3BD5A

Crystal structure of single domain vl of an anti-dna binding antibody 3d8 scfv and its active site revealed by complex structures of a small molecule and metals
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
LVMSQSPSSLAVSAGEKVTMSCKSSQSLFNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYYHMYTFGSGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of single-domain VL of an anti-DNA binding antibody 3D8 scFv and its active site revealed by complex structures of a small molecule and metals
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords catalytic antibody
total genus 25
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bd5A00
3VWJD 2XQBH 4JG1H 5DEFB 1AHWA 1QFHA 4OGAC 4LLQB 25C8L 1JWUA 3O6LL 3VXSB 4YPGB 1MI5D 5JHDE 2P47B 4Z7WB 2A38A 1XGQB 4U31A 1CWVA 2ATPB 4U1MA 1B0GB 4UT7H 1HN1A 1WEJH 1WSST 2X7LA 3O8XB 4Z78A 1MHEA 5IW1A 3GRWH 1SJEB 3HC4H 4RIRB 3MOQA 2EDKA 1T3FA 1OT1A 3VXSA 2DWEA 1U8PB 1YYLL 1S7XA 3QNYA 4NKMA 1N4XH 1HE7A 5TDNA 1ZS8B 5GZOD 4LEXH 5E2JA 1NMAL 1IGML 3EGSB 1NEZG 5JOPE 2DQDL 4IS6B 4AM0B 1VKXB 5IWLA 4XI5C 1U8KB 2YBRB 4ZYKA 4X80H 1F3DJ 3B4NA 1T1XB 3TCLA 4FZEL 1HXYB 1PZ5B 5EU6D 2BSRA 4MX7A 4KUCF 4MXWL 5E8PB 1I1AD 4NQXB 2E9BA 2VDRH 1E4WH 1HKLH 3WDHA 2DQFA 2OYPA 5SWSE 1JFQH 4KKAD 2AXHA 3AROA 5CMAA 3WIIL 1BD2E 3QCVH 5L2KA 3G04B 4TNWF 2ZG3A 3BDYH 3V52H 4OZIB 3BKYH 4OLVH 5EOCL 2K3TA 3QNXA 1OAUL 4G6JL 5CINH 1RIUH 1VCAA 5J56B 3VXSE 5EBLA 2D7OA 2Y7QA 3TP4A 3VDAA 1A21A 1VDGA 4Q9QH 1YY8B 4GO6B 2QKIA 3RGHA 3B9KA 3QIBC 4IRJC 1GGCL 4XPHL 3KPMA 5D2LB 1K3IA 3OKOA 5T1MA 4HXBH 3IXTA 3OAZH 4GUPA 1MCKA 1UEMA 3O2VH 1YMMB 2Q7YB 4KJYA 1FNAA 2PNDA 3GSRB 4KJWD 3ILQD 1NAKH 3BPCB 1C5BH 4LPWA 4ORGB 5T1KB 2R56L 4OZFG 1A8JH 4UAOC 2F15A 1OP9A 5IMMB 4LAQL 1LE5A 2BY1A 2Q3AA 1FVDB 3L3HA 5M94B 1INDH 3MLUH 4JFFB 4P4KB 2OTUB 5FO8B 4LNRB 3WFDH 4MWFB 5I1EH 3GSVA 3NFPB 4ODTL 5B22A 3LQZA 4PJ7F 4XCEB 2KKQA 3WIHL 1CR9H 4X0KA 2Z4QA 4XPBH 3MPCA 2BC4B 2E7MA 1TLKA 5DYOA 3QUXD 4JKMA 1BIHA 5CGTA 4X5WB 4OQ1A 5JIIA 3HZYB 4QWWD 5D6DA 2ORBL 3ORJA 4G6FB 4WCYH 1ZT7B 2DF3A 5C0BD 5HJ3A 3R0NA 3SKMB 1IE5A 2HTLD 5JORA 4NN6B 2EIZB 4LLVA 3MV8B 3VD4A 2A6DA 4I3SL 3RDTD 3OKMA 1CLCA 1YDPA 4HGWB 1S7TA 4JLRB 1T83A 2WUBL 1MAKA 1UJ3C 5L8LB 4RDQF 3QI9D 4ZNEA 3LV3A 5C0EA 4N9OB 1J5OL 4YZFF 2VB5A 1XIWB 5TE7L 5CS7A 3KPSD 1XZ0B 1I9IL 1RZJC 3HCVA 4GAYA 4X5LA 5IF0B 4WY7H 1PYWB 5JR1L 4JVUA 3EFFA 3MFFA 5GHWL 1B6UA 1C8PA 1R3JA 2BFVH 4EDWH 5I71C 4LCCB 5EO0A 4YBLB 4YHNB 3QH3A 4UAOB 1Y6MR 4WWKD 2R2BA 1P53A 2BSTA 4JM4L 5DJAA 3O0RH 2VZSA 3GHBH 4W6WB 3B9AA 3RBGA 3HNTH 1NGPH 2XN9A 3JTTB 3RA7H 5D7LD 5F6IB 4HKZA 3OJMB 3TA3B 4F7MB 3ARYA 3H0TB 1DUZB 4PJIE 5DJ2A 4AH2B 1AO7D 5GS0L 3EIFA 5GGRY 5IFAH 1NKRA 1F45A 1OSPL 4HS3A 2R2HA 1NFKA 5IHZB 1UM5H 4ELMF 5E95B 2BRRH 3L5WB 1JWMB 4HZLA 4N5ED 3Q6FA 1O7VA 4XCNA 3BRFA 1EX0A 1X4ZA 2GJ6D 1CVSC 2ADIA 3T4AA 5DJ0A 1U91B 4U7SA 2FEEI 2A83B 4PRPE 4QEGA 3DI2B 4DN3H 4WO4A 5FO9B 5HDBE 4I48A 1UCTA 4FQLH 5C0AA 2NTSP 4FABL 4C56E 3REWB 2CDFA 1CLOL 1RJZA 4MDIA 4ZUUB 5SWQB 5DFVD 1CFVL 5GSVB 4JO2L 3DJ9A 4IEFB 3T09A 4MJ6B 3QIUD 3TYGL 3L5XH 4XPTL 3TZVD 4MSWA 1CDCA 4G8GD 4OFKA 1FC1A 4K3HA 4Q9RL 2DLFH 3NZ8A 3PL6D 4NC0B 4D9LH 2WBJA 1HHHA 1MLCA 3R1GH 3S35L 4Y5VA 1S7UA 3HCVB 3W11D 4BM7A 4Y5XC 1N5YH 3MRKB 4HGKC 4B0MM 1A6VH 2BVUA 3HAEA 4HIXL 1FZOB 1FFOB 1TETL 4QOKD 4MA7L 2VXSL 3V0WL 2OXGA 2JJSC 1YDPB 3S3PA 3CDCA 3GMPB 5CJQH 3UTPD 3V7MA 5C0ND 1H3GA 4LLVB 3ZSTA 3ECBB 1A7NH 5CUSH 4TOYL 1J1OH 4OCXL 2CJUL 4FFWD 3AU1B 1KCUL 3MRPB 5ID0A 3UZVB 1A6AA 5DURB 1YEEH 2GAZB 5EORH 1AD9A 43CAA 1HQRA 5ACLA 3OR7A 3B8SA 4PD4K 3MUJA 1QR1B 1D5XA 1X5YA 3KLSA 3OKNB 2AK4A 3C60C 4S11A 4TUKH 4R4FL 4FQ2H 3F58L 4XH2A 1P5VA 1QSVA 5F1IB 3D2UD 5ISZE 1J1PH 3SGJA 5IJVA 3MA7B 1S7RB 1J5OH 2ZUUA 3HC0A 1MCFA 3IT8D 3T1FA 1T2XA 2EDHA 2VLLB 4APQD 4KUZL 3G08A 5IK3A 5JW5A 2QSQA 1ORQA 3FT2B 4Z18A 4RGNE 4EN3D 4KTEH 5DD6B 1BQHA 1G1YA 5J11B 1AR1C 4XCNB 4K3DH 4Y16C 1MEXL 4K2UL 4PJXE 4OKDA 1QRNA 1ONQB 3MGTA 3RVVC 1KB9K 3K2MC 2NW2A 3SDYH 1X5XA 1AD0B 2ED7A 3MRQA 3O3BB 2GJ6A 4U7MA 3T1WA 2VH5L 3G5XA 4CVXA 4IDLA 4QHKJ 2H8PA 4Z8FL 3PWLB 1VEMA 3FO0H 4YHLH 3CH8A 1J8HD 1P4LB 1F8TL 2I27N 2AEIT 3IAPA 3MRBB 3PP3K 4JFZL 1H8OA 2VXSH 3N1PC 4HWBL 5D8JH 3M8OH 4UOW0 3EHBD 4RFNB 3CFEA 5ALCL 3U82B 1G84A 5C0DA 1HINL 4RFEB 2UVFA 4EI6B 4P23A 3OG4B 3TGXA 1RY7B 4KMTL 4ZDHB 5DJXB 3D3VD 4M61A 4Q9RH 3RVXD 3BZDA 2IH1B 3RWCA 3DOSA 4G8IB 4L8BB 4LGRB 4I5BB 5HPOA 1F90H 4NO0A 3ISWA 4PG9A 4Z76B 5D70L 4OKVB 4M62L 3VXTA 2V5TA 1HEZA 1XGUB 1G6RH 4LNRA 1FQ9C 2UZXB 1F58L 1YC8A 2CRZA 4XP4L 1C5DA 1KJ2L 1UQSA 2D9QB 4ZUVB 2AP2A 1HIML 2VIRB 1JF1B 2X1XR 5MEPB 2E5EA 3V6FB 4BFBD 4L1DA 1GOGA 5F7YC 4L8SC 3EO0B 3G08B 5IK3B 4BUGA 4MA7H 3UTZB 3BPOC 3AREC 1T7VA 5DLMH 1CFTB 1FV1B 1Y6NR 1A4KA 1EXUA 1XCTA 4HIXH 3EDDA 3SCMA 5ICXA 1NMBH 5CP3A 5E4IA 2ESVE 1DN0B 2V7HB 1ZWIB 5FEBA 3N9GH 3HI5H 3IDYC 5L6YL 2PR4H 4A6YB 4MWFA 1HZHH 3MACL 4M93C 2DQJL 5TF0A 2KL6A 1OAKH 1OQOA 1CS6A 4QCIB 1XH3A 3NN8B 1KENL 5DQ9A 4P46A 3TVMA 5DD5H 5I76A 4FQJH 3GSRA 2APBA 2VC2L 1XIWD 1FVCB 1CDYA 2Y07H 5CHNA 1DQDH 3KPLA 4JN1L 