2DWEA

Crystal structure of kcsa-fab-tba complex in rb+
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords ANTIBODY FAB HEAVY CHAIN
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2006-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dweA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dweA02
1JHKH 5F7EH 2IMMA 3WV0A 2Z8SA 4HUXA 4TOYL 1NMCC 4UQ2A 2BSED 4F57H 3QUKB 1BQLL 3IFPB 3MRLB 4IRJB 1KJVA 3GMRB 1XF2B 1T1XB 4XPTH 1QPPA 4J4PA 4TUKL 1PD6A 2A6DB 5DS8A 3OGOE 2QQLH 4QT5A 3MLVL 4ODXA 5IG7A 4PP1C 4Q74A 1DANU 1A6PA 4BH7A 1S7UB 2HTLC 1NL0L 4PRNA 2P5WB 3UC0L 3PWPE 5E95B 1IMHC 1OL0A 1D9KB 1NGQH 4RMQA 5AWNH 1VB9A 3LRHA 5F3BB 1P5VA 2KL6A 2B1AL 5D1QA 5HI5D 4GSDL 2FATH 3S3JA 5EIIB 4LSTL 3S3SA 5CJXA 2GJ6A 3O4LE 4PUBH 4APQC 5CJOL 3QJFA 1A9BA 4OQTH 2CPCA 3C8HA 3WFDH 4F58L 4XVJH 1HWHB 3GK8H 3L5JA 3SKMB 4CN4A 2DKUA 4XB8A 5J1AA 5BVPL 4R2GD 1Z2KA 5TF1L 1BQHA 5C3LD 3QO1A 1RVFL 5ESVB 3X13B 2VB5A 3RAJL 2FEEI 3KNBA 5FECB 1WZKA 2P45B 4P23C 5D70L 3LV3B 4PRPB 4BFGA 1T7YA 1E27A 2HFEA 3QIUD 4HJJL 4K7PY 3F5WB 5D7SL 5DJYB 3VXTA 3PL6C 4OCWL 4V1DA 1E4KC 5F7EL 4NOBA 1I3GH 2X1PA 4MB4A 5I1EL 2FECI 3CDGA 3KPLA 3F62A 4HFUH 2NNAA 4F57L 1ZLUH 1T0NA 4D0CA 4F37K 2JE8A 1PKOA 5HY9A 2BCKA 1CFQB 1E4WH 1MCOH 3QEUB 3WUWB 1EHXA 1HHGB 4M93B 3VRJA 3RVUD 3MJ9A 4XAKE 3VXMB 5TFSL 2Q8BL 4KJYA 4NPYB 4ZSOE 4PTUB 2Q76A 5CHNA 3ULUE 1H15B 3I3DA 4TQEL 2VXUH 5F96H 5E8PB 5DMKA 3NAAL 2OTUB 2MCG1 2AJZA 2A9NL 4XNQA 1R3KB 2VSDA 1LO3L 2HFGH 4F7EA 3L3GB 5SV3A 3DMMA 1RZJH 2GK2A 1FO0H 3QFJE 4FQJL 3VD4A 1ZVSA 3DROB 5AD0A 4YHOH 1CF8L 5GGVL 4EZMA 1ZLSL 5HY9B 5D2LA 2RR3A 3T0EA 2GAZB 3BP6A 4OZHA 5K33A 4M8QA 3TO4B 4P2QE 4LSSH 1FHGA 1DTUA 1ZT4B 4QOKB 4XRCA 5CZXC 1D5BB 1X6LA 4MA3B 2C1OB 1JTOA 2VN4A 3IFOA 4X7DC 1G9NH 2EO9A 1ZWIA 5DHYA 5EU4A 3LAFA 1JV5B 5ESQB 5JW5B 2R2BA 4X99A 1B0WA 4WHYG 3RX5A 4X8JB 3MOBL 4JKLA 3DURB 5IBTH 5F93C 2GI7A 4N0FB 3OKDB 3NACH 4HLZG 4WW1B 1A6TA 3QWQB 3PGCB 4POUB 2CLRA 2QQNH 1ZHBA 3QUYD 3O6KH 3FFDB 4JPVH 4GLRH 2UY7A 4HH9A 3VFOA 5IB3B 3IJHA 4X6DB 2YD8A 1RZGB 3ZKMC 3DX8B 3D3VB 4IRZH 3SDXF 5IMMB 4GG6F 2WQRA 1CXKA 3RX8A 1V3LA 2XXMB 3EW3B 3OXSA 4ONFH 4RGND 4ZTOH 4KKAC 4L5FL 1T7WA 2HKHL 2Q8AL 2EDEA 4JN2A 4ZXBC 1JZ8A 5FKAB 3N1PC 4B5EA 3QIWD 3U30B 2GJ6D 1OT2A 4LAJH 3KLAA 5A2IH 3P73B 3L5WA 2YWYA 5CD3B 3B2UD 4AT6B 3SY0A 1TQBC 4TSCH 3GEWB 1K5NA 3O9WC 1KC5H 4FZ8H 1DQLL 3HCVB 2HA1A 3U0TA 4N0YL 4MCYA 1S9WB 5DJDB 5EFIB 2AJVL 2F54D 1C5DB 4LSPL 3FO2B 5HHMD 3FZUD 3H9SA 5CKAA 3OHXA 3I2CH 1OSPH 4JZOB 2ARJQ 4TUJA 1DVFD 4J4PD 4JLRA 3OXSB 3P11H 2OJEB 5ENWA 3S36H 4NYLA 4XXDB 2OJZH 4R96A 1KCSH 1QFPA 1U8OA 2MQCA 5FHBH 3RTQC 2ZG3A 3FO0L 1JP5A 4M6NH 1KIUA 4JHWH 4G9FA 3VFTA 1CLZL 1XFPA 3GHEH 5D6DC 2IH1A 2FX7H 5M7QA 4XBEH 2MQ0A 1A0QL 2GJZA 3CSGA 3KPSA 3AM8A 4M43H 4N8PA 4WFFE 1ITCA 3WYRA 3P0YL 3ALWA 3MODL 4HCRA 4GMSL 4NSKA 1J88A 1MFBL 2IC2A 2XKNA 4G8IB 4LLAA 4JZOA 5ITFB 4Z7QE 4JLRB 4RBPH 4Y1AE 2HTLD 3MGAA 1MFCL 4R97B 3FAXA 5HGDB 1PKQA 3MJ9L 3NN8A 1KTRL 2WANA 4UT9H 1IGIL 1K6QL 4JG0L 5T1LB 1JYWA 3EOTL 4AL8H 4R0LB 4OLVH 2W60B 5CCKH 3VXQA 5EC1B 1B3JA 1G6RB 3FRUB 4ZTOL 2G2RB 2VUOA 4OFDA 1G7MA 1BVLA 1FNSL 4WDIB 3HZVA 2F53E 1JWSA 1RJCA 2A9MH 4L1DA 1UEMA 3EYOA 1YEKH 4HUXB 1X6NA 2R69L 5IHZA 3QFDA 2EDQA 4GUPA 4JREB 1C16B 1OSZB 3O6KL 5B38A 4HX1A 4F8QA 3E8UL 2CUMA 3HUJA 3GMPB 5BS0A 2X4QB 4UDTB 2CJUH 1A7RH 3QG6A 4XNZB 2GCYB 4X4XB 5C0BE 4NRYA 3FQNA 4P2QB 3ARWA 1BAFL 3QA3A 3W9EB 1IAIL 4I9WE 4PR5A 2CIKA 3STZB 3O2VL 5I71B 1MJ8L 5H37H 2PTUA 2XY2A 1CLZH 2P47B 1JTPA 3K46A 2VLRB 4F7PB 1KIPA 3IVKA 5ICYA 4HGWA 3FTGA 1AD0A 3U0WH 2EDKA 4Z8FL 4JG1H 4JFFB 4NQDB 1NSNH 5FB8A 1TPXC 5D7LB 3UTSA 5ADPH 1J7VR 5CSBA 2X1XR 1G7LB 4U05A 1LE9B 1U8QA 3IS0X 4ZQKA 1ZHNA 2H3NB 1RPQA 4IIQB 2Y5TA 5IB1B 1O5DT 2W65A 3VFNA 1WWAX 4NRYB 4JZNB 3T4AB 4UIMA 4OM0L 2YD6A 3QHTC 4QXGH 4Z95H 3TBVA 4C83A 2NR6D 3A6BL 3IU4H 3BXNB 3D0LB 4O58L 4ZUVB 5HGAB 5D1XB 4FG6D 4NQEB 5IJKA 4GW1B 2FH6A 1EAJA 3BP7B 4PJCE 4ZUUB 3QEGL 1EZVY 4XCNB 4DFIA 4NKMA 1YMHB 3IDNA 4MJIB 4KGLA 3F5WA 3REWB 4I3RL 3P30L 4ODVL 3SDXB 5D7LA 1JWUB 3WIIL 1INDH 3F7YB 4P4KC 3T3MF 1NFKA 2VDRH 3RVTC 4D9LH 2FGWH 1T0NB 4U3XA 1E6JL 3C09C 5IHUH 5A2KH 5DVKA 3LMJH 3TJEL 3GRWL 3D9AL 1KCVL 2B0SL 2PTVA 5C0CD 3OX8B 1ORSA 2VLJB 3L3OB 3QT2A 3LN9A 5F6HJ 5DWUL 3ZDZE 3CVHL 