4P3DB

Mt1-mmp:fab complex (form ii)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
218
structure length
218
Chain Sequence
DVLMTQTPLSLPVGLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHAPYTFGGGTKLEIKRAADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Heavy Chain Fab fragment of antibody LEM-2/15
publication title Inhibition mechanism of membrane metalloprotease by an exosite-swiveling conformational antibody.
pubmed doi rcsb
source organism Mus musculus
total genus 56
structure length 218
sequence length 218
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p3dB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p3dB01
2L7UA 3HNSH 2A1WH 2NY4C 1J18A 4OLZH 4Z7WB 3BH9B 4N0CD 4I5BB 4Y4FB 4NQXA 4JG1H 5AUMB 1RZJL 2AGJH 1PLGH 1LDSA 3RWGA 1QFUH 4OCNC 2R56H 4CNIB 3AREB 2AJZB 4KJWD 4OLXL 5I74C 2IMMA 4MMXC 2C9AA 5CP7B 3UTQB 4YQXH 2RCSL 1HKLL 3RJDA 2DDQH 5EZLB 4M1CC 1CU4L 4I77L 3W9EB 3L3JA 5D1XB 3MA7B 4YAQA 4Y1AA 2EDYA 3QJHA 1AO7A 4IHOB 5JR1L 1U8PB 5D2LE 2ZUTA 2H32H 3VGAB 2DN7A 1CK0H 4UT6H 1RUKL 4NQCB 4P9HH 5CEXA 4Q9RH 4LIQL 5C0CB 1NMAH 2J2ZA 5ERWB 2IEPA 3GMOA 3IAPA 3HAEG 5KANI 1I8MB 4GRWB 4G6FB 3HPLB 2HJLA 1GGIH 3ALWA 2ICEB 1BJ1J 2Y9RT 5DUML 4HUUA 1MJ8H 3D3VE 4W70A 3AS0A 1D6VH 3P4NA 2LU3A 2X1QA 3H6JA 1KPVB 3EYSL 1ADQH 4GMSL 4UT7H 5KSAB 5GGTH 4YPGB 5BMFL 4JLRB 2FNBA 3RWIB 4YHYB 4M62H 5IBTL 1BZQK 4HGWA 5GRVK 1EERB 4HKXB 5D7IE 1YEKL 3M1BA 4PGDB 5KTEH 5JQHC 2FSEA 4OBSA 1ORSA 3SEPA 3BYYA 2VAJA 1JNLH 2EDQA 1CZ8L 1MLCB 1TZGL 4L3EB 4LQFL 4EQ3A 5IESH 3FKUS 2CIKA 2GY7B 3BN3B 2A83A 4LU5L 4BH7B 1JYWA 4LKCA 4IEFB 4L8SA 5EG6C 1QRND 5CHNA 3DXAA 3FO0L 3P0VL 4MNGA 2EE6A 4TUOB 4X0KA 3VRIA 1OD7A 4AY0A 1MAKA 3OKNB 1F4YH 2XA8H 2R0WH 3C5SB 2VLRB 1AFVL 4ZS7H 4JQVC 5FYLH 1KFAL 4TSBH 5J6HB 1G6RA 3A6CH 2B5IB 3EO1B 4G8IA 1Q0YL 4FQCL 1REIA 3ETBF 4KRNA 1FNSL 3O3EB 1DBML 1PW3A 1O7VA 3W39A 4F58H 1JGVH 2WWMD 3QNYB 1XGPA 4XCNA 5BZDB 1S8DA 4KPHH 1OTTC 1WTLA 5HTSA 2ZUQC 3SGEH 5TQ0H 2GY5A 1D9KC 2DBJA 2BC4A 3MRKA 3O3DB 3QDMD 4PY8J 1W72A 4QRSB 4EUPB 4IIQA 2LFGA 3L1OL 3DETD 1TZIB 3KDMB 3DX9B 1ZLVK 1F97A 4OGAD 3WE6A 1LWRA 1T7XA 2EYRA 5I1GL 4QTHA 1QR1B 4TVPD 5F7FA 3VI3F 3H9ZA 2PYEA 4NM8H 1KELL 1YMHA 3RHWK 2Z4QA 3UTTB 2K3TA 1JYXA 3G6JA 4ENEC 3MV8A 4XAWL 1NGPL 5CMAB 1KT2B 2OR9H 3MJ8A 4HEPG 2CXKA 2BDNL 3ZO0A 3QI9B 4E41E 4LLDB 5K9KB 2ITDA 4FHBD 4LLWB 4PRPE 2E7HA 3MBEC 4LCCB 3IFLL 5EA0L 3U4EA 1FBIH 2AXGA 4LSSL 1D5MA 4DAGH 1ERNA 1GL4B 1U36A 2VN4A 3Q6FB 5IVXB 1RVFL 4I0PA 5FUOL 2BVPB 3U7YH 1UACH 4CVZA 2VZOA 1CT8A 5JO5B 1CBVH 3NAAL 4P2OB 3JSSA 4M5YL 3SE8H 4G9FD 4QRUA 1IBGH 2B1AL 3GI9L 4HKBB 3DSNA 2OLDA 1NCDL 3J7HA 3AMKA 5FCUH 2C1PB 3D0LB 4HLZG 1JMXA 5DK2A 2R29L 2FX9L 5A1AA 4MJIE 1NDGA 4S10A 1BEYL 4KTEH 4JFPB 3QT2A 5K9JL 1N8ZA 4NFCA 4H8WL 1OQOA 1I9EA 3P11H 5IMMA 3RGVB 1K4CA 4NO2B 5IVZA 1E4KC 2BVYA 4G43B 3I50H 1R3LA 5GQBA 1ETZA 4HZAA 4BKLA 2A2QT 4HUWA 5GGVY 5DFVD 3KLAB 3I3BA 4OZHE 1C5DA 3V8CA 4LVNC 5TF1L 3MXVH 4JRXD 1SHMA 3OKOB 3LMJH 2GTZA 1A1OA 3MLWH 4F7EA 4CN4A 4QKXB 5I1CL 4YHIA 5ENWA 1T0PB 2I9LA 1FZJA 4MHHG 3IETA 3MV7A 4PTUB 1JPGB 3MLTA 2Q8BL 3TFKC 2FJGA 5FHAH 1RK0B 2APWA 2VDKL 3V5DB 4KZEL 1RFDL 1VFMA 5GSRB 5DXWA 4N5UA 2VTFA 3R0MA 3MUGA 4JPKL 1MFBH 1MCWM 3FFCA 5GGSA 2R23A 2JIXB 3STLA 4EN3B 1NL0H 5IHZB 2E5EA 1VHPA 4UILL 2HJFA 3KLSA 2QTEA 4H88L 4O2EA 5E8DL 4ZMAT 5C09B 4ZFZA 1U8QA 3W2DH 2XKUA 3JV4B 3D18A 5DJ8A 2F19H 2PXYA 1CFTA 3DI2B 4GG6A 2BP3A 4X6DB 4DN3L 5D72L 2WINA 2VB5A 4WHTB 1NUDA 4LDLB 1H3PH 5CIPB 3WL9B 4G42A 3OKMB 1FH5H 5D8JL 1GC1H 5DS8B 1JI1A 1IVLA 3TO4C 1RURH 2EEBA 4JDTH 4CMHB 4PRBA 1S7VB 4HPOL 1Q8MA 5AG9A 1E6JH 3MRIB 4WU7A 1E28A 4G9DB 2AABH 4RFEA 3MRHB 3ILPB 4FMFA 2FX7L 5DR5L 4ZAKA 3O4LD 1UXSB 2VDPL 2EIBA 2R9HC 3E8UL 3TZVA 1NCBL 1ZLSL 1S9YA 5HHMB 1WWWX 4PJHA 3EYUL 1YNLL 4HWUA 1JYNA 3KYMA 5E8NA 1WCQA 5SWZE 1XGUA 3VXQB 3ZHLA 1OAKH 1Z9MA 1KN4L 1QEWA 2IANE 3BKMH 1T20A 4ONFH 3QDAA 1DQLL 3WJLC 4P5MB 3VFUA 3C6LA 3BDXA 3FZUD 3BISA 3EDDA 3D0VB 1AD9B 5FGCE 1UA6L 1N7MH 1RD6A 2D31B 4OT1H 4OLVL 3MRLA 3ZKXC 3HZVA 3C08L 3I6LE 4XGZB 3ECBB 5T1KB 2VDMH 1E4XI 4RWYH 3JTTB 4HXAL 3TJEH 4JO1H 5JDSB 2B39A 4J3TA 4PGBA 3NTCL 3BN9D 1HYSC 1ZAGA 3P73A 3K8MA 5D9SB 4IRSC 2JJVA 2IGFL 5JXAH 3OJVC 4NRXB 1QSFB 3KPNB 1ZS8A 5C08B 1A14L 1FSKB 5IW3A 1ZSDA 5F96L 3QCVL 4ZUVB 2XRAH 5CCKL 4QWWD 1YMME 3BGMA 5BO1H 1U9KA 4GKSA 4PJFE 3MYJA 2FIRT 1JBJA 3OAZH 5CBAB 1BD2A 3K8LA 4Y2DB 4IRJB 3FT2B 5FO9A 1IT9L 3U46B 3SDCA 4DJMA 2SEBB 4OM1L 5FO7B 5JLZA 1T0NA 3D6GA 5C3LD 4KK6C 4Q6YA 4TSAL 4LLYA 4KGJA 5DA4A 4M7LH 3VXSA 4X9HA 1NMCC 2VISB 1G1YA 1OSPL 2JCCA 4HJJH 1P2CB 4NZRH 2Q76A 5FEBA 1KC5H 2ZPKH 5D1QA 1BOYA 3SDDD 1IM9D 3W9DA 4R9HA 3M8OH 1BVZA 1U8IA 1S7WB 1KEMH 3ZSSA 3QIUB 4APQC 1NFIA 4I8DA 2WBKA 5D71L 1F3DJ 3UBXB 1TQCB 4MXVE 2D7MA 3RX5A 5CFHA 1DVFA 4L8CB 3QEGL 3MCLH 1IAKB 3EJZD 4N0RA 2V9QA 2LU7A 4F8QA 5FB8A 3BDBA 1KCLA 2XY2A 3ZHKA 2DD8H 4KK8C 1DR9A 4ZS6D 3U36B 1HHIA 1K4DA 4YDKL 3TA3B 4YHNB 5ICXA 5FYJD 3CMGA 2CO6B 4ZO9A 1D5BA 1EJOL 2Z93B 4MJ4A 5C92A 1I1CA 1VKXB 5DHYB 4Q0XH 3T09A 4NN6B 3S8WA 1AD0B 1IQDB 3NZHH 5MP6L 1KCSL 