2EZ0C 4OLXH 5AG9A 4HMCA 3V8OA 2EH7L 2I24N 1KCLA 1V7MH 4Y19A 1FNGA 4W6YB 1A7OH 2WQRA 4WFGE 3QCUH 3P77A 4MQXD 2OK0L 5BVJB 1J1PL 2QJDA 4LGPB 5DVKA 1S9KC 4NO3B 4OFDA 5FKPB 5KS9E 3VXQB 3ULVD 5C0IA 2I5YL 6FABL 5CIPB 4YHIB 5CEXA 5FDWA 4O51A 4KI1A 5C0BE 4J6RL 4UT9H 3OPZL 4DW2L 4P5TD 3QEUB 4QRPB 2AK4D 2NX5A 4KKLC 4LGSB 5KW9L 1IZKA 3GHBL 4Y4HC 1XGPB 5EA0H 1S7VA 5GGRB 4F37F 4A2MA 1CF8L 1T0MB 3TBVA 3CVHL 3NCCB 3H42H 4ONGL 1Z9LA 5CP3H 2C4FT 3HI5L 5DQJA 3IFLH 1DLHA 1RJZB 4MDIB 4ZUUA 1ZS8A 2OX5A 4XPGH 2CDFB 3FN0H 2X4PB 3MJ8B 3L3IA 1KV3A 4FQIL 5T1LA 5C0RL 1M4KA 5MI0C 1L4IA 2WM0A 4U1IB 2G5BB 4LMQE 5IFJA 2BNRA 5HYQA 4ZXBC 2EH8H 5FK9A 1WBZB 4MS8D 3SGEI 4M1CD 2ZWLT 1ZT4A 3RHWF 4NBXB 5JIKA 1SJHB 4WW2F 1UWXH 1DDHB 1MLBA 2LAAA 1IGIL 4U1LA 5D70H 1FVDA 2B2XL 4M62H 1MI5E 3I6GB 5JHDD 3EZ8A 2CPCA 1HCFX 1QR1A 1EUUA 2FWOB 2FL5A 1GIGH 3DUSA 4L4VB 4S1SL 1QA9B 3EDFA 3G6DL 1JNLH 3MODH 3P77B 4ZUSA 3ULVF 3EJZD 4H1LH 2BY3A 4OM0L 5GRZA 4XXCC 2ERJC 4BZ1L 5IUSA 4C56A 4YBQC 4K8RL 1EMTH 1JGVH 1QFPA 3HC0B 3IXAA 4R96A 4P2OC 1QLFA 5DJCB 1A9EA 3TNMA 1EFQA 1SEBA 4U6YA 1S7WA 5I76B 2FWOA 3K46A 3TVMB 2RQ8A 1X5ZA 3O2WH 3MQIA 3P4LA 1OTSD 2FEDD 1L0YA 3RWHB 1DQMH 2UWEA 3U46B 5FYKD 4ZNCD 1T2QL 1MWAL 5E24E 3S35X 2H2PD 1NUNB 1IAMA 1N64H 4A6YA 5C0CB 1YNLL 2Y06L 4ZXBB 4J4PA 3WIFA 2O61A 6CGTA 5KTEL 3JV4B 4NN5C 3DYMA 4XNMA 4ETYA 4GKZB 2APWA 5IT2H 1GGIL 3FQUB 3T0EC 1OGTB 4L4VD 4WU5A 4D0CA 3S37H 2XT1B 1T7WA 3B83A 5LCVL 2I5YH 4OZGF 1BM3L 5L2KB 2JJSA 1FL3B 2ZPKL 4WY7L 3W39A 3X13B 3HI1B 4NSKA 4OUOA 2A6KA 2HLFC 3QHTC 1OW0C 3IFPB 4FQHA 1T0MA 1ZLSH 3TBVB 4KRLB 4FQ2L 4GW1B 3RTQB 1CICD 1FLRL 1JNNH 4F57H 2EYSA 5F7EL 4PG9B 1QBBA 2FDBP 4ODHH 4QKXB 2PO6B 5FCUL 2BNRE 5MERA 3CVHH 1FE8H 4HZLB 4TVPD 4KJYB 2NY3D 1SBSH 3CD4A 5C0CD 2W0FA 1E6JL 1A3LH 5C0DB 1YECH 3KVQA 1BAFL 4K3DL 1MQKL 1P1ZA 4FNLH 4KK9D 5D7JB 5KANI 3FB7B 4WJ5B 4F7EA 4U6HB 1U93A 4WHYH 5AEAA 5D2NC 4MNGE 1OM3H 5C0AB 3QDGA 5J1AB 4MAUH 4MNGB 3C09C 5ESVA 4P3DA 3FFCD 1KTLB 1UYWL 1T5WA 3GSNH 3ULUF 2W9EH 5IBTL 1FBIL 1S7SA 3G5XB 4CVXB 3P4NA 2XZAL 2Y36H 2HTKC 2D0FA 4AMKL 2W91A 4LCCA 1NUDA 4GBXA 4PJ9A 3OB0H 3T0EE 3Q5OA 4CU7A 2J8UF 5I1JH 1MI5A 3FMGL 4M7LL 1TJGL 1N7MH 4JFED 1IGJB 2EKSB 2NX5D 4XGZA 5FK9B 4L3CA 5JNYA 3BRDA 1T5WB 3QRGH 1RU9H 4GKNA 3I50H 1OP5K 4BQ6A 1VB9A 4Q9QL 3AY4A 1K85A 4OV6F 3HLAA 1KYOK 5DK3A 3RVTD 2PYED 5DC0A 1IL1B 2A73B 3QUML 4O5LH 5GS1A 5F70A 3F7VA 4FXGB 3OF6A 3AAZA 3HAEH 5AUMA 5F6HI 5D7LB 2F8OA 1INDL 3MLUL 2EYSB 4OZHF 5EOCJ 3UDWC 1FGVL 1XIWA 2AV7B 1EMTL 3CGTA 4WFEE 1MCIA 1JN6A 4YXKL 4LLDA 4GRLA 4Z7WA 2BVPA 2VLME 1OTTC 3ARSA 3LOWA 3S36L 2V2WA 1V5JA 3CMOL 1A9BB 2VSDA 1NGPL 4HW6A 2OJZH 2DLIA 3Q48A 1L6ZA 3V0VA 3AAZB 4PRPD 1FAIH 1CXHA 2NXYB 5CLTA 4YHYC 1FL5A 5HHNA 5KSBA 3HZMB 4M48L 5DQDL 2O5YL 4NQCD 3U0PA 3BQUC 3PWPE 1MFCL 3O6KL 4AT6A 4MS8C 1F90L 4DFHA 2V9RA 3QHFL 1AR1D 4L9LA 5GGVL 2WUCH 4NQDD 1GHFH 5EH1A 2VAJA 1MQ8A 5TDOA 3RZWA 2YD4A 3BJLA 4X6DA 4KZEL 3QNXB 4LCIH 3GK8L 3DXAA 4YH6A 3S98A 4LCYA 1AKJD 3G04A 3VXNA 1MI5B 5E6YA 1LK2B 4PRDB 1I3UA 2HWZL 4X99B 1U8IB 3L5WA 2EE3A 1A7OL 1P2CB 1ADQH 4HUWB 4E9LA 2NY5C 2V9QA 4NUGH 2QQKH 4KROB 3TN0C 1IM9D 1QLEH 5I19H 4WV1C 4BZ2L 5DJ6A 2OBGA 1YEJH 5MP6H 3WLBA 1QHOA 1DVFD 5HHXL 3DX8B 4PJEF 1AGDA 1X5LA 4ELKA 3HE6C 4XHJD 4JM2D 5J6HB 5ESVB 4P5TC 1ZV5A 2OSLA 2DQGH 5IG7B 5T1LB 5CJXA 1X4YA 1KLFA 3LSOA 1URLA 1ES0B 2IG2H 1PVHA 4R0LA 4C58B 1E6OL 5EWIH 4L4TE 5TPWL 3KPPA 1RIHL 3FOMA 2AJYL 5C6TL 2NW2B 1JRHH 2X10A 3TLRA 1YNKH 4KKBC 2CMRL 4TNWK 1F6AA 1K8IB 4IHOB 4KHXL 1A4JB 4HUNB 5H37H 2YHGA 1R5WB 5IB3B 4PS4L 3QBTB 2V5MA 3D3VE 1FZKA 3MLYH 4NZDA 2RIKA 5BV7H 4UZGA 1C5CH 5IESH 3QSKB 4JLRA 4Y5YB 4NRXA 4OIIL 3OKMB 2O5ZH 4LMQI 3VFGL 5F97E 3SKUD 1NAML 3OAZK 2IQAB 3C08H 3G6JE 3GHEL 5IJVB 1FAKT 2CK0H 3UDWA 1NCCH 2ICEB 1A7QH 3H2WA 3I50L 3TO4D 4JE4B 5F1NB 4FQLL 3WJLA 3QCVL 3GJFB 4C55A 3DIFA 4NPYA 1QQDA 3S6CA 2FEEL 4WUKH 2P8PA 2WINA 5C0FA 4YFDB 2KDGA 3U36B 3VFWB 4GG6F 1HOCA 3WIFB 2O61B 1NGYA 3RY6C 4TNVF 3VWKC 4HGWA 5CGMA 3CVHB 4P46B 5F71A 3NA9H 1I9JH 2F8VA 3RWFA 5ESQA 3NH7L 4P2RA 1SYSB 4PJGA 5KSBE 3AM8A 3S5LG 3SDAA 4IOSD 1WISA 4M6MH 4TVPL 3HZYA 1DE4B 4X98A 1W2KT 4KY1H 3DYOA 3RNKA 4ZD3H 4LF3B 5SX5K 3RVWD 1DCLA 4Y16D 1YYLH 5D7IE 4LEOA 4NQTA 3CSYA 4L4VA 3INUL 3GJFH 3IS1X 1R5IB 3S4SB 4EN3C 4PP2A 2OTUA 4OCXH 3QDJE 1SYSA 3MBXL 2VABA 5A16A 5IB1A 2NY6C 3BWAB 4GH7B 2AJXH 3CLFH 1G7JA 4J4PD 1H3XA 2XN9E 4LCWD 4Q9CA 2AJZB 2VUOA 5IEKB 2FNBA 2UY7A 3DUUA 3ZE1F 2PO6C 1HINH 5F6IC 5D6CB 2YPLA 5JA8B 4KDWA 3H0TA 2P8PB 1RUQL 1FLTX 4GRWB 3IDMB 3JZ7A 4UV4L 5DRNB 3WCYA 2PO6D 3IAQA 4ZS6D 2GJ6E 4HX1B 1S78C 1U3HA 1ZMYA 3QO0A 3R1GL 5JPMB 4HXBL 4O2CB 4OD3H 3OKDB 3O4LE 4PJDA 3CDGB 3MCLL 2DQDH 4EI6A 1F42A 5T1KD 1CFNA 5BV7C 5F1KC 3EOYG 2ZOLA 2F74A 5C0AD 3ARDA 1JVKA 2P42B 2EXWC 3HAEB 4UDTB 2I9TB 5K9JL 4JPVH 3J8F7 4XWOC 3VW3L 1N64L 1XR9B 3OX8A 3PGFH 2X7LB 4K8RD 3S97C 3TCLB 5C8JA 5AYUH 3NIFF 3H7LA 3WEXB 4PLJC 2WBJB 2VDMH 3MLRL 3ZKNC 1H8NA 3O2WL 4X7DC 3SJVB 1QEWA 5E70A 3MXVL 4MXQD 5FDWB 3V4VL 5CEXB 3VXQA 2BNRD 1R5VA 1P7QB 5IW6B 2IPTL 3NFSH 2DYPA 1FORH 3QNYB 3NBNA 5L88H 5I30L 3EW3B 3HKFA 4FQXA 