3VXUA 1N64L 1HHHA 1OGAD 4LDLB 5DRNB 2QKIB 1UM4L 1AQDB 4NC0B 5DI8B 3UPAA 1DBKH 5GZOC 1KIRB 4D9QD 1CT8A 1ZTXH 1GGYA 1SBSL 4YXHL 2AXJA 4XHJD 3DBXA 5E9DD 5IB5B 4NO2A 3IDJA 4XP5L 1NGWB 1LDSA 2CLZB 1MHPH 3SE9H 2QTEA 3WS6C 4BH8A 4QF1B 4CVUA 2ESVE 1JHTA 3T65A 1NFIB 5MERA 4TYUA 2JB6B 5FIEA 3TYFB 2W9DH 1MRFL 1IGMH 2IANE 1KCKA 1ZHKB 3T0ED 4R3SA 3KYNB 4YXLL 3J8F7 4PGDB 1NL0H 4WU5B 4Y16A 2C9AA 2WMPA 4Q2ZB 4GS7B 4G6FD 3IKCB 2EO1A 4TUOA 5H8DA 4M5YH 1MRCH 2CO7B 5JOPE 4FQQB 4JB9H 4M1CC 4NQXA 4FQCL 4U7SA 4CMHB 2HLFD 3GM0A 4LP5A 1YEJL 2YUWA 5GGRA 3HFMH 4WFGD 4XMKL 2R56L 1CDBA 4C56E 4LSQL 1MI5A 2BSTA 4NCDA 3ES6B 3ARBC 1L0QA 2BNRA 3BPLC 1TZIB 1FL6B 1V7NL 3QCUL 1NH6A 5CBAA 4UINL 3UZQA 2FEDC 5DO2D 4Q2ZA 5CEXA 2CKBL 2M2DA 4LVEA 5CLWA 3V52L 4YGAB 4KKBD 3WIFB 1BBJA 2E6JA 5MENE 1AXTL 4LCIH 2HFFB 1CVRA 3ESUF 4UT6H 3TVMC 1CXHA 1RJLB 3HE7D 1JUFA 1IC7H 4NJAH 4JKPL 4G6JH 4MCYB 2Y36H 2HLFC 1F3DJ 2P5WD 1C5DA 4YQXH 5DTFA 2WBKA 3OG6B 4AIXA 3WNNA 5KSBB 5BRZA 4PY8I 1QFWL 4XCFH 1A3RL 1X44A 2GHWB 3DOSA 4U33A 2OJEA 5ENWB 3QPQD 4OQTA 3DJ9A 5IQ9B 4QTHA 4X5LA 4H1LH 1QSEB 4JM2F 4XTRC 4Z95L 4YFEA 5DEFB 4HS8H 1JYVA 4X98B 5HHOB 2DQIH 1BBJB 3CFKA 1MSPA 5JO5B 2YA0A 3V9FA 4XPAH 1OD7A 4OCLC 2FJGB 4P4RA 3M17B 5GRJL 1JPTL 3L9RA 4QOKD 1VHPA 1WFNA 3LEVL 1M7DA 4N5EC 1KPVA 3TBTB 2IFGA 5I1CL 5EUOA 3ARPA 4GG8B 1NAKL 3EZJB 3MRNA 2EDXA 1I1AA 1CGYA 1WZ1H 1XF5B 4LRIA 3G6DL 4AK1A 2IANA 4P9ML 1LO0L 3PWJB 3VXPB 2IQ9L 4MZ2A 1YEEH 4OZIB 3GRWH 5L2JB 3OAUL 2WUCL 4CAGA 4ZS7H 3AM8C 3HZKA 1S5IL 4JCMA 1F00I 4CBPA 2ED9A 3LKSB 2FJHB 5IBLC 2J6EA 4QCIB 3HE6C 2VWEC 3AMLA 3DV4B 2BSSB 4GAJL 3VXMD 5EU7C 3RGVB 1S9YA 1CBVH 4K8RH 2EZ0D 2Z8WC 4UV4L 4LLUB 2HTKD 2F5AH 2IPUK 4UV7H 2DTSA 1CLYL 1GHFH 4X7SH 2Y72A 4RWHA 4JKPH 2PCPB 3M1BB 3MTRA 1HHIB 5ISZB 1C12A 1OAKL 3IDIB 5SWQA 4XH2A 1XF3A 3K7UA 4PR5B 4YDVA 5FDWA 3QDHA 2M26A 4O00A 3K1KC 5CD5C 4ZPTB 2VAAB 3ZTJH 3EUUA 4JRXE 2AKRA 2F53D 1QO3A 3O3DA 4LEXH 1V5JA 5LGKA 1Q9KA 3WLBA 1HEZA 4MWFA 4G9FE 3NABL 1ZA6A 1D5XA 4KXZH 5IR1B 3KPNA 4JFEB 5FGSA 4M6OL 3WFHA 4K7PL 5DQ9B 1WIPA 5FDYA 1MCQA 3MBXL 4NQCB 3N1GC 4RIRA 4EI5D 1FZOA 4M9OA 5D5MF 3ZKND 4K3EL 5ISZA 1EVTC 3LDBB 1BLNB 1ONQA 4KK8D 4LLDA 5E24E 2X4RA 1F58L 3IU3B 4HUNB 3SDDB 3GNML 5DVNA 2QR0A 1QLFA 4OD3H 3MA9L 3D0LA 1LD9B 3VD9A 4OFVA 2AP2A 3DV6B 2VABB 2VAAA 2IPKB 4RMUA 4L4VA 4U7MA 3JVGC 4DKEH 1TVHB 3VXNA 5DJ0B 3CX2A 5H2BB 2CDGA 2EDLA 1SVCP 1AIFA 4NRZA 2D7MA 4OGZA 1F3DH 4FP8L 2WLZA 1MCPH 4KTEH 2VH5H 5TFSH 1T0MB 5IT2L 1A6WL 4HJGB 4H0IA 4HLJA 3RWDA 3QQ3A 4DVRH 4L3CA 2R4RL 2XN9B 1H8NA 4BH7B 4L3ED 1B9ZA 3MJGX 4GKSB 4M48L 4YR6B 1CGSH 4F8TA 2P5WA 4TTDD 2VKXA 4MNHA 1XIWB 1P4LA 4IMLB 5LAXA 1U6AL 4UZGA 5HHOE 1YPZE 4HWUA 4OI7A 1NQBA 1MEXH 2UV3A 4DN3H 4BZ2L 1MCNA 4O9HH 5CILL 1RJYA 3WIHL 3UBXB 4YNYA 5HTSA 4K23L 4OZFB 3RVUC 3GMMA 1G7JB 2VNCA 4CVXB 3TZVD 5DMGD 3RL2B 1YEGL 3EYSH 4YEFA 1SHMA 4JHWL 2D3VA 4P59L 4PRDA 3FQXB 3B8SA 1JHLH 3MYJB 4RCAA 3MCKA 1N6VA 2QEJA 4KRPB 2N1KA 1T1ZA 3BZDA 1U8LA 1J9CT 3SDDC 1VKXA 2X4NB 4JFOB 1GHFL 4X7SL 3QZWA 4NFCA 3IFNH 5D1ZB 3CFIC 4YBHA 3VFUB 5CMAA 4GQ9H 3BW9A 2H6PB 3JTSA 4DTGH 3GIVB 1IGTA 2A6KB 4UAOB 2WINA 5DRZA 3MRQB 1F6AB 3MLSH 3AU1A 1P4IH 1DQLH 1H3PH 4YDKL 3ZDXF 2XYCA 1QLEL 2NY5L 2PXYB 2NNAB 3KR3H 5EH1A 1U8KA 3VGEA 1P69B 2OQJA 5TPWL 4LLVB 3UTPD 2A77H 5CCKL 5CKGA 3K80A 1GZPB 43C9B 3FOLB 1FFQA 1JZ2A 1TTGA 4PLOB 5L0QC 4P2OD 1V3KA 5IVXB 3VFWB 1MI5B 4IJ3B 2X09A 5T33L 5I1DB 1KJ3H 4BKLB 3KPRD 3U0WL 4XX1E 4NP4L 3WSQH 1FYHB 1J1OL 3HR5B 5IW1A 32C2B 3VFSB 3MJ6A 2IEPA 1IKNA 4NM4L 2XTJE 1L7TL 1HSBB 5CBEB 4FFVD 3WDHA 5JHLH 5I8EA 3WIFA 1N6UA 2X9XA 2DBJA 1BAFH 3OB0K 4IOIA 2EECA 2VL4A 5F9WC 2V7NA 3H9HA 3ESVF 3WIIH 2I24N 1EJOH 1D5ZB 1JPGA 3VI4F 1MLBA 2YD3A 4F7MA 4C56B 1S7VB 5EU6D 3RNKB 2PW2B 1OCWL 2NZ9D 1T1YA 5I1GL 3S37H 3JUZA 2FL5A 3EYQC 2Y07H 4NBZB 3TF7C 5HDBE 5IEHA 5L6YL 5DZLA 1WFUA 4X99B 3NGBC 1T04A 1MLCA 3ARFD 1BM3H 3OJDB 2F8OA 2P8PB 1P7HL 4N8CL 3WHE0 3LEXA 4Z77B 4N0FA 2W9EL 1MHEB 2GFBA 3QQ9D 2VC2H 2HG5B 4OCRL 2YRLA 5C8JB 1DFBH 1AJ7H 3HC3L 2JCCE 3HC0A 5FOBA 3B2VH 3ARYA 5JLZB 4L8CB 2KQNA 2VXUL 1VPOL 4YC2B 4S10A 4RGMB 1CL7H 5D6DA 4G6KL 3T0WA 1RZFH 4LSTH 1MHPL 1I1AC 4K8RC 2ICWI 3DSFH 4EI5A 1MAMH 4GAYA 5A40E 1DEEB 1UB5A 4KDVA 4XP1H 1E6OL 4BM7A 5KVEL 4MQ7A 1I7RA 3KLDA 1XGYH 3ARGC 4LLWB 1MCSA 