5I9QB

Crystal structure of 3bnc55 fab in complex with 426c.tm4deltav1-3 gp120
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
217
structure length
202
Chain Sequence
VQLVQSGTAVKRPGASVRVSCQASGYTFTDYFIYWWRQAPGQGLEWLGWINPLTSQPSYPSRFQGRLTLTRDTFDEMLYMDLRGLRSDDTGIYFCARRHSDYCDFDIWGSGTQIIVSSASTKGPSVFPLAPALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLICNVNHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 426c.TM4dV1-3 p120
publication title Structural basis for germline antibody recognition of HIV-1 immunogens.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 34
structure length 202
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i9qB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i9qB01
1AC6A 1S7UB 4Y5VA 4AEHH 2QQLH 4RWHA 3IAQA 5DJYB 4BFBD 3GRWL 3R06B 4MXWH 3IDIB 3E6HB 2ZUWA 3L3KB 2VN4A 4YZFE 2VDLH 3NA9L 3F7YA 1ORSA 2WK2A 2YUWA 1MI5D 4O2EB 1EJ6A 4GKZA 4RFNB 4L3CB 2V9RA 2ADIA 3CPLB 1OB1A 3MOQA 5E2VH 2CKNA 4NQCB 3RY4A 1DCLA 4KKAC 4ENEC 3IRZA 4Y2DC 3W82A 3MLTA 2R0ZL 1JYWA 4BA8A 5JDSA 1IBGL 4MXVF 2B5IC 5TE7L 1BFSA 4PRDB 3GMMA 4D2NA 1MAJA 1H3GA 4I5BA 4OCLC 3MLXH 2JK5A 3HZMA 2UWEF 4G6AD 3SDDB 4XXDA 5CJOH 4WU5B 3RL2A 1R5IA 4GFTB 1GAFL 1NGZB 4MJ2A 2WUCH 5EIIA 4HIJA 1E4KC 3PWJB 1V3JA 1ACYL 1GZQB 2L0DA 2F15A 3OR6A 2DS4A 3BWUC 3N9GL 2D7TL 3UBXG 5DMKB 4P2OD 4MCYA 4GW5B 4XP6L 5BOPA 1NJ9A 5J12C 4P59H 4Z95L 4LSVL 1Z5LA 1VHPA 1LDSA 3O0RH 5DFWH 1MFNA 4Q9CA 3ES6A 4L4JA 4R3SA 3MNVA 5DK3A 4PRPE 2ESVB 1CFVL 3QPQD 3E6FA 1C1EL 3QUYB 5IV2B 1OD9A 3BXNA 5BV7B 1CLOH 5A2FA 3MLZL 3VXOB 1Q0YH 4X7TA 3ZMRA 1BQLL 4PJEF 3FZUD 4M4PA 3T3PE 4XWOD 5IESL 3BW9B 4YJZL 3FO9A 5JW5A 3BAEL 3REVA 3SBWA 5BVPH 3GIZH 5GS1C 2AXFA 4POZC 1IFHH 1LE5A 1FG9C 1U91B 5FO8A 1A7BA 4PJFA 4NM8H 1JPGA 1WBYB 5HGHB 4PJ9A 4M43H 4PRNB 4I4WA 2F8VA 4Y1AA 3VXSD 2DMBA 1A6ZA 4RMSA 1ZHLB 2IADA 4ZOCA 5F71A 4ZUTA 4KJPD 3BVNA 4G7YL 3QHZL 4LCCA 1PKQE 2X7LB 4PJIE 5L8JB 1NAMH 1G9ML 2DQTL 1KJVA 3W5NA 3KPSE 2C3VB 3PL6D 4D0BB 4KGLA 5DVLA 3MRDB 3TT1L 2J8HA 4P5KB 3QRFM 1B9ZA 5CLTA 5DD1L 1UH2A 2X4QB 3MUGA 4B53A 4V1DE 1CFQB 4TSBH 2XZCL 3ZE2E 2ED7A 3P4NA 4L8BA 3P9LB 1R3LA 1MNUL 1T1XA 5F44A 1EK3A 3D39A 5E8DH 1W72L 1MIEH 1FLRL 1WJ3A 4JFPB 3OJVC 1UADC 5ILTH 1P7QA 4N1CA 4LVHB 3BOVA 3AUVA 3KPPA 1Q9OA 3WNLA 3K4ZA 3CZFA 4DGIL 5ELIA 1N6QH 4GRLB 5KANI 5DJ6A 1R3IH 3L95B 2OTWA 4TYUA 3UJJL 3VXRB 2XTJB 1FLTX 1MFBL 1FZKA 3C6LA 3TJEL 3FRPA 1FE8H 2XN9B 1NSNH 1BFOA 2VLRD 3BT2H 3VFPA 4KRPC 3VGFA 4Z77B 1M6OA 1MJUH 1U3HD 3HG1D 1PW3A 1J11A 4OLVL 3RWDA 4HUVA 4RSVA 5FYJH 2WUBH 1RJLB 5CIPB 3BP4B 3EIFA 5F7UA 4ELKA 1LP9F 3OZ9L 4LLQB 1KN2H 2MNUA 2NYYD 1OAYL 1PG7L 5ID0A 1OARH 3FOMB 2OL3A 1NFKA 2DOCA 3BH9A 1K4DA 2Z8VC 4J6RH 1U3ZA 5D5MB 3RPKA 1GGIH 5L6YL 2WBJD 4MB3A 1EEZB 4QO1A 3HE7A 1RFDL 5AZEL 1RUAH 2NX5D 3AS2A 2EDXA 1CYGA 4OZIA 5HHNA 4YFEA 4TTDD 5D9SB 3DROB 2ICEA 3EJZC 1N4XL 3K1DA 3ALPA 5GGRY 5I9QC 5JOFA 2H9GA 3MQIA 3V6BR 4APQB 4LSUL 1VGKA 3VG0L 3MXWH 1FRGH 4O02L 5EOCL 4Y5VC 4KAQH 1L7TL 3UXFA 1NMAH 4MD5B 1R3JB 3NCBB 4M7KH 2WMPA 4XPFH 1JGDB 4CUCA 2Z4QA 3UX9B 2F53A 1ZAGA 2DDQL 3KPOB 3U2SA 1AO7D 3VD3A 3UP1A 4PG2C 3VDAA 4R9HA 5FF6A 3SDCB 3B3IA 1N3NA 3C8KA 3PDOB 3GMLA 3MRPA 2AQ1A 4JR9L 1NEUA 4YXLH 2Z91A 3BZFB 5E6ID 1D9KA 1QZ1A 1YPZB 1I3GH 2DTML 4RDQF 3EO9H 3JWDC 4GQ9L 4NKIH 1L7IL 1XIWD 4JVWA 3S7GA 4G7VH 4PLJC 5ERWB 5D6CA 5FAAA 4PJ8B 3STBA 3D85A 3TA3D 4F3FB 3P77A 4WY7H 5I1DA 5IMLB 5HYJB 1JTPA 3M1BB 4M5YH 5KS9F 1ZTXL 3KPLA 5DJXB 4IMKA 4CVXB 2B0SL 1AXIB 2BNRB 4G8IA 5E6YA 1BZ7A 3Q5OA 5IHBA 5KG9B 4JDZB 4N9GA 1AGDB 3QG6A 1D5ZA 4QRTA 5TDPA 1U2CA 5MP6L 4RA0C 3N50A 1G7IB 4LCWD 4X4YA 2NR6C 3NH7H 4YHOH 2NY5L 1RMFL 4CW1A 3D69A 3D0VA 3GNML 1MJ8H 1UZ6E 3B6SB 3DX6B 5TF1H 4HCRA 3U4AA 3IU4L 2BRRH 3QWRD 1F8TH 4OGXL 4PJFE 2OJZL 2CJUH 4NC1C 4QKXB 3D0LB 3U7YH 5I76B 5I1IH 1UWGH 5FGRA 5J9PB 4Y1AE 3LS4L 5HHPA 5IWLA 2DN7A 2DQHH 4C83A 4XVJL 2XQBH 5K9QI 1UWXK 5GSVB 2QADB 2X9YA 2VITB 1RZKL 4TSCH 1BBDH 1EHLL 1LO5A 3MROA 2D4FA 2FX9L 1NDGB 5ETUA 1KJMA 1WQVT 3SN6N 1FH5H 1VGEH 4E0RB 5E2UH 1YEHH 4JPVH 5TE4H 1UXSB 3O8XA 2HKHL 2HWZH 1BBJA 4I8DA 1NCWH 3IKCA 1KELH 1FO0L 4QRSA 4LCCC 5CUSL 3WFZA 3LN5B 3RIAK 4H26A 1AIFA 3ETBF 1EZVY 1JWMB 2Q8BL 2D9QB 3MUJA 1QACA 3D39E 2YHGA 2J12B 1X5IA 4NZRH 3BP7B 1CGWA 1P9MA 1E27A 1CTOA 1E0OB 3L7EB 1G7HA 4E42B 2QSCH 4J8RA 4OCYL 3KPMA 4ALAL 3EYFA 1ZA6A 5GISL 5EU6D 1ZT1A 3PP4L 4LLAA 4KZEL 1B2WL 3LKNB 2NTFB 3QXVA 3HR5B 1YYLL 3GSQB 1CDHA 4Z7WF 5D96B 2K7PA 4FXLA 2ED9A 3UTTB 2HT2C 4JFZL 2J5LB 4YGVA 3BZ4B 4KHTL 2CK0L 1HCVA 3C6SA 1A7NL 5HPMB 2APBA 3OAYH 4LRNL 2X4SA 4ELMA 1U42A 5FYJE 5L88L 3MRGA 1U8NA 3C6LC 4XGZB 4OCWH 1D5XA 5KVGL 3TYGH 3GMOB 4LPTA 2XICA 5HHME 1UENA 1EERB 5DTFA 3ULUH 5EO1A 3NACL 4NKDA 3EOBA 2VDMH 4ZOEA 2H3NB 1T1YB 3FQTB 4OZIE 4RDQG 3U0TB 5F88B 4C56D 4YHNB 2YC1A 1MWAA 4D9QE 4XPGH 4KI1A 4KI5E 4MXQD 3FN0H 1TVHA 3BKCH 3I50H 2W38A 4I3GA 4XPBL 1CL7L 2E5EA 4BH8A 1ZVSA 4ODUA 4M9PA 4QTIL 2W07A 2O5YL 3WCYA 4PJ5D 1CXHA 1U93B 1YUHA 4LP5A 5BZWA 3VRIB 3HE7C 4Y19A 5DVKA 3MUY1 3HZKB 1YEFH 4U49A 5CBEA 1IM9A 2DD8L 1LO3L 2YN5A 4XP9L 4U0RC 4G42B 1WCBB 