3BD5A

Crystal structure of single domain vl of an anti-dna binding antibody 3d8 scfv and its active site revealed by complex structures of a small molecule and metals
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
LVMSQSPSSLAVSAGEKVTMSCKSSQSLFNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYYHMYTFGSGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords catalytic antibody
publication title Crystal structure of single-domain VL of an anti-DNA binding antibody 3D8 scFv and its active site revealed by complex structures of a small molecule and metals
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bd5A00
5HHNA 4J3WA 2E9JA 3ZKXB 5JW5A 4DKEL 2R2EA 1OOAA 4RMRA 2GK2A 5IQ7H 1FGNL 2BRRL 5AYUL 2HG5B 2ZUQC 3CXDL 3V6OC 4Y16C 2XQBH 3Q2CA 1OSZA 4NZUH 4P9HL 4NC1E 4FFVD 2VABB 1QSED 2A6IB 2Y06H 1YJDL 2JK5B 5IB1A 2H6PB 5ITBH 2HRPH 4AIOA 4DAGH 5IV2B 4L4VB 1T1WA 4H5SA 5L8KB 3KYMB 2SEBA 2IADB 4HH9A 1YEKH 1RIHL 4DKFH 5K9OA 4AEIL 2AXGB 4HKJB 2AV7B 3JWOH 5EFIB 4LPXA 1Y18A 1T6WA 5F88A 2Q8AH 5D96B 3TT3L 2VZOA 3HA0A 4YXHL 1F2XK 3VFWB 1XMWA 1MQ8A 4ETQB 2H3NB 1ZS8B 4RMSA 4TVSa 2GAZA 4I3RH 2DQUL 3QPXH 2VE6A 4RISL 1FG2B 4NBYB 4DKDC 5I1GL 4MVBC 5ANMB 3SHSA 1Y6KR 3V0VB 3ECBA 1EEZA 3FT4B 3LHPH 4PGBB 1H3PH 1UJ3C 3TVMC 1SM3L 4PRIB 5I76B 5ISZA 3FHQA 4JM2C 1YPZE 1I1AD 4BSWB 4FQCH 4JN2B 1ZGLP 4CMHC 2IPUG 3CXHJ 2CGRL 4JHWL 4A6YB 3D25A 2VZVA 4OB5L 4U6VL 4J6RH 2LE9A 3P4MB 2A83A 4MDJA 2E7HA 4LCYB 5EU4A 4BH7B 5B8CC 5ITFA 3VG0L 2HTLC 5FA4B 2I60L 4YNYA 4DUVA 3MJ6A 2DI9A 2MKWA 3L95A 4RA0C 2DI7A 2CQVA 1ZKAA 1OD9A 5DR5H 1IM9B 2EIDA 3TO4B 5HHQA 4KH2A 5SX4I 5D93B 1MY5A 1XZ0A 3EYVB 4OCWH 2NY0B 3X12B 4Y5VC 2DQCH 4L8DB 5DEGB 1A6VL 3VXMD 4HPYL 3RBSA 1FVCB 5D1XD 1U3ZA 2CDFB 1BEYH 1CE1L 4R7DA 3HPLA 3RGVA 5I1CL 1N5YL 3TJEL 1NJ9A 2DQGL 4LPTA 1N6VA 5DUBA 1D5IH 4M1CD 1JYVA 5JZ7D 5JOFA 4JN1H 1RZJL 3D0LA 1AGBA 5B38A 4ZXBB 5CEXA 4LDEB 2LVEA 5KG9B 2HKFH 1JZ7A 1SJEB 3C9NB 3EFFA 4NNYA 4X7DC 2JJSC 2VXVH 4XPAH 5AG9A 4NQCE 4HWBH 1XGUA 3RUGF 3DYPA 1OM3H 3WFEH 2Q6WB 2NY2C 5E95B 5FGSA 1KGCD 3KDMB 4Y2DA 5CSBA 2E7CA 2XY2A 3GKZA 2HH0L 1MAMH 3BYTA 2C1OA 3SDAC 3AB0B 2ADJA 2ZUYA 1H8OA 1T2XA 3WN5B 3HAEA 1ACYH 4YQXL 2V7HA 4P3WA 1UCBH 3VFMB 4HT1L 5DEZA 3QI9D 5KBNC 4OZGB 3OX8A 5DJ8B 1WTGT 3UTTB 2NXYC 1XIWD 5F8QC 4L3AA 5FM5O 3RWDA 1DBJH 3CIQA 5CCKH 2VDMH 3PP4L 1Q94B 2X4NB 4JKWA 5DHVA 4WCYL 3VGDA 1P9MC 2RHEA 5IJVB 3T4AB 2R15A 5DJAA 5JXED 4N0FB 3P11H 2W9LA 2VDKL 3NFPA 4LGSB 4ZFOA 3O9WA 1KTRL 4KTEH 2RFXB 4ZD3L 4CVUA 4N0YL 2NY6D 2DIJA 1EMTL 3LS5L 4G9FB 3HZKA 2AK1L 4WO4B 3PL6C 1FZKA 4I5BB 1B4JH 4EDWL 2AGJL 1QOKA 2VAJA 1SJHA 1GH7A 1JF5A 3F62A 3PG2A 4JZNB 2ARJQ 3T65A 5IVXB 4PJIA 3U46B 1U3HD 2IPKA 3BUTA 1BQUA 3GNML 3TT1L 1YEIL 2ICWB 2BVEA 5HYJD 2FJGA 1QSFA 1VSCA 5C09E 2R0KH 3T1FB 3S97C 4U05A 4GKZA 1QLEL 2XN9B 3QEQD 4F7CA 3S36X 2L7UA 1MJJA 4GW1B 3S37L 1H5BA 3NMEA 1GOFA 3PWVA 1CS6A 1RJZA 5LBSL 4N5ED 4IIQA 2H2PD 3RZCC 1WJ3A 5GGRY 3S96B 5KVDL 2NZ9D 4QRQA 5DUPL 1UADC 4NT6A 4YHZH 3HNSL 4G8FB 1F2QA 1IAIL 4PFEA 5GS1A 1MFDL 3VW3H 1HXYA 1LVEA 1T04B 1OAUL 1GSMA 1BGXL 4FQXD 4H8WH 4LVHB 2JB6B 2P5EE 3BPOB 4NO0A 4GJTB 1ED3B 3CVHB 4BUGA 3C08L 3KXFD 4YBQD 3U6RA 4JZOA 2JCCF 1RUPL 2I07A 5IHUL 1MWAA 1KCLA 1KBGL 1RK1B 4ZUUB 4XCYA 4XVUD 2DQEL 3CFBB 4Y8DC 4PGJA 1ZT7B 4UAOB 4XGZB 2YPLD 2AJ3B 1EX0A 1TCMA 3I3DA 3MJ8A 2JTDA 5FM8A 4XP5H 1D9KC 3VGHA 4R4BB 1A9EA 1A1OA 4HGKC 3CNKA 4XNZB 3SCMD 1FNSH 5HHME 1KCSL 4PV9A 4FP8L 3G6DL 4HJJL 3ZT6A 3C6LB 4P46A 5J13B 5SWQA 2F54D 1AXSA 4M7JH 3ZE1F 2EH7H 2P7TB 3Q1SH 1MVUB 4I8DA 2GCYA 3HR5B 4KROC 4XX1E 4DEPB 3IFOB 4YFEA 2NY3B 3LH2H 4HMDA 4DZ8B 4WRLA 4NWTH 1A8JH 1ZHKA 4Q0XH 3RL2A 3NA9L 3D5OF 3V9FA 3GO1H 4I13B 4P2RB 5CZVL 3I84A 4K07A 5HPMB 5MERA 1JCKA 1I3RA 5F96L 2BMKA 3H3KA 5E1HB 3W39B 1G7QA 1P84J 2QQQA 3P40A 5CLWA 1TENA 4TQEL 1JZ6A 1NFIA 2L0DA 4IJ3B 5CGYC 1YNTB 3SE3C 1Z6JT 4MAYA 1INEH 2K7PA 2ADIB 3EGSA 3IETB 4FQLH 1EFXB 4MZ2A 3V6OA 4Y16A 4QRPA 3F7YB 1N0XH 1FNEB 5C0BB 1GCFA 4HIHA 4Q74A 1BD2B 3LV3A 1TITA 4QHMB 4ZO9A 3GSQB 2DKMA 1R3KB 2I9LA 3VWJB 2BVOB 4Y4KD 3QZWA 1WFNA 3BYYA 2C5DC 2XQBL 5IESL 2R2HB 3MREA 5JLZB 4HKXA 4NO3B 4R8WH 4RGNC 1DQDH 5JXAH 1ITBB 2Y06L 3HFMH 2Q7YA 4X8XA 1OP3H 4FXGA 1W0WB 3QAZC 1T1XA 2ZPKH 3FN3A 3RDTA 4EEEA 5EUOE 3QO0A 4JCLA 4NHCH 5IMLB 1UJ3A 4JO2H 3TVMA 4DJMA 3SE9L 3MFGB 4ACPA 1MRCL 1XFPA 5HDQH 3V4UH 1BBJB 2E9IA 4NP4L 1D5MB 2R8SL 1F6FB 4JREB 4LLMA 1RZGA 1LEIA 1FO0L 4PGDB 2G75A 2Z93B 1NAML 3PQYE 4UB0L 3U4BL 4F7PA 5IT2H 1BIIB 3OKDB 1XCTA 2IPTH 5D71H 4FQ1H 1EHLL 1F00I 4IRZL 4K8RH 5LJYH 3RP1A 5B8CA 3LHPL 1DDHA 4LLWB 1NPUA 3DARA 8FABA 3ZYOA 4PRIE 2A1WL 2ZWLT 1G7JB 1FNGA 1GZPA 4YE4H 1OPGL 4M7KL 2BVPB 3QIWD 5FO8A 4UNVA 2VXSL 4MD4B 4CMMB 3MRLA 4OM0L 2WINA 2CRIA 1EGJL 3DO3A 4EKXA 3LEYL 2WAHA 1TJGL 2ZG1A 3RNQB 2ITCB 1BMGA 1T80A 3O11A 1PD6A 4HHAB 3A67H 5F3HB 4U3CA 1FH5L 3ARDA 3MLWL 4AQOA 3S9DB 5HHOB 4X6DB 3VRJA 5H35A 1U8KB 4YC2C 4Z7WF 2DQCL 5IMKB 3MCLL 5HGDB 4I9WD 1HI6B 1D5XB 4LSSH 2OMNA 4HFUH 2JJSA 3NPSC 3VI4E 5JQHC 4N9GB 4ZPVA 5IQ9A 3HN3A 3RGHA 1LILA 1CXKA 3DX9B 1CFTB 5J1AA 1CQKA 1UG9A 5D6CB 2H32A 