5L2JA 3IYLW 3WDJA 2V9RA 3WSQL 4HUUA 2IWGA 1I7UA 4MNQE 4Y19D 1QRNE 1NCWL 2HT2C 1L7TH 5FF6A 3O3BA 1AGEA 2C5DC 3TZVB 4L8BB 3Q5TA 4LPUA 3QUMB 1G7PA 2CH8A 5JDSA 4DZ8B 5F9OL 4NP4H 3QH3A 5D7SH 4HGKC 2FGWL 2Q1EA 5A43C 4QRRA 1Q8MA 2RFXA 3GKZA 3ZKXC 5BOZG 3C2SA 2XRAL 5IGXH 1CDIA 3QSKB 2VISA 3QEQD 4MGXA 1CFNB 4YHIA 4S0SD 4YDKH 2PO6B 2X40A 4H1LB 4OFYD 3WO3B 4TULL 3AS2A 3IDIA 1MREH 3OKEA 5J3HC 1P9MA 3TBSB 4JZJB 3H9SD 5D96B 2DQHL 1PEZA 2YEZA 3WJJC 1D9KD 1JPFA 4NM8L 5I8CA 3B6SB 1U92A 3FONA 4MS8C 3KS0J 5HJ3B 5C0AB 2D4DA 3G9AB 1HOCB 5INDB 5HYQA 3U48A 1ACYL 4HBCL 4M5ZH 3RZCC 4XBPB 1T21A 2VC2L 4R6UA 3HMXH 3FT2B 4HWEL 2KZ1B 2CLVB 3ZT6A 1JZ4A 2AI0H 4ZOEA 2MSPA 4IDJL 3TO2B 5IFJA 3CFJA 1GH7A 1E4XH 3L1OH 2GJJA 2ICWB 4Z7WA 2FWOB 3IXAA 4WI3A 4JRXD 2MHAA 5F44A 3BESR 3DO7A 4PRIB 4XMKH 3X3GL 1EBAA 3T0EC 3AS1A 1QNZL 1MCDA 4JHAL 4YPGA 5C09E 5C0IB 1KUMA 5D7KE 5MEOB 1OHQA 3FFCB 1JWSB 3RKDC 5F89A 1MAJA 1MFDL 1MRDL 4WFED 3VMOA 1HYSC 5JOFB 4JFEE 3HI1B 1A6ZA 1Z9LA 4LVNC 4D3CL 5I1IL 1NFDE 4ZO9A 2XQYK 3TWCL 3MLYL 4MA8L 1I8MB 3GB7B 2DLGA 4I4WB 1AJ7L 4PJ8A 3MJ8A 3KPRE 1B6DA 5IF0B 4KTDL 3KJ4B 4BZ1L 2CD0A 4X8XA 2HKHH 2X05A 4LGPB 5FECA 4XWOC 2JIXA 1OTSD 5I1KL 2OCFD 3NOIA 5TGBB 5T3ZH 5T5NF 3CIQA 1IJ9A 2DLFL 4KUCD 2DLIA 4ODWB 2CR6A 1OARL 3RZCB 4GRLD 2YXMA 2O5YH 3IFPA 3P0YH 3WUZA 1CDYA 2EE2A 2YS4A 2FR4B 3WHE1 3GBLA 2G60L 2XN9E 2HWZH 3PDDA 3MYJA 1A0QH 2QADB 2VRAA 3V79C 4HK3N 2EC9T 2VXTH 3TBVB 4C83B 4ZNEE 5LQBL 5EBGA 3LN4A 1LEIA 1BBDL 4CN1A 1F42A 2XV6B 3VXOA 5BXFB 4M7ZC 4OCXL 1OVZA 4WW2C 5L2KA 3KPMA 3CAFA 3VFUA 1BD2E 3TT1H 3E3QE 2UZXB 5IJKC 4WTWA 1KELL 4OZ4A 4PV8A 5TGBA 1YEFH 4ACPA 3RWFA 3QXTA 2YPLB 5CWSA 2CQVA 5E03A 3WMSA 4MDJB 1ZGLM 3CFCH 2IADB 4HQQL 3OBAA 1TENA 1AKJD 3O2DH 4U1KB 1OWRM 1HDMB 4YFLI 5BMFL 1NGYA 4G5ZL 4U6XA 4JFYA 4L8SC 5TQ0H 1KXTB 3DI2B 4TNVK 3QNYB 3UPRA 3LN4B 4MA3A 5KOVC 5I1LB 5DRNA 5I16B 1G9MC 1RZIA 1L9MA 2D0FA 1XCTA 4J4PC 5DLMH 4OGAD 4WY7L 1A7PL 5JW5A 4RAVA 5ANMB 1E27B 4LEOB 3CH1B 2X1QA 5AWNL 32C2A 1BF2A 1HH6B 2GYSA 4OLYL 4P2OB 5CSZA 3WJLA 4EOWL 1RZKH 5C0CE 1YQVH 4U6YB 4FXGB 5DUPH 1UXWB 5SX4I 4JANA 2UWEF 4WGVB 4OLXH 4M00A 1IGYA 2CLZA 2J12B 4MJ6B 3PE9A 3Q3GA 3BHBA 3EJZC 4RQQB 3O3EB 8FABB 1GPOL 1ETZB 1B0RA 1S7WA 2E7HA 1MCWW 4R26L 4FQHB 2H9GB 3WUWA 3DX8A 3BT2H 4G3YL 1LVEA 4XMLH 2OP4L 2OX5A 1U3JA 4P46C 5DD6B 3ZKSD 5EOCH 2D9CA 5TF1H 4AIOA 3F8UB 3CC5A 1J18A 2YA1A 3I3EA 5BJTB 5F7YC 5CD3A 2FX8L 4PJBB 2LTQC 5DFTA 2AJZB 4KRPD 4RRPA 1VGEL 4BSVA 2P24A 1K5NB 1FVCA 4XGZA 4Y2DD 3CX5K 5GGSA 1UADC 4GXUN 3O45A 5GXBB 1KJ2H 4X9BA 4NC2B 2NX5B 2Q6WB 4PJAA 1AFVL 4ODHH 5IESH 2NX5E 5JMOC 4EI5B 1R3IL 1IC4L 4U3HA 4WW2F 3JZ7A 2P44B 1NC4A 2MCPL 4X4YA 3CC5B 5ADPL 1A4KA 3O9WB 1HYSD 4YBQD 1QEWA 4FFYL 2DQCH 1FZMA 2JF1A 3VWJD 4G8GE 4WW1A 1MRDH 1RZ8B 4I18B 4MAYB 4NWTL 5EO0A 3MRRB 3QWOB 1U41A 3QUMA 2Z8RA 3U83A 4WUUA 5FXCH 2OL3H 1MF2L 2IMNA 3CZFA 12E8L 2HT4D 1S5HB 1QA9A 1YMMA 2AAVA 3B83A 4RGNB 2R0WH 3FQWA 3TLRA 4RA3A 2VLJE 3HFML 5ID1B 3GSNB 3QIBC 3O9WA 4OF8A 4ONHB 3O6FB 5J6HB 1N64H 3IRZA 3QIWC 5IWLC 3VXRA 4E0RA 1AR1C 5JO5A 2P1YA 2V2TB 1MJ7H 1EAPB 1KGCD 5C0CA 3W82A 1A4JA 1DQDL 3LMJL 3TJEH 4RAHA 5MENB 4XC3L 3TT3L 3VE0A 2GEEA 1WT5A 4Z7UE 1BVLB 4CKVX 1NUGA 1A3LL 1NEZB 1U3YA 1YQVL 1CDHA 1Q0XL 4UBDC 4JFED 2IBBA 3LQAL 1NC2B 4HBQA 1VFAB 3CCHB 3QHFH 1MWAH 5BZDA 2NPLX 5D2NE 1AY1H 1QKZH 5FUZL 3KS0H 3VGHA 3RU8L 1YUHB 2YWZA 1P1ZB 1IM9B 4JN1L 5J1TC 1FYTE 2A73B 1T6VN 43CAA 3WNOA 1T0PB 4L5FH 1EEYB 5C0AE 4FQXC 1DE4B 1VACB 3AUVA 1B2WL 1NC2D 4J6RH 1QSZA 1EFXB 1KCRL 4X7TA 2WWMC 3GSVB 4OKVB 4N8CH 3VE0B 5SWZE 1RUPL 2GJZB 1MHHB 5H37G 4MQXD 2NTSP 3GJFA 5D7JC 1XIWC 1I4FA 5HI5C 5LBSL 3T0EE 5FO7A 3SPVA 1FZJA 1OLZA 3O6FD 1K2DA 4QHMA 4GMTH 4U1MA 3T3PE 4CDHA 43CAB 3GSUA 1E6OH 1UACL 1QQDB 2Y5EA 1F02I 2XT1B 1ZLWH 1DUYA 4JKMA 1A14H 3U1SH 4K3JL 3AC0A 3GRWA 1R5WA 2XWBA 4KJPC 4LSUH 4JQVA 2E9BA 2JIXB 2Z0BA 2VR9A 2DQCL 5DGQA 4H25B 5DK2B 1BVKB 1JF5A 4YK4B 1RZJL 5HXMA 4NKIL 3SGEI 4NZDA 1OAXH 3HZYA 3RVWD 3B3IB 2JJSC 5HI3C 3JV6A 3O6LL 4G8EA 2BNQA 1A5FL 4PREA 4FFYH 3U9UB 3RDTB 3PG2A 1QVOA 2ZP0T 3QJHA 4KY1H 5IW3A 3SDYL 3T4YB 1NCCH 3TN0C 3HAEH 4YFLF 2MWCA 2A1WL 2K3TA 2I27N 3MCG1 3NAAH 3UX9B 1MQ8A 4MNGE 3WXWH 1N6QL 4J3VA 5MI0C 2UUDK 2EDWA 2I60L 3ZL4L 2FECL 1H3PL 1RSFA 5HHVH 4YFDB 2FDBP 4N8VB 1AQDA 1OAQH 3OKLA 