5I9QB

Crystal structure of 3bnc55 fab in complex with 426c.tm4deltav1-3 gp120
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
217
structure length
202
Chain Sequence
VQLVQSGTAVKRPGASVRVSCQASGYTFTDYFIYWWRQAPGQGLEWLGWINPLTSQPSYPSRFQGRLTLTRDTFDEMLYMDLRGLRSDDTGIYFCARRHSDYCDFDIWGSGTQIIVSSASTKGPSVFPLAPALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLICNVNHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for germline antibody recognition of HIV-1 immunogens.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
molecule keywords 426c.TM4dV1-3 p120
total genus 34
structure length 202
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i9qB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i9qB01
1X9QA 2QQKL 4X6DF 2VN7A 3CSYA 3IETB 1NCAL 2J5LB 1X5IA 4X7TA 4NIKB 1RQ5A 4MJIB 4YC2B 4MJ5B 3VE0A 5IB5A 1RUML 5IJKA 3U30B 3RZCA 2F8VA 4ZD3H 4I2XE 1MHPH 4JM4L 4RAUB 1S9XA 4BQ8A 1QA9A 2IG2L 3MRFA 1ZHKB 5TGBA 2VXVH 4KDVA 4FQPA 3LV3B 4NFBA 3VWKC 1QSFB 2FJGA 3UXFA 5BJTB 4KU1A 1RZKH 2VTFA 1OAYH 3VXOB 4KK6D 5CINH 4NQCD 3ILQD 3A6BH 4H26B 4KRLB 2OI9C 4YEFA 5DLMH 1N5YH 3QFDA 4Z76B 2X4SA 4ODHL 1ULVA 2BY3A 3C8DA 4FQJL 1LK2B 3CFJA 4D2NA 1G1YA 4B5EA 1JWSA 3WL9A 1U8HB 1FZJA 4G6ML 4NZTH 4TQEH 3D0VA 4YK4C 3OR6B 1OM3H 1BM3H 5I75C 4LEXH 3IDNA 3L3KA 1GYAA 1JGUH 4M3JA 3PUCA 4P57A 3RZCB 1NLDL 4Z7WB 2NZ9D 2XY2A 4H5SB 4NKDB 4ELME 4XCFL 3BN9C 5FOJA 5JW3L 4FQHB 3WIHA 4DEPC 4Q0XH 4N1EA 4JO2L 4Z95L 5D7KE 5FB8A 2X4PB 2J1KA 4I8DA 1GZPB 2JJVA 1CD1A 4O4YL 3F62A 4PGZA 2EIDA 3ZTNH 5I1CL 5D9SA 1RZIB 5MP6L 5DSCA 3F7YB 3TA3D 1NC4B 3HCVB 1PG7W 3CFCH 2EIBA 1X5ZA 4HJ0C 4JEGB 3RUGB 3HB3D 4X4YB 1MLBA 2ADIA 4HSQA 2ZWLT 5HDBF 2R2BA 4ZPVB 1DE4A 2C3VA 3IFNL 3O9WB 1XCQB 3OBAA 1FRGL 3HC0B 3EDDA 2NXZD 2CIIB 5F44A 1HCVA 2YRLA 4AL8H 1HN1A 3HE7B 3EKCA 4A6YH 3QUYB 1AGCA 2AJYH 1JHTB 5L9DL 1ZGLB 4OGXH 1RSFA 3D3VD 1MHEB 2MHAB 3NCFB 4NYLA 3VXMB 2EEAA 1DVFC 2P8PA 3MLSL 5L2KD 4D0DB 4R90L 5DJYB 2PR4L 3GO1H 2X4TA 4PB0L 5IWLA 3C08H 3E6HA 4K8RC 5I17A 4MNQE 3SDAC 2G60H 2R56H 3T3PE 1I8KB 2OJEB 2HFEA 4MCZA 3CK0H 3QO0A 4Z0XA 3OJDB 1CQYA 2AJSH 2VQTA 3SE3A 4F37F 2ZCLH 2P8MA 4MWFB 2FSEA 3W9EB 3D2UB 4X6FB 5DEFA 3O8XA 3JUZA 3K8LA 3KGRA 1A1MA 5DUPL 4WWKC 1DBBH 4QXUL 2X5PA 3ZYOA 1JF5A 5DQDL 5DRWA 2COQA 3MOQA 4Z7QF 3WSQL 4LNVA 3I50L 3IDJB 1X5YA 4NHUA 5DVMA 2DLIA 1WGOA 1NCWH 1S8DA 4YBLB 5ALCH 2FO1A 5IB1B 5FHAL 3TBWA 4PGCA 1HDMB 4P9MH 3WS6C 4Y16C 5FAAA 3GMOA 4MZ3A 2D3VA 4I3GA 3PWVB 5H2BA 3INUL 2NY5C 1GC1L 3ZDXE 1I9JH 5F1IB 1RK0B 4GLRI 1IM9B 4FFYH 4ZSOE 4ZD3L 1CGUA 3DX6B 3QIUB 3RWFA 4K3EH 2PYEA 3T04D 2NNAA 4MA3B 3V5HB 3VXPB 1BQLH 3MNZA 4G5ZH 1T21A 2VITB 2P5ED 4Y19A 1ETZB 2CJUL 4NNXA 1NGQL 4BK4A 1M6OB 4ONHB 4OFDA 5I74C 1UWXH 4PRPE 3UZVB 4OI8A 1YJDL 1VENA 3WLBB 2OQJA 1J10A 3LB6C 3UTSA 1E4KC 4PP2B 3NPSB 1G7HB 1V3MA 1FJ1B 1F13A 1NGZA 5D6CB 5M94B 3BWAB 3QAZC 4E42B 2FO4B 5I8OH 4HUNB 5CZVH 1NGPH 1DDHA 4JFHD 4XNXH 4NRYA 1J11A 2GTWB 2NXYD 1J1XH 1T6VN 4P4KA 3OPZL 4KJQD 3OX8A 3WHE0 4XCEB 2P8PB 4H25A 1NCCL 4D0DA 1YQVH 2VXUH 3VMOA 3V52H 5JXAH 3CJJA 3O6LL 1AD0B 1RULL 4FTVA 4I18B 4P5KB 5E7BA 5FECB 1JCKA 5C8JB 3TF7C 5CHNB 4ODUA 2BNUA 4OGXL 1KTRL 2Z8VC 4FQHA 2JB5L 5EUOF 4FQXD 5D5MF 5GZOD 5JUEH 4R0LC 3GGWA 4LPCA 3RBSA 2BOBA 1I75A 4NO5B 1RIVH 3T08A 1W72B 4OI9A 4TSAH 4U1HA 2NY0C 1XCQA 4H8WL 2CXKA 1UJ3B 2Q76B 5F7UA 1TVHA 4D0CB 3Q5YA 1CZ8L 4HZLA 3MGTB 2WIIB 1A6UL 2LV4A 1MFAL 2G5BB 2YPLD 3FFDA 4UIMA 3B5TA 3HUJF 5F9JA 3WE6B 3BP7A 3JUYA 3LH2L 4LOUD 4MQ7A 3VH8A 1CD1B 3RI5K 3GRWA 2KQNA 4EIZC 4L3EB 5ILTH 2QSTA 3MMEB 1UWXK 3S8WA 2ERJC 5E9DE 2PXYB 4OZHA 4LFHD 1GGIH 2E9IA 4CDHA 2MPAH 4PG9B 2KQMA 4NKDA 1GC1H 2ICEA 4R97B 2CKBL 1S5HA 4YDJA 4ZUSB 4WW2F 1EEZA 1BVLA 1UENA 2CH8A 2ICWJ 3DRQB 4AT6B 2GYSA 2QQKH 1MI5D 3N1PC 1FJ1A 4XC1H 1N0XL 3BYYA 2R0LH 43C9B 3RUGE 4JG1H 3FFCD 3NPZB 5KSUB 2APTA 2QADB 2CR6A 5I6XC 4YR6B 3IDMA 4IIQA 3CMOH 3S34H 5K59E 3QFDB 1HQRA 5JLZB 1NEZG 1SJEA 4KKAC 5LAXB 4UT9H 1T04A 2FHFA 1JWMA 2YK1H 3MLWL 3MSPA 5DR5L 4LSPL 1T0NA 2RB8A 4EDXB 1RK0A 2YRPA 1EBAA 3UEZA 3I02A 2R0LL 4Z0BH 1X5JA 2EYSA 2C3XA 3PDDA 4KKBD 2BY1A 1FLRL 4OD1L 4TVPD 1FQ9C 3BKMH 4MQXC 2ZUTA 4FG6D 1D5XA 4WFEE 3R0NA 3D39A 1IILE 2V5TA 5AZEL 4ZFZB 4NQDD 3VFOA 4WEMB 2DMCA 1TJIL 1S5HB 2QQLL 4GG8A 4J3WA 4NKOA 4FFZH 2HFFB 3IU4L 3QCUH 1MCOH 5C0ND 5C0FA 4HCRA 4OFPA 2BNRB 4TRPH 3P73A 2V9RA 1I85C 3MJ9A 2AEIT 2AEPH 2VZUA 2FL5B 5DJXB 3I9GH 1U8JA 3I6GA 3GI8L 1KPRA 1A7OH 1FYTE 2ZZUT 5GS0L 4HJGA 4UOW1 1V05A 4ODSH 2V5YA 2HJFA 3DROA 2HTKC 4JZJC 3L9RA 4KAQH 4HFWB 3U83A 3GKWH 1G7LA 4MMXC 2Y5TA 1FC1A 1SYVA 6FABL 3H9SA 4U31A 1UG9A 3I6KA 4WTXA 2NXZB 4N8VG 4OD2B 3IFPB 4UT7L 5EH1A 1MFCH 2UUDH 2DQFA 1UJTA 4XGZA 4NO2A 1JPTL 3OGCA 2KL6A 2OS7A 5IBLC 5FKAA 3NFSL 1JPFA 2CR3A 5C0DA 3CDFA 5DJZB 4PJDA 1I1FB 4PD4K 4JHBA 4TUOB 1QR4A 4P2RA 3ULUD 3AS3A 2ZKHL 3ILPB 1G6RL 3K74B 4G6JH 4XNMA 2I24N 3IDGA 4F58L 4KROC 5F6IC 1UXSA 3RDTB 3LEXA 3IFOB 4PJCF 5FECA 1QQDB 4EQ2A 3ARVA 2Z0BA 4DEPB 4BSVB 3KPPA 3W39B 1RIHH 1X4YA 3ZYJA 1IC7L 2UVEA 3G6JA 1JYVA 5IEKA 1X5FA 5E9DA 2QEJA 3QT2A 3E6FA 3UPCA 2J8UE 3EJZD 2R15A 4HFWA 1N2RB 