2VO5A 1JGEA 1DN0A 2IFGA 3U30B 4JZJB 3IKCB 3QUKB 2WV3A 4XHJC 3MV9B 4PJFA 1HEZB 3GMLA 4JKPH 3C5JA 1WBYB 3H9YA 4APQD 2VTFA 4M6OH 4FZEL 1GGCH 2W9EH 2E7LC 1A6WH 3FQUA 3PGCA 5FECB 5FKPA 1OM3L 4JFEB 2A38A 2R0LH 5FK9A 3GB7A 1IMHC 2A6DA 2OSLA 2NYYD 3ARVA 1Q9KA 1MAML 4UZGA 3BH9B 3PE9A 3RAJH 4PG9B 1U95B 3MBEA 1YMMA 3FOMB 2BHZA 3QQNA 1QTYT 1T21B 4MLIA 5DYOB 4WHYH 1BX2A 3KYKL 2D7QA 1XGYH 3EYFA 4HC1L 4OIIH 3CGTA 4WI8A 3DRQA 4P5TA 1KFAH 3QDGE 1QBAA 2UWEA 3KPNB 2VLRE 4FXKB 5F7EH 4NCC2 1AQDA 2P5WE 5DK0A 1NGQH 2VLLB 3LKOB 1LEGA 4OZGE 5BMFH 3ESUF 3B9KD 3DV6B 3K0WA 4UT9L 1PW3A 2QKIB 2WBWB 1QNZH 5B21A 3ULUD 4OD3H 4QEGA 1LO3H 2IH1B 2CH8A 2V5RA 4RAUA 4OLYH 3GSUA 3FL7A 5DJDB 3M1BA 4QT5A 4YDJB 3FO1A 1URLA 3QQ4B 1T0MA 5F9DC 5KJRH 5JW4N 2NY7H 3L7FB 4LSPH 2GK0B 3IJHA 3PL6A 1IBGL 2DDQL 3WD5L 4TNVK 4G6JL 3MRCA 5I74C 3VXRB 4ZDHA 2Y36H 4NM4L 2LTQB 3ETBF 3U9PH 1H0DB 2O5XH 5IVNA 1GYAA 2VKXA 5AZEL 4OLXH 4PJDB 3SKJH 1AGEB 5ADPL 3GDBA 3MA7A 3KPSD 3T8XB 3VMOA 1T7YA 3KR3L 1AE6L 4P23D 4X4MA 2VXTH 3RZCA 3HRZB 3TBVA 2Y9RT 3BGMA 1WC7A 4R96A 1L9NA 3MJ9L 5D2LB 4UUJA 1FO0B 2R0KL 3C8HA 4TUOA 1J1OL 1NCCH 5FOBA 2XNAA 2NNAA 4NSKA 4N8VB 4HPOL 3ZMRA 2R0ZL 4NZTL 2DQHH 1S7VA 1ZHNB 3HI1A 5C0DA 3ULSA 4OGYH 5ALBH 1ORQB 5ALCH 1PVHA 3ZHDA 1I3VA 2PXYC 2XICA 1EVUA 1I9IH 2A73A 3VW3L 1KG0B 2EDRA 2OL3H 5D5ME 1FLRH 1U91A 2VR4A 5BQ7B 3MNWB 3F6LA 5I8OH 4KQ4L 5TDPA 4PRBB 5F6IB 2ZUUA 4NRZB 2FIRT 4WHDA 1ZLSH 3RI5F 2I25N 3C60B 5K9KA 3GMOA 43C9A 1DEEA 3CFDB 4Y5XC 4QXWA 5F1KC 5ERWB 4L3CA 3H8NA 1RK0B 1NLBL 1FBIL 3NACL 4OCYH 4NFBA 1LMKA 5HHPB 4PV8A 1VACA 4P2OC 1TTUA 3BZ4A 4CVZA 1JRHI 5E2WH 3B3IA 1RVFL 3EO1A 3LKNA 5IF0B 5FFLA 3UJIL 5DDHA 5SWZE 4BFIA 1MFCL 4YGAB 3HE6D 3SPVA 2I5YH 4MLSA 3TM6A 4QF1B 5TQ0H 1U8NA 1G9ML 4PJBB 5FUZH 4ODWA 3VFNB 2P46B 4FFYH 1T0NA 1KELH 1WSST 2IBBA 5T33H 3OB0K 3F12A 3L3JA 1WF5A 3QDJD 4PJGF 5HVHB 1NBZB 3LH2L 1QRNB 3CC5B 2W92A 4JPKH 4JY5L 5JMRA 4Z7UB 5C6PB 4I0PC 1IGYB 5C0GA 1RZIA 5KANG 2I9TB 1G7LB 2I24N 1F90H 3C6SA 2D0GA 2VYRE 2BY1A 3QWQB 4G6ML 3DX8A 3RY6C 1C08B 3W0WB 5A16B 4KVNH 3QG6A 5C07B 4OGXH 3MUY1 1MCWM 3VGEA 4R26H 1AIFB 4NM8H 3UBXA 5KAQF 2HT2C 4PJ5D 2HT4C 3I75A 4JFYB 4OZFA 4FG6D 1EDQA 4EQ2A 2AERT 3DBXA 4MNQA 2NY1C 4QOKA 5HGBB 5F89A 3QUZD 4MXQD 2ICCA 5C0BE 3QUMH 4V1DD 3O2WH 1A7PH 5FEBA 2ZJSL 2AJYL 1GZQA 1E0OB 2XA8H 1A3RH 3EOYG 1VENA 1HN1A 32C2A 1EEYB 3SKMB 4J4PA 4GQPH 5GGTA 5E8OA 3WFZA 1PFCA 4WU5B 1S78D 3WEXB 4ZPTB 3B6SA 4RFEA 2FRGP 1E6JL 1FYTB 1R3LB 3WLBA 3SDXA 5JOPD 5E5UB 2P47B 1R5VA 1FCCA 1X5KA 1J8KA 1QHPA 2R2BA 1XH3B 3EO0B 4FRWA 1KCVL 1VFBA 2FH6A 3A6CL 4MJ5A 3ULUF 2A9MH 1PG7L 5C09A 2XZQL 1YECH 2IANA 3VRIA 1BF8A 4E41A 3JTSB 1G84A 3MC0A 3JWDL 1YN7A 3GSWA 2UZIL 3ELAT 1U9KA 2DM7A 4WO4C 1FORH 1VGEH 4C4KT 5D7KE 1EERB 3MRHB 2X4QB 4LCIH 4DW2L 4M3KB 5IVZB 3WIHA 1NMAH 4JFFD 3UJJH 3EOBA 4PR5B 2B2XH 1GOGA 1BJMA 5CD3A 2ZOKB 4W68A 1JPSH 3MLSH 1CFSB 1T7XA 1RURL 4QLRA 1MCKA 1W0VA 1AKJB 2C1PA 2JE8A 4ZQKB 2FCBA 5KSAB 4XC1H 1VCAA 4WW1B 1I85C 43CAA 3TIEA 2ESVE 5IHZA 2DKUA 3JTTB 4XNYL 5C9JA 3I6GA 3LS4L 1MCPH 5IK3A 5FIEA 1MVFA 5L2KB 4PJ9D 4RFNC 3QQ3A 1WFUA 4I77H 3TYGH 1JP5A 3QISA 1CLZL 3OAUH 4WI7A 4FTVD 1Z3GL 4R3SA 5C92A 4NKOB 1S7TB 3KLHC 1HQRA 4MA3B 1KXVC 3H9HB 5JR1L 4KDVA 1P7QB 1BOGA 4GAYB 3TBTA 5L8JB 4LSSL 2VDRL 2C3GA 5DZLA 1ZWIB 5HPOA 2LABA 5DQ9B 5HHXL 3F7QA 3AMLA 4OZHF 3MLUH 5IB3B 4UAOC 1MCOL 1CG9B 2VDQL 2W9DH 3HMWH 5DT1L 3S3SA 1EK3A 4LP5A 4OLWH 1I1FA 1NC4A 4KI5D 3X14A 4XNZC 1VDGA 3GMNA 4LLVA 2C7UA 2FJFA 1VPOH 4C59B 3VXSB 1IAKB 5J11B 1CDCA 3FQTB 3IGAB 5GJSL 3STZB 5I1EH 1HYSC 5C0AD 2BY2A 2FX8H 3CK0L 2IBGA 4U1GC 1XGTB 4MXVF 4XNUH 1TZGH 3NN8B 5TH2B 2D31B 4E0RB 4JFEE 4P3DB 1QPPA 3ULVD 3ARFA 1IZKA 5GZND 2CDEB 2ICEB 3Q3GB 3ZDZF 3BWUC 4LIQL 4PGCB 5TDNB 1JTTA 1DN2A 1A6ZA 2ITDA 2UVFA 3DSFL 4X5WB 4X99B 1MRDH 3G5VA 4ODUA 5DD6B 5HI4D 5EBWB 4GAGL 2DYPD 5C0EA 1ZA6A 1JNNL 3BIKB 3FB8B 2JKXA 3RWJB 4LSTL 1RU9H 3H9SA 5MP6H 4JFPA 3BP5B 3MNVA 3OXRB 4U1SA 2FEDD 5DD0H 3ARXA 1L6ZA 1IGML 3BISA 4JFZH 3GUTB 1F5WA 4X6BB 1RZKC 2F74B 4XC3L 1QQDB 2VITB 3RVXC 4ONFH 3F58L 3HG1D 2HG5A 4OZIF 3QDMB 4J3TA 2CIIB 1NFDE 3E2HC 1CXEA 4XXDB 1K4DB 4Y4FB 4JFOB 2VABA 3RJQB 5J3HD 2EKSB 2PYEE 1A0QH 2K1MA 3GGWB 2JK5A 2OLDA 3ZHKA 2H6PA 4RFOL 5IV2A 4L4VA 1IC7H 3KYMA 2DBLH 4JFHD 2IADA 3LQAC 2AXGA 2WBJD 4HKJA 3LB6C 4R4FL 2AV7A 4LCWD 5EFIA 2XQYG 1JUFB 4HUWB 4POZD 2EZ0C 5DXWA 2YRPA 4YBHA 2NPLX 3G5XB 4XWOC 5CWSB 2DWDB 3QR2A 1NGPL 5IB5B 5DJYB 3VFWA 4QNPE 1DBMH 1JRHL 4HQQL 3RIAK 2H3NA 4ETQA 1ZS8A 1ODAA 1NBVL 4TSCL 4O9HL 3BGFB 1FG2A 4AY0A 5ANMA 4NNXB 3V0VA 3HNTL 3FT4A 2W65B 1TJIL 4PGBA 3MRJB 4LOUC 2B5IC 4PRIA 2E9BA 5I76A 1WIPA 2QQLH 2JIXB 1GAFL 5D7JD 4BSWA 2GFBB 3ARGD 4JN2A 3MRGA 5JUEH 1LDSA 4A6YA 1DE4B 4QXUH 2FX9H 4QWWC 3P4MA 2BFVH 5D7LB 2BNQA 1KEMH 4BH7A 1T66C 2XTJE 5FA4A 1SYVB 3I3BA 1E4KC 3O8XC 1F11B 3KPRB 5DVMA 4XPFL 5AZ2H 3WNOA 3LN5B 5T1LB 3FB5B 3UO1H 1IGCL 4G43B 1FFQA 1IM9A 2FECI 3TO4A 3QUXB 3PNWB 4M5YL 5GHWH 5I1LB 5IFHL 3EYVA 3X12A 2HWZH 3GRWA 1C1EH 4KQ3L 4XP9H 4P2OA 4XVJH 4L8DA 5I15L 5LWYH 5DEGA 2DJSA 4Z7OF 4TULL 3KJ6L 1FVCA 1OAZL 2CDFA 1IQWH 4K94L 5C0RH 