3TFKC 3I50H 4P23A 3TPUB 1R3JA 4M61B 5H2BA 3PWPD 2AS5M 3RIFF 4HEME 1FG2B 1S3KL 4F9LC 4I2XA 1WITA 4PRHD 3HZMB 2AXGA 2XTJB 4PG2A 4R4BA 4OAWA 1TITA 1X5AA 1SJEA 4L4TB 1KJ3L 4NKOA 3AS0A 2WP3T 3RIAK 4WNQA 2AI0L 4XXCA 4UI2A 5DZOA 5C7XH 3TNNB 3DGGB 3MPCA 4PGDA 1B0GB 3ARBA 1YNKL 2Z92A 3N9GL 1ZAGA 3MBEA 3FB7A 5E6ZA 1F4WL 4XCNA 2W0FA 4KKCD 2LAGB 4H0GA 3UTTD 3PWLB 5AZEH 2X4OA 1CG9A 1I7TB 1N59B 5CSZB 3RVXC 1D6EA 3E6FA 4XMPL 1FPTL 2OL3L 4EN3B 2IJ0C 2ESVB 1F4XL 2ZOLA 5GHWL 3MR9A 5B8CC 4ZD3H 2FO4A 2DF3A 2AV1B 4MXVF 5JIIA 4M1DH 5BO1H 2H2PC 2H9GA 2F58H 2EICA 3D39E 2R23B 5M94B 4HKZB 3IFOB 1DDHB 2NY0D 3DGGA 3HG1E 1FN4B 1AKJB 3GMLB 2AV7A 1DFBL 3LPWA 3HNTH 5JW3H 1TTFA 3TT3H 3V5DB 4QEGA 1UQSA 2YPLD 4LQ1A 3B9KC 1TZHA 2HJLB 4HIIA 4OB5H 4NGHH 4Y7MA 3FZUC 1UB6B 5C2BL 1KB5A 2ZOLB 1KIQA 4CL7A 3WIHH 4Q9QH 5EN2A 4NKDB 5FKPA 3ARDB 3T0AA 4IS6A 3ROLB 4B41A 3WEXB 4PJAB 5F1IA 5I75B 3CK0H 3DI3B 5KVFL 3RGHA 5DQJB 3G08A 1BQSA 5CJOH 2VXTL 5BS0D 3FFCE 1GGCL 5F72S 1D6VL 4LGSB 4OGYL 3OKKB 1OAYL 5J0BA 4NFBA 3VFSA 4M6MH 4YX2H 4P48A 5DJAB 3V0WL 3BDXA 4P5TD 1TCRB 4Q0XL 3IAGC 4QXGL 2FJGA 4F33A 2VLLA 5B8CB 3GSXB 1JPGB 4F7MB 1TNMA 2C3VA 5C70A 4P57A 4NHUA 5E70A 5HPOA 5ID0A 3WE6A 4KPHH 1KLFA 3OXRB 4YHZH 3HTLX 4O2EA 2J6EL 2OTWB 5TH2A 3WO4B 4XVTH 5HYSB 5C08A 3VXPA 4Z8FH 2EXWC 2FX9L 1PEWA 3QPXL 2DQHH 2EDRA 2B5IC 3MROA 4LBEA 4IDLA 2Y4SA 4MX7A 4HF5H 4OM1L 1J10A 3GIZL 1HIMH 4HT1H 1GOHA 3BJ91 1L4IA 5E7FA 2IH1B 3MREB 2BSSA 2Z31B 2X7LA 1A7RL 5F1NA 4WI6A 1DBBH 2XWTB 1KB5H 4NCC2 3ZO0A 1U93A 1CF8H 5GRUL 3NH7L 2F9BT 4CJ0A 4AIZA 3PQYB 1S8DA 3L6FB 3MRHA 3VH8A 1CICA 3UP1A 4K23H 1IM9A 4R9HA 2A73A 2HH0L 4LBEB 3UJTH 4OLYH 4EOWH 2AK4B 3ZSTA 4RGMC 5CAYB 4UDUB 1RHHB 2AJXL 1T1WA 2M8XA 2P42B 3SGEH 4KHXL 5CZVH 5F7FA 3IDMB 5F8QC 3VXQB 4PD4J 5F96L 4O5LH 3BUYB 1U3HA 2VDOH 4WI7A 1LE5A 3GUTA 2O5ZL 4GKOA 5F1NB 1RUML 5AAWA 4RZCA 5F7LB 2VERN 1MJUL 2FB4L 3D69A 1S8DB 1S7SB 4DEPC 5JTWA 2AABH 2V9TA 1FFPA 3ZHKA 3ILPA 1TJGL 4ZD3L 1X7QB 5FK9A 2SEBA 1PY9A 1LK2A 5TE7H 1BLNA 1ONQB 5EUOF 4O2FB 3VG0L 3STLA 3FRPG 3BPOC 4PJ5E 5ACZA 5KSAC 4FQ1H 1NMAH 2QR0B 3CFCL 3OMZA 4CVZB 2ZUQC 3DECA 3BKCH 4AQOA 1QHOA 3B9EA 1Q1JL 1KELH 3MV9D 3ZYJA 4GRMB 1QLRB 2NXZD 3GI9L 1E6JH 5IHUL 1N8ZB 4U1HA 1W0YT 1U8IB 3LEVH 1RFDL 1KB5L 2EIBA 3TCLB 5GGVY 3QNXA 4YBLC 3I2CL 4I1NB 2PR4H 1WJ3A 3CSYA 5KJRH 1XR8A 1KV3A 4LRIC 4PJFF 3MOBH 2CDFA 2EIEA 1Y0LB 1MAML 4UTAL 3W2DL 1M6OA 3HNSH 4MCZA 5TDOB 5HGBA 4JJ5B 1B88A 3S4SB 4Z5RB 2J8OA 3MLUL 3U36B 1L0YA 1QYGH 3FT3B 4HFWB 2Q7YB 3U4EB 3S36X 4LHJB 2YRPA 4G80A 4KK9C 3DYPA 4NFDA 1WAAA 2NYYD 4KPHL 4M62L 1I75A 3RPIA 4PBWD 4LIQE 5F6IC 2XZCH 3I6GA 4UNVA 3DVGA 1NCDL 5DUPL 3ILQC 1HEZB 3U30C 1YMHA 3IDNB 1B6UA 5LWYH 2VL5B 1J0IA 5D7IF 1G7JA 2I9LA 2D03H 5IVXF 3SE4A 5CZKA 2Z91A 3O3AA 1NAMB 4D9QE 1H8OA 4ERSH 2F53B 4HXAH 1U2HA 2LU7A 1QSEE 3FB5A 3C87A 4MCZB 5EO1A 5KS9F 1ES0A 4PJGE 1M71A 5EG6C 3L3OA 5EUKB 1MFCH 1U95A 4PV9B 3GJEB 5I66B 1QRNB 1DLFH 3DRQB 1J5OH 4R4ND 3G5XB 5SX5H 3RPIB 4L4VB 4XHQA 3AREC 2H6PA 3JTSB 3OB0H 1FNEB 5I6XB 3MBEB 3DTXA 4HDIA 2DI8A 3BZ4A 2IFFH 2L4OA 4XPHL 1TMCB 3RVVD 1BIIA 3NMEA 3CLFH 3WFCL 1ZK9A 3ULUL 1ORQA 3L3DB 1UKSA 5EOTA 1WZ1L 1AO7D 1JIBA 3QJFB 1C5CL 3QUYB 3WXVL 5DJXA 1Q1JH 4M6AA 4HBCH 2R39A 2VZVA 2LABA 3NIFF 1T3FB 1ZT1B 3NCCB 1OM3H 3DUSA 4O02L 1BZ7A 1B2WH 2NY0B 4GFTB 4PJDB 1ACYH 3V0VB 4LL9A 1ULVA 5HHQB 4ZO7A 1KG0A 3FO1B 4F7TB 3HR5A 3MV7D 4E41B 4JQXA 1IGFH 1KJ2L 1YN6B 5D2NC 4P46D 3MLRL 4HWZA 4OLUH 1HNGA 3LKRB 4PJHF 1WISA 4LCWA 1WSST 4Z7VF 1A7OH 1R24A 3KYOA 4PRBA 3FB8B 3K4AA 3U2SA 3OF6D 4PJ8D 3LS5L 3WNPA 1UH3A 1Z9SA 2Z35A 4HWBH 4PJEE 4QNPF 3UJTL 3BO8A 5LGHL 2ADGB 4HUVB 1RZIB 1GC1H 5E00B 5L88H 3V7MA 5D70H 1EUUA 1HN1A 1T04B 3GMNB 3QQ4A 3VG0H 4CMMB 3MRJA 2A6KA 4TOYH 1CLOH 4JGUA 5DRZB 1BBDH 3HC4H 5CS7A 5A1AA 1IGYB 12E8H 1TCRA 2OLDA 4Z7WE 3ULUH 1QNZH 4DK6A 1U8JA 3UZVB 2UWEB 3W0WB 3DUUB 1RIVL 1NCAL 1XIWD 3PL6A 4MD4A 5J11B 1JNNL 2BNRE 3KYKH 2BJMH 5DTFB 1FORH 2JJVA 2VDPH 4GAYB 3JWOH 5DFVD 5GGSY 4P2OC 1MCRA 2IPTH 1T20A 1OAZH 2NXZB 4I3GA 4P4KA 2V2XA 5BRZD 3UTZA 1DEDA 1YNLL 5E56A 2ICEA 4RDQG 1FLTX 5IQ9A 5DRWA 3MJ7B 2XI9A 3QUZD 4ETYA 3I9GL 3QXAB 4P3DB 2NW2B 4L8BA 2DD8H 5CUSH 4P46B 3KVQA 3SKOA 5FOJA 1ZHBB 2X9WA 2QSVA 5DUBB 1EHNA 1U8JB 3O8XA 2Z31A 2NY6D 3VGDA 1CGXA 3VD7A 1VFUA 4QY8A 5JNYB 