5LJYH 4YHML 4KI5C 2F53E 1GGCH 3JTTB 3WHXB 1A7RH 1LEGB 1S7SB 1N0LA 1FFOB 1YN6A 4XBGB 3S3PA 4UV7L 3LN4A 4YFDB 4LGPB 3GBML 3GZKA 1TCRB 5H37G 2GK0A 4Z7NF 4QY8A 5A2LH 3DGCR 1UKQA 4K55A 2B5IB 1D5IL 4OD2A 2VB5A 5HTSA 4C59B 1N6UA 4K8RH 3MRKB 3RY5A 3CVHL 1MPAL 2G5RA 3RAJH 4DVBB 1FV1A 3M8OH 2IAMD 1FL5A 2XRAH 2AK1H 1Q1JH 3O11A 3DMMD 3GSNH 1DN0B 4HIEB 2Y5TB 1OTUC 5M94B 1FL3B 1MUJA 3HI5L 3N85H 4MCZA 2J7LA 4PJCA 2ZOKB 4GAYB 4MD4B 3V4PH 5AYUL 1N0XL 3H9HA 5J12B 5GGSA 4XCYA 2NY3C 1A7OH 3BP6A 4XHJD 4Q9RH 2DQJH 4FG6D 3GHEH 4LF3A 5D93C 5TQ2L 5AUMA 1QSVA 4HS3B 4PV8B 3L3IA 2NY7H 4ODHL 5I17B 2MQ3A 4NGHL 1JMZA 4IMKC 1U92B 2GJJA 2DQFB 4BSJA 3IDJA 4PLKD 2X4NB 4WI9A 4XNMA 2ZWLT 2BVUA 4KJQD 1QNZL 1RULL 1L9MA 1FCGA 3C2AH 4B50A 1AXTL 3CXHK 4KK8D 4PRPB 1FIEA 5GS1B 5EO0B 3EFFA 2FRGP 4HKZA 4NN6B 2YA2A 3A6CH 2R2EB 5T3ZD 3BE1L 1MHHB 3LH2H 3OKDB 4HS8H 5DGRA 1RZJH 2AJYH 3OXRA 5D2NA 3WKNA 4PJDF 4MA8L 4Z5RB 3O4LD 2V2TB 5J1AB 2IPTL 3FB7B 1QHPA 3WDHA 3IXAA 2E6QA 1PFCA 5F8RC 2Y7QB 1EBPA 1T20A 5CJ8A 3I75A 1DBAH 1DR9A 5EOQL 2BZDA 1T7WA 5GGUB 2IGFH 1XFPA 1DQLH 3I6LE 4KVCL 4R96A 3FQNB 2VSDA 3OGCA 3DX9B 1A5FH 4MA7H 3O8XC 2AKRA 1K5NB 1PKQB 43CAA 3WS6A 4PJIB 2BVEA 2VAAA 2GHWB 1PDKA 4PRID 3CFCL 5DMGD 3MACL 3X14B 3IDYB 3RA7L 2I60H 2Q1EA 3B9KA 2BNQA 1XGRA 3U7WL 1AGBB 1DLFL 4L4TD 5ICZB 8FABB 3D9AH 4V1DB 4WUKL 2YD7A 4HZLA 4KKLC 3PQYD 15C8L 2ED8A 4OQTL 3O3DA 4QCIB 1QOKA 3T1WA 2ICWI 3AGVA 3VH8G 5FYLH 1UACH 2VR9A 4JZJA 3W9DB 5GIRA 5E8PB 1A02N 1BFVL 4UT6H 3C09B 5FIEA 2YOCA 4ZOBA 1IGCL 1NGXB 4Z78A 3LD8C 5CWSA 3QULB 3ECBB 4UOW0 1TFHA 2X6MA 2FO1A 2PKDA 5T3ZL 2MHAB 1BFTA 2C4FU 3C5SA 4G3YH 4I3SL 4NHUB 4TVSa 5F7MC 4P99A 5DRWA 4UQ2A 4OZGB 5C86A 1QEWA 4LNVA 3U83A 1QBBA 4UUJB 5HJ3A 4YDJA 5KSAB 2W1NA 4M5ZH 1NC2A 3SDAD 3CFJB 4GRMA 3SE9L 3T3MF 5DYOA 2XKSA 1P4LA 3D2UB 4Y2OA 5EA0H 4Y19E 5GZOC 1ZVYA 2BVQB 1ZLWH 1UA6H 5D7LA 1DUZA 2D31B 4NNYA 5C2BH 4FZ8L 1MCOH 3QWQB 1XGUA 1EMTH 4CDGC 3TBSA 3O45B 3DLQR 5I16B 5I8CA 5DJZA 1EEQA 4UT7H 5JIPA 2F58H 3O3AA 3P4LA 5FYKD 2JELH 4YR6A 2EH8H 4AH2A 2O5XH 4JFDD 1ORSB 3ZT5A 1VEMA 2GT9B 2VC2H 5K9KB 4GKZB 3VWJD 4P49A 1OP3K 1FSKB 2J8UB 2ADIB 1E4XI 1OB1B 1GC1C 2FHBA 2BERA 4D94A 1SVZA 3WFHA 2DAVA 3QIWA 1NMCC 5D1ZA 1F90H 5F6IB 3UAJD 3OKLA 3FB5A 4H88H 4ZUWA 4ETQA 1RJYB 1YJDH 4R0LB 5IB4B 5HYQA 3MLTB 2OJEA 2APTA 4MDJA 2GITA 5AD0A 5CAYB 4PP2A 3OAZK 2O61B 2WIMA 4LMQE 4PJCE 1LEKA 4ETYA 4I3RL 5F89A 3C60C 2CKBL 3QIUA 4HK0A 3JBG7 1NUNB 3RGVC 4XXDB 1R5IB 1OTTD 2D03L 5HYFA 5EIIB 1SHMA 2R1XB 3VW3H 3LSOA 5DD0H 5B8CA 3WV0A 5KZCD 2JJTA 2O5ZL 3OR6B 5ESVB 4M7ZC 1MIMH 4CJ0A 4QXUL 4MLIA 2VLLA 4G43A 4MCYB 5GRJH 5BMFH 5GS0C 4OJFH 3QBTB 4JFHE 4K94L 4N9OB 2VQTA 1J1PL 1TNMA 4NOFA 5IB3A 1UQSB 1Z5LB 1AGCA 1YMMA 1OM3L 3ES6B 2KZ1B 1HHGA 2BVYA 3LQMA 5HVHB 5AYQA 1WFUA 2EDNA 4ZYKA 5T1DL 5C09A 1I9IL 5KTEH 4GUPA 4JO3L 4EI5B 3QXAB 2DBLH 2E7CA 1CICD 4WHCA 4YHKL 3X3FL 1DQTA 4JPKL 3IDUA 3EZJB 4PJHA 3CSYA 5D1QD 4RAUA 1U95A 2H2SC 2PTUA 5D2NE 3BXNB 3AU1B 5FV2A 2AABH 2ZOLA 4X7TB 4QXTA 3G5VA 4Z76A 5JW5B 3REVB 5GRWA 3BEWA 3ZYJA 5JXAL 3QEHB 5CP7A 5FYKL 1VFBA 4DKAA 1G7MA 3I9GH 2AXFB 3LQAH 1NCAH 3QUXC 5F9WC 3C5JA 1LE5B 1WIUA 2EIZA 1I8KA 3VFVB 5D2NC 2I9TA 2ZSWA 1P69B 1AC0A 2ERJC 4LSRL 4PJ9B 3V6ZA 1W8NA 2BVOA 4OFKA 2IADB 3FB8A 3BVNB 3T8XA 1F13A 4LCCB 5SWZE 2DKUA 3NCJL 5F1OB 4EEEA 4XWGH 1KJVB 3MCLL 4PUBL 2VJXA 2P8MA 3QB7C 2AJSH 2EXWC 5E95B 5FUZL 3GBLA 1NAMB 1BZ9A 2ZP0T 2BNQE 4F9PA 2IMNA 3MUGB 3W9EA 3S88L 4U6HB 3QZWA 3UJIH 1HHIA 3P4NB 3VXQA 3AREB 1T04B 4EXKA 3ALXA 5L8LB 2MPAL 3WS6C 2ITCB 1PG7X 1T1XB 2WBKA 3H9SB 3GRWH 4DUXA 3MLYH 2YD8A 5FYLE 2C9AA 3V6OA 1WWBX 5I74B 5J8OA 3MJ6A 2XG5A 1JCKA 4FQQA 2HYMA 3GRWA 5BZDA 4ZO7A 3CZFB 3NA9H 4P3DB 5DJ0A 1VADA 5DVNA 5HYSA 5ESAA 4WTWA 5IG7B 4WTZG 1T7VA 1DFBL 4JZJC 2OLDA 4KROC 3C6LB 5J13C 2RFXB 3ZT7A 1BFOB 2VISA 4UOJA 3VFPB 1CK0L 1M6OB 1MH5A 3VJ6B 2R0ZH 4F7CA 3VXNA 4RRPA 3EDFA 2WINA 2XV6B 4HXBL 3RWDB 4HUVB 1IBGH 2VYRE 3V5DA 1I85A 3I84A 2Y36L 4ZUSA 5TE7H 3WO3B 3F62A 1BAFL 3VGAC 4H0HB 4GAJL 1C12A 3KHQA 4HIHA 4X8JA 4Q7DA 5ID0B 3GSVA 1GAFH 3BH9B 5EIVA 1K4DB 5D7LE 1IEBA 4JFYB 5HVGB 3R0MA 1D6EA 4RNRA 1ACYH 4YBQC 43C9A 3CFBA 3HE7B 2D7TH 4CADA 2N56A 4PJGA 1NUDA 4XP6H 1S78C 2OI9C 4OZIB 4RCAA 4WO4C 4Y16B 4Z95H 5HHNB 3SEPA 2HMID 4LSVH 3VGDA 4FFYL 4U0RB 4WGVB 5D5MF 3WLBB 2ICEB 3QUMA 1Q72L 5JOFB 3PWUA 2H9GB 3DX7A 1CFVH 1VGKB 1G7LB 4Q58C 3TNNA 5HHOD 2GJ6D 4S0TD 4KJWD 3NVQA 5T3XD 3UYOD 2HTKC 3STZA 2X41A 4IDJL 1PZUB 3VXUA 5D2LA 1HOCB 2Z4QB 5TE6L 1A22B 1WF5A 2F53B 3U2SB 4IMLA 5B39B 2B4CL 3BAEH 1Y18A 5FF6B 1N3NB 2HA1A 3G5YB 1EIBA 3GMLB 3MRPB 1ZLUK 1G1CA 2AP2A 1AY1L 2Z91B 5D1ZC 1D9KB 3D48R 1MI5A 3DUSB 2UVEA 5GRXG 1V7NL 5D6CB 4G7YH 3D85B 1K9TA 3QHZH 5FYJU 3P77B 1G9MH 2DQTH 3NFNA 4ZFOA 1KIUA 4LLVA 5I1DB 1YPZF 2YZ8A 2RCSH 2WZPD 4Y8DC 1YMME 2CQVA 4K3EH 3TT1H 5HPOA 3DBXA 4TUJA 1XF1A 3DRTA 3KPLB 5DD1H 4NT6A 2IC2A 4G8IB 4M8QA 5LCVL 5F7YC 3ARFB 1FNEA 3T65A 4OZHA 5C09E 3MJ9L 3UYRL 1KLGA 1AGFA 4N9GB 1T5XB 3RKDC 5F1KC 2ATPB 4PJHE 5E00A 2C3XA 4QRTB 3UTZA 1MNUH 4M6NL 2DRUA 4GT7A 4PV9A 1W72H 4X4YB 3BZEB 4Y5YA 1FLRH 4KMQA 2YWYA 4HG4J 3FT3A 