5I9QB

Crystal structure of 3bnc55 fab in complex with 426c.tm4deltav1-3 gp120
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
217
structure length
202
Chain Sequence
b'VQLVQSGTAVKRPGASVRVSCQASGYTFTDYFIYWWRQAPGQGLEWLGWINPLTSQPSYPSRFQGRLTLTRDTFDEMLYMDLRGLRSDDTGIYFCARRHSDYCDFDIWGSGTQIIVSSASTKGPSVFPLAPALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLICNVNHKPSNTKVDKRVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 426c.TM4dV1-3 p120
publication title Structural basis for germline antibody recognition of HIV-1 immunogens.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 34
structure length 202
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i9qB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i9qB01
5FB8A 5D5MB 5DI8A 1REIA 3RGVB 1U8QA 5TQ2L 3TV3H 3CLFL 4GKNB 4YC2C 5GISL 3QEHB 4U1IA 3INUL 3T77A 4L4VB 2F58H 3QYCA 1TQBC 5IMMB 2EE3A 4ZUWA 5J6HB 4XNMB 2XWJA 5T1DL 3FRUA 1HHIB 3TO4C 1C7SA 5KSAA 3UTTE 3NGBC 4WHDA 4J2XA 5A16B 1CFSB 3E1F1 5C7XL 1W0WA 4PJ7F 3UO1L 1HINH 4JKPL 4AEHL 2J4WL 2N7AA 3W0WD 2H8PB 3S36L 5E6IC 5I66B 3EOYG 3QG7H 4G6JL 4MA1B 5EC2B 5C0AD 4LSVL 3ARFA 3EO0B 4ZUUA 1U8PA 1MAJA 1F00I 5FK9B 3ROLB 5F21B 1YY9C 3QO1B 2FJHB 3FT3A 2ZUSA 4JANA 2EXWD 2VLRB 4MA8H 3CNKA 4LPWA 3VXSE 3HLAA 3Q5YA 4JM2F 3EDEA 4EUPB 1OAXL 2VN4A 2V2TB 1ODAA 5GS1C 5IJKA 1FBIL 3MROB 1F4YL 5D6CB 5D7JD 3VDAA 3LB6D 3JWDC 4X9GA 1OGAE 4DCQA 2BVPB 4H20H 3RWDA 3BZDA 1FVCA 4NN7C 4KMTL 2X4RA 1QFWL 1T2XA 4HXAL 4IRJA 3GSUA 3D9AH 1I8MB 1VADB 4QY8B 4QXTA 4Y4HB 1FZMA 2XTJE 2V2WA 4HKXA 3IFOB 1R5IA 3G9AB 3L5WA 1AC0A 1XR8B 4FHBD 3KS0J 1FIGL 3VXQB 1UZ6F 4OTXH 2A9MH 4KZDL 5E8PA 3FO0H 4F7CA 3AVEA 3L3OA 4G8GB 5GS0L 1CI5A 2GK0A 4YHML 4O2EA 5IW3A 2ADGB 5FAAA 3SE3C 3H0TA 3B2UD 5TE4H 2DBLH 2DQDL 4OCRH 5C09B 1LO0H 5C07B 1CXIA 1SEBA 2CRMA 1JZ6A 4LF3B 3QHZH 2VQ1B 2VOTA 3FHQA 4WI8A 4Y16A 2M2DA 5DHVH 4G5ZH 4WU7B 1IAKB 5ADOH 1Q0XL 4KTDH 3F5WB 1NJ9A 3U0WL 4EDXA 3QDHA 4Y4KD 3K4AA 1MJ8H 2E9WA 5IB4A 3BH9A 3V52L 1RJZB 5BOPA 1MCCA 3IRZA 4Z0XA 4NGHL 4M9OA 3G6AA 4XPAH 2XIDA 1Z5LB 3GBNL 4OD3H 4P5TA 2XN9D 1CT8B 4RGMC 1F4WH 1JZ3A 3N85H 3MR9A 4B41A 1INQB 1NFDE 3KPOA 3G6DH 4NQTA 2R1XB 3S96B 3ZSTA 4U1GB 2YXMA 4U7MA 4Q6YA 1MQKL 4Y5XB 1KJ3L 3D0VA 4PJXB 2HJLA 1FL3B 5HBBA 4R2GD 1GYAA 5IV2B 3BD4A 1ZANH 4ODHH 5D71H 3ZKSD 3WN5C 5IG7A 5GRUH 1F6FB 2P5ED 4YWGL 4CW1A 3T2PA 1UEMA 4ELMA 3QG6B 4X6BA 2FEDD 3O11B 4HJJL 1ES0A 5ACLA 4YHKL 4L9LA 3U7YL 3P9LA 4J4PC 4LHJB 1HH9A 2ZWLT 4RFEB 4S0SD 2V6HA 4G42A 2R15A 1KT2A 3D2UD 1N26A 4UNTA 1QFUL 3KXFA 5DMKA 5MEPA 3R8QA 4ETQA 1EEQA 2OZ4H 5FFLA 1HK6A 4A2LA 1WZKA 3O3AA 2DLIA 4XBGA 4Y5XC 2R0KL 4P57A 4WI5A 5INDB 4GW4A 2XKUA 3ZDXE 4UTAL 4S10A 2APXA 3BZEA 1KCVH 1CVRA 3KGRA 3CDGA 3HC4H 1JHTB 4U6HB 4IBLT 3IF1B 1ZT7A 4HV8B 3RIFF 3U83A 4LCWB 2FO4A 2HRPL 3WEXA 4Z7UF 1NGWA 2JKXA 3PHQA 3RDTD 3WE6A 1MJUH 4YX2H 5LCVH 1C5BL 2R9HC 2JLLA 2W65A 3RUGF 1WCBB 1YC7A 4DQOH 1R5WB 3QXAB 4M5YL 3H9HB 1JF6A 1IC1A 4X8JA 4MNHA 3CFIC 1NCBH 5E9DE 5J06A 1TZGL 3ARGD 1XCQA 3D1MC 1A6VL 4YO0A 5HI4D 1LO4H 2OJEA 3DUSA 3PUCA 4LSUH 1KJ2H 4RX4A 5TDPB 1RJCA 5GGTA 3RVWD 3VG9B 1JPSH 2DKUA 2ZG1A 4L4TD 2BFVL 2J2ZA 1AXIB 2R8SH 2FR4A 3WIHA 3P9MB 5HHOA 2IALA 3QXWA 2EE2A 3B43A 3CPLB 3LKQB 3B4NA 5JW5B 3MRDB 4F7PB 1BJ8A 2F5AH 3TPKA 5E7FA 4DVBA 1QA9B 5I17B 2X70A 5IMOB 2GCYB 3QWQB 2I60L 4PRIA 5D1ZA 3BFOA 2WUCL 5CSBA 3BDXA 3J7HA 2QL1A 3VWKD 3TNNA 3ARPA 1DQTA 1H8NA 1UH3A 3BGMB 4WENB 1OTSD 2Q20A 3U30C 4ETYA 3LS5H 2AGJL 2BSRA 1EDQA 4JFEA 3IAGC 5C9KA 5AZEL 1G6RL 4HG4K 2P8MA 3UTSA 1Q1JL 5D7JC 2UWEE 3LB6C 1FFNB 3MLSH 5E2WL 5EIIA 1IM3A 1MLCA 2G5BA 3GRWA 3MV7B 2RR3A 1HWGB 3CFCL 4X4ZA 1RURL 4R7NB 4X98A 2XN9B 4PB9H 5J1AB 1FDLL 4GRWF 5E00B 3CVIH 5DJ8B 2A6IB 2OK0H 1BFOA 4FABL 4H88L 1PG7H 2EYSB 1QYGH 2WIMA 4X4XA 1QSEA 2O5YL 5DD6B 4XPHL 4MNGB 4R2GB 1NLBH 4PRNB 1JNLH 1NMCB 2E27H 1JZ2A 3U9PL 2OSLB 1ERNA 2VDNH 3WFEL 3U0TB 1SJVA 3CVHA 1IM9D 2HJKA 4KI5F 3DRTA 3I3BA 3VD4A 5I18H 4OZIE 3KNBA 1ZLUH 2FCBA 1ZA3A 3B2UC 5IESL 4GG6E 2P5EB 4BSVB 1KCUH 3CSGA 5L88L 5GZOD 4OLXH 1G7PA 4M1DL 1RQ5A 2YOCA 1NC2D 4PREA 2P43B 1N59B 4OZHE 4XZUB 4NZRH 5F1NB 3MO1B 4U1JA 3PJSA 3N50A 4J6RL 2DIAA 2F54A 4MLSA 1X3DA 1LD9A 4HS8H 1I3GL 4Y4KC 2CDGB 3TT1H 3MUGB 3SDAB 2ITCA 1NGQL 3D2UB 1JJUA 1LNUA 3O6FD 1MJ7L 1HH6B 1FG2B 5DRZA 5E99L 1R5VA 1LGVA 2V5TA 3VMOA 1N6UA 4HIJB 3D87B 5EA0L 3FQRB 3GO1H 1D5BB 5GGRY 3FMGL 5EU6B 1RUML 3ARQA 5HGAB 1YY8A 4GOSA 3QZWA 2Y1VA 5L2KB 1HIMH 1J8HB 4K7PL 1RZ8B 2XV6B 2NNAB 5KSBA 1FE8L 5C0JB 1A3LH 4BKLB 5GGQH 4BFIA 3AUVA 1KB5L 3BDYH 5FKAA 5D1XB 1FNHA 3K4DA 4HEME 3HMWL 1CIUA 3RBSA 3H9SB 2C3GA 1V3KA 2DD8L 1C1EH 1M1SA 4FQXD 1A6ZB 4HMEA 2YN5A 3QNXB 1P9MC 2IANE 3SDXB 1G7QB 1WWAX 3GMPA 1A7PH 1T20B 4P4KA 1I1CA 1NSNH 1I9RL 4KQ4H 4C59B 4X6DA 4ELMF 2A83B 3REVB 2PO6D 4NIKB 1T7ZA 1XGYL 3ARGB 5IFJB 5JOEA 2WIIA 4H1LH 4L29A 5H94B 3AY4C 4PRHD 2P8LB 1FZKB 1LEIA 3KLHC 2I5YH 4PRPD 2DQFA 3MJ8A 4LHUA 4F37F 1G7JA 3PE9A 3GSOB 3ZSSA 1SJHA 1BFVL 4IIQC 1FVEA 5GGVL 4XNZC 5IOPB 2NQCA 2BVTA 2YWYA 3FB8B 5HGHB 4NKDB 1BOGB 2KL6A 4HG4J 2ZCKL 2ZNXA 3VXRA 4JJ5A 5E5RB 3ZE0E 1KPRB 4BQ8A 4WFGE 