5ICXB 1M7DB 2R2CA 4AENB 3KPTA 3OPZL 3HAEB 3ZZ1A 3PXHA 1RD6A 4PJ5D 2HMIC 4AIZB 3PQYA 1JF6A 4Z6AT 1V8HA 4PJHB 3MFFB 3SBWC 2V2XB 1ZLWK 1W2KT 4N9OB 3UTZB 1AGFA 5LKNA 1A8JH 4W6WB 2WIIB 4Y8AA 4AMKH 3GBNH 4LSQH 1JNJA 1ERNA 4S1SL 4Z7QF 5DT1H 5IROC 1IBGH 3E2HC 4XBGA 3BIKB 1MCCA 2PYFA 4QXTB 4MD0A 1ZT7B 3T77A 1DBKL 3X14B 3IDMA 4LRNH 2HRLA 1U92B 4KI5C 2OSLA 2E6QA 4MZ3A 5HVHB 2A2QT 3RI5F 5C0AA 1N5YH 3MRCA 3CZFB 3QWRA 2WV3A 4JFZH 1FFRA 3O4LA 3UTOA 3QULB 1SY6L 4U1JB 3MRDA 3REVA 4XPFH 4U1SA 1OD9A 1RZKL 5BV7B 2NY4B 3GMQB 1U3HC 4KJQC 1PG7W 2WBJC 4W6YB 3MC0A 5EZJA 4WWKC 1IM3A 4U2ZA 3IETB 3KDMB 4NC1E 2HT2D 3MYZA 1FORL 2AEPH 1EAPA 1P4IL 5C0CB 1LGVA 3NCJL 4ZDHA 3CFEA 5DLML 2XICA 1VADB 3MLTB 4ZS6D 1F4XH 5JDSB 4X7CC 3OWEA 25C8L 1DZBA 2HRPL 3IFNL 3O4LB 3CK0L 1NGZA 2BVPB 2DYPB 3QNZA 4H20L 4JM2D 4U1SB 4PJEB 5E2WL 1CFNA 3ULSB 5FFLA 4P99A 4MS8D 2A0LD 3E3QC 2L7UA 3PGFH 2XTJC 4ODXB 4JJ5A 4OD1L 5C2BH 3DVNB 1KCSL 3LS5H 1JPST 3QEHB 4P9MH 4R0LA 3MRFB 4LCYA 3BPNC 4G80B 4K3GA 4HMCA 3B5GA 5GS3A 4PB0H 2VABA 3SKUD 5C71A 1K8IA 2EDJA 5I8CB 1TVHA 1HQ4A 5HGGS 1IAOB 2EIDA 1I9EA 3HPJB 4MJ2A 2F74B 3MMEB 1RMFH 4WTZG 4X9HA 3VRIB 5A2JH 5EIIA 2ATKA 2VL5A 1QSED 3GFUA 4QHLA 1C16A 1OSZA 4JPWL 1MCEA 3P9WB 1OB1A 1YEIL 4RGOL 1QOKA 2NW3B 3OPZH 2Y23A 2V9QA 3OB8A 5L0QB 4XNMA 3GSUB 4OM1H 3MGOB 3JV0A 4U4BA 4P2QA 2H41A 3B2VL 4WWKB 1NBZA 4IJ3C 4J3UA 3CFJB 4HKXB 1NMCB 5ALBH 3SOBL 1A1MB 4BK4A 1HH9B 4U0RB 1CICD 3PDOA 1BJMA 2EZ0C 3VGAC 4JGMA 2NY3C 5GGTA 1LILA 1UWEH 2VLKD 3D0VA 4A6YH 4IRZL 2XXCB 3KPPA 5DJYA 1UJTA 1J86A 4E42A 5FYKH 4YO0A 4KKLC 1BOGA 1G7LA 3BPLB 4K8RL 3CDGB 4GXVH 2DIAA 1TTUA 2X4PB 5DC9B 1NBQA 2BNQB 1GGCH 4NUJA 1GCFA 2BJML 2ADFL 5E6IA 4W70A 5CINH 4Y19A 3SJVA 1QVOB 3T4YA 2GW5A 4R90H 4CDGC 4EN3D 3L3HB 2P8MB 4S0TD 4G9FD 4I8DA 2A6DA 4UIKL 2COQA 3B9KA 35C8H 3QQ9C 3GIZH 3QZWB 3RWIB 1KTDB 3ABZA 4HD9A 5E2TL 1J8HD 1KPUA 4NGHL 4N0UB 3TPUA 3MNZB 5CJBA 3S35L 3KYMB 2BC4B 3PQYE 4X6DF 4X6EB 2V5YA 2R2HA 2Z31D 1VPOH 1FNSH 5E5MB 3SCMA 2DDQH 2IQAB 2CK2A 2APWA 1LO4L 2NXYC 4FZEL 8FABA 2XTJD 4XCCH 2LU4A 5HSFA 3X3FL 4JFHD 4FNLL 5DF0A 5FYJU 3RHWK 5K59F 5DD1L 1R24B 1T6WA 1BM3L 3CDYA 1RK1A 4ODUB 3PWPB 4E41E 2QJDA 5IVXA 4OI8A 2ED7A 2XKUA 4KKAD 2WZPD 1WUNT 3UCRA 2JCCF 4JN1H 4LKCB 3H7BB 4N0YH 2BOBB 2YPKA 5IVZA 1DQJB 5L2KB 1JV5A 3K8MA 2BZDA 3GMNA 2VDOL 2X5PA 3IDGA 1IAKB 3MRJB 5JZ7D 1RI8A 3FT4A 5HHMB 4JVUA 2Y06L 3VG9B 4M3JA 4G6ML 2KUTA 2ED8A 2VMFA 4M7LH 3Q1SL 2CLRB 1MVUA 2I5YH 5IFHL 4ETQA 4URTB 3FFDA 4OUUA 1ZV5A 3HHRB 5IB3A 4ZYKB 2IH3B 4IDJH 4PGJA 1FNHA 5I2IA 5DXWA 3NIGF 4LDEB 4PJGF 3CVIL 1BGXH 2R23A 3RGVC 1W72B 4MAUH 4JN2B 3CXHK 4HIHB 3UYRH 3EAKA 3UJJL 1NCBL 2DYPD 3CU7A 4BZ2H 5C0FA 1LMKA 5E2VH 4F3FA 4N1CA 2VLME 4BJLA 2HJLA 4HIIB 4M48H 2P5EB 3GMOB 5CJ8A 4NUGH 2VIRA 1DP0A 2L7JA 5EIVA 5DURD 1ZVHA 3L95A 5EZOL 4I3RH 4ODVH 4H8WL 4XNUH 2F15A 4R7NB 4XP4H 5D1XD 2AK1L 5AD0B 3I84A 4ENEC 3MLSL 3O0RL 1P7QB 2JJSA 4LLMB 1DN0A 5DUML 3MV7A 1JF1B 3B5TA 3CGTA 3HAEA 2GUOB 3QO0A 1NCTA 1VCAA 3BN9C 5T3ZL 1D5BA 1L7IH 3HN3A 1TJHH 4KC3B 1JZ3A 4Y4KB 2GIYA 1MCWM 2VZOA 1SQ2N 1ZGLB 5ALBL 3WFCH 4KMTH 5J6GB 3AY4C 4KVNL 5GRXG 2RJMA 2NXYD 3FHQA 3GNMH 3RY5A 5MENA 5FGCE 3CPLA 5INCB 3MCLL 4EUPA 4FFZL 3T04D 1YEIH 1A6UL 3LN5A 1IC1A 5CEZE 3CXDH 4XX1G 2P4AB 3QI9B 4G8IA 3L1OL 1CIDA 3REVB 1YUHA 4FQ2H 1DVFA 2YPLE 2PO6A 1BD2A 4HKBA 5GSVB 1X5GA 1G9ML 4L4TD 1WGOA 4HEPG 4A6YL 4ZUSA 4ZFZB 1KCVH 2B0SH 2EE6A 3C8DA 4JZJA 4LSVH 5FYKL 4PRHB 4PLJD 5INCA 1F8TL 1QBLH 3D5OF 2VR5A 1KPVB 3K0WA 2B5IB 2B1HL 3IGAB 4J23A 1IQDB 3ARTA 4TN9A 1IGML 4UQ3A 1ZHLB 2A83B 4IRSC 3GI8H 2ADJA 4LVOC 2PYED 1CICC 3LH2L 4XNUL 3MUJA 1AXIB 4PY7B 2NY5H 7FABH 2BVQB 4QRTB 5IW6B 1NGXB 3MRIB 4Y5VA 3T3PF 1IE5A 1T66D 1F2XK 4F7PA 5HHXL 4W4OA 5E8OB 3FTGB 4H25A 1ZS8B 2DDQL 1IC5H 1P7KA 4ZAKB 3W39A 1PZUB 1IFHH 4EXPX 5C0ND 2FGZA 4XC1H 1X5YA 1PZ5A 1EA9C 1C1EH 5E08H 3CH8A 3QG7H 1FFPB 4V2BA 1W0WB 1I1FA 2H2SC 4ZQKB 4OCXH 1UGNA 1FFNA 2WWKT 4ZFFA 2ARJA 4R97C 4TNWF 4I77L 1UXSB 3CXDL 2AJYL 1T83A 4Z7NF 5C0RL 1GZQA 1WC7B 5I1AB 4CVZA 2IFFL 5LGJB 1HK6A 4C59B 1EV2E 3IDXH 2VXSH 3V6OC 4R0LC 3FRUA 4KK5D 1DLHB 1A64A 4WDIA 4JB9L 4KVNH 5BMFH 4NZJA 4W4OC 3BSZL 3H9SE 4ELMA 3C6LB 4MXQD 3DUHA 4YO0B 5C0GA 2GJ6B 2WK2A 3E6HB 4WJ5A 4ISVA 5B38B 1KCLA 3GSQB 5IKCB 4MVBC 3HUJF 4YC2C 1UWGH 4LMQE 1JZ7A 