3D69B 3D0VB 1W72A 4P2OA 3CH1A 4NQSA 5DQJA 3EYQD 4IOFC 3FN3A 5FCUL 3UJJH 5DZOA 3HI1A 1MFBH 3TJEH 1NCNA 1F3JA 2ADFH 5EPMB 2PW2A 2E7HA 4OLVH 4R7NA 4IRJD 4NUGL 5F7KC 4C83B 2OZ4L 3IFPA 3REWA 4W68A 3IRPX 5CD5C 1LO5B 1IC4L 1XGPA 3NOIA 4H0GA 1FDLH 2MTPA 3OZ9H 3MROB 4M6AA 1KACB 3RHWF 1NGPH 4OQ1A 4EOWL 1PVHA 1OAYH 1KJMB 1ZA3A 1PG7H 1QBAA 3NCCB 5IK3A 3TIDB 4QGYA 2VLMD 2RHEA 5FXCH 4L8SA 3O8XB 4BK5A 1JRHI 5CJBA 4FFVC 3V0WL 5IUSA 1BBJB 4I0KA 3IKCB 5L6YH 4QHNA 4HUWA 4QRSB 3FT2A 3JUZA 1RFDH 3LS5L 4L1HA 5AZEH 1WBXA 1D5BA 4M7JL 1GGYA 3V6OE 4NZDA 4JREB 3VXSA 2X42A 2BY3A 4OFVA 5E8NA 3P3YA 4N5ED 3DVNA 5TF0A 4RAVA 1G7HB 1N4XH 4F9PC 4PYGA 3BQUD 3RL1A 3VFUA 4RFEA 4LSUH 4J4PC 1ZA6B 1L0XA 2UUDH 1ZT1B 3PL6A 4JY5L 3ESVF 4MMXC 2IMMA 1UJ3A 3WNOA 4D8PB 5I66A 4O02H 5EOCH 1SJEA 2X89D 1LMKA 4IEFB 1SY6L 3RVTD 4LIQL 3V6OC 1L0QA 1X4YA 5FDWA 1FC1A 5JIIA 4HK3N 2G5BA 3DXAB 2YXMA 5DO2C 1YEJL 4KXZH 3IAPA 2R0WL 1T4KA 4BSVA 4CVZA 3EO0A 3HN3A 3VFWA 1J0IA 3FT4A 4HV8A 3OKYA 5MERA 3CU1A 3NTCL 4OKDA 3V52L 5ACZA 3VRJA 1D5XB 4W6WB 3F5WA 1IAMA 3BKJH 2DTMH 1A6PA 3WFCL 5DTFB 2BOBA 4GQ9H 1L7IH 4NKDB 4OBRA 1TQCB 3ULVD 3EOBB 2D0HA 4WFHE 3RVWC 4PJGE 3O9WD 3S3SA 4Z0XA 5CFHA 2VLRA 3CU7A 2YC1B 3O2DL 1U3HA 2A74B 1QSED 3RWIA 3OMZA 4ZNEA 1X5AA 5C0BD 1TVHB 1ZTXH 1U3JA 3O2VL 1BGXL 1ZVSB 1AE6L 1VEOA 4G9FD 1A4KB 3VFMB 5D7JB 3HFML 4M93B 4ZTOL 4FQ2L 2BP3A 1QUNA 5MP6H 3VXUE 5B3NA 3ZYOA 3S4SG 5D2LE 4A2MA 2ZSVA 1C08A 1MSPA 4KKBD 2NY5H 3AB0C 1RMFH 2K3TA 3FQRA 3C5ZA 3GNMH 3VWKD 5MEQA 2NX5A 1JNHA 3CDGA 5AWNL 1YN6B 1KG0B 3PWPD 4NNPL 5CGYD 3IU4H 1MRFL 2GK0B 4OGXH 4QY8B 3TBYA 1IGJA 2OJZH 2YPLD 3WFBL 4TNVK 4OD2B 2Y06L 1MI5E 1WZKA 3IETA 5C6PB 3QCVL 3LS4H 5L2JA 4PJ7A 3K74B 1GOGA 4YGAB 1Z6JT 3RFZC 1MFEL 4XVJH 5B3JE 3O11B 4KDTA 5IQ9A 1EHLH 3V5HB 1RZKH 2GY5A 4YZFF 4XVUD 4K7FB 2PYED 1MUJB 4LGRB 4S0SD 1FVCA 3GSNB 4PJCB 1AO7A 5DR5L 1YC8A 3CX5K 2HKHH 2I5YL 4OUUA 2DJ4A 5GGSB 4OZHE 4XVTL 3BP6B 1FO0H 5E6IA 5CHNA 5CUSH 4LF3B 2JJSA 5AUMB 3UO1L 3ULVL 3L3IB 5BOZG 1XIWA 2Z0BA 1HQ4A 3C9NA 3GGWB 4XNZB 3TLRA 3ET9F 3ZHDA 1FG2B 3MGTA 5DK0A 3V95A 2ARJA 2EDFA 3IDJB 4OCYH 4XNMB 1S9YA 3I02A 4ALAH 3BPNC 2CLZA 3PP4H 4KZEH 4NCDA 1B2WH 3HNVL 5DDHA 2VZ1A 1YYLH 1JPFA 4Y5YC 3EFFB 4HKZB 4R2GB 4JFZH 4JFED 3O6LL 5F9WB 2DQEL 4KHTH 2CK0H 2FEEL 4OSUL 1MCWW 1A7NH 2CO7B 4LRNH 4NDMA 2W9DL 3OXRB 2EC9T 1CQKA 4YBLC 5D2NB 4PBVC 4LCWA 4MA3B 5L88H 4O51A 2KUTA 4XVSL 3CXDL 3QHTC 1U8IA 4PRHD 4BFIA 1RI8A 5FGSA 5KVGH 4IHOA 3SE4C 1XGTA 3IXAB 1EXUA 2CUIA 1JYXA 1RIHL 3FB6A 1T20B 5TFSL 1SYVB 1WFOA 3QWRA 3NACH 2NY1B 4KUCF 4POUB 3RIFF 2QQNL 1L0YA 1DVFD 4U7MA 4R96B 2FEDD 1HNGA 5ALBL 4AEEA 3VXSE 5I8KL 3FZUC 4XWOC 1D7FA 2ZCHL 2V2WB 2GUOA 4V2BA 2AKRB 1EEUA 43CAB 4XPBH 5SWZB 1CL7H 1MOEA 4QTIH 3TT3L 3PNWA 1EAPA 2O5YH 2VAAB 1D3CA 4Y88A 3MX0A 4I48A 1WIOA 3VFRA 2VN7A 2I27N 2AJVL 3B9KB 2HT3D 2BNQB 1OAUL 1XGRB 3BKML 4LLYA 4LKXA 1LO3H 3RTQB 4X98A 4XP9H 4PJIF 3O3DB 4KJPC 5JOPD 1DEEA 4KRMB 4JZJB 4KROB 3SGJA 3RJDA 1VEPA 5GIRB 1QD0A 5J13B 3SKJL 4JEGB 3PL6C 1CIUA 4GBXC 4HH8A 4UV7H 1ZSDA 4W70A 2DLTA 1FZMA 1X9QA 3GBMH 1RAMA 4Z78B 1OAZH 3MRRA 1D5IH 4PREB 1AKJD 3NMEA 5B4MD 5CWSB 1FNGA 4PJAA 2NXZC 4HX1A 2D7QA 1HH9A 1IAOA 5EU6A 3CVHH 1MPAH 4QRPD 1X5ZA 1I1YB 3C5SB 1CXEA 3CVHA 2VLRE 1HH6A 1V3LA 4UQ2B 3TVMD 4YDVA 3HG1E 4MVBD 1AGEB 3HI5H 4ZNEE 2HFGL 4PY8I 1QEWB 3GMNA 4YDJB 4J12A 1NC2B 1N0XH 4TRPL 2OI9B 4GRMB 4JCLA 3ZKMD 1FZOA 1BVKB 4OZGF 3P9MA 5D7LB 4NNYB 5F8QC 1XGUB 1Q9KA 3T08A 3NABL 3MGOA 1KLUA 4ODHH 2YD9A 1NQBA 5KOMC 2VABA 4NGHH 2BOCB 5MI0C 5I8CB 5DJZB 2NX5E 4WHTB 5DEZA 4C56A 3OJDA 2NYYC 3DSFL 2J1KA 1FZJA 1P6AB 1QNZH 4YR6B 4FQ1L 1NBVL 3KNBA 4AH2B 4M00A 1AXTH 4U1KA 2XWBA 4HWNA 5LVEA 3D1MC 2PXYD 4PJ5A 4NP4L 3BE1H 1XCTA 4KK6D 4PJ7E 3AS1A 1BOYA 3C5ZC 3QIWB 2R1YA 5D1ZB 1O7VA 1WBZA 1KULA 1WWCA 2C5DC 2OJEB 4K9EL 2GITB 1FVDB 4PP2B 1AO7E 3OX8B 3O4OB 2J8UF 4YFLI 2IPTH 5ACMA 3U9PL 5E2TL 1I9EA 1YEKL 3G5ZA 1N59A 4FQJL 5F89B 5DMYA 1G84A 1T22A 1OGAD 3P9WB 3QIUB 4HK0B 5EOQH 3DRQB 5GRYA 3ARYA 5GS3A 4LL9A 3QH3A 4KDTC 3DHMA 3RZWA 3LSOB 1MVUB 5B8CB 4EBQL 1JL8A 4HEME 4JRYD 5HHQA 1IZKA 1OP9A 4KC3B 5M95B 5GRVK 2IAMA 1KIRA 1ZGLM 4DKFL 4JKPL 2AJUL 3TO2A 4G43B 3DMMA 1BREA 4HG4K 5IB3B 1AGCB 5E6IC 3HNSL 3CFCH 1SM3H 3MACH 1J9CT 4Y5XA 3IF1A 1BX2A 2QQKH 2JJSC 1JTOA 1J0HA 3U7WH 1DLFH 2I25N 4WUKH 1XIWC 4NRYB 4XZUA 5C09B 15C8H 4ODXA 2WWKO 4GUPB 4HF5L 4EDXA 1QFPA 4LVNB 3QQ9D 4PJHB 1XGYL 3CSYB 4XNYL 4RAUB 4K7PL 3BGMA 3FL7A 4LHUG 4LCWE 4MJ5A 2VDNL 2VQUA 1HXYA 2ZOLB 2X4PA 3TFKD 4KRNA 4QXTB 1IGCH 2G9HA 4GW4B 1Z2KA 5EU4A 1VFBB 3QUZD 2YKLL 3BPOC 2HTLD 1G7MB 3I6KA 2DL9A 3MXVL 2R8SL 2EIZB 5J57B 1TDQA 1VENA 2RQ8A 3VD5A 5E5MB 5T3ZH 2I9TB 4I3SH 1FBIL 2ZSWB 4BUGA 3V6ZB 1S3KL 4HMEA 1UZ6F 1JIBA 3BDYL 4IM8A 3MRQA 2WWKT 3FB8B 4PS4L 1Y6NR 1Q9LB 4BUHA 1OLZA 3SE9H 3GSRA 3O4LA 4OF5A 4XP1L 2COQA 2BNUA 3HE6C 2GI7A 4FZ8H 1EJOL 4HULB 3W9EB 2FSEA 3V79C 2PO6C 1HHIB 2NY4B 2IH3A 4JY4A 3U1SL 5KSUA 1NL0L 4F7EA 4GKNA 4J3WA 4U1LA 4JQIL 3MGAA 2ZCKH 1NLBL 4W4OA 4YLQT 4FN0A 1QO3A 3T0ED 4MWFA 1QRKA 3MCG1 4TUOA 2EEAA 4HWBL 4FQQB 4XCEB 5DT1L 1LQSR 5DJ0B 1PD6A 5HI3C 1VADB 5ESQA 