4WFFE 3F6LA 3WJJC 5T3ZE 5JW4R 2Y23A 3RDTC 3ULVD 3CFBA 3T4YB 3JVGC 2DQTL 4KTYA 3NFNA 4PJAB 2OL3L 2YD7A 4NNYB 1PSKL 3O45B 5F7LB 3LN9A 4OBSA 4OD2A 2NY1B 4WW2B 4ODVH 3L9RA 1S3KH 1VKXB 1MOEA 3U6RA 4Y19B 3RX7A 3X13A 5EN2B 2ZG3A 2AJSH 4I5BA 3RZCD 1XGPB 4PV9A 4UQ3B 1BLNA 3L5JA 5DFVD 4I2XA 5GQBA 4HK3J 5HI4C 5DJYA 1NC4D 4KY1H 4Y2DB 3ZE1E 3ULUF 3FB7B 4GRLD 5J6GA 2G60L 3UDWA 5I73C 3RVWC 4GQPH 3WS3B 4XP6H 5I1HH 3AROA 5LWYL 3BKYH 5CGMA 1D5MA 3W39A 1DSFL 4X6CA 2QSQA 1FO0L 2OYPA 4X5XA 5BV7B 3QNYA 3X3FL 4Z7NE 1M4KA 4QEGA 5HHME 4A6YH 4YGVB 4UAOC 3RWFA 3BP5B 3X14A 1FNSH 3WHE1 3PG2A 1YNLL 3MTRA 1BAFL 2ARJA 3ABZA 2ZZUT 3ILPA 3HZMB 3AS0A 4XWGH 3NA9L 5HD8D 3PL6D 4WO4A 3VWKC 4UI2A 3U0PA 1AE6L 5J8OA 1R24B 1WBXA 4UB0H 3VFTA 2B4CH 2IBZX 5JORB 3HC3L 4OCSL 1F90L 3ES6A 3VRJB 4V2CB 3ET9F 3I75B 3WD5L 4OD1L 5LG1A 5SWSE 2Y72A 4N8VA 4OUUA 3CMOL 1YYML 4TUJB 2WANA 3G08B 3KYMA 4KROC 3D69A 5D96B 1NDMB 5D8JH 1OP5H 1PQZA 2XZAL 5EU3A 4TPRH 1A7NH 3L6FB 3F58L 4U1HB 3OKYA 1T1WB 2NY0C 4YQXH 2P5WA 1GZQA 3LSOB 4WTZG 1RAMA 2A6DA 2AK1H 2AJ3A 3QI9A 4NT6B 5FYJU 3S34L 3VFMB 5JA9A 4NP4L 1G7HB 1UQSA 4CBPA 1GIGH 5FDWA 4NRXB 2X7LB 2XZQH 5EORL 4XXDA 1FFRA 3QXDB 4R4BB 3IDXH 5GZOC 2X4QA 3IFPA 1LO2L 1EMTH 4M5ZL 1S5IL 3RNQB 3QCVH 1KCSH 1PX4A 4KKLD 4ZUTA 2BVOB 4JFDD 4FQLH 4LKXB 6FABL 1G9NL 1LK3H 3H9YA 43C9B 4HDIB 3ZL4H 4PJFB 1C5CL 2ORBH 3MRRA 2N1KA 2YA0A 3O9WA 3FOLB 4HK0B 4I3RH 5D7IB 5E4IA 3VXMA 2PO6B 4HFUH 2FWOA 2HKFH 3U9UA 4Z7VB 3O6FC 3BXNA 3OWEA 3I50H 3TM6A 3PWNA 1GC1C 1V5JA 4KAQH 2YD2A 4XBPB 2VDRL 4EOWH 1P7QA 2MQCA 2GAZB 4PRHB 5I1DA 5CLWA 4G6MH 5CMAA 2CMRL 2PXYD 3V7AE 5CSZA 4PRPB 2VDQH 2YPLE 3NA4A 4KJPC 4KUZH 4LEXL 3SJVD 4G7VL 1KN2H 3SGJA 1JTPA 3GSNL 3MACH 3HE6D 2IPKA 5GPRA 3QRFM 2OTWA 2QR0A 4MJIA 5GS0D 5I30L 1F8TH 1VFOA 3WDHA 1E4XH 1H3UA 5IFHL 3TA3A 1IGTA 4FQXC 4D0DA 5KSBF 3M1BB 1M7DA 5I8OL 4CKVX 3QFJD 3GJEA 5FEBA 1RU9L 4M6ML 4QRRE 3ZT6A 2C3HA 5CILL 3OV6A 2XA8L 3QAZB 1MREL 4NHCL 1WEJH 2YA1A 5IEKA 1MCPL 3DECA 1FZOA 3WJLC 5F3HA 3AMKA 3AC0A 1NC4B 3MV9B 3MODL 5D1QD 3DVGB 4IEFB 3T08A 4XVJH 4X6DF 4U6VL 1PYWA 3UJJL 4FQCH 4S0TD 2ED9A 3EJZD 1M7XA 4ZFOA 2L7JA 4CMHB 4I3SH 5HYJD 3V6OA 5T3XE 3BKCL 5DK0B 2VDOH 1QQDA 2DJSA 2GSGB 1UM5H 4TUKH 1UC6A 3BH8B 2FD6H 2Y36H 2R2EA 3O3DB 4M93C 3FZUD 5DO2D 3ZE2F 2XNAA 5ABDE 4BA8A 2HFTA 4I0PD 4LLYB 1KTKE 3ULVC 3EYVA 5EU7C 4ZQKA 2VXTH 2GYSA 5ERWA 4MGXA 5FXCH 4E41E 3BRGC 1J05B 3QA3A 5JW3H 3KPLB 4QOKB 5D9SB 3LEVH 1CYGA 3VCLA 2ENYA 1EHNA 4K8RL 3LRGA 3P4OB 4DUVA 1MFDH 3NABL 4W4OA 1H3GA 3MLZL 3V6BR 5IW6A 3R0NA 4JRXB 4L8DA 3RZCC 2I25N 3NCMA 4TULL 5DFVC 4XCCH 5HPMA 1J0KA 3C60B 4GRLC 2AXGA 2DYPA 3OKMB 3HI6H 1IQDA 3D85A 3MLXL 4E5XB 4JG1H 3EFDH 1MFCL 4ZO6A 4MDJB 1QLFB 4OCNC 5DC9B 5F7NC 3UTPD 4CMHC 2O61A 2PETA 2EIEA 4QRPE 4AH2B 1QFOA 4JHWH 2ATKB 1BM3H 2ZUYA 4NM4H 5L6YL 2GI7A 5CINL 5E2VL 3SOBH 5E8OB 3G6JB 1QSZA 4PTUB 1RZ7H 3BPNC 3ZDZF 5M94B 4NFCA 5CJQH 1TNNA 4WUKH 5IQ7L 1Q8MA 1AO7D 3QRGL 4X6CF 4PPTA 2PYFA 3RI5F 3T3PE 3RY4A 1A47A 3EDJA 3PL6C 4UT7L 3ZMRA 5HYQB 1IKFL 3QIWB 3GDBA 1AGBB 1RMFL 4I0KA 3WXWH 1GRWA 3JV6A 2QQKL 5LBSL 5TPWH 2P42B 3QDMD 3X11A 2VWEE 4C54A 3V8OA 3FRPG 4YJZL 1D5IL 1RFDH 3LPWA 1WWBX 4HIXH 5GGSB 5IHZA 3FB6B 5T3ZL 4ZS6C 1MFEH 2XACC 3O2DA 4OZGB 3RFZC 2A38A 5F8QC 5TQ0H 1SY6A 5F1OB 1R3IL 5ISZD 3DTXB 1QRNA 5BMFL 1MHHB 2ED7A 3DVNB 4BZ2L 1EJOL 4XCYA 3HG1B 5ADPL 2OJZH 4J8RB 1Q9OA 5MEND 3OJDA 5FGBA 3MRNA 4CVWA 1MAMH 4UBDD 3D25B 2Z91B 3KPQA 2HA1A 3SJVB 1HXMB 1PZ5A 3DIFB 1RZFH 1YPZE 3HNSL 3FT4A 2UZYB 1H15A 2X40A 5D7LE 1Q72L 1OAZH 2ATPA 3S37H 5I1AB 1NGZB 3TO2B 1M7IA 4XRCA 1N0XH 3MRQA 5TFSL 4UIKH 1UKSA 5EBMB 4G9FD 2H26B 4LSRL 3GMRA 3R8BB 5EWIL 1K4DB 4M1GL 1P4BH 4Q0XH 3TIEB 2HVJA 3WSQL 4PJEB 3BT2H 4CDGC 3MA9H 2VXQL 1T04B 4JRYE 2BOBA 5B4MD 1E4WH 5DJAB 3TO4A 1NKOA 1E4KC 2EDWA 2J8UE 1T22B 4XXCC 4JY6B 5C0CA 2V17L 3IYLW 5D1QB 4P49A 3B83A 2PXYC 4A2MA 5E6IA 3W9EB 1DL7H 2OMNA 4YUEH 4GBXD 3MLYL 3HE6C 4LHQB 4OF3A 3FJTA 3JWOH 4L3ED 4F2MA 5CZKA 5GS0C 5J4MA 3VFOA 1J1OL 4RCAA 2QQLH 1JHKL 5IVXB 4WUUE 5DXWA 5GS2D 2GUOB 4RMQA 3SKOA 2ZUQC 1A3RH 5C6PB 2GJZB 2Y07L 3RGVA 3BO8B 3EYQD 2FZ3B 2R4SL 4FZEH 5GJTL 3WKML 5LAXA 1MWAH 4L4VA 3WBDA 5IMMA 4OGXH 1DTUA 4PJDE 5J6HA 4XNMA 4FQIL 5DUBB 3VXSD 1HHIA 2VZSA 2IEPA 4G8EA 3E6FA 4LDEB 1IGMH 5D1QC 5E08H 4AIZB 1QFWM 1SBSL 5CZVL 3T04D 1CZ8L 4K23L 5TDOB 3IGAB 3ZHKA 3EJZC 1NEZA 1KTLA 4X7SL 5I66A 3U4EB 4JDTL 4OFKA 5EC2A 3V4PH 5AYUL 3MX0A 4GXUN 1NUFA 3ROLA 4QHMB 2FJHA 1Y0LB 2ZOLA 2BX5A 5FYKE 2VLRA 2E7LC 1KB9K 3FZUC 4PJIB 5DO2C 4TQEL 5JR1H 3OQ3B 4MXVF 4I0PC 4LSSL 1UJ3C 3T1FB 2VZVA 1QUNA 3WLWD 3FN0H 1CGSH 3VGAB 2FH8A 4KRLB 3IJYB 3PP3K 3RA7H 3O4LA 4NNXA 5D6CA 5DD1H 4YHYB 2W9EH 4NDMB 3PWJA 4WW1A 3KG5A 4JZNA 4XVTH 4UV7H 4U0QB 1VB9A 1JL8A 4FTVA 4EZMA 3V7AG 5AUMB 5K9QI 5KZCD 1UB6B 5IVOA 2VLKE 4LDLB 3GNMH 4OM1L 3OB0K 1I8MA 1VADA 4QY8A 4MNQD 1BBDL 5ISZB 2YKLH 3GMLA 3BISA 1KN4H 4HCRA 1CGWA 5BCAA 4PGCA 5IBTL 2P8PB 3IFOA 4NNPH 4NKOA 4U7KA 4LFHG 1FL6B 1MFAL 3EYUL 4ZODA 1KEML 2B8OT 3S7GA 5B8CB 2PCPB 1FGVL 4G8GA 2ZPKH 2CK0L 3F7QA 2ADGA 4OLZH 3OXSB 3U46B 5J89A 2H32H 3CH1B 3H9ZA 2NPLX 4XTRD 3VDBA 