2JK5A 2VOTA 5DJ2B 2J1KA 3NPSB 3UJIH 1Q72L 2R9HC 1R3KA 2G9HA 4NZTH 5F9WB 3MLWL 3E1F1 3DXAD 4GBXD 1RURH 4LRNL 2HKFL 3TGXA 1BQHB 2QSCL 5E5RB 1DLHA 1N7MH 2R4SH 1RJZB 5C6TL 1VGEH 2LTQB 3DBXB 1U0QA 4PV8B 2DLHA 2BC4A 3NVQA 5IB5A 5HDQH 4X6EA 4GBXC 4JHZA 3H42L 4BQ6A 5E5MA 3SCMB 3G9VA 4PJ7F 5EBLA 1WWCA 5IKCA 5CEZH 3IAPA 3WFBH 3KPOA 2W0LA 3VI4E 1JNLL 2HVJB 4HT1L 1M71B 2CJUL 1GIGL 1OGAA 3FMGH 4TVPL 3PJSB 4H1LG 4MD5A 5IFAH 3Q6GL 1FO0B 3KPRB 3LH2H 2VKWA 2CR3A 3ELAT 4I0PA 2OMNA 1OAKH 3PGCA 4FQ1L 1FN4A 2DBLL 3MV8B 3S36L 1W0VB 3GKWL 3U6RB 3R8QA 5J7CC 1UWXK 2XY1A 1PQZA 2B7DT 1YA5A 3HRPA 3UO1H 2HT3D 3U7YH 5DMKB 5IVNA 2DD8L 5CUSL 2GTWB 1AFVH 4ODHL 3HE7A 1C7SA 2AERT 3GBML 2DQJL 3IF1B 2AVGA 4NZUH 2IPTL 3VWJB 2UVFA 4WV1B 1X5JA 3RBGA 4KZDL 3ROLA 2P8LB 1XGQA 1KSRA 2QQKH 1MJUH 2X42A 4M8QB 2X1WL 4O4YH 1MFBH 1BIHA 1SYSA 3EOAB 3UTQB 2V5RA 3HCVA 3ZLQC 3BW9B 5K9KA 5EFIA 3BZFA 3TN0D 1U42A 3G6AA 3FN0L 5KW9H 1SY6H 3ZKNC 5L7XH 2OXHA 1F4YL 4QRRD 2B4CH 2XFXA 4XT1C 5HHNB 4N9GA 3CLEH 4ZUWB 1JYXA 1NGWA 2HKFH 1FVCB 1ODAA 5GGSB 5T3XE 3TNMB 4F15B 3ZKQD 4CNIB 1T03H 3L7EB 4OZIF 2AV1A 5CZXD 5I74C 1OF2A 1T5WB 3IJHB 4X6DA 4F7CA 4PJ9A 4LVNB 4K3DH 2HN7B 2GUOA 3QO0B 3TYFA 1CDJA 3TN0A 2WQ8A 3WFZA 1H5BC 3GSOB 5D2NB 5LQBH 1FIEA 8CGTA 4HKZA 3KJ6L 2AV7B 4D9RD 2AXHA 2NZ9C 4GSDH 2G60H 1MIML 1YPZF 3DRTB 2UZIL 2VO5A 4Y4HD 1HHJB 3UZEA 1N0LA 1WIUA 3ZDXE 2DLEA 2UYLB 4BFIB 1D5MA 5EO0B 2DQJH 4PJIB 5F7DB 2KPNA 3LQZB 2IPUG 5GRYA 1MJJA 3B4NA 1IAIM 1RK0B 4Z7WF 2FIKB 3O2DL 2JLLA 4GAGH 4NO3B 5ABDE 4IRSD 3MA9H 1SBSH 1UA6L 3NA4A 5EUOB 5T1LA 4YXHH 3MXWH 5GGRY 4F2MB 2P48B 3LKOB 4JFPB 3QI9A 4P59H 4YHNA 5IBLD 3GHBH 2YD7A 1GIGH 4TRPH 5D2NA 4DGVH 1IQWL 1SVZA 5DEGB 1WBXB 4HWBA 1LO2H 3C5ZA 3L3IB 2DMKA 3F7RA 4LHUD 2C3GA 5MP6H 5E1AA 4QRPE 2PO6D 5H35A 3BN3B 1G1YA 3HUJB 2R4SL 3CMGA 2DWDB 3L3JB 2LV4A 5ICXA 1IT9L 4FQLL 4Q9QL 4FQXA 5CJQH 1XT5A 3DNKA 4CADA 3BGMA 2CIKB 2DQGL 3IGAA 4YHOL 2R56H 3STZA 5JPNB 1OAQL 1S9VB 1INEL 1OGTB 3D85B 3MFFA 1Z5LA 3BT2L 4G3YH 2VLRA 1A2YB 4R8WL 4LSSL 3ZHDA 2SEBB 2FYYA 3PV6A 4JDVB 3LKNB 2AW2A 5LGHH 1PG7X 3X12B 1CDUA 5DFVC 2FHFA 4HS6A 4KK5C 1TJIL 1UC6A 3PHOB 5D9SA 3D87B 3BD5A 4U6VL 1AHWA 2E9IA 4NCC1 4PG9A 4Z7UA 3BRDA 4LLQB 1X5FA 4NO5B 1HXYA 4EXKA 2EYRB 2YA2A 3TV3H 3UAJC 3C8KB 2CRZA 2X44D 4HW6A 1G7MB 1U8HB 3DSNA 2GKIA 2F54E 4ZPVB 2ITDB 4XNZC 1IZJA 1L6ZA 3VH8G 2NY2C 4M1DL 4M7ZB 3ZKMD 1FVEB 3QIBA 1LP9F 1OT1A 4Q9RH 5E2TH 1GL4B 3IRPX 4GO6B 3TVMD 1K2DB 4MQSB 5I71C 4L4VD 3HI5H 1S7RB 4X0KA 1M6OB 3BQUC 3UJJH 3DX9A 4YDLB 4IEFB 4X4XA 5J3HD 1FPTH 5E2VL 2WUBL 4NQUA 4Y5VC 5E94B 5BOPA 2ID5A 4EIZC 1FZKA 1ZEAL 4R26H 1IM9D 5KSUA 4TSBH 1JZ5A 1MUJB 1WFOA 4XVSH 5DD3L 2PXYD 4HLZH 1U3HB 1AO7A 3OX8A 4IRSA 2VTFA 5L7XL 2AQ2A 5I0ZA 1FVEA 2J8UF 3JV6B 1AGCB 2P5EE 2A0LC 5BRZE 4PREB 1W72H 4NOFA 4EVNB 2ERJB 4G42A 1CK0L 1NGPL 3LZFH 2ZPKH 5BVJB 5KSAD 1SM3H 4PLJC 1AY1L 3DIFB 1CFBA 3DARA 2MOVA 5JZ7C 2YRZA 3O11B 3NBNA 2CIIA 3ULUC 1PYWA 2VDQH 3WNMA 1OPGL 2EDHA 4YNYB 1QFWH 4JRYE 5LJYH 5CP3H 1N8ZA 1JGUL 4QHKJ 3T2OA 4ELMF 5C0AD 5HDBF 5FO8A 3KXFA 1BIIB 2ZUYA 4LNVA 1I9RH 5EOTB 3F7YA 4MAUL 1XF4A 4XPGL 2BSRB 1XR9B 3RNQB 3V95A 2P46B 4KDTA 4WWKA 5CGYD 5GRVK 4D0BB 5FEBA 1XGPA 4L3EB 3S8WA 3DUSB 5FHBL 4KUCF 5I9QB 2IG2H 1YN7A 2DL2A 4OV5A 1QACA 1MJ8H 5MEPB 1Z0NA 5E2WH 5C86A 4DQOL 5DK3A 4DUWA 2P7TA 1MFEH 4P5KB 3ROOB 3VXNB 2HJFB 1KIRA 2D7PA 2NY1B 3TA3C 3CSBA 3T0XA 5LXGL 5C0DB 2BNRB 3O3AB 3RKPA 4Y19B 3VXSA 3GHBL 1GGIL 4PJFE 3CFBA 3UTTE 5MERB 3L5HA 1JRHI 1XGPB 4L3EA 2XN9A 2VDMH 4L8SA 5IMLB 5DYOB 4AL8L 1K8DB 1A6VH 4WUKL 5EOCJ 3X11B 5IMOA 5TQ2L 1L0XA 3QO1B 3GJEA 1G7IA 3F65A 4MA7L 4LHUG 3TC9A 1ZANL 3C60C 1CGTA 3WNKA 5KS9A 2J5LC 4UUJB 4UV7L 5FM5M 3BZFB 2HJFA 4JR9L 1Q9WB 3VCLA 1FGNL 5ADOH 4RISL 4RGNC 4Q9BA 1ORQB 3L3DA 4IOIB 3S37X 5IHLB 2O61A 5E9DB 2P49B 2HJKB 4KHTH 3VXSB 1NFDF 3SDXE 1E4XI 5GGRB 1YY9D 1U58A 2CDEB 3BPCA 1FDLH 4ZFGH 4K7PH 5C9JA 4OI9A 3VRJB 4JM2C 3IJSB 2EH8H 3SGDI 3V0AC 4KJYB 3BIBX 2VZ1A 5EBWB 1RFDH 1RZJC 2Q76B 5CHNB 1NDGA 1XCTB 1KNOA 1K4CA 3C60D 3V0VA 1FL3B 3K4ZA 1BHGA 4Y4FA 3FO1A 4F7TA 4K2UH 2AJ3A 3CH1A 3GI9H 2VUYA 3B9AA 3TBTA 4F9PA 4LCWD 4HPYL 4E9LA 1KJMB 1FNGB 4X6BA 3RGVD 5EOQH 2HFFA 5A16A 2R0LL 2PXYC 1KCRH 3H8NA 4DN3L 4FOMA 5E2UH 2OL3A 1ETZA 1PG7L 2K1MA 4QXUL 5GPRA 4QY8B 4FQHA 1EFXD 2WBJD 4NN6C 5FYLD 