5B8CC 2VE6B 4RMSA 3WNPA 3NCBB 3GSXB 3JBG7 3VD7A 4HK0B 4YXLL 4TRPH 3CU7A 4JKPL 5FOBA 2A6DB 3VWKA 4GKZB 3HC4L 4AIZA 2V2TB 1BREA 5F3BB 1I85A 3GKWL 2IADA 4R6UA 3RZCC 4XVTH 1QYGL 2YPLB 3GMRB 3MGTB 4NJ9L 3IJYB 4P46D 1N59B 1J5OL 4AIOA 3QXAA 1CQKA 2AEIT 4JY4B 4H25A 4RRPA 4AQOA 2JJTC 1D5IH 4HUXB 5H2BB 3KPRB 1JK8A 3ROLB 5KS9B 3L6FA 4WU5A 1I75A 1A4KB 1A2YA 5D6CB 5E2TH 4WHCA 3DV4A 2CK0H 1I3RA 4JGUA 1QSEB 2HLFD 4QRRE 3BIKB 4I18B 3Q3GA 2QV2A 4JAMB 3BPLC 3QUYD 1UB6A 3UJJL 1BECA 3QEQB 5SV3A 3FL7A 1EEQA 4EBQH 5F7YC 1UG9A 3LEVH 1DL7H 1G1CA 3LRSB 1J8HA 2VLKD 3RWHA 4TNWK 3SGEI 1B4JH 4F2MB 3VG0L 4XP5H 4CU6A 4LLVA 4RGNB 4UUJB 4P3WA 4X4ME 3FO1B 2BJMH 3F8UB 4G8EA 1F4WL 4Y16A 3ZKSD 3SKJH 4WW1B 3VFSA 5JW5A 5E6ZA 1UZ8B 4PD4J 1T1XA 4Y4KA 5DJDA 3GI8H 3O2VH 1OP9A 1G6RH 2A38A 1LDPH 2NXZC 3MRPA 4XNYH 4P59H 4ZPVA 1T04B 4PGZA 4G8GD 3FJTA 3ZYZA 4EQ2A 1JZ3A 2MTPA 5DHVB 2AEPL 2FO4B 5MEPA 3HCVA 4L29B 2NW2B 1KV3A 1RZ7L 1IAIL 1HH6B 3UJIL 1V7NL 2DLFH 3WYRA 3BSZH 3GJFK 4P9MH 5F9OH 4ZYKA 3GK8L 3RL1B 4LLQB 2PTVA 2P24A 4OLYL 5CJQL 5F8QC 4O4YL 2XZZA 4LVOC 3A6OA 4O02H 4NQED 4K3DL 1ND0B 4K3EL 5D70H 5HJ3A 3VCLA 1N6QH 2I26N 4AL8H 4JFDB 2XACC 2M1KA 5E9DD 3CH1A 1T0MB 3JTSA 3TJHD 4C56D 1I8LA 3PQYA 5DJYA 1W72H 3U79A 2IPKA 1M6OB 2ESVB 1UM4H 4QRTA 5T1LD 1VFBA 2VL5A 5DI8B 3ORJA 4F33A 3PGDA 1ZT1A 5LGKA 2R1WA 1IMHC 3VXUA 2YD7A 4MA7L 5C2BL 3I02A 2BNRB 4O51B 3B9VA 5D1ZA 1NBYA 4YXHH 4PJXE 1JP5A 1XR9A 4JHZA 2F74A 4P5TD 5D5MF 1LQSR 2VDRL 4XVUD 4LAQH 5EOQL 1A7PL 2ERJB 4DOHB 5BRZB 4OFYD 4X6EA 5I17B 2DS4A 1XGYH 3GSNB 4D0BA 1LO4H 3LPGA 5L9DL 4NNPH 5IHLB 1E27B 2F9BT 2CDGA 3C60D 3R0NA 5DDHA 2VQUA 2Y7QB 2K7QA 5DEZA 1YEEL 3VFMA 4M1DL 4HPYL 3CVHB 3UTZA 3N9GH 3IFNL 3SDYH 3MO1B 4TOYL 3QNXA 3IAQA 1QRNE 4M93C 1CGVA 1XF1A 1R5VA 2AV1A 5HVHB 4GAFB 3WFEH 5J11B 5FYLD 4XWGH 1MCCA 5I8OH 3N85L 2BNQA 4X8JB 1HN1A 1T66D 4I3SL 5JQ6H 1OGAE 4JN2A 1XGRB 3FQWB 1S5HB 1FE8H 1WT5C 2AK4E 4DKDC 2A6IB 4JFEA 2VN7A 5JXEC 1NEZA 4JFXA 1BP3B 3UYPA 1YDPA 4TULL 4EOWL 1A1NB 2HRLA 5L88L 1RUML 3RU8L 1LVEA 4XNMA 3EFFB 1X5ZA 1N2RB 5EO1B 4W4NA 1NGYB 1MIML 3IFOA 3I2CL 4NT6B 3T2NH 3EO0A 5EU6A 4DGVL 4DZBA 3ULVF 1XFPA 2GSIA 3HMWH 3OB0H 3CUPB 1U8HA 3FB7A 5E4IA 1ZTXH 5D96C 4NNYA 3WXVH 1C12B 1H8OA 2CLRB 4X6DF 1T5WA 2RFXA 1FO0B 3QDME 5B38A 5LQBL 3KYOA 4OZGE 4YUEL 3E6FB 4ZUWB 4R26H 4LKXA 5EB9A 4P2QD 35C8L 4KKBC 3PWPD 3SDXE 1U92B 4I2XB 4TVPE 1GZQB 1GPOH 3B2UC 1UH4A 2WIMA 4JPWH 1I7TB 3CX5J 2QSQA 4YWGL 3U4AA 5IW6A 5KW9L 3FQNB 4F3FB 2ZOKB 4NKOB 4CADA 4Z78A 4PJ9D 1SJXA 3D2UD 1EHLL 4DTGH 4YDVA 1L4IA 3AREC 1BBJB 4ZO8A 5FO8A 1BFOB 4XNXL 4AK1A 4JPIB 1WVZA 3ARPA 4OCYL 4IMKA 3MLYH 1FQ9C 1J1PH 2V17L 1FC2D 2APBA 2H2PD 3PDGA 5IM7A 4QGYA 1SJEA 4OLWH 3SKNB 1DQML 4XPFL 4NSKA 2XKNA 3T0WA 1YNTA 5IJVA 3LOWA 5A16A 4G9FE 2BRRH 5JHDA 2KDGA 5GISL 3VGAC 4U6VH 5IB1B 4LSTL 5HYJD 5J89A 2GITB 1M7DB 2MHAB 5EUOB 1S7TA 4JZJA 5D2LF 1VADA 1VPOH 2XN9A 4OCMC 1F8TL 1I7UA 1EAPA 3HG1A 3VH8A 1FFOA 1ROWA 4N8VG 1FC1A 4ODXA 3ARDB 3ARQA 3EDKA 4Z7UF 1A6ZB 5HI5D 2QSCH 2ZG3A 5KSAC 5TE7H 1YPZF 4M4PA 5HYEA 4ZXBA 4OUOA 1MEXL 1FIGH 1UKQA 1AH1A 3GM8A 5J1TC 4NPYB 4K9EC 4OIIL 2Y07H 1HK6A 2AXFB 2AJUL 3BQUD 4ODWB 3VFNB 3W82A 2A0LC 2HLAA 2IH1B 5L6YH 1KJ2B 4YGVA 1Z3GH 3ALXA 4F7CA 5D7IF 3L3DB 1MCKA 4LL9A 3T4AB 1YEDB 1KCRH 3UROR 3RY6A 1DBBL 1KTRL 1NBVL 5DRWA 3QXDA 2DRUA 3RA7L 5C0BA 1DLHB 3QUXA 3T8XA 3KJ6L 3PHQB 3L7EB 1OB1B 2VXTL 2X89D 4JM2C 3MFFB 5BVJA 3CFIC 5EU4A 3OV6A 3HE6A 4PJCE 1UCBL 4JG0H 3ULUC 1Z0MA 2OK0L 3ARGA 1UWGL 1UQSA 3ZKNC 4OTXL 1ZK9A 2B5IC 3QRGH 3O6KL 3WIIL 5IOPA 2IJ0C 5BXFA 1I8IA 4OM0H 4QXTA 4PREA 5IEHA 4N68A 3TBTA 1Z5LA 5I19H 1WITA 4XNQB 1I7ZB 2GHWB 2C4FT 2MNUA 2P47B 1YEHH 3MX0A 3D39D 4WDIB 3OG6B 2VZUA 1UEMA 5F89B 5JW3L 4KAQH 3ARBA 5CS7A 3IU4H 5HHOB 4ZOBA 2NY1D 1ORQB 4K7PX 2YUVA 4RIRA 5J06A 1CDIA 3IF1B 3Q48A 1WWCA 4JZOA 3LQZA 2XTJB 2OL3B 3BEVB 2QSVA 2XIDA 2X4PB 4NN7C 3ULUE 4ZTPL 3OX8B 2Z35A 4OD1L 4QHMB 1HZHL 4JVWA 4Y4FA 1LE9B 4PLKC 3QEUA 4YFLF 5IB5A 2N56A 4U6HB 4OKVA 2IQ9L 3MUJA 1AXSB 1YYLH 2IBBA 3MRMB 1CXEA 2HTKC 4F15B 4CL7A 2NY5H 4CVWA 3QI9C 3WO4B 4J4PC 5EZLA 4OUUB 4LCCC 4ZQKB 4KJPC 4MD0B 5D1XA 4KROD 1TLKA 1FN4A 4ODTH 1PG7L 1ZHKA 3C5ZD 4NJAH 3HRPA 1I9IH 1EZVX 2EYSB 4U6YB 2D3VA 4NQCA 1R3IH 15C8H 5C0CA 5ERWA 2BSSA 3RAJH 2NQCA 5L8KB 2ZKHH 1WZ1H 2EZ0C 4P2OC 1BFTA 5E6ID 3IJSA 4QXUH 4PTTB 1I1AA 5I1DA 5KZCD 1TTGA 1Q72H 3QDJA 5LKNA 1INQB 4KVNH 4HUVA 2HVJA 4KQ3H 3PXHA 1VGEL 3QCUL 4BJLA 4NZUL 5IGXH 1DJSA 1E6OH 4OQTL 5DJCB 1R3HA 3I9GL 4YPGA 5MI0C 4D0CA 4KHTH 3F6LA 1T22B 2FZ3B 3E2HC 4HQQL 2EDXA 3EYQC 1BLNA 2ITCA 4FNLH 2Z31A 4LHUG 1KB5A 4L4VD 1PYWB 4PGDA 3RGVC 4YDLB 3RNQB 4QYOA 2DJ4A 5IF0A 1JZ7A 1IM3A 1QSVA 5E94B 1DQJB 2C1OA 3QFDB 2ZCLL 4TSCH 2BRQA 2KBGA 1PQZA 4U33A 4ZD3L 1SYVA 2VDNL 3BKJL 4OZHF 3BZEA 4Y4HA 2FL5B 4JN1L 3O9WD 4MA3B 3U9PL 4I3RL 1MWAA 4G6KL 3TH4T 3FT4A 5J6GB 2Y1VA 2BFVL 1DSFH 2Y6SD 5B3JF 2R2EA 4JCLA 1ZWIB 5ACLA 5J6HA 5DUPL 3EO1A 1MF2H 4ONHA 1X5KA 1HNGA 1NFDB 4YJZL 2BHUA 2VKWA 2VNCA 4TUJB 4BK5A 1T1YA 3MRBB 4NBXB 1NLDL 1D6EA 2RJMA 2VQTA 1EH9A 4PYHA 2BVOB 1KF9B 3OZ9L 1P7QD 1OM3L 4PJDB 3X3FL 2PR4H 