5C09A 4ISVB 4LF3A 4Q74A 5T3XL 3KPSD 2D31B 1UGNA 2D2OA 2CDFB 4N0FB 3BQUD 4KHXH 5DEFB 4G8IB 1UYWL 5EB9A 3S4SA 1PZUB 1RJZA 5HI5D 4EDWL 1SYVB 4JKWA 1G6RB 1CT8A 2FX7H 2D7NA 3BRFA 1INQA 3MPCA 1MEXH 3F7YB 1IAIH 1G7IA 2R1XA 3S96A 3UZVB 1IC5H 2IPTH 2E3VA 4Y5XA 5HGDB 2ZNWA 4PJXA 1FL3A 1DVFC 2HWZL 4OCYH 5FUCE 4JREB 5B8CC 2KH2B 4UBDC 1NCDL 2R29L 1PJ9A 3NTCH 1CXFA 5E5MB 2EDNA 3TV3L 2LTQB 2COQA 4PGEB 1DCLA 3QG6A 5EH1A 1UCTA 4LP4A 3UTTB 2WNGA 4O51B 4Z77B 4HUVB 2F58L 3O11A 5C70A 2R4RL 4JGUA 3Q6GL 4JHZA 4DKDC 5IB2B 3H3BC 1ND0B 3HI5H 1F13A 3U2SA 4HBCL 5GRVL 4DK3A 4Z78B 2DLGA 5IVZB 2W9LA 1EIBA 1KFAL 1MHPH 2ERJB 1MHCA 2YUWA 1T0NA 4J12A 1FL5A 5IWLA 4LAJH 5JQ6H 2AEWA 3ARZA 5IKCB 5F6HI 4NQXB 3S6CA 5DD5L 3VXSB 2Q86A 1UCBH 1KB9J 1NAMH 4ZSOB 1EHAA 4NFBA 4TSCL 3DO3A 2YZ1A 4Y2OA 4JO1H 1JHTA 3W0WA 1FORL 5J12C 3IF1A 4EI5D 1VGEH 3HCVA 1OGAB 4GBXC 3WDIA 3KYNA 1TTUA 3C6LB 1RSFA 1IEHA 4PJ8D 2HFGL 1F6LL 3I84A 5DUML 4UILL 4GJTB 4QRQB 1KB5B 1EO8L 2RIKA 2YRZA 3WNPA 3DJ9A 4XCNB 4ZAKB 1G84A 4XX1E 2XTJB 1BD2D 2VZUA 2IG2L 4WV1B 3SCMD 1WCBA 1CD0A 1HCVA 3H9HA 1P5VA 3EYQC 1CVSC 5HHNA 5TF1L 2NX5D 3TBTB 4DGIH 4B5EA 3BOVA 4EVNA 3QCTL 3RL2A 5D7JA 3C8KA 2QSCL 5K9QG 3C2AL 3JSSA 4HPOH 3ESUF 4OFYD 5DFTA 3I6LD 2BOCB 5TDPA 5LGHL 1VFMA 1RIVH 1BIIB 1KTRL 3ZYOA 2GY7B 2NCMA 2ZSWB 2P47B 2NW3B 1RZJC 1I9JL 3FHAA 2XPGB 5TE4L 4BZ1L 5F7DA 3P9MA 3LKRB 1XFPA 3QXTA 5BO1H 5BRZE 3CPLA 4OFPA 4M7LL 1P1ZA 3UC0H 4D9QD 1HHGB 4KRPD 1QA9A 5I17A 2XTLA 1FNAA 2CKBL 4M1CC 4GKZB 3T1WA 5HDQL 1BWWA 5BVJB 5KOMC 1NFDB 1S7XA 4F9LA 3GFUA 4WV1C 5C3LD 5CWSB 3ZTNL 3WLWC 3BGMA 3JV5A 4K9EL 3DO7B 1OAUH 2V5YA 2WUBH 4OKDA 2W0FA 4NJAL 3MOBH 1FN4B 2R0WH 1D5ZA 2OL3B 3BQUB 2QQQA 1NBYB 1FFNA 2Y06L 4FS0A 4Y4KA 1W72H 3MV7A 4IS6B 1AJ7H 1EUTA 2AKRB 5GSRA 1BQHG 1I8KB 2PR4L 4R7NA 4FFYH 4O2FB 2XN9A 5J1AA 1PLGH 1URLA 4M6AA 4M8QB 1WSST 5E00A 1S9KC 2VLJE 5DJ8A 2A6IA 3UCRA 2AJUL 1VCAA 1F11A 5FYLH 1CFVL 5DD6A 3GI8H 3NPSB 3QXUA 4UDUB 2NXYB 4MNGA 4JN1H 4LLQA 4PRNA 1MRCH 2W60B 4ORGB 2LVEA 2OSLA 4D9RD 1UT9A 2ADFL 2CIIA 4EN3D 4MSWB 2Y9RT 1I1YB 3ARDB 3AGVA 1LDPL 4I9WE 2P5EA 4XTRC 4G43B 4BSVA 1A22B 2FSEB 4R9HA 4HJGB 1N59A 2FL5B 4GG8B 4XZUA 2VO5A 2OZ4L 1L7IL 2VXSL 1P9MA 3P77A 1DUYA 4LLMA 2DI8A 1U93B 1E6JL 2EH7L 5FYKL 2D3VA 2VL5B 3MUGA 3V7MA 3SDAA 4K8RD 2LQRA 3FQWB 3D2UA 3HKFA 3PXHA 3MRGB 1KCVL 2Q8AH 3HC4L 5SX5K 3PGFH 1HH6A 2BDNH 2L0DA 5I1CH 1TJGH 3MOAH 4K2UH 1G0DA 4GLRH 2IAND 4O4YH 2CRZA 3FQRA 1D5BA 3ZDYE 1CGYA 4I48B 1CXHA 4GKSA 5HGAA 4HLZG 4IIQA 1ZLWH 3FT2B 1A8JH 4KXZH 2NNAA 5E9DB 3ARRA 4MYWB 1HQ4B 2GJ6D 3M8OH 4IOIB 2XQBL 3QUZC 3MJGX 3HPJA 4YFLF 5D1XA 1D7FA 4PJXF 4Y1AE 4JFPB 5DR5H 3AM8C 3W9DB 4Q6IB 3D0LB 4XMKL 4F58L 4NSKA 1A6ZA 4GMTH 3WJJA 1DE4B 3QNXA 4NQUA 1DLHA 1LO4L 4LSUL 5LQBL 4NO2B 4OQTA 1G7QA 4OFDA 4I18C 4IJ3B 3BPLB 4GQ9H 4RIRB 4Z95L 1JPSL 5GRXG 2A83A 25C8H 3MFFA 3REVA 3C6SB 4OBRA 3MLUH 2DI9A 3ARGA 4LKCA 4WFGD 4WFFD 4KK6D 5GRVK 1L0YA 4WY7L 3OGOE 1EERB 1MI5E 5H94A 2N7BA 5CJ5A 3B9KC 3P0VL 1S7QB 4R4ND 5DYOB 3HRZB 2DIJA 3LVEA 4W6XB 1BGXH 2EDKA 5AG8A 4Z8FH 4UIMA 5D2LE 4HWEL 3WIFB 3EOAB 2O5XL 3GSOA 1CDGA 2VKWA 4L4TA 3QUYC 4IMKC 3WO3B 5FM4A 4JO4L 3VI4F 5IOPA 1KENL 4EI5C 5HGHA 4M62H 4NKDA 2UWEB 2IC2A 3T2NH 5I75C 5I9QC 4QF1A 1U41A 3S5LG 4UU9A 2H41A 1GGIH 1PVHA 4BQ9A 2NY2D 1KPRA 4PJ8C 1LK2B 3ZTJG 3GSNB 4XPFL 5HHXL 1NUNB 1WFOA 2GQHA 3DBXB 3MLSL 3T4YA 1IARB 4RNRB 1H3PH 4DUWA 3VWKA 4PJAA 4JFFD 2EZ0D 1U8KA 3BPLC 3O45A 1XF5A 3SCMC 3NIGF 5HHMD 3J8F7 3ULUH 4Z76A 5EN2A 3RU8H 1XGPA 3ETBF 4UQ3A 4NC0B 3DSFH 2MPAH 5A3ID 1EFQA 4AEIL 4OZIB 2R2BA 4PFEA 3KPRE 4GG6B 3DROB 2C7UA 4HZLA 3MLVH 1WBYB 4G7YL 4NRZB 3WS3A 4HKJB 4JO3L 5I15L 4DKEL 1JUFA 3ISWA 5BS0E 1RUKH 5I18L 4OZHB 1YMHB 5GGTH 5JOPD 5GHWL 3UBXG 1TLKA 4XCFL 4YGVA 4X6FB 5E2UH 3BP5A 5ACMA 3VRLF 2CH8A 2B5IB 5IM7B 3BN3B 3WIHH 2GITA 5SWSD 4KRPC 3HZMA 1IAMA 1DBBH 4HIIA 4EN3B 2VDPH 4NKIH 1V7NL 3L1OL 1TJHL 1CBVL 3GMOA 1R24A 4NQDD 3MREB 5EUOE 1NC2A 4M3JA 4DFIA 3OJ2C 4LNVA 1I7UA 5JORA 5B3JF 4BH7B 1HDMB 3MZGB 1TCRB 3UAJD 3BIKA 4F8QA 3I75A 4WHYG 15C8L 2JIXD 3OKLA 5C0ND 4IRSC 1HZHH 4TUJA 3G08A 4XI5C 5I1JL 3O6FA 5EO0B 5CP7B 1NDMA 3ARYA 3SGKA 1LE9A 5IB1A 2YPVL 4HUXB 8FABB 3HZYA 5A2FA 4PBXA 3L6FA 4LQ1A 1A6TA 5D6DC 2IANB 5CJBA 5EFIA 4M6OH 1FSKB 1C1EL 2DQJH 1U92B 5DHYB 4LBEB 3LSOA 1IL1B 4RDQF 2YD1A 2DQUH 4YZFF 4NT6A 5EU4B 3AAZB 1QO3A 4Q9QH 4XX1G 5GXBB 2P1YA 3LRHA 4LSDA 3EO1B 4NRXA 4UT6L 2X7LA 4M43H 4QXGH 2OTUB 4X7EC 4XVSL 4KQ4L 4GAJH 4TVSa 3CVHH 5C0BE 4Y7MA 4ONFL 1NMBL 2K7QA 3CJJA 1BJ1H 5KN5B 4FQXA 4AM0B 3T0EC 3QJHA 2YPLD 3RNQA 2YA2A 4GRMB 1UENA 1NCWH 1OSZB 3DYMA 5I76B 4LKXA 1K8DA 3C2SA 3NIFF 1T1YA 4PGBB 1RULL 3D39D 4HK0A 2AJYH 3FOLA 5D7IA 3VD9A 4M48H 2PO6A 4Z7VA 2XICA 4PG9B 1B0GB 1UWGH 2R1YB 5L7XH 4XBPA 4RRPG 1DANT 5DEZA 1N3NB 1ETZB 3JV4B 4PRHA 2GAZA 4XPTL 4TUOB 2WM0A 1MF2L 4TSAH 3QBTB 3UXFA 3QDJD 1OB1A 3BP7B 2PTUA 4PRPA 3DX6A 4RFOH 1A1OA 4JKLA 3Q1SH 1KEGL 4JQVC 3ZKXC 2MHAB 4Y5VC 2CDEB 1U8OB 4EI6B 2NMSA 1EXUA 4P4RB 3VI3E 2WAHA 1KULA 1CN4A 4X9HA 2F53E 2XQYG 3D18B 5C2BH 5TE6L 1MRDL 1XGRB 2NY2B 2UUDH 5KW9L 1QHOA 4HKBB 2ZG2A 3V2AR 5IT2L 3V4UL 3M1BA 