3RZCD 3KPMA 2AV1A 4O2CB 1G7LB 4RA0C 1YY9D 5GS2D 1IQDA 4EDXA 2HT4C 1K5NA 4GBXB 4JG1L 4M8QB 4C59B 5DHYB 1XH3B 5TE4L 1RJZB 5I75B 3L5IA 3O2DA 1NGZB 1S9VA 1INEL 4Y88A 3QDGE 5FO7B 1QFWH 2H9GA 3IDMB 4IIQB 4R90H 1P6FA 5F97E 3D25B 4ODWA 4TPRH 4TSCH 3WXWH 4U1NB 2P42B 4G80A 3VD4A 3DTXA 2D2OA 3O4LD 4EUPB 3NCEB 5FV2A 2WAHA 3B9VA 3RI5F 1JNHA 5CP3H 5BS0E 4I48B 5DURD 3ARBD 4YX2H 3TP4A 3C8KA 3OV6A 4YHKL 4APQD 4O2EB 4ZUUB 4ZYKA 1QBML 5C0BB 3GSRA 3GHBL 4KI5F 4M6OL 4LSDA 4JFYA 3VFPA 3TCLA 1LP9F 1MJ8L 2J4WH 5DK0A 1OAYL 4IIQC 5J8OA 3UC0L 3B8YA 3VFUB 1O7VA 3GSQB 3P0YL 1QG3A 3HC3L 2VB5A 1F6AA 2VLRE 3PNWB 1CK0L 4QWWC 2QV2A 3T0BA 2FSEB 1EHLH 3GHBH 5EOCJ 1HYSC 1BVLB 5F7YC 4LIQE 3KS0H 1RUQH 5TE6L 1AC6A 4MA1B 2JJSA 2YMXH 4GW4B 2NY2C 3WIHL 2K7QA 4CGTA 4KK5C 3QFJB 5I0ZA 3CFEB 1ONQA 2YPKA 2FHBA 4E41E 1E4JA 5EZLA 2BERA 4BH7B 1KBGH 3LMJL 4NNYB 1ZVSA 5GS3A 2OL3L 4LU5L 5CHNA 1QZ1A 1NBZA 1B0WA 4UBDD 1F4WL 3FQUA 1F00I 1J0KA 2VH5L 5J1AB 3G5YA 4OGYL 3S35X 4HC1L 1X7QB 1IGTA 3RFZC 4MNHA 1BVKA 5E6IC 4KJYA 3DX9A 3EHBD 1JK8B 4LF3A 4G8IA 3SDDC 1CGSL 3ARDB 4NZJA 2Y4SA 3ARQA 3QQ4B 4R7DB 5IMMA 3FO2A 3VWJC 4PJ5E 1F4YL 3ISWA 1P7KA 2I5YL 2DJSA 2Q3ZA 2A83A 3DNKA 3ARGB 4S1RL 3FQWB 4N5ED 4HIEB 4I3SL 4JQXC 3RWIA 4LLWB 1N26A 4OCRH 5T3XH 1AQKH 3C60C 1P5UA 4QTHB 3C60B 2VDLL 3KNBA 4GBXD 2X4UA 2EE3A 1KIPB 4JN2B 3RA7L 5I73B 3F5WA 4NNPH 2H26A 1XGTA 1RZ7H 3BQUC 2HJFB 3O8XD 3N9GH 4L3EE 3RL2B 5F7EL 1GZPA 3DVNA 1W0YT 2VWEC 3HB3C 2GTWA 3PDOA 4U33A 5E9DD 3CIQA 1W8NA 5JPNB 4MJIE 2WIMA 5BV7H 4KH2A 4ODTL 1ZA6B 3HE6B 4MX7B 2YD6A 3PWNA 5C08B 4K7PX 3CCHB 3HZKB 1J8HB 4YAQA 1FC2D 5GIRB 2VZVA 3V4UH 1I9EA 3BD4A 1FH5L 3BYTA 5IROA 5GJTH 2A38A 4MHHG 3RUGF 4UAOB 5F7WC 4PGBA 4LVNB 1I3GH 5SWZB 1YMHB 4XP5L 3SGDI 1HNFA 3PWLB 4AENA 2AQ1A 4YHOL 3MRMB 4DW2H 3OF6D 3B8SA 1BWWA 1MJ8H 4RA3A 1QKZL 4JHWL 4NC0B 2CRYA 1I1AB 3CMGA 1P1ZA 3QIBA 1ZLSL 4FS0A 3PWPA 4PJ9D 1OGTA 5E8NA 5DD6A 3ZDYF 2R69L 3L3DA 1PKQB 1BF2A 4OLVH 5JDJA 1CS6A 3GSNL 4LHUD 1F6FB 2BSSA 3BUYA 2GKIA 5I71C 3KPOA 5GGQH 3HE6C 1RUQL 4IJ3B 4MYWB 5IWLC 2BMKB 1TZHB 4JQIL 2PXYC 4UV7H 4OLYH 1KACB 3HRZA 1J0IA 2CGRL 5BVPL 4R97C 3UX9B 5D1XB 3T0XA 4GKSA 2HT3C 1NCBH 1DCLA 4LP4A 5AUMB 3S4SA 5KVFH 1J12A 2W59A 1GAFH 1ROWA 1A1MB 3RTQD 4KRPC 5I76B 1IAKB 1NCAH 1TJHL 2D4DA 1G7PB 1C7TA 5J6GA 3LIZH 2VZTA 2EZ0C 3ME0A 2EKJA 2V5MA 4FFWC 2AV1B 2IPUG 1KGCE 1VPOL 4JGUA 5ELIA 3MFGB 1M7DB 1FZOA 5EU6D 4JFQB 1NCBL 3FFDB 4FQ2L 4XP4L 1RFDH 4M1GL 4XPBL 3T1FB 3QQ3B 2OTPA 4LLQB 2NY1D 2D7QA 1QUNA 4ZOAA 3HS0A 5GGRA 1JYNA 5E8OA 1RUKL 3TIEB 4RGMC 5IKCB 1ZT4B 3CDYA 4JM2A 2ILLA 2BVTA 1JHKL 1H3VA 4MX7A 2VDMH 5TJWK 4GRMB 2NYYD 1E28A 4IRSB 3IDGB 4OLZH 4UNTA 5FGBC 3N85H 1UH2A 3QIBC 2IQ9L 3F7RA 3QUZA 4RRPG 4R4BA 4WTWA 4YO0B 3RL2A 2BNUB 4JB9H 1J05B 1IC4H 4M61A 4K3HA 2ZUQB 1IGTB 4AM0A 2QTEA 4GW5B 5CIPA 4RWYL 1FL6B 5BXFA 3L6FA 4H0GA 3W2DH 2MOVA 5EU4A 4NDMB 2C4XA 3RWIB 5IIEB 1FH5H 3KJ6H 3K1DA 1CTOA 1W0VA 4MNQB 4ENEC 4AEIH 2Z91A 5HTSA 3FT3A 4M1CD 1MREL 4NUJB 3IKCA 4Y2OA 3L9RB 3L7FA 3PHSA 1YEFL 2XWTB 4D9QD 4G6AC 4OD3H 2F74B 12E8L 2FLBT 2PR4H 3GO1L 2CK0H 4FQQA 3WFHB 2YD3A 1A21A 2XT1B 2I25N 2W65A 3LQAL 1AXSA 4U49A 3VG0L 4L4VB 1C7SA 1OAXL 3VXUD 1DQQA 1A4KB 3SGKC 1A7RH 4N8VB 5B3JE 1YEKH 3GMRB 3QFJD 3QXDB 1FL5B 1I9IH 1KG0B 3SE4C 2F5BH 2XZZA 1N64H 4GRWH 1NUDA 1QLRA 3GBNL 1MCPL 3IDYB 4M6ML 4OLUL 1YA5A 2CDEA 2J3SA 4I9WE 3QEHB 4JAMB 1FGNH 1WAAE 4U2ZA 1F90L 5T1LB 5L2JB 4C57C 1I3GL 3DRTB 1IQWL 4C4KT 3DGGA 2OMNA 3MRHB 4OUUB 4U7MA 1O5DT 3QJHA 4PRPB 2PUQT 1GVIA 1I9IL 5CZXD 5GSVA 2PTVA 3JWDH 3REVB 4NP4H 4XH2A 3GNML 2E9BA 5IMOB 5ESAB 3HMWL 4IOIA 3UTSD 4LP5A 4QRRA 4M93C 1FFNB 3OKLB 4Q6IC 5D7KD 1PZUB 3F7VB 2PTTB 4QYOB 4EBQH 1WISA 4WEUD 1AE6H 1MOEA 3T4YB 3BDXA 1SJHA 1WWAX 1WCBB 3DWTA 5D1ZB 1T1ZA 4LMQI 4OB5L 3HNVL 2AXJA 1O7SA 4HIIB 4NZUH 2VLMD 3DURA 2BCKB 1BAFH 2PN5A 2X4NB 2IMNA 2LFGA 5HHNB 1WV7T 3CZFA 3MV9E 4XPHH 4XRCB 5SWZE 2HFGL 3FHAA 3NIGE 1TVBB 1XCTB 2XN9E 1I3VA 2MNUA 3DUHA 4UOJA 3BESR 5KSBB 4K8RD 4EQ3A 1W72L 4K9EH 2ICWA 2EDQA 3TNMB 3TBSA 2VXQL 5CINL 5E0QA 1YY8A 4K07A 4X5WA 2VDKL 1WLHA 1M7IB 5SWQB 1KV3A 2EE9A 4Y4FC 3BZDA 1B9ZA 2NTFB 5H35A 3Q6GL 2VLKD 5DUML 1F8TL 2E7MA 2APWA 1KUMA 2IPKB 2AI0H 2YHGA 1U3HD 2Q7YA 5E8EB 1I8MB 4JREC 1TETH 4C56E 3D3VB 4YHMH 5IMLA 2DQIH 2PW1A 5JW5B 5C71A 1PJ9A 2C7UB 4KK8C 4XBPA 4FQIH 1M7XA 5IM7A 5GISL 1R24A 3QH3A 2YXFA 2P44B 2VWEE 3NPSC 2F15A 2BJMH 5D8JL 3DURB 5HYFA 3HAEH 4YHYB 5TDNB 5E03A 2Y07L 3TZVD 4KZEL 1YMME 4OZHF 5GGVH 3U0TA 3AREA 5T1KD 5ECJE 2AJUL 3HPJA 4KK8D 2Z4QB 3IFPA 4B7LA 3QIWC 1FCCA 4H8WC 5BW7A 5IFAL 3MCLL 1QOKA 4DAGH 5D8JH 2J6EL 1F2QA 3KPRE 4L8SA 5KVDL 1QEWA 1T1YB 5E56A 2VL5A 3Q1SL 1OY3B 1WWBX 1FVCB 2ESVD 5H94A 4UILH 5D1XD 5EO9B 3V5HA 5JIPA 4OCNC 5SWSA 4CVXB 3TIDA 1YEJH 3MNZB 1OSZB 5TDPB 3VI3E 5F93C 2J6EH 3HMXH 4WNQB 4CL7A 3MREA 4J3TA 1CFSB 4KJQC 4JFFA 2XTJE 2YR3A 3O11B 5E8DH 5IV2B 1C16A 1CYGA 4LLAA 3QXDA 5ICXA 5D2NC 3FCTB 1LEKA 4PJCB 4AEHL 3ORJA 3FB6A 1TDQA 4FQQB 3TV3L 5DO2C 2VDQH 3D39E 3TPUA 4G7YL 1MCLA 1DZBA 2AJSL 4NOFA 2YBRB 2AAVA 3UDWA 3FQNB 4P2QB 4QHNB 3IF1A 4MDJA 3Q5OA 3BPNC 4PJCE 4JFZH 3QP3A 1SM3H 