1X5KA 2VQTA 3E6HA 1C12A 1UXSB 2YD2A 1MWAB 4QT5B 3BGMB 1U3HB 3BGAA 4QHUB 4WEBH 3VXOA 3H3BC 4P4KC 3P73A 1OAUH 1HHIB 5T3XD 5T3ZE 1DUYB 1RUMH 3QWRA 5IEKA 4GKOA 4G7YH 3SDDD 5ANMB 1YA5A 5BQ7A 2VISA 1NCBL 3MREB 4PG2A 3MV8A 3C9NB 3LRSB 3P11H 4LSRH 1P4IH 5HPMA 1U95B 4LVNC 4QRSB 4OAWB 1NFDF 2HKHH 5SWSB 4KHTH 2GTZA 3CSGA 4ODWA 3KS0H 2MQ3A 1ZEAL 1CZ8H 4LDEB 4WI5A 3DX6A 1QTYT 3G9AB 3WXWL 2AJ3A 4JQIH 2JCCF 3EOAA 3FO0L 5ETUB 3ZDXF 2HRLA 4X6DE 5FYLD 1JYVA 3W9DB 1HHJB 5C6WH 4YX2L 4YFLI 4P2QE 1T1YB 5HHVL 1LE5B 2V2WB 2V9TA 4LCYB 3MRNA 3OHXA 3LV3B 5C0EB 5T33L 1BBJB 5EUOF 1CQYA 2GHWB 5F7MC 1NJ9B 1DQJB 2W07A 3DGCR 1I8IB 4TRPL 4NQUA 5JHDB 2IH1A 5DD0H 2C7UA 4WI6A 5JTWA 2DQTL 4ZO7A 4AT6B 1YNTB 4OV5B 4Z76A 4HIIA 1J8HE 2NY0B 3VFUB 1KJVA 3OKYA 3FB5B 3RWCB 4NNXB 4Z0BH 3TZVB 2DQEL 1RUQH 2FL5B 3PDGA 1FRGL 4KK5D 3SCMD 1P9MC 4PGEB 1BLNA 1G9NC 2ICWB 4BH8B 1KIPA 3LDBB 5DC4B 4PUBH 3W0WA 4WI7A 1F5WA 3PNWA 4N0FA 1KLUA 3FO1A 1MNUL 1WVZA 2W9DH 5JOPD 3H9ZA 1MIML 4EUPA 4PJHE 1GZQB 2A74A 2XN9D 3MBEB 15C8H 3ARDB 3H3KA 5KG9B 4KVNL 4HS3B 4D0BA 5I8EA 5HGAB 1NLBH 4JPIB 3MZTA 5DMKB 3HG1A 2YR3A 3NFSL 1MOEA 4LSPH 1H3TA 1J0YA 4X8JA 2VLRD 1GAFH 1S7XB 1HILA 1T3FB 3F7QA 3RJDA 2CMRH 4AQ1B 4MJ2A 3MROB 1VGKA 1JRHL 1S9XB 4MZ3A 4MDJA 1MF2L 4NNYA 3BP6A 3BW9A 2NZ9D 4BK5A 4D9LL 4DUWA 1DN2A 4X7FC 4QTIL 5D5MB 5DJZA 1RUPL 4QWWC 1RUML 4PJ5A 3BEVA 1X7QB 4M3JA 1E4KA 1YQVL 3AB0B 1IM9B 1U8OA 5INCA 2DB8A 1TVBA 5A16B 3RKDD 4WNQB 5IV2A 4ERSH 5EOCH 1Q9LA 1OTTD 2ZUWA 3DETC 5LKNA 2C3HA 2DS4A 4MNQA 4OQTA 3MBED 1XCQA 3EO9H 4DVRH 5IMKB 2R9HC 3LD8B 4HXAH 3CXHK 2EDNA 3K2UL 3CJJA 4LAJH 4BZYA 1UADC 3WS6C 4I77H 3W2DL 4M6OL 4RMVA 4LAQH 3HFMH 4ZSOB 5A3IC 4JAMB 5EU3B 3PHOB 2HN7B 3IFLL 2ZCLL 3FQRB 5GRWA 3F7YA 1F11B 2ZUVA 5EG6C 1F4WH 1NMAH 1KCSH 3BKCH 1S7UB 3KLHD 3T65B 3MRKA 5KVFL 1LP9F 2P5WD 4O2EB 1ORSB 1RK0A 2BK8A 3DV6B 1H5BC 5EZJB 2VITB 5JQ6L 2OZ4A 3LQAC 4WW1B 4ZSOA 1DBMH 2CDGB 2P24A 2ADGA 3TBTA 1H3VA 3BDYL 3RWGB 2VXQH 3EO1B 4M7KL 4XMLH 4XCCH 3WFCH 4LIQL 4TULL 5FGCB 1QPPA 3EDEA 3K8MA 1UWGL 4TTDD 4X5WA 5F72S 1T1WA 4HWNA 3O9WD 4XC1H 3TO4B 2C3VB 5I1HL 4IRZH 2FYYA 4MZ2A 2Z4QB 2X1OA 3NACH 4PJBE 5IMKA 3RY4A 4QRRD 4XI5D 2DQEH 4MD4B 3FQNB 4YNYB 5HI5D 5A2KH 2NYYD 3Q6GH 4FFVC 4C4KO 4PGZA 1N6QH 2W9LA 5I1GH 3L7FA 4PTTA 2AJSH 2OR8A 4OQTH 4X9HA 1MRDL 4EXKA 4GW4B 1OGAD 2GJJA 4P9HL 4DOHB 5FF6A 2QBWA 5LGHH 4X6FB 3GBLA 4PJAB 1BVLA 1UWEL 3BD4A 4M7ZC 4JRWA 3GMQB 4P23B 2Y9RT 4X7EC 5CCKH 5ADPH 1YEHL 4PRAB 1U2CA 1CR9L 3EYQC 5BO1H 4V1DB 5DA0B 1CLYL 4GMSH 4P59H 1TIUA 3EFDH 2FGWL 5TH2A 1GGBL 1Q0YL 1Q38A 1MWAH 3MRBA 3UJTH 1JGDA 4POYA 3V2AR 2R2BB 5CJBA 3PWJA 4NZTH 2WWMD 1D9KA 3HR5B 2GITA 1EFXA 4IMKC 3SKJH 4HV8B 5C2UB 3ARGC 4NZRL 5E1HB 3N85H 4RGND 4DKEH 1ONQA 3T0ED 3VCLA 2XNAA 2NY5L 2H45A 2R69L 3ZE0E 5JZ7D 5MERB 1NC4D 1PYWA 1PJ9A 1QPXA 5T5FH 1NBZB 2WIIA 4G43A 3NCJL 1A1NB 1MHHA 1MFEL 3PQYD 5EU5B 4KU1A 3UROR 3RZCA 3TO2A 1DVFB 1MCNA 5IB4B 4P2RD 3MLVL 2D0GA 1OCWH 3JTSB 2EC9T 4K94C 2E9WA 2AJSL 2FBOJ 3TJHC 3OKDA 3T04D 1KIRA 2X4QB 3U0WH 3P4MA 5E8EA 4X4XA 3VFUA 2H3NA 3GMRA 3QDHA 4MAYD 1U2HA 1J12A 3I84A 1R3HA 4UTBH 3U79A 1I1FA 2VOTA 2Y1VA 3PWNB 1FJ1B 1H9VA 4YHZH 3VXRE 3MRHA 2PXYB 4JFHD 1TNMA 1LP9E 1X9QA 3BISA 2Y23A 4F15C 5IFAL 4GAFB 3BFOA 1DBJL 1WK0A 5DO2D 4O4YH 3RVUD 2QLVB 2CD0A 1NC4B 2VC2H 4P99A 1PSKL 3SDDC 4LEXL 1DBML 4R4NC 3IDXH 4HBQA 5I18L 1WAAF 3TN0B 3UAJD 5ICYB 1W0VB 4M48H 5DQDH 5D2NE 3CFCH 3V4PL 4I8DA 5IM7A 5D7LE 3GMPA 3QJFA 3R0MA 3IDNA 5EBGA 4YHPB 1VA9A 3BE1L 4YAQA 3DSFH 5J3HC 4Y19B 4ZFOA 4YXLH 3RPIA 2X4TA 4MA1B 3MRJB 1O7SA 2Z31D 4M93B 1RZKH 2EIEA 3QUXA 1BGXL 1FYTB 2JJTA 3KPQB 2XXCB 4WV1B 1HHHB 2X44D 1JYNA 2ZOKB 2HJKB 2B39A 1HWHB 1XH3B 4Z77A 5J9PB 4X6BA 5E6IC 4Z0BL 5IVZB 1BWWA 1W0WA 3P11L 4PJEB 3MV9E 4CVZA 1L0XA 2YPKB 5TGBA 2XA8H 2EDEA 4LVHC 4YC2B 1EBPA 3MV7A 4ZFFA 1QQDB 1HI6A 1FSKC 3IDIA 1K2DA 1EZVY 1DN0A 2V7HA 3EJJX 3V5DB 3GM8A 3H8NA 2DM4A 4JY6B 1VKXA 4EVNA 2IH3B 2JJVA 1MFEH 4HHAA 1LEGB 3O4OB 3MV7D 2B7DT 5EU4B 2ARJB 3DHMA 3QDJB 5F89B 4ZPTA 2EXYD 3CX5K 4NFCA 5AWNH 4BYHA 3S34H 5I1LB 2WBWB 2Q8AL 5D7IB 1SYVA 1TTGA 1Q94B 1IM3B 3REVA 3QYCA 2MKLC 2NY5H 1AKJA 5CJ8A 3WV0A 5F7FA 3W0WE 4JFPB 4JZJB 3TBWB 2VLJB 2Z93A 2DWDA 3M1BB 3KPTA 5C09B 4IRJA 3OGOE 4MCYA 3SKJL 2LTQB 3O3BA 2DQTH 4H8WH 3ULSA 4M61B 1FNEA 5C6TH 2QQLL 1Q94A 3REVB 3RL1B 3VFVA 3ZSSA 1GL4B 5I6XB 3SKMA 3ZTNL 4KKCC 1MAMH 2B1AL 3G5ZA 1EHXA 2YZ1A 4N0UE 1BECA 4CNIB 5IJKA 4OGZA 4HX1A 3C08L 5F7DB 2BNUB 2EKJA 3P9LB 1UCBL 4FP8H 1AD0A 1QFOA 2FO1A 1W0WB 43C9A 3LKOB 4W6XB 3C5SA 4Q0XL 4FQQB 4NQDE 3TJEH 4WDIA 5JORB 4K71C 2GEEA 2M1KA 1IKFH 3PWPD 2H2SD 4HLJA 1ACYH 4MVBC 1DQJA 5FCSH 2YUXA 4R26L 1VACA 3LH2H 3PQYA 2NY4B 1SM3L 3CDYA 4ZFOB 5M7QA 1BP3B 1A14L 1SMAA 4OF3A 1YEEL 1N0XH 3ET9F 3MOAL 5HGDB 4TQEH 3LQZB 4XCEA 4L29B 5B39A 1OHQA 4HSQA 3LEYL 5BZDB 2HT4C 4Z7VF 3ZKMC 1MQKH 2UVEA 2F53E 2NY2C 3D1MC 3P4OA 4JFEA 1OAKL 1F4HA 1U42A 2E6PA 4OZIE 4LL9A 5GGUB 3F8UB 3LKPB 4HUXB 1G9NL 3MJ9A 2BVTA 1O0VA 5KVGL 4HIJB 3QCTH 4W4OC 3N1GC 3MRRA 5IJKC 4ENEC 1CBVL 4LHQB 2FBJL 5JR1H 2GFBA 5ID0B 3L3JB 1QRNE 3VI4E 1U3JA 4HC1L 1EAJA 1ZLWH 4UTBL 2Q7NA 3ARDC 