4NKDB 3OGOE 4XC3H 5B4MD 2E6QA 3MC0A 5C71A 1TETL 2QQKL 4K8RH 4QRPE 1MCJA 4JDVA 3O3DA 3QUMB 3LPFA 4MVBD 5IIEA 4FFWC 1TZIA 3EOYG 5LJYH 4FFVC 4HIJB 3AB0C 2W65A 4M7LT 2MQCA 4UBDC 4XXCC 3H7LA 2XZQL 2NYYD 1CLOH 2Z8RA 3QG6B 3U7WH 5TDPA 2D7TH 4PBVC 4GO6B 2PUQT 4KJQC 4MWFA 4CMHC 1FDLL 2G60H 5CMAA 1T7YA 1RUPL 1RUQL 4L3CB 5K9KA 5EZJB 2O61A 4OIBA 4XI5D 2DBLH 2H8PA 3JUZA 43CAA 3NFSL 1G0YR 4FTVA 2MPAH 3GSWA 1T2QH 3QP3A 1NDMB 3F7VA 1WEJL 2EDHA 4RAVB 4QTIH 1AY1L 1XIWD 1OTUC 3MOBL 2NTSP 4R0LA 4PB9L 3KJ4B 4FXGB 3T1FB 4MDIB 5IFJA 5I66A 2ED7A 5E03A 3A67L 4XX1G 1MLBB 4JM4H 2XQBL 1CE6B 1CR9H 5D5MA 1EV2E 1ZHBB 3IU3B 4WO4A 3U4BL 3QNZA 1C5CL 1JNNH 4LCYB 3FQUB 1RZIA 3GSVA 4HFUL 4XNUL 1NAML 5C0AB 4Y89A 1SYSA 4PR5A 4WI5A 4EZMA 2OMNA 2DQIH 2PO6B 4G43A 3DURB 4G5ZH 2VLKE 4KMTL 3CDGB 3IXTA 1H3GA 4N1EA 3O45B 4B0MM 3PWNA 5FHBH 3RTQD 1F58H 3WS6C 3QZWA 1W0VA 1FSKC 2DQGH 2IH3B 4P4RA 2IBGA 4WWID 1JFQL 5EOTB 5HHVH 5HYQB 1KCUH 1PX3A 3IDGA 4JANA 1QSZA 3EGSB 3WUWG 4FQXB 3REVA 2Z8VC 5DFWH 1I1FB 1R0AH 1UC6A 3OXSB 3CVIH 4PJFF 1P4IL 4XTRC 4Q6IB 4X6FB 3DX7B 1A7NH 1CDUA 4RQQA 2B4CC 4HJGA 1QKZL 1JUFB 3EOTH 1F11A 2J8OA 1WLHA 4RMWA 4XBGA 3WIHL 1XH3A 4RFNC 5BQ7A 5FUCE 3QO0B 4EN3A 2Q87A 3DUUA 1OCWH 4HDIA 4UQ3B 1BOGA 5IHZA 1G9MC 2FJHB 2X9XA 4WWKA 4RMUA 4Y5VB 4UT9H 4X7TB 3VFTA 1T80A 1UYWH 3QIUC 1AR1C 5C07D 5I1KH 4NQEE 1TQCC 1ODAA 1BQHG 1S3KL 1GGUA 5T5NF 3EYFB 5E1AA 1IC5H 3T0EA 4X6DA 3LKQB 2VXUH 5BS0B 1KGCD 3RVXD 1RIHL 4XRCA 4K9EL 2XZCL 4WHTA 5T5FH 2PYED 3WL9A 4IDJH 3SJVD 3TA3C 1FJ1A 4HXBH 2PETA 4HMDA 4YIQB 2D4FA 5KSBE 2VERN 4JJ5B 5JNYA 2VLJD 2P5WB 4YPJA 2CDEB 3NIDF 4H20H 4YC2B 5CBEA 4NN6C 4UDTA 8FABB 3O8XB 1F4AA 2GUOB 5ITBH 3TEUA 2EECA 2I5YH 43C9B 2N4IA 2D0GA 1CXHA 3F12A 4OCRL 2X70A 3KHQA 3D25A 4UB0L 4YNYB 3DROB 3SHSA 3TT1H 4QLRA 4I0PD 3HNVL 1TJHH 4V1DD 3RI5K 2Z91B 3WLBB 4KKAD 5KVDL 1EEUA 3O4LB 4MAYD 3QHFH 3VXQA 4XBEH 5GZNC 1JPST 1QA9A 4P5MA 2BOCA 3IDXL 1MI5E 5EPMB 3GM0A 5L0QB 5D2LA 3BWUC 3CK0H 5JDJA 3D0VA 1AD9A 4U1SB 1KBGH 4G80B 4FQQB 3RVWC 4U1JB 2J12B 1IQWH 3BP7A 3QXTA 5ANMB 5T1KA 3DVNB 5ESQB 1IZKA 4I18C 4Z7UA 1FNEA 3D3VA 1YPZA 4BZ2L 2H1PL 5GZOD 4MAUH 4XVJL 2QHRH 3BD5A 4GBXA 3Q5TA 1UZ6E 1KEGL 4PJEB 4ZUVA 4QOKA 4L3AA 3SDAB 2Z8WC 2XWTB 3MLVL 4CVUA 4J3XA 5D7IA 1PKQB 4RGNC 1H0DB 4Y2DA 4IRJA 4BA8A 3MMEA 1OT2A 2DMKA 5FO7A 5GS0H 1RJYB 2YEZB 1HOCA 3KPRE 4HT1L 5C8JA 2NR6D 1H3VA 4NDMB 3RUGB 2APTA 4X7CC 5CEZL 1CFVL 1TFHA 1YY8A 3FCTB 3PWPE 4BFIA 2VISA 4RGMB 3U9UB 3HFMH 1IFHL 4M9PA 4XVSH 3SGKC 4HJ0D 5IQ9B 4A6YB 5K9OB 3ZT6A 3P30H 5MHSD 1IKFL 3SCMB 4H1LA 2I25N 3PHSA 1XF2B 3UBXA 4OIAA 2HWZH 2BERA 1DFBL 1MCLA 3L3HB 2O5XL 3LQAC 5F7UA 4PJAE 4YE4L 5DJXB 4LEXL 3B8SA 3F7YA 1HXMB 4RGNE 4D9QD 3PWJB 5B39B 2EC8A 4OF3A 5EUKB 5FKPB 5DEGB 3HR5B 2BVQB 3VFVB 3ZTJH 1Q1JL 5FYKL 4JFOA 2Z93A 4PV9B 1DZBA 5DTFA 5HYJE 4PB0H 2B2XL 3MRGA 3WFHA 5FA4A 1VKXA 2PTTB 2CQVA 5FYJU 4X7SL 1LD9B 4UV4L 4X6BA 4Z7QF 1FGVL 4YBQD 5HYSG 4JQVA 4P2RB 1KCKA 3QUZB 1R5WA 1ACZA 5F7KC 2ORBL 2WUCH 2NLJB 4PJXF 1S7SB 2A6DA 1FV1A 5IG7B 1UWXK 2NZ9D 1CD9B 3T0VA 2ERJC 3ZHDA 4IRZH 2ADIA 2CJUL 1WICA 3GSRB 3ESVF 3K0WA 5ELIA 4E41A 3D85A 4PRID 4KK9C 4MQXC 4PRPA 3MGTA 3BW9A 3D1MC 4N0FB 4FFZL 5E8PA 5SX4I 4UINH 5H37G 2VXSL 3S36X 3ZT5A 4JFDE 3VI4F 3ARFA 5F3HA 2X4NB 4NQUA 4AEIL 3WN5B 4C4KO 2UWEB 5ABDE 2GCYA 1X4YA 3M17A 4RISH 3QWOB 3H0TB 1HDMB 2X1WL 2I24N 5HVHC 5J11C 3IDYB 3DMMB 4X9GA 3SGDH 1QSEA 2WBJB 1CL7I 3C6SB 4XCYB 3TLRA 1CFSB 4ELME 3S98A 5LG1A 3GZKA 4UU9B 1K3IA 4OGYL 5GGRB 1NFDF 1V8HA 3TV3L 3QEQA 5CJOL 5BRZE 1KB5H 4LCIL 1RZKH 2EXYC 1KXVC 3X12A 5C0IB 5DFTA 4F2MA 3MLSL 3AS3A 1XGTB 4UTAH 3RWFA 5E4EC 3ET9F 4L8BB 4PJDF 4Q9BA 4OD3H 3LHPL 1JTTA 1LO5A 2DIBA 1H8SA 2R1XA 3MRJA 4OZHA 3VGFA 3D39E 4IJ3C 1KFAH 5ICYB 3B3IB 3PNWB 3U1SL 3IJHA 1YQVH 2DQEL 3GRWH 3BT2H 1Q0YH 4N0UA 3LS5L 4K7PL 3SE9L 5FAAA 2BOBB 1CFQB 3EOAA 1X5FA 3AU1B 3TVMA 4DEPB 1DBMH 4OZGF 2OXHA 1EJ6A 2XA3A 3K81A 5F70A 3RJQB 1KB9K 5FECA 4LHUD 1SY6A 3L7FB 2XNAA 4G8GB 3FQXB 5FDWB 3O2DA 2YXMA 4KY1L 3SDXF 2RB8A 5JOFB 1BQHB 5DT1L 4LLQA 5I18L 2VXVH 3CAFA 3LSOB 5SWSB 5CAYB 5IQ7L 1EFXD 2D0FA 1QP1A 3WO3B 1RJLB 4XPHH 1LK3H 1Q0XH 4XB8A 5T3XE 4J1UA 1YUHA 2CMRL 3G5YA 5DLML 3STZB 1B0GB 2IAMD 4PRAA 2ESVA 2H32B 2HT4D 5KJRH 5DI8A 5E9DB 1GGBL 2D7NA 1J0ZA 1D5ZA 1Y18B 4C56B 3MCG1 2ZSVB 4WJ5B 1XT5A 5I8EA 5T1LB 4XAWH 1LO3H 1NGPH 4G7VH 5TFSH 4KVCL 4RMRA 1P9MA 3HNTH 3MXWL 4I2XE 4P4KA 4R3SB 4KDTC 4RA0C 3HE7C 3RPIB 4B7LA 3MJGX 1RK1A 2B4CL 4P5TB 5HD8D 3V5KA 3SY0A 2Q86A 3MROA 1K8DB 4OD2A 2EDFA 4X5XB 1RVFH 4ZOAA 3VGDA 2YK1H 2WUBH 4L4VE 1RU9H 2ADFL 4HZLB 1S9XA 2ZUWA 4LGRB 1SEQH 5HPMA 4NNXA 1Q9OA 5MEND 5HI4D 1NCDH 1HHHA 3FN0L 3GBNH 3C60B 3MO1A 3RWCB 3W0WD 1P7HL 4JHAL 3PP3H 3V79C 3E6HB 3BUYA 5SWZA 1HINL 5DC4B 3HC0B 2IANA 1QOKA 3BP4B 4NO5B 2VDLH 3V9FA 1IL1A 4OF8A 4Q74A 2R2BB 3BKCL 4Z8FH 3FAXA 3CFDB 2A6IA 4JQIH 4LLUB 4M7ZB 3UTSD 2DMCA 4JO2L 2ZG2A 3KPMB 1JJUA 1KIRA 3DBXA 4PJBB 1N2RA 4PJCF 4OZIB 3S35L 2FD6H 5TF1H 3OAUH 3X13B 2VC2H 4KRPD 5EN2A 2VUYA 3LH2H 3CFBA 4K8RD 3RWDB 3N1FC 1Q94B 1UM5H 1WFUA 2BY3A 1U3YA 2BHZA 4Y4KD 4S1SL 4BYHA 5CSZA 4J23A 1FG2B 1YMMA 