3RKDC 4KY1L 2M1KA 4GAGL 4NC1E 5T3XD 2BRRL 3MXVH 1Q0YH 2VC2H 5FCUH 3SE4C 4XP6L 4P9HH 1MCFA 2V7NA 4LVHC 1U42A 5HHMB 1OP3H 4OLVL 1AGDA 3TBWB 3GBML 3LS4H 1S7VB 1EFXD 2I07A 3RWJB 3RZCA 1X7QA 2BXZA 2ICWI 4XMLL 4K3EL 1NC4A 4O2CB 4GRLA 3FQXB 1ZHLB 1YNKH 3DVGA 1VFBB 4E41D 5IEHA 3MLRL 1FV1A 1KLGA 1FFPB 3IB4A 5F6IB 3JTSB 3TYGH 1QBLH 4W6YB 2O5ZL 2VDLH 4CNIB 1XGTB 1UWXH 2BZDA 1IGIL 4PJ9B 3L5HA 5DK0A 3O81A 3IU3A 1E28B 1I1AD 4V1DD 4C57C 1Q9KB 2VIRB 3O3DA 5SWSB 3IDMA 4BQ6A 1B88A 4WTWA 4LLYA 1JP5A 5L8JB 5T33L 3U7WH 1Y6NR 4QRPD 3PL6A 1N6QH 2EEAA 2EZ0C 2BNQE 1UKTA 2XZCL 1DQDH 3EAKA 3FQUB 4LGRB 4QOKA 4Y5YB 5DSCA 4FFZL 5JXED 3P4OA 4NQED 4F8TA 2WLZA 1M71A 4O00A 4TPRL 3SE8L 2JELL 1N64H 3QUMB 2MNUA 5A3IC 4PJAF 4YQXL 1T1XA 3O2VH 4WTXA 4KJYA 1NBQA 5E8EB 3GKWL 4E5XA 1X5HA 3U1SH 5C0EB 3HZKB 4POZD 4MDJA 4IDJL 4JGJA 2BNRD 2ZCLH 3C08H 4AG4L 3MRFB 2W07A 2XZQL 4LL9A 4CN6A 1BHGA 1FYTE 1FNGB 1WZ1H 4ODWB 1E27B 3FQNB 2JJSC 1AHWC 3PHOA 5ENWA 4L8SB 2VZTA 5HHPB 4MVBD 3G6JA 2BK8A 4ZFZA 4PTUA 2RHEA 2IPUG 3RWGB 1EMTL 3TT3L 4JO2H 5GJSL 1ZLUK 1YEJL 3QCVL 4IM8A 1KCSL 5EZIH 5F6HJ 2RCSL 3WYRA 3E3QC 2ENSA 3Q2CA 1F58L 1TFHA 4I77L 1B2WL 4K07A 1VDGA 3C5JB 1AGBA 1IE5A 1B4JL 2HKFL 4Y5YC 4CL7A 3I50L 3DXAE 1FFOB 2YPLB 1JZ7A 1G9ML 4LSTH 2DQCL 5GGSA 5KSAD 4ZOAA 3WFBH 3UAJC 3FB6A 3PDOB 5CBEA 3EYOB 5C0NC 1ZT1B 3AU1B 5K59E 3DTXA 1KN2L 3HNTH 2ZUUA 3A6BH 4PJGE 1A7QL 3DVNA 4WWKB 3HG1A 1E4KA 3V0VA 4XXCA 4YDVA 4J8RA 1INEH 5IROA 3BKMH 2PXYA 4I4WA 3P40A 4QRRB 5CBAB 3D25A 3OF6D 4UT9L 3SJVA 4FZ8L 1HXMA 1P4IL 3DIFA 2WQ8A 4NPYA 5JLZB 4RGND 1FJ1B 3HE6A 3OZ9H 2YK1H 3QNZA 4M7LT 3U82B 2DS4A 1JBJA 3BGFB 5CEZL 3U4AA 1NGZA 3W2DL 2DL2A 3TO2A 4D0BB 3BYYA 3HUJA 1N6VA 3S35H 5EBWA 5EBMA 5ESQA 4K3JH 4K94L 3QFJA 4OF5A 4U6XB 5I71B 1F45A 4MD4A 3WFDL 1NGPH 4FFWD 3TIEA 1YEDB 1P4LB 3MGAA 4GS7B 5IMLB 4XVUD 5CGYC 4DTGH 5CJXC 4I3SL 1A7BA 1T04A 4KI5D 1EFXB 2O93L 2AK4D 1CL7H 3LEXB 3LN5B 2BVYA 1T22A 4ZXBD 5ICZA 2YRLA 5D1QA 4R26L 2FD6L 4JHAH 1YEEL 2YUZA 5DJ0B 4E41B 4S1RH 4PJFF 4R8WL 5D7IF 5ITBH 4Z7VF 2XQYK 1QLRB 1ZLVH 3W9EA 3GSVB 3KWWB 5HYJA 2ESVD 1MFBL 3P4NB 4JZJC 2XKNB 5EU5A 3O4OC 3VXTA 2FBJL 2E7LA 4L8BA 1F97A 1AXTH 3WFCH 1L4IA 3G5ZA 1P7HL 3GSXB 2GUOA 4I0PA 2VQUA 1UJ3A 2GJZA 4QRPB 3OR7B 3HI6L 4XNYH 1A3QA 5CSGA 1EGJL 1ADQL 1ZHBA 1CFBA 5MI0C 3LQAL 2HFFB 4PJCE 5FYKD 4DN4H 1ONQB 4UQ2B 3ULVF 2AI0L 3QPXH 1A14L 4KV5E 1PG7X 4AIZA 5F9DC 3CSYB 2QV2A 1GGUA 1KIRB 4ALAH 2JK5B 4U7SA 5T1MB 3IGAA 5L9DL 3VFVA 4JRWA 3HR6A 4FQJH 2WINA 1XF1A 4U05A 1D5XB 4ERSH 4FNLH 1O0VA 5FHBH 1A7RL 4U33A 1CDYA 5JMRA 1I1AC 2VLKD 1BF2A 2XXCB 3BE1L 2EECA 2X4NB 4PJIA 1QSFE 4HIXL 3RVTD 3O6LH 1AO7A 4DZ8B 3T1FA 3VXUE 4ENED 1G7MA 4LQFL 1ZHKA 1MY7A 1WICA 4XMPH 3L5IA 4YR6A 5AYQA 4PS4H 3IJYA 1U8HA 2KUTA 3MGOB 3KXFD 3QDMA 1UB5B 1YN7B 5F70A 5JXEC 2APFA 5FV1L 4NDMA 4CDHA 2JCCA 5IW1A 1T03H 5AUMA 3R0MA 4NQCD 3IDNB 5GSVB 1MAML 1YPZB 4N5UA 1OP5K 3OHXB 5D7LB 1MH5A 1ZVSB 5ISZA 3BP4B 3QEUB 4HPYH 4GXVH 1R3JB 1AGEB 1X5IA 2P8PA 3I2CL 4QYOA 5FM5M 4QHLB 1RV6X 1HOCB 1TVBB 3QQNA 2IPUK 4OIIL 1U36A 2R0ZL 4OKVB 1FL6A 2QHRL 5MENA 2G5RA 1XIWD 3K8MA 1F4XL 5B8CA 5FV2A 2VXVH 2PCPA 4MVBC 4R0LB 4URTB 1NL0H 3E8UL 5D2NE 1EO5A 1T6WA 2DICA 5LXGH 3X12A 3U46A 4YE4L 3BW9B 2BSTB 1MCOL 1S78D 3CH1A 2ZJSH 2VDKL 3MLWL 2HJFB 3NFPB 4JRYB 4M6NL 4S2SB 5I19H 4ISVA 5DHVB 2J8UB 4XCEB 3FFCD 3EOBB 2CKBB 3G6JF 1OP9A 4G8FB 2CDFA 2KPNA 5E2JA 2B1HH 1JGEA 5DVOA 5LGJB 5DEFA 1BQHB 3OTTA 2FX8L 1ZGLB 2AW2A 3STBA 4KKNA 3CAFA 5KSAC 1IGJB 2F15A 1JI2A 1SYVA 4OF0A 1G6RA 4U1NA 4UTBL 5CS7A 5CGTA 4EIZC 5FM5O 1T4KA 3QHFH 3ILQD 4BUGA 3DLQR 4KRNA 4X5WB 4LLVA 4M61B 3O2DH 5HGDA 4WUUB 3GM0A 3FAWA 2EO9A 4PIRF 3MJ7A 3ARFC 1G7LB 3SDDB 1J0JA 1DQML 4EJ1C 2QQLL 4J3XA 4JFQB 1OQOA 4F7EA 5D1ZD 3WL9B 3G5VB 3MBEB 1ZKAA 2MCPH 1BEYH 1OQXA 4JPKH 4GBXA 4RGNC 1QG3A 3PGCA 4MAUL 4PJDB 4UINH 3S3SA 4PGEA 2GK2A 5A43C 5ELIA 4DGVL 5BJTB 4L3EA 1MWAL 3IFNL 3QQ3A 4XPBL 4O51A 4Z77A 4HUVA 4UOW1 3RKPA 1ND0A 3GUTA 2H2PD 5MHSE 1E6OH 5EZOH 1GCFA 3TZVB 4Z78A 4K9EC 5IVZA 3L3IB 2AJXL 4ODTL 2OMBA 1JNJA 3ALWA 4MHHI 3CU7A 1MELA 1U6AL 2G2RB 4QCIB 4OGYH 3BI9X 4XVUC 1JRHH 3GSWB 5DK3A 3HUJF 3QIBD 3CFEB 4GXUM 4KI5C 4NQXA 3VMNA 3VXSA 3AS1A 3CK0H 1OGTB 1QSED 1DLFH 5ACZB 4ZXBC 4R4FL 1WIUA 1H9VA 5FYJH 4PJEF 1IC7H 3HFML 5JR1L 1IC4L 1RIUH 2GTWB 5CIPH 1RK1B 1JYNA 3OJVC 3C6LA 1BVLA 5C6TL 4XC3L 1UACH 1Q94B 2LVCA 4NZDA 4LNRB 5IGXH 2VLKB 5ICXA 4MQXD 4U1KB 4QRQA 1KB5A 2H1PL 4Y16C 4PY7A 4FOMA 3DGGB 4U2YA 4XCNA 2NLJA 4WV1A 5C0IB 2OI9B 3NFSH 1XCTA 3LHPH 2FNBA 4YH6A 2VITB 5HDOA 4B7IA 3F62A 1MPAL 4QTIH 1ZGLM 3O0RH 1KN4L 4P5TC 3MUJA 4FXLA 5IVXF 4XNXL 4PYGA 5IHUL 4JDZB 2BOCA 5E8DH 3P30H 2H6PB 1UM6H 3JWDH 2Z92B 1UWEH 2HLAB 4RZCB 4OAWB 2B0SH 4PBVC 4J3SA 5FHAH 3P11L 4QHNA 3BPOC 2NW3A 4P2OB 3H6JA 3U4BL 3MRMB 4YGAB 3S5LB 5I8KH 2CXGA 1AI1H 1Y6MR 5D7SL 4MB3A 3A6OA 3HAEH 4HFWA 1KJMB 1OWWA 1XIWB 1HHGA 5IBUG 2X89D 1CD8A 3O3EB 4M7JH 4HWBL 1FYHB 5AAMA 4CVZB 4GKZA 3ME0A 2PW2B 1NFDA 3RVTC 1AD0B 5AWNL 4NM8H 4NQVA 4OQ1A 1D6VL 1QRKA 4XP5H 1QLEH 3SQOL 4X7TB 2FX7L 4KUCD 3V6ZB 1FN4A 1HYRC 1K6QH 2OL3A 3BQUA 4PJIF 3N1MC 4Y0GA 4OGAD 1J1PH 