4OF5A 4IOFD 4RNRA 5JUEL 3A6BH 3IU4L 3NIDF 1J8HE 3TIDA 1FC2D 1UVQB 3B5HA 5CZVL 1QD0A 4P2RB 3JVGA 5I73B 2DL9A 1YPZA 2UZYB 3MA7A 3QIUC 4X6FA 4N8VG 5IV2A 1JI2A 4XB7A 4K7PX 3ZT5A 1FIGL 2F5BH 4ZOCA 5LCVH 1A6WH 1J1XL 3FFCD 4GH7B 2P5EA 3GMOA 5I8EB 1TETL 4R2GC 5AZ2L 3C9NA 1CXEA 4LF3B 3UO1L 4PRID 3JWNC 3MLVH 4FRWA 1KTLB 2KDGA 2PCPA 4OT1L 2YR3A 3P0GB 4I48A 1AXSA 4U1JA 4GG8A 2ZCLL 4PB9H 1VSCA 2ITCA 3EDKA 1C7TA 5GS0L 1V7NH 2ADIA 4PJ9C 2FJFB 3H42H 3MA7B 3OF6A 4UU9B 2ICEB 2O5YL 3CJJA 2VITB 5K9OA 1CGVA 3GSWA 3MRMB 3K1DA 4GJTB 1N0XH 4JFHE 3BVNB 4AEIH 3FQUB 4IOFC 3PHOA 4IRJA 3WLWD 4TNWK 5HDQL 5KVDH 2H32H 4YHLL 3C2AL 3VW3L 4JM2A 5F6HI 5I8KL 2CGRL 3S88L 1KTLA 2QHRH 3BYTA 3WN5A 4NN6B 2P5WE 3OHXB 4RAUB 3NCEB 4ERSL 2OR7A 4KTDH 1N3NB 1IEBB 2HFTA 3JSSA 4LFHD 4R4FL 1LD9A 2ICCA 15C8L 1EHLL 4XZUB 5I73C 1S7RA 1YC8A 4Y4HC 1JTTA 1NUNB 2R1XA 3OGCA 2DQDL 3ISWA 3GSWB 4HUUB 3MRMA 2BVTA 2G5BA 3IXAB 1RUQL 5E8NB 3P0VL 3ILQD 5TE6H 5KVFH 2BMKB 2B39A 4B7IA 1T0MA 1K8IB 4HJGA 4S1DC 5FYLL 4PJXA 1D6VH 1M7XA 2V5SA 4WFGE 3MMEA 2RCSL 3EDDA 2HYMA 5AZEL 3EO1B 1FFOA 4XAWH 2DWEB 3DXAA 4L4TE 3P4MB 1YEHL 4BQCA 1J5OL 3OAYK 2CRMA 3HS0B 2C7UA 3I75A 4JM4L 3MGOA 5GISL 2G75B 4U1IA 2CMRH 3ZDYF 4JFQB 1TQCC 3DYMA 3VXUD 3OKEB 3MQIA 1F4AA 1EMTH 1IAII 5DVOA 2OS7A 3RWHB 5HBBA 2VLRE 3BUTA 2ZJSH 4JEGB 4WVRA 5DEZA 3W81A 5C2UB 2OZ4H 5HDOA 1NMBH 1OQXA 5D6CA 4L1HA 3U4AA 1CFQA 1J1XH 5FCSH 2VYRE 3MOQA 3G6JA 2NY7H 3FKUS 4HWBL 4OLWH 4L3AA 3EO1A 4Y16D 4UV4H 1WZLA 2DM2A 4YUEL 4RX4D 1MIMH 1T21B 2DMCA 2VQ1A 5FUZH 1LQSR 2BDNH 1RZFL 3FT2A 4MDIB 2HT3C 4JJHA 5ESAB 3R1GL 1YDPB 3B9KB 4NRXA 4QRSA 2ICWA 3DMMB 5IROA 1I9IL 1PDKA 4KQ4L 4LVHB 4JDTL 4NT6B 4Z7NE 4FFWC 4I5BB 5ICYB 5JHDB 3T0EB 6FABH 4L29B 5T1KB 3EYUL 5FB8B 4NJAL 3HPJA 4FQXD 3BZ4B 1ZE3C 3ZTNL 2OJZL 1IKNC 2YUZA 3QDJD 1Z9MA 2O5XL 2C1OA 2JELL 3KPLB 1R5VB 3T08A 1I8LA 4OTXH 5IIEB 3QUYA 4XAWL 2Z31C 1AO7E 1SEQL 1NCWH 2BXYA 2DN7A 2W65B 3CFBB 4BFEA 4JZNA 3T4AA 1NBZB 1BEYH 4H26B 2YUVA 4XP9H 3ARFB 3X11A 4GRWE 4LLYB 4NNYA 4PRNB 3MO1A 4TPRL 3MCLH 4Y16C 4PTUA 4NT6A 4QRQA 3V8CA 5C9KA 5D7LD 2GT9B 1YEJH 4P2OA 1RQ5A 2AXFA 4FXGA 1NAMH 2QHLA 2MPAL 4X6CF 2AXGB 4B7LA 2FL5B 1QFOA 2FD6L 4GXUM 4XPFL 3ARQA 1YYML 5DFWH 1SJEB 4L4TA 2Z8VC 4QYOB 1KENH 2EXWD 1EERB 4LSRL 3THMH 1WBZA 3AB0B 2D03L 2VE6B 1IGJA 2MFNA 3QUXD 3S5LA 2UZIH 2C4XA 3X13A 1S9WA 5DDHA 4OCSL 4L8CA 3QUZC 3LV3A 2CKNA 3E2HB 3K81A 1XAUA 1FV1B 2X4UA 1ND0B 5K9JH 4AH2B 5FCUL 5IW1B 3U1SL 3C2AH 1KPRA 3G5ZB 3HE7B 2VWEE 4ODSH 5HVHC 2H8PB 4OGXH 3ALXA 4U6TA 2GTZB 4RGNE 1IQWH 5F97E 1XGQB 1GSMA 5CIPA 3BKCL 4PYGA 4TSBL 4JFYB 2PW2A 1QG3A 4JFFD 1SYSB 2O5XH 5GGUA 3SO3B 1JYNA 3RWCA 5T1MA 1TNNA 2BRQA 5LBSH 4TTGA 3CMOH 4PJFA 5T3XH 1RVFH 3BJLA 3G6AB 1JK8B 4QGYA 1PSKL 3S34H 4KQ4H 1EH9A 4RMVA 5EZLA 4JO4H 4N9GB 1B4JL 2BP3A 2NW2A 3KR3L 3D25A 2YMXL 5CP7B 1MVUB 2XQBL 3RVTD 1PKQB 1XH3B 5KZCD 3ARGD 3H9SB 1UEYA 5ITBL 3VFMA 3ARGB 5CIPB 2ZUQB 4Z0XB 1PY4A 3Q6FB 4QRUB 2B1AH 3N1MC 4XRCB 1TJIH 3RWCB 2K9UA 4PG2C 3F6IA 5J9PB 1RULL 2VITA 1OM3L 2Z4QB 1LDPH 5I74B 4ZUSB 4WI4A 5EIQA 4A2LA 2XA8L 3LKPB 1T7ZA 1NBYB 4HIXH 3BWAA 4YGVA 1D5MB 2QQNL 4KI1A 1JI1A 4NHUB 1EJOL 4Y1AD 3MBEC 5TDPB 1DLFL 4LLMA 1QSVA 2R29H 1JE6A 1NCNA 2H26A 3SE4C 3QRGH 3VFGH 3P9LA 2N7AA 1A3QA 1INDL 4JFXB 3HI6L 3Q6FA 4KI5D 4Z7WB 2FWOA 4EBQL 2X4TB 5IP4A 2XOTA 4CU8A 1ZHLA 5EBMA 1VFOA 5DEGA 1I1YB 1HCVA 5AYUH 4O4YL 3D3VD 1IILE 1WICA 3A6CL 1IM3B 2D7NA 1JBJA 1I9JL 5JOFA 1QEWB 1P6AB 1IVLA 3WCYA 3VFVB 1LE9A 2MKLC 5H35B 4KMLB 2VH5L 1F90H 3BWAB 2YEZB 3HE6A 3MLXH 5C08D 2PW1A 3O6ML 5TQ2H 4AG4H 1YJDC 3B6SA 4PLKC 5TPWH 2DQTL 5GS1B 3RY6C 2E9JA 4JY5L 3MJ8B 4C57C 1QFUL 1NAML 5HVFB 5D72L 5D1XA 4NBXB 1JWMA 1I1FB 3QDGA 1GYAA 1H0DB 5C0JB 2DI7A 4J1UA 5FYJE 2AJSL 4OD3L 3MNVB 3V6OE 3LKNA 2GCYA 4O51A 5TJWK 3TO4D 5GS2H 2V5TA 1ZOXA 4QRPA 5J6HA 4P5TC 1BECA 2BX5A 3PWVB 4QHUB 5EU6B 5T5FH 5KSAA 3AAZB 3QEHA 2OM5A 1BOYA 3EO0B 5HYJD 5DVMA 1WVZA 1CFTA 3GBNL 2W92A 4XWOD 2OP4H 5AEAA 3VDBA 2O93L 3PV7A 4OCNC 3V5KB 2QSQA 4NJ9L 3PF2A 4JFFA 3HC4L 3SQBA 5FCUH 1ZLSH 1KB9K 4JQVC 3VRIA 1LDPL 1P7QD 4G43B 3B3IA 1T7XA 4JO3L 3QDMB 2NW3A 2VQ1B 5DI8A 5F7HA 1ZGLP 4GBXA 3SDCB 1X7QA 3G5VB 4LPYA 1YC7A 5DURB 2Y5TB 5IB1A 5HGDA 4OB5L 2B4CL 1FE8L 4QRPD 2ARWA 4HV8A 5ACLA 1CE1L 3QDJA 4MSWA 1BWMA 2VDLL 4M7LL 1WLHA 2NY2D 1DBAH 