4M43L 4FFZL 3QDGE 1DFBL 1TZHA 1R24A 2IPKB 3S88L 1ZGLP 2Y07L 4KDVA 5L2JA 5EBMA 3KNBA 4PRIE 4XVSH 5JIPA 4H8WC 1SEQL 1E4XH 5IQ9B 7FABL 3O3EA 4HKJB 4NQXA 4MQSB 4P2QB 4X9IA 3HA0A 3HE6D 4LOUD 4KMQA 5FKAA 2ADIB 2CR3A 3L95A 1D5IH 4ZD3L 2VDKL 4F58L 5K93A 2HLAB 5HYJA 3ZE2F 5HYSG 4GG6B 5I71B 1K8DB 3DPBA 3WD5L 2EE9A 3T0BA 5SWQA 3RWJA 4HULB 1ETZB 5D93B 3TT3L 2VKWA 3BUYB 4H1LG 4HWUA 3D85D 5DD1H 5JHLH 2HP4A 3LEXA 2VDML 5FGCE 3OAUL 2XKUA 4RRPA 4OFVA 4XBPB 2B4CH 3MYJB 2W0PA 1U93B 1JNHB 2R23A 4OCYL 2G75B 4EBQL 2UWEE 3CH1A 5L9DH 2AKRA 3HNVH 5CJXC 5ERWB 1DQLH 4OGYL 1AGEB 2IADA 2H2SC 4MVBD 5JOFB 2FRGP 1ZANL 1MUJB 5IVXB 3ARGA 2PXYD 2O5ZL 2Z0BA 4JCMA 4EIZC 5JPMA 2R0LH 2GSIB 5DJYB 4FXKB 4E41E 4JM2B 5HVHB 3UYRH 5B3JF 2XTJC 5TDOB 3A67H 4S0SD 1ZA3A 3QUZA 3TWCL 4RGNC 3VRLF 1I1AC 3BXNA 4LSRL 1KN2H 5DK2A 3TV3H 4GRMA 4QHLB 1FFRA 3QT2A 4O9HL 2YZ8A 3LRGA 1FL5B 3WYRA 2WWMC 4OLZL 4N0CC 4ONGH 1FYTA 3MV11 5IEHA 4GMSL 4P59L 4Y16B 4ACPA 5E7BA 4Y19D 4TUJB 2FSEA 1N4XL 4OD2A 1FHGA 2KZWA 3S8WA 1FAIL 3BPNC 2IBZY 3MOAH 2W59A 4LLDB 3BP7B 2Y06H 3DVNB 4HWZA 5HHOB 1VEPA 3G5VA 4TPRL 5IM7B 4LCWE 3OJ2C 1FC2D 3UX9B 2JTDA 2AEWA 2P5EB 2Q3ZA 2H32A 4G8FA 1LVEA 1ND0A 3QIWC 5BS0B 3O6LH 3QEQB 1CU4L 2IBZX 3HUJB 2MPAL 2ZPKH 3TCXA 1KNOB 1IAOB 1QKZH 3BAEL 5DYOB 5DT1H 4U7KA 4OM1L 3NCYP 1N8ZA 3VXMB 1KXQE 5CEYA 4KGJA 3OBAA 1YEDB 5FYKU 4Z7OE 5KAQG 2BXZA 2JELH 3DRTB 3BSZH 3QR2A 1OCWL 3KPRD 3ULVL 2BNQD 1CE6B 1I1RA 4H20L 1UB5A 3RZCC 1DVFC 2CKBH 1Y0LB 2GT9B 1E4XL 3B9VA 2IQAA 1FVEA 4E41B 5B8CA 2O5XL 4HPYH 1NDMB 1ULVA 5IB2B 1BIIA 1A7NL 1XR8A 3T4YA 2H2PC 1S7SB 2CRYA 3WO4B 4G43B 1RZ7L 2QR0A 4HWBH 4NZRH 4UINL 4RCAA 5IB3A 4D9RD 1TJHH 3GMMA 4PRNB 3VFTA 4IS6A 4LU5L 4AM0A 1LEIA 2EEDA 3GSNL 2A6IA 2UWEF 4U6HA 3QO1A 3D0VB 1FBIH 3ARGB 3DHJA 1GAFL 1NLDL 4LKCB 2YC1B 4Y19E 1FG2A 3E6FB 4DFIA 1KB5A 5FM5O 2DWEB 4HJ0D 1KT2A 1MCOL 1NFIB 3PDOB 5DGQA 2EDJA 3O6ML 1YPZA 5I1CH 1OY3B 4L8SA 1S7QA 2GK0A 5C07B 1I3VA 4ZO8A 4HZAA 3QJHB 2I9LA 2K9UA 1RIUL 3U30C 1PKOA 3UTQA 1B0GA 4GFTB 3PIQA 2APVA 1ITCA 5JDJA 1XGQA 3VRLE 3I3DA 1KJ2B 4K7FB 1S8DB 5DJ8B 5LGJB 4HS6B 3MV7B 4ZFFB 1JNNL 2ICWA 4F57L 3BHBA 3FMGH 2FEDC 3Q6GL 1IQWL 2AABH 5FAAA 5FA3B 3N1MC 3THML 3V5HB 4GW5B 4FFYL 4DK6A 3CAFA 5E6IA 3DX9A 4KJWC 1U8MB 1BMGA 1DANU 3ULUE 3MLSH 4XNMB 3OXSA 4Q9BA 1YEDA 4PRIB 3TA3C 3FQNA 3VFRB 4IRJD 1FZOA 4HIEA 1XGRA 2ZCKL 3KPLB 2C3GA 1MFDL 2ATPA 4U1MB 3VD5A 5E8NB 4HKXA 4DZ8A 3ARFD 4G7VH 3CFBA 3SY0A 4R90H 3HNTL 1U8MA 5FUCC 3FFDB 3V6OC 4QCIA 3V4UH 2GTWA 4MXVE 4OZGE 5E5RB 4O02L 3MRDA 5D96B 1RFDL 2BFVL 4GRLB 2VE6A 1MH5A 1YUHB 3IAGC 5K33A 1OPGL 4XVTL 5HHPA 1A2YA 3C60A 3GJEB 4OGAD 1YY8A 1FGNL 2P7TA 3A6CL 5F7LB 1MJJB 4UU9A 3F7VB 2JB6B 3MUGB 3SDXF 2XOTA 2KPNA 4PRID 3DMMC 5HYJE 1HIMH 2XKNB 3PGFL 3OKEA 4NN6C 2AK1L 3S7GA 1NDGB 4WGWB 3HE6B 1UACH 4FMFA 4XPTH 4WFED 2F5AL 2A6IB 3KPOA 2VDLL 4HMEA 1MCEA 1UA6H 4PGCB 4PRNA 3VFTB 3ARFC 2VZ1A 1CG9B 1A1NA 2OL3B 4FG6C 1S5IL 3BGMA 1OAXL 3I75B 3WFBH 3WIHA 2R1WA 3HS0B 1T03L 3TA3D 4IIQB 4OZHA 5I30H 3DTXB 2YRLA 1YPZB 5FYKH 5FUCE 3TPKA 4K7PH 1NFIA 1JJUA 4GRWE 2DQUH 4Z7WF 2PF6A 2FB4H 1DR9A 1OAYH 4LRIC 2PYFA 4LLWA 5CZXD 1T1ZA 3EDKA 2PTTA 1U8QA 3E2HB 3LVEA 4KTDL 3TBYA 1YY9D 3B9KC 1IEBB 1L9MA 3H6JA 5IVXF 4U1JB 1E6OH 3HMXH 5EWIL 5FUOL 2JB5L 3IRZA 1KCKA 1XT5A 4MAYA 3U9PL 4YDLC 1A7RL 3GKWL 1EGJL 4TSCH 3MCG1 1KIQA 4GKSB 1OVZA 5DMIL 2FX9L 4IMLB 4DGIL 3O2DL 5J7CC 4G6JH 3X14A 2VLJE 1HWGB 5FYLL 5T3XL 2XWBA 2LV4A 3OKLA 3UTSD 3QDJD 4OFYA 3NZHL 4RFOL 2F54E 1VFMA 4ZS7H 2XKNA 2FSEB 1DTUA 4ZPVB 2FYYB 1K5NA 4PJ7E 3U7WL 1SYVB 3T77A 3U0WL 3UBXG 4N8CL 3X12B 4Y7MA 4HQQL 3TZVA 2B4CC 3J7HA 5GJTH 1OGTA 2HYMA 2Q76A 3GSXA 2FECI 3NOIA 3FFCA 1CL7H 1IGMH 3ARBD 5E5MB 5KTEH 1MCQA 3MCKA 1YUHA 4X6EA 4GG8A 1BFSA 3MMEB 1IAIM 2W0LA 3GMNA 4ORZC 3VFGH 2FJHA 4ZUWA 5D71L 4OCRL 2BVQB 4WW2B 1PDKA 4M7JH 3CLEH 3QNZB 3QEQD 5ILTL 3SCMC 4ZOEA 2G2RA 2HRPL 1PKQE 4JZOB 4KK5C 4H8WL 1NC2D 5JXAL 5DUPL 1CTOA 4NQEB 4EQ3A 4LDLB 1EAPB 1FNHA 2DQUL 5MEQA 3VXMD 1BF2A 4F2MA 3D2UB 3C8HA 2VR9A 1NGYB 4L3AA 3ILPB 5L2KE 2BNQB 2BCKA 2BSRB 2OJEA 1NCAH 2EZ0D 2OM5A 4JFYA 5E9DE 2H1PL 1XIWC 4MMXC 1JNLL 1A02N 1ZHLA 2Y72A 2GSIA 4TVPE 4MA8H 4OTXL 5BJTA 1BAFH 3VXUB 5KN5A 5IBUG 4LCUA 1G7HA 1G6RL 2G9HB 2VDLH 4H20H 2ESVA 4XTRC 2X9XA 1NCWL 5J89A 4JY4B 3GBML 2A2QT 4HS6A 3IFNL 4S1DD 3VFSB 5FDYA 3FQXB 5KVDH 4M5ZL 4U49A 3VGHA 1HCVA 2J8UE 3GSQB 4YQXH 2IQ9L 5E9DA 5F7DA 4LRNH 4U3HA 5CJOH 1IILE 4MDJB 5I1EL 1N2RB 2F9BT 4ZTPH 4PJGF 2D7MA 5TFSH 3QPQD 3TT3H 4KWUA 2AVGA 3D48R 1OAYL 4PR5B 1OPGH 2GJZB 3KXFE 1NBVH 4UINH 3BJ91 4LHUB 4IMLA 5AZEL 1A6TB 4LSTL 1UFUA 4NGHL 4JRYB 3X14B 1GGIH 3QO1B 1PEZA 3CLEL 2VRAA 2FJFB 32C2A 1VGEH 4GOSA 3KGRA 1CK0L 5DD5L 3BRGC 4CN1A 3V5KA 3L3JA 3QXVA 5GIRB 1BZ7A 1BFVH 2R0WH 3T4YB 1BVZA 5EBWB 2LU3A 2C4XA 1K4DA 4P5KA 4U2ZA 5A2JH 2F74B 5IW3A 5EO1B 2GY5A 3L3KA 2BZDA 1MELA 4XPFL 3V9FA 2QQKL 1WLHA 3IF1A 3KNBB 4FN0A 4DZBA 2IBBA 4HPOL 1R24B 2IPKA 5ENWA 4KUCD 3DLQR 3VFNA 2F19L 2NNAB 2HFFB 2J2ZA 3NZHH 2M2DA 5IMOB 3MUY1 2BRRL 4JKPL 4DGVL 3LS5H 4DUVA 1KPUB 3TH3T 3JSSA 5B38G 3H9SA 2ZJSL 5D7IF 1MAJA 4L9LB 4I0PA 4M7KH 3D39D 1N59B 1JNJA 