2VWEC 2DB8A 1FO0A 1BQLH 1IARB 4NRYA 4JHWH 4E5XB 3V5HB 4PJFA 1RFDH 4S0TD 4C4KT 3BO8B 2VITA 1NCTA 3RDTD 5EULV 1AGBB 1FNLA 2YA2A 2AJVH 1H5BA 2HA1A 3RNKB 3TN0D 3GSQB 4FZ8L 3RPKA 2XTJC 1EAJA 1CICB 4PG2C 4P2QB 5HGHA 5DJZB 5DA0B 4HX1B 2YWYA 1UXWA 4HBCL 4F3FA 3ULVH 1T5XA 1EXUB 1S7QB 5GGVH 4OB5H 1R5IB 5HY9B 4RMQA 2Y4SA 4QXGH 4DVRL 4F15C 5D72H 1EIBA 5F7DA 2NZIA 4PJ9B 1CDJA 3D87B 5C0EB 1MRDL 3WO4C 1ZGLA 5DYOA 3MRCB 4EDXA 2I60H 5BZWA 5LWYL 4LCWD 3UMTA 1A6WH 2YUZA 3SKNA 3CC5B 2VWEE 5HSFA 5D1ZD 1WISA 4L4TE 2C5DC 1KIQB 3G08B 3VRLE 4NZTL 5HYSB 2GITA 4HC1L 2JLLA 2IQAA 5HHQB 5HHOE 2QR0B 3VFPB 3QJFB 4POUB 1DUYB 3HS0B 4R7NB 1A6AA 1YNKH 3FB5A 4OGXL 3TT3L 3BYTA 5IK3A 4R4NC 5DR5H 4B5EA 2YHGA 3ARDA 3UPRB 5DJ0A 1WIOA 3EYOB 4P23B 5KN5B 2X4UA 3UPAA 1A6ZA 4I4WA 2ADGA 1EMTL 1P1ZB 4PV8B 5T33L 3JWOC 3SKUD 4CUCA 1DN2A 2HMIC 2EIDA 2W9EL 4PJEF 1BAFH 3HZYA 6CGTA 1AI1H 4YDLC 1KJ2A 2AEQL 4L1HA 6FABL 2VDQL 1IGFH 4XHJD 2EIZB 4JY6B 4J8RB 3LQAL 4PJ7E 4HIIA 5IBUB 4HXAH 4GXVL 4X83A 3OGCB 3FONB 4MS8C 4KI1A 3RY4A 4QHUB 1UB5B 1RPQA 1FL6A 3S37X 2ZSWB 3L7EA 1OB1A 3BZ4B 2Q3AA 3OG4B 2FEEL 3MJ9A 5F7NC 1KOAA 3KGRA 3VFWA 4KMLB 1B0WA 5KVGH 3Q0HA 1HEZB 2EH8L 2OJZH 4DGYH 5FGBC 3SBWC 4QRRA 5B8CA 2LAGB 4QHNA 1DBKL 5J57B 5TPWH 3MLUL 4Y5YA 1U3ZA 3K3QA 4IOIB 1BFVH 4BH8A 2OBGA 5IROA 5EO0A 2VIRA 4D0DA 2DKSA 2DYPD 1EGJA 4OF5A 4CU8A 5C07E 2JKXA 2X4SA 1KPRA 2EEAA 2DQCH 5IFHH 4JO4H 4DUXA 1BM3L 4DZ8B 4XCEB 2DQJL 3GSNL 4AENB 3KPPB 1JGDA 1OL0A 4NFBA 1G84A 2ARJB 5D7JB 3PDOA 1ORQA 3FO2A 3KPQB 3IF1A 1JWUA 2QSTA 3CVHL 3MLZL 1FORL 1HSBA 2OL3A 5IW1A 4F57H 2VLJE 3MOQA 1ZLUK 4RBPK 3DNKA 1BQUA 2G2RB 1LEKB 2YRPA 4H1LH 4U6HA 5HHXH 1T03H 1I9RH 4HHAA 3R1GL 3CLEL 5DJ6A 1QBLH 3QIWD 1JHKL 5D2NB 1MFDH 1PZ5A 4HFWB 4YDKH 3O2WH 1QFPA 2A77L 3KR3L 4FN0A 4TQEH 1Y6KR 2XN9D 3VMPA 5JTWA 4HS8L 3UAJD 3KJ4C 1MSPA 2ZCHH 4NOFA 3S4SG 1RQ5A 2AJXH 2EDJA 3SGDI 5FV2A 3JV6B 4ETQB 1F2XK 2IPTH 3SE3C 2QQLL 3H9SD 4IM8A 4LF3B 2NX5E 5E6IB 5A2IH 1FO0L 5IB4B 4QCIA 1S9VB 4PJXA 4ZXBD 5DJCA 1OQXA 2P48B 4GQ9H 1CXLA 3SE4A 3CSYA 4S1RH 3EOBA 4TNVF 4OZFG 4X80H 3GMMA 2O5ZL 4HWZA 4ISVB 3IKKA 5I0ZA 3IDNA 3L3IA 4M7JH 1Q38A 1JGUL 3MRRB 3QBTB 3RVTC 1II4E 1TJGL 2PO6C 2DM2A 5E94A 4CMMA 1AQDB 4NQDD 5GS0D 1OPGL 1K8IB 3L3GA 2ED9A 4NO3A 1MREH 4XCCL 3W11D 2DIAA 1KN2L 3FHAA 2QADD 3JWDC 4NQSB 1ZHNB 3TIEA 3QQ3A 4FQXC 1P4LB 5F9DC 1QRNA 2MSPA 4MLIA 1BZ7A 5I1HH 2CDFB 3FOMA 3B83A 4Q6IC 1NMBL 2XWBA 2J7LA 4HULB 1PZUB 2FO1A 3N50A 5J1SC 4FP8H 1NFDA 4TUJA 2RAMA 1OGAA 4KHXL 1I9JL 3D9AL 1NPUA 1F3JA 1UT9A 5EOCJ 1WZMA 3GB7B 3L5HA 5IV2A 2DQUH 1OAQH 4BQ9A 4UV7H 1ZHLA 4JFQB 4NZJA 2NY6B 4NCC2 4PJGE 4PLJC 2XI9A 1ZKAA 3C2AL 1U2CA 4Y5VC 1PGRB 2UVFA 4NKDA 3U0PA 1GRWA 3LEYL 1JZ5A 3G5ZA 2IALB 1AIFA 4FQJL 5DO2D 4WUUB 3FN9A 4J6RL 3MRQB 2DJUA 2C3VA 1J1XL 1CDHA 5C0DA 4AEHH 4UNTA 5IEKB 3IVKB 2RR3A 2AEPH 1RZ7H 3QUKA 2P1YA 1LEIB 3QDMA 4KUCF 4ERSH 1KJ2L 4OZGA 3S3JA 3VWJD 1PSKH 5DWUL 4URTB 1U42A 3RVUC 3OKEA 3O2DH 2BCKA 4N9GA 5E56A 4NQXB 3SDXA 4D3CL 3MZGB 3NCJH 3RWGB 2Y06H 5KSBF 3DVGA 4K3DH 3O8XC 5EZJA 1QLRB 4MZ3A 1G7JA 3EO9L 2IBZY 4PRIE 4XWOD 5I15L 3UC0H 1MFEL 4R4BB 3L3JB 1OAUH 1ZANH 4U3HA 5DEFA 4YAQB 4Y1AB 3QJHB 1AO7B 4W4OA 1RUAL 1DBJH 1S78D 5TQ2L 5INCA 4RAUA 3O6FD 3QAZB 3V95A 1YEGL 1MHHA 1QFWH 2CD0A 3S36L 1OSZA 5CEXB 1I3GL 1I1AD 5L8LB 3C9NA 3GMOB 3RKPA 1OWRM 1XIWB 2F58H 1MCNA 4NZDA 3PUCA 1RV6X 5L0QC 2VAAB 4G9FA 4KKLC 3A6BL 5C9KA 3P4NB 1VFOA 2A73A 3H42L 1OW0A 2P5WE 4IOFD 4DN4L 1YY9D 5DJ2B 4LVEA 5L9DH 4S1QH 2NY0D 2VYRE 4N5EC 4X5WA 4F9PC 1NUNB 3ILQD 2V2XA 4LVHB 1IGIH 2YUXA 2AXJA 5ADOH 4HGWB 1FGNH 3M1BB 2OL3L 3WKMH 5M7QA 4PJBF 3HI1A 2RIKA 3U2SA 3ZYOA 2FSEB 3SKMA 2L7JA 4PS4L 4EJ1C 3ARRA 1VFAA 3RZWA 3SDAC 3BKYL 2ICWJ 2CIKB 4HH8A 3ROOA 2A83B 1UZ6F 4LKCB 4L8SB 3U82B 5CHNB 3BX7C 3ARTA 3GGWA 2CKBA 4MNGB 4X0KB 3PL6A 3VRIB 4W6YB 5DMGC 3EAKA 4JRXA 1TDQA 3FO9A 3TP4A 4X6FA 1MHPH 5BW7C 5K9QI 3DO7B 4XAKD 5HVWA 1G6RB 3TF7C 1TVHA 1WJ3A 4LDOB 3ZZ1A 5L88H 4G8IB 4YLQT 2PTUA 5FUZL 3RU8H 2ZP0T 2AW2A 4RGMC 4JKWA 4Z7NE 1TJIH 3AC0A 2KPNA 1K6QH 1BPVA 1BJ1H 1VEPA 3W39B 4PJCA 4KV5E 5LAXA 5ALBH 1XGPB 2X42A 4XCNB 3SCMC 2FWOA 1S8DB 2PW1A 2GSGA 4NKIH 1MVUA 4YDJA 2BC4B 3JWOL 3MRKB 2YOCA 4OJFL 3VXOB 3CZJA 3LKQA 1IGMH 4U0QB 3L5XL 1DQDL 1MRFL 1CLYL 1S7RA 4QF1A 1MCRA 1O5DT 1W0WA 1W72B 4N0YH 4RGOH 1A6VL 4IIQB 1ZEAL 5TE6L 4U0RB 5CP3A 1G7QA 4PRNA 1Q9LA 1YJDC 2XV6B 3WE6B 2EYRB 3MV9D 2GYSA 4QTHB 5KVFL 2PYEB 3U30C 2O5YL 1YMHB 3SJVB 2Z4QB 3OJ2C 5J56B 3QHZL 1A7OL 2H45A 2YSSA 3G6JB 5CJXC 8FABA 5I1EL 3MV8B 1U3HD 1OTSD 4JM2A 2MCG1 3MJ8B 1SM3H 1EHNA 3KXFD 1H3UA 4CW1A 3QUZC 4K23L 3QQ4A 4OCYH 3GBML 3U4EB 2V17H 2AXGB 1YZZA 4P99A 4GH7B 1D5MB 1HIMH 2PW2B 3LIZH 4RCAA 4DFIA 3DRTA 2Z91A 3TPKA 4Z77A 2E27H 1HQRB 3B9KD 4I0PB 4DGIL 4FABL 5MENE 4U1MA 1DN0A 3EUUA 3U0TA 1CT8B 4CVZB 1JYVA 3X17A 2NY7H 2CLVA 2WW8A 4BQBA 3QDGD 3HLAB 4QRUB 4PJ8A 1IKNC 5GS1A 4BSVB 3HMXA 2C7UA 2QKIA 1KB9J 1SBSL 1T7VA 4HCRA 2PCPA 4U1SA 5DK2B 3UO1L 2JELH 4PGCA 3WN5C 5ANMA 1NDGB 3T77A 4XMPH 5GJTL 2HT3C 1IZJA 3DECA 3X14B 5ESAA 1Z9OA 1VENA 1KTLA 3RVVD 3QUML 5IMLA 3IDYC 4LSDA 3DMMC 4PIRF 3RL2A 