2V2WA 3M45A 3O6LL 3VU2A 1MFBH 3GI9H 3STBA 5C08E 3TNMB 4NJ9H 3D6GA 1MAJA 4CAGA 3OGCB 3VGGA 4KJQD 4ZXBA 1E4WH 2BVTA 4CW1B 1KN2H 5KG9A 4WFFD 1CXIA 4HK3N 4PJHB 3TA3C 1SJEA 1KLFA 3C9NA 3OKLB 3TH2T 1R3IH 3B8SA 3L6FB 4TRPH 2R4RL 2EYTB 2Q6WA 3WUZA 4ODTH 4K9EC 1OQXA 3KDMA 2OR8A 3CSPA 1DQTA 1UFUA 4S1SL 3QWRA 4IDJL 3RRQA 4LEXL 4GQ9L 3RBGA 1YUHB 1HH6B 3QULB 4LHQB 4U4BA 4JDVB 1QRNE 1JF6A 3T3MF 5ISZD 3MLPA 2E6JA 5BOPA 1JF1B 3AS0A 1I75A 1QZ1A 4YDLC 3VFMA 3SQOH 4OZGA 5CEZH 3DO7B 2MKLC 3OHXA 3RUGE 3UTTA 3L3HB 3JVGC 2FB4L 2X10A 5IMMB 3CXHK 2DN7A 4QGTA 4QRUB 4WFEE 3Q6FB 1KXQE 5SV4A 4R26L 4Q97A 3BZDA 5I8EB 1INDL 4L3EE 4KI5F 5DMKB 1FG9C 1Q94A 2X4NA 2Y25A 4LVNC 4Z95L 5E9DE 4L8SB 4FFZH 3W11C 3SE4A 1KNOB 5IJVA 3T4AA 3WS6A 1CU4H 4N0FA 4EQ3A 5DHYB 5FB8A 3FFCB 1XGRA 4MNGB 3CU7A 1U42A 4NJAH 3SO3C 3ULVF 2J8UF 2RFXA 5GRUH 4KRPD 3RGVD 2AJSH 4G9FA 3LEVH 3MLRL 1PX3A 3QBTB 4TTGA 4KU1A 4WO4A 5KSBF 4YO0B 4I5BA 2R2CA 2ZCLL 2YC1A 1KCRL 1C5CL 2IJ0C 4JZNA 5IVXA 1F8TL 2CMRH 3U46A 4NOFA 3BN3B 5BS0B 1X4ZA 4XMKL 1I1YB 1N8ZB 2ICWA 3LIZL 3T1FA 2R29H 1CGUA 2AK4E 1QFWI 4Y2DD 2K9UA 3ULUL 2XN9A 3VXUE 1X5LA 3HE7C 2NW2B 2DQDH 3OJ2C 1IE5A 1P4IL 1I85A 3JWOC 4GW1A 4KK6C 4X7EC 4LCIL 5J1TC 4UDTB 4XVSH 3L1OH 3ABZA 3S96A 3KLDA 4HGMA 2COQA 4YHOH 3D3VB 2Q86B 3DVNB 3GHEL 3Q5TA 4G8FA 5HVFB 3AAZB 3NH7L 4XCNB 1ZOXA 1T04A 2HLAB 1NCAH 5IBLC 4KKAD 5D7IF 2J6EL 2JB6A 1JGUH 4NGHH 2R23B 5FGBA 5HYQB 1ED3A 1QSEE 1U8JB 3CVHA 3MACH 4HUMB 4PJ8B 1IKNC 4Z78B 1OTUD 1EO5A 4OCSH 2HT3D 2E8YA 1IGFH 5HI3C 4N8PA 2V7NB 4OSUL 1CDYA 4L5FH 4ZOCA 5L2KE 3N9GH 4Z0XB 2OL3B 1RK1A 4ZUUA 5CINH 4S1RH 3DX7B 4X7SH 3CFBA 4Z8FL 1IRAY 1ZT7A 4ZUTB 3VFTB 5FF6B 4XGZA 5KS9F 5F1SA 4DKAA 1DSFL 1Z9SA 2AJ3A 1A6PA 1JNLL 1VKXB 3WJJC 4UDUB 4R4BA 5F6IC 4I3SL 2ZZUT 7FABH 5L0QC 2GITB 4AT6B 4ZTPH 2NXZC 3KYNB 4P5MB 3C6LA 3K80A 3EZ8A 3N1QC 3EHBD 4N0UE 3G6JF 4WVRA 3REVB 2P7TA 5F93C 3A0OA 1CGXA 3S5LB 1QBLH 2W9DL 4ZNEE 5JO5B 3HR5A 3O0RL 4GT7A 3IFOA 4DZ8A 3O6FC 1CICB 1FSKC 2C4FU 2BXZA 2WSKA 3ZE2F 3ZTNH 1QSFD 5I75B 4O51A 4P2RA 5HPMA 5HYEA 5I6XC 4IHOB 3GMQB 3W39A 2UYLB 1WEJL 1OVZA 5CZKA 5FKAB 4MQ7B 5GXBB 2BNUB 4D0CB 4Z7QF 1YNTA 2YKLL 4KHTH 2EDXA 5HI5D 3GKWH 1D6VH 2PF6A 5GRJH 1BVKB 1TVDA 3UCRA 3RY4A 4HCRL 2ADIA 3IETA 3SDDB 1EFXA 3PGFL 1NANH 3FO2B 3TZVB 1RD6A 2BVQB 3F7YA 5GGQH 1ZAGA 1FNEA 2XACC 4WI4A 2EIZB 2R9HC 4NO0D 1BD2A 1NLDH 4QHMA 4KAQL 4OJFL 1HKFA 2BVOA 2VB5A 2MNUA 1HNFA 1Q0XH 2FECL 3P4LA 4OLUL 3O2DL 2R2HA 5JLZA 4YDVB 1T4KB 3BKMH 1NCNA 3K8KA 4NO3A 4D0DB 3TC9A 5F6HJ 1W0YT 1J10A 2UZYB 1A0QL 1LNUA 2YPVH 5M7QA 2VUOA 2W38A 3AU1B 4XPTL 2YA1A 3HC0A 1W0WA 2P45B 1NGXB 3UTZB 4KY1H 3FJTA 1KGCE 4C83B 1SVZA 4JFQB 4AH2B 1BFVL 5IMLA 4P46D 3MBXL 3WMSA 1I8MB 4TVPD 5IFJB 3GM0A 4XBEH 1FIGH 5MEOB 1BBJA 3SE8H 4KHXL 1D5MA 1DBML 4NCDA 1UH4A 5KN5B 1A7OL 4L9LB 4PGDA 2OM5A 3DPBA 3BX7C 2Z93A 3ZTJH 1QG3A 1BIIA 3OKDA 4D8PA 2D9CA 4JB9L 3ZKQD 3GSRB 4NHUB 1HIML 3T2OA 4LLWA 3ARSA 1E4KA 1FZJB 2OZ4H 4GRWB 1B9ZA 1G7JA 4OD2B 3VXOB 1W2KT 4WV1B 1Y0LB 3PWNB 2FX9L 1NANI 2BVPA 3HI6L 1P6FA 2BDNL 1I7ZB 4CMMA 3QXAA 3P30L 1JFQL 4MAYD 2FL5B 1KEML 4HW6A 3HMXA 3RNQA 2ITCA 5DMGC 2NTSP 4Y16D 2D4FA 3GI8L 3HUJB 3EDDA 2WUBH 4QRPD 2AS5M 1AQKL 3BP4B 4HHAA 1WFTA 5F3HA 1E28A 1S7WB 3KPTA 5C7XH 5ACZB 5HHOA 4OBRA 3GBLA 4I48B 4X6DA 1OTSD 4JHAL 5MENB 1U8KA 1XF2B 5IMKA 4IRJC 5E6IB 5HGDA 1HI6A 1D5XA 1JI1A 3TWCH 3SDYL 5C0IB 3CDCA 3S4SB 4H8WC 1IT9L 5F7UA 2VKWA 2VDLH 4N9GA 4UBDC 2R4SH 3KWWB 3DX9A 3LY6A 1AI1L 1RIUL 1CFTA 5D6CA 1BQHB 4ISVB 3BQUC 2VN4A 1J8HB 4NUGH 6CGTA 4JZJA 5HYJE 2YD6A 3IKCA 3V7AE 3RDTD 1KN2L 1CFVH 1JGLL 3LPFA 3QUKA 4N0CC 3MV9A 3B9EA 2C9AA 1HEZA 3QEQE 5AAWA 1FDLL 2CIKB 3K1KC 3TVMD 1R3IL 5I1KH 2M1KA 5FECA 1IGIH 4OFDA 3BSZH 3OGOE 1IC5H 2F58L 4N9OB 3BH9A 1HILB 1A7QH 1WWWX 4PG9A 5E8EA 5C9KA 4GG6B 5JHLL 4NQTA 1PZUB 1OTTD 4K3JL 3FOMA 1P2CB 1T21A 5DYOA 1BFSA 5EO0B 3K2UH 3MLXH 1QFWL 2HTLD 4RZCA 3QFJB 4WHTB 3VRLE 5A2FA 1JWMB 4X9BA 4HIXL 3T0EB 2AEQL 1WZKA 5EO9B 3S36H 1HWGB 3KPNA 2DJUA 4ZTOH 4FXKA 5IW6B 4HEME 3KXFE 2VLLA 3LKOA 3DV6A 3CLEH 2QKIA 1UWEL 1AXTH 2CLRB 4ORGA 4PLKC 4F15C 2IH1A 1WT5C 4PJIF 1QR1B 3E8UL 2YPLE 3LMJH 4M1DH 2Z4QB 5DJDA 1QSVA 4YDJA 3ARDD 3NGBC 2GUOB 3D87B 3QQ4A 2W0KA 3L7FA 4GRLD 1S7XB 3LDBB 5DD1L 4RGMB 4WWKB 2GK0A 3IU4L 3MFFB 4AYFA 5E24E 5F21B 2MWCA 1PAMA 2F54E 3TCXA 1ADQH 4MNGE 3AREC 3BIAX 5K9QG 4OQTL 3VXRA 3P2TA 5CKGA 1J88A 3ULVL 4DGYL 2XA3A 2C3XA 1H0DA 4QTIH 4Y4FC 2FBJL 2R56H 1N3NB 2NY2D 1YYMH 3LKSB 4PJDA 1AGEA 2ATKB 5FDYA 2H41A 3V0WH 4N8CH 5GS2H 1DLFL 4RNRB 1TPXB 3FQXB 4WHYG 4M9PA 2XYCA 5LKNA 4PJEB 3T8XA 3VXTA 2QQNH 3IDIB 3MLTB 2UUDK 3H7LA 3CAFA 3HRZA 4QKXB 5HD8D 1UH3A 4NRYB 3WDHA 5JW3H 4GKNB 5FGRA 5D2LA 1DCLA 1QFPA 1FO0A 1MJ8H 2V9TA 5DGQA 5T3XH 4P49A 1A7RL 4C57C 3GJEB 2NY4D 5FUOH 5I66B 3QEGL 2X1OA 3MBED 4N8VA 1YMMD 4GG8B 4K7PY 1ZHNA 1RZ8B 3E6HB 3V8OA 4WI6A 1KCKA 4Y4HC 2EYRB 1ORQA 4DGIH 4NN7C 4NWUL 1XR8B 4JPWL 4P5TD 4XWGH 3RJDA 4BA8A 3FB6A 4WEBL 5D2NC 1KG0A 4K8RC 4DGVH 1T1YB 4R9HA 3MLVH 1BWMA 1WWBX 3BKYH 5BQ7A 4LLUB 1MPAH 2CKNA 2IG2H 3DJ9A 4PRBA 5JPNB 4NRZA 3SKNB 1T0PB 4JG0H 1ZGLM 4MJIB 5KSVB 2Y4SA 3C60A 