3PGFH 4QTIL 3STBA 1J8HD 3IJSA 1E4KA 4M7KH 1GIGL 3V9FA 4R0LA 1NLDH 1BF8A 3IU4H 1K8DA 4U7SA 3NBNA 2A6DA 5IR1A 4EBQL 1F8TH 2DI9A 1D9KA 1FAKT 1TQBB 3HI1B 2X89A 5JW4N 2EDJA 4P46C 3I85A 2P45B 2W65B 2NY6D 1URLA 3V4VH 5AD0B 5IF0B 4LVEA 1NBVH 5JIIA 1J8KA 3OPZH 2MQCA 1VPOH 5LWYH 4UT9L 2IWGA 1IEAB 4ZS6D 3WLWD 1MIEL 4NO0B 3MCG1 4XWOC 1WTGT 3X14B 1LEGB 1EZVY 6FABH 4X99B 2VLJA 3O6ML 4P3DA 3KVQA 3K3QA 2WWMD 1DN2A 1XGRB 3F5WB 4YDVB 1A8JH 2EDBA 3MNWB 4Q6YA 1OP3K 1U41A 3CNKA 5GGUB 5INDA 3JWNC 5E94A 3VG9C 5F6HJ 1FFRA 1QBLL 2IPKA 4R26H 4GW4A 4UINL 4WU5B 3SDAD 1S7XA 1T0PB 4NJ9H 2IQ9H 5CKGA 3WEXB 4AYFA 4GT7A 5I18L 2CLRA 4ZAKC 2FGZA 5C0IB 5IQ7L 1MCSA 5F72S 1AGBB 3P4NB 3F7QA 2ED8A 2DQIL 2OM5A 1BJ1H 3P4OB 4FFVD 5JW4Q 5CBEA 3VXNB 2YPVL 4HUVA 2D03H 3MR9A 1DBAL 4PY7A 3T4YA 5GRUL 4X6EA 2QHRL 2JJTC 1KENH 4HXBL 1K3IA 1MCWW 2X1OA 4KZDL 1MCCA 4DGVL 5BS0B 1S7RB 4XNUL 4JFFB 3GK8L 3GSOA 4LBEB 5E2TL 4JZNB 3AREC 4CW1A 1T0NB 4LDOB 4ZXBD 1JV5B 1WFTA 5GJTL 2CK2A 5T1DH 1QSVA 1P2CB 4M7ZB 1J88A 1MWAB 3DX8B 2DS4A 3L5XH 4PJAA 1QSZA 2NY3D 3F7PC 3PHOA 1DLFH 2IH3A 4LGSB 4WFFE 3VGAC 3BE1L 3MYJB 1MUJA 5KVEH 5L0QC 4GKOA 5IGXH 2YSSA 3OR7A 2R69H 3OG4B 1YEJL 5KOMC 3VXNA 4CKVX 1WEJH 5DVOA 5FYJL 1SVZA 3KAAA 2XZQH 3O6FD 1I1YA 2ZUWA 5GIRA 1ZTXH 4HPYH 1H5BA 1AHWC 2XTJC 4TULL 3HRPA 4X6EB 4PG9A 4ZO9A 1EVTC 3OKDB 3GSVA 3QISA 5I19L 3GI9L 1L0QA 3F58H 1XF2A 1AR1D 2H1PH 4NN5C 2Q8BH 3CUPA 4DGYH 4KY1H 4QCIA 3PGCB 3BHBA 4MJIA 3LKRB 4N0UA 4P46A 3K81A 4PJEA 1NL0H 1A22B 2BHUA 1DQQB 5D93C 4RMQA 1PSKH 2PXYD 3SKJL 1MHHB 1P1ZB 2FLRT 1VEPA 3UCRA 1T03H 3NOIA 2VLKB 1UJ3C 1IKFH 3GJFA 5CMAB 3V5DB 3PV7A 1AXTL 5EU7E 2X70B 5EUOE 1A6WH 4JFOA 3PWJA 2CUIA 4N0FA 2O61B 2VZ1A 2Q8BL 1CG9B 5ID1B 1IKNC 3LEYL 2VERN 2A1WL 2ZSWA 3N0PB 3SDDB 5DJZA 4PJIB 3EYFB 1YEGH 1NAMH 1IFHL 1MCFA 4DK6A 1HHKB 4LU5H 2AQ3A 3KPNA 3UTPD 4ZNEA 3VFTA 4LCIH 4ISVB 3W0WE 4WU5A 1UQSA 3WCYA 3L3IA 2BRRL 3O0RH 2DDQL 2VKWA 4G6FD 3SKOA 2UYLB 2J88L 5E7FA 5JO5B 1OM3L 4WUUE 3QI9B 3MXVH 3UPRB 3F6IA 3NFNB 5CSZB 5I0DA 1IGIL 2VABA 1VGEL 4UUJA 2AK4E 2P24B 1LK3L 2P46B 1U3JA 4GXUN 4OCSL 2X1WL 4GRWF 2NY0B 2AEQH 3OTTA 4S0SD 4AH2B 4UI2A 3BKJL 2ARWA 1KPRB 1K8DB 3HE7A 1ZS8B 1QYGL 5I1JH 4XNUH 3B4NA 5GS0H 1NAKL 2XZCH 4BM7A 1EJOL 4JZOB 2ADIB 4NBXB 4K94H 3FQNA 5BS0D 5JXAL 2VH5H 1KJ2B 4JM2C 1HKFA 4PV8A 3VDAA 3S9DB 3U7YH 1M71A 1TCRB 3VFWB 3EOTH 1N3NA 1G9NH 4LSUL 3IJSB 5EU5B 4RFOL 4KI5C 5HVHB 1B90A 2X4SB 3FO1A 2N7AA 5EG6C 3BE1H 3NN8B 4W81A 2YOCA 5FFLA 4IMLB 1Z9LA 4KKNA 2AXFA 4NNXB 5JHDA 3NZ8B 4PJ9B 2A73B 1VKXA 1E6JH 1GHFH 3WS6A 2BNQB 5D1ZA 3U2SA 3EYUL 3V95A 1UA6H 1Q9LA 2QJDA 4ODVH 3TO4B 2O5XH 5IMKA 4CVZA 4DW2L 5DD1L 2DQJH 2I07A 1H3PL 1QP1A 4BSWB 2EDHA 3TFKC 4NKQB 5TQ0H 3KDMB 1KOAA 1U8HA 1NKOA 3O6FA 1Z3GH 3O3DA 2GJZA 2WMPA 4LQFH 1XGQB 1F11B 1PG7X 3U82B 2ADGA 3U0TB 1IC5H 2AV7A 5I1DA 3W5NA 2F74A 1A0QL 1DBKH 3WFHA 4IS6B 5HYEA 3DARA 1LO0H 4NQXA 3FO9A 4QXWA 5MENE 3DMMD 5F1OB 4JKPL 2Q8AH 4OGZA 3VJ6B 1GGBL 3DLQR 5GS0D 5F3BA 1P4BL 4G43B 5C2BL 4Y1AB 5LGKA 1JRHL 2VO5A 5IMLB 4WIQA 1GGUA 1CFNB 4OLXL 1IC5L 4L9LB 5DRZA 3FQRA 4PJHF 4RAUA 2IADA 1VFBB 1PLGL 3G6DH 2WLZA 2BK8A 5IW1B 3R1GL 5C0EA 4KUZL 1UM5L 4JFFE 4QRSB 4ORZC 3CMOL 3QUYA 4M1DH 2ZSVB 3P0VL 4N8CL 5KVGH 4HS3A 4OUOA 3D5OF 4Y89A 3GKWL 4UV4H 3EW3B 4XPGH 1BAFL 3LN5B 4HIEA 5EU6E 2VRAA 3H2WA 3WBDA 4OGAC 5H37G 5EUKB 2O93L 1HH6B 4MQ7B 1E4XH 2L7JA 1RZKC 3CVIH 2HP4A 4JPIA 1BQHA 2AJZB 4ZO6A 4Q58C 3VFSA 1JIBA 1LNUB 2BFVL 1FL3A 5DHVA 5HYQB 1IFHH 1JGEB 1F3JA 4OLZL 3RZCC 1XZ0A 4QRPE 1EHLL 4NZRL 3LHPH 1BQUA 2HKHL 2Y6SD 5FB8B 1M05B 5AEAA 5DS8B 3SE9L 4Y4FD 3U4AA 1ZVSB 3QDAA 2J8UA 2DM7A 5KSAD 3WJJA 3MUZ1 3V6OC 4DN3H 4OV5B 4WDIB 5IVNA 1Z9MA 4OFKA 3KJ4C 4QGTA 4F37K 4M03A 1BBJB 1XF2B 4EI5C 2B20A 3O6FB 4QO1A 1R5IB 5EULV 5A2JH 5CD5D 4N0YH 1Y0LB 1UA6L 3V5KA 2O5YL 3FT2A 1FNGA 5K9OA 4OZFA 2FECI 4QXGH 1DANT 3H9SB 5HJ3B 3LEVL 4OZFG 1OGAE 4KHTH 1U8QB 4YUEH 2HKFL 3K2UH 2EDDA 4JKKA 4R6UA 5F1KC 2VZSA 2GW5A 4DN3L 2ZP0T 2BSED 5CEZD 4M7LH 2RCSL 3VRLF 5T3ZD 1FSKB 5LAXA 4JY6A 3SCMD 3SKNB 3RVTD 4FHBD 1YEHL 3KPRD 5HGAA 4PRBA 1MQ8A 5MI0B 1FO0A 2FX8H 4XHJC 2ZNWA 15C8L 3QCTH 5TFSH 5I1DB 1AQKL 2C1OA 4JKPH 2W0FB 5C0FB 4GXUM 3FB6B 1LO2L 5JOPE 5FO8A 4XC3L 3U46B 3JWDC 2VE6A 3LS5H 3JV6A 2DQEL 4M7LL 5A16A 2WANA 3DPBA 1BFVL 5B38A 3LV3A 2MKWA 2YPLE 5EPMB 3WHXA 2CIKB 2K7PA 4Y4HA 1J9CT 4MJ2A 2VC2H 3VXRE 4PG2C 3U2SB 3H3BC 3PWNB 4QNPE 4KKCD 5C08A 2OTUA 2Q7NA 2O5XL 4DZ8B 1BFOB 1DJSA 5D7IB 2JB6B 1H3PH 3RRQA 4NHCL 1A3QA 1KIQA 4L5FL 2FX7H 1K3ZA 4YDLB 1S78D 4YDLC 3LN4B 5I1HL 2NX5A 4HWEH 3GBMH 2J8OA 3VG0H 3BMWA 1F2XK 3TT3L 3MRMA 5E99L 5EOQL 2ENYA 3QULB 1JPGB 1VA9A 4F15C 2VAAA 1JHLL 2Q8AL 5J6HB 4D0CA 1T1WA 2LVEA 2PF6A 3VFTB 3S3JA 4XMKL 5DO2D 4PJIF 2XN9D 4OLVL 5D7JA 3BJLA 2E7CA 2ICEB 3TO2B 4JFHE 3IXAB 2NW2A 4PJHE 2UWEF 4XP4H 4PJ7E 3RVUC 3BP4A 3UAJC 5E99H 4ODXB 1ZVYA 2LTQB 4HQQH 3OXRA 4X7EC 4ZFOA 1IQWH 4JLRB 1S7TB 4YPGA 1WTLA 2N4IA 3QUZD 3L6FB 3K7UA 1DR9A 2DMKA 2Y5TB 1R3LA 3O4OC 3L3GB 3BXNB 1GZQA 1YYLH 5D9SB 1EEQA 1OAQL 4XVUD 3T0EA 2B2XL 3HZMA 2VLRD 2Y36H 5DD3H 3TJHC 3FOLB 2BNRD 2JCCE 3S88L 5KVFL 1LEIA 4GAYA 1CQKA 