3BD3A 2WBJC 4X99A 2KL6A 1N8ZB 4P2RE 2EDBA 5IT2H 5IMMB 2BNUA 2J5LB 4ALAL 1I4FA 3KS0J 1GJIA 1U8OA 3UTSE 5IVZB 3OKDA 4PJ5D 1IC4H 3EBAA 1R3LB 5F93C 1P4BL 5F7EH 4BKLB 4L1DA 3KYNA 4HUWB 3EYVA 4OCWL 5GS2H 1TVDA 3CNKA 2DQDL 1C5DB 1OAXH 1DBBH 2Q8AH 1NBZA 1A7RL 4LPWA 2VLLA 4WFEE 2K7PA 2DM4A 1LEGA 5BVPL 1ZVYA 3FB8A 4H5SA 2GTZB 1A1OB 5A2FA 4XX1E 4F7EB 1J05A 4YHIB 3V6OE 5ENWB 3BZFA 4AZ8A 2I9LB 3S34L 2A9NH 3T1WA 1FZJB 3IETB 3FQTA 3MV7B 3WFCH 3K8KA 4FQ2L 3MLTB 2LTQC 4FQHA 4FFYL 5F6IB 3RGHA 2FJGB 3MJ9H 3FCTA 3HC3H 3U9UA 2V5SA 2QLVB 1MCOL 2UY6A 3MUGB 4U2ZA 2JK5A 4ODVL 5DZOA 5GGSB 4DEPC 4MGXA 5EBWA 5E2UH 3STLB 3MOAH 4U7KA 2HJFB 4YHOH 3SDDA 1IM9A 1EGJH 4O2EB 3JVGA 3O3AA 4ZFZB 1MFAL 3D18B 2Y36H 1IEBA 5DJ8B 5CUSL 2PXYB 4AM0A 4GG6B 4K71B 1HXMA 1V7MH 1KJVA 3PWJA 4KTDH 1NC4A 2F5AH 4MNQE 5FK9A 5I6XB 2JB6A 4DKFH 2WINB 1QFWM 4LARH 5DEGA 2NW3B 5FM5O 4WY7L 5BOPA 3WNNA 4PRHD 2VQ1B 4G42B 4B41A 4QRPA 1I3VA 5JW4R 1DE4B 2FECI 2NXYD 1FL5B 3WXWH 4OD1H 2J6EA 2VDOH 4P9HC 1AJ7H 3DHJA 5E7BA 5GRJH 4POZD 4Z7OE 1IAOA 4PRBB 5ADPL 5L2KE 3JWDL 4CRPA 2ATKA 4WU7B 4GRLD 3N1MC 4RFEB 3DV6B 3VXTA 1S7UA 5C6TL 3TYFA 5DD5L 3DX8A 5EBLA 4LSQL 4MDJA 4ZAKB 4FG6C 1N64H 3FT3A 1JGLH 4P5TC 4ZNEE 1GHFH 3GSRA 1PG7H 1JL8A 1UM6L 4NHUA 1S9YB 3MNZA 5SWSE 1A0QL 4M6AA 2P5ED 1DDHA 1G9NL 1YC7A 3KYMB 4I0CC 5E8NB 4K94H 1XGUB 3ZE0E 2J88L 1QEWB 1QVOB 4M6NL 4MNHA 1SJHA 4P46A 4V2BA 4HS6A 2H2SC 3VFUB 3HB3C 2VZVA 2NY4D 1HDMA 3MRLB 3HZVB 3GHEH 1RIUH 4NWTL 1CYGA 4XP6L 4PGBB 4NC1C 5JPNA 3NA9L 4ORGA 3U0WH 3P73B 1LE5A 3IDUA 1ZS8B 4M7ZC 4M1CD 3FMGH 3QUYA 1ZSDB 1NEZG 4KUZL 3KPLA 1N0XH 3F5WA 4WV1C 4ZD3H 2VDNH 3MR9A 3BGMB 1ZA6A 1AGEA 4N1HB 2VLKA 1UADC 2VO5A 4GKSB 5D7LD 3MYJB 4LSRL 5E08L 1BD2B 4UIKL 4CDHA 5EORH 5DD0H 5FO9B 2BFVH 3SDCB 4NGHL 4AMKH 1XMWA 1T0NB 4XC1H 3CSPA 4Z6AT 3HAEA 3LKOB 1DLFH 4LLYB 5B38G 1IGJB 1LILA 3VXSB 4XP9L 1EO8H 2JCCB 1CFQA 4NC1E 3NCCB 5D1QB 5T1MA 1JN6A 5DD1L 5HGGS 5AD0A 4LRIC 4ODUA 4G8GA 3HMXL 1U8IB 5E6YA 3GHBH 4HCRL 1CICC 1NFIB 1BZ9A 5JOFA 2XZAL 2FLBT 4Q97A 1DVFB 3LSOA 4YHML 3VXRE 4OZIE 5C7XL 1S5IH 1ZGLM 4JQXA 5C9JA 2Q7NA 2EKSA 4XPAL 4A2MA 3GSOA 5FB8B 5SWQA 1J1OH 1AGFA 2VZSA 2ZZUT 3V0WL 3STZA 4HWEL 4NQEA 4PJ9C 5FF6A 4WW2F 1HHIB 1J7VR 1HNFA 2HP4A 4MA8L 1RIVH 4KXZH 2XZQH 1A22B 5ICXB 3T3ME 4GAGL 1JHLL 5E9DA 4YGAB 3V4UL 3DOSA 2NY2D 3GKZA 5C0NC 4WJ5A 5T1LA 1Y0LA 3CMOL 3P4MB 1RUQH 4C57C 4P5KA 2HVKB 3VRLF 1BHGA 3VW3H 2R0KL 4TVPH 1JTOA 2BMKA 5GGUB 3SGJC 4P3CH 5FOBB 5KSBA 2UZIL 3RRQA 3VH8G 5A2JH 3VWKB 3VXNA 4PRPD 4OBRA 5AWNL 1BJ8A 3CCHA 1RJZA 1LP9E 4HIHA 5GGTA 3WFZA 4AIZB 4RA3A 1OTTD 4P23C 2F5BL 2IFGA 3WD5H 2IADB 2RGSA 4OFYA 1ZLWH 3MOBH 5J1AA 1QG3A 1D9KD 3QXAB 4A6YL 1F3DH 1YECL 4H25B 5HI5C 2XWJA 2E7CA 1JPTL 3ES6A 1G0XA 5HHPA 3C60A 1V5JA 4HIXH 1JK8B 3QULA 2ZJSL 3BE1H 3KYAA 1GAFH 3L6FB 2OI9B 5LCVH 4WU5B 1A2YB 3RX7A 2AK1L 4Z9KB 3ZL4H 3HTLX 2Z92B 3HI6H 3KNBA 1NAMH 3DV4B 1DQQB 1I3RB 1M7IB 4MJID 2HKFH 3O4OB 4LPXA 3Q3GB 4N8CL 2H6PB 2YRLA 4C55A 1YJDL 1UB6B 4NYLA 2E7LA 12E8L 4LSPL 5DK3A 3HZMA 3MBED 5CD5C 3BPOB 3K74B 4BZ1H 3KPMA 1J8HB 4PJBA 5M95B 5FYJL 2FBJL 5F7LB 3RWHB 1FLRL 4D8PA 1B2WL 4LLVB 5GGRY 4HWBA 5E00A 4UMGA 2R4SL 4G6JH 4G8EB 2KKQA 4Y16B 2J1KA 3KWWA 3Q5YA 1AGCA 2CKBH 4AJ0A 5EZIL 3IB4A 1A5FH 1CIUA 3VFSB 4E5XA 5JW5B 3V5HA 2C3HA 1T1XB 4Y4KB 1KNOA 5DJDB 1F2QA 1WIUA 3MLXL 1VFUA 4D94A 4OCXH 3LS4L 3MRPB 1J11A 1MNUL 1CLZH 4WTWA 3OAYH 4XMKL 4ZPVB 5D7JC 1MCWW 4ODHL 1RULL 5EU7E 3RNKA 4GRWH 5MEPB 3HCVB 2X4RA 1GC1C 5LXGL 1YEJH 2DI9A 3H8NA 3IS0X 3PWPA 2BY0A 3P0GB 1TMCB 1EXUA 4OCSL 1S7QA 2P24B 2MCPH 4LIQE 4KI5F 4G7YL 4JREC 5HJ3B 3VCLB 3AM8C 4K9EH 4M5ZL 1H15A 2AJYH 1C7TA 3CH1B 3D2UA 3JTSB 1SEBA 5D2NC 3S37H 5IKCA 3PQYB 2X1PA 5DJYB 1ED3A 4PJAA 3L5JA 2IPKB 1F90L 3C8HA 1FCCA 4QRTB 1VFBB 2VL5B 4LPTA 3VD5A 4F33B 5C6WH 2FIKA 3AROA 1ZT1B 5CP3H 1WBZA 5GRUH 2R1WB 3ZYJA 4U1HA 3VXUB 3BAEH 3I02B 1MQKL 4PY8I 4LRNH 5D1ZB 1NBYB 3VFPA 1XR9B 1PY4A 2R2CA 2F74B 4U6TA 5HYJA 2E8ZA 2X9YA 4NKMA 3ULUH 3HNVH 2ATPA 4X6EB 5E6IC 2NMSA 4GXUM 4D0BB 4JO3H 5D6DA 4MQ7A 1A6TA 2EE3A 1R3JA 4NUJA 4XP4H 2OP4H 3HNSL 1MCPH 2CDGB 2A1WL 4GFTB 3CSBA 4OLZL 3VFMB 2CSPA 3P4OA 4JG1L 2AGJL 1PDKA 1T1ZA 3B2VH 1TPXB 2EIZA 4F9LA 1PLGL 1WQVT 2R56L 4U7SA 3BQUA 1R5VB 2AV1B 4CGTA 1CVSC 4X4ZA 4YQXL 3NIGF 1SQ2N 1LNUA 2DDQL 2BNQB 2OQJB 2J8UB 3VG9B 3I6LD 1ZT4A 2ZSWA 1YEFH 3VRJB 2YZ8A 2CLZB 4KWUA 4U2YA 3VXMD 4UT6L 4JFEB 4P9HL 4Q9RL 1NEZB 3QFJE 4JFXB 4UIMA 1NMAL 4Q2ZA 1J8KA 4HG4J 1YDPB 2YUWA 2R9HD 5T1DH 2MQ3A 3EW3B 3IFOB 2YD5A 1GGIL 3EO0B 5EU6B 4DZBB 2I27N 2GSIB 4ESKA 1JPFB 1YMMD 1MJ8L 5DRXB 1U8HB 2Y5TA 3FB7B 1D6VL 2NY6C 3QXUA 4OV5A 1ADQL 4DZ8A 4UT7L 5GGTL 4XCEA 4NNYB 4PJGF 2UUDK 5B38B 1I8KA 4M62L 3NIFE 3KYOB 5E24E 2HT2C 1IFHH 3AUVA 3KAAA 4OFDA 3TC9A 5KTEL 1BWMA 3SKOA 4LKXB 3D39A 1JNLL 3MV9E 4H8WC 3O3BB 4MZ2A 3GUTA 4EUPG 1PD6A 2H9GA 1HYSD 2QL1A 3QXWA 4OLUH 4GKNA 4IRSD 5IW6B 1FVCA 4PG9B 1DFBH 1G0DA 3KXFE 2W0KA 4CADB 4ZSOE 2M2DA 1F4YL 2XA8L 2R0WL 3AAZB 4YDVB 1NCWL 4ZS7L 5FYLL 4TSBL 5ID1A 3A6CL 5E99H 1U2HA 3THMH 2B0SH 5IM7B 1SJEB 3ZYIA 4JFFE 4NSKB 2XKNB 1YNTB 4NO0D 4QEGA 5A16B 5IJVB 4KK6D 5D7SH 