3WFBH 3CFDA 4F7TB 5HGHB 3KYAA 2Y1VA 5ERWA 5CINL 2GW5A 1RK0A 2QR0B 1UZ8B 1CZ8L 4NO5B 3MROB 3PL6D 2H2SD 5HHPA 4HJ0C 1BVLB 2DQIH 3S8WA 1QLRB 3QWOB 3QNXB 3VE0B 2RCSL 5IF0A 7FABL 2DLHA 4OF6A 2IEPA 4LMQI 3NAAH 1KSRA 1XT5A 4M6ML 1TETH 2ORBL 4MX7B 5JTWA 1BQLL 2DOCA 4QF1A 4PJBA 4K3HA 3VFNA 4NFDA 2F15A 4UINH 2WUCL 3WUWB 3CX5J 3B8YA 2HN7B 1Z5LB 1KJ3H 3FAXA 1NBZA 4WEUD 3CC5A 1JK8B 2YA0A 4HWBA 3RZCD 1CDIA 4Z7UA 4R0LB 5E56A 5ICXB 3EFDH 5GZOC 1IGYA 1UACH 1AJ7L 3C5ZB 4HLJA 1KCUL 3CMGA 2I9TA 1G7LA 4GBXC 4HXAH 1C08A 3W0WA 5A16A 1DQML 3MYJB 5C07A 3EYSL 4DOHE 1J7VR 3GKWL 1J18A 2FDBP 2MJWA 1IL1B 1AIFA 1FL3B 1OSPH 4X5XB 5DD5H 4KZDH 1HZHH 3Q0HA 5C0CB 4JFYA 4CJ1A 2FX7H 2B20A 4WW2B 3RIFK 4GRMB 2IGFL 4I9WE 3MLZH 2YR3A 1HQ4B 1G6RH 3D9AH 5FYKH 5HGBA 5ILTL 2DLFL 2Q3AA 4B0MM 1ZHLB 1MCSA 1MF2L 1R3HB 5B3JE 4ODBD 3NIDE 1EEYA 3GK8L 3QQ9C 4FS0A 4L8SC 3BWAB 2ZSVB 4JJ5B 3WNMA 2QHRL 3BKML 4WU5A 4TNWK 3WEXA 1AD0B 1NKRA 4ZPTA 1FYTA 1R3LA 1U8LB 3TESA 3QH3B 3F7VB 1VFAB 3V95A 4KROD 4UILL 1H8NA 4LHJB 3VXPA 4TPRL 4YFDB 1XH3A 3EO0A 4LPVA 4LVOB 1JPGB 3RA7L 1JTOA 3JTSA 4GAJL 3HB3D 5I1HL 5D7SL 5E2UL 4FQIL 1GGYA 5FM5M 1IAOB 4NRXB 2EE9A 3MRHA 4FQ2H 5BO1H 5IGXL 3WFHB 2X4QA 3RTQD 1OT1A 2BVYA 4M6NH 2LU3A 5CGYD 15C8H 3FONB 1UM6H 1S5IH 3DROB 4R2GC 3I02B 4PR5A 6FABH 1MHPH 2ZOKA 1AXIB 3SOBH 1CFSA 2ZNWA 5CJ8A 1AKJA 3ULUE 3MV8B 4ZQKA 4ZOBA 2ZCHH 5D70H 1UKSA 5GISH 5KSAA 1G7PB 4WW1A 4GRWE 4OI7A 5JDSB 1TCRB 4LKCB 3JTTA 2AJUH 1MFAL 1QSZA 5I19H 1P69B 4XCFL 2EDQA 4PJFF 3SGEH 3OR6B 5E99L 4ZO6A 3TN0C 2NW3B 3FQNA 4X6CF 5DFVD 2WBJB 2HJKB 2CRMA 2X7LB 3THMH 5C86A 4MNQD 5C7XL 1PLGH 4NKOA 3G6AB 5DMJB 4XNMB 4S0TD 3LQZB 4MA3A 4PTTB 2HP4A 4G7YL 4Q58C 3BDYL 2IAMC 1CD9B 3H9HA 3J7HA 1P7QA 4GAYA 1H3VA 2Y5EA 2VQ1B 4J4PD 1RUAL 2NCMA 5C6TH 1TFHA 1ZWIA 3KPSE 5DQ9A 3EO9H 5IB3A 1BM3H 3HS0B 5T5NG 1CG9A 2UWEF 4F3FB 12E8H 3P0YH 2E7BA 1X9QA 4X83A 5GSVB 1N6QH 5DURB 5L6YH 1GHFL 2BOCB 1DBAH 5C09D 2IAND 2O5YL 3F7RA 1IAKA 4LRNL 3VXSA 4E41D 1OAXH 3FQTA 3IGAA 5IBTH 1X5GA 5FXCH 3MXWH 3STZA 1A6UL 5H8DA 5EU3B 1XF1A 4YHPB 1XGTA 3NN8A 1Q72L 5TH2A 4PLJD 1MRFL 2D31A 1TZHB 1EEUA 2N4IA 4E0RA 1IC5L 4KMTL 4P3DA 3P9WB 4LBEB 4OZHE 2CDEA 2ICEA 3Q3GA 4JRWA 5J12B 3RX8A 4PGCA 1CICC 1QBML 5TDNA 5EOTB 3HNVL 1DVFC 4X5WA 4X99A 3QXVA 3PIQB 3K2UL 5DD6A 1WT5A 2BCKB 5EBWA 5I75C 3CU1A 2FJHB 3S4SG 4ZFOL 3BIKA 3FB8A 4BUHA 3RWJA 1UVQB 5E8DH 4XI5D 3KS0H 3BP5A 3OXRA 2YD1A 1N59B 4MXVE 3ZSTA 3MLYH 2EDHA 3EOAB 1BZ7B 1BQHG 2VDPL 3BT2H 4X6BA 5J6HB 4ZAKB 3GM8A 2F74A 5F6HI 2RGSA 3NFSL 4X8JB 1OB1A 1QQDA 3O3BA 1FFRA 2VITA 1GVIA 3ZDZE 1WGOA 5ETUA 2SEBB 1I9EA 5KVGH 1NKOA 3QDMA 2CIIA 2J1KA 5KW9L 4K23H 3TPKA 3U82B 4XXDA 3WHE1 1K4DA 4Y4FA 3K1DA 4JFOA 2OJZH 5DC0A 4YHMH 1IFHL 2EKSA 2ADGB 4M7LT 3GGWA 3QCTH 3M07A 5HHMD 3T2NH 4X98B 4KUCD 4PRAB 4P9MH 2VE6B 4KKCC 3NCJL 2GHWB 4IMKA 5DJXB 1LO0L 1JUFA 4HUWA 3QDJE 4OGAC 3G5XA 4TTDD 5CWSA 4LARL 4YUEH 4OZIE 2DWDA 4MXWL 4G8GB 5IB5A 5DJYA 1T2QH 3RL1B 3K4AA 4CVWA 3I50H 2YD7A 1YYML 3MSPA 3DTXB 1NC4D 3QIBC 3IDYB 4Z0BL 4ONGH 5E0QA 4NNXA 1J1PH 3UTQB 1SBSH 3QNZB 3P0VH 2V2XB 4XAWL 2W65A 1NBQA 5GS0D 1G7HB 3MRJA 2XZAL 5DUML 2MCPL 1TQBB 2JIXA 5GJTH 2GFBA 1TXKA 1MJUH 5EDXA 2E27L 4IRSC 1JGVL 1WLHA 3ARFD 1DE4A 1CL7I 3FQWB 4L9LC 4S1DC 3C2SA 4PJ5E 4LSQH 2DQJH 2RR3A 5D7LA 1MWAL 3RQ3A 1GC1L 3QCVH 3V4VL 1CXFA 3WJLC 2AJVL 5A3ID 1U2HA 1HOCB 2NR6D 2MQCA 1F11A 3KPRA 2OP4H 3BEWB 1GGBL 2F53B 4V1DE 3LN5A 3WHXB 1YEGH 3EDKA 3H9SD 5T1LA 3FB5A 1TMCB 4EI5B 4UIKH 4G43A 1P4LB 2EDOA 4AZ8A 2X4RA 2WWMD 3QUXA 3PNWA 3N0PB 5I1LA 4W4OC 4FFWD 4AM0B 3MRNA 5JOFB 5EBMB 4XNXL 1M4KA 2HYMA 1MPAL 4TVPL 1MJ7H 3B2UC 4OF3A 5TQ2H 1MIML 3STLB 2FHFA 1V7NL 5JOPE 5DO2D 1U58B 4BKLB 4GW5B 3TNMA 5DJZB 1V3JA 2XTLA 1MEXL 1KF9B 3OGCA 4R90L 3BPLC 4OIAA 3EJJX 4L4VD 3QUYC 4CW1A 2WM0A 4F9LC 3U7WL 2ICWJ 2BC4B 3LD8B 3O2VL 4PJHA 2BX5A 3U48A 3OKLA 5INCB 2QSVA 1M7XA 4XP6L 3T0WA 3MGTB 2M2DA 4NC0B 2DQTH 3OJDB 3L6FA 1NCWL 4QHLB 3OR7B 1MCDA 2EYTA 4JFFE 5EA0L 1IC4H 1U3YA 3RVWC 1WBXB 3F8UB 3U1SL 1HINL 1DUZB 4AEHH 1MELA 1YUHA 3H42L 1HH6A 2YMXH 1ORSB 1CLCA 3QULA 4JDVA 4PRID 4G6AD 2DLTA 3P77B 4OZ4B 4MWFB 1QVOB 1BFOB 1JF1A 4X9HA 4FZ8L 3CFCL 2P49B 1UYWL 4WUKH 3DO7A 2RIKA 4BFGA 5J1SC 2D7MA 3L3HA 4KKBC 2OR7A 5IMMA 4HIEB 4PY7B 2QADB 3N06B 4QRUA 2BNQD 2VDOH 3JZ7A 3SDXF 3P3YA 1U6AL 2Z8WC 3M8OL 4FTVE 4U1KB 3Q6FA 4TSAL 4TN9A 2UUDH 3EW3B 3O9WB 5I8EA 2DTMH 5DMKA 1PKQE 2JF1A 3JXAA 4L8SA 1KNOA 2IQAB 1IQDB 5TPWH 1IM9D 3TO4D 4OAWB 3ZDXE 1I3GL 5DHYA 2NY0D 3BZFB 2EXWC 3FFCA 5T5FL 4P2OD 4MNGA 5SWSB 3P9LB 5L2JB 1T03H 3O3DB 3KPPB 2VRAA 2GEEA 3ZYJA 1BREA 2FR4B 3LZFL 4PREB 1H9VA 1FZMB 1NCBH 5EOQH 2H1PL 2C4FT 1FNFA 3BAEH 4JKLA 2PO6B 5AD0B 5EOCH 4KTDH 2GJ6B 4KI5E 1HE7A 3LDBC 5JQ6H 3LEXB 4WWKC 4YO0A 1A6TA 4ZXBD 2YN5A 5C0AE 5L7XH 1T1ZB 1MJJB 1TQCC 2ZG2A 5BS0A 3ULVE 1N8ZA 1EJOL 1FAKT 1GGIL 1I1YA 2J8UE 3EYOB 3ZYIA 1ZTXH 1BJ8A 3BGAA 1A7BA 4X9IA 1I9RL 3QWRD 1P5UA 2NW2A 2VH5H 2K7QA 4M6NL 1CDHA 1UXSB 4UDTA 5IG7B 2KQMA 2DMKA 4KUCF 3IVKB 3MOAL 3NZHL 4UNUA 3MODL 3D3VA 1A4JA 2Q86A 4LPWA 3DVNA 1LE5B 1ITCA 2JJTC 3UTTD 1EBAA 3AAZA 4XCNA 4F80A 3V52H 4OTXL 2NY1D 1NEZB 