2XKSA 4I9WD 2AV7A 4LHUD 4LLWB 4HUNB 2HH0H 1CGUA 1I8KA 4O2FA 4EQ3A 3LKNB 2ICEB 3GB7B 1F3JB 1MUJB 2JCCF 4UDUA 4HCRH 1B3JA 4NN6C 4TNWK 1XIWC 4DZBB 1FO0A 1YJDC 4ORGA 1MCKA 3T2OA 5F7KC 4H0HB 3RTQB 3HI5L 3IETB 4HH9B 4JPWH 1P5UA 3DOSA 2X4PB 4H0IA 2ICWJ 1U8JB 3FQTB 1I1YA 3ARDA 1N4XH 1S78C 4FXKB 3HZVA 3ULUC 4G43A 1FRGH 4ONOA 4ZOEA 2FSEA 3NIDF 5BQ7A 4N5ED 4HJGA 2FL5A 4GG8A 5IFAL 3I6GB 4UUJB 1LEKB 4ESKA 1EVUA 1AQKH 3H3PH 4ZUSA 1M6OB 4ZDHB 3JZ7A 5BZWB 3LEYL 4MHHG 4NCDA 2VL5A 1IVLA 3MYJB 4LIQH 3MXWH 4OM0H 5CUSH 1A4JB 5T5FH 3WNLA 4U3CA 5I2IB 2ZOKB 3ILQC 1VGEL 3CXDL 1JGLH 3HS0B 3QIBB 1D3CA 5T1KD 1WBZB 4L5FL 3LKSB 1RJLB 6CGTA 5M95B 1T7VA 3WXVL 1S7UB 4GLRI 4HX1B 2I9LB 3IDYB 4KVNH 4CN1A 1JK8B 3OSKA 3FO1B 2AXFB 5D1ZC 4EI5A 4WJ5B 1MI5D 1FH5L 4KXZI 5D4QA 3OR6B 4JFPA 3W9DA 4X7CC 3D0LA 4PJ8A 2VLME 4DGIL 4OSUH 4ZG1A 2B2XL 2FGZA 3VRIB 5L2JA 1MNUL 4NO2A 5FUZL 4N90D 2F74B 1S9YB 5DD0L 3RNKB 5BRZB 4RIRA 2X42A 3SCMA 4C4KT 4R96A 1IGYB 4FP8L 4B53A 1CLYL 4F15C 3DVFA 2W0KA 3V6FA 1YYLH 3NH7L 1NBVL 4RWYH 5HYEA 4OFYA 1S7QA 4RBPK 5AAWA 1ITBB 1A6WH 4GAFB 2EDEA 1JWSB 4U49A 1ZGLP 1QVOA 3NCCB 1U0QA 3RWEB 2F54E 4KPHH 1DEEB 1YNTA 3VFWB 2AXJA 1FP5A 2UWEA 4O02H 1RJYB 1LE5B 2FGWH 4PBWD 1LEGA 4DKFL 4H0GA 3CZFA 4MXQD 1LK2A 2K3TA 2R2HB 3MOBL 2W1NA 3GSNA 2R0WL 4KK9C 1D6EA 2JJVA 2V2XB 4MQXC 3RVUD 3DBXA 1JF1B 1BFSA 1WGOA 4Q2ZB 4RNRA 4BSWA 1W72L 5CEZD 2CR6A 2VLJB 4KHTH 4YHIB 4ZS7L 5C0RH 1JIBA 1PLGL 5B3NA 5TH2B 3O41B 4LASH 4CU6A 2WV3A 2YWZA 2W91A 3HC0B 5CD5D 5J56B 1JPFB 2D7MA 2BY2A 3LRSA 5DVKA 1PY9A 3DROA 1QBBA 3EYFB 1NLDL 3V0WL 1WBYA 2EC8A 5CD3A 4YDKH 4C56E 5DK2A 3GK8L 4EBQH 2XFXB 3GSQA 3IFLL 5JUEL 4OZHA 5D6DA 2UVEA 4BSJA 3QIUB 1ZWIB 5KTEL 4X6DE 2KKQA 2CJUH 3ZHLA 1N5AB 1JCKA 5IM7A 1EAPB 1DANU 5DMGD 1B9ZA 5DC4B 4U6YB 3S37X 1TJIL 1A6UH 5J3HC 2DQHH 4EN3A 3SDCB 5KVFH 5C6WH 2Y5TB 4D9LL 2DDQL 2MCG1 1J0YA 1IRAY 2OBGA 1DR9A 3ZE2E 1DP0A 2CLVB 3K1DA 5JW4N 5L8LB 2BDNL 5I1CL 2F5BH 3ZYZA 3PP4H 1RZGB 3WNKA 1HDMA 1TCRA 5L8KB 4RGOL 1OAYL 1NFDF 3FO2B 4OGAC 1QBMH 4QRTB 2B1AL 1NAKH 4Y1AB 5C0BD 2APWA 1S7WB 2IBBA 2CSPA 1IGCH 1ZTXL 3SKJL 1J5OL 3EO9L 3M8OL 5ALBH 4FG6D 2PYEE 2FB4L 4HUXA 3X3GH 3B6SA 8FABA 3V5DB 2UZIL 5DEGB 4KGJA 43CAB 4BUHA 2B39A 2IANA 3C09C 5F9JB 1U92A 5DHYA 4LBEA 1IL1A 4KK8C 4Y4FD 4BH8B 1GL4B 3DX8B 4LCCC 4JQVA 2DM2A 5EU4A 5KSUB 1AKJB 3AAZA 4Y5VA 3EOTH 5JQHC 4HS3A 2GJ6A 3EO1A 4OCXH 3Q48A 4XAWH 4GQ9L 2OR9H 4HUKB 2R23B 1MI5B 3BJ91 4R97B 5ILTL 2C4FT 2QKIA 1HSAB 4YNYB 2OTPA 5T1LD 4XBEH 4N5EC 1UA6H 2ZCHL 4BK4A 2UY6A 4AM0A 4HC1L 1OL0A 5D2LB 4H25B 1DFBH 3FONA 5IQ9B 5IHBA 3R06B 1OSZA 1N7MH 3BEWB 3OKNB 1SEQL 4MWFB 5EZLA 1I7ZB 5F9WC 4HW6A 5EBLB 1S9VA 1K2DB 4LU5L 4AZ8A 3ZDXF 4PG9A 1B0GA 2R1YA 1XGUB 3ALPA 1N3NA 3T0AA 3JV4A 4UNVA 4TUOA 4IMLB 4LPTA 5ETUB 4G6KH 4DW2L 1RUAL 4R90H 3ULSB 1CDBA 1M05B 5F89A 1RVFH 3P2TA 3BP7A 2IAMD 1MRFH 1AGFA 2YHGA 5K33A 1HXYB 1YQVL 5I1EH 2E6QA 2CDEA 1A6AB 1H3PL 1U8OA 4EI6A 2VKXA 1RUPH 4NO0B 1CXKA 4WIQA 4YIQB 4WO4C 3D18A 1JMZA 1KBGH 2HAZA 5E95B 5DURD 3KPRB 1XGRA 4HKBA 3BAEL 2EKJA 1MCSA 2FLRT 4W81A 4NYLB 4WGVB 5BS0B 3UJIH 1JFQH 4ELKB 2ICWB 3MOQA 2VABB 4YXLH 3TBWA 3MBXH 4OQTH 1RUKL 1G9MC 4U1SB 4TN9A 2GSIB 1BBJB 2A9NL 1XGQB 2Z35B 1TQCC 1DBML 4JFZL 3F12A 4O2CA 3FN3A 4JKMA 3FQXA 5IF0A 1ZHLA 1FGNL 3L3KB 1NGXA 1NKRA 1L7TH 1RZIB 3N0PB 1FFPA 2XWBB 3QI9C 5EUOB 3WNNA 3JTSA 5JPMB 5DUPL 3VD7A 4ZFGL 1XGTA 3U48A 4H26A 4FFVD 4Q9CA 1AHWA 4D3CH 1A0QH 2AEQL 1RIHH 3TYFB 4OV6F 2VIRA 4MXQC 5SWSA 3RAJH 5I6XB 4PB0H 3RVUC 1DEDA 3SGEH 1FAIH 3THMH 3QO0B 1Z2KA 2R0LL 3VGGA 2N4IA 3DRQB 3BUYB 4K7PY 3AMLA 1YEKL 2UWEF 1ZMYA 1U3HB 1MFNA 2DQIH 3FQUA 2AV1B 4ODXB 4Y5YA 2P46B 1S7SB 3PWLB 1RK0B 1BX2B 3ESVF 1T83A 3KJ6L 4HIHB 4JY5H 4P3CH 1CR9H 4K94C 3NCYP 1F4HA 2KQNA 4KZEL 3L3JB 1F2QA 1SM3H 3QUXB 5FA3B 1P84K 4H8WL 4OB5H 4OJFH 2PF6A 2JIXA 5E8EA 4Z9KB 5C0EA 2C1OB 3D3VE 3HZKA 5C0BB 3DX7B 5CHNB 2FEEL 2UVFA 4HIEB 1I7RA 3OGCB 4HXBL 5DJCB 4DGYL 4X9IA 1U8NB 4UDTB 1G6VK 3SGJC 4DEPC 4JG0H 4MD5B 1FNGA 3QHTC 5ITFB 3FQNA 2A6JB 5J13B 2FX9H 2WW8A 4NHUB 1IFHL 4GG6F 5BV7H 2GFBB 3I3EA 4HGWA 4J3UA 3RWGA 2AS5M 5DMGC 1YEHL 4MS8D 3VDCA 5TGBA 2DMKA 4G9DB 4H5SB 2HMID 4OZHF 2CQVA 3DSNA 1JNNL 5EOTB 3RGVD 1QR1B 1OW0C 5DT1L 3QP3A 3OAUH 3X17A 5F7EL 3MNVB 5T1LB 1JGDA 1UXSA 1S9WB 1VEOA 1FVDB 5F1IB 4MXVE 1FFOA 2YPLA 2EH8L 1DQQB 3PNWB 3VG0H 12E8L 1CLOH 4OGZA 5AZ2H 3Q3GB 2ZUVA 3PDOA 2D7TH 2DM7A 4KMLB 4RFOL 3EYOA 5DRXA 5HHQB 1ZT1A 2DQEL 2F53B 3D39A 4PUBH 3AU1A 5CJXA 1KCLA 2X9XA 5C0DB 4OLUL 4RAUB 2APVA 4MX7A 3KLDA 3G5XA 4CU8A 1MHEB 3O2WL 2W92A 4FG6C 1OCWH 4ZD3L 3V6OC 3RL1A 3BJLA 1AFVL 4MJ6B 2R56L 4XP1H 4WEBH 3KVQA 5HHVL 2IGFL 4QNPE 5CBAA 4Y4FC 5FYKU 4G6FB 3VFPA 2JB5L 5E7BA 4OCLC 5JLZA 4P5MB 1HI6B 2VH5H 1FJ1A 2N56A 2VR9A 4JZJA 4NFDA 3TBYB 3FCTB 1XF4B 3QZWG 4O9HH 1I1RA 1NMAL 1QBAA 3NCYS 1N8ZA 1W8NA 1TETL 4RAHA 1YEFL 5DURB 4D0BA 2FATH 4PGDB 2OP4H 5E1AB 3O6ML 2P7TB 4PTTB 2CLZB 2L4OA 5ICYA 5J11C 4W4OC 2XRAH 4U6XA 1YEGH 1EV2E 2FDBP 2AQ3A 3MRIB 4OCWH 1P4LA 4Y4HD 5DVLA 1T5XB 3DUHA 4ZTOL 2IFFH 3REWA 1H0DB 3VFRB 5I8EB 1HHKB 1EFXA 1FFQA 2Z8VC 5BVPL 4Z0BH 4ZUVB 3SO5A 4DFHA 2BSSB 