3VU2A 1U3ZA 3GSXB 4LLYA 5EA0L 3RIAK 5GRVL 4XCFH 1KENH 4YX2H 3ZDYF 4PJIA 5KVFH 5I1CL 3QUXB 3RIFK 3NFNB 4K55A 4QXWA 1QSEB 2OJZL 2X4RB 4WFGD 4HUVB 3DBXB 4LPCA 1PSKH 3QPXH 5C0BB 5CEYB 2D03H 5E8OA 4CW1A 1SMOA 3U30B 2I60L 4P5TA 3WKML 1CFBA 4UV7H 2FLBT 1AQDB 2AI0L 2V7NA 2OR9H 4X83A 4KKBD 3NZ8B 4JVPA 1N5YL 2XQBL 1KG0A 1ZT1A 2VZVA 4NZJA 4Y4HB 1UQSB 3H42L 1NAMA 4NYLB 2DTMH 4N0RA 5HXMA 2EXWD 2UYLA 4AENB 1OP3H 2OTWB 4DK3A 3AM8C 1HSBA 2CKBL 1WFTA 2G5RA 3QDMA 1GOHA 4S1RL 3RNQA 3BQUD 3NCMA 3WS3B 4XP1L 1CICA 2F5AH 4U1HA 2CJUH 4F37K 4W68A 1ZAGA 3ARXA 5EN2A 4FQXB 2HJLB 3O11B 4GRMB 4KRPB 1G7IA 3DRQA 4ENED 4I3GA 1J8KA 4X9FA 4FQIH 5FB8B 1D5MA 1KPUA 2C1OB 4X6CA 1GJIA 4JQVC 1HXMB 1T20B 2AJYH 4XVTH 4POUB 4MAUL 4AK1A 2P49B 3L5IA 2HFGH 4MA3B 4OUUA 1CE1H 1MFBH 5C9JB 2VXUH 4H0GA 4UMGA 5EU6B 4NDMA 4S1SH 3QUYC 1W72L 4U1NA 5GS0C 5IB5A 4RMTA 1B0RB 2NXZB 4G9FD 3IF1B 4DZBB 1OARH 4CU8A 3SDDA 5C0GB 4LLUB 2W1NA 1YEIL 3MV9B 1I1YA 2B2XH 5HBBA 4LBEB 4O00A 4NJ9L 2VWEC 1FO0A 5K9QG 4AIZB 5MEND 1MJJA 1NGQL 3QIWB 4XXDB 1WEJL 3LHPL 4K23L 4FQ1H 3S88H 2GSGB 5JW5B 4PGBB 2ITDB 2V17L 5DR5L 5EU6A 4U3CA 5F7EH 4KMTH 2VLLA 4ETQA 3GMMB 1Q9KA 1EEZA 4E41D 1EDQA 3FO2B 2RBLA 5EOQL 3ZDZE 2HT2D 4OF5A 4IDJH 3KJ4C 4KKAC 4GG8B 3P40A 4RFOH 5DMKA 4G3YH 4NYLA 5B8CB 4XH2B 1X5GA 3QXDA 3U48A 1QACA 4NQSB 1Q0XL 1PZUB 1UCBH 4PV8A 1UEYA 3NCFB 2HLAA 2R0LL 2MJWA 4JDVB 2HJKA 5HYJB 4WU5B 3SO3C 1CXIA 2DM3A 2X9YA 5E7FA 5E03A 2N7BA 5ITFA 4XP5L 1M7IA 3GUTB 4UBDD 1KPRA 3NABH 3GBNL 4I3SH 5IMLB 1Q8MA 4FNLL 3QQ9C 4PJXB 2X9WA 5DRZB 2AXFB 2JIXB 1TCRB 2RGSA 3CFCL 3NIGE 2DIBA 4HIHB 4PJAF 2V2TB 5DUBB 1UWXK 4NIKB 4NQED 4K3EL 1I3RB 3I2CL 4P4KA 3U0PB 1JWSA 1HNFA 5KOMC 3VH8B 1CE1L 4PRHD 5E6IB 8FABA 3ECBA 3RUGE 1KYOJ 2KBGA 4GW5A 3JTSA 5KBNC 3NAAL 3D39E 3W9EA 5MEOA 4ZUWB 1NLDH 5HGDA 3DMMD 1SEBB 4GAGH 2BHYA 1ZHLB 3CFJA 4MYWB 4U6YB 4ZFZB 5DHVA 2DJSA 4H1LB 1T6VN 2UUDH 5D7KE 3WLWC 5EU7C 4Z7QF 3WKMH 2X09A 3ZL4L 2R0KL 3BYTA 4ONFH 5EZLA 5E8NA 5HI5C 4MJ4A 1MFNA 4LVEA 4N1EA 4F2MB 1KCRH 4HIJA 2V17H 5DR5H 3S34L 4JAMA 5AZ2H 2XTJE 4LPVA 4OZHE 4CVUA 4MB4A 2NR6C 4JFDB 5A2IH 2AW2A 1YEIH 4IRSB 3FHAA 4IM8A 5F6HJ 3CMGA 3EBAA 4M02A 4JRXD 5SX5H 3BXNB 5FM5M 3C5ZD 4ZOAA 3TIEB 1OAQH 1YEJL 5MP6L 2EC9U 1LO0H 1CIDA 2JELL 5I1JL 1VACB 1WZ1L 3TT1H 1DLFL 1T1XA 2CK2A 2W65A 2HFGL 4LHUD 5DJ0B 5J11C 32C2B 3V7AG 3PJSA 5BV7B 1IM9A 1U8OB 4TVSa 1PKQB 2Y36L 1AO7B 3GMQA 3ILQC 1VEOA 5J13C 1T7XA 5CD5D 4ZTPL 5I0ZA 2OMNA 3MV9A 3AREB 2PYEE 1RIHH 4RZCA 4LSSL 1NDGA 4YDKH 3O9WC 3CLFL 4PLKC 4NQDB 4HKZB 5CLWA 1EFXB 5D71H 1CGVA 4U2YA 2FX9H 5F7UA 1XGPA 2E7HA 2Y5TA 4Y1AD 4CNIA 1C08A 1F3RB 1J0HA 4Z7UE 5H94B 4F7EB 2EECA 3SE3A 4PJ8A 2BERA 3GMLA 3SGEH 1A0QL 4NRYB 3P0YL 1EEQA 3VRJB 4ZTOL 1MREH 4HC1A 3VWJB 3CFJB 4F7TA 3MJGX 4M6OH 4LHUA 5BJTB 2D3VA 5KN5B 2I07B 5J4MA 1YMHB 2OL3A 4CRPA 1ORSA 1RK0B 4LPYA 3HMWH 2DLGA 5ICZA 5JMRA 5GGSB 1IQWH 2AABL 5DRWB 5DTFA 1KC5H 4HIHA 2X2YA 2X4OA 3BP5B 5GRJL 4WHDA 3W0WB 1AGFB 4JRXA 1BREA 3QHFH 5GGVH 2R9HD 5CJ5A 1GHFL 4G42B 3OF6D 4PY7A 5GZOC 1IAOA 4WI3A 1MY7A 3TPUB 2P8MA 1EV2E 3V4UL 5IR1A 2WP3O 3EYOA 3K0WA 4AL8H 1TZHB 5JW3H 4XCFL 4OCNC 4K71B 1VGEL 4O2CA 5JZ7C 3AMLA 3VFOB 3CFIC 3BO8B 4ZODA 3MRFB 3MMEA 1BBJA 1XF3B 4OF7A 4GRWH 3G6JF 2NYYC 2CQVA 3GI9H 1OLLA 2VXVH 2VLKA 1TTFA 1SY6L 3WD5H 3DBXA 5CD5C 5FYJE 2A9NL 2I9LB 1X5FA 4HUXA 5I15L 5I8CA 5IMMA 3GGWB 5C1MB 4I1NB 2IAMD 5C08A 4HPOH 4NQEA 1FYTE 5D5MA 1Q9OB 5DJZB 4HH9A 4O58H 2F54D 3WUZA 3RAJL 1IL1A 4FG6D 4GAJL 4KK6C 5EIQA 3E6FA 4FOMA 5A1AA 1KGCE 1A7QL 3GBMH 3FRPG 1DQLL 4AQOA 1RJCA 2ADFH 3OGCB 5FGSA 4JFHE 4KKLD 4JQXC 4D9RE 4G8IA 3BEWA 1DP0A 4L8BA 4NCC2 5ICYA 2CIIA 3F12A 4KJQC 3D9AH 1TZGL 2EDDA 1K8DA 3FAXA 4EIGB 1RIVH 5KVEH 5KG9A 3CFBB 2XA8L 1I7UB 5DJ8A 2DMCA 4ZAKB 4DZ8B 1FNSH 4Y2DB 1NMBL 5ALCH 3A67L 4HWBA 1WJ3A 1CXKA 1LK3L 5EN2B 5D8JL 1ZT4B 3U6RA 5IBTH 4UDUB 2LVEA 1C08B 3QIWA 5CSGA 1ZA6B 2AERT 1JNHA 1F8TH 5TJWK 3KYMB 1UM5L 1RFDH 3CX5J 3MROA 3PWLA 4LASL 3MLRH 5ESAB 3GSOB 4MHHG 1KIRB 3G6AB 2DI7A 3DSFL 4RDQG 5B4MD 3DETD 4YXLL 4FQJL 3WUWG 1KSRA 1WBYA 5FGBA 1BFVL 2R0WL 1AQKH 3UXFA 3RGVB 2VL4A 1EHNA 1O5DT 1YEKH 5JW3L 3S5LB 4G6MH 3DVIA 3TESA 2R1WB 3HS0A 3S96A 1RMFL 4RIRA 1JPFB 1M71A 3VXUD 1A22B 5J1SC 5FB8A 3QI9B 2A1WL 5EUKA 1K8IA 1ZLWK 5I1GL 4JVWA 3JV6B 2CUMA 4CUCA 3S4SG 2R4SL 2R1YA 1T1ZB 1ZSDA 3H9YA 1BWMA 2JF1A 1CU4H 2ZNXA 2HG5B 1ZHKA 2MHAA 2WV3A 1WGOA 1KEML 1N5AB 2F53A 4JFEE 4MXVF 3NIFE 2RB8A 4HCRH 4NWTH 1BJ1J 1TZGH 1UZ8B 3MRMA 1AFVH 1DSFL 5JUEH 1HKFA 4HIIB 1ZGLM 3L3OA 1V7NL 4BQ9A 4U1KA 1A5FL 2QR0B 2BNQE 4Z95L 5GGQH 2C3VA 1IBGL 4K8RC 5JQ6H 4HBCL 3DX8A 5HGHB 5IROC 4H1LA 2ATKB 4P4KD 1FVCA 2DAVA 1ZGLB 4HK0A 2J6EA 4LVOC 5CILL 3GSWA 4X6FA 4GXUM 4EXPX 1FO0L 5LQBL 2J1KA 5INDB 4UOW1 5DEGB 4YXHH 3QAZB 1L7TL 5AZEH 3MXWL 3EOAB 4D3CH 5B39B 4AIXA 4KQ3L 4XHQA 2YWZA 5GGSY 3LMJL 1BZ9B 4LF3A 2P8LA 3CXDL 2EO9A 5J1TC 1IEAA 5C86A 1I3GL 2YN5A 2YRPA 4NBZB 4TUKL 5E1AB 3UTZA 1KN4H 2DMBA 1QA9A 1B0WA 2ILLA 3LS4L 2VLKD 4EUPG 4EOWL 2H32B 5HHNB 1JGUL 3LRSA 2FLRT 3JWDC 5HY9A 4RWYH 3V5HA 5EB9A 5EDXA 3S5LA 3KPSB 4L5FL 4GT7A 1G7MB 3QIUB 3RPKA 4DGYH 2PTUA 5HYSA 3VRJA 2ADFL 