3MGAA 5E2VL 1KJ2H 1IC4L 1LO5A 4IRJD 3VI3F 4WW2C 1TETL 2PCPB 4C56B 1VFAB 1QFPA 4RCAA 1CE1H 1R0AH 1Q0XL 5I2IA 5C0EB 5IW1A 4HJGB 1OWWA 3JV4B 4JZJB 3ARWA 2FO4A 3RIFK 5INCA 1YQVL 2VXUL 1EXUB 3QQ3A 2F54D 2V17L 1JGDA 3N9GL 4WUKL 5FUOH 5J7CC 5E2JA 3WS3A 3O6LH 1CG9A 4UNVA 5FYLH 4QF1B 3WLBA 5AG8A 3MBEC 1MREH 2NR6C 1K4DB 4NKOB 2B5IB 2NXZC 1E6OL 4NZTL 4TQEL 4F57L 25C8H 1Q9WB 2D7PA 1W72H 4K9EL 2VDNH 1TPXC 4OBSA 3TM6A 5FO9B 3KPSD 4DUXA 4LDLB 3SOBH 4WRLA 3O4LE 3NAAL 5JXEC 3CLFL 5IBUB 3PL6C 1QFUH 4QEGA 1F4YH 4QY8B 1A7QL 4XAWH 3BQUD 3BRFA 2ZPKL 1U8IA 2R1XA 1I8IA 2O5YH 3BPLC 1ZWIB 1NBYA 3VD9A 5MEPB 1PVHA 4JFEA 2VLLB 4EN3B 3OR7B 4CMHB 1C12A 1EO8L 1NAMB 3LDBC 2E7BA 3U1SL 4APQA 1I8LC 1AGFB 1BIIA 1OB1B 2HYMA 4HT1L 1FFQA 3HG1A 1L9NA 5F7LB 4FQLL 4PS4H 3VW3L 4UQ2A 4OTXL 4X4MA 2NY4D 4M5YL 5FO7A 4X7FC 2B5IC 4X0KB 3P4OA 3VWKB 2BVYA 4MWFA 1CDBA 3ARRA 3ZE0F 5DVNA 4Y8DC 1EHAA 5CEXB 2OJEA 2ZOKB 5IBLD 4DKFH 4C83B 3QHFL 3EO9L 5ISZD 3UBXG 1SMAA 3SDYL 5FM8A 1Z5LA 1PG7H 4XB7A 5J06A 4OF5A 3PQYE 3NVQA 4Y5YC 5D7JC 4WJ5B 5BO1H 2V9TA 1TJHH 4HKJB 4X8XA 4YDJB 1Y6NR 1HSAB 4AY0A 1OTUD 2QSQA 2BVQB 2V2TA 3EYQD 5A2KH 1FNEA 1CF8L 2XN9B 5AYUL 1KB9J 4YBHA 3S34L 4L8CA 3KPQB 2EIEA 1CFBA 3S5LB 2CO6B 1FHGA 3RVXD 3C08L 4ESKA 1IL1B 3BO8B 5KAQF 1WT5A 2G60L 2R56L 4R9HA 5C0RH 3DXAE 3U48A 5D5MB 2A83B 2AJ3A 4RX4A 4H1LA 3PHQA 5GGQL 2IPTH 4PJFF 4WI7A 2P24A 4NFCA 1NJ9B 4G8EB 5HGBB 2CKNA 2A1WH 3NA9H 3QEUB 2BY2A 4HUUB 5JPMB 4GQ9H 1S7TA 4YPGB 3MGTA 2BRQA 1TITA 4LCUA 3S6CA 1NGWB 4LPTA 5D7LB 3AGVA 4BSVA 2Y06H 5C0RL 3FRPA 3TO2A 4P59L 2ZG2A 4G7YH 2D7TL 3I6LE 2NX5B 3I6LD 3CH1B 1MHHA 4QLRA 4XP9L 5GGSY 4PJBA 5CS7A 4JLRA 2BSRB 3O4LA 4LPYA 1PGRB 3P9MB 3VI4F 3K4DA 4OM1L 3K8MA 2BNRA 2UVFA 5I9QB 3ARBC 1ONQB 2EICA 3NAAH 3QG7H 2DBLH 2X70A 4GAGH 3QUXB 2JJWA 5HYJB 3ARSA 4MNGE 2IADB 4KQ3L 5LGHH 2A77L 5HHOA 3VCLA 1FFPA 2P5WB 2C3HA 2RIKA 1G6VK 4GUPA 4DVBA 1D5XB 4OD2A 5D6DA 32C2A 5KBNC 4G7VH 2ATPB 4A6YB 1QLEL 2X1XR 5FIEA 3SE9H 5D1ZD 2YXMA 1TZIB 2XQBH 3LPWA 5SV3A 4NKMA 1M4KA 2JELH 3TYFA 1LP9B 1WAAF 1ZHNA 4NUGL 2FEEI 4NWTH 2DRUA 4C83A 3TCLB 5FYKD 4EI6A 4NQXB 4KMQA 2MCG1 3ZT6A 5DD6B 2UUDK 4HIXL 1S9WB 4I0PB 1CTNA 2GJ6D 3EOTL 1JNLH 1SJEB 1JBJA 3T0EE 3U46A 1MRDL 1OGAB 3GJFH 1RHHB 3QR2A 4GG6F 4KXZH 5AUMA 1LEKB 3QI9C 5GJSL 4Y4HB 1JNNL 1P4IH 3MLTB 4HWBA 4MQXD 2BP3A 4F7EA 1OAUH 1SEBA 4P46D 3MNVA 2WP3O 4APQB 5C3LD 4KXZI 3MRBA 1RJZA 4XX1G 1DN0B 4KK6C 1JUFA 3HPJB 4RGNB 1TMCB 2XA8H 4HKXB 4UDTA 5D7LD 4ZFOL 3QQNA 2H8PB 3F6LA 1TZIA 4Q2ZA 3PABA 3D2UA 5FO9A 5ACMA 3IVKB 2OR9H 5HY9B 1I9RH 3FT2B 5DT1H 5K9OB 4JKWA 1MJ7L 3SJVA 1CR9L 1T1YA 2C5DC 5DGQA 2VISA 4G3YH 5EU7C 3RIAF 5FGCB 2FWOA 1RJCA 3IDJA 3ULSB 1U93B 1DBKL 1PY4A 3EDEA 2QR0A 4OLEA 2V7HB 4P9ML 1C8PA 3Q6FB 4PJ5D 4F7TB 1JGEA 3STZA 1I1AD 3H9SD 3DETD 3P11L 4PJIE 5EFIB 2W0KA 2OXGA 4O5LH 2FX7L 1FZMB 5I1EH 3FAXA 1UM4L 3ZKNC 1T4KB 3MCKB 4GBXA 3K80A 2CIIA 3CCHA 4HEME 4LL9A 5D93B 5FK9B 4ODHH 4NO0D 4QHUB 2HFGH 2Z9TA 2VJXA 5T5FL 4HUWA 4BQBA 4R7DA 1BOGA 3MA7A 4J1UA 2B7DT 1H9VA 5IEKB 5DUPH 1A6ZB 4GW5A 4NM8H 5C0GA 2OZ4L 3SDAA 2IAMB 3DYMA 3FOMA 3MUHL 1PQZB 1RK1B 4GSDL 2ZCKL 1YN6A 5BQ7B 1KLGA 4RISH 4HPOH 3IVKA 2VXVL 4XCFH 1MNUH 2DQTL 1XR9B 3E2HB 3B6SA 2V9QA 4CMHC 2AJVH 2FX9H 1G6RA 2AK4D 2IFFH 4G43A 4XTRC 3RPIB 5D6DC 4E42A 4L3AA 5E1AB 3DROB 5D7SH 5D7IE 1WCBA 2H6PB 1UWEH 2P5EE 4Y16D 2XFXB 4LIQL 2F54A 4L4TD 5D2NE 3TN0A 4AZ8A 2B4CC 5AYQA 3OGOE 4X5LA 2BXYA 2YK1L 1JPGA 3MLWH 4AQOA 3ARGC 3S5LA 1AKJB 4P2QD 4YFDB 3B2UC 2ERJB 4FQJH 2NY1B 1F4AA 4OBRA 4M1GH 4XPBH 5IHZA 3ZKMC 5E2VH 5DJCB 4R2GC 4YHLL 4P9HL 3FFCA 4JY5L 2CLVA 3V6ZB 4Q74A 2Z31B 5DMJB 4ZXBA 4LCWA 5SWSD 4JR9L 5F96L 2XZAL 4PJGF 5CEZL 2XQYG 4HIJA 3UJJL 2VR4A 3PABB 4ZDHA 1BFOA 1FVDB 1AR1C 5B8CB 7FABL 4RZCB 1G9MH 5FYLL 3MLYH 4HBCH 3RTQC 4X80H 1EERB 3TNNB 4X6CA 3W11C 4WTZA 5JA8B 3C6SA 4HUKB 2HTLD 5A16B 1YNLL 1JYWA 4NQCB 5D2LE 4S1QL 2X1PA 2OR9L 1I7RA 3EYVA 2GUOB 1N5AA 1VB9A 4CVWA 1IGCH 3ARFC 3GMLB 4P5TC 1KTDB 3WJJC 5L2KE 1AY1L 3RNKA 4IRJB 1HZHL 5I18H 1S9WA 1YECH 3P4NA 3AU1A 5I1JL 5KSVB 3D3VE 1HOCB 4PBXA 5CSGA 5E00B 5DJDB 2P8MB 3OAUH 4O2CA 4OSUL 4XBEH 1AC0A 3QNZA 4M8QA 1JZ2A 2P5EB 2AK1H 1CVRA 3GMRA 3RVTC 1LP9A 5FYJE 3ESUF 1KG0A 1INQB 4KK9D 5CLTA 2H32H 3VFMA 3OAZK 4X8JB 1NSNL 1SY6A 1K6QL 3HZMB 3QUXA 4PJ7F 5T5NG 5HYJA 2P7TA 4BH8B 1RU9L 2Z8SA 1FFPB 4LPUA 4F80A 3BKCH 1J1PL 4CADA 3V4PH 3KPSB 2GJ6E 5KW9L 3PE9A 3V6OE 3BDYL 2NCMA 5GQBA 2HWZL 3MXWH 4K3JH 4MD4B 1GIGH 2Q7YB 1HCFX 4OF3A 4RISL 4ENED 4U3XA 5EZIH 5T1MA 1NMBH 1MEXL 5ADOL 4YNYB 1VGKB 1YY9C 1LO4H 5IM7B 1R5VB 2DBJA 3WJLA 1JZ4A 1N59A 2Y7QA 4S1DC 4Q97A 1G7IA 2D9CA 3ROLA 5FUZL 3MZGB 2UZXB 2D0FA 5K9QG 1G9EA 2BC4B 1PX3A 5KVGL 2WP3T 4N0CD 2FBJH 4JO1L 2DD8L 3F12B 3ZL4L 4AM0B 2OL3A 4KVNH 3OHXA 3A0OA 1C1EH 1T5XA 1MLCA 2CKBB 3F58L 4NQDE 4QRPD 3BWAA 3ARDA 3QIWA 3CVHA 2FL5A 4MS8D 5DJXA 4P5TA 3P3YA 2XRAH 5DFVD 3RWHB 4HK3J 2VN4A 1T1ZB 1IAIM 1VGEH 1YNTA 3VDBA 5IHUH 2AGJH 1DN0A 4XAKD 3TH3T 3NCBB 2IBGA 2DICA 3KPSA 1KN2L 2DI7A 3ULUL 2V2TB 1NGYA 3WKMH 2DQTH 4I77H 1D6VH 5GGRB 4XVUC 4DCQA 4BFIB 5ID1A 1I7TA 4FP8H 1I1CA 1MJUL 4CMMA 4WWKD 1MFCL 3KWWB 