5JHDB 3QAZC 2Q6WB 1JGVL 2EH7H 2J6EH 3C5ZA 5AZEH 1S7TB 2YXFA 4JZJB 4LPCA 5HI3C 1VERA 2XN9B 2WK2A 1EAPB 1WAAF 3HG1B 3VH8B 3K2MC 5TQ0L 5J0BA 5ISZD 1N6VA 1FFOB 4JCMA 3REWA 4LF3A 4ODXB 3WIFA 2CJUH 1UJ3B 4APQD 3INUH 3BWAA 2R0LH 1BX2A 4PJ5E 1ZVHA 4ZXBB 1T21A 4LVHC 3MRRA 3EFDH 3N1PC 1YYMH 4ODSH 3BPCA 4NM8L 5DD3H 2HLAB 3VA6A 4YGVB 4L4VA 1JNJA 4DFHA 2OR9L 4C58B 2NNAA 2V2WA 4U1GB 5DRWB 3QXDB 3QIBC 1CS6A 1U58A 3EDFA 4L8SC 1IEAA 4L9LA 1FBIL 5C0BB 3QUXB 3T8XB 1B90A 5J7CC 4DAGL 1V3JA 1X5YA 1XEDA 4YX2H 3DSFH 5CZXC 4E9LA 5BVJB 5EU4B 3VGEA 1OAZH 3O9WA 1L7TH 3BRFA 3HE6B 1UACL 4MQSB 1E4XH 3BH8A 4YEEA 2CK2A 1CBVL 4JPVH 4JRYD 3ARGB 1UQSB 3SE8L 3HE7A 5IOPB 4BSWB 2VH5H 4RMTA 1IBGL 2R69H 3OKLB 3GJFA 5BXFB 1I8IB 5FCUL 4QXTB 4PREB 5IEHB 1JZ8A 2ZUYA 3S9DB 4FQ1H 1Z5LB 1NJ9B 5CKGA 1DANT 1KJ3H 4KTEL 4LK4A 1FNGA 4KV5F 3IDIA 3VMOA 1FVEA 4KXZI 3U1SH 5C0RH 3TO2A 3P11L 4M3JA 3ZDXE 1P7QA 1WZKA 5K59E 3ARBB 3HAEH 4PRHE 3DXAE 3SE9H 4KDWA 1ZLVH 4MNGE 1T6VN 4MMZC 3FQRA 4WFFD 4JZOB 4IIQC 4Y5XA 1LEIA 3LQZB 1MCDA 4U0RC 3BP6B 2DJSA 3IRZA 2V9TA 2Z35B 2F54D 3LMJL 3MLWL 3QEUB 5IB5B 4OKVB 1E4WL 2ARJQ 3BOVA 2F15A 1QLRA 1W2KT 5FHAL 4KI5C 4R4BA 3OHXA 2P5EE 5JORA 1FN4B 1GVIA 2EO9A 1ZHKB 2AV7A 4Q9CA 1GYAA 3KHOA 4WW2A 1MQ8A 2Z9TA 2ENYA 1NL0L 4Y19D 4I0PC 2UYLB 2BSSB 1FIEA 1Q9WA 1I1YA 2FDBP 1XIWA 2NXZD 4HF5H 4E0RA 3IJSB 2E7MA 3NPZB 3W2DL 1I1AB 5I1DB 4L4TA 2F19L 4GW1A 2VAAA 1JMZA 2WWKT 3QDJB 3CDFA 4HUVB 2HVJB 1YEIH 4HUKB 5DMIH 5DJ2A 2JB5H 3STBA 1R3HB 2P7TA 4D0CB 4S2SA 1H3PL 1BLNB 1QQDA 2ITCB 1HILA 2Z31B 1FH5L 1ONQA 5C6PB 1GC1L 5HDBF 1G9MH 1KB5B 3CX5K 2J5LC 2NY0B 4FMKA 1NGZA 4JR9L 3HA0A 4JDTL 4QYOB 5IF0B 4AG4H 1IM3B 2APFA 2C1OB 2WZPD 4X8XA 4YDIH 5D7LE 4RX4D 1E6JL 1PQZB 3L3KA 5GZOC 1OVZA 2CR3A 1SYVB 2AABL 3RTQA 2D03H 3S88H 1JWMA 1P69B 4HEME 3BZEB 4Y4HB 1L6ZA 2VJXA 1MWAB 3FT4B 1OP3H 4U1LA 4XMLH 3V7MA 2R2EB 1HQ4A 1T7WA 2DQFA 1NEUA 2R4RH 3IFPA 3KPSD 5TJWK 3DO7A 1OGAD 4M7KH 2AK4D 4IBLT 5F6IC 4ONHB 1OAKL 1QLFA 2JF1A 3BKML 1L7IH 4ONFL 4M8QA 2DWDA 5HHNA 3S35H 1T1YB 4K7FA 3BP5B 5EDXA 5A2LH 5ILTH 1D6EB 4LCUA 1KULA 1VB9A 1G9EA 1N7ML 3BEWB 4OT1L 4JB9H 2VDML 4RWYL 4HWBH 1B88A 3RP1A 1KCVH 2NY3B 4JO1L 1OP5K 3TJEL 3UBXG 3CJJA 1A9EA 1AQKH 4MB5A 4HKZA 1JV5A 4UNUA 1B3JA 3VXOA 2PXYC 4JDVB 2WAHA 5C07A 5DRZA 5JXAL 4MYWB 5I6XC 3SN6N 3RKDC 3QPXH 2V5MA 2NCMA 1QLEH 5IIEB 1EEYA 2V7HA 1CLCA 4HLZH 5BJTB 2FX8H 2W65B 2XRAL 4GKOA 4XCFH 2KQNA 1N5YH 1RSFA 3K46A 5SX5K 5BO1L 4EDWH 4PP1C 3SJVA 1OGTA 4HBCH 1QBML 4MXQC 5TDPB 5JXED 1ZVSA 4MWFB 4NHCH 4P57A 3OL2A 3PG2A 3ZKMC 2VLJA 3FFCE 5DC0A 5FGRA 4DVRH 2J3SA 2O61B 1XZ0A 4Z7OF 5KG9A 2H8PB 43CAB 2HTLC 5HDLA 3O0RH 1AXTL 3VFGH 4FTVB 3GSWB 3T04D 2WSKA 3OKKB 2PW2A 4M7LL 3F7VB 4ZAKC 4HJJL 1CGSH 4NZRL 3TZVC 1EO5A 5I1IH 1MJUH 4KJYA 1HQRA 1KC5L 2LAAA 4R4FH 5DMYA 4V1DA 4R0LB 4LSVH 2CXGA 2HN7A 1KEML 5IFJB 5I66B 1ZV5A 2VXQH 3HLAA 5I1JH 2JJSA 4MAYA 4BSVA 2CUIA 5DF0A 1FZKA 4KKBD 5LBSH 3C6LC 3MCLL 3V7AE 3QDGB 5D5MB 4QY8A 3B2UD 4WO4B 2J8UF 1JNHB 3QNZB 3X14A 5ALCH 2DD8L 3MUHL 1EBPA 1RZIB 3GSVB 1SYSB 4W68A 4PR5B 1D3CA 2QQNH 4HKJA 5EFIA 4RFOH 1VESA 4KKNA 2IFFH 1RZGA 1INEH 2XXCB 3QRFM 2AJSH 3ARED 1J88A 4Y8DC 1DBAL 4Q0XL 3IXTB 1F02I 2YC1A 3PWNB 3NZHL 3QZWB 4UAOB 1W0VB 4DVBA 1K5NA 4PJHE 4P4RB 3PL6D 3P9MA 4TRPL 1FRGL 3IDGB 4JANB 3REVB 5I8KH 3L3OB 2CIIA 2ZUUA 1C16A 3SDCC 4XVTL 1OP3K 4RQQB 1MOEA 3FB6A 4HJGB 3T3PE 5ICZA 5I2IA 1F11B 5TDNA 4ODBD 4LP4A 1D5IL 4XBGB 4N8VA 1XH3B 4O2FA 4U3CA 5BQ7B 5IWLA 2B20A 4YZFF 1Y6MR 25C8H 5KSAD 3B6SA 1URLA 3DUUB 5D1QC 4HDIB 1BOGB 3F58H 3S5LA 2G5RA 4WWKB 5FFLA 3HUJE 5E2TL 3VFTB 2CK0L 1WZLA 3GSNH 2A0LD 1DVFC 2GAZA 2NY5C 1QNZH 1G7LA 5E1AB 4PJGA 3SO3B 1X5IA 3T0EB 4L3ED 5I73B 2OZ4H 1V3MA 5EU3B 4XRCB 5KBNC 2NW3A 4EBQL 4DK6A 1A3LL 4F7PA 5DZLA 3LEVL 1DL7L 2VQ1A 3DI3B 1DE4A 1FJ1B 1FL5A 1B4JL 3B9EA 3I3DA 4JM2D 4XP5L 1T89A 2VLRD 2HRPL 5JNYB 3G04A 3ULUD 3ARSA 2BJML 3I85A 5IHUH 1UVQA 5CBEB 5KVMC 4KQ4H 4UDTB 3R1GH 2N1KA 3SKJL 4DQOH 2F53E 3F12B 3OMZA 2X70B 2HFGH 3DV6A 3D25B 3GI8L 3O2VL 3VWKC 4GRMB 1X44A 1G6RL 4GRLB 1LDPL 4ZPTA 4XNYL 4P59L 4PJIE 5I16A 4Z7VE 1I85C 1LP9F 3CH8A 2W60B 4PJ8D 5T3XH 2YKLH 5EBGA 1BQSA 3CFCH 4PRIA 2DLFL 4P2CG 4LPYA 1QA9B 1QVOA 1QHPA 4P9ML 4ONGH 5F9OL 1I3UA 1M71A 3R4DA 4JFYA 2BOCB 4WUKH 2ED8A 2XPGA 5D2LB 1QBAA 2ZOLA 2DL2A 1WAAA 1G7HA 3CD4A 5D70L 1H3XA 3BP7B 2OI9C 1N6QL 3IGAA 4NWUL 2FGWH 2ZCKH 4PLKD 3UTTD 3OR7A 3T2QA 4G8FA 1W72L 1MRCH 3VXME 4Z7UB 3O4OC 3LEXA 1FNEB 1M05A 1UM4L 1JPSL 3D3VB 2HTKD 2EC9U 1YPZB 4BQCA 5F8RC 1U93A 5IUSA 2UV3A 2J4WH 3QI9D 3MLRH 4U6XB 4J4PD 2AVGA 4H26B 1INDH 3O81A 4GBXB 1S9WB 4KJPD 2HH0H 4YXHL 3BPOC 5I74B 4QOKB 32C2A 4KMQA 3WHXB 3GNMH 3B5HA 4LAQL 5D7IB 1KN2H 5GSVA 3I3EA 5IR1A 3MMEB 1XGYL 3F7QA 1MCIA 2EZ0D 4P2OD 4Y16C 1FFNA 4NNPL 1HOCB 1IC1A 5C8JB 1BFSA 4KK5C 3LKOA 2C4XA 1GSMA 1IGJA 1YY8B 4BFIB 3S97C 4KHXH 1L0XA 2YA1A 3N9GL 3SDYL 1S9KC 3KYKL 4GUPA 1TITA 1PX4A 3EYQD 1JRHH 3GJFH 4LGPB 1KXQE 3WFEL 2MKLC 4H1LB 1K9TA 5A3IC 5C0FA 5CZVH 3GMQA 4XWGL 3RGVD 3PIQA 4M4RA 4LHUA 5I8OL 2J8HA 1EDQA 1NC4D 5I9QB 3LEYH 3H3KA 5HDQL 5FYKD 5GGSY 1GOFA 3MZTA 5JQ6L 4QT5A 