2HLAA 3BP6B 5F7LB 4LSRL 2P48B 3EJYD 4LPCA 5J06A 4OLZL 2R23A 3CD4A 5DMYA 4MA8H 5HYQA 2EDWA 5E2TL 1U8JA 1J86A 4PJ8A 3WXVH 1JNJA 1UM4H 4JM4L 1OAYL 4Z78A 1IGJB 4RCAA 3K8MA 1D5ZB 4XP4L 3U83A 3MOBH 2A77L 2N7AA 3V7MA 4Z0XA 4JFHE 3A6BH 2OL3A 1OARL 5T1DH 5HJ3B 2HTKC 5T3ZH 4ZUTA 4GLRH 4LCWE 4NQEB 1L7IH 3VFTA 5FF6A 3KJ4B 4AL8H 1KEGL 4U6YB 1VKXA 4UDUA 1PQZB 5FOJA 3IRPX 4OD1L 2ZKHL 4UOJA 1RQ5A 2GCYB 5D7IE 2CK0H 1SYSB 4OKVB 2ZNXA 4AT6A 2CJUH 5D1QC 4G9FD 3KYNA 3RL2B 1DFBH 4P5MA 4JO4L 3WS3B 4WO4D 1X5IA 2EDYA 4MJ4A 3REVA 3S5LA 3VFOB 5JO5A 3IAPA 5EIQA 1LP9B 1C16B 1FVEB 5KS9E 1CICA 3QNYB 3E3QE 1DVFA 1YEEH 1P53A 3SGJA 4CL7A 2A9NH 1F4AA 2J4WL 1E6OH 5ID0B 2VLKB 2XN9D 2ZUQB 4IHOA 3GMQA 4G42B 2VWEC 3NIFF 2V5MA 5FKAA 4MQ7A 2BNUA 4D0CA 4TUKH 4D3CL 3G6JE 2MQ3A 1P6AB 4Q9RL 1BVKA 5LQBH 4YPGB 2QSCH 3KHOA 3SDDA 2N56A 1CL7L 4M00A 3FO2A 3TZVA 1PZ5B 2BVQA 2VMFA 4DTGH 5E08H 5KVFL 3U9UA 5E8DL 1CT8B 1KPVB 3FKUS 2EIZA 1CDBA 2YUXA 5CJXA 2EEBA 3KLHD 4GLRI 3CMOL 5HY9B 4Z7QE 1SEQL 2XRAL 3RWHB 5DC4B 5HYIA 2NQCA 5ID1B 4L1DA 2VN7A 1G6RB 4WFFE 4YDVA 1T4KA 1JHLL 2FZ3B 4D0DA 2R0WH 1L4IA 4EIZC 4JM2B 1QFOA 5CZXC 1A7NL 2V5SA 3DI2B 5LGHH 1GPOH 1NGXA 1OL0A 4HAFA 4KDWA 2OJEB 4JPIB 3UTZA 4LQFH 5IP4A 3TV3L 3DX6B 4C83A 1XCTB 5GRVL 4JFQA 5FHAH 4AH2A 1TVBB 3W82A 3C6LD 4H20H 1I8MA 4NZRL 5IFJA 1F3DJ 4J3UA 5MEOA 4YFLF 3P9MB 1T2QL 2WP3O 4U2YA 5MI0C 3ZE0F 4OLVH 5ISZE 4L9LA 3FO9B 3BE1H 2NY3D 2YK1L 1I7TB 5TJWK 1N4XH 4KK9C 4H25B 4XPGL 1PKOA 3GSRA 1J1PL 3WJLA 2IBZY 5E2JA 4Y5VB 4NHUA 4G6KH 2XTJC 2QSQA 4P2RD 4Z76B 3VI4F 5B39B 5KTEL 4DN4H 1FP5A 1FZJA 2BJMH 3GHBH 5CHNB 1S7SB 2O5ZL 2PYFB 3VXOA 4ALAL 4WV1A 1Y0LA 3PWNA 4WUUB 4UV7H 4ZNCD 1IAIM 4GH7B 4WY7L 4PS4H 4FQHA 1I7ZA 5FYLH 1S7QB 4OBSA 1CGSH 2XWBB 2FL5A 2EDTA 4JRYB 2CUMA 1EFXD 5AWNH 1L9MA 4H88H 3FN9A 3QJFB 3HUJA 3AC0A 3BP4A 1X6LA 3PWJB 3I85A 4I2XB 4UIKL 5ESQB 1S7WA 2BXYA 5FGCB 5EWIH 5C0BD 5ACZA 4NPYB 4Y89A 4I48A 1CLYH 1MY7A 3Q6GH 5MENA 1BD2D 1XF2A 1RJLB 4KJPD 4JQXC 5DC9B 3A6OA 3HZMB 5F1IB 3G04B 3SKOB 5E6IA 2MPAL 3SDAB 5IWLC 5C0IA 3L7EB 3S4SA 3QEUB 2B0SH 1ND0B 4WFGD 2AEPH 3KWWA 1V3KA 1XF4B 4PB0L 4WENB 3PGCB 3ZTJG 4OZGF 1BQHA 3DI3B 3GB7B 4G8IB 5EZIH 1J8HA 4OFVA 2NXYB 5BW7A 3U36B 4NDMA 5EU5B 3SJVA 1S7UB 3BHBB 4M1GH 1RUKH 1L6XA 1ERNA 4LOUD 2CIKA 2RAMA 4YHYC 1DZBA 2B1HH 4ZFGH 5A2IH 1LO4H 3EYFB 2FHBA 4EXPX 3DRQB 5DD3H 3VI3F 1F4WH 4LAQL 1HILA 4HBCH 1MOEA 1KB9J 4GG6A 1WUNT 3UJTH 3BZEB 1BBDL 3BKCL 5IEHB 5EO0A 1WZMA 4ELMB 2G60H 3QFJA 4WHTA 1JWMA 3T0EA 1KT2B 5EO9A 2APXA 5IW6A 4WUKL 3PWUA 5J12C 1EO7A 2MTPA 3WSQL 4CNIB 1D7FA 3WKMH 5F7DB 5GGTL 1Q1JL 4HCRA 3DVFA 1MIEL 2CLRA 1T83A 1F3JB 2NX5B 4K7PL 3DMMB 3PGDB 5IVXF 4MGXA 2Z4QA 1PEWA 4JVPA 3MQIA 4G9DB 4KVCL 2GUOA 3DGCR 4LASH 4X7CC 2HRLA 3FRPG 4U6XB 4HS8H 2GKIA 5HHOD 1S7XA 4LSUH 4YEFA 4G3YH 4NO2B 4WWKA 3MFFA 3NFNB 2A6JB 5CUSL 3MXVL 3BKJL 3HLAB 1CR9H 5SWSE 2XIDA 4P3CL 1UXWB 3MA7B 5HBBA 5EOQL 1DL7L 5FUCE 2Q3ZA 2F5AL 2IFFL 3FB7B 4PJIE 1P4BH 2GTWB 3OZ9L 2AEIT 1N3NA 1E4XL 3WIHL 4NQUA 3LKSA 1OAQH 4AG4H 2ATKA 5D5MF 1L7TH 4NKDB 3TNNB 4RNRA 4RA3A 5CAYB 1QSFE 3FQXA 4L4TA 3WXWL 1RUML 3MV9D 4PJEA 3L5XL 3MLTA 1RIVL 3L3OB 4FA8A 3W9DA 2B39A 4NRYA 4JFED 4L9DA 4HS3B 5JMOC 3NPZB 5GRVK 5IROC 1JPTL 4HEPG 4NZJA 1VESA 3GJEA 4HF5L 4LMQE 1ZLWH 5I66A 5BZDA 5FA3B 1WZ1L 2BK8A 3IDYC 3MRPB 3K3QA 3IF1B 3O6ML 4GG8A 3ALPA 3PXHA 1RZ8A 3E6HA 3IU3B 1D9KB 1K6QH 1EAPB 2EYRA 4K3EH 2BP3A 1KPRB 1XR8A 5EO1B 1OAKL 1EO8H 1OCWH 3NBNA 5BV7L 3RWIB 3B4NA 3S37X 3T3PE 1V8HA 3PUCA 3ARZA 5F9OL 1CWVA 1QKZH 4P0DA 4HGWB 3UTPE 1T1YA 1LO2H 4RDQF 3N85H 4PV8B 1ZEAH 4LLUA 4MJ6B 4BK5A 2F19L 4CVZB 5FDWB 4KROB 3HAEH 5JPNA 4EZMA 3SKNA 2ICWI 1HHIB 4MJIA 3VFGL 1RJYB 5KSVA 4Q9QH 5HGHA 3IDXL 2QR0A 1UZ8A 4NO5A 3MROA 3K46A 1A3LH 1BVLA 1FFOB 1QLRA 5DWUL 3QWOA 2EDNA 3QNXA 4TVPE 1I1AC 1QYGH 3JV4B 3QHZH 3VE0A 3WE6B 3VXRD 1K8IB 4CDGC 4EDXB 1C5BH 1TJHH 4YHLH 4LSVL 4MX7A 1W72H 3WHE0 1BF2A 1AH1A 1G9MC 4YWGH 3QHFH 1YQVH 2HN7A 1Z5LA 4KK6D 5EZJA 4BJLA 5KANI 4BZ1H 1JK8A 3GIZL 4R0LA 2F5BH 3C5ZA 2A9NL 5CJ5A 4LCCC 3V5HB 3RHWK 1CQYA 3I75B 5D1XC 4LU5H 3LN9A 3V6OE 1S9KC 5IBLD 3DBXB 2ZUXA 4RGNB 2DAVA 4TUKL 1S9XB 1CE6B 4QOKB 4K3DH 3DRTB 4BYHA 5GRXG 1RULL 4D9RE 2N1KA 1IL1A 3GEWB 1FL3A 4M1CC 4YHIB 5JZ7C 4W6YB 1M05B 4X5XA 4I4WB 3CDFA 32C2B 1N26A 5C0CA 3OKMB 4WW2A 4GRMA 1X4YA 5IJKA 1NMBL 1HQ4A 3LQMA 2QADC 4KK8D 5D9SB 1FAIH 2WQRA 1YYLL 1ZHLA 1R3HA 4JGMA 2C3VB 3C60D 2DL2A 4NQDB 5GRYA 3BWAA 2ZSVA 4JJ5A 2X44D 2PR4L 1J0YA 1O7VA 4NCC1 1AD0A 3ZL4L 4OCNC 5F7WC 5TE7H 5I1IH 35C8H 1U8LA 2DLIA 3FAWA 3QH3A 1GRWA 3F7VA 1VFAA 4OQTA 3WO4C 5EZOL 2FD6H 5IR1B 4HSQA 4OCRH 5A1AA 1B0GB 4ENED 5MHSD 4A6YL 3QI9C 2X89A 2VSDA 1JPGA 2A0LC 5T1KB 1CF8H 5E7FA 4P2QB 4NIKB 3S88H 1JTPA 2PO6C 4W81A 4JDTL 3R4DA 4D9LL 4IOIB 5F3BB 3DVGB 4OCMC 4B50A 4U31A 4DN3L 1IAOA 4NRXA 3ZT5A 3MGAA 2OS7A 1TDQA 1QFUL 1PGRB 1UWGL 3WFHA 4RWYL 1QRND 4X6DF 5F7FA 3FONA 5JHDB 3DROA 5I8CB 3I02A 4YC2B 5INDB 4X4XB 2M8XA 5I0DA 4M48L 4ZS7H 4PJAB 3MRKB 1F4YH 1N7MH 4DN4L 1KYOJ 2Z8RA 3MV8A 1A21A 1C7TA 3W0WD 5I2IB 3NPSB 1G7PA 1J1XL 2HKHH 4UV7L 5JDSA 2NY6C 1TCRA 4LKCA 2DWEB 1S9VB 4Q9BA 5C07D 