2C1PA 1DVFB 3O9WC 4P3CH 4Y0GA 3HZVB 4WNQA 5D1QD 1A7PL 3GKZA 3MA9H 5KS9F 3NFSH 4OCXL 3P0YH 3QUXC 3QNZB 3BUYB 4CVXA 1CK0H 2AXHA 3C2AL 4GJTB 5CEXA 1L7TH 1FVEA 3NTCL 2E27L 4ZODA 3O6MH 5JOFB 4A2LA 2ESVA 4YHLH 4ONGL 1NC2B 1KCRL 3RNKB 5L8KB 2MJWA 1QEWB 5B3NA 3O3AA 5HDQL 3M1BB 5HYIA 1MQKL 5C9KA 4GLRH 4BZ2L 1KFAL 1A2YB 3SDXE 1CBVH 4DOHB 3OKOA 5DZNA 3HRZB 1CFVL 2ZUXA 4HC1H 1NBYB 1KJVA 4EEEA 5MEQA 5JW4R 2RFXA 3THMH 3UJIH 3NACH 3S36L 5KG9A 3I3DA 5TE7L 5BOPA 4X7SH 5I17B 4PBWD 1M1SA 1OOAA 4HGWB 1GGCL 1Q9WA 2A6JA 5HHMB 4XCYB 3BJ91 4DAGL 2GY7B 4A6YL 3PJSB 3E2HC 3I3BA 4U1NA 5GRXG 3H7BB 4QRTA 3RX7A 2LQRA 5IIEA 2A9NH 4OM0L 3GK8H 4NHCH 2AKRA 3K2MC 4TTDC 3GBLA 5CJ5A 2AK1L 2FBJL 3BP6B 1G9NC 2NW3B 4B41A 5I1IL 1QACA 5EBWB 4ZSOA 4NWUL 4TUOA 4ODVL 4Y5VB 1GOFA 2DLFL 2XY1A 5E8DL 2YWYA 1CGVA 2B4CL 3FKUS 3P30L 3RGVC 4DVRH 5IB3A 1LDSA 5HVFB 1J0JA 3BIBX 1QQDA 4NN6B 4M61B 3ES6A 2HWZH 4K3JL 3SO3B 1HSBA 4NCC1 2IG2H 1T1XA 4FFZL 1ITBB 3D3VA 4M5ZH 3V6FA 1S7VB 3MRQA 1HHJA 4I77L 1FGVL 2EDYA 3LPGA 3AB0C 1R5VA 3GSVB 4QOKD 3TZVB 4DVRL 4Y4HC 2R4RH 5DDHB 1HH9B 1OD9A 2MFNA 3BDBA 4ORGB 4AJ0A 4GSDH 4PRPD 3W0WB 3AU1B 1O0VA 5C09E 3I2CL 5CJQL 1ZT7B 5DRXA 1S7WB 4LSQL 2ITDA 1FNEB 2E27H 2OR8A 1Q72L 4PJHB 3BSZL 3FL7A 3HI1A 3R1GH 3FZUD 2A6KB 3IFLL 3WO4B 3V4VL 5BVJB 3MLUL 3HNTH 2KH2B 1A6TA 1A1OB 5IK3A 4LCWE 1IAIL 3O11A 2P1YA 4MCYA 1BZQK 3K46A 3HG1D 5FUOL 2HLFC 3N1FC 4Q9BA 1DEEA 3ZKSD 1EAPB 4ONOA 5F1IA 3T3ME 3RWFB 2OXHA 4JVUA 1MJUH 4HDIB 2VL4A 4ZUWB 4OZGF 2VDLH 3E1F1 2QADD 1HILA 5EA0L 1ZHLA 1T7WA 4ZTPH 5IMOA 3QEGH 4JANA 4FNLH 5D4QA 5IOPB 4XVSH 5GS1C 5DJ2A 3O3EB 1U8NB 5ITBH 4ERSL 1A47A 2HN7B 5HGGS 3GM0A 5IW6B 2F8XC 3QZWG 3G04B 4AEEA 4YQXL 4X7DC 3VFVA 2FH6A 2Z4QA 5DA0B 4X5XB 4L4TB 2F53E 4I13B 4JAMA 3MRGB 3V7AG 1KTKE 4U1GC 2C1PB 3IDXH 3SKMA 4XPTL 3FB7A 2QHRH 2FH8A 4MCYB 1HZHH 1T2JA 3S35H 8CGTA 5CD3A 3PP4L 2EDFA 1DBJH 4MB4A 1CD8A 1A7RL 4NQVB 3DTXB 2BY0A 5EU5A 5HVWA 5IEHA 1YEEL 3B9KD 3X11B 4D9RD 4JDZB 1CXKA 3RA7H 1H3UA 1AP2A 3MRIA 4YBQD 1EO5A 4XVTH 1P53A 1RZ7L 4TUJB 3C60D 1NEZA 5GGVY 5T3ZE 4PRHD 5AZ2H 4PTTB 3KYKH 1JL8A 5BV7C 4PGEA 2F54B 2XA3A 1W72A 5J56B 1K6QH 3H9HB 2VLJD 1JGVL 1EO8H 1KNOB 3C9NA 3TJEL 1G7JA 4LKCA 4OCWL 4LLYA 1HYRC 3FOLA 5HYSB 2BSTA 4PJEF 5LGJA 2M26A 1MFEH 4U1MA 1OF2A 4PIRF 1GSMA 1HHKA 1YEKL 2IBZY 1A6ZA 1DQDH 5HD8D 2DI8A 4ETQB 2E9JA 1VFOA 3TPUB 3BUTA 4QCIB 4JFOB 4DZBB 1RJYA 3VA6A 3OAYK 3MRLA 5CGTA 4DQOL 4OZIE 2YA1A 1T4KA 4WHCA 5EO0A 5KSBA 4KTYA 2NY5L 4GBXC 1T1WB 4AIZB 5HD8C 2YD8A 3N1QC 1KTLB 2XTLA 4LHUA 2ADFH 2W1NA 3HC3H 1GL4B 3I2CH 2YBRA 5ERWA 1U3HC 4PRAB 5FUCC 4PJ8B 5H94B 1BZ7A 5I1LA 3O3EA 3RWEA 4QOKE 3BGAA 2Z8WC 4R8WL 1DSFL 1TNNA 3KYMB 4Z7VA 3QCVL 4BQ9A 3CFBA 3DIFB 4LARL 4UQ2B 1NQBA 5HVGB 5E6IA 4OB5H 4FQIL 4L8BB 5D1QB 4RWHA 2AXGA 2X4OB 4XPAH 3AMLA 5C0CB 1BIHA 2EYSB 3QWRD 2H3NA 4JHAH 5C07B 1YC7A 3FB8A 1QPXA 4H20L 15C8H 5E5MA 4K7FB 4OFVA 1P4LA 3MYZA 1OTSD 4R7NA 4XMPL 1FBIL 4JPWL 3WNMA 4TN9A 1Q0XH 2J8UB 2E3VA 5ENWA 1DQLL 2EC9T 4ZXBB 2KBGA 1CGYA 2VABB 1EGJL 4KZDH 3BGFC 5JR1H 5DVLA 1N3NB 3DVFA 2VIRA 3LD8C 2NZIA 4HK0B 4OZFB 5FGRA 4MA8H 4RWYH 2F5BL 3TJEH 5E2TH 1QA9B 3L7EA 1ZHBA 4M6MH 4JQVC 4J3VA 3A6CH 2PKDA 3LKOA 5J9PA 2NY6B 5MP6H 4H1LB 5EUOB 3X3GL 1EEYA 3TVMD 2IPUK 1EMTL 4OAWB 4YXLH 3EGSA 3EJJX 4XWOD 1IEAA 4XCNA 1DLFL 2FATH 3ES6B 5GGUA 4NQSA 4XBPB 2VZ3A 4PGDB 3QUML 4WCYL 3BPNB 4UT6H 3A6CL 4JM4H 1DBML 3RWJA 3QDJA 2R29L 1D5ZB 3KPLB 5ICZB 4ZOCA 3MCLH 3EOBA 7CGTA 3HUJB 2DQUL 3QI9A 4FMKA 3UPRA 2LTQC 5KTEH 1G7JB 2AJYL 4KJPC 4LKCB 5FHAH 3W9DB 4ZQKA 2C26A 4CJ0A 1JGVH 4ELKB 3HE7D 3UTTB 4HKZA 4F15B 1FO0L 5C86A 3HNVH 4FQXC 1NCDL 2X9YA 4QHLA 1Z0NA 2F9BT 1ZT1B 2QL1A 2R9HD 5IR1B 1CL7I 3BT2H 3GSNB 3MLVH 3AXLB 5FA4A 4OI7A 3VWKD 3QZWA 3WFDH 2MQ0A 1T89C 2M8XA 2ED7A 2VLKE 4S10A 3FQRB 5ISZB 3ULVL 4O02L 3T09A 5EBLA 1CL7H 4K23H 4XCNB 4NT6A 1YPZF 5GGRY 3PQYA 4NP4L 5T5NF 5EZJB 1YPZA 4Y5VA 4CVZB 5HHVH 1VACB 2RFXB 2KUTA 4M48L 4JDVA 4ONFL 2WWMC 1U8LA 3CUPB 2E8YA 4JZNA 4MA7H 1S9YA 2PETA 4LVNC 3UYRH 1WBYB 5H37H 5SWZD 3TH2T 5DXWA 1LE5B 3SGDH 1OPGL 5ICXB 4LRIA 5I8KH 1FPTL 3GIZL 1FIGL 1DEDA 2K1MA 4WFGD 4LEOA 1OAKL 4KDTA 1XGYH 4O2FB 2OZ4H 4KAQL 5DJ6B 3RL1B 3QWRA 4NHUB 3RWGA 2XKNB 1BFTA 2D0HA 2AEQL 3ARFB 1ETZA 2FGWL 3CFBB 3SE8H 2YD7A 2UZIL 1B4RA 1F58L 5EC2B 5C09D 4ZFFA 2QQQA 3MRPA 4G8GA 5HGHB 1NBVL 5CWSB 5JUEL 1RMFH 2PYEB 4NOBA 1NDMB 1NLBL 4UU9A 3SGKA 5GPRA 2HFEB 1A3LH 5JPNA 4WI6A 3V0VB 5GS1B 1GCFA 1VSCA 4P2OC 3SE4A 3KWWA 1G6RH 4WFFD 3BPLB 4TVPL 1RJYB 5T3XL 5CILL 3THML 4XI5C 1K4DA 3GM8A 1MFAH 4B50A 4F9LA 4HH9B 2XZAH 5CEZH 5J3HC 1QBLH 1N4XH 4NO0A 5JOFA 5F7DA 4LEOB 5FYJD 1XGPA 2QKIB 3UYPA 1U8KA 3OL2A 4HJJH 1F5WA 2FEDD 4FQCH 4BKLB 1DQTA 1UC6A 4EI5A 2IFGA 2AABL 3WE6A 3N1MC 3VRIA 1I3RB 5TE4H 1MRDH 3WO4C 4IDJL 5GGVL 1XZ0B 1ODAA 2ATKB 3CFDB 4GAYB 3RKPA 2C9AA 4I0PD 3V4UL 1JTTA 1REIA 2D03L 4GAFB 2DQEH 3PQYB 3OAYH 5TPWL 4M62L 3CGTA 1KSRA 3GJEB 4I18A 4JPIB 4P5KA 1MEXH 4KHXH 1FV1B 1ORQA 4YJZL 3NFNA 1KLUA 1GOGA 3KNBB 4LSRL 2LVCA 2RGSA 3QZWB 1CXFA 5IB3B 2JIXA 3T0EC 3ULVH 1Q94A 4P46B 3SDCD 4JFXB 4N90D 4FFYL 1G1CA 1BD2E 1V7NH 2EYRA 3S4SB 