4WI4A 4PJAE 3BESR 5HYSB 5ESAB 5EU6E 5C3TA 2HJKA 4PRIA 3MLSL 1NCCL 3DI2B 5EU7E 3SGJC 4MJ4A 1UWXH 5CJQH 5JW3L 5IMOA 4LHQB 3WS3A 1RHFA 1ZT4A 4L4TA 2VISB 4P4RA 4F7CB 4QRUA 3VXNB 3PQYA 1EX0A 3O6ML 3WN5C 1AD9A 3DETD 4ZUSB 1F45A 4DN4L 3PP3K 2Z8SA 4I3RH 3MFFA 3IDXL 2A2QT 2CKBH 3VG9B 1IQDA 4I9WD 1KCSL 5EU7C 5ECJE 2VERN 1J86A 3GSVB 3K2UH 3JWNC 2D03H 1IEBB 3LEVL 4NIKB 4QYOA 2UV3A 1DUYB 5IGXL 1D6EB 4RNRB 43C9B 3CFBB 4MAYB 2O5ZH 4H25B 5DSCB 4XPHL 3QIBD 3QAZB 3HZYA 4OZFH 1CDCA 4QXUH 4CADB 4PJGB 5IEKA 3SCMD 2LVCA 4K94H 5FGBA 1J1PH 4C56E 4OZFA 4CKVX 1PX4A 4NNXA 4ENED 1JK8A 4Y2DD 4EXPX 2VKWA 1FNSL 5JOEA 4K71C 3S5LA 3AY4A 3SDAA 4MAUL 3TNNB 1MCRA 4PJ5E 5T1DH 4OCMC 1I9IH 4OZIF 4JO3H 1A2YA 5B38B 4YHIA 3GSWA 4YHKH 3X3FH 1JHKL 2E8YA 4JPKH 3VCLA 3L3JA 2ZG3A 3VXUB 3KWWA 3VRLE 2W9LA 2F5AL 3QO1A 5IB2A 2OMNA 1H0DB 4MB4A 1Y18B 2FB4L 4I2XA 5M7QA 3EDDA 5FGCE 5JXAH 5FYKH 4N8CL 5C07B 2HFFB 1EDQA 1J8HB 1YEEL 4QWWC 5DJDA 5CMAA 4BQ8A 2WNGA 4LNRA 2OK0L 3FHQA 1X7QA 1Z9MA 5D6DC 4JFDA 1ADQL 1A9BA 1MI5B 5I18L 4LSRH 5K59F 5I30L 1MFAL 3VWJA 3WO4B 5DF0A 4ZS7L 2NZ9D 2ENSA 1DSFL 3NCJH 5DD6B 1KTLB 2BXZA 1N8ZA 3O6FD 4DGYL 3NFNB 2X4UB 3MCLH 4PUBH 1KCKA 5FUZH 3DBXB 3GKWH 5CEZD 4NT6B 3KYKL 3RX7A 1EVUA 3J8F7 4YDKL 3U36B 3S88H 3GO1L 4M62L 1FNEB 3T65B 2E6JA 5A2JH 1KLGB 3BPNB 1AGFB 1RZIA 4HUKB 2LU7A 3UTZB 4PV9B 4Y5YB 2VE6A 4RQQA 2CSPA 2BCKA 3VXMA 2IQ9L 3FT3B 2YD3A 4YC2C 1GL4B 1W72B 4P2OB 2FHCA 3CH1B 3P73A 4YBLB 5DQJB 3KYNB 5A3IC 5LQBL 2EZ0D 4FG6C 1DFBH 4KMLB 5TPWL 2JE8A 3HI1B 5IJVA 3ZZ1A 4Z8FL 3BUYA 1OGTA 4L3EB 1F3JB 3VD9A 2PW2B 2R29H 1CK0H 4PLNC 5T3ZE 3MV11 4DZBA 3V6FA 5B22A 2APWA 4R7NB 4HXBH 2J6EL 1CICA 2Y36H 1P53A 5D1QA 3REWB 4EIGB 1BAFH 4QGTA 4GAJH 1WZMA 1XGPB 2JIXD 3WSQL 5IEHA 2H1PL 1FN4A 4MQXD 3EYOB 3O4LE 5E4IA 1ZA3B 2NY6D 2GFBB 4AJ0A 1C7TA 3GI8L 4AEIL 4L8SB 1ACZA 4LFHD 3UPRB 5CJ5A 4N8PA 4QHNB 1WT5C 1KEGH 2DWDA 3FT2B 2VDRL 1WBXB 1D5BB 1PY4A 4JAMB 2WANA 1JI2A 2QR0A 4FFYH 5DEFA 1A1OA 3DVNB 4RAVB 2Y4SA 1Q72H 5CKAA 4KRPD 3RL1B 3VFUB 4RFEB 4M1DL 3PL6B 3IKKA 1U8MA 4KJYA 4BZYA 4PRIE 1IGYA 2AJZA 1UJ3B 1T1ZA 4LEOA 1CFTA 5EU3A 4IDJH 4W4OC 4L4TE 5E99L 3PQYE 3OKKA 5TE6H 2B4CH 1T4KB 4BSVB 2BJML 1UKTA 4G6FD 4GG6A 1A9EA 1KYOK 3VFWB 2R1WA 3HLAA 1Q94A 4JHZA 4HV8B 4JZNA 4QF1B 1VPOL 1ZLSL 5I0ZA 2FO4A 5MERB 1AY1H 1ERNA 5ACZB 3FONA 4P5MA 2IBZX 5IBUG 3F5WB 4NHCL 4BQ6A 1RHHA 3Q6GL 3PHQA 1MREL 3CZJA 4PTTA 1ZWIB 4GMTL 4ZDHA 4M6OL 1CTNA 4F7TA 2HLFC 3ELAT 1A8JH 4Z0XB 2VLRB 4GXUN 4WI2A 1C16B 1X5GA 1S9XA 3RWCA 1U3HB 1QLEL 3HG1B 4PB9L 3X13A 2K1MA 1F6FB 3VH8A 1R0AH 1ZVHA 2BY1A 4HGMA 5LCVH 2VZUA 1T1WA 3ULUF 4TNWK 3MJ9H 4WI6A 3UYRH 3ARBC 2HH0L 1MCQA 4JQXC 3LKPA 1TTGA 2LU4A 5F96L 4H20L 5FGBC 4M6NH 4J3TA 3MA9L 3EYUL 4NBZB 5DI8A 1C08B 2WBJB 5F7DA 3S3JA 3FQRB 3ZYZA 4I2XE 5E24E 3AY4C 3SDAC 4QXWA 2NX5B 1JNHB 3RVXD 3IU3A 3O41B 5FCUH 1Z9OA 5FYKE 3S37L 3TBYB 1IGJB 1QA9B 4JFDE 3TPUA 1UWEH 3IETB 4L1DA 4CU7A 1PZ5A 3KLAA 5HHOA 2GJ6A 2GTZA 4PJ7B 5T1MA 3MV8D 4NUGH 2OZ4H 5KW9L 4HHAA 1V7ML 1QR4A 5IQ9B 4WDIA 5SWSD 2Z8WC 4Y4HB 1IC4H 3ZTNL 3W5MA 4EOWH 1JF6A 3EZ8A 4N0UA 1AO7B 3BD5A 3SDYL 5HDLA 1MLCA 4UNTA 2NR6D 2C3HA 3VWJC 3V0WH 1OHQA 2EICA 1R3KA 4WWKB 3HS0A 3NZHL 4QOKD 5CHNB 3LS5H 3UAJC 4YAQA 4PJCF 1FO0B 1JN6A 1S9WA 4M7JH 4TN9A 4MQSB 4U6XA 4CU8A 4OCRL 1HQ4B 5HDQL 4FQXD 2HT4C 2OCFD 3HC0A 4X9BA 3K8MA 3CMOL 4XCFL 4DVRL 5BRZD 3TA3B 3Q1SL 5DK0B 2ARJB 3JWOH 5I1AB 1YYML 1S9YB 3I02B 4DJMA 4PGDA 4HMCA 4JY5H 1IC7H 3A0OA 1OTTC 4UBDC 5DDHB 3GMRB 1T80A 4LIQH 4OFYD 3BX7C 2GCYA 4JJ5A 1A1NA 2WBWB 1K4CB 1P2CA 1YEJH 4AZ8A 3THML 3F7VB 4NDMB 4NQDD 4PJBA 2SEBA 3TZVB 4LCWB 2C26A 4O51B 4CMHC 5I8OH 3WIIL 3JWDL 2F54B 1U8IB 4W4NA 3NTCH 3V52H 1DBKL 4BFIB 3TN0C 4KTDL 3UBXB 1XGTB 1EXUB 3WFCH 3SGDI 3VFSA 3CNKA 2GK2A 1CICC 1FFNA 1KNOA 4X5LA 1IGTA 4WW1A 1KXQE 4Z9KB 2FGWL 4NC2B 3O2DH 4HWUA 1AXSB 4RMQA 4IRJA 3O2VH 1X4XA 2N1KA 1AE6H 4X6BB 3ZO0A 1EAPB 2JCCA 5KOVC 2IPKA 3VFRB 1P7KA 1SEBA 1CDBA 4PFEA 1FJ1A 4JPWL 3HFMH 4ZTOH 3ZSSA 4FQ2H 2ZJSL 4JY6A 4LKXB 3QJHA 4LLYB 5KJRH 1CD8A 4X98B 3Q3GB 2W59A 1DEEB 2R2BB 3FAXA 1OWRM 4GG6E 1XR8A 2QEJA 1F4XL 2E27L 5AWNH 5GGSY 3HC3L 1ZSDB 4NNPH 1ZLVH 1HSBA 1FZMB 1MRFH 4ODWA 1D6VL 1NLDL 4JZOA 4EN3D 3ARGB 4FTVD 3GK8L 2ICES 4U1GC 4JG1H 4CN6A 2H45A 4DN3L 4K2UL 3WFBH 4K3DL 3MRRB 4M7LT 1FNGB 2H8PB 3BKYL 3BQUA 3K3QA 4FOMA 4PJAB 1I8MA 2Y5EA 1CI5A 1HH9B 1IAOB 5EU6B 1UVQA 3QCVH 1MLBB 1Y0LA 1BVLA 4N0YL 4U05A 4YPJA 3QQ3A 3T0BA 2X89A 1MFEH 4JDVB 3U4EA 2G60L 3CVHB 5C2UB 4YDVB 4S1DD 2XFXB 5IVNA 5I8EB 3MR9A 1GH7A 3R4DA 1TQBC 3GMNB 4HZAA 5DR5H 1EBAA 3IVKA 1IMHC 2XQYK 4HJJL 2I5YH 3D6GA 4LBEA 3LB6C 2EDTA 4XVTH 1NCDL 1OF2A 1IEAA 2M26A 1K2DA 2AAVA 1ROWA 4ZAKC 4LLUB 2OTUA 3UO1H 3ULVH 2XQYG 5TDOA 1Q9KB 4S11A 3ISWA 3MGOB 1KLUB 4F15C 1NBYB 4D0CA 4IJ3C 1LO2L 3FHAA 2VABB 1I8IB 1OTSC 5A43C 2Q3AA 5GGQL 1JVKA 3O9WA 4U6YA 5T1KB 4C56B 3IXTA 1FZJB 1QSEA 3OR7A 3JXAA 5D7SL 3HNVH 5C0BA 3KNBB 4RMVA 1MIEL 4U1KB 1XZ0A 2XOTA 2VWEE 1OTUD 2A6JA 4Z7OE 2RIKA 1AHWB 5HHOE 4PJ5B 2GJ6E 5C9KA 4G9FA 1XCTB 3O6LH 2DQEH 5T3XE 4OSUH 3R1GH 2I9LA 1E6JL 2R1YB 2HVKA 4LSSL 2W9DH 1I7RA 2HMIC 4OM1L 2NY3D 4OGAC 