4GFTB 1BOYA 1UM5H 1LGVA 1LK3H 1DLHB 3T09A 3PDDA 4K9EH 3OR6A 3L3KB 1DTUA 5IWLA 2NW3A 4OT1H 1RFDH 2HJKA 1NAKH 1EZVY 2X7LA 4Z7VB 4HXBH 3CUPB 2WMPA 1Q9LB 3Q6GL 3G6AA 8CGTA 4F9PC 4RX4A 4XNMA 3ILQD 1AC0A 3LQZA 5C0NC 4O2EB 2Q76B 4PTTA 1KULA 1CLOH 4WU7B 2Y72A 2VQ1A 3KPQB 1MNUH 1HHGB 4PJFE 2DBJA 1FRGH 2UY6A 5B39G 4MAUH 4N5EC 3SGDH 2H2PC 3HS0A 4YHKH 1FYTD 5EC2B 4F3FA 1Q9OB 3VDBA 2NZ9C 3ARPA 4M03A 5K9JH 5GSVA 2ZCKH 4HWZB 4F57H 2BOCA 4UQ2B 1M6OB 3VFSB 3BJ91 2Q87A 4FQXC 1BAFL 4JO3H 3CVIH 2ICES 1YMME 3S35L 5EU3A 1UEYA 3DV4B 2D2OA 1TZHA 3QFDB 5CJQH 3VFRB 2I26N 2YBRA 2V2TB 4F58L 4P59H 2YWYA 2ED7A 4YBQC 1F4WL 4U1SB 1GL4B 2EO1A 5I8KH 2X1WL 2UWEE 5EOTA 2EDKA 1YEJL 3L5IA 5E2VL 3TFKC 1Q0YH 2B4CH 3U7AA 1W8NA 3PIQA 3UZEA 2BCKA 5FHBH 2FJHA 5EORH 1AKJD 1YNLH 4YDIH 5I74B 3VGAB 4YDKH 1S3KH 1UVQA 4QNPF 1MCRA 5KSAD 2Y5TB 3MO1B 4CN4A 1OGTB 4OCXL 1N59A 3SCMC 4XVTL 3EOAA 1BZ7A 5J6HA 4ZAKA 3BH8B 4X8JA 3MMEB 1CTNA 3I2CL 4C56B 1EAJA 5L2KD 1KENH 3UYOD 4U7MA 3T0BA 5DQDL 4MQSB 5LCVH 4LASL 1AGCB 4LP4A 5D2LF 1ZVSB 2ADGA 2CKBL 3OF6A 1SY6H 3IDGB 4EUPG 3X3FL 3QG7H 1IILE 4YX2H 1RZ7H 3SGDI 4X98A 4PRAA 5IEKB 3H6JA 5KSBB 1P7QD 3LKRB 5DJXA 4JG1L 1LK2B 2OYPA 4X4ME 4WI3A 4WI9A 4O00A 4G8GA 3RL1A 2PXYB 1UWXK 2OI9C 5IROA 3OPZL 3MRGB 4AG4L 3IRZA 2YEZB 5KAQG 3DTXA 2LQRA 3JBG7 3BPCB 3TO2B 3AXLB 1I9JH 1HHJA 1EPFA 2V17H 2DIBA 2HFGH 3IXAB 3MA9L 5HHVH 1UKTA 3UTQA 3QNZA 3VXSD 2E5EA 2V2XA 4B7IA 2BNQB 2VSCA 1G7HA 4ZFFB 5LXGH 3QRGL 3CLFH 4FQJL 4OV6F 5FYJH 1N2RB 5ELIA 2EH8L 3CVHL 3TCLB 4DFIA 4M43H 1AO7B 1UA6H 1CGVA 3FQWA 1QBBA 4Y5XB 1FE8H 2UVEA 3I9GH 1B3JA 2BRQA 2QEJA 3R1GH 3GBNL 5DLML 1AGDB 4PLKD 4P2OB 4JLRB 1MQKH 1IKFL 1HOCA 4O58L 4Y1AB 4PB9H 2OZ4A 3RVUD 4PG2A 3BEWA 2F53A 2V2WB 5FCUH 3WHXA 4EI5A 3W2DL 1KC5H 5CP7B 1U8OB 1P4LA 5BRZB 1R24B 5TFSH 4S0SD 5C2BH 4AM0A 1MREH 5EBMA 4YXLH 3E6FB 5IW3A 2VLJB 3QDMD 4Z7UF 3STLA 1D5BB 4LPYA 4DUXA 1U58A 4BKLA 4GW5A 4I0PB 5DJZA 4Y4FD 4NBZB 5GPRA 4J3SA 1IVLA 4OM1L 2IWGA 2ATPB 1D6EB 1X5JA 5CGMA 4QHNB 4Y88A 3BUYB 4LFHD 1FPTL 2EC9U 3QHZL 2BC4A 2AV1B 4BZ2L 4EBQH 4PJXB 4K3GA 1MI5B 5INCA 4TSBL 4ODVH 1JN6B 4XP1L 2DS4A 4PUBL 3MGTA 1TJHL 1HWHB 3OJDA 4KUZH 3WFDL 1RZKL 2APWA 3AVEA 4QHLA 3OR7A 1N64H 4YWGL 3QHFL 4JDZA 4EIGB 1LDPL 4Z77B 4QXGH 1DQLH 1WBXA 3VXMA 1GIGL 1XAUA 3OHXB 5I18H 5K33A 1OW0A 1DUZA 2Y07L 4KRLB 2NY1B 3ROLB 4K2UL 1I8LC 1ORSA 2AJXL 5I17A 2IQ9L 2JIXD 3P77A 4OZ4A 1N5AB 1QVOA 4MWFA 4BQCA 1BFOA 5DRNB 3LQAL 4K8RD 3ZHLA 1JE6A 4HIEA 2AW2A 4PY7A 5D7LD 5FB8B 1QLFB 1XGRB 3EYUH 4U1KA 4MNQE 2E7MA 4PD4K 3G9VA 4QOKE 3KPRD 4OUUB 1CK0L 5T1LD 1A9BB 4XPBH 2XZCH 2ADFL 4PRHB 3GSNH 1MFEH 3LKPB 2IQAA 1IQDA 1CTOA 3K8LA 1PSKH 1RUQL 3QUXD 4X80H 2JJVA 4OAWA 3S3PA 3BZFA 1F58L 5JIIA 1II4E 4L4JA 5SWSA 3P9LA 5L2JA 3O3DA 3KPPA 2AKRB 4QTHB 4MB3A 2FATH 2YC1B 1CI5A 3DMMC 5JA8B 2FR4A 4PREA 1FZMA 4MA1C 1G7MB 2VXQH 3IDJB 4UTAL 3SDXE 4WI5A 2NYYC 2D03L 2CKBB 4KMQA 2PO6A 4MS8D 5AD0A 2GJ6A 3INUL 3LEXA 4PJCB 2G9HB 2IANE 4E41E 25C8L 4TOYL 2JELH 1T1ZA 2VISB 2FD6L 3MJGX 5HVGB 4R6UA 3R06B 5GZOD 4PJ7B 4BQ6A 5BVPL 1T89C 4FMKA 3S88L 4HWEH 4KTYA 3IFLL 3LVEA 3EYOA 2R69H 3T08A 4RFNB 1FGVL 1JI2A 3ULUC 5JW4Q 4JR9L 4H0HB 2J5LC 3HMXL 2KZ1B 4N5UA 5MEPB 3RWCB 3DURB 1PG7X 4GXVH 1UXSA 1HKLL 3HC3H 5D6DC 4EOWL 5IG7A 4KKLD 4WDIB 3IVKA 3WNNA 4JQIH 2X6MA 5KVEH 3WDIA 1LE5A 4X4ZA 3N1FC 2OMBA 5TF1H 3D69B 5GSRB 1AHWB 1NEZA 3BP6A 3WFCL 4GSDH 2D0FA 4R7NB 1F4XL 2ILLA 1OP5H 1KJVB 1T22B 5I9QC 4X9GA 1IGJA 3I6LD 4NKIH 3S34L 3IFNL 1D5ZA 1H3UA 1J0HA 3NTCL 2Z31B 4JFDB 5CSZB 4OI9A 2B1AL 1K4CA 3QXWA 5DJ2B 2PW1B 5I1JL 5HJ3A 2Q8BH 4NQEA 4U1GB 3FFCD 4J8RB 2X4OB 3MRMB 4U6YA 4I18C 1PQZA 4XPHH 4FNLL 1IC1A 2OK0H 1SYSA 1NL0H 4OKVA 5IKCB 3L5WB 5IHBA 2BSSB 4JCMA 1B2WL 1T5WB 4RGOH 3U7YH 2DM3A 2PNDA 1YEHL 3WS3A 1DBKH 2PCPB 2BNRB 4O51B 3QHTC 4ODSH 4YXKL 3VFOA 5E7BA 3NCCB 2OR9H 1NSNL 1LP9A 2VDNH 1C16A 1FVEA 5T1MB 3D39B 3QNYA 5BS0D 1W72B 1KB5H 3T77B 3C09C 4O4YH 3UX9B 5ID0A 2VLKA 4DQOL 3SQBA 4OFKA 4G42A 3E2HB 4Y2OA 2XXCB 5CSGA 3RU8H 4O5LH 3H9SE 3GSVB 4U1LB 2CLVB 4NQSB 4YPGA 3NCEB 5L88H 5IQ7L 3KLAB 5CS7A 3D3VD 4I1NB 4GOSA 3BP7B 5F44A 1PZ5A 1S3KL 2V5TA 1D3CA 1HDMB 4KZEH 4NZUL 1CT8A 1M7IB 1KPVA 3QA3B 2QQKH 4M61B 1YY9C 1LNUB 3NIFE 4PJ8D 4AMKH 5F1NB 3V0AC 3HC0B 5HY9A 5ITBL 2HRPL 4DAGL 4LCUB 3RWHA 4C56E 5JOEA 1YEKL 4L4VE 4DKFL 1UKQA 4KPHH 5ID1A 3JWOL 3EJZC 1G6RA 1I7RB 2P8LB 2FZ3A 1LO5B 2B5IB 2Q8AL 4JM2A 1H3WM 2PKDA 4RQQB 4LK4A 4EN3B 4DVBB 4YX2L 5GGVH 4J3VA 4I3RL 2OJEA 4JPIA 1RY7B 3QPXL 3AUVA 3DX6A 5JIKA 4H0GA 1U3JA 4D8PB 1DBBH 1TVBA 4QRRB 4WGVB 4CJ0A 3NCMA 5ANME 3O4OB 1X5YA 1H3PL 2JB5H 2APVA 1KN4H 3P9MA 3O8XB 1H8SA 1CFQB 4FQCL 1H15A 5D1ZB 3FO9A 1I7TA 5F9WC 3HC4H 1CICD 4H25A 4J6RL 1G6VK 1DVFD 4U1MB 3QXAB 1PG7W 4Y5VA 2VL5B 2J12B 5C0JB 5GS3A 4Z76A 5B39A 2BNQE 4RIRB 1UEMA 5CHNA 1S7SA 2PYFA 5ABDE 4M5ZH 4XCCH 4WUUA 3IJYB 3MV7B 1AY1H 1E28B 5TE4H 3UZVB 1A4KB 4WEMB 5DR5L 5E8PB 3B83A 3ZE0E 4OCWL 1S7QA 2XWBA 5GS0H 4JPVH 4JRYA 4P4KB 3SDDD 3DIFB 2AI0H 4J3XA 3VFVB 3QJFA 3TZVD 2FGWH 3TA3B 1BEYL 4P2CG 3PWJA 1G9NH 4I2XA 5ESQA 4NPYA 1D5IL 1RJLA 2YUWA 4P5KB 1X5FA 4JN1L 2J7LA 3HZMA 4LF3B 4KKCD 