1AE6H 1EERB 2BVPB 2WWKO 4P5TB 3KPNA 5LGHL 3OB8A 1UVQA 4PUBL 3OKKB 5F1SA 3RTQC 4CW1B 2HFFA 4ZUTB 4NCDA 2AV7A 3BN9D 5JQHC 1X6LA 2JIXD 5CUSL 5FO9A 1R3HB 3I3BA 1XFPA 5I1DA 4MQXC 1CGWA 4NM4L 4P9MH 4HLZH 2R8SL 1KT2B 2IFGA 4LLYB 2B0SH 1KB5B 2V2XB 2DOCA 1CGXA 1KEGH 4ZSOE 1FFQA 4XCCL 3WFCL 1DUZA 1N0LA 3K80A 5I66A 4NCC1 2P5EE 5LG1A 4C59B 1MFCH 3DROA 3HMXA 2EYTB 5TDPB 2Q8BL 2BP3A 2N1KA 1ETZA 5C8JB 4OB5H 4LVOB 3IFOB 1A3RH 2VL5A 1TPXB 1MUJA 2OJEB 2N7AA 5HHOE 1IGFH 4XNZC 3E1F1 3BEVB 1GPOL 5FIEA 3FOMB 1BZQK 3M17B 3PQYE 4JDTL 1BQLH 5CBAA 4P9HH 3QIBA 4P0DA 2DIJA 5IB1B 4V2BA 4JHAH 1TTUA 2GI7A 5FKAB 3TNNA 4JFFE 1WAAE 2XG4A 4CKVX 1I9IH 1LEKB 5SWSD 1F4AA 4G8GB 3TM6A 1JPGB 1RI8A 2EIBA 4DAGL 1AR2A 5IIEB 3IDUA 4PLJD 4EKXA 1QBMH 4WJ5A 4HXAL 4UNTA 3ARZA 2FJFA 2IEPA 4FZ8H 4OCSH 3T2NH 2CH8A 4XPFH 4N5EC 4XVUD 1WWCA 4JPIA 5KSUA 3K7UA 3T2QA 3ZKQD 3B5HA 5F3BA 4XP1H 1INQA 1AGBA 1OAZH 1HHKA 4UTAH 3M07A 3N1FC 5KSVA 1B4RA 2NXZD 2D7TH 2P8LB 4MD4A 4ODXB 1HHGB 1Z5LA 3DNKA 2ZUXA 1AC6A 1ZTXH 5HHPB 1FYHB 3BPLB 5DD1L 4HH9B 1RUAL 1E4WL 1HKLL 1ZWIA 3X13A 1QSFB 5GGSA 3L7EB 3BVNA 2ZNWA 1MCDA 4NO2B 4JFZH 1T1WB 1CXLA 3PWUB 1MSPA 5JXED 4YUEL 2R8SH 1L7TH 1PX4A 4X6CE 1CN4A 4MNQD 4P48A 4C57C 5GS2H 1KPVA 4Z6AT 4X7TA 4Y4FA 5A43C 3ULVE 2WUBH 1V3MA 5FO7A 1GGCH 2ICWJ 5E1AA 3G5VB 4DN4L 1ZANH 1DANT 2XQYG 3RTQD 1U95A 4XNXL 3TIDA 2EDYA 3UBXA 5K9QI 4PJFA 1S5HA 3C9NA 2HAZA 4JO2H 3ZT6A 5E0QA 5D7JC 5F8QC 5MEQB 4WU7B 2R0ZL 3RDTC 2HFEB 4HH8A 4ZFGL 3CNKA 1MJ8L 4MJIE 5D1ZB 4QYOB 3FRPA 3ARDD 3WL9A 1HHJA 1WZLA 4O4YL 4DKFH 1JGLH 3VGDA 4N0YL 2Q86B 3KLAB 5CMAB 1ZSDB 5HHQA 1MRFL 3JWOH 4QRTA 2A77H 1QSFD 3C5JB 3FB6B 1M1SA 2XWTB 1FG9C 4I0PB 2IANE 5EU5A 2BSSA 3F7RA 4X6EB 1R3IL 1F4XL 3G5ZB 4NWUL 3D18A 3V4VH 4J4PC 4OAWA 3WNPA 1UYWH 4XGZB 5BRZD 4KC3B 4XPGL 3HZKA 3RGVD 2NXYD 2NNAA 4M7JL 3SGDI 2D9CA 4KK8C 2LABA 3EYUL 4XP6H 4OI7A 3BT2H 5AYUL 1QO3A 4JQXA 2XNAB 3C8DA 4WVRA 5HGBA 3ZKMD 5IBLC 1T0PB 3IJYA 4OGYH 3BH8A 1FZMA 4OCWH 2XA3A 3OKEB 1M7XA 3I3EA 1ZHKB 4Z7OF 1Q9WB 3E0GA 5EO1A 4U6VL 1E4XI 4PRBB 1CE6A 3MNZB 2VO5A 4R0LC 2GITB 1FFNA 1U8QB 3UAJC 3LN4A 3EYFA 5KSBF 2NCMA 1RHFA 4ODHL 4XBPA 3LEVH 5F7NC 4M4PA 4L3EB 1M71B 3RVUC 4W70A 1AGDB 1PG7X 1JPFA 4FZ8L 1EO5A 4POZC 1V8HA 1TDQA 8CGTA 1R5VB 1ZLVH 5IW6A 3DX7B 3OAYH 4P23D 4X8XA 5LWYL 3THMH 4X6DF 2BMKA 4PJDE 5HGGS 3U4BH 1Z3GL 2J12B 2EDTA 3LIZL 4ZO9A 1KJ3H 2R4SH 3L9RB 1PG7W 1OWRM 2R4RH 1A9BA 3FONB 5MENE 5BRZB 3W81A 1TMCB 3PV6B 4WEUD 4NNPL 2YA1A 1H3PH 5DRNA 3QIUC 4EI5D 2WAHA 2G60H 3PABB 5ADPL 3O6KH 3SJVE 5HVHC 2HH0H 1CDJA 4N0FB 4X6BB 2R0ZH 2P5WB 1LNUA 1Z6JT 2NW3A 3C2AH 4PRIA 4PB9H 3D6GA 4K7PX 2YEZA 2XG5A 5EOTA 4E0RA 5GGTA 3R8BB 1A14H 3SKNB 4PP1D 1W72H 4KI5F 4YGAB 4R8WL 4WW1A 4EN3A 2MPAH 3O9WB 4DUXA 2HKFH 1NBYB 2JJTC 3GMNB 4J8RB 4A2LA 3NFPA 3MRFA 3UTPE 35C8L 3DVNA 3O4LB 3ARWA 2ITCA 2Z91B 1Q9LB 1RV6X 3TEUA 5DJDA 5TE4L 4ZOBA 1EJOH 2GSGA 3HG1E 3EFDL 2DMKA 3FTGB 4JFFD 1I7ZA 2DLFL 3IU4L 3TPUA 4XCYB 3X12A 1L0QA 1SJXA 4IOFD 1NL0H 2IADB 3ZE2E 4JZOA 4OI8A 2Y4SA 2QADD 1LO4H 4Z0XB 3GJEA 4DGYL 1GXEA 3V52L 2E3VA 3B6SB 1FIGL 2V5YA 1JGEA 4I48B 3B3IA 1A7PL 3I85A 4JM2A 2ICEA 1V05A 4PV8B 1KN2L 3DARA 1HYRC 5DC9B 3I9GL 1A6ZA 5IFHL 1MRCL 4RA0C 4MNHB 1P1ZB 4WDIB 4JRYA 5L7XH 3QI9C 2XY2A 2VISB 3WUWA 4HUMB 4GG6A 5DHXB 2QEJA 4R4FH 1IFHH 3RIFF 4Y5YA 1FVEB 1BQUA 2VQUA 4HKXB 5GZNC 4E5XB 3F6LA 3ULUL 1UC6A 3TYFA 3FQTB 4UB0H 3LN4B 3RKPA 4YZFE 3RTQA 3RL2B 3JTTA 2DD8H 5F1NA 1FYTD 4NJAL 3T3ME 3CVIH 4R4ND 3AS0A 4HT1H 4QRRE 1FZMB 4PJCA 4WWKB 1MCHA 1PAMA 5IGXH 3UJJL 2EDXA 2NZIA 3HR5A 3HPJA 5HI3C 4Y4HA 3MNWA 1R0AH 2ZSVB 5T3ZL 4BELD 1IT9L 5GHWH 4EUPH 4NOFA 2DKSA 4MAYB 3I75A 4PGJA 1RVFH 3LKQB 3DECA 4NO5A 1R3KB 1WFNA 4PB0H 4G9DB 4NM4H 5E5UB 4ZAKD 1IGCH 4R9HA 3SDAC 3PXJA 5I1IH 3QRFM 5IWLC 4CN4A 4LLWB 2CDEA 1D5IL 3WFBL 3RJQB 4DVRL 4OLUH 4JPKL 1UH2A 2IGFL 3MBXH 1AO7A 3CC5A 1LO4L 1RAMA 2HH0L 5BVJA 3ROLA 5JLZA 1CDHA 2Z8RA 1ODAA 2NY7H 3UPCA 4EI5C 2C7UB 1UB6B 3WIHH 3SQOL 3ARTA 5FO7B 1D6EB 1F3DH 1TJGH 1NMCC 3H9SB 4KMLB 4RAVB 1CICC 3IDMA 4S1QH 2C1PA 4D8PA 3FFCB 2E27L 5L0QC 5DF0A 1G0DA 3UEZA 3V95A 4ZXBD 2VMFA 1P2CA 3FQWB 3VG9B 2VR5A 2F53B 4UV7L 1T04B 3B43A 3PE9A 5DS8B 2UUDK 2VJXA 3K74B 5I16A 1KB5L 5DUBA 1R5IA 2KH2B 3V6BR 4PJHF 2FD6H 5EC2A 1MCBA 4X6DB 2QSVA 4KK9C 3ES6A 4RAVA 1U8HA 5GSRB 2VXQL 2Q8AH 1HYSC 3WJLC 3PP4L 1VFAB 3MV01 4XNUL 3QI9A 3BD5A 2G5BA 4NM8L 1S9YB 4LFHD 3EO1A 1VENA 3QXTA 1I1CA 2PW1B 5FA3A 5FV1L 1DFBH 4JPWL 2BDNH 4LQFH 4WFHE 1MIEH 4WTZA 3TO2B 3IJHB 3PWPB 1EJ6A 4Z7WE 3HFML 4KZDH 1H5BB 4I0KA 1JPSL 1KEMH 1ZLVK 1RZJL 5BXFA 4OKVA 4YK4C 1UH4A 1IAIL 3VWJC 3CZJA 1U36A 2BOCA 4IOIA 3QJHA 1I1FB 4XC1L 3ARED 4KFZC 1EEYA 5DD3H 3BZ4A 1NFDA 4UIMB 3IVKA 3STZA 1XGYH 2MQ0A 1RJYA 5IGXL 1P7QD 1E28A 3BIBX 3O41A 4Y1AB 3QDJA 4OFYD 5T33H 2YD1A 1QNZL 4M1GL 1YEKL 1MHPH 3BHBB 3CDGA 4WEBL 3VI4F 1IGFL 3PHQA 5DK0B 3UYPA 3KLHC 5F88B 2O5YH 1B4JH 3VXUA 5GRVK 5FHAL 4CVWA 5E99H 2EE2A 2EYTA 1PX3A 4RISL 1MHEB 5A3ID 3UTQB 1TQBB 3MCLH 1IGJA 2Z93B 1XR9A 3OX8B 2JK5A 3K3QA 4ODBD 4PIRF 1ZEAH 3T3PE 4H26A 1K6QH 5BS0E 1J18A 5F7HA 4U1GB 2HT3C 4LLUA 5CIPA 3KPQA 4BZ1H 4YHZL 1AHWB 5GQBA 