4U6VL 1UC6A 3T2NL 1JGUH 1IM3A 1KN4L 1IARB 3CXDH 4XVSH 3ME0A 4N0UE 5IW6A 5FV1L 2AK4D 1FFPA 3G6JA 3G5ZB 1N59B 3L3DA 4ZPVA 5FGCB 3VWKA 2YD4A 1RIHH 1T22B 5FYJL 3PWPA 3H6JA 5TFSH 9CGTA 2CDEA 4K7PX 2ZUTA 3EGSA 3DO7A 2OL3L 3QH3B 2QQNH 2YPLA 1ZEAL 5I2IB 4BFGA 5SX4I 2LABA 1V05A 5I8KH 3IS0X 2ZCHH 2IAMB 1KIRB 4QHUA 2E6PA 4Y8AA 3WEXA 5GGTA 3L7FA 3S96B 3DMMB 2P45B 2EKSA 3TT3H 2PYEA 3L3OB 2YPKA 3QYCA 4PD4J 2R4RL 1VDGA 1G7QA 4Y5XB 2AJVH 2W0FA 1OAUH 1J88A 3WDIA 3BKMH 3QNZB 4XZUB 4ODXB 4EDXB 4LIQE 2F19L 1WFTA 3LRSA 4PJBE 3SKJH 2P5EB 1ZLUH 4MJ5B 3BEVB 1HXYB 4HKBA 3BIBX 1YEDB 2LTQC 3QEQD 4X6CB 3JWOC 3UROR 5C6TL 3T0DA 1CXKA 1G9NC 1SJHB 4ZUUB 4YX2L 3DVGA 4S1QL 5EU4B 3T1FA 4BH7A 4PJHF 3I6KB 4RGND 2KQNA 1OQOA 2XNAA 4WFGD 2V5RA 3LZFL 4WV1C 4YXLL 2GSIB 2A6KB 1IL1A 3SO5A 4KK5C 4JFEA 3MRQB 2HFGH 5EC1A 2FYYA 2F5BL 4W6XB 4NKIL 4NO2B 4TRPH 2DI9A 3HMXL 3EYQC 4GO6B 2JCCE 3GBNL 2NY2B 3DV6A 3O4LB 1BVZA 2AW2A 4WY7L 4PRHA 1KCLA 2VLME 3KJ4C 4XMKL 1MCWM 4GSDL 2FSEB 4WEBL 3NABH 4XHQA 5DMIL 1N6VA 2IH3B 4JY4B 4Q0XL 1D5MA 1Z9LA 5KSUB 4U1JB 1DVFA 4GKNB 3MRBB 2AGJL 4NQUA 1QO3B 3DSFH 1KFAL 2AEIT 4RIRA 4TUOB 1EHNA 4FQ1H 1NBVH 1KIQA 2KDGA 4U3CA 3DARA 5ESQB 5DWUL 4UU9A 2FJHA 4HCRL 1HHKA 3VGGA 5I1HH 3HUJA 1G7JA 1FNHA 2ICWA 2HJKB 3CFIC 1X4ZA 4NP4H 4NQCD 4PRIB 3V5KB 5INDB 1PYWA 1MCIA 2ZPKH 3VXPA 2P7TA 3P0GB 1NFDB 1ZT4B 4L4TB 4K9EH 3LCYA 3PQYB 5GZOD 5E70A 2CRIA 1RZ8B 3V4UL 4XP4L 1U3YA 3U9PH 5E2TH 2OYPA 4FQJH 4UQ3B 3MFFB 4G80B 4XBPA 4O2FA 2NNAB 3FN9A 3SDDD 2D7OA 2CKBB 5H2BA 1AKJA 4QYOB 4EBQH 1YEHL 3QWOA 3I6GB 4QRPA 2VRAA 5E94A 3ULVE 3MRFA 5DVOA 4DKFH 4JKPH 2AJUH 4WUUD 4ACPA 5HSFA 4S1SH 5IEKB 4GXUM 1U8OA 3GSOA 5BW7A 4OZFB 3MLPA 1J0KA 1QSEE 4TSAL 3HNSH 1QBLL 5C0BE 5IVOA 1P6FA 5IM7A 3GMPA 3ARXA 2R56L 3ZLQC 2Y07L 3RPIA 4PJGF 3V7AE 3MBED 4G9FE 1YZZA 4HF5H 1A2YB 3JUYA 1TJGL 4YHIB 3O9WC 3NBNA 3C60D 1XGYH 4XNYH 2Z93A 4OLXL 3VCLB 4K7PH 3W81A 4JJHA 3RDTD 5C0EA 2J2ZA 3RGVD 5EIQA 3QO1B 5IB2B 5GSRA 4M1CD 1H5BB 3G6JE 4OLYL 4KZDL 2YKLH 5I6XC 5DJDB 3RBGA 5CMAB 5CSGA 3PWPE 1KUMA 1NBZA 3MXVH 2R8SH 2BHYA 4LNRB 5D70L 5DURB 3MYJB 1RU9L 1X7QB 3ZDYE 5LXGL 3KAAA 2YPLE 5F7EL 1A9BB 1FBIH 4NCC2 2A0LD 1S3KH 1A47A 2PXYA 1BP3B 2OQJA 2FBOJ 3VWKC 4PS4H 4X4ZA 3QHFL 2ATKA 3TO4B 4F80A 5CGYC 2PYEE 3OL2A 1MWAL 3BRGC 5IT2L 3S4SA 2Q76B 2FH6A 4EZMA 3MJ8B 5A1AA 5FFLA 4XP1H 4NJ9L 3I2CL 1K8IA 4KTEL 2FCBA 4NKMB 1EJOH 1A6TA 2WQRA 4L9DA 5B3JF 1OGAA 1KT2A 1PEWA 4PY7A 3QA3A 3F8UB 4MJID 3U1SH 5C0JA 1RZIB 1NL0H 4AG4L 2LU3A 3RWFB 3ARUA 3QUXD 5KZCB 1NLBH 2VE6B 1A21A 1CT8B 4JRYA 4N8VA 4RQQB 2BCKB 5DRNA 5DT1H 1WWAX 4HWBH 2HN7A 4LDEB 1GC1L 4PRAA 1SJVA 5MEPB 1FNFA 4W6YB 3NPZB 1LO4L 5GZND 3CDYA 1UYWH 4WI7A 3W2DL 2YMXL 4YHPB 3MLSH 4L8CA 3QZWG 5IJVB 5JW3H 3BUYB 1OGTB 4JFOB 4R8WL 4OZ4A 2VXVL 3SE3A 4EDWL 4UILL 4DZBB 4JFEE 3BUTA 3O6MH 3V6FB 4XCNA 2VIRA 1CICB 2P1YA 4K8RL 3EBAA 2ID5A 5D1QB 4DN4H 3V0VA 3IDXH 5FYKU 5IEHB 4NFCA 1KCSH 4D9LL 4WRLA 1OAQL 1Q9WA 4YO0B 4PRHE 1NC4D 3N1GC 3LEVH 4UIMA 3QUZA 5GS0L 4HEPG 5E03A 4LOUD 5IGXH 3QDJD 3QFDA 5IHLB 3V4PL 1XGQA 2DWDB 4XPHH 4FQIL 3NGBB 4NWTL 4FZEL 5ABDE 1H15B 2DQJL 2QV2A 2QR0B 3IDGB 3VXTA 5DEFB 5E7FA 1OSPL 1F11A 1HI6A 4KUZH 5JLZA 3X11A 4P2QB 1GGTA 4APQD 1Y6MR 4KHXL 2ARWA 2CRZA 3KXFB 3HUJE 4MAUH 4U1HA 1U8MB 1IGYB 2AJZB 5BVJB 1T1ZB 1HKFA 4LEOB 1JHKH 4U1GB 5EU3B 1X6LA 2FEDC 3QCTL 2ZG1A 3FFCD 2F5AH 4YNYA 1I8LA 2UYLB 5JOPE 1FQ9C 1I3RB 3VE0A 5F3HA 1OCWL 1KCRH 2FB4H 3SDCD 2WAHA 4N8CH 4GG6B 5FM5O 4X4MA 5L0QC 1YEEH 3HLAB 5JZ7D 2X2YA 3T0EA 3WL9A 2AJYL 2FO4B 2P8LA 2OK0H 4OAWA 2HT3C 1PLGL 2BSRA 4P5MB 4HC1A 2OXHA 4N68A 4WO4D 5I18H 4GKSA 3PHQB 5E6ZA 2EECA 1MFAH 5IBLD 4PTTB 4P57A 5E1AB 4QRPE 4ZS7H 5AG8A 3EO1B 4LLDA 4PJ8D 1UB5A 4NO5A 4KKCC 2M8XA 4P9HC 4F7TB 2XG4A 1DSFH 3S37X 3U0PA 4DGYH 2P8PB 1S9XB 3RWCB 3TWCL 1JYNA 4IJ3B 2HTKD 3X13B 4Q2ZA 5I75C 4JGUA 3VH8B 3ZDXE 3IDNA 4HWZA 5B4MC 1DLHA 3KYKH 3CFEA 3NZ8A 4NN7B 4YDKH 3GO1H 4M62H 1T1WB 2YK1L 1S7XA 1YNTA 3LKPB 1JZ7A 5BW7C 3MV9B 5MEND 5DI8B 5IMMA 3VG0H 5F7DB 3RVVC 1DN2A 2BSED 2IQ9H 3QIBA 2V5YA 5I1GH 4WNQA 3SCMA 1A6WL 1I1FA 4PRBA 3MJGX 2DIJA 1V5JA 2P24A 3IU3B 3WUWA 5LQBH 2QKIA 4WTXA 2IWGA 3RBSA 4Y2DA 1ETZA 5TPWH 2EDOA 4UT6L 4YBHA 4Z8FH 2CIKA 4X4XA 1MCBA 5E8EA 1UM6L 1HEZA 1BJ1H 4LPVA 3KLAB 5HHOB 4TULL 2GTZB 5T1MB 2J6EH 2P48B 2PW1B 4HHAB 1MHCA 4WDIB 2FBJL 3WSQH 2J6EA 2H1PH 4HBQA 4XNQA 3WYRA 3RKDD 1E4KA 1F2XK 3GI8H 4AEIH 3BYYA 1MLCB 4PJ7F 2EC9U 3T4AB 5DC0A 2FECI 1OGAE 5C3LD 1R3KB 4A6YL 1M7IA 3H7LA 3HS0B 2KL6A 1BZQK 2VDKL 3DYOA 3RQ3A 2Q8AL 3VMPA 2VDRH 4YAQB 2RR3A 3L6FA 3DUUA 4YIQB 3MNZB 1JN6B 4JRYE 1EHAA 4U6XB 3OKMA 1W0WA 3HC0B 3RZCC 1LHZA 1S7RA 3ZTJH 5FKPB 5GGVY 3CSBA 1BQHA 3O6FA 2QLVB 5CEZH 4M1DH 4PGDB 1MFDH 5FK9A 4RBPK 3UYPA 1ZOXA 4I0PB 2EE6A 2YBRB 4UT7L 5CD5D 1SYSA 5E99H 3BGFB 5F7LB 1F3DH 2A9ML 2O5XL 5C8JA 3LHPL 4JJ5B 1CR9L 1A1NB 1U8QB 3TIEA 4FFVD 1CGVA 2BJMH 5C0FB 1CGUA 2DICA 5JPMB 3HZVA 5CINL 1NDMA 5A16A 5J6GA 1P84K 2H2PC 4H88L 4P3WA 5HGBA 1HNFA 4Q6YA 3AC0A 1TVDA 4NHCH 4D0DA 4U4BA 3Q6GH 4D9RD 1MREH 4GMTH 4NQED 1N2RA 3QQ4B 4X8XA 3QQ9C 1KNOB 3QDHA 4M6OH 4WW1B 2X1XR 4J4PD 4NWUL 3KJ4B 2BX5A 