5F1IA 3G04A 3SKOA 3SDAA 2HKFL 1JGDA 3VRLF 3L7EA 4RAVA 2VLJE 3IXTB 3QEUA 1ND0A 1VFMA 2VXVL 4XPAL 4HWBL 1XF4A 4BFEA 5EN2B 3TBWB 2EE6A 2LU7A 2YUVA 3RNKB 1JHKH 3WFEL 4YDLB 4G8IA 4DVRH 4J12A 3U36A 5EU5A 5E8EB 1S7UA 3NZ8B 4O02H 3BHBA 3O6KH 3V6ZB 1I8LA 5E94B 4PPTA 2BSRB 1MI5E 4Y19B 5E6YA 4RZCB 2X1XR 1ACYL 5EG6C 1AFVH 4LVNB 3EYQD 1R5WB 3L3GA 1UCBL 5CFHA 1P9MA 4M62H 4C54A 1MCBA 2VZ3A 3O3UN 3BZEA 4PP1D 4L1HA 5IEHA 3UTTE 4ELMA 4ONHB 1F13A 3SO3B 4ORGB 1DBJL 1DQJB 2J3SA 1NCDH 5CCKL 5DVNA 2EE2A 2OTUB 2APFA 2VDML 1KT2A 1S5HB 4YGVB 3CFKB 3O4LB 5I30H 4YH6A 4H1LH 5ADOH 3VXNB 4CNIA 5F7DA 3P11L 3RX5A 1OLLA 3VI3E 1F3JA 2NX5A 3GMRB 3B2UD 3BN9D 3DMMA 3PGDA 1PJ9A 3VFPA 3BD4A 4KTEL 4DZBB 3VGAC 3HI5H 3WIIH 3PV6B 4G9DA 1EXUB 4LGPB 1FNAA 2X4PB 4KI5C 3VFUB 4U6XA 5MEND 4NO2A 4G9FE 3NFNA 2A6JA 1B4JL 3HE7B 3CFJA 3HLAA 1PY9A 5CGTA 1MCQA 5E6ID 1UXWA 3VXTB 3IAGC 3K81A 3FO0H 3ROOB 3ULVC 4ORZC 5E5RB 5GZNC 3FB7A 4O2FB 5IVXE 4XTRC 2GTWA 4WTXA 1YNKH 3GZKA 5DJCB 3BEVB 3GRWH 1ZSDB 4JRXB 1JMXA 5CKAA 1J8HD 1INQB 1CDJA 4NKDA 3TNNA 4QCIB 2JELL 3VXQA 4GUPB 2XN9E 3L3OA 3U0WH 2KUTA 4JO1H 5D6DA 3W5NA 2FEDC 5AEAA 5CBAB 5JIPA 3GBMH 2YD8A 1JZ2A 2BSED 1EFQA 4HS3A 1LWRA 4YHZL 3WNLA 2DD8H 3FB6B 4KKBD 1NCTA 5FA3A 1UJTA 3MRPA 4LHUB 2DM2A 5L9DH 4H8WL 4G7VH 3IF1A 3IU3A 5CJOH 5J3HC 1D9KA 3QFJD 1EAPA 3N1PC 5EU6B 5DFTA 1KPRA 5EO1A 3T0ED 2XKNB 4OI8A 5L0QB 3C2AH 3RWIA 3DXAB 3H3PH 2NXZB 2K3TA 2EC8A 4HLZH 2EXWD 4HGWA 4X6CB 3U4AA 1XCQB 5J6GB 4POZC 1B88A 4DCQB 1FL5B 4MJ6A 2H8PB 4XP5L 5FDWA 3QRFM 4YK4C 1U93B 1HHIA 1YY8B 1RJYA 3O6FB 1FSKB 4QHKJ 1FNSL 1UT9A 4GMSH 2BVUA 3G08B 1JYNA 5IFAH 4UV4H 3CFEB 3SDCB 4WWKD 1Y6NR 1U8PB 1HSBB 1FFOA 5TE6H 4M7JL 5I6XB 2EH7L 4BSVB 4KK5C 3Q1SL 4U2ZA 5CILH 5D7JC 5FAAA 3JV4A 3WE6A 3ARGC 4Q6IB 3WV0A 2IC2A 4XBPB 1K8IA 4EDXA 3E3QC 1HXMB 4NWTL 3SE3A 4J3OC 3B5TA 4Q0XL 5B38G 4DKEH 2Z8VC 1KTKE 3GO1L 3ZDYF 4GW4B 4ZYKB 2BRRH 4ODSL 5AYUH 2XG5A 3IKKA 4L4TD 4P2RE 1H3TA 3CXDH 2Q20A 2AQ1A 3NVQA 4P9HH 1XR9B 5B3JF 3PHSA 3NIDF 4U3HA 2KBGA 4Q7DA 4HH8A 3V5HA 1INEL 1QFWM 4URTB 4M4RA 4FQLL 1RIHH 4AEIH 1N0XL 2ZSWB 1WIUA 3VA2C 1S9XA 1CE6A 1VEPA 3DRTA 3HAEG 1OD7A 3QXTA 4W4NA 3AS1A 3TT3H 4YHIA 1M05A 2VL4A 1BD2E 4FQQB 4I4WA 1KOAA 2DQUH 1JZ5A 1OY3B 4RISH 3RVTD 5I1GH 3OKMA 1A5FH 1ZK9A 5GRZA 4GS7B 4R8WL 5D9SA 1YPZB 1DQDL 4HWUA 1SM3H 5JXAL 3QPQD 5FO7B 2WLYA 4WFGE 3HFML 1A64A 1JMZA 2UZXB 2CGRH 4JHWH 3VXPB 4MJID 2ZPKL 3GSNB 5J9PB 4OB5H 2C3VA 4U6VH 4CVXB 4Z5RB 3U4EB 4NBXB 4NQDA 4UOW1 3KGRA 4NHCL 2Z35B 4JO2L 1JYXA 3PXJA 4GRWF 5HDQL 3V4UL 2D7NA 3VG0H 2I60H 1V3LA 5IR1A 5ENWB 1B0GA 4XCEB 5IT2L 5T1KA 2IPTL 1H3GA 5D71L 4FQ1L 4MYWB 4P2QA 1JJUA 4K8RL 2EYSB 4IOIA 5F3BA 1BIHA 3DVGA 4N1HB 1KN4L 4HJGB 4HPYH 2XXMB 4GMTH 2L4OA 1CE1H 5I1CH 1N5YH 3TJEH 3HC4L 4YE4L 2DQGH 5JHDA 4HDIB 5I8CA 3RWFB 3UTOA 2OX5A 3C5ZD 4BELD 5INDA 1ZGLB 4X4XA 1RZJH 3X13B 5AG8A 4PJAA 3MRKA 1X5HA 4IRJB 4MNHB 3FQNB 4HFWB 5I1DB 5I2IA 3A67L 2J2ZA 4NQCB 4M5ZL 2EIEA 4KRPC 3RGVC 5TE4L 2DWEA 3AROA 1S9VA 3UEZA 5HHOE 3BQUB 4X6DE 1DLHA 3L3KA 4JPVL 5CEZD 2HH0H 3CCHB 5C0CD 4ZS6D 1MHCB 2V9RA 4HFUL 4Z7VA 1AHWC 2E7LA 4NYLB 3CUPA 5F9JB 1Q9LA 4OV5B 3MRIB 3VGFA 4O2EA 2Q76A 4GG6F 2Y6SC 4Y2DC 4WU7A 3KPQA 2Z31C 1P7HL 4JKPL 4R4ND 1HHGA 3MV9E 4M6OL 1GGCL 2W9EL 3S6CA 1A6WL 2VIRB 3WNPA 5EC2A 2R0LL 1Q9OA 4I3GA 4MB4A 3PP4H 4HWZA 3LSOB 4WCYH 2X89D 3RAJL 5F7HA 4RMQA 1FIEA 3O6KL 4UQ2A 3OTTA 1M6OA 3VFSA 4MDIB 4KKAC 4EI6B 4F15B 2VDKH 1XGYL 3DV4A 4OIIL 3QFDA 3VFRA 2PW2B 3VCLB 4ZD3H 5HDLA 1KFAL 4N0YH 3NGBB 2V2TA 5F7EL 2HT3C 1VADA 4E5XB 2R1XB 1KB5B 1NGQL 1FC2D 1EMTH 3LS5H 5BMFL 3FRUB 1OB1B 2AK1H 3O3BB 1QNZL 4OD3L 1LO3L 4EDWH 2AGJH 5ETUB 3AREB 3MV8D 4OLYL 1DR9A 3ARYA 2E9WA 2Y5TA 3MO1A 2WIMA 1OGTA 1OQOA 5KJRL 2VR9A 1OHQA 3KPLB 2NY7L 4LSPL 4ZUVB 1FL6B 3GNMH 3TT1H 1YEIH 3BH8A 3MMEA 1UCTA 2FLRT 2ARJB 4C56A 1KLUB 3CPLB 4PJEF 4JHZA 3HCVB 3S37H 2Y36L 5CP3H 5LBSH 4QO1A 3U9PL 3VXRE 1AGCA 2O5XL 1ZVSA 3O3EA 3LCYA 5KVDH 3IDGA 4RX4D 4OLXL 2B8OT 5DUPH 2YXMA 5CJBA 3QZWG 3SKJL 2DM4A 4NQVA 5IEKA 2DRUA 5SV3A 1IAIH 3JSSA 4PJDE 4X4YB 5KSBA 3LKRA 1MFDH 3OKNB 3PABB 1YQ2A 2P5EB 1OAUH 1BGXH 3DUUB 2VXTL 1LK2A 4G6FB 4Y4HB 4NN7B 2PXYA 3U0TB 3TBSB 5K93A 3C08H 4EN3C 4OF5A 2YEZA 4BQ8A 2DMCA 5DURD 3BPCA 3DETC 1NCCL 5D2LE 3TO2A 5D2NB 3AXLA 1RUPH 3L3DB 3MOQA 5IHUH 3IXAA 1KBGH 1MH5B 5GS1C 5HVWA 3U0WL 4JKKA 2DQHL 4ZFFA 4JGJA 3QXDB 3O4OC 2IF7A 4OGYL 1N2RA 5ALBL 5ALCL 3PHOB 3MV01 3TCLA 1IZJA 5GIRB 5KZCB 1AO7A 1I9IL 4Y5XA 5D1ZC 1YN6B 5DJ6B 2X4RB 4FP8H 3G6DH 4HJJH 4MB5A 2HA1A 2OL3L 3AFLA 1OGAA 1AGDA 3MRNB 4WI2A 1FLRL 4JLRA 4CKVX 2HAZA 4Y1AA 5I8OL 3V5KB 4Z9KB 1AD9B 2NMSA 1KUMA 1SBBA 1SEBB 2WP3T 1ZLSL 5CP7A 1U8OA 1PBYA 4PYHA 5BRZA 1R24A 4IS6B 4QY8B 4ZAKD 1MAKA 3NA9H 2ARWA 2AJZB 4OCYL 3BMVA 1HHKB 4JGUA 4P46C 5CZVH 2EECA 3E6FA 5F96H 2DJ4A 1NGZB 4P4KC 2WNGA 2VLJA 5E2WL 3ZKMD 1Z0NA 1SVCP 1D5BA 4TQEH 4I0PA 4IEFB 4GMSL 4U1HB 5IFAL 5MHSE 3OF6D 2I5YL 2D7OA 4DUWA 2ATPA 1D6EA 5TQ0L 5FUZL 4F33B 4QHNA 5TE6L 3BUYA 4GBXB 4FFYL 4PJBE 4B7LA 5CILL 1KELL 3RY6A 3MRRB 1Q9WB 2P8MB 4LHUG 5T33L 1XF3B 3SEPA 2AV1A 4PJXA 1MI5A 4JPKL 4CADB 1JN6A 1M1SA 1WAAA 4G8GD 