4L8DA 3F58H 4R7DA 1PFCA 12E8H 3MBEC 3W9DA 4LRIA 1ZXQA 3GMOA 4UOJA 1RIVL 2F58H 3ZYOA 5C70A 4ZUTA 2B5IB 4MA3A 5TH2B 2PW2A 3WBDA 5ICXB 5K9KA 5I8KH 4DQOH 2YXFA 3VFOA 2NX5E 1YYML 2FATL 1OTUC 1UGNA 3V4PH 4HJ0C 5K9OB 2VAAA 4L1HA 3AMKA 5EULV 4P4RB 3VE0B 4OV5A 1AFVL 1DSFH 1I7ZB 2PO6A 1BHGA 43C9B 3QUYD 5GS0D 3X11A 3OR6A 2BOCB 4HF5H 5D5ME 1AGCB 1CD1B 2FD6L 1S9WB 2R15A 3A6CH 1MF2H 3U36A 3VFWA 1F97A 4KHXH 4LFHG 1OWWA 2A0LC 2CLZA 2BNUA 1KIPB 1QSEA 2X4RA 1M7DA 4MXQC 5DD0L 2NLJB 4K8RH 3HRZA 5D1XC 2BY0A 3P4MB 5E56A 2NY1D 1WC7B 5E8EB 4AENA 3GNML 1AHWC 1WV7T 1IEHA 1NCBH 4GMTH 5LXGH 3QEHB 4PJGB 1C1EH 2VDKH 3C60D 4U1GC 4OLWL 5BZDA 2VDNL 2DQCL 2IJ0C 1QFUH 1YNTA 4K2UH 4UQ2A 5FM4A 1VFAA 4PBXA 1CL7I 1AI1H 4KXZI 2WIIB 4ZQKB 5I18H 4HJGA 3U2SB 4KROD 4RWYL 4YFEA 1SQ2N 3MRMB 1AXTH 3RY5A 4L8SB 4DTGH 1BOGA 5D9SA 4I2XB 1KJ3L 1RD6A 4X7CC 3MRQB 2R4RL 3KYOA 5HI4C 1NC2A 2X4QA 2OQJB 4ZPVA 2Z31A 2WMPA 4AMKH 5DMYA 5CEZL 3JWDH 4P3CH 5I74B 2R1YB 4I3RH 3UPRA 3I9GH 3D85A 4UUJA 1NGWA 4JY5L 2OLDA 1D9KC 2EDFA 4EJ1C 3HLAB 1LEIB 3GI8H 4QXTB 3STLB 3KHOA 4TRPH 1J86A 3DGGA 1V3LA 4KJPD 1G7LB 2H9GA 3HRPA 3QULB 4WEMB 3SDXB 3QO0B 3W11C 3IETB 3WJJC 4PJIF 4G80A 1RULL 4M6AA 4OCRH 4ERSL 4MB5A 3O2DH 4MNQB 1DQTA 2NXZC 5DMGC 3PL6C 5F96L 3TO4C 1NL0L 1MLBB 1MHPL 5JMOC 4LIQE 5EC1A 2R29L 5DZOA 2Q8BH 4IRSA 3UC0H 3RWDA 5FUZH 3RAJH 1LP9A 3ARVA 4HFWA 3GNMH 2PCPB 4PJXF 1LK2A 2NY1C 2NTFA 2J8OA 4HKBB 4BUHA 5GS3A 3BW9B 3ZKXB 1JZ6A 3MLTB 3KR3L 2QHRH 2A0LD 5IFJB 3QEUA 1UXSA 1IQDA 4M9PA 2X4TB 3QB7C 4I77L 3GSQA 1IKNA 4MJ5B 3O3EB 3F5WA 1EIBA 1PLGL 4GS7B 4XBGB 5SV4A 4TYUA 1JK8B 2RJMA 3MA7A 1NLBL 2NMSA 4J3SA 3CFKB 1TXKA 5DI8A 4K94L 2EE6A 2CSPA 2C26A 1G7HB 3EFFB 3MFFB 4Q6IA 1CLZH 1LE9B 3MLWH 5EZJA 1U8IA 1CG9A 2ICWI 5L0QB 1QYGL 3O2DA 1WQVT 2BHUA 3VG0H 3VXNB 1HI6B 3RVXC 3MNVB 1M6OB 1JZ4A 4APQC 4TOYH 4Z77B 3PHOA 1BD2A 1M7IB 4LLQA 1A47A 4DKEL 4X6CF 2EH8L 5HSFA 5KS9B 3D3VA 4D0CB 4YUEH 5FYLE 3FQUA 3IU3B 5JOEA 3X3FH 4LCUB 2VDQH 3GK8H 3FN0L 2V6HA 4JY6A 5B21A 2DM7A 4NC1C 4YHPA 4NKQB 1MVUB 3FAWA 3E8UH 4ONHB 5JHDA 4QHKI 5JO5B 1Q1JH 1UH3A 4QRRB 2NY2B 4FXKA 4GKNB 3ZT7A 4NKDA 4F8TA 3R8QA 4NKIL 2OL3H 3QUMB 4HG4J 2I26N 3MX0A 4EI5A 5CCKL 3GB7A 1XMWA 1EEUA 4P57A 2ZOKA 4IHOA 4JM4H 4RMRA 4XTRD 5TQ0H 1G0YR 1S7WB 1LE9A 3GSUA 2J88L 1UWEH 4WWKC 2J4WH 3MJ9H 1HOCB 2WIMA 3OPZH 5MI0B 4DW2H 2EDRA 3PUCA 5JUEL 1XGRB 2VUYA 4QRRA 1JP5A 4HV8A 3C6SA 1FN4B 3EUUA 3P9LA 3LIZH 3LS5L 3QWOA 1CGSH 3KYAA 4ALAH 4MD0B 3EOBB 1VGKB 3LAFA 4KRNA 1F4XH 4MNGA 2DRUA 1DEEA 4LARH 1YN6A 4APQA 3SDAB 1QUNA 4LCIL 2YD5A 3V6FA 1YNKL 4YE4L 1X4XA 4YDVB 2EH7H 4E0RB 2AXJA 4HKBA 1N3NA 4FQQA 5HGAA 1UT9A 3EZJB 1UWGH 2W0FB 1X7QA 1GRWA 4KJQD 3FZUC 1MHHB 5BW7C 3BZ4B 2ZSWB 2NY2D 2X5PA 3VDBA 3UC0L 2R2HB 4NJ9H 3SJVA 5LVEA 3BE1H 2ED9A 4LSVL 4WCYL 3NGBB 2MCPL 1JUFB 4U1JA 5ACZA 1BBDH 1JI2A 1AQKL 4U4BA 1KJMA 3GZKA 2FR4A 5MENA 4QTIH 3O6FB 1QHPA 2DIAA 3HMXL 5FUOH 5C0AE 3QDMB 1ADQA 5F88A 2NY0C 3EGSA 3M45A 5JPNB 5EBMB 1CI5A 3QH3B 4I0CC 1BQHB 4U6XB 4XP9L 5C71A 3FT3B 3MOBL 5GGTH 5KSBB 4FQCH 4UV4H 4PRHA 1CDBA 5JDSA 4JGMA 3RWEA 4GXUN 4X0KB 3PL6B 4U3XA 5IF0A 5C9KA 4YQXL 2AEPH 3IKKA 5F9DC 5CWSA 4M1DH 1H5BA 2BDNL 4JQVA 3QHZL 3QIBD 2GW5A 3INUH 1R3LA 3MLWL 4M9OA 3ZZ1A 1PY9A 1CYGA 2G60L 5FHBH 1IC7L 3BQUA 1NSNL 3OTTA 3D87B 5ETUA 2FX7H 2WQ8A 4PJDB 3FRUB 2DL2A 2VR4A 3MLYL 4ODTH 3KPMB 5D2LA 4JR9L 2HVJA 5IESL 1UB6A 2BC4A 2CO7B 2AI0H 3O3UN 1NGWB 4D0DB 3S37X 4PGCA 1KFAH 4AZ8A 3KLAA 3MXWH 4XBEL 3W5NA 3LN5A 4U6TA 2HTKD 1DQQA 3KR3H 2E9JA 2W9EL 1BQSA 4D2NA 2CDGA 2P24B 3VGBA 2JJWA 4JDZB 3V0VB 5ILTH 2YD6A 3LEVL 2I60H 1BQLL 4I2XA 2FO4B 3SE4C 1RUAH 8FABB 1MJUL 2ZUYA 2BJML 2WSKA 1IGYA 1U3HC 4YHYB 4MQ7A 3JVGA 3KYKL 4JM2C 3KPRA 4G9FA 1XGTB 4OB5L 1F11A 3OXRB 1K4DB 3B8YA 1UA6L 3PGDB 1AJ7L 3VFRA 1A4KB 1XCTB 4NPYB 3SCMB 4BA8A 4NQVA 1RU9L 1S9XA 1TJIH 1H3PL 1EXUB 4QHLA 3H9SE 5F3HA 3QXDB 1IGCL 4I0PD 5I1IL 3T2OA 2QTEA 2VLRE 4R97C 5MHSD 1SBBA 4RMWA 5D7SH 2NXYC 1MCSA 1FNEB 3QUYB 2VZOA 4LARL 3SY0B 4ALAL 2NY4D 1AXSB 1YEFL 3MBEA 5CWSB 5DJYA 5E2WL 4YWGH 4BQBA 1N26A 1A1OA 4CMHB 4N0YH 2YK1H 2L7JA 4HAGA 4LIQH 2SEBA 4TULH 5FYJD 1NPUA 3L95B 1RZKL 2WINB 5HD8D 5C0FB 4XXDA 3BESR 3ZMRA 3HPLA 3WNMA 3I2CH 3VMNA 4PJ5D 3E6HB 1WIPA 1KIUA 1T4KA 2EC8A 3GKWH 4OZ4B 5KSUB 3HE7C 1BBDL 3ZDZF 2DQCH 3CFKA 2Z8SA 1WT5C 3B5GA 3VRIA 2DD8L 4QXGH 2PKDA 3WN5A 1CT8B 4Z7VA 1MCPH 1F2XK 5FCUH 3ZYJA 3CX2A 3GSOA 4NNXA 5GS2D 5C7XH 1QG3A 4ESKA 1MHCB 2DQHH 4WO4B 1GH7A 1KXVC 3G5YB 2IFFH 4UILL 4V1DA 5CZKA 5I8OL 2J7LA 3HNSL 1KC5L 4IOIB 1SVCP 5FV2A 1I8LC 2APXA 4Q0XH 1B9ZA 4PLOB 4WFFD 4XBEH 2NTFB 4HDIA 2QL1A 3MRRB 2KUTA 3TJHD 2EDWA 5D2NA 5KVEL 3CCHA 3WFHB 3PDOA 3VXME 5FA4A 5LGKA 5J6GA 1A64A 1CFNB 4HEPG 1MCLA 4EI5B 3MSPA 2IG2L 3FN9A 3RUGF 1LO0L 1KB9J 1NSNH 4P2QD 3BEWB 3DXAB 5C3LD 1HH9B 3H9HA 4GLRI 2DQIL 5E8DH 1XF2B 2J8HA 4KH2A 1CLZL 1S7TB 2IALA 3B9KD 3C6SB 4WTWA 2MTPA 4PBVC 4NNPH 1IKNC 5CGYD 5DDHA 4F9PC 2E8ZA 4XWGL 3A6BL 4AEFA 1FORL 4QHNB 3IVKB 3SE3C 5L88L 5ESQB 4YDKL 3QFDB 1WT5A 1IGYB 4P23C 3I6GA 5T1DH 3P9WB 1KOAA 3T77B 2BVOB 3KJ6H 3T0EB 2BSED 5I2IB 3DRTA 4CADA 3LN5B 5T3ZH 5ISZD 2DN7A 1AD9B 