5DWUH 4FFWD 2AK4B 2Z35B 2IANB 4HBQA 2YC1B 1NFIA 2H41A 1RURL 2FD6H 5CEYB 3UTTA 4L9LA 3X11A 5J6HA 1NFKA 1IKFL 1VFBA 5SWSE 1CXEA 4QRUA 1WZ1H 4WJ5A 3IU3A 5EFIA 1H3GA 4DKDC 3QG6A 5ID0B 3WL9B 2YWZA 1YJDH 4X9FA 2VXQH 3EIFA 3D85D 4HWBH 1QTYT 1HNGA 4M00A 5ESQB 3LN9A 2FYYB 1UVQB 1NMCB 1V3LA 1YDPB 3P0GB 1R3KB 5D72H 5FYJH 4XNYL 5FCSH 5L8LB 3PWPB 5C07D 4DQOH 2SEBB 4Z7OE 5C3TA 4H5SA 5EC1B 5KS9B 3T8XB 3PXJA 5FDYA 1S7SA 5F89A 4WO4A 2WBJB 4LAJH 1FE8L 1BJ8A 4YZFE 2DL9A 4FQ1L 4I2XB 2ZUSA 3O3DB 3VFPB 1KGCD 1A6VH 4LHUG 3DRQA 3LKPB 3D0VB 3FCTA 5F1NA 3OJMB 1T21B 4G42B 4WWID 4PJ8C 3V0VA 4XAKE 2BOCA 3O2DL 5EORL 3HPLB 3IB4A 5LBSH 1FNHA 1BM3L 2AXFB 4OV5A 1QHPA 1CDGA 1EJOH 1OAKH 4U3CA 3SJVD 2WUCL 1DUYA 3MRPB 3RAJH 4MAYB 5KN5A 1RIVL 4S1DD 2LE9A 5DJCA 1WUNT 3Q3GA 3ARFA 1T22B 1UVQA 5FGBA 3CC5A 4GAJH 3KLAB 4EOWH 1U8QA 2DDQH 1E6OH 4A6YA 5FXCH 1FBIH 3L1OL 1F3RB 4PGBB 4R4ND 5T3XD 1FNAA 4P3CL 2X10A 3W9EA 5FM5O 5IB5B 1MHEA 3MA9L 4NNPL 1JZ3A 1G7QA 5F8QC 3GRWH 3JVGC 5DMKA 1X4XA 3QQ9D 4KRNA 4OZ4B 3L5XL 3WNLA 2DYPA 3UTZA 4P23C 5EZJA 4QT5B 3TFKD 4DUVA 4UT7H 2Z31D 1F02I 1KB9K 2R4SL 3QWOA 3R0MA 1MCHA 1INEH 2N56A 4X6DB 5TQ0L 4ZAKD 1QFWL 5CJXA 3LY6A 3U30C 4RAVB 1UM6L 2X4UB 4PRIA 4F3FB 2VDQL 3VFSB 5JDSA 4XZUA 2VC2L 2IALB 1CZ8H 2JIXD 3F7YA 1YC8A 1R3IL 5HYQA 5DRNB 1D3CA 5C9JA 3LSOA 1SVCP 3H42L 3TESA 4PJBF 1JF1B 1BX2B 4K7PL 1RIHL 2DQCL 1NUFA 1OW0C 3TN0D 4MDIA 4ALAL 3EO0A 3P77B 2G2RB 3DX7A 1NMAH 4U6VH 1DBMH 5IT2L 5C2BH 5FDWA 5EUKA 3B2UD 4Z7VF 1Q94B 5F7MC 2YA2A 2VLRB 5FYLE 1AP2B 3HMXL 3O3BA 3DHMA 1XGPB 4N1CA 1OL0A 4LSRH 4WV1A 1CIDA 1QFOA 1HIMH 4GRWB 4C56D 3BIKA 4HAFA 3RKDD 4E9LA 2MPAL 4UTAL 2DLGA 4HIIA 3LEYH 1J1PH 2BVQA 2PYED 2X4NA 3RP1A 3V0AC 4X83A 3H7LA 5KANI 5DURB 3NCJL 3GB7A 1R3JB 3MROA 1NCDH 4PR5A 1KN2H 2VDOH 4DZ8A 1U6AH 3VD7A 2J8UF 2ZOKA 1IM9A 1T66C 2YD2A 4WO4D 4J3XA 1FG2B 5CZVL 4FFVC 3ULVC 3DYPA 4KY1L 4PYHA 2GJJA 4LGPB 4X4XB 4YE4L 4MXVE 3MV7D 3T1WA 5TF1H 1NC2D 2IH3B 3HR6A 5A2FA 4PP1D 5CUSL 3A6BL 1MUJB 1PEWA 3RTQB 2Y06L 1L7TL 3X17A 1N8ZB 1OB1A 4RAHA 1EA9C 4TVSa 4X6BA 4MA7L 1H3XA 3LHPL 1B4JL 3CXHJ 1ZSDB 1DP0A 3O2WH 4Z7UA 5D7SL 1CDJA 1JHKH 4MCZB 2HTKD 4YWGL 4LARH 2APXA 4S1QH 5SX4I 4V1DD 2P49B 3GRWL 5KANG 1VERA 1OLLA 3P9LB 4NRZB 1Z2KA 4J4PC 1I7TB 1KIUA 2X09A 2F58H 5EBLB 3ALWA 4F7EB 1QRNB 3B83A 3QXUA 3PV6A 4YAQB 1AXSB 1TNMA 4JCLA 3KYAA 4Z7QE 4QF1A 4HIHA 3C6LD 2GJ6B 5F7NC 2BSRA 3O4LB 5I1LB 3MO1B 3MLRH 4JFDD 2GSGB 2ZUYA 2BJML 3BQUB 4XAWL 1D7FA 1IJ9A 4GRMA 1RI8A 1ZEAH 4IHOA 5CLWA 3ARTA 5J11C 4M7JH 3JV4A 4JO3H 2WBJD 2NY0D 6CGTA 4OZIF 3QFJE 5DJ0A 4JQVA 5DC0A 1UYWH 3L3JA 2Y25A 1Q8MA 3EYSL 1YQ2A 4YXHH 2WIIA 1DBAH 2OI9B 5K93A 1PQZA 1RK1A 1FNSL 4RGND 4MNQD 1GZQB 4R3SA 3ARDD 4Z7NE 3WIIH 3LEVH 2AERT 4PGDA 1VHPA 4PJGE 4UOW0 4LRNH 1UYWL 5A3IC 3QWOB 1D5MA 5IUSA 4OCWH 4KUCD 1WBZA 4Z9KB 2O5ZL 1G0YR 2BZDA 1CLOH 1FDLH 2RJMA 4Z8FH 4GG6E 1XF5B 3BP4B 2O26U 1MCDA 1QRKA 2ORBH 3L7EB 5F70A 5HDBE 4HLZG 4QGYA 5BO1L 1L6ZA 1A7NL 3U7AA 4XCEA 4D9LH 5GZOC 2IALA 2ZCLL 1UKTA 5F7HA 3CPLA 1NCTA 4EJ1C 4RIRA 1DDHB 1WVZA 2AEWA 4ZO7A 1OVZA 1BJ1J 1UKSA 1KC5L 1KCUH 4YDKL 3Q0HA 2O5ZH 3WFZA 5I1EL 1RURH 2FD6L 1TJIH 1SJXA 2OYPA 3TBYA 4JO4L 5E6ID 5B22A 1JPST 4OIIL 4Q2ZB 4XNQA 3JTTA 3U4BH 4L1DA 1CFQA 2B1AH 4LSTH 4G8FB 2QHLA 3CLEL 3GMLA 5SV4A 3MRBB 4QTIH 3OAZH 4PREB 1U8OB 1M6OA 3U7WL 2BNRE 5I1KL 1T2QL 5DD3L 5MEPA 1WIPA 3QNYB 2HT2D 1OP5K 2GY5A 4PGJA 1A3RL 3P9LA 1TZHA 1FZJB 4JFPA 5J13C 1CGWA 5DRWB 4KRMB 2VOTA 4RFEB 3RL1A 5JHDE 5E00A 2OR7A 1CDUA 4EXPX 3S4SG 5E2WL 4HHAA 5C0BE 4WFED 3NGBC 1HDMA 2X2YA 1HQRB 2IBBA 4IRSC 2DLEA 2HT2C 3QNXA 1RZGB 2W9LA 4URTB 3UAJD 1G9NL 2EH7L 3AC0A 3WFCL 3DXAA 1R5WB 1JGLH 1NANH 4Q0XL 2WUBH 5JQ6H 1YPZB 2YMXL 1S3KL 5DQ9A 1FNGB 4HFUH 3VFGH 2GAZB 5FM5M 5B3JF 1YJDC 4YXHL 4NUGH 1T6WA 1WITA 4Q9QL 2VSCA 1ACYL 2I26N 4OIBA 4L4VA 1ZGLA 2XACC 4DTGH 1XGUB 3TJHD 3GUTA 3DO7A 5LKNA 3BN3B 4WO4B 5DD5H 2PYFA 1RFDL 2KKQA 1MSPA 4LPVA 3VA2C 1HEZA 1IAMA 1X6LA 1D6EA 3ZSTA 2I9TB 3QUYD 2Z35A 4LLUB 5DJYA 4PRHB 4F9PC 3NZHH 3QB7C 3OHXB 3D18A 5L8JB 1FV1A 1ORQB 4RIRB 4LCYA 4XHQA 3LEXB 1IBGL 3TCXA 1KELL 1LDPH 3WUWB 1QLFB 3MA7B 1OAUL 5DRNA 2PW1B 5JW5A 5AZ2L 2G5BA 4FQCL 3BISA 1WT5C 2OL3B 5DD5L 4BSJA 1QR1A 2JCCA 3TN0B 4NQUA 1GPOH 3KXFA 4GKNA 3CFDA 1KYOJ 4WUUB 4Y1AD 4EVNB 1VGKA 2F8OA 1IC7H 5CEYA 5IQ9B 4OF0A 3VH8G 4DZBA 3WNNA 1YUHB 1BLNA 3GSXA 5TPWH 5D5MA 4L3ED 4F33B 1L9MA 4XPTH 3OKEB 4G3YL 1CN4A 4HLZH 2CMRH 1XGUA 2P8LB 4R2GB 1NSNH 3HA0A 1G7QB 3CX5K 2LABA 4LOUC 4MA8L 2DQCH 5AYUH 2DIJA 2NQCA 2BCKA 4YGAB 2YPKB 3NMEA 3P0VH 3V7MA 5JW4M 4X9IA 4LVOB 1B88A 5K9KB 2FJHA 1X6NA 1Z3GL 4UV4L 3ROLB 1G84A 4LMQE 2VDRH 2NW3A 3QXAB 5D7JB 4R96A 4Z77B 1U91B 4HQQL 4M9PA 4MXQD 4Z7WF 5JNYA 1RZKL 5ESAA 4EKXA 5E8NB 3G5VA 1FFNA 3OKLA 4L29A 2HRLA 4RMRA 3LOWA 5C0CA 3QUMH 1QFWM 5KSBF 3UTTE 2HRPL 2QR0B 5HHVL 3SY0B 3TH4T 4TSBL 3GSNH 1QNZH 3FB8B 4Y19B 1HQ4A 1P9MA 4NKIH 4KRPD 4OUUA 3GSRB 3MRNA 4U1SA 5ANMB 1UADC 2YPLA 2WQRA 4ZUSA 2HH0L 3VXPA 1FE8H 3RWDA 3FMGH 5BZDA 4V1DA 2JB6A 1MAKA 2CDEB 3BP5B 3VMPA 3E3QC 2AGJL 1FNFA 3LQZA 3GMOB 3O45B 2I5YH 4PG2A 5LGHL 4P2OB 3BT2L 1DVFA 3GHEL 3T77A 1QVOA 