3F7PC 1QLEH 4PB9H 3TFKC 3RUGB 4IRJB 3QUZC 4P46D 5C0DA 2HTLC 4UTBH 1WLHA 2JIXA 3B9VA 2JCCB 5DO2D 1FAKT 3MZGB 3PV6B 4OJFL 1P7KB 1SEBB 3UTPD 1VERA 5F96H 4H20H 4JY6B 3QJHB 5EN2A 3MA9H 3EYUH 5DJCA 3DOSA 3HR6A 4CNIA 4XXCA 2C7UA 1KCVL 2BSTA 1I1AD 1W2KT 1XR8B 3TH4T 4X4ME 5E8OA 5IB1A 4CVUA 1AP2A 5IKCA 3T0EE 1RVFL 1HSBB 1YN7A 4ODWB 4JZOB 4CMMA 5DK2A 2ZZUT 3S37H 5K9JL 3SKMA 2D4DA 3V4VL 1I8MB 3BQUB 5C9JA 1S5HA 4EVNA 1I8LC 3MNWB 4HT1L 2NXYC 1UVQB 1Y0LB 1BVLB 3IJHA 3K0WA 1EUTA 3QQ3B 4Z7QE 5JMOC 3U4EB 5KW9H 5DEGA 1NCAL 1V7MH 4JFFD 5H8DA 3ESUF 3ZTNH 1J05A 4PJAF 2DKSA 4GOSA 3MR9B 4X80L 5HGDA 3SDYH 3IVKB 2CLVB 6CGTA 1WK0A 4LBEB 4I9WE 3L9RA 4JRWA 2GSGA 1NAKL 2E7BA 3MOAH 1QPXA 1IEAB 3DYMA 3NZHH 4LMQI 2HJLA 3ZKXC 2OTUB 3QNXA 5TDOB 4F9LA 1YA5A 4D0CB 4DW2L 4M9OA 3PWVA 4OCRH 3Q2CA 5HDQH 3WDJA 4XCFH 1ODAA 4DVRH 5IIEA 3Q1SH 4NC0B 4U6YB 1KPRA 4XNXL 3T77A 1YYMH 3IXTB 3WE6A 1R24A 1QSEB 3OR7B 2A6DA 4G8EA 5C0BB 4NFDA 3MLYL 5E4EC 1XZ0B 4P3CL 2A6JB 4I18B 3D25A 5DD3L 3QIBC 4NKQB 4PG2A 3OHXA 2E9IA 2I9LB 3SCMC 3THMH 3PP3H 2Q87A 2DMKA 1CF8L 1MELA 5IR1B 1I7RB 3V8OA 4JRXD 3E0GA 7FABL 5ITFA 5T5NG 3VGBA 1IM3B 3JWDH 3WIIH 4DEPC 2APVA 4YEEA 1PGRB 1DBKH 4JO2L 1FFPB 4FXGA 3JVGA 3G6JB 3L3DB 4KTDH 4ZPVB 1E28A 5LBSL 2CDEB 1UG9A 3DO7B 3VRLF 2G75A 2X4TA 1T3FA 4IBLT 3ARTA 2FGWH 1RIVL 2HRLA 3MV8A 1ZV5A 4QHUB 5SWSA 2PYEB 2YPKB 4ZG1A 5FA4A 4DQOL 4HS6A 4JG0H 1G7QB 3MO1A 4HAGA 4JPWH 1HILA 1UCBH 5CEZE 3QUML 2W0FB 4K3HA 3BJLA 2ZJSH 4KTYA 4RISL 3T2PA 4Y4FB 4F8TA 4YQXH 3DI3B 2NZ9C 1XF4A 4FA8A 4WCYL 4QOKA 4BSWA 1Q8MA 3DWTA 1SQ2N 3LRSB 3O6FC 1MCDA 4R4ND 1F4XH 5EH1A 1FVEB 1GGBL 2E27H 5AAWA 4HKBB 3BI9X 3HC3H 5FO7B 4CL7A 4GKOA 3LEYL 1A3QA 3O3UN 1D6VH 1NLDH 3GK8H 4FQXA 3CK0L 2LVEA 4DN3H 4K2UH 3DVGB 4K3DH 5BRZA 5IP4A 3E2HC 1KB9K 3T1FB 4BH7B 3BKYH 5I1JH 2IH1A 3RWJA 3KS0J 2NW2A 4N0YH 4QEGA 4X7FC 4X6CF 3OG4B 3CXHJ 2G60H 4OFYA 4OCXL 1KB5A 2PTVA 4JFEB 1F2QA 2JTDA 5EC1B 3QNYB 1M7DA 1UZ8B 1ZHKA 4NQDA 4HJJH 4HUXA 3EOYG 4ZFOL 2EZ0C 2OMBA 3DV6B 5BQ7A 5DC9B 1NCDH 2DQCL 4OBSA 3KDMA 1T2XA 4PRHB 4R97B 2RCSL 1RURL 4GBXD 4K3EL 5IMKA 1LO2H 4IS6B 2IJ0C 1D5MB 5LGKA 1K3ZA 5GGQH 1DVFB 1G6VK 2NXZD 1T6WA 4MA1B 2PTTA 3QUKB 2PNDA 4MQXC 2NY6C 2OR7A 4RIRB 5D7SH 3AAZA 3IFOA 3VMOA 3ILQD 4LLWA 5FKAB 1EO8L 2FJHB 1JPST 5EDXA 1FORL 5GJSL 4XXCC 3TNMA 3HUJB 4UDUA 2ICWB 3BN3B 4IOIB 3MODL 1CDYA 1E6JH 1QSZA 2FR4A 3VXPB 2P7TB 4NM4H 4LSSH 1I1CA 2L7JA 3OSKA 1DE4B 4OM1H 4U6VH 3T2NH 4OGYL 1KN4H 5LAXA 1OW0A 1JF1A 2IAND 3T0WA 2ADFL 3E3QC 4WGWB 4YDLC 5EZLA 1CD1A 3K81A 3LOWA 3MLVL 4UTAH 1CXFA 1NFDF 1U58A 4XBPB 4PGZA 4XC3L 4EN3A 4FTVA 2OL3H 5I75B 3STLA 1FDLL 1ZEAH 3O3EA 2ZG2A 1AKJB 1NGPL 4ISVA 2JB6A 1RPQA 2YEZA 3QWOB 2E9BA 1RZGA 4AEFA 2NY0B 5DUBA 3H42H 5E94B 5AG9A 5C92A 5HVWA 5DZNA 3LDBC 3MRFB 2VXQL 1NEZA 1BM3L 1ES0A 5JMRA 1U8OB 3GSOB 4CN1A 3LRHA 3TVMB 4NCC1 2R4RH 3C5ZD 3RIAF 3PXJA 3RP1A 5IQ7H 5I1KL 4O5LL 1EUUA 2K7QA 3GMPB 5EFIA 3RPIB 4F9LC 1W0VA 1UT9A 2AXHA 3ARRA 4XAWL 3SJVD 4EI5D 5C0IA 1OY3B 2OP4L 2P47B 2ZUYA 2F19H 2KBGA 1T0NA 5GRZA 4E41B 2P44B 2MOVA 2Z93B 3P0VL 4DWHA 1BMGA 2Z31B 5C0EB 4FRWA 1MJ7L 1X5JA 3NCYS 3UJTL 5C6TH 1QLRA 1BF8A 5I19L 2H26A 1WITA 5GSRB 1K8DB 4KVNH 4YX2H 5A2KH 1J10A 3VI4E 4S1QH 4M02A 1E4WL 3BRFA 2XWJA 2AEQL 1RK1A 1JYVA 1NBZB 2N4IA 3MREA 3ARDD 3LEXA 4P2RD 1FFRA 4IDLA 1HDMB 4PJDA 2KZWA 1G0YR 1XMWA 5HI5D 5CZVL 4LPCA 2Z35A 3LZFH 5IBTL 1CFNB 3WNKA 3GHBL 4P5TB 2PXYB 4FHBD 4IRZH 1LVEA 4FP8L 3BKJL 3MV8E 2F74A 3JVGC 2G2RA 2F5BH 2ATKB 5DQDL 5GHWL 4WI5A 5SWSE 4ZXBC 4N0FA 2Y9RT 2BY2A 3HMXH 3RVXC 1CLCA 2XY2A 3GBNH 5HGAB 3FO2A 3QSKB 3S4SB 3QFJD 1WUNT 2VAJA 3K4AA 2WWMD 1K8IB 3HMXA 5DUML 2AK4A 3TESA 1NGYA 1A6TB 1VFAA 4XMKH 4GSDH 4WEBH 1AR1C 1KT2B 1OGAB 1HXMA 5DMIH 3QA3B 3LQZA 3ARED 2ARJQ 4X6DA 1NGQL 4DZ8B 4QOKE 4Q0XH 2V5SA 3H9SD 1WCQA 3FKUS 4HQQL 3BPCB 5FOBA 3ZKSD 2AGJH 5I71B 4U1IA 4N8VB 1KFAH 5DRNB 3HB3D 4DKDC 2XACC 4PBWD 3CC5A 1B3JA 3OKOB 4HGWA 4NC1E 4MHHG 3DX8A 4PRAB 5BRZE 5DWUH 3PIQA 4J1UA 4WW2F 3UZEA 3W39A 4HCRH 1WIPA 3WIFA 1BOGB 4L8CB 1RUMH 2CPCA 2JB5L 3RWHA 5DFTA 1ZT7A 3RI5K 3TYFA 1G9EA 4E9LA 4FQXC 3V4UH 3UMTA 2VIRB 3HE6D 3TGXA 4XP4H 4F7PB 1YC7A 4TUKL 3HKFA 4NQDE 3V0VB 3F6LA 2PO6D 4QNPE 2H32A 3RWEA 5HI4D 3QEQA 4G5ZL 5LWYL 4ZO9A 2UY7A 3G04A 1MAKA 3TBVA 1FYTD 1PKOA 4UIMB 1JNJA 5DMJB 3QFDB 1AD0A 1FP5A 1XGQB 1I75A 5HI3D 1S7WA 1TZHA 3W0WD 4Q9QL 4G9DA 1LO0L 2MWCA 4Y16D 5CD3A 2DJUA 4FXKB 4OM0L 5EC2A 1UH4A 3VXTB 3WXVL 3PWNA 4TSAH 4AM0B 3T4YA 2A83A 4J3OC 1JFQL 1QBLH 1HI6B 3DIFA 5JLZB 3MMEA 4P4KC 3X11B 2R56H 5LGJA 2VTFA 2Y07H 4RGOL 4N1HB 3MTRA 5JA8B 3QI9B 1TIUA 2VZOA 4U1HB 3F12A 1J0ZA 4IIQA 4NKOB 1TJGH 3VFNA 4N0CD 1QSFD 4OLXH 4NBXB 3L3HA 1QLFA 3IFNL 4LCYA 3ZHKA 4YNYB 4NQTA 1FIGL 3F7QA 5IROA 2XYCA 4OFDA 4OZFG 5F9AC 3R8QA 1S7UA 3FQXB 3VE0B 1T83A 5DJYA 5F3HB 2CRYA 4OLYH 1INQA 4KZDH 4LDOB 3G08A 3O3BB 1GIGH 3T0EB 3S5LG 3WL9B 5D70H 4FTVE 1TJHL 3IS1X 4OAWB 1RU9H 1T0MA 35C8L 5LXGH 4KU1A 2C4FT 5F7EH 4YK4C 3L1OL 4LPWA 1HIML 2CIIA 4GKSB 1L9NA 3VGEA 2OR9H 4LP4A 5EORL 3QCUH 4GG6F 1CZ8L 2XXCB 1OW0C 2X9XA 4NQCA 3HNTH 4LLDB 2OR8A 1UB5B 1YMHB 4NO5B 1SEQL 25C8L 2P5WD 3QHFH 