 5L6YH 4BKLA 5I71B 1UGNA 5LAXA 5EU6B 2R1WA 4JM4H 4WFFD 1DTUA 4QLRA 4GG6A 3INUL 3T4YB 4J3VA 3NACH 1LE9B 2W0FA 2OJZL 4HGWA 1RUKL 3PNWB 3KVQA 4N0YL 2AQ1A 4D94A 1I7UA 2NY4D 2HMIC 3RVXD 4NCC1 1GGIL 1WEJH 3RY6C 3TT3L 3E2HC 4NZUL 3MLRH 5BJTA 2P8MB 4E9LA 4G8IA 4HHAA 3QUZA 2ZCLL 3NIDE 3IDUA 1NKRA 4WEBL 1HXMB 3BWUC 2CH8A 3F6LA 4XCCH 4D0DA 1U8IA 3G6DH 2VXUL 2VDLL 1E28A 5K9KB 3ARGD 3DURA 1T20A 2HJLB 1H0DA 2QQLH 3W2DH 1QZ1A 5HYJA 2XTLA 1OAKL 4NOBA 5EUOB 3LHPH 3QDAA 3QXTA 2VLJB 1HSAA 1NBVL 4RCAA 3O4LD 1NGYA 3GSNA 3BSZL 1UM5L 2Y72A 1WAAA 3QXVA 2RCSL 5F7WC 2IC2A 3GSNL 4JQVC 1DLHB 5DJ6B 2VLLB 1OP3K 3OKNB 1WZLA 4M00A 3FB5B 1FH5L 1GC1H 5K9QI 4YX2H 2ZUQC 4Y4FB 1K8IA 2YR3A 4NNPH 4K9EH 2ZOKB 5D1XC 2JB5L 3QUKB 5E1AB 5GGQL 2DBLL 3DX9B 5BO1L 4TULH 3I85A 4H1LG 1A7OL 1YECL 5H2BB 1TMCB 1MFCL 1TNMA 4E41E 4HK3N 3VFMA 4HD9A 2H8PA 3TIDB 1S7VB 5IJKC 5IEHA 1KCUH 4Y5YB 1DL7H 1JUFB 4M1GH 1CLZL 3OKEA 2X4UA 4LSTL 4C57C 5DD6B 4YEFA 3FT4A 1KN2H 2XQYK 4MJ2A 3CJJA 4I5BA 2XY1A 1H15A 2P45B 5DRZB 1G7HB 1N26A 4NQCB 2NTFB 1AE6H 3EO9L 3VH8G 5E56A 1JZ4A 4QTHB 2XN9D 3DETD 4KTDL 3STLA 1BVKB 1Y0LB 3JTSA 4ZFFB 1J0KA 5CSZB 3BEWA 3ES6A 4O9HL 1QLRA 1S7RA 4HH9A 2VZVA 3L1OL 3WS6C 1JZ2A 3QNZB 3SJVA 5K59F 3AU1B 4LKXA 2FCBA 4I48B 4KQ4L 2C9AA 1BZ7A 3VG9C 1F13A 4PJ8C 1YEHH 4KKLC 1F45A 1I8KA 3DYOA 5IWLA 4GKZB 4JG0H 3UTZB 4RWHA 1EUTA 4N5EC 5L2KA 1XF4B 3MFGB 1MJUH 3HC3L 5MHSE 2VXSL 3QO1B 4W81A 2I60H 1WGOA 3DVNA 4DAGL 5E0QA 5F1OB 2DD8L 1DVFC 4PRDB 4MS8C 1H3UA 4OM0H 3U4BL 1QPXA 3LDBB 4JY4B 4HBCL 3DJ9A 1VFAB 1PAMA 1IQWH 2O5YL 4XC3L 4HJJH 5IFAH 2FJGA 4MMXC 1GPOH 3GMQA 1WWWX 3MUJA 4DKDC 4WJ5B 5T33L 5E6YA 2QQKH 5KVGL