4FQ1L 1I7TB 3DIFB 4G6AC 4P46D 4PD4J 5C7XL 2WBJC 4QHUA 4O02H 1BLNB 3P0YH 2HFTA 3TH4T 4YHKL 3OKLB 2MQCA 2DQGL 3MV8E 4FXGA 4YDJA 1A6WL 3WHE1 2N4IA 1RZFH 5DJCA 3QEHA 5HDQL 4GRLC 3T0AA 3H3PH 5F44A 1FE8L 1SEQH 1S9VA 1DQML 3PGDA 1F4YH 4NGHH 4WHTA 2DM2A 3HB3D 5GRJH 5LAXA 1F02I 3RHWK 4NWTL 5CKAA 5EPMB 1FFNB 3AXLA 4CGTA 3ULVC 4MCYB 4OZIA 5HYFA 5ICZB 3PDDA 1VPOL 5ACZB 2EDBA 3FQRA 3WXVH 1A6PA 1LDPH 1ZVHA 5C0RH 1DBKH 4QTHA 4KZDL 5E08L 4X80L 1HHIA 1A7PH 2P48B 3O4OC 4D8PB 4X5XB 4NFDA 1QLFB 5I1AB 4U6XA 4OF6A 3LSOB 5F93C 2EYRA 1RMFH 3D18B 3FOLA 2HJFB 4U1SB 4RSVA 3T4AB 1UZ6F 3C6LD 3CC5B 4LSVH 3BUYA 3VFVB 2PN5A 4DCQB 2Z31B 2B1HH 2VDOH 4KTDH 2RR3A 2ARJQ 5E2UL 5F9WB 4QYOA 4P2OD 5HGBB 4KI5C 2AGJH 4NP4H 1UKSA 3L7FB 4PTTB 1JGVL 2LE9A 3KJ6L 4U0RB 5I8OH 4Y4KC 2XTJD 2DLEA 2ZUTA 1QBLH 4H0IA 2HT2C 4JZJA 5BVPH 4HJGB 1MWAA 4QT5A 1H3UA 1NAKL 3QUMH 4O5LL 3O3AA 5IOPB 3UZEA 3QDGB 4XP4H 5J1AA 2ZSVA 5E6ZA 3AU1A 3FQXA 1KJ2H 3RKDC 3PHQB 5DK0A 2FIKB 3D0LA 3CZFA 3FO9A 5DJ6B 5DEFA 1YYMH 2FATH 3AGVA 4X5XA 3GM0A 3IU3A 2NPLX 3LB6D 3WO4C 5IVOA 3LQMA 4D0BB 3FB5A 3CPLA 2QQNH 4PV9B 3BWUC 3U9PH 3DV6A 4V1DE 4XAKD 4OD1L 2MNUA 5IW1B 5IHBA 3FKUS 1J0IA 3DWTA 3B2UC 3WE6B 4MJIB 4G9FB 1A6AB 5I75C 4V2CB 1OGAA 4MQ7B 4UT6L 1MLCB 2PETA 4XNQA 4P2CG 3VJ6A 3RP1A 1G7QA 2EIZA 3T8XA 5MEOB 3LKPA 2P5ED 4MB3A 1KLGA 1X6NA 2DBLH 3F12B 4PFEA 3NAAH 4HF5L 3WFEL 4K23H 1F00I 4NO2A 4LEOB 3H3PL 1RHHA 2R29H 3B6SA 1JYWA 1FNGB 1ZHNA 3HI6L 1MJ7L 3QFJE 2KQMA 1GC1C 1OGAE 2GTZB 1IQDB 4YLQT 1T21B 2DTSA 5BMFL 1WUNT 3KYKH 1CFVH 1TCMA 1YPZF 4URTB 3TN0A 2XXMB 3CU1A 3VH8G 3VD7A 3KPRB 5J12C 1QSFE 3RWFB 1ACYL 4XCYA 5HHXH 3ZTJG 2AQ3A 5CJQL 2AQ1A 1K9TA 2YA2A 3OV6A 2CGRH 3U1SH 4Q6IB 2B0SL 4QXUL 1A6VL 1SJHA 4ONHA 5T1MB 4IRZL 4C56B 3QUKA 4U1SA 1AXTL 3QA3B 4X4XB 2D2OA 2AJUL 3BN9C 1I4FA 2ITDA 3QCTL 2ZUSA 3WN5B 4R7DB 2VH5H 5IR1B 4PRPA 2NY6D 1X3DA 2AJVH 5C3TA 3AUVA 3LKOA 3CCHB 2ZG1A 4WO4D 3CVIL 4GRLD 5DGRA 4DEPC 3O6MH 1RZGB 2IBGA 3MUHL 3VDCA 5EO9A 4HDIB 2FH8A 5C07D 1QO3B 5DFVC 4ZMAT 3JWOC 4GAYB 3UTSE 3LN9A 3CXDH 3LKQA 2GJ6B 2XN9B 3PNWB 5FYJU 3KPNB 5DSCB 4YNYA 3MLSL 3MGOB 4P2OA 2NQCA 4UDTA 2I9TA 5H37G 3L3GA 3MRPA 9CGTA 4QXTA 1JI1A 2HA1A 2XWTA 2PXYC 1G0XA 4R0LB 3QUZD 1TVDA 5DVMA 4L8CB 3L6FA 4PJFF 1JYXA 2W0KA 5B8CC 4HHAB 1F58H 3SQOH 2IH3A 3IFNH 2DKMA 1DEEB 1S5IH 3HRZB 1TJIL 2J3SA 5DSCA 3IB4A 3QUKB 2J88H 3O6FA 4LCWA 3EOBA 4U33A 2DI9A 1FH5L 3UJIL 1U8HB 1A4JA 2HVKA 4PY8J 2BVEA 5D7KD 2OCFD 1MNUH 1AXSA 1KCVL 3HC3L 4HS8L 5D93C 5JA9A 1FNLA 3AREA 3T0EA 2UWEB 3U46A 4M03A 1SVZA 4AEIL 2ZSWA 3T0WA 4K3JL 4Y4FB 2B4CL 4JB9L 4Y16A 1KELL 4WENB 3KPSA 3N0PB 4RWHA 1C16B 2COQA 2RFXB 1EFXD 3IETA 3LMJH 3VD3A 4PS4H 5H35A 4PTUA 4J2XA 4YDJB 4EVNB 1WZMA 1X5JA 2M26A 2VXTH 4NQCB 1CFQB 3LKNB 1YPZE 2O93L 1CVRA 1PQZB 4ODVL 5IP4A 1NGZA 1CFTA 1FV1A 5FXCH 1L9NA 3QPXL 4I9WD 1I85A 4J1UA 3QDAA 4Z5RB 1V3JA 4RAUA 3QQ4A 2FO4A 5IVXA 3HI6H 2N56A 1CDGA 5HDOA 2FCBA 1HQ4A 3MRGA 4IRSD 5ID1B 1J11A 3WN5C 3VXOB 3BSZL 1T21A 2Z91A 1RZKC 1BFTA 4MCZA 4D0DA 2E7LC 3P4NB 3DURB 1U0QA 4QOKE 5DHVB 3GJFA 5K9KB 3U7WH 4OCSL 3T2NL 4JKPH 4U1IA 4I5BA 1WCBA 2FB4L 1YEFH 4K3GA 2A73A 4P5MA 1I7RB 3LPFA 4MJ6A 1MRCH 2EEAA 2XYCA 1YEGL 5ELIA 1XF4B 2XRAH 1E28B 5DQJB 1RJYB 3RZCB 4LP5A 1BD2B 1IGTB 4XBGA 4NOBA 2P5WA 2DQFB 5FHBL 4WI8A 1GZQA 5B38A 4TSBH 3KAAA 3MZGB 4L9LC 3Q5TA 5T5NG 1OOAA 5ITFB 2PXYA 4RNRB 4Y4FC 4Y5XB 5ANME 1U8KA 1WICA 2YBRA 4ZAKA 4KV5F 5DHVH 3ZO0A 4WI9A 5F3BB 4ZDHA 4PGEA 1JZ5A 2OR9L 4OI9A 3D0LB 4M6NL 4H88H 3VA2C 4Y5VC 1RURH 5ECJE 1XF2A 3QDGD 2MCG1 2Y6SD 2OSLB 3RI5F 4NQVB 1EUTA 3WJJA 3FL7A 1JBJA 5C0CA 1CF8H 3ALPA 5AWNL 3WO3B 4H26B 1QSZA 3SGDH 4PB9L 2OQJA 3BIAX 3RVTC 3MGTB 3WHXB 1IGTA 2YUZA 4PP1C 4YDIH 2CIKA 1FH5H 3UJIH 1B2WL 1JTOA 4DQOL 1NFDE 4JM2F 1RK1B 4KRPD 1XZ0A 1JHKL 4M1DL 4OUUB 4G6AD 3ZTNH 2ITCB 2OMBA 3P4OB 2AEPL 2C1PB 4F80A 1RUPH 1ORQB 3FT2A 1NGZB 2JB5H 4XNYL 5GRYA 3IKCA 1G7LA 3QULA 1PQZA 1RHHB 4GQ9H 4GXVL 4UBDC 4LVNB 5SWZE 3ZDXE 3ZKSD 5E00B 4C83A 2BSSB 1ZHNB 2R69H 2V2XA 4F8QA 3JV0A 2YN3A 4K07A 3ROLB 3MA9L 2DLHA 3HZMA 5HHMB 5HTSA 1MCJA 3ARGD 3ALWA 5F9WC 2FBJH 1G7PA 1NC2B 1HQ4B 5TQ2H 5DUPH 2X4SB 3GB7B 1R6VA 4GJTB 4BSVA 3S35H 4JHWH 3KS0J 3O8XD 3CU7A 4PJCF 4QXGL 1HEZB 1XGUA 3ARQA 4Q6IC 3IFPA 1YEHH 4J8RA 4TTGA 3PV6A 4NSKB 1PZ5A 3L5XL 3L3HB 3QZWG 1FL3A 5EU6E 3MCKB 4LNVA 3TN0D 4G8GE 4OTXH 1F4WL 2IGFH 4KTEL 5GJTL 1UM4H 1BOYA 5DI8B 1CD8A 3T0XA 1FCCA 3DX7A 1HNGA 4LASH 5KANG 5MEPA 4YXKH 1UENA 3U7YH 5D4QA 5C0JB 2VERN 5GSVA 1P7QA 1DBJH 4L4TA 4NWUH 3CZFB 3FO9B 4KK8D 4JREB 4Y2DD 5HYJD 1TETH 3UYRL 3VXPB 3UCRA 4QXUH 5EBLB 1A6UL 2ENSA 1HH9A 3H9HB 5GPRA 1AC0A 3BGFC 5CJOL 5E2VL 3GO1H 4IRJB 1VFBB 3O81A 4Q2ZB 4L3CB 5JNYB 1MVFA 4Y5VB 4LCWB 4JPWH 2X4NB 4OZFB 3WHXA 4F15B 2H41A 4AEHL 4QO1A 2OR7A 3QFDA 1TENA 2XPGB 5D7IA 1JWUB 1H0DB 3GHEH 4AH2A 5FM8A 3GEWB 1D5BA 1WBYB 3IJSA 2BNRB 5HYQB 4NKOB 2H9GB 4PYGA 4XNUH 1K4CA 4NC2B 3NMEA 2VTFA 3FOLB 3STLA 1U8NA 2HJFA 1QFWH 2XACC 3VFNB 4HJJH 3TBYB 2XZZA 3RL2A 2DBLL 1UKQA 1VESA 3FHQA 3G6JB 1RK1A 1EHAA 2CXKA 4NKMB 2VDQL 1H0DA 5EC1B 3F6IA 5I1AA 2IFFL 3AY4C 1IAKA 4YBQD 3VXRB 1QZ1A 1JPSH 3S3SA 2X70A 1P9MA </