1MIEH 3VFOB 4O5LH 1KTKE 3NN8B 4EI5A 1FE8L 3F7YB 3T0DA 5CINH 2X2YA 3DGGA 4KKCC 4QRPD 4U1NB 5E2VH 1EFXA 4FXKA 2OR7A 4L5FH 1JF5A 1I8LC 3GBLA 4JFOB 3VE0A 5DTFB 3OQ3B 3SQOH 3MRGB 2DICA 2IAMA 5EWIH 5FA4B 3WFHB 4UI2A 4HWNA 3HMWL 4XPTH 4D3CH 3PGCA 4WHYG 4P49A 2X4QA 4X6BB 5D1ZC 1ZTXL 3P4MA 5GXBB 5ISZE 2W9LA 3HZKA 2NY2B 4UOJA 3ZTNH 1RHHA 2HVKA 1R5WB 3GSUA 5GGUA 3WXVL 4PP2A 1NAKH 1FV1B 5H35B 5JHLH 3C5JA 2JIXD 4P3DA 4YHLH 4L4JA 4R26L 2ADIB 5EC1A 4E41B 3D85B 4YHKH 3TNNA 3K2UH 4PRPB 3BW9B 1I3GH 5E8PB 3Q2CA 1GPOL 4JPWL 3K4DA 2ZUQB 1B6DA 5AYUL 3ARFB 3QWQB 5E2WL 5F3HB 3L5IA 3ARWA 4D2NA 3WKNA 4NP4H 5DHXB 4AT6B 4FFWD 1MFCH 4FFVD 5MENA 3MYZA 1TPXC 3A6BH 2BVTA 4UBDD 2GCYB 3M17B 1P5UA 4DTGL 3B43A 3W0WA 1F3RB 1ULVA 2Z92A 1W0YT 4DW2H 4OKDA 1DQQA 5ETUA 1IE5A 1M7IA 4BZYA 1N3NB 3MLYL 1J1PL 3C8DA 2LABA 1UWEH 3VG9C 4OLWL 4HK3N 2H6PA 4MJIB 4JRYE 4HH9A 4P48A 4F7MA 1LO2H 2BRRL 4U6VL 1Q9KA 3U48A 5HGBA 3V6FA 1O0VA 3X12B 4AEFA 4TPRH 3BKYH 1VPOL 4LHJB 2L4OA 3UTSA 4XPBH 3RWFB 1OTUD 3C09B 4BM7A 3WFBL 3KLHC 3L9RB 1LO5B 2R1XB 3MRJB 4OZHB 2XOTA 4OLEA 5I30H 2QSCL 5TE7L 2OTUA 2ICES 1JF1A 1SMAA 3MFGB 4HBQA 4OQ1A 2DTMH 3IJHB 4Z95H 5FUZH 1WWAX 4WFFE 2OMBA 4N0UB 3V6OA 2B1HH 3NIFF 3EOAB 4XXDA 3TVMB 3UTPD 5L6YL 4P0DA 1NGQH 2FGZA 2Q20A 1Z3GL 3RDTA 3CFEA 5FECB 2F54E 2XNAB 4RNRA 1KCRL 3PWUA 4O9HH 3TN0A 4K2UH 4M1GH 3MRFA 1KTDA 5KVEH 4WFHD 4DCQA 1F4XH 5C08D 8CGTA 3BGFC 4G6MH 1GIGH 4J1UB 1YUHB 1DQDH 5F1SA 4M48H 1CLYH 3FRPA 4I3GA 3G5YB 4JG0L 4OI9A 3MRDA 4B50A 1PJ9A 4MHHI 3VFRA 3QRGL 4PRAB 1T83A 4Y19E 5MEOA 1T3FA 3WUWA 4XTRD 1X6LA 1D5ZB 3NFNB 5MEQA 4LCWA 4OM0L 1FYTE 1DUZA 2GJ6E 1U8JB 5I8EB 5I19L 4JZJC 5LVEA 4UDUB 4P4KB 1RY7B 1U8MB 1YEHL 4FZEH 1T7ZA 2FCBA 2DF3A 1A64A 1RK1B 4KAQL 1AKJD 3ZKQD 1L9NA 3V5KB 3IU4L 5L2KA 2AQ2A 5ACMA 2Q86B 3MROB 3SY0B 4OD2B 5IJKA 3V6BR 1F6FB 1AR1D 3QIUD 4X6CF 1MCSA 4EIZC 1S9XB 2R1YA 1AHWA 4ZXBC 5HPMB 5KOVC 3GIVA 2P49B 1NUFA 4WNQA 4KZDH 3TCXA 4NNXB 4BQ6A 5I8CA 1Q9OB 4ZNEA 3P3YA 1HHHB 1CE1H 2GIYA 1MI5D 2FEEI 1YYLL 3BUYB 3TA3D 1OLLA 4Y7MA 5SWZB 3I6GB 2NY5L 3ZT7A 5JHDE 2IANB 1EA9C 3RY6C 2OQJA 2J8UA 2G75A 1IL1B 2VOTA 3E1F1 3OPZH 3KPSE 3QUXC 3VRJA 4ALAH 5FGCB 4ODTL 2DL9A 4NJAL 2CLZA 3QB7C 1I9IL 3MACH 3Q6GH 1P4BH 5DURB 3A0OA 4FQLH 1R3IL 1J0IA 1MH5A 15C8L 3HE6C 3MA9H 4I48A 3RAJL 2ZKHL 1KIRB 3ARGC 3W5MA 3DBXB 3P77A 5BCAA 4QXUL 2YBRA 5EZOH 5CSGA 5EN2B 3V4VH 1JPFA 3CFBB 1N26A 3AMLA 4KVNL 2RQ8A 5DRXA 4ZFGH 5AAWA 5GZND 1PY9A 5IGXL 4IMLA 1E6OL 5CSZB 2DYPA 4KHTL 1YMMB 4FQ2H 2GW5A 1FAIH 1MY7A 4NRYB 4FNLL 2DMBA 4PJFB 3KPRD 4WTZG 2VITB 3RVWD 1XF3A 3ARBC 1I7RB 1N4XH 2ICWA 1H5BB 1NBQA 3O3BA 5A43C 3EZJB 3HKFA 2OTWB 4HAFA 4TSCL 3I75A 5HGAA 4YXKH 2V5RA 1NKRA 4JEGB 5HGHB 3DWTA 3ZE2E 4J3OC 4PG9A 5F9JB 1UXWB 1T5XB 4Y4FC 4PPTA 4IRSB 1VSCA 1DSFL 3AAZA 3TBWB 3RIAF 5F7DB 5CGMA 3H3PH 3ARZA 4WY7H 1ZGLB 3QIWA 4RGND 5DYOB 5J8OA 1MF2L 4EDXB 5IB3A 5BZWB 3PABA 4WV1A 2PF6A 3LVEA 3VXRA 5D1XC 1UH3A 4QRQA 3WHE1 2Q6WA 4M9OA 1TNMA 3P4LA 3TNMB 2IQAB 3LB6C 3WJJA 2DKMA 3JWDH 2N7AA 2V5TA 1MJ7H 2GQHA 4DKAA 1A6AB 4QHKJ 3FB5B 1JHTA 2PR4L 3EHBC 4XC3L 4DKEH 5IK3B 2G9HB 4K8RL 5C6TH 5DQDH 4Z7WE 5B21A 5DJ0B 1J10A 1UJ3A 4FQIH 2O93L 5KANG 1CD1A 2X4UB 3BESR 3H9SA 2DWEA 4I4WB 2ADGB 3K1DA 3MGOA 3PHOA 5I1AA 1HXYB 1A02N 1WF5A 1E4JA 3WSQL 4YHYC 5GJSH 1C7SA 2FYYA 5JZ7C 2Z31C 1CLOL 3DJ9A 1LP9A 3HZYB 3TWCH 1RZKC 3OSKA 3U7WL 2D7TL 5TH2A 1DANU 4JFDD 2EICA 3MNVA 1GCFA 3BFOA 4U05A 4NQCE 2DBLL 4HIIB 5C0CE 4NQDA 4XP6H 2MPAL 1T2QL 1NGWA 2BNRD 4Y4HC 1FL6B 4GRWE 4E42A 3LZFH 5IVOA 4QTIL 3G6DH 3VFWB 1JRHI 1Y6NR 5ACZA 2YD4A 5AYQA 1TZHB 4QRRB 5B8CB 4QHNB 3RQ3A 5BRZD 1HHJA 2FH6A 4BSWA 1CDGA 1ITBB 3MQIA 3OKLA 3S3PA 4Y5YB 1FL3A 4BH8B 4KK9D 3DVIA 4MQXD 1F42A 2YZ1A 5EO0B 2VIRB 3RWEB 4D0DB 1CR9L 4C59B 1M1SA 4JDZA 2X4SB 5E7FA 1NJ9A 1KPRB 2Q7YA 4BFBD 4NGHH 1JNNL 1NCUA 4LOUC 1GZPA 3BHBA 4OF7A 1CI5A 3TCLA 2NY3C 4L3EE 1FNHA 3ELAT 4LSUH 4HLJA 3T2OA 1JGDB 3QG7L 3CZFA 4XP9H 5HYIA 4LASH 3PDOB 4G5ZL 3FO2B 5BV7H 3NABH 5CLTA 2YRZA 1JWUB 5FHBL 1F58L 5L2JA 1OAYH 5F1IA 1HSBB 4XT1C 5F1OB 2DQGL 1RMFH 2VLRE 3QO1A 5IW1B 3BP6A 4R2GD 4UTBH 3BVNA 4M43H 1A8JH 5HHVL 1MHEA 1P7KA 2EXYD 3VWJA 4HHAB 1R0AL 4JGMA 4PGEB 5DJ6B 2R2HB 3CVIL 4Z0BH 3JXAA 5DQJA 3BRDA 1VGKB 1A7NL 5CILH 1HYRC 1EVUA 1UFUA 4UQ2B 3LDBB 5T3XD 1PZ5B 3EOTL 4MA8H 4Q9QL 4AH2A 3UX9B 4Y2OA 4OSUH 4U4BA 2HFTA 1F00I 4YR6A 4MCYB 3SOBH 1MAMH 4RMVA 1GGTA 1OCWL 1QR4A 2UYLA 1MCFA 4R0LC 1XF5A 3CMOH 4HS3B 2XG5A 3O6FA 4UT9L 3IDMA 2XFXA 4NIKB 3B4NA 1UYWL 4YHZH 4DUWA 5I1KL 2APVA 2E9JA 3MUZ1 4BSJA 3ABZA 4NRZA 4OGZA 2ZG1A 1IC5L 3VU2A 4QCIB 2VXUL 4PJXB 5CLWA 3UTTE 1XR8A 4WO4C 4UNVA 1ZA3A 3CSYB 5T5FL 3H7BB 3EOBB 2OYPA 2I07A 1JTPA 4IDJL 1XF4B 3GMMB 4HWZB 3TIDA 3IDNB 3L3IB 1XCQB 4HXBL 4WI8A 3W81A 2OJEA 2Y23A 2EDOA 4YH6A 4H20L 2P44B 5ESVA 4CMMB 1C1EH 4K3JH 5SX4H 5ITBL 5CEZE 1NLBH 5IVXE 3QCTH 2I5YL 3L3GB 1YN7A 4M6MH 4NO3B 1CF8H 3UCRA 3CXDL 4PUBL 4X4YA 1G7MB 3TT1L 1HCFX 5TGBA 3WCYA 1TJHL 3TIEB 3QQ3B 1QRNB 4JFHD 4LEOA 1BZ7B 2VLMD 3FOMB 4QGTA 3GRWA 3HE7D 2FATH 2XWBB 3GMNA 3QHFL 4JFZH 1CL7H 4XBEL 1NFKA 4ZFFB 4HIEA 5I1LA 1OGAB 2AK4B 3T3PF 