5DHVH 1T0PB 3ZKXB 4EN3C 1MWAH 5IT2H 5DHVA 4Q2ZB 1XF5B 4NJ9H 3I2CH 1I7TA 3AFLA 1IAKA 4KTEH 2GTWA 4PRDA 3MRJA 1DLHB 3CFEB 3NZ8B 3ARFD 1T66D 5CJXA 3SDDA 2BMKA 1S7XB 1NGZA 1YNTB 3C87A 3QXUA 4AG4H 1W0YT 4NQVA 4QWWD 5E4EB 3PWJA 1MCFA 2E9WA 4S1DC 5CZXC 1U8JA 1R3HA 3QIBB 3K8KA 1GC1H 4LQFL 4WUUA 3SCMB 5EUOB 4JM4L 1I1FB 3LKSB 1LO4H 2P24B 3WUWB 3MV01 3W2DH 2YMXH 1OQXA 2QKIB 4Y2DB 1ETZB 4QHLA 4PJDE 1EVTC 2CIKB 4R8WH 2VXVH 5KVFL 5KVDL 4EDWH 3MBEA 4UILH 1IEHA 4L9LC 3U30C 1OAZL 4E5XB 2GYSA 3C60A 5F6HJ 4DCQB 1MHCB 4FS0A 3RDTA 4EQ3A 3RGVA 4XNQB 3MZTA 3WFEL 4D9LH 4JN2A 4WHYG 1WVZA 1OAQH 5BO1L 4NZJA 2AK4E 4BFEA 5GS0H 2JJWA 4I77L 3AM8C 4X6DE 1M7IB 2D7PA 4FQIH 1WBYA 4NWTH 5L9DH 4FZEH 2I24N 2B20A 3L6FB 3DUUB 4PRNA 5A3ID 2Q7NA 3MLUL 3ZE0E 1X5FA 3GIVA 3MSPA 3OKMB 1W0WB 5F3BB 1OSPH 4FMKA 4HXAH 1JGLL 3ARPA 4NRZA 1SJXA 1HZHL 5E1HB 3SKUD 1BQHB 3O6FB 4KHXH 5D71L 3RGHA 5D1XC 5FK9B 4HUUB 4GRWH 4TPRH 3BH8A 5FHAL 3QCTH 3VU2A 1H3PL 1CFQA 3WLWC 3DXAD 1T89A 2XTLA 2EIBA 1I4FA 4MJIA 5CLWA 5HXMA 4H8WC 3V9FA 1OCWH 4MDIA 3FTGB 1UM4H 3QUXA 3L5XL 3SE8L 3QEQE 5J6GB 1DDHB 1I7UA 5EZJA 1PLGH 5HGBB 4RGNE 1CE1L 1CGXA 3VXRA 1RUQL 4BK4A 5DJ2B 3ULUD 5ANMA 2ICWJ 4WFGE 1BLNB 1HCFX 1WTGT 4X6EA 5KANG 3TWCH 4X9IA 3ZSTA 1RJLA 3U6RA 5CIPA 5C0DB 3BPLC 4RGNC 2AEWA 5TQ0L 4LHUB 3QJFA 2YK1H 1J1XL 2NY6B 5H35A 5D7JD 1NC4A 5IOPA 5L2KD 3KPSB 3RUGF 1SM3L 3QDJA 5C08D 4LSQL 1LK3L 2GJZB 2XA8H 2QQKL 2C7UB 1KENH 1MY7A 3B8SA 1H3VA 2BSTB 3SY0B 2X4OB 5E8OB 5IB1B 1A6WH 2RB8A 1DANU 5IKCB 4IIQC 1BQSA 1ZGLP 1YN7B 4CMMB 5DK2B 2W0PA 2BXYA 3G9VA 4OF0A 4ELME 2HLFD 1QR1A 3SKMB 1R5VA 4KRPB 2MQ0A 4APQA 5C9JB 1UM6H 5IROC 1ZANL 4TULH 1KBGL 4NQCE 3IJHB 1L6ZA 1T83C 2VDPL 3H9YA 2HAZA 1R3JA 4R4BA 5T1LD 2FBJH 2J88L 3OQ3B 5DS8A 2V7HA 4OTXL 3PXHA 3FFCA 3ARBD 2O26U 2C3WA 1JMXA 4KY1L 1KOAA 3LDBB 4AMKL 4RFNC 3SDCA 4G6FB 3NN8A 2ZNXA 3PDOA 1MRCL 3L9RB 1G7PA 4F8QA 1INDL 3D3VD 2DM7A 4A6YH 1CGYA 3P4MA 2VNCA 2VDKH 2YN3A 2Q8AH 3VFTA 4PGCA 4L5FL 2HJLB 2MJWA 2NLJB 4WO4A 3QNXB 4LARL 1T6VN 2EDEA 4A6YA 4RX4D 1KJ2H 2XWTB 3PWVB 4PJ8A 4YHLL 5I9QB 4WUUE 4DK6A 1KJ2A 3ILPA 1KPRB 5CJXC 4O2CA 3T77B 1WC7B 2YR3A 5IMLA 4TVPD 1MCNA 3SDDC 5HYJA 2GW5A 4I1NB 4Y5VB 4X7DC 2A6DB 2VLJD 4G8EB 3E8UL 4M3KB 4N90D 1CXLA 2ZCKL 1MRDL 4JN1L 2L7UA 4FFWC 2BNRA 3ULVF 1N5AA 4R2GD 2APFA 2DQIL 1EFXD 2A9MH 4URTB 4XC1L 3F7YB 3LHPH 1CR9H 2JJUA 3OHXB 2V2XA 4KPHL 5DFVC 5F70A 3EFDL 3FFDA 1G7IA 2C4XA 3KHOA 3MRCA 5MENA 3LIZL 5ITFB 1YQVL 5CJQL 5CINH 2NW3A 2EDDA 4H0IA 4FXGB 1DBBL 4RFOL 3MBEC 5JDSB 1WAAF 3QUYC 2HT4D 1G0DA 4OCNC 3GMMB 2G75B 5BV7C 4I5BB 2IBZY 2XY1A 3BMVA 3D0LA 4EUPA 1NANH 3UBXI 2JK5B 3HZMB 4NWUH 3RDTC 3AROA 3G6JF 3RL2B 3K2UL 4UBDD 4HIJB 4M1CC 2IG2L 5ADPL 5GSVA 2YUXA 3ZDYF 4UAOC 3VXMD 3QDMD 4ONHA 1NDGA 4HS6B 3MO1B 3X12A 1HILB 1NJ9B 1P4BL 2A0LC 3PABA 1F6AA 5K9QG 3CX5J 3RTQD 4GRWE 4ODSL 4HLZG 1NCUA 4MJIE 4R3SB 2QBWA 3MNVB 1DQQA 3TN0D 1KCVH 3LN5A 4BSWB 3E6FB 4UNUA 2YRZA 5IHZA 1G1YA 2CRMA 3BP7A 1SBSL 1RVFH 2A1WL 3SDXA 4TVPL 4FQXB 2YUZA 5K9JH 3S36L 5BRZB 3V4VH 1TENA 2IH1B 4K23L 3RWJB 1T89C 4HT1H 3FO9B 1YDPA 2DIAA 3VXRE 1CDJA 2NW2B 2NTFA 3AMLA 4LLMA 1QFHA 5ANME 5IB5A 1U8HA 5IF0A 5FO8B 4PJFB 1JPGB 1JBJA 4X80H 3O2WL 1ZHKB 3IT8D 4I4WB 4DAGL 4NQDB 4Y1AB 1A6ZB 4HUXB 5GZNC 4QHMA 4ZUTB 2R2HA 5BQ7B 4YDIL 1NAKH 4CAGA 2A73A 3GMOA 1U0QA 4NZTL 5MHSD 2FIKA 3QDJE 3GKWL 4DW2H 4M8VA 4NQEA 5EUKA 1ZK9A 3FQTA 5C0CD 4J4PA 4XNXH 4YHNA 5C7XL 4L8BB 4UI2A 2NMSA 1ND0A 2B39A 5JHDD 1R3LB 3IFOB 2OX5A 3D39B 3LY6A 4P46A 5SWQA 1NKRA 4P3CH 4LOUC 1P7QB 1KEMH 2C1PA 4XP5H 2AEPL 2AQ3A 3KPPB 1Q9OB 3TNMB 4I0CC 4UDUB 3WBDA 5DD3H 1YECL 3U48A 5DJ6B 5EZIL 3QR2A 4XX1G 4LVEA 1CF8H 3LB6D 4X7EC 2OTWB 4UIKL 1AJ7L 3T04D 1FNAA 3FFCE 7FABH 1FZKB 3KLHD 3K46A 5LAXB 3JTTA 1JF1B 3HUJF 4JFXA 4ZAKD 3UZQA 4U2ZA 3WHXA 4JO2H 3FQUA 1I1AA 2R29L 5EZLB 5HDOA 4APQC 3C08L 4XPTL 5E5RB 4XBGA 5LBSH 3SQOL 1CD9B 1OTSD 4UV4L 1QFUL 1TCRA 3H3PL 1VACA 1X5XA 4FTVB 3V7AG 3FQWA 2E7LA 4ELKB 1EA9C 2ZNWA 5FB8A 4G8GD 5FECA 4HKJA 3B5HA 1UB6A 2OL3B 3MRKA 1RIVH 1NBQA 1QVOA 1RZGB 5DUBB 5DHXB 5ADOL 4JLRA 4YPGA 5HHMB 1NEZB 3SDCC 1ES0B 4ONOA 4JFFA 5JZ7C 1KEGL 4HIEA 1EH9A 5HYJE 4JGMA 4ZS6C 4LHJB 4DQOH 1BJ1J 3UPCA 2ZOKA 5EBLA 3QUMH 4GAYA 1H8NA 3AMKA 5EFIB 4OGAD 1BEYL 4RISH 3V0AC 3QG7L 5IBLC 2YD2A 5I15L 4PJ8C 4WCYH 3PGFL 1T0NB 1BWWA 4PV8A 4GG8A 5IBUB 3EUUA 4KK9D 1GGBH 5MENE 1TTFA 4JDTL 5I17A 5ID1A 3RRQA 1EGJL 3LEYH 2ORBL 3CK0H 2H26B 1U92A 2X4RA 5J0BA 1Z0MA 2DQFA 4JE4B 5C0GA 2V6HA 4LSPL 3MRNA 1RK1B 4PGEA 1IAII 1BIIA 3B3IB 2UZIL 2NTSP 3C8KB 4CN4A 2VH5L 3WNNA 2Z35B 4OCXH 2EKJA 2RGSA 4D3CL 1IKNC 2G2RB 4L8DA 1OPGH 5CCKL 4N0FB 1WEJL 2NY3B 4ZFGL 4JRXA 5SX4H 2V2TA 4C55A 2DQCH 2YS4A 3P40A 5E9DD 1F3DJ 5D93B 3FB7A 2AK4B 1T7YA 3MBXL 4QRQA 5KVEL 3TPKA 1VFAB 1RURH 2FD6L 2QHRL 1QQDA 4F57L 3MJ7A 1GJIA 3DTXA 3WUZA 4LPUA 4X6DB 1R0AL 2RAMA 5GGUA 2QADC 1BZ7B 2D2OA 5T33H 3FQNA 5FOBB 1MY5A 1NUGA 3KYOA 3QG6B 3S97C 1D5ZB 3SDXE 3HPLA 3CC5B 5TDPB 2HJFA 3P30L 3DX8B 5F93C 2HLAA 2MCPL 3PIQB 5ITBL 1EO8H 4J1UB 3W39B 2E9JA 3NFSL 1FORH 5GJSH 4KK5D 3BYTA 2CDGA 4CW1B 1MCCA 5IVXA 1KTDA 1NMBL 2E7MA 3MODH 4FNLH 1MVFA 