3V95A 2YPKB 5EC1A 5JIPA 3UYPA 4J7RA 1Q9LB 4NC1C 5DJ0A 1IBGH 1CL7I 4E41A 4GW5B 2IAMC 2BNQB 3QB7C 4PJBE 1MJJB 3JUYA 1MCHA 3EZ8A 3L95B 4YFDB 3ZE0F 1TIUA 3KWWA 3KHQA 5DA4A 1SYSA 3P4NA 3R1GH 1A7OH 5JXAL 2XKNA 3KJ4C 2KBGA 1C16B 1X9QA 3O3UN 5C07D 4PRDB 3MRPA 1XAUA 1P84J 3NAAH 3QEGH 1JN6B 3GSXA 4XC1L 4P48A 4S1QH 5HY9B 3K4ZA 3EGSB 4OZFA 4XNUL 3WO4C 4ZYKA 1MWAB 2AVGA 4QRPA 3OR7A 1BZ9B 1JPGA 1FYTB 2DQGL 5GS3A 2ICCA 3B9DA 3ULVH 1JYWA 3ZE1F 5FOBB 4NWUH 4O5LL 2A6KB 4NQEA 2HTKD 2OX5A 1CK0H 1HCFX 4UQ2A 5F96H 5E4EB 1W0VB 1EEZB 5F7FA 1N5YH 1I9IH 4RQQB 2B7DT 3LQZA 4PRAA 5FGBC 4Z7NF 1WWWX 4MCYA 3CSYA 1JPTH 1P7KA 1KIRA 2DIBA 2JK5A 4RAVA 3EHBD 2PTTB 4NO3B 2YEZA 2BNRA 3DXAB 1EA9C 2VR5A 3F7RA 3EDDA 3IDIA 1D5XA 4O58L 1JGVL 2GTZB 2HP4A 4FFVC 2Z4QB 1J86A 1I4FA 2X4NA 4AIOA 4G6AD 5I1GH 5FYJE 1SVZA 1LO3L 4X0KB 4DZ8A 4F57H 4PJGB 4Y88A 5C0CE 2Y7QB 3LZFH 4NC2B 3RJQB 3TN0B 3NBNA 3MGOA 4X6EB 3FB5B 5DWUH 3LMJH 1U91B 5DHXB 2HKHH 1T3FA 3RVXD 3KYKH 1INEL 3BSZH 4S1DC 4YDIH 2V7HA 1KELH 3VGBA 5E4EC 3IU4H 4K3DH 1AH1A 5GSVA 1HILB 3TVMB 1YPZA 2G9HB 1A9EA 1U8MB 3OHXA 4ORZC 4JN2B 5TQ2H 5JW4Q 4YK4B 3QEUA 3CLFH 1IT9L 1X5ZA 5FGCE 5GISH 3INUH 2EEDA 1AGEA 3MA7B 5IBUB 4QHLA 2DRUA 1NH6A 1NDGB 1HOCA 1TVBA 1KACB 1H3VA 4N8VG 1FNFA 5E03A 4PRBB 3K80A 3GMMB 5T1DH 5I8CA 4LCWD 5CKAA 4JLRB 2HLFD 2H32B 1T0PB 5C7XH 3OF6A 4JKPH 2X4TB 4AEHH 2J4WH 5I1KL 4MS8C 1ZT4B 3BW9A 2HMIC 4NBXB 1TVDA 4XP4L 5F9OL 3S36H 2HJFA 3U7AA 5FOJA 3RGVC 1A1MB 4ZSOE 4G6JH 2Q7YB 1JWMB 2J8UA 4NRYB 3EOBA 1IAOA 2CKBA 2JJUA 3WUZA 4DTGL 4G8FA 3GSRB 3MYZA 2VAJA 1CDJA 2F9BT 4MDIB 3OKKB 4MCZB 3TCXA 3SHSA 5LGJA 1H5BB 1U8LB 4Z7QE 4X4MA 1UVQB 4HHAB 1Q9WA 2ED8A 4ZO7A 4YHOL 3FL7A 4NQSB 5I74B 1IGJA 1OAXH 1BREA 1EHXA 3IS1X 1RHFA 4BZYA 4EXKA 4WHTB 4YK4C 3PWVB 4U1MA 3WFHB 4X5WA 1F4YH 4N9GA 1MLBB 5GGRB 4LLDB 2AK4A 2YR3A 4MA1C 3AB0B 4ZXBA 4XGZA 3O8XB 4KMTH 3VW3L 1QFWH 4HXAH 4HAGA 5GGUB 4JFQA 3WL9A 2C26A 4FTVE 4PJCB 2ESVA 1TITA 1EX0A 3DGCR 4XNYL 4PJDA 3M17A 4FRWA 3BVNB 3TH2T 5SWQB 2X41A 4WNQB 1DBJL 1PBYA 1FIGH 4QLRA 3WHXB 5C0GB 1P69B 4KZDH 1OD7A 1J88A 5GS0H 3QPXL 1AQDA 3MV7D 1DDHB 1CICD 3I6KB 1BZ7B 2OZ4A 1B6UA 1TPXB 1LVEA 4F33A 2AABL 2G2RA 4OLYL 4QCIA 2AEIT 4Y4HC 3GSWA 3HE7D 1JVKA 1NAMB 4PJ5E 5SWZB 1X44A 2NY3D 4FNLL 1QSFB 5FHBL 1Q0XH 1JRHI 3U0WH 2DLFL 3VXUB 1OY3B 4LK4A 3V52H 5MEOB 4Z7UB 4NGHH 3TH3T 2GTWA 1RK1A 3OX8B 5MERA 2J6EL 5DD3L 4JFOB 3UEZA 1BQUA 4PP1D 1MQKH 4LNRA 4YHPA 2VLKA 2EDYA 4U1KA 1R3HB 4QXUH 4OFIA 2NY7L 1FHGA 2FLBT 5C0IA 2BP3A 5FB8B 1WV7T 3SDAD 2VITA 3VE0B 3ARUA 4YBQD 3PF2A 4WWID 3UTZB 2VQTA 3IRPX 4HLJA 2HTKC 5K93A 3T77B 5FA4A 4HJJH 4YHKH 5D2NB 3C87A 3U7YH 5MP6L 4JDZA 3DWTA 4U1GC 4ZUWB 3PV7A 2XWJB 5J0BA 3FRUB 4NQCA 2Z92A 4WI2A 5EU6D 1L9MA 4XHQA 4OAWA 5F44A 1RHHB 1JMXA 5L2KD 2NY6B 4P2OA 1J8HD 2ARJQ 3CUPB 1QFUH 3MRMA 3S5LA 1G1CA 3EHBC 3VD5A 1CLZL 2QADD 3A6CL 5D1XD 2CRIA 1CGTA 5GRJL 1KJMA 3H9SD 3T3PF 1VESA 1XIWA 2R0KH 3CC5B 4ZUUB 4BM7A 3EFFB 3O3EA 2B1HL 4E42A 3FT3B 3B5GA 4UTAH 4CVZA 4G6AC 3P9WB 2PW2A 1AD0A 1L6ZA 1VFUA 4TTDD 4AQ1B 1VSCA 2YD4A 4BK5A 4BYHA 3FFCA 3QHFL 3H42L 4YDJA 5J1TC 1B0WA 1W72B 5IWLC 2YUVA 4PJHE 5CKGA 2BSED 3RVXC 3DV4A 1HYSD 5C0AE 2V9QA 3BD3A 1OAKL 2X4RB 4LLWA 1J1XH 3UBXA 5C0FB 4IRJB 3GSUB 2VE6A 4M5YH 5ANME 4QXTB 2DOCA 2MCPL 2ICEA 4NZUL 1TZGH 1JNHB 1VGKB 3GB7A 1F3JA 3FO9A 3V4VL 3VXNB 4M7ZB 5HVWA 1WC7A 1D9KB 1YPZF 4DZBA 2C9AA 3I9GL 3T4AA 2HLFC 3E0GA 3BX7C 4HH9A 4KGLA 1V3LA 3FTGA 2EXWC 4Z18A 1ZE3C 3RY5A 2GK0B 2BFVH 2DWDA 2X4PA 5KAQG 4DVRL 1U8JA 4HGMA 4I1NB 4FXKA 5CCKL 4HMCA 2NY1D 3PGDA 1P6FA 4OGYL 1JRHL 3I6GA 4Y19D 1LEKA 4FXGB 2FYYB 4ONGH 5A2IH 5DZNA 2I60H 2D4DA 4ZDHA 1JYVA 3VXPA 4Y2DD 2EICA 2WUCH 3BH9B 1AY1L 1CICB 3OAZK 3MYJA 3VGDA 4F7MB 2VNCA 4LSQL 4N0RA 1IC7L 2J8UF 3DETD 4Z0XB 3VG9C 1T89C 5JIHA 1A4JA 3G6AB 4QRUA 5I2IA 2FO1A 2AGJH 2ZOKA 2RAMA 2GJJA 2PW1A 3HS0A 3KPOB 3QIBA 3HE7B 5AZEH 1G6RH 1Q1JH 3PQYE 5DC0A 2NY3B 3LKSA 4Z6AT 2YD3A 1MCJA 5E2WH 1RJLA 2HJLB 4TVPD 1YECL 1S7UA 4HX1A 1T1ZB 2I9LA 3BIBX 2X2YA 4MXWL 2X1PA 2A1WL 3BWUC 1JK8A 1RURH 2AXFA 4JGMA 5I1IL 1RY7B 4PGZA 4YDLB 4JR9L 4P99A 4WJ5A 4F9LC 5C8JB 5IG7B 4FABH 4AMKL 4H88H 4CW1B 3O0RL 3NCJL 4PG2C 2O5YH 1DZBA 3UYRL 1JWUB 2HG5B 3VRIA 5H2BA 3BZFA 1ES0B 3MRKA 3CDYA 1ZHNA 4L9LB 3U9PH 3NCEB 3P9LB 4MD0B 3WFEH 5E8DL 1J10A 1S9YA 3CX2A 4NWTL 1UM6L 1PG7W 5BRZA 4PJDF 2EIBA 5DJDA 5IESH 4RRPA 2HFEA 5FHAL 5GS2H 1KT2B 2BVUA 3H2WA 5F1SA 5L88H 2AEPL 2YSSB 4M1DH 1ACYL 1HEZB 5DMKB 1OT1A 1VPOH 2DN7A 1QFHA 1KXVC 4J6RH 3OB8A 3O3AB 4P57B 4L3AA 4JFXA 1I3GH 4GW4B 4R2GC 1FNEA 1NGQH 1NMCC 4ZPVA 5GIRA 3BZEB 1EPFA 1MJ7H 3KPNA 4L9DA 1DEEA 2DWEA 3VFWA 3PWPE 5E99H 2QADB 1RJYA 1LE5A 1ZLSL 3TPUB 1MIML 1RZJH 1II4E 1QLEL 4KC3B 1XZ0B 1XF3A 3HAEG 3IXTA 3CFJB 3MRCA 2FO4B 1NEZG 5EA0H 2P48B 2X89A 1KXQE 2FEDC 3FMGH 1U58B 5EOQL 1RUMH 1MCBA 2PNDA 1JF1A 2EDTA 4Q2ZA 1QSVA 3ZT5A 4DKAA 1R0AL 4K7PH 2YN3A 1FE8H 4MB5A 1KB5H 2HH0L 3SDAC 4LOUD 4X8JB 1PKQE 4MNHB 4YBQC 7FABL 3T65A 1SJEB 5DDHB 1UKQA 2DD8H 3O41A 4IOFD 3MCLH 3HC0A 2C4FU 2RFXA 3TP4A 1JPFA 1NFKA 4YO0B 4JCMA 2OJEB 3LPGA 3STZA 2YC1B 5IBLD 4CMMA 3EYFA 3RHWK 3PWUB 2NTFB 2J88L 