3BP5A 1F3JB 3LD8B 3CK0L 5IV2B 4R90H 4EN3C 1ZHLB 3BEWA 3QFJA 1IQWL 3LKPA 4WWKC 4HUMB 4J7RA 5FYKE 4F8TA 3ULVC 3CDYA 4X98A 5CKAA 3U0PB 1AC6A 3HUJF 1KLUA 3G5ZB 1AIFB 1KENH 3MLXH 2F8OA 2Z8SA 2C3VB 2DLHA 3P9WB 4JKMA 1TCRB 1WWBX 5C0DB 5LGJA 1MNUH 3SO3C 3NACH 1Z9LA 3T0EC 3PWVA 5B39G 5I73C 2YD2A 1RULH 4MAUL 5TDOA 3MCKA 2QHRL 4GXUN 3CLFH 5BJTA 3QUKB 5CGYC 3QDMB 4MD4A 2HG5B 4XPGH 3OR6A 1MJJA 2P8MA 4OZGB 3OKEB 4N8PA 4S1DC 4XP1H 3W5NA 2BCKB 4N9GB 5FXCH 3SDXB 2AI0H 3LY6A 3MV9A 2WIIA 3D69A 3DVGB 5GS0L 2HKHL 3QA3A 1A3RH 5IBLC 5ID0B 3KPOB 1U3HA 4M00A 3VD3A 2X4OA 1B6UA 4RDQF 1G7JB 3UDWA 1AR2A 4LGSB 3OKKA 1IGTB 3KXFA 7FABH 4ZSOA 3HFML 4XVSL 5C09E 5DEFB 3QWRD 1A6UH 2VL4A 5EOCH 5INCB 5DC9B 4RAUB 3VD9A 5AZ2H 1MHHB 1OSZB 3T0EE 4X6DE 4L4TD 4PJIF 3C9NB 1OARH 1XGQB 1RJCA 3B9KA 3BZDA 2CO7B 2AQ1A 2HWZL 2W9DH 3IDJA 5HHOD 3WNLA 1CQYA 5FM4A 4G9FB 2BSRA 1E0OB 3QDGA 2EXWC 3V2AR 1A9BB 2XTJD 1JNHA 2A73B 3BDYL 1A7QH 2KZWA 2CRZA 2W0PA 3NFPB 1MPAH 3O3UN 3PP4L 1TVBA 4X5WB 2HYMA 3PGFH 2ADJA 2V2XB 3G6AA 4UOW1 2QBWA 4GW4A 5DVLA 4X6CA 4PB0L 1L0YA 4WEBH 1JZ4A 3HI1B 3U2SB 1NKOA 3NCFB 1CGWA 2OSLA 3SKMB 4DUVA 2YR3A 2DOCA 4PJ5A 4GBXC 5TE4H 1GGCH 5HHME 1VFAB 4JKKA 1CGYA 2H3NA 3ROOB 4GG8A 1KSRA 2WUCL 2YMXL 3NMEA 3FHQA 1U91A 5L7XH 3GGWB 4ZUUA 2CKBB 3L3OA 1ZE3C 3PL6B 4Y2DC 4IRJC 4IRZL 4MQTB 3P0YL 4JRXB 3FO9B 4IOSD 3DVFA 3HR6A 5CJ5A 1TCMA 3GO1L 4R4ND 1TVHB 4ZO6A 4UINL 3MBXH 3UTPE 2IWGA 5DMJB 2X41A 3NH7H 2XTLA 2X09A 4Z7UE 4LAJH 4N90D 2VR4A 4PJCB 4WFHE 1YPZE 5LAXB 4RISL 3FTGA 1QSFE 1BMGA 2FWOB 5IVNA 2HMID 5C08E 4WEMB 2P8LA 5BOZG 1CGUA 4JY5H 2PW1B 2GSGB 1MVUB 4QOKE 5I9QC 3F62A 3DARA 3DIFA 4YDJB 1K3ZA 2GFBA 4MXVF 4BUGA 2DKUA 5EU3A 1S7RB 2DQHH 1KB5L 4QF1B 1W0WB 4KC3B 1RZKL 4MS8D 4CN1A 5CD3A 1G7QB 4PRNB 1Q9LB 3QIBA 2V7NA 1AXIB 4PRHA 4UTAL 2FBOJ 2A6JB 3UYRH 5KSVA 4OD3L 2YSSB 3T65A 4JM2B 3AY4A 4L8DA 1WIPA 1NCWH 2NY2C 4F37F 5HVFB 1MWAL 1UWXH 4CW1B 3MODH 3QQ4B 1NSNL 1JF6A 2EE9A 1YQVL 4GRMA 3GRWL 3BT2L 3HI5H 4TNVK 3EJJX 4GRLA 3HRZA 3DRTB 1N5AA 4K07A 3GJEA 1ES0A 1T4KA 4Z77B 2W60A 4U1MB 1DN0B 3U0TB 2FEDC 2CLVB 2CR6A 1X5XA 1DP0A 2P5EA 3UZVB 3R8QA 3ARFC 4PJ8B 2BVUA 5GS1B 5JPMB 1CIDA 2C7UB 2VXVL 3PJSA 4KTYA 2QKIB 5F1NA 2PCPB 4PGCB 5J13B 4XPHL 1LK3L 1Q0XL 2APXA 1NCCH 3T77B 3NCYP 5CWSA 5ESAB 1EHXA 2NX5D 1KTLB 5IMLB 3TYGH 1JE6A 3ZSTA 2FH8A 4NOBA 1NCAH 3O6MH 3RL2B 4X99B 3WEXA 1TNNA 4NN7B 3X3GH 2BNUB 4I9WE 5KJRL 2UVEA 1I4FB 2MOVA 1U8OB 5E5MA 1M7XA 3OKDB 4NQTA 4U6XA 5C2UB 4H26A 3KYNB 4R8WH 1S9WA 3EYVB 1LO3L 4G7VL 3DGCR 4MB3A 5TFSL 4G6AC 3V52H 3WHXA 3HNTL 2XYCA 2YPLE 4PY7A 4ZUSA 2NTFB 1NBZB 2VLLB 1LEGB 5I71B 3FB8B 4H5SB 3M45A 3C09C 1J05B 3BZFB 3JV5A 4CVXA 3FQTB 5D7LA 5GIRA 2YK1L 2WUBL 5KS9E 3S4SA 1RU9L 4FQHB 4LNRA 3ZDZE 4PLNC 1SEQL 3Q1SL 4WVRA 2PYFA 3N06B 2E9BA 2G5BA 1QSEE 3GBNL 1FFPA 2JK5B 3TVMC 5EBWB 3LKSA 5C0AD 2IMNA 5J12B 1BIHA 2FB4H 4NUGH 2OS7A 3QEQE 5MI0B 3RVTD 4OZFA 3SDDB 1IM9B 3TBSA 3E2HB 1RZ8A 2PO6D 1AP2B 2I9TA 3O3AB 2VDLL 1CDYA 2IG2H 1IEBB 1U8LA 3KS0H 2XY1A 2CGRH 1YN6A 3VFOA 1P53A 4AM0B 3NN8A 5H37H 5DUBA 3DYOA 4Z8FL 1KJVB 1JVKA 1NGXA 5DQ9A 3WLWC 1NC4B 3UJTL 5FYKU 5FK9B 4JQIL 2JB6B 4U1NA 1U8KA 4K55A 2EYTA 1MELA 2P42B 1DTUA 5T3ZL 4FQXD 4QRPB 3SPVA 1I1RA 2W38A 2FD6L 3OAUL 2X9WA 1TTFA 2VC2L 5B3JE 3LH2L 4TN9A 1RZJH 1E4WH 2B7DT 4N0UE 4J3VA 1IAOB 1UM5L 3S7GA 4QHLB 4OLXH 2P4AB 1P9MC 2ATKB 4W81A 2RCSH 1HKLH 1BQLL 4P4KC 5H35A 4JHWL 2BSTA 2ZUXA 1CU4H 3VXTB 4I77H 1S7UB 2E3VA 3TYFB 3DX8B 1PEZA 4PLJD 5EBLB 4MDJB 2WBWB 3FT3B 2D4DA 3TBVA 5C0JA 3R06B 5JR1H 2AJVL 4KGLA 4NHUB 3MNZB 5F7HA 2Z0BA 1RUKH 1KIPA 1DDHB 4LIQH 3RIFF 4NN5B 4EI6A 1OD9A 1OF2A 1U95A 1HCVA 4MNHB 1SJHB 4P46B 5BS0D 1D9KA 3OJDA 4HS6B 4AT6A 3ULVL 1IC7L 2ESVE 5DUMH 5GGVL 1YC8A 3G5XA 4OB5L 3MSPA 4QXGL 4K7PY 4OAWA 2DLEA 3EYSH 1HE7A 2BNRE 2PNDA 4GMSH 1GOHA 4NQVA 2ZNWA 5EC2A 5F6HI 3RVUD 5BMFH 3AB0B 1N3NA 5IBUG 2AP2A 5DMKB 2I60L 1EEZA 2P5WD 5JPNB 1A6WL 3WS3A 5IBTH 2HAZA 4ORGB 4EVNA 4FS0A 1YEKH 3O8XD 4MJIA 4JR9H 1LE5B 4WFGD 4DOHE 1R3KA 1CZ8H 4TTDC 1PKOA 1TZGH 3QUYB 2R0ZL 4LQFH 3KPLB 3LKNA 2C3XA 3MBEA 4LU5H 2VZTA 1YNKL 3F5WB 2EEDA 3MR9B 1ZA6B 3FO0H 1AGEB 3BMWA 3P0VH 2VLKB 1UCTA 4TVSa 3L9RA 4R96A 1EZVY 3OBAA 1AFVH 1PG7X 2EDDA 5D93B 3UZEA 3HAEB 4OV6F 2D0HA 3QQ9C 4KKLD 4FQCH 5INDB 1BAFL 1AI1L 1C5BL 1FNSH 5FV1L 4MSWA 2B8OT 4PRDA 1IGFL 1ZXQA 4N5ED 1H5BC 5T1MB 4ZDHA 1KJMA 1JN6B 5AD0B 4M61A 4ODUB 4PBXA 3TH2T 4WENB 1BZ9B 4EI5D 5C0GA 1BIIB 3NA4A 4HV8A 1E4KA 4RZCA 3ZE2F 1FZOA 5DD6A 4EEEA 5C9JB 5B3NA 1LK2A 2EKSB 3SDAD 3GSOB 4M6OL 3VXPA 3HUJA 4B7IA 2ILLA 4Z18A 4M8VA 5SWQB 1EBAA 5HYFA 1AGFB 1B0RB 3L1OH 5KVGL 1KG0A 2OJZL 4DGYL 1MCEA 4NQEB 5FF6B 5IMKA 3K80A 2JTDA 5I1GH 1GGYA 3DYPA 4GQPH 4Z76A 5DMGD 5TPWL 1BFVL 3NFNA 1KELH 2X1XR 1QBMH 2VABA 2Q3ZA 1U8JA 4WGVB 3JZ7A 1Y0LB 4KFZC 2BDNH 2DQCL 5IFHL 4JO4L 3OXRB 4UDUA 4D9RE 4P5KB 2IF7A 1U8MA 2BMKB 3EJYC 3DUSA 3IFLH 5EA0H 1AXTH 5KSBB 4LSSH 3WNMA 5I76A 1ZT7B 3VXNB 4L9DA 4G3YL 3DX6A 3CCHB 1RJZB 3ARDC 4HIHB 4HW6A 4RFNB 3SCMD 1WFTA 5FUOH 5EIIA 2F53A 4Z7WF 1AKJB 5E5UB 5J1AB 2HFFA 2AJ3A 3NAAH 3V4PL 4F57L 4MJ6B 4M5YH 2BZDA 3OTTA 2B1AH 2XWJB 3GI9H