3D18A 1ZT7B 1AGBA 3G9AB 3TYFB 1JZ8A 4OF6A 1P5UA 2YUVA 4BZ1L 4OGYH 5T3XL 4AENA 1UWEL 3SE4A 1FAIL 5HHPB 3MLVH 3HAEG 3QEQB 4XC3H 4JCMA 3CH8A 4U1MA 3TBVB 5JW4Q 4JM2D 1NGXA 1ORQA 1RY7B 4UB0H 4ONGL 3QULA 2P46B 2YD5A 3P2TA 5ETUB 1B4RA 4D9RE 3RU8L 4MAYD 4CVWA 1AD0B 4K7PY 4NQEE 1S9VA 2VXQH 1TZHB 1BM3H 3QDAA 2FX7L 4G9DB 1UCTA 5EBGA 5F7NC 5EC2B 3M45A 4OZGA 4H26B 1AIFB 4KRLB 5I1KH 4O5LH 3DIFB 3MMEB 1UEYA 3UDWC 3CFJA 1E27B 2LV4A 2IQAA 3F12B 4XAWH 2HFEA 4K07A 3UTPE 2OP4H 3JWOL 4J8RB 3VFNB 3KPMB 1G9NL 1TCMA 4ZUVA 3EYFB 3P0VH 4GBXA 3V8CA 1IC7L 1MCLA 1QLFB 3L3HB 3RY6C 4MQ7A 1LILA 3O45A 3A6BH 1MJ7H 2WW8A 1MFCL 3UJTH 3WXWL 4P46C 1DEDA 5I19H 3LD8B 3BP5A 5C07D 1INQB 1J8HD 1E4WH 4YGVB 4LAQL 3G08B 3LV3A 2AEQH 3C6SB 3QXDA 2X4SB 5LG1A 4ELMB 1T0MB 2DM3A 2GT9A 3MRGB 5K9KA 1U8NB 4HLJA 4QHKI 5K9OA 5I8OL 2CIIB 5CZVH 5IBTH 3GHBH 4Q6IA 2J8UA 4FP8H 1I1AC 3GI9H 3D87B 2NPLX 3NCMA 4JFFE 5DQDH 5IB4A 5GHWH 1RJYA 4R0LA 5EO1B 2E7LC 5DHVB 2O61A 2IANA 5DUMH 1I7TB 4GH7B 1IAIM 1IAKB 2GTWB 3DNKA 1MWAB 3MRJB 4Z7QF 3I3BA 2HVJA 2QSQA 3DPBA 3TCXA 2BMKB 1OP5H 3EYVA 1NGQH 4ZPTA 1I9JL 4BH8B 4ODUB 1WSST 2R1XA 4NQVB 3IB4A 1YUHB 5BZWB 4HQQH 4Y19B 3QT2A 5J3HC 1GHFL 3DV4A 5ESVA 1U8JB 1R3HB 2DL2A 5CBEB 5KJRL 1IM9B 1NPUA 4WUUB 2YPVL 4EIZC 5JW4N 1DQDL 1UQSA 3KGRA 1NMCB 4M3JA 4QHLB 1F4YH 2JB5H 1ZHBA 3LN4B 4L3ED 5CKGA 4YXHL 5EUOF 3KYMA 3MBEB 2R0LH 4JG1L 1RUKL 3SJVA 4EI5A 3QXAA 5ISZD 4G8FA 4N8VG 4FQLL 4TUKH 3Q48A 3C60B 3AU1A 1FV1B 4JRXE 3RDTB 1FL5B 1P1ZA 1ZHNA 3RGVB 4G5ZH 5LWYH 2WM0A 4WEMB 4JN2B 4UMGA 3QEHA 3VFOA 5FEBA 1TPXC 4NN6C 1A3RL 1WISA 4MCZB 4UAOB 4M7ZB 1CG9A 3ARDA 3HCVA 4P2RA 1PBYA 2B1AH 3VFVA 3N06B 3BJ91 3H9HB 1HYSD 4U2YA 4Q9QH 4XCYB 1LO0H 5F7FA 3B4NA 4HIIA 1IGIL 1VFMA 4OM0H 3WXVH 3GIVB 3HHRB 1JFQH 4OUOA 2HG5A 4JPIA 4NRZB 3HMWH 4S10A 4RGOH 3QFJA 5H94A 5IVXE 4X99A 1NAMA 3MFGB 4DTGL 2C1OA 3BH8B 2BDNL 4ERSL 1S9KC 1XR9A 1BECA 4U6HA 3IFNH 4GMSL 4GRWB 5HBBA 3SKNA 1NGWA 1FIGH 3AREA 4MJIB 1I4FB 1T04A 5I73C 2ITCA 4MDIB 4PB0H 3H9SA 2BC4A 3QUXB 2X9WA 4AQOA 3GDBA 3R1GL 3IDYC 1UKSA 1VB9A 4G6JH 1I7UB 1TJHH 5EZJB 4P3DA 35C8H 2ERJB 2IFFL 1JGUL 3L1OH 3UTQA 1HIMH 3CIQA 2Q86A 3G6AA 2X40A 5SX5K 5IG7A 1AQDA 5EORH 1CZ8H 3GSXA 1FFQA 3MCKA 2RFXA 1SEQH 25C8H 4R4NC 5ANMB 2A9NL 3I75B 1OAKL 3CD4A 3VJ6A 3C09C 4L4VD 4X6EB 4OZGE 1K85A 3JSSA 4UDTA 1ZKAA 3HE6A 3T3PF 5EU5A 3U6RB 2D0FA 5GGTL 5C0NC 1I3UA 5DJ8A 3OGCB 3QRGL 2PO6A 4JHWL 5BS0D 3QJFB 4U7KA 2EO9A 5H35B 4ODBD 1NC4B 4JFYA 5IOPB 1FYTA 1JTTA 2DLGA 3NAAL 4ZOAA 2VR4A 4PR5A 1OWWA 3DSNA 1PQZA 3QDJB 2QSTA 4DOHE 1BWMA 1RJCA 5KSAC 2FHFA 3W0WA 5AAMA 3G5XA 3HTLX 4LQFH 4HZLB 5IJKC 4JM4H 5JNYA 4Y16A 1EPFA 4QTHA 4PY8J 5I1EH 3WLBA 1MCPL 4KKCD 1QR1B 5C0AD 2ADGA 3NCEB 1R5VB 2DLFL 5DQ9A 1KC5L 4JFQA 1G7LA 5KVFH 5KVDH 3WN5A 2J8UE 1C5BL 1GVIA 3ZE2F 3L5IA 3Q6FA 4Z7VA 2DQUL 3VGAB 4JO1L 4R4BB 1QSFA 3ROOA 4N5UA 4Y4HD 5DS8B 4EJ1C 2V7HB 1HOCA 3GM8A 3FFCB 4HK3J 3FOLA 3F7RA 3WFEH 5BO1H 3QPXH 2IANE 5B39A 3ILQC 3WUWG 3G6DL 4XB7A 5DRWB 1QHOA 3NN8B 1FSKC 3G5YA 4Q6IC 1KYOJ 3KVQA 4KQ4L 4I77H 1G7PB 3RVVD 1LK2A 4WWKD 5GGVL 5HJ3B 3P4MB 5F6IC 3VFTB 4PGCB 4WHDA 3B9AA 2MFNA 4R0LC 5I1CL 4WO4B 5DYOB 1P4LB 3DUSA 1MAML 4H1LG 4A6YB 2ITDA 3OKEA 3MLUH 4HFUL 4BELD 1ED3A 1QBML 1DUZB 1CN4A 1EV2E 2VXUL 1JGLH 2P5WA 4JHBA 4C58B 1KJ2B 3ILPB 2CXKA 3TBSB 4O2CB 3NIGE 1HZHH 2R0KL 4WVRA 5D71H 2ADJA 1JHLL 1WZ1L 2W0KA 3R8BB 2Y6SC 4LPXA 5FHAH 3S9DB 1N5AB 3O3AB 3ARFA 4JO4L 1H3PH 3FJTA 3OB0K 3SJVE 2V2XB 1MJJA 1T5XA 2ATPA 2DBJA 5DA4A 4HJ0D 5CEXA 5I1HL 4TTGA 3OAUH 3FFDB 3TZVD 3BZEA 3MRCB 4OIAA 5MENB 1A4JA 3WFHB 3L5XH 5KAQF 2ZPKL 3SE8H 2NW3B 2F54D 1BQHG 5D6DA 3OKLB 1F4HA 3FB5B 4ZUWB 4ETQB 5HVHC 5HYQB 3DO3A 4MDJB 3ARVA 3ZTJG 4P9HL 5AD0B 5FUOL 4EI5C 3OF6D 1LEKB 1CE1H 5IFHL 4KV5E 3RVUD 3RZCD 4P2RE 4UZGA 1RUQH 1LDPH 4EUPB 5EPMA 1I9RH 1MCSA 3S36X 4MNQD 3VI4F 1T5WA 4GLRH 5C6WH 5JQ6H 1DQJA 3SBWC 3OJ2C 1OOAA 4YEFA 1ZMYA 2YZ1A 1IT9L 2K9UA 4IRSD 5TQ0H 4ONHB 1BHGA 2VXTL 3ARDC 2VLLB 2CGRL 3QFJE 4S1SL 1J1XH 1IGFL 3X12B 3TIDA 4OI7A 4PJ9C 3PABB 5HI5C 1F6AB 3CCHA 1A0QL 1YMMB 5F21B 4ZODA 4LSQH 1LK3H 2H2PD 1HHGB 1YY8A 1DQQB 1DP0A 1ONQA 2YA0A 1TVBA 5J7CC 4ZYKB 3H9SE 5GXBB 5IHZB 3DGGA 3ARGD 4OB5L 2WWMC 1P5VA 1U95B 3SDXB 5JORA 1MCKA 2W91A 4MNGA 2VDQL 1E4XL 3AREC 1ZANH 3G5VB 3OB8A 4PIRF 3ZE1E 1YDPB 4D8PA 1KBGH 4Z76B 3BEWB 5CZKA 5J4MA 5CP7B 2JJVA 4LLMB 3JV4A 4LFHG 2VDPH 2Q6WA 5F97E 3C5JB 5IB5B 1U8HB 5IF0B 2J88H 5I74C 1S5IL 4OTXH 3HB3C 2Y1VA 1I8KB 2YD1A 3DXAA 4PJXA 4DGVL 1PY9A 4KY1H 5JA9A 4AMKH 2BVOB 4ZMAT 1VFUA 3GJFK 4QHMB 1MRCH 3P0YH 1WT5A 2R2HB 4FQHA 3T8XB 1INDH 3M17A 2FX8L 2WQ8A 1M05A 4PJFF 3LKOA 1B0RA 1IZJA 3N1MC 4L5FH 1FYTE 2A73B 3C8HA 4M03A 4LARH 2BVTA 2FIKB 2P8MB 3PHOA 2V5TA 3CMGA 4OLWL 1U6AL 4HPOL 1BZ9B 4QNPF 2X70A 4R6UA 4NQEB 5EUKB 1QFOA 4YHLH 3W0WE 5CSZA 2Z92A 3QZWB 3WIHL 5T1KD 5TH2A 2NXYD 3MOBL 3VXQB 5HI4C 2A74A 1ND0B 4PP1D 2EO1A 4Z6AT 4LVOC 5AZ2L 3E8UH 1MRDH 2YRLA 1MCHA 4P46B 5SWQB 4JN1H 2C1PB 2CMRL 2EE9A 2DQIH 5BZDB 4XC1H 1A4KA 4Q9BA 3VFMA 5D7JA 4KPHH 4WEUD 4Z7VE 5L2KA 1UYWL 1QSFE 4Y16C 3EFDH 5C08A 3LIZH 1YQVH 4NUJA 4JFXB 5INCA 5K59E 2FGZA 3FQUB 1I1AB