1I9RH 5EO1A 1OM3L 4UV4L 4HH8A 1FG9C 4LARL 5HJ3B 1HHHB 2D7QA 3B9EA 5EUKB 2BCKB 5TDNB 2IALB 2WBJD 5D1XC 1ZWIA 4WFED 1J8KA 1BQLH 1CU4L 4YHLL 2EDRA 2PUQT 3S8WA 4LCCA 2WBKA 4U6YA 4NZTL 1BFVH 4HUWA 3QWOB 3S35X 2PYED 4KK5D 4L8CB 4TTDC 2WWKT 3MXWL 3QSKB 3S97C 4ODSH 2CIKA 3TFKD 2CLVA 1CQKA 2ZCKH 2ZKHL 4UOJA 1L0XA 2X4SB 3LKPA 3ARGC 3KDMB 4KVCL 3VJ6A 3WKNA 3FO2A 1HYSC 5EIIB 4G3YL 2G5BB 3MV9D 4DN3L 2DQTH 2OL3H 3RWIB 4Y1AA 4XPGH 1S7WA 4X98B 3IKCB 3JTTB 1X5FA 1AXSA 3V5DA 3SEPA 2XWTB 5T1KA 43CAA 3UMTA 1UM4L 2BXYA 1BFOB 2LU7A 4U3HA 3GMQA 4X4XB 3WHE0 3G04A 1KC5L 2VB5A 5F9JA 2X4OB 4U3XA 4BH8A 5KSUA 1GHFL 5JNYA 2NR6D 5FO8B 5LWYH 1NCCL 3L3GB 3BWAA 3CVHB 1FZJB 1DSFH 1FO0H 3DRTB 2R23A 1MI5A 1ZA3B 3EIFA 4CUCA 4JFHD 4P2CG 4X83A 3X3FH 1HSAA 4QOKD 3H7BB 4YNYA 1OTSC 4AK1A 3IVKA 2P45B 2GW5A 2NY1C 1G7PB 4WW2C 2SEBB 1CFTA 3OKEB 3RBGA 4PREB 5IQ9A 1SHMA 3NACL 2VRAA 4JRXD 5HSFA 3PJSB 4EEEA 3BEWA 3OKNA 2F54B 4MWFA 4LCYB 3NA9H 4Y2DC 3C60D 1I7ZA 1A6WL 4YPJA 4D8PB 2C5DC 1AE6H 5EBLA 1K2DA 3DETC 3T0DA 1XEDA 1QPXA 4U0RB 2NY4D 5BV7C 3VU2A 3CU1A 4OCSH 1F90H 5E6YA 2YD5A 1INDL 4ZFFA 2W9DL 1NGYB 3C5ZD 3WD5H 4OD1H 1PX3A 1HXYA 1VA9A 3QZWB 1YYMH 4CVXB 5KSVB 3N1GC 1NUDA 4RFNB 4NO0A 4ZMAT 4RMTA 4YIQA 4KHTL 3LH2L 3QIWD 2DJ4A 3F58H 4GSDL 1JYXA 1CD1A 3C5SA 4ZO9A 1YEIH 1EEYA 3VWJD 4C56B 1UZ8A 3S34H 4NP4H 5B38G 3MJ6A 35C8L 3U79A 4E9LA 1TTGA 2ICWA 2Z31D 3GMPB 1GAFL 4ELKA 1EHLL 4P4KB 2VABA 3QQ9D 5EORH 5L0QB 5C86A 2CK2A 4X6DB 3FOMB 5IB5B 2D7PA 5D96C 1OAQL 3SGKC 2OR8A 2GSIA 1T5WB 4KDTA 1LO2H 1T7YA 2Z35A 3HG1D 5T5NG 5CP3A 1PGRB 4PV8A 2Y6SD 3QUKB 6FABH 1G9NH 3TGXA 1DUZB 2DQFB 3MJ8B 5HDLA 1I1FA 2ITDB 2XWBA 1C5CH 5JPMA 4NN5B 1FVEB 3WLBA 3MCKB 3VA2C 3B9VA 4TRPH 5JW4M 5IB3B 2C3XA 2WBJB 2VDRH 1U8IB 3TYFA 2CMRH 4JJ5B 1HE7A 2BMKB 3D3VD 1RZKC 2NXZB 2J12B 5HVFB 3VFGL 1K3ZA 4LEXH 3CFBB 4G7VH 3DRQA 4PLKD 3BUYA 2PYEB 3GSNH 1OW0A 1NCAL 1UH4A 3ZKQD 2CGRL 2XA3A 3GI9L 1S7SA 1RK0A 4LOUC 2PO6C 3L9RB 1OARL 1PY4A 3U6RB 5IFHH 4IOFC 3L3JA 1ZVYA 4L1HA 3P73A 4TOYL 1EGJA 4JB9L 1ADQA 3SE9L 1IEAA 2CO6B 3WNMA 5I8OH 1P2CB 3SKUD 2NY5L 5I16B 4LVNB 3SGDI 1RU9H 4M6MH 2C1OA 3RWCA 1VACA 5C0BA 5CHNA 5CILH 4HIEA 2XA8H 3OGCA 4KUCF 3ULVE 5EU7E 1U8NA 4UDTA 1UJTA 4QWWD 4NHCH 5ITFA 3QNYB 1MCPH 4YEEA 3V5HA 2WBJC 3TWCL 4NHUA 5H37G 4YBLB 4RISL 3RWFB 2GFBA 3X14B 3MODH 5JOFB 4Y4FA 3N1PC 2VAAB 4J1UA 4G9DA 3ILPB 3UJJH 2OCFD 4OV5B 5EOTA 4MA7L 4S1SL 1GPOL 4KK5C 1WTGT 4JFYB 3Q5OA 4LVOB 1AD9A 3BKCH 4ZNEA 3AS2A 5T1LA 1ED3A 2J5LB 2YMXL 1S9WA 4HS6B 3TFKC 3QAZC 4W4NA 5F1IA 2WZPD 4MQ7A 3EDFA 5D93B 3PP3H 4ODBD 1NBZB 3PNWA 2ZUXA 1GGCL 4JCLA 2BC4B 3ES6B 1I7TB 3OKOB 4YPGB 1EBPA 3K2UL 3MNWA 1RVFL 4J3WA 2EEBA 3TEUA 1AIFA 5A2KH 1MRFL 3KYAA 3BYTA 4N8VB 1GGBL 4AYFA 3ZDYF 2L7UA 3OPZL 4RAUA 5C0DA 1K8IB 3D69B 4GT7A 3OB0H 4PLNC 1FPTL 4K8RH 1MHEA 1PQZB 4N1EA 3NVQA 2NY4B 3CIQA 3NABH 3GIVA 5EU3B 5DMIL 4TULH 1V7ML 1A5FL 4LDOB 2IAMA 3C5ZB 1SJXA 4TNVK 1CFQB 4QRSA 2ADIA 2DTML 3MLXH 4OF7A 2AJ3B 3LDBB 5DJXB 2NR6C 1MFCH 5I0DA 1HI6A 3ZKMD 3TBYA 4IOSD 5FDWB 3FCTA 5HD8C 1WQVT 4XXDB 5EPMA 5L6YH 5CINH 2DLEA 2J5LC 5E2VH 4WVRA 4HQQL 4U6TA 5E1AA 3IFPB 5LJYH 2P7TA 2CLZA 3VWJB 4M8VA 5F3BB 4QXWA 3QRGH 2P4AB 3DHJA 4E0RB 2VISB 2Z31B 3C60C 3MRIA 3BP6B 4UT7H 1IKFH 1VEPA 1RMFH 3O9WB 1T5XA 4M7KL 2QQKH 5LBSH 2FWOB 1H0DA 5D2LF 3U9UB 4C83A 3BXNB 1HHKA 1ZS8B 3PWNB 5FO7B 3MRBB 4ZUVA 3WUWG 4XH2B 1D5IH 1P7QB 4DAGL 2HT4D 1KPVB 5CMAB 3MRLB 5T3ZH 1X5LA 2BNQA 3C5ZC 2NYYD 1JI1A 5ID1B 3HMXL 3ZT7A 5BMFH 4JFDE 2AJVL 2WWKO 1OHQA 4ZOBA 1S7TA 1EJOH 1C16A 1OF2A 5ADPH 3QIWC 2F19L 4PRDA 4UMGA 5EBGA 2A2QT 2QR0B 3HI1A 1LQSR 3MUZ1 3TA3B 1IGTB 3D3VB 3VWJC 5K9JH 4GKOA 2DF3A 2E8YA 5HY9A 4KKLC 1BZ9A 4D2NA 3OMZA 1FYTA 2CUHA 3HNSH 3K74B 3KLAB 4NJ9L 2XZZA 3QQ9C 4NUJB 5DQDL 3WNOA 3RP1A 2GIYA 1NEUA 1UADC 1GSMA 3SBWA 5TFSH 5KVEL 1AP2A 5IEKB 5KS9E 1FZOB 1W0VA 4WU5A 5ALCL 4LSRH 5IROC 5EWIH 1WITA 3NZ8A 2VR4A 3CDCA 2IH3B 5DS8A 4M1GH 4ZTPL 1CE1L 3WSQH 4NO3A 5FUOL 1TVHA 5F88A 1YMME 2VXQH 3B3IB 3QFJE 4ZFOB 4KTEL 2GTZA 3MRHA 2Z4QA 9CGTA 3UTTD 2V17H 4AENB 2OXGA 2R2EB 3PIQA 5FDYA 3B8SA 5EUOF 3PHSA 3LD8B 5E56A 5AZ2L 2Q3AA 3EYVB 5D5MA 4ZQKB 4PLKC 2Y7QA 3QUML 3MLYH 5BW7C 1T0MB 3QA3B 4LSPH 4X6EA 5DF0A 4GKNA 3QEHA 3VCLB 4FQ2L 4EXPX 5EOCL 5HYJE 1J1OH 3ARXA 5K9OB 1JHKH 5IW6B 1GC1L 2WP3O 1HILA 1CFSA 5A16A 2Y07H 2G9HA 2IADB 3SDYH 1U8MA 3GIZL 2DYPB 4MQTB 2YUXA 4MMXC 1LMKA 4JN2A 2R4SH 3D85B 2UV3A 5GJTH 1RUQL 4WCYL 5C08E 3WKMH 2J8HA 1BP3B 2H8PA 3O3BB 1DQLH 1X6NA 1NDGA 2O61B 4QWWC 5DRNB 3CDFA 1OGAD 4PRBA 2AERT 3GMMA 3C6LD 3EO0A 3VFSB 1G1YA 5FK9A 1MCEA 3QO1A 5E70A 1NCTA 4JZOB 2OP4L 1SVCP 3GBLA 2X4TA 1Z3GL 2CUMA 3P0YH 5CZVH 3IJHB 4K23H 4ZAKD 4EUPA 4WFHE 2XTJD 1EEUA 2PYFB 1KCRL 1A1MA 2V2TA 3GM8A 4P59L 3TJEL 4HWBA 1WT5C 4HK3N 5AYUH 3WIIL 1J18A 3MROA 3MJ9L 4J3VA 4XT1C 1J87A 4X80L 5KJRL 3X11B 3UTPE 4MDIA 4MCZA 3OKKA 4P2RE 1KPUB 3MZTA 1H5BA 4NKMB 2BVPA 4PJBB 1UVQA 2Q7NA 2VDML 4NQSA 3W81A 2A0LD 4HT1L 1OPGL 5IHZB 2BERA 3MMEB 4JVUA 5JZ7D 2QQNH 4Y4HA 2GEEA 3PWVA 3WFHA 5FGSA 1AO7E 1CF8H 2Q8BL 3I02B 5GGRA 1GJIA 2FHCA 4JY4B 1LP9E 1XR8A 3BN9D 4NBYB 3VI3F 3OJDB 4M03A 3QDME 3VXQA 