2XZZA 4Z7UE 1T6VN 3ZDXF 5J8OA 4Z77A 4MAYC 4GO6B 4WW2F 3RKPA 1F90L 3SKUD 4D94A 3RVVD 4XAKD 5SX4H 5IESH 1I8IB 3JUYA 2C4XA 4CU7A 3ROLA 3W0WE 4KVNL 4UQ3B 4OGXL 1QA9B 3B43A 4X6EB 4PP2B 5HYSB 1OTSC 5C07E 5I73B 4ODXB 1N5AA 4NM8L 5BJTB 2XT1B 4LL9A 5DRNA 5EUOB 2QBWA 2D7TH 4AIZA 4IMLB 4NOBA 3CH1B 3PWPB 4PBXA 3ES6B 3SE9H 1QLFA 1MRCH 3QUML 4NC2B 4NP4H 3O2WL 1A7PL 2R8SH 1KACB 3PQYB 3I6KB 2XA8L 1A3RL 4OUUA 2F53D 4IDLA 1FO0H 2LU4A 4H1LB 4UB0H 1A9BA 1NAMH 4PRHA 4Q2ZB 3U4BH 4EI5D 4L8BB 3RDTC 3LKPA 1EHLH 1A5FL 5E00B 4IRZH 2WW8A 2B4CC 5ESVB 4RAHA 1A6TB 2AKRA 4QTHA 2A1WH 1FYTE 1G7MA 3IDJA 4U1JB 3SGKC 1FZOB 4H26B 1OPGH 3GMMB 4M7KH 4MQXD 3ARRA 2CKBA 3P0GB 4R2GB 4Y0GA 2VXSH 3QJHB 2A9ML 1YECL 1OTTC 4OM0H 4PIRF 1WBZB 5FM4A 4NUJB 1EGJH 4ZG1A 3LEYH 2G9HA 2XI9A 4PJCA 1TJGH 4HX1A 1MCHA 2I27N 1FORL 1G0XA 3OAYK 1VGEL 2VISA 3ZKND 1FH5H 1K3ZA 1SMAA 3MLWH 5HDBF 3R06A 4PJ7A 1NMAL 3UJJL 2B2XL 1AP2B 3G9AB 1JPSL 3MLSL 1IAMA 3TN0B 3MCLH 2Z0BA 1RHFA 1A1MA 1I7UB 1A4JB 2W0PA 1T7ZA 5CD5C 2HMID 5BVJB 1ZMYA 2APTA 4GMTL 5IB2B 5MEPA 4HMEA 3RWCA 2XFXB 4XC1L 1O5DT 3DURA 5IIEA 1K2DA 3U2SB 3S3JA 1CFBA 3ARDC 3OB0H 5JNYB 2D0HA 4GRLC 4WDIA 4B5EA 1MCPL 1YEFH 2IAMB 3UZQA 5JORB 4M9OA 1MCNA 2WANA 4I77L 4CRPA 1K3IA 2H9GB 4ZSOB 3D85B 4QHKI 3TYGL 3D69A 5GSRA 2XKSA 1AHWA 5EH1A 1KV3A 1MCJA 2QADD 3OAUL 4YHNA 4R7NA 4FZEH 1ONQB 4AENB 1KJVA 4HZLB 4ZFZB 1A2YA 1T22A 1KJMB 3O9WD 3OQ3B 1G0DA 2Z31A 4JFDA 3BPNC 1BWWA 5CSZA 5SX5K 5DJ2A 2PW1A 5B22A 3KYKH 5SWSD 4J8RA 2X4OA 1LQSR 3MLUL 5HD8C 4MMXC 3MRMA 4HC1H 3QDGB 2VLRB 2W0FB 3HMWL 1BZQK 3V2AR 2P5WB 4MHHG 1XF5B 4PTUB 4OLWL 4AEEA 3RI5K 2A0LD 4F8QA 4NFCA 3O3AB 4HUXB 2YOCA 5IKCA 3L5WA 4IBLT 3VH8B 2NY4C 3V79C 2G5BB 3TF7C 1DVFB 2BSSA 2PO6D 4HUNB 3OKOB 1T5WA 1KJ2H 1VPOL 2GJ6D 3MBEC 4UT9H 3SDCC 2PCPA 2BNRA 5I1EL 3VWKB 3VXSE 2FX8L 1PX4A 4XNUL 1TZGL 5EBLB 4P5TC 4O2CB 2QLVB 4Q6IC 5T1MA 3D39A 1W72A 3T77A 4EJ1C 4HD9A 4Y5YB 1IBGH 1MRDL 5GS2D 2DDQH 3WD5H 4MD0B 4G6JH 4HULB 2GSIB 4NC1C 1FJ1B 3U9UB 2GTZB 1RU9L 4NM4H 5MP6L 5IVOA 1B6UA 2ZUVA 3OJVC 3N50A 5DD0L 3GSVA 4JFZL 4U1LA 2CLVA 5AZEH 1OWWA 4NQSA 5T3XD 4U0RC 2H2SC 4YIQB 4CU6A 3KLAA 5GGUB 1OF2A 3RKDC 4ONFL 5ADPH 4UTBH 2HVKB 3BP7A 2ZUTA 3UTPD 3FQRA 4A2MA 1U8MA 3KR3H 4UIMB 1AE6H 1HDMA 1CIDA 3BMWA 1M7IA 3QDME 3ILPB 3QA3A 4YLQT 4M61A 3C5SA 3ARBB 3QUMB 3UAJD 3UBXG 5F1NA 5C0ND 3MJ9H 4HKZB 4KJWD 4XRCB 5DA4A 4OZFG 4LCUA 1IC7L 1J1OH 2DBLL 3DUHA 1P7KA 3QIBB 5B4MD 5LG1A 5DSCB 4HPOH 1I7RA 2R0ZH 2P8LA 1ZHBB 1LO5A 4NZTH 3EZJB 4NQED 4GS7C 1Z0MA 4RQQA 3NCBB 4EN3A 2YA2A 4DVBA 4IRSB 2GSGA 4K7FB 4PGEB 2B7DT 3KYOB 5D5MB 5DRZA 4YEEA 1C7SA 2MCG1 4QRRA 2VUYA 5TGBB 2DL9A 2QQLL 4KQ4H 3O8XA 3FFDB 1CFQA 1FQ9C 5JUEL 5D1ZA 4QXUL 2PTTB 4FQHB 4U1MA 1P84K 5D2NE 3TFKD 2BFVL 1NLBH 1FBIH 3NACH 2VL5A 5C0JA 4M8QB 5D7LE 2VLKD 1OWRM 4RIRA 5AZ2L 1RVFH 5SWZB 3UJIH 3WYRA 3IJYA 3MV7A 3KPRE 3UO1L 1A4KA 1MFCH 3DYMA 4D9RD 5F97E 2YD9A 3KS0J 3BPLB 5E8PA 3K4ZA 5GHWL 2OQJB 1J12A 1G9MH 2HWZL 5EIVA 3MUJA 1C1EL 4XP9L 4XVJL 3QUYB 2E6QA 5H2BB 4P4KA 5LWYL 3DIFA 3DSNA 3VFVA 1IQWL 3TA3A 5C0RL 1MFBL 3GI9L 1F6AB 3EOTH 4JY5H 4NJ9L 3HR6A 5F71A 4P5KA 1T20B 3HB3C 5I16B 1E4WL 4LF3A 4G6MH 4NDMB 4MVBD 2FO4A 3SJVB 5DRWB 3H3BC 3IXTA 5E1AB 5FYKD 3I3EA 3RTQC 5TF0A 4PJHE 3R0MA 2GY7B 4JM2D 4LLYB 4XH2B 5EN2A 4XT1C 4ZUWB 3TBWA 4TRPL 3RNKA 2BZDA 3JV0A 4D9QD 4ODTL 5JW4R 3PJSB 3QDAA 3IDMA 3JVGA 3BXNB 2NY5C 3NZ8A 3V6ZA 2RJMA 4W6XB 4KGJA 1HSAB 5E94A 3WIFB 2W0LA 4XX1G 4KRNA 4UOW0 2BSRA 4Y19A 3BI9X 3LPGA 4U33A 3RIAF 4LEOB 1YC8A 2AJYH 2ZJSH 4Y8AA 2FIKB 1IGTB 1R5WA 3SQOL 5CEZL 1U8HB 3PWUB 3UPRB 2KH2B 4BH8A 5DFVC 4LIQE 4NN6C 4FABH 1BJ1H 3HZVB 4ONHA 2VQTA 5GGSB 5DEFB 3JWNC 1MHHA 1E6JH 1DQJA 2MMXA 2OTUA 1IM3B 1S5HA 4YGVA 3CFKA 2D7TL 3O4LA 4WUUD 1KCVH 2D9QB 3I6LE 4FFZL 3VJ6B 3A6CH 1FC1A 4J4PC 3VXNA 1PG7H 1IEBB 1TTGA 2XZQH 4PRNB 1UENA 1CU4L 2PETA 3JWDH 5L8LB 2UZIH 1RV6X 3PWPE 5ACMA 1WITA 2BSTB 3GMRA 4NJAL 4JRYD 3MRQA 5ICZB 3FFCE 4OUOA 2CLZB 4DZBA 1CBVH 3SGKA 2X4TB 1TQCB 5GRUL 3PV6A 4DW2H 1WIOA 1EXUA 3T04D 1I1CA 2AJSL 3ISWA 2XWJB 2X4PA 3VFUA 3LEVL 3CSYB 1CXLA 1RURH 3HE7A 3ESVF 5E4EC 4L4TB 3X3GH 2X70B 4GKOA 3SDAD 5IW1B 2ESVB 4PLJC 3TH3T 4B41A 2CMRL 3ROOA 5BOZG 5HYSG 4O2FA 1SY6A 1C5DB 3W9DB 4XNYH 1FVDB 2G2RB 3LS4H 2VC2H 3T3PF 2HFEB 5DJCA 2FSEA 5BS0E 3OB8A 3IS1X 3BEVA 2R29L 1ZSDA 4JRXA 4QRSB 1INQA 4QCIA 2NXYD 2DQDL 4GUPA 5BZDB 4IOFC 1C12B 1CLZH 1V3MA 1Z3GH 4XI5C 4XVSL 4X0KB 5CBAA 4GRLA 3L1OL 1ZT1B 1IKNA 1Y6MR 4H1LG 5AUMB 3WLWC 1NC2B 4YHOL 3T4YB 5JR1H 2WWKO 3GJFK 3B5HA 3D3VE 4PRPA 2VDRH 3TIDB 1EVTC 4LHUA 1ZVHA 4LLDB 1NCAL 3EBAA 5KSUB 2X9WA 5HHXH 1JGUL 4MCZB 4NGHL 3WJJA 1MCOH 1PYWB 2VDQH 2QTEA 3BFOA 3MACL 1U92B 5EU6A 5DT1H 1YEFL 4F2MB 2XKNA 4OCSL 5BV7C 1IGFL 2GJZB 3B9DA 1CD1B 3DXAA 1JZ4A 5D1QB 4L5FL 3L5HA 3N9GL 4ZSOE 4S1RL 4X7SL 4X6CA 5GJSH 4V2BA 1XCQA 1NMCC 5J6GA 4HUKB 1MUJB 4DCQA 3CK0H 1FL5A 2NX5D 3DMMD 4TTDC 4POUB 4HS6B 3P4OB 4HUVB 2H8PA 1ZLVK 1LP9F 5HDOA 2F9BT 1WK0A 1U93A 1YY8A 4S2SB 4R97B 3O6FA 1JHTB 3G08A 1ES0B 4LIQH 4ZTPL 3CFEA 4AJ0A 3D0VB 3SDCA 3DSFH 1U8PA 5EOCJ 3MRBB 5GS0C 1HSBA 4GAGH 4P99A 1BHGA 4BSVA 1JNNH 4LDLB 1QBLL