3PWVA 3QO1A 4S1RH 2G75B 4KPHH 5ANME 4TYUA 3DMMA 4S1SL 1EX0A 2HVKB 5CJOL 1TQCC 3C2SA 4PJHA 1A7OL 5IG7B 5EIIA 1FP5A 5IFJA 2NYYC 2YKLL 3C60A 4O4YH 3G5VB 4WHYG 5CAYB 3DECA 4OCXH 1AQDA 4NZUL 5DHVH 1CDHA 2H9GB 4XXCC 3SCMB 1HK6A 1IEHA 4I0PA 3ARPA 5B39B 2UWEB 3ZKND 5DD0H 5DI8A 4LPXA 3DVGB 1TXKA 1ND0B 1JNLL 3TVMB 1WZLA 2G2RA 3PWUA 4PRNA 4NC1C 4TNVK 3RY5A 5ISZE 4FXKB 1MCNA 1TPXB 5CFHA 1AI1L 3R8QA 2LAAA 3GGWB 2JLLA 2XKUA 1S7VA 1JP5A 2ITCA 3VFGL 1ZV5A 12E8H 1IT9H 1WFUA 4LCUB 4CMMB 3HUJA 2XG4A 4Q7DA 1KLGB 1FORL 2ZCHL 3MUGA 4KQ3H 4LSVH 1TVBA 4OT1L 5CSZA 2CLVB 3V6ZA 5CGYC 5GSRA 3MQIA 4G7VL 1HHGA 4MXWL 5JMRA 1Z9OA 3NIGF 4LLUA 1S7WA 1MFBH 1MIML 2CO7B 2Q76A 35C8L 4QHLB 3MBED 5D2LB 3SDCA 5ADPH 3T3MF 1HHIA 3T2NH 4LSVL 2FHCA 3UO1H 2XWJA 2IH1B 2CPCA 1UCTA 2W0PA 3G08B 3QIBD 1P7QD 5CILH 2NY2B 4I1NB 3SGEI 4QRTB 3BPCA 3EJZC 1INQA 5I66B 3IAGC 4HMCA 3V4PL 3JTSA 3KPSE 3ZE2E 3BDYH 4S11A 5MEOB 3GNMH 3UYOD 4JRYA 4K7PY 2DTML 4UB0L 5DJDA 3D87B 4F9LC 2GT9A 3MOAH 3BO8A 1BOGB 1EMTH 2XI9A 3OKKB 2NTSP 1RJLA 4IEFB 2P5EA 4Y19D 3VFOB 2ARJB 1RAMA 4YHNB 3S36X 2YUWA 3RGVB 4HS6A 4NN5B 2HFFA 1MCIA 4YHPA 1PY9A 3U9UB 2WBKA 4KFZC 4OZHE 4BUGA 5MEQB 3QUKA 4HXAL 1U0QA 2X44D 1HXMA 5EC2A 3KLHD 4J6RL 1U8NA 3WXVH 1ADQL 4AQ1B 2DOCA 5EOCL 5E24E 1FN4A 3H0TB 3K0WA 3SY0A 3CFJB 5CWSA 2CUMA 1FPTH 1RHFA 3GIZH 4OZGB 5ITFA 3DI2B 1UWEL 3D9AH 1NCNA 3TIDB 5DWUL 1J0ZA 3MACL 1AO7A 4U1SB 4IMKA 4HDIA 3MFFB 4KJWC 2V17H 1N8ZA 3MBXL 3CDCA 1L4IA 5BJTA 5HHMD 1DUZB 2HA1A 4XXCA 2X05A 1CICC 3AM8A 4I0PC 4LCCB 3T0WA 2IPTL 1OCWL 2R1YB 3MROB 3MRNB 3L3OB 3WIHH 2R8SH 3ZLQC 1QHOA 2BDNL 4NM8L 4H88H 3D9AL 5F96H 1R5IA 1RVFL 5JZ7D 4NM4H 3MRDB 4DGIL 2ID5A 4UINH 2Y9RT 5L88L 5A1AA 2YZ1A 5DLML 4PD4J 3S88H 3NTCH 4CAGA 5BW7C 2A73A 1VKXB 3AVEA 2A9MH 4ONGH 2W07A 2Y07H 3CX2A 3TBTB 3TA3B 1OQXA 2R0ZH 4L8SC 3UZEA 5EDXA 3BGMB 3QDMB 1Y18A 4JFFD 1UFUA 3ARDC 3ZSSA 4ELMB 3KXFB 3ARGD 1XR9A 1AJ7L 3VGFA 3WDIA 1FL3B 5DHVB 1FL6A 4M5YH 1AY1H 1BQHB 2CRMA 3R06B 4LSUH 1Q0YL 1N0LA 3H3KA 4Z95H 3G6JB 4MMZC 2H6PA 2AK4A 4YHML 4P5MA 5DJAB 2H2SC 5GZNC 2GQHA 3IXTB 4OLWH 4OZGE 2GSIA 4BFBD 3REWA 3X12A 5C92A 3SO3C 5J12C 1BOYA 4WENB 1CXLA 3AMKA 3ELAT 4KJYB 3U9PH 4HBCL 4XGZB 1AR2A 4GAJL 4EOWL 1HWHB 1A14H 1U93A 5DD1H 4Y4KA 4U1MB 3V0WH 2PO6B 4HKJA 2LU3A 3S3SA 1KIRB 3AB0B 5IEHB 3NIFF 3VFMB 5SX5K 1ZKAA 4XHJD 4J8RA 1UM4H 4FRWA 4F7CB 4BYHA 2UV3A 3C9NB 3QFJA 3KYKL 3CFEA 5KG9B 1KEGL 4L9LC 1OAXH 3MRKA 4F7PB 2P5WE 1HIML 1QO3A 3JVGA 4V2CB 4NJAL 3T0AA 5GXBB 3L3HB 1F42A 3HI6H 5KSBE 2UWEA 4HULB 2EDOA 1N5AB 2ZCKH 2RHEA 3MRHA 4E5XB 3LRSB 4M62H 5I1HH 4JDZA 4JO4H 2D7NA 3U0WH 2X42A 3OG6B 2X41A 3MTRA 5TH2B 5IHBA 4BZ1H 3MNVB 4X6FA 3EJYC 5CCKH 2YS4A 5I6XB 3EFFB 3BZFA 1J18A 4KI5D 1TZGL 1U58A 2DBLL 2R0KL 5E6ZA 4XPGL 1H5BB 3MV8D 3TV3H 1KCVL 5EOTB 2B1HH 4XC1L 3VXQA 1I1AA 3QIBB 1SY6L 1E0OB 3U6RB 3O6KL 2VMFA 2ADJB 1I3UA 5CCKL 2H1PL 4GUPB 4DVBB 1KCSH 3WFBL 5CGMA 2Y1VA 4W4NA 5ISZA 1JWUB 4MGXA 2JELL 2F5AL 1A7PH 2IEPA 1FZKB 4XVJL 3DV6B 5F71A 2OL3H 5DMIH 1M71B 1TCRA 4M48H 3C6LA 3ARBA 4PREA 4LNRA 3SHSA 2V6HA 3X3FL 3GMQB 4POYA 3WFCH 5IFHL 4NQEE 4IRSD 3P2TA 2MSPA 4X98A 3PGDA 1NAKH 1SYSA 2GT9B 1MJJA 4U6HA 5HDQH 1KIRA 3F12A 5FHBL 1LO3H 3RVVC 1ZGLM 1GXEA 3QWQB 2RQ8A 3PDOB 4MB5A 4BZ2H 5IFAH 3QBTB 1A9BB 1NFDB 3V6FB 3RWJB 4G9FD 2A77H 3FOMB 3EOBB 4N0YL 4DUWA 1BD2D 3L3GA 5E08H 1DTUA 5DJ8A 5IESH 3QHTC 3O2DH 5EORH 1CU4L 3EDKA 5L2KB 2BSTB 5LGJB 3BAEL 5EU3A 1YUHA 2R4SH 4OFYA 4HWUA 3P77A 4W4OA 4P4KC 2FIKA 2LAGB 3FTGB 3ARGA 3PDGA 2JE8A 4ODSL 5HVHC 2XWJB 1TCMA 5F88B 3W0WA 3BKYH 1G9MC 4NWTL 1FORH 1GHFL 3HS0B 1FNSH 4YEEA 3TZVA 4FZEH 3CVHL 4U6XA 1Y6MR 1QR1B 2OP4H 1YEHH 4HWZA 1SMOA 3RDTC 3PP4H 4TTDD 3MLXH 3R06A 3EYOA 4NJAH 1F4HA 1KXQE 4OQTA 2EZ0D 2FJFB 5DZLA 3RU8H 3VFNA 3BIAX 4FXGB 3BX7C 4U1JB 4XRCA 5KW9H 2QLVB 3H7BA 1NBZB 3KJ4B 1IAOB 1KFAH 4NQVA 3IYLW 3V5DA 4LQFL 3G5YB 4D9RE 1AHWB 2XTJB 5ALCL 1P84J 5F9WC 5JIHA 2DM4A 2AABH 2EYTA 2IAMD 2GFBB 2GJZB 1YMMD 1AFVL 3QDMD 3RY4A 2F19H 2ADGB 3OZ9L 5J4MA 1L0XA 1TZGH 3IDNB 4MAUL 3S96A 2CLZA 3MV7B 1UCBL 2YEZA 3B9KB 3L3KB 3NIDE 4JGJA 4JO1H 3ZL4H 5ANMA 1OWRM 1BIIB 3TWCL 3TO4A 5C6PB 5FO8B 3C6LB 1KXVC 3JV6B 2BMKA 3JWOL 4KDWA 1S9KC 2IFFL 3L3DB 3S97C 4V1DE 5M95B 4Y5YA 2BSSB 3IAQA 1RUMH 2CKBH 5KSVA 1QVOB 2KZWA 2M2DA 1GOHA 2RR3A 2V5SA 4Z18A 2WLYA 2HN7A 4PRIE 4TPRL 3WXWL 3HMWH 3SDXB 2AV7B 2MCPL 5KZCD 5EU6B 5F21B 3ULUH 5BOZG 1J5OH 2E6QA 1ADQH 3JWOH 1RZ8B 2FIRT 2J7LA 4PJGB 1G0DA 5K9KA 1MI5B 4QRUB 3HN3A 3AREB 3NCCB 1LO3L 5JNYB 4G6KH 5SX5H 32C2B 1U91A 2DD8H 3ARUA 4B53A 3I75B 1XT5A 3WJLC 1N5YL 4PY7B 5EZOH 3BOVA 4XPHL 4J4PA 3BZ4B 2OLDA 3WIFB 3LRSA 2F58L 4L29B 3C8HA 5I1GH 1FGVH 5SWSB 1A6TB 1CE6B 2SEBA 1S5IL 1HHHB 3AFLA 3BEVB 2R4RL 1Y6KR 1B0GA 1KLUB 2APFA 4ZNCD 5L7XL 1A6VL 2X4QB 4Y4FB 5EIVA 1ACYH 3ET9F 2W92A 5B4MD 3T2QA 1OF2B 3QA3B 1A02N 4LCIL 5INDB 3GMPB 4L8DA 4MQTB 4PJBE 5IP4A 5FYLD 2GK2A 3V8OA 3VXTB 3IJHB 4HD9A 4PLOB 1E4XL 4LLMB 3NCYP 4X4ME 4HUUA 5B38G 5I8OL 5TE6H 3QDJB 4WEBH 3K2UL 5DDHA 1T3FA 4H0HB 1H8NA 1IGML 3KR3H 3RHWK 3V2AR 3HNTL 5JHLL 1EIBA 3RAJL 1EBPA 2EYRB 1KELH 1XR8B 3KJ6L 3IAPA 1TFHA 4Z7OF 4HX1A 