3MRNB 4OM1H 1EUUA 1A21A 1BBDH 2JCCE 4PJCA 1OSPL 4N0YL 4KQ3L 5IBTH 1QKZL 3VGAC 5E8NB 5SWQA 1H15B 4TNWF 5C07A 4X4YB 3KR3L 3S88L 1MFAH 3EYUH 2IQAB 1KEMH 3A67H 4LRNL 1CK0L 2VQ1A 3WHXA 1IQWL 5C0GA 1JGUL 4M4RA 3GHEL 4WU7A 4YHYC 1IAKA 3F5WA 4KDVA 2R69H 5CJOL 2C4XA 4FQ1L 2CK0H 2E7BA 5MENE 1DDHA 3GJFK 1L9NA 3I6KA 1N2RB 1ZEAL 1WAAE 4JQIL 4JPVL 5B39G 3BD5A 1Z5LA 3AFLA 4YC2B 5T3XH 1TQBB 5IP4A 5SX5H 4LAQL 2BOBB 3TO4B 5DVMA 1UYWH 3VXUA 3NGBB 5CIPB 4W68A 2NXYD 3Q6FB 1EH9A 2HT4C 5C0CB 1XH3B 4EDWH 2Y4SA 5IV2A 2FJFB 4LP5A 4G9FE 3KPTA 4X9FA 2BY3A 3QEQE 4N8CH 5E6IB 3HA0A 3ARDD 3OL2A 4LGSB 4M00A 4Y8DC 3LPFA 2AXHA 3MRJB 4P5KB 1R3HA 1U95B 1U3ZA 1NCDH 1EK3A 2R29H 4RFEA 2R9HD 4PP2B 5FGCB 3WFZA 3HHRB 3VE0A 1HINL 1W2KT 3N1QC 5GS1B 2DMCA 2VZ3A 5LAXB 1CGVA 4OZFH 3UTZA 2R4RH 3Q6GH 5D2NA 3QG7L 3L5XH 5FKPB 3G9VA 5H35B 5B4MC 4HBCH 4NN7B 4L3EE 5INDA 5DJZB 4G8EB 5SX4H 1WIOA 3E6FB 5SV4A 1KFAH 2NZIA 1RHHA 4JREC 4MA8L 1S5HB 3CUPA 4U6HA 4I0CC 5E9DD 3HAEB 3F65A 4XP9H 1NEZB 1KTLB 3OAYH 1LILA 5EG6C 1GZPB 1ZV5A 3NOIA 4HV8A 5IIEB 3RX5A 2LTQC 5DD5H 4LCWA 3CC5A 4QKXB 1B4RA 1I3RB 3EFFA 1TXKA 1Z0NA 2ZOLB 4H20L 3RZWA 4TSCH 1FORH 1WLHA 1FC2D 2Z0BA 3D9AL 1R5WA 3QXAA 3IJSB 2ERJC 3P0GB 3O4LB 1F3DH 2HTLD 1W72A 2HFGH 4NNXB 5DUMH 4UILH 1OTTD 5K59F 3PWJB 1IEBB 4WW1B 4JZNB 1EO8H 5FECB 4PJGF 5D5MF 4FTVB 3QDAA 2IG2H 3K2MC 4OTXL 4QGYA 2D0FA 2A9ML 5C0FA 2UZXB 1T89A 3FO0L 4HBQA 4RGMB 3BESR 5TF1H 1DJSA 4HWUA 3GMLB 1JNHA 1VGKA 2DBLL 1EZVY 4OCRL 3QCTH 4PGCB 2MSPA 2QSCH 3LKQA 3QQ4B 3C2AH 1K4CB 1LO0L 3N06B 3VXNA 4NKOB 3MRDA 5JW5A 4F7PA 3C6LC 1D9KA 4OLEA 5LGHH 3DI3B 1QPPA 2CO7B 3QHZL 1YA5A 1MCRA 5IMOA 4G5ZL 2GCYA 5ADOL 4KTDL 3WN5B 1MJ8L 1I9JH 2D03H 4ZAKC 2A74B 4BZ1H 2XTJC 4PJ5B 3PQYD 3IKKA 1BVKB 4PG2A 4XPAL 4OD3L 4M7LH 4MNQE 1F4WL 1I3VA 3N85L 5DZOA 3G6DL 1JZ8A 4FXGA 2FYYA 3UPAA 4M02A 2CKBH 3L7EB 4MJ5B 5HDQH 3BGAA 5F8RC 2XG4A 3S4SB 1CICA 3ECBB 4GRWH 4F7MA 5B21A 2A0LC 1X5AA 3ZTNH 2LV4A 1WVZA 4K9EH 1ZANL 4ODHL 5D71L 3VA6A 5JZ7C 1PD6A 3CFDB 4NJAH 1YC8A 3HE7A 1G7IB 5SV3A 5GRUL 4MMZC 3ELAT 2EYSA 2Y06H 3BN9C 4ZO8A 1T1ZA 3KPSE 4QXUL 2X6MA 1G0YR 3U0TA 2PR4H 5C8JA 2AJUH 1T80A 1CFVH 4Y8AA 1JWUA 2HG5A 5DTFB 3EUUA 5F1NA 3MO1A 4U31A 4MD0A 3BQUC 4ZPTB 4DWHA 3U2SB 4PJCF 2ADFH 2CDGA 3PWPD 1X5XA 4HC1A 1LDPH 5HI5C 1WFTA 4KV5F 1MHCB 2YSSA 1HEZA 1I85A 1T0NB 2FECI 4LVEA 1FL5B 1FG2A 1L7IH 4YAQB 2VXSH 2CKNA 4HIJA 3KLHD 2Q86B 3NPSC 2EH7H 1E6JH 2NXYC 5FYKH 5EU6A 2QTEA 4HLZH 4CGTA 5D70H 5L2KA 1TENA 2LFGA 1MJUL 2VLLB 4YX2L 5LCVL 1J8HA 1RZ8A 2BVQB 3W0WB 5C0JA 4BKLA 4PJHB 3HCVB 3TPUA 3ARDC 4DQOL 3K3QA 1XZ0A 3KYNB 5C0AB 3CFJA 3UROR 3H9SA 1NCBL 1V3MA 2VXUH 5B38B 4ACPA 3TH4T 3JUZA 1U58A 1MCNA 3T0VA 4YLQT 5ANMB 3SDXA 1KJ2L 1GVIA 1GOHA 1T20A 5EOCJ 2XQBH 1J1XL 3U30B 2KQMA 2IBGA 5HHNB 1SJEA 5DDHA 2K7PA 3P3YA 4XMKH 2R8SL 4F58H 5IFJA 2X5PA 4EVNB 3RL2B 5D7JB 5A1AA 3C8KB 2YD6A 5T3ZD 1A6PA 1C7TA 5TF0A 2P8LA 1FZKA 1CDIA 5LQBH 2YC1A 2F5AL 3PWUA 2NTFA 4GO6B 1U2HA 4Z95H 5HJ3A 1HHHA 2WBWB 2HVKB 3MGTB 2MOVA 1BD2E 3FB8A 5EUKA 5F7DB 2BCKA 5TDNA 1MCLA 2LE9A 5DJ6B 4WY7H 1BOGA 2FRGP 3LS5L 4Z7OE 3P0VH 3LKOB 1P1ZB 5IK3B 2NX5E 4Q6IC 1G0XA 3ZTJH 4ONGL 4QO1A 4HWEH 2O5XH 3BUTA 5ESVB 1PFCA 5TE7H 3LV3B 3I6LE 3QWOA 1YJDH 2VSDA 4JO4H 4L8CA 4Z7WE 1S7XB 3RX8A 2Y5EA 2XOTA 1KENH 4IJ3C 4N1CA 3KPMB 4NNYA 3PQYB 2RGSA 1BPVA 4WW2A 3ARED 4PB9L 1VKXA 4LCIH 4Y19A 2W0FB 2X4SA 2HTLC 3KDMA 3CVIL 2OK0L 1D5ZB 4XPFH 5HHXH 1G9NC 1OTTC 4F9PC 1PG7L 4GUPB 1QYGL 4FQQB 4X99B 3MV01 4Y2DA 4Y4KB 2EIDA 3FB7A 1A4KB 3T3ME 1NLBL 4D9QE 1YZZA 3RWIA 1JNLL 2E27L 2VDNL 5GSRB 2QSTA 4PYHA 4KROD 1BECA 4K3HA 3IKCA 3JTTA 3QWRD 4LGPB 1IZKA 2XWTA 4PJ9D 1KCUL 1F11B 3MV8E 4CJ0A 3B5HA 4OLXL 2NY0D 2X4OA 4TTGA 4AEIH 3CD4A 3LOWA 3IXAB 4LLQB 3NCFB 4NZRL 4G7YH 2GT9B 4JO3H 2MKLC 5FO8A 3L3GA 5I15H 4DKEH 1FZJA 4HS8L 3UPRB 2CIIB 3TT1L 2FECL 5GHWH 5MEQB 1HNFA 1CQYA 3H7BA 4XCFH 4Q9RH 4TSBH 1H8SA 2SEBA 3OKEA 1VPOL 1YQ2A 5K9KB 2YBRB 1QR4A 5HYSG 3VRJA 4LCYA 3P77B 3GO1L 5E24E 1DUYB 4LLMB 4WHYH 3LIZH 3PWPB 4D8PA 1V7NH 3L1OH 1TJHH 1CBVH 4D9RE 1HIML 3GRWH 3TCLB 4PR5B 1A3LL 5GGQL 2G75B 3KHOA 3BDYL 3DVIA 4HULB 4D94A 1KNOB 2NY5C 1RZJL 1ZSDB 4FMFA 4U1HA 1T1WA 1NGYA 1OD9A 4JAMB 15C8H 2B5IC 3HPLB 4GKSB 5DGQA 3T0EE 4KJPD 4CVXA 5KSVA 3VFMA 4IIQB 1PKQB 1G7HA 5I1JH 4XNZB 3B2VH 2W59A 2YPVH 1A7PL 3Q5TA 3N9GH 4EN3C 1VFAB 1NSNL 3HPJB 3QXDA 4JE4B 5HDBE 2MMXA 4R4BA 4OF8A 4RSVA 1SBBA 4RMUA 2EE6A 4NSKB 3MCLL 4C56A 3RDTB 1DLHB 3GJFB 3FN9A 2BVOA 2I5YL 2BY1A 5F7YC 5C1MB 43C9A 1J9CT 4UT6H 4HDIA 4ONHB 4K8RC 4XVSH 4PJFA 3WUWB 3MFFB 4P2QE 3FOMA 4LFHD 5IB5A 4ONFH 1NMBH 3DUUB 2GJ6E 1T5WA 4LKCB 5E2TH 4WWKD 3UTQB 4H1LG 1BMGA 4LMQE 4KMQA 3RPIB 1BQLL 3QUKA 2C1PB 3V79C 1FSKC 3D5OF 1DUZA 4QRRD 1PDKA 4UIMB 5I73B 2ITDA 1RULH 4L4TB 5FGRA 3HB3D 3S98A 2W0LA 3MCKA 1IKNA 4IRZH 3LAFA 5J7CC 5IVNA 5IB3A 5KOVC 2WBJA 3OKDB 1U8IA 4ODSL 4UAOB 3S36X 2WK2A 4ODVL 4XPTH 1MF2H 1S3KL 4QF1B 4UU9B 5F71A 2WSKA 2AJSL 2BMKA 3RY6C 1KEGH 1AGCB 4XHJD 3UP1A 1E4XI 2PYEA 3VWKB 2XXMB 1U8KB 4XPGL 5BOZG 2X1WL 1XF5B 5I1HL 3BKYL 2HN7B 3AREB 4HKZB 5TE6H 4Z76B 4KKBD 1MRDH 1MVFA 5KW9H 1KIQB 2HRLA 4KK6C 4B0MM