4I9WD 3S37H 2FIKB 4AEIL 1ZANH 4KTEL 3EYUH 4HH9A 3CFCL 2ZPKH 4M4RA 3VXRB 4R4FL 4Y4KD 4X6DE 1AD9B 3OGCB 3ZYZA 3MRDA 4WEBL 1MLBB 5D71H 3LKQB 3VGEA 4MD0A 3QUZC 4ZG1A 1U92B 2V2WB 3DI3B 1C5DA 3BHBB 1AH1A 1J1OH 3CDGA 3QEGL 1BFSA 2V5RA 3B9EA 3QUMA 1NBQA 2VIRB 4PJEB 1MJJB 1CFNA 2DTSA 3Q6FA 4U6HB 1KJ3L 3VGDA 1U3YA 1ZOXA 3X3GH 3U7YL 1GRWA 3OWEA 1OSPH 4U1IA 1FZMA 3MFFA 4OCRL 4DKEH 5ENWB 4QT5A 4YK4B 4CNIA 4WTZG 2CIKA 1ZLSH 5DK2B 4QKXB 3EYSH 4L5FH 2Q86A 4JPKL 1CDCA 2NY7L 1LDPL 4MHHI 3PHOB 3L95A 3QEQA 1YMMA 5HI4C 3O8XC 1DFBH 4UTBL 1SQ2N 3QHZL 3BD3A 3E8UH 3VXSA 3RQ3A 1MWAA 3DX8A 3DGGB 3L5HA 1KPVB 3BMVA 4MA3A 4PJAB 2GEEA 1AFVH 2J5LC 2BVUA 5E1HB 1RZ8A 1MCQA 1JI2A 3NIDF 2P4AB 3RKDC 4M1DL 4M43H 4JDTH 1MAMH 2W60A 3OKDA 4J3SA 1S7SB 4G9FB 4X7TB 2FEDC 4DOHE 3QCUL 1NMBL 1U36A 4M7LT 3FO9B 1FVCA 2CMRL 4BZ1L 3LKPA 1HWGB 2BRRH 3EO1A 3O0RL 4MLSA 4ZS7H 3RNQA 5I16A 2FYYA 1IE5A 1A6AB 4EI5D 2P5WA 2QSCH 4JFZL 4CJ1A 3LMJH 5L7XH 4JGMA 1JZ7A 3DRTA 3EYOB 1NH6A 2EECA 4GFTB 2Q86B 1JPSL 3V6OA 2GITA 1VFUA 5K9JH 3RGVA 5GS2H 4G8FA 1DEEB 3BRGC 1P69B 1A6WL 1OARL 4KGLA 2K9UA 5CZXC 3E6HB 1VACA 2ZUQC 3M8OL 1BHGA 1DSFH 4MLIA 1QLRB 1ZS8A 4S0TD 4Q6IA 5HHPA 4KKBC 1LEIB 5JDSB 2BVOB 1PD6A 4MD0B 4NPYA 1RVFH 3UTOA 2C4FT 3GSWB 4XBGA 5F9AC 3CDGB 3LRGA 5CJQH 5L2KA 3BP7B 1MIEH 3OKYA 3I3EA 2XXCB 4J23A 1DANU 3SDAB 5J11B 2NLJB 4Y5XB 2W0LA 5FUCE 5C0AE 2CQVA 4JB9L 1B2WL 1R3LB 2GHWB 2YC1A 4IMKC 5F9OL 3VFWA 3REWB 2VDNL 5IVOA 3LD8B 3BPOB 3WS3B 3K4AA 1Q9OB 4NQDA 3GSXB 1I1RA 5HXMA 3VG9B 4MDIB 3EO0B 4BA8A 1IGJA 3CSBA 3MBEA 5DMYA 2M1KA 2A74A 1UT9A 3V6BR 3U0PA 2W9DH 7FABH 3RPIA 1WBXB 4QOKA 5J89A 3TNMA 3QIWD 2FB4L 3ECBB 4FABL 2UWEE 1OP3H 4JRXB 3IJHA 1OLZA 3FRUA 1S78C 4F3FA 3U1SH 4MJ6A 1ADQA 4P4RA 3GJFB 5CMAA 1SBBA 1RUPL 4F7TA 5C0AA 5JHLH 5I30H 3SCMC 4HJJL 4M8VA 3PQYD 4H8WH 4Z7UF 2UY6A 4WY7L 2XXMB 2H2PC 5DZOA 4UNUA 2ARJQ 3QPQD 1YECL 5ABDE 3NH7H 4ZAKB 1K4CA 4FABH 5DHXB 1NUNB 2L0DA 4XMPH 2VR5A 1XF3B 3FQTB 4QRSA 1BQHG 1KT2A 5A3ID 1D9KB 1X5XA 4PJIA 3TO4D 3D39B 2NY3B 1B0RB 1NGXA 3MLTA 1DBJL 2W0FA 4ZS7L 2GUOA 4ELMF 3FN0H 3RWGB 2C4FU 4U6TA 1F6LL 2VDPL 4R4NC 3BKCL 1T20A 5EU6A 1UZ8B 5D70H 4GW1B 4JKMA 4ONHA 5DFWH 5IT2H 5KSUA 3D2UD 4WI9A 4JG0L 4B7IA 1EUTA 1ACZA 5D96B 4K2UH 1I8IB 4HK3N 3UO1L 1QSFA 2FJGB 1XGQA 3QHZH 4LBEA 1MRCH 5EOCH 2W60B 3DO3A 1N6QL 4H1LH 3PL6A 4PR5B 43C9A 5E5RB 4O2FA 5DJ6A 4DGYL 1ZHKA 1KJ2A 3D0LB 1N64L 4WFGE 3VXUB 1S8DB 3IDYC 1NGYB 4DKFL 5HHQB 4OLUH 3QIUC 2ADFL 4HZAA 4JRYE 4DCQB 1CFSA 4YHKH 3RBGA 5T3ZH 5HYJE 1QBMH 1J5OL 2CRZA 3Q48A 3L95B 4OLXH 5EB9A 4PV8B 4U05A 3G6AB 1KYOK 1SBSL 3GDBA 3JTTB 2B1AL 2WNGA 1DQDL 5DEGB 1JHLH 4Z78A 5MENB 4JJHA 4H1LG 43CAA 5I15H 1K2DA 3ZE0E 3C5SB 3BIKB 5IHUL 4LVHC 1LGVA 1NAML 2CLRB 5FGCE 2AJXL 3NIFE 4MNGB 3SPVA 2B0SH 4QHKI 3V79C 3QDJD 1JYXA 5MHSE 3QG6B 1UXWA 4GXVH 4IRZL 4NRXA 3A67H 4RBPK 4DFIA 3RPKA 3MNWA 3T3PF 2OMBA 2WBWB 3B2VL 1A1NA 4RAVA 1Y0LA 1J05A 2EE2A 3VCLB 4L1HA 5HHOB 3ILPA 3X14A 3S98A 3MJ7A 1PEZA 3IFOA 1G6RB 1ZT1A 2WW8A 4OCSH 4Y19E 3QIWB 1WBZB 1UGNA 2DIAA 4TTGA 3HUJE 4HIXH 4I18C 4PJBB 4GXVL 1T66D 4IRZH 1ZT4A 4ZPVA 3QCTL 5TFSL 5CZKA 2NPLX 1OQOA 5I8EB 5EA0H 4RNRA 1LD9A 3WFEL 4R0LB 1LNUA 1ND0A 4K3GA 3RIAK 1CLYL 2OP4L 4MNGA 3SN6N 4FXKA 3VU2A 4I3SH 4PTTA 4PJXB 4L4VE 5F7DB 5I74B 1MCJA 1INDH 4C54A 5CKAA 3O4OB 3RVXC 4RFNB 3HNSH 4POUB 2G5RA 3P73B 3ETBF 4X6BB 3L5JA 4OF7A 3IDXL 3OKMB 3QPXL 5K59F 3CC5B 4P2CG 1QFUL 2EO1A 5GRYA 1FAIH 2IJ0C 3AROA 1YEDB 1A7QH 1PG7L 3STLB 1ZLUK 4K3DL 3NABL 1MF2L 2XQYK 1A2YA 5B38B 1FO0B 2QADC 4ODTH 4JQIH 5JOPD 1CD0A 3HNSL 3KLDA 3SO5A 3TZVC 4R7NB 2NNAB 2YN5A 4UU9B 1BBDH 1IZJA 2CK0L 2OTUB 4TNVF 1HOCA 1KJVB 2EE6A 3VW3H 2OCFD 3ESVF 1A4KA 3VD3A 4Z7UB 4U1KA 4PGCB 4XT1C 5C0CE 1UZ8A 2N1KA 4F8QA 4IOIB 3WFDL 3F8UB 4Y5YB 4IMLA 1SBSH 1S7QB 1HI6B 3QEQE 4LQ1A 1EZVX 3MRJB 2HTLC 1SM3L 3PGFL 3O3BB 2LU7A 4BUHA 2X9WA 3FONA 1T5WA 2XWBB 3RVWC 5JA9A 1VFMA 1T0MA 4TUKH 3OJDA 2DWDB 2OSLA 1JGDB 4CNIB 2B1HL 4ZYKB 4TNWF 4Y8AA 4F8TA 5F9DC 3A67L 2YEZB 3B9KA 4M6OH 4YHNA 1KN4H 1A6PA 4G9DA 4JZOA 5F89B 5J57B 5C0NC 1PLGH 4YHPB 3TYFB 2IQAA 5BMFL 1LO5B 3LDBB 1MCRA 4AH2A 4KMTH 1V7NL 5A43C 5GHWL 2XICA 3QDGB 1RPQA 4PV9A 1KPVA 1EO7A 3HE7C 2H26B 3MMEA 1XGTB 3QYCA 3KYNB 2R0WH 4KI1A 3PP3K 5D96C 4JHAL 4X6DA 5CIPH 4FP8L 3FN3A 4WU7B 3VWJA 1F3JB 1B4JH 4TVPE 3SQOL 4WV1C 4OZFH 4P2RB 1WICA 5JPMA 3OKEA 3NA9L 4N1HB 1EGJA 4ISVA 3MLUH 1TTGA 1WBXA 5FDWB 5E8PB 4U1HB 3MACH 2ICES 3EZ8A 1NCCH 2Y36L 4NCC2 1IAII 1VFAA 4Y5XC 4FQ2H 5E4IA 1D5MB 2ZSWB 3MC0A 5IMMB 2ICWB 1CU4H 3LKSA 3EYFA 4G6MH 5IBTL 4G6AD 1E4XI 1BVKB 2UZYB 3BPOC 2EDNA 5I8KL 3CD4A 2IAMA 4Y2DA 1G7MA 1T22A 5EIIB 5IG7A 1XF1A 2E8ZA 1SEQH 1V3JA 4Z78B 5FGSA 2VLJE 5LWYL 3TBVB 4PRHA 1T89A 1IM3B 4PLJD 2MKLC 1A64A 1B0GB 3QDGA 5J1TC 4CN4A 5FOBA 4NNYA 3LN4A 5IJKC 3U9PL 3X3FH 4GRLB 3EUUA 3N1GC 4Q6IB 3KPRB 5DJ0B 3WDHA 4UDUA 1D6EB 3SGJC 4YXLL 4P4KB 3PWUB 4PRNB 4M3KB 2NW2B 1X44A 4IHOB 4UILL 3MLSH 1BBDL 4OF8A 4N5EC 5DRZB 2KDGA 3IT8D 4G42A 5DQ9B 4AMKL 5FF6A 1MJ7H 3R4DA 5D6CA 1WFNA 1G9ML 4P48A 1IGYB 1KB5H 3CXDL 4YPJA 4RRPA 2VE6B 5IOPA 3H42H 3GMMA 1F45A 5IVXF 4P2RE 3QNXB 1PBYA 1CF8H