4X6DE 1AD9A 2C1PB 1BPVA 3AAZA 5ITBH 2PYEA 3RA7H 4QF1A 1IL1B 2ENYA 3DX7A 4GRMA 1U8MB 2HVKA 5JHDA 2Z9TA 3TVMA 3I6KA 1U8IA 5I19L 3BEWB 1SEBA 1HHGA 1S5IH 1X5HA 3EYOB 4ZSOA 5HD8D 3VXMA 1MWAL 4OCMC 4G43A 1UM5H 3MODH 3RZCA 4PJIE 4OAWB 1RU9L 1F6LL 3MUZ1 2CDFB 4X9FA 1XZ0B 3T8XA 3LKQB 5JQHC 4DVBB 5HGBB 4LEOA 4NZRH 3QDAA 2EYSA 3OJ2C 2EKJA 3VXUB 1I8KB 4PJEF 5EOQL 1H3GA 2UY6A 4U6YA 3NGBB 3V6OA 4MHHI 1S9XA 4YHLH 3VW3H 3SE3A 4G7VL 4PLKD 3SDAD 5BXFA 1D9KC 3M8OL 3BHBB 4RQQA 5BS0E 4U6HB 5IFHH 2DTML 3MNWB 3MX0A 4FQ2L 3EDFA 5I1GH 2GT9A 3QXWA 4C58B 1WT5C 3F6LA 2GTWA 2OBGA 5CWSB 3QCVL 2C3HA 3C6LA 1TZIA 5GRJH 3LQAC 4G8EB 3VWJA 4APQD 4FFWD 2X4SB 3OJVC 3R06B 3RDTA 4UT7L 4XVTL 5DJ2A 4BYHA 3SQOH 3V7AE 3CDFA 3ULVD 3KHQA 1G0DA 4TSCL 4UIMB 4OZGE 1KEMH 2B1HH 3HC3H 3UPRB 1MQKH 1CCZA 1JUFB 4YH6A 1J8HB 4P5KA 3QEQB 1RIHL 3QUXA 3NCYP 5JPMA 1GVIA 4JY4B 4X5XA 4GKZA 2FZ3A 3QRFM 5KTEH 3DETC 1XCQA 1AGBB 1DBMH 3SKJH 4YHZL 3NFSL 1RZGA 4LKXA 5KSBA 1EFQA 3BH9A 3EGSA 4HKJA 2BVUA 5A2FA 1BFOA 3SN6N 4JANB 4HULB 3BIAX 3R0MA 5GZND 1U8PB 4YIQA 1KFAL 1CTNA 3S37L 5I18L 2ZCHH 3T2NH 4I0KA 4N1HB 4ETQB 3ZDZF 1RUAH 3LRGA 4OF3A 1RHFA 3QP3A 2J7LA 4EDWL 1TIUA 4M7KH 5F1IB 3H0TB 5F70A 3SY0B 1VDGA 1E28B 4P4RB 2ORBH 4PJDA 4OIBA 3L9RB 5JA8B 1KG0B 4R90L 4M6OH 3QEQA 3EYVA 3FO2A 1RUKH 2FZ3B 4GKZB 1O7VA 2CUIA 3B9DA 4M1GH 5C0FB 1CG9B 1I7TA 1N59A 2CXKA 1L6XA 2E7CA 5E08L 2D7TH 3FQWB 4XVSL 5DD3H 1FBIL 4JO1L 1E4XL 4G7VH 3GSXA 5F7DA 4OV6F 5CP7A 3VJ6B 1DSFL 2ZCKH 2FIKA 5FV1L 1XH3A 4UOJA 3KYOB 5FYJD 1YY9C 1Y18B 4F2MA 2NX5A 4S2SA 4OLVL 5CJXC 5JW4R 2VZSA 1MNUL 4FN0A 2YUXA 4OLZH 5D1QC 5TE7L 2HWZL 1NANI 2V2TA 4PJ7B 2A6IA 4M62H 3GO1H 1EIBA 5E00A 4Y5YB 1JRHH 3EJZD 1NEZA 1VA9A 4G9DB 4N5ED 4ZFOB 1A7PH 1SM3L 4IMKC 1JGVL 3PHQA 4CMMA 2DQUL 3C5ZB 1FNGA 1ED3A 3ZE1E 1XGTB 5E1AB 5KVGL 3R1GH 4P2RD 1TZHB 2WLYA 1NGQL 4K3JH 4NO0D 5MEQB 4HK0B 5GZOD 1YNKH 5BZWB 3SCMD 2FBJH 4KAQL 3L7EA 3FQRB 4HQQH 5AG9A 3V6ZA 4PFEA 1YMME 3S3PA 5D8JL 3FRPA 5FYKD 2RHEA 3PP4L 3I02A 1J05A 1FNFA 5DQJA 5E4IA 1XGUA 3MLZH 2CMRL 3BEVA 1Q9LB 2GK0A 1GC1L 3GJFB 4PJ5B 1FH5L 3LVEA 4XCYA 1MI5D 4NZRL 1BD2B 4MNQB 1WK0A 4X5WB 3QXVA 4HC1A 4Q58C 3BN9D 3WFHB 3G6JF 3HUJE 3MV7E 4ZFZA 4ALAH 2J8UB 4LF3A 4F33B 3QIBD 4QLRA 3GMPA 5BS0B 4U1NA 3KG5A 4G6MH 4HK0A 1KLGB 3PHSA 1V05A 3MOAH 1F97A 1WCBA 2WSKA 1A6AA 3JTTA 4PGCA 3IU3A 3QIUB 3MLRH 5HHOD 5I1HL 2ICES 1JMZA 1QLFB 1CU4L 5BZDB 4CN6A 1FG9C 2NY3B 2QADC 1FGNH 5BRZB 5C6TH 5ADOL 5KG9B 3QDGB 1KIPB 4JPKL 3QFJD 4XMPH 4JPIB 2LFGA 3UTSE 3VA2C 4HSQA 4PRAB 4GQPH 4KQ3L 2ZCHL 1F11A 1MRCL 4H5SA 3UTSB 4WW2B 4QRTA 3ALPA 2PYFB 3S96A 3T1WA 3RY4A 5D7IB 3PWVA 4KRPC 4QHUA 5D71L 5T3ZD 2W9DL 2AKRB 3M17A 4UT6L 1CFTB 1RIHH 2IBZY 3HG1B 4M7LT 2NX5D 2YBRA 5D1ZC 1KTKE 1PFCA 3ULVF 1X5ZA 2XWJB 1GXEA 5HI3D 3BKJL 5B39B 1D7FA 3AFLA 4PJIF 2D4FA 1LEKB 3SE3C 5I76B 4JHBA 4PJHE 3H3KA 4XP9L 3OAZH 1NFDA 3LD8C 5T5NG 2Q7YA 3JWDC 2G5BB 4I2XB 2PKDA 1A7QL 2PYEE 2JB5H 1HIML 5JR1H 1EUTA 2C4FU 4R4BB 2PYEB 4A6YA 3RZWA 2XWBB 1J1OH 2XA8H 3T3ME 1UZ6F 5FHAL 1KFAH 1MFAL 1FFOB 5T33H 2JTDA 5E6IC 2F5BL 3EOBB 1T22B 4HUMB 3S4SG 3U9UA 4EIGB 4BSWB 2J4WL 5D7JD 2YN5A 4D0BA 3AU1B 3SDDD 4FTVE 1GAFH 4X4ME 1CU4H 2DRUA 1HZHL 1JPSH 2CK0H 3DO7B 3HRZA 4ODTH 3DGCR 4MQTB 1FYTB 4MNGB 4OIAA 2E7BA 4R7DA 3SDAB 5KVMC 3H3BC 4AEIL 1MUJA 2XG5A 2I07A 4XCFL 4M4RA 2NMSA 4P23B 4XBEL 4HIJB 1SJHA 4WO4D 2BVOB 2Q8AH 3S97C 3QUKA 4MXWH 3TBYA 2NY6C 3EOBA 1P9MC 4WEBH 5DMJB 4JRXA 4LPXA 2QQLL 1EEUA 3R06A 4UBDD 2FIRT 4QT5B 5L8LB 3V5DA 4HKXA 5E5UB 5K9QI 1R0AL 5C6WH 1VFBA 1V7MH 1KN4H 3FL7A 5TDNA 1RULH 3UTPE 2IAMB 5FO9A 3HMXL 2FHCA 5F7KC 5IM7B 4EN3C 4OLXL 4R7DB 1XGYL 4YDIL 1OSPL 3SO3C 2UWEE 2DQFA 1SJHB 1AGBA 4L8DA 4HMDA 4XP1L 3A67L 4KTEL 4KMQA 3BZEB 1RUMH 1UM6H 1BF8A 4NWUH 4DZBA 4NQSB 2Z93B 1NUFA 4XNYH 5T1DL 2XPGA 1ZXQA 1KJ2B 1CK0H 3LZFL 1BFSA 2AJUH 3Q0HA 4YR6A 5HVWA 2B8OT 4GKNB 2E9WA 2WIMA 5DR5L 2AEQL 3RWIA 4MNHB 2IAMA 4QGTA 5FO9B 1NDGB 5I1DA 2QHRL 5FUOL 4CUCA 5IM7A 4Y4FB 1DDHA 2J8HA 1DQTA 2IAMD 3ARUA 4RMWA 3Q48A 1OTUC 5GISH 1HNFA 2WBJA 4HS3B 5DMYA 5EPMB 1UH2A 3VXUE 1IT9H 4XNXH 1KB5B 1O0VA 1KIQB 2RCSH 5DO2C 3WJLC 3H3PH 4CMHC 1CWVA 3UPCA 3AS3A 4LHQB 2IG2L 5E0QA 1IARB 4DZ8A 3QH3B 2XNAB 1EZVX 3VRLF 2ILLA 2R69H 4LIQL 1I7ZB 4X4ZA 4X7FC 5T3ZE 4X83A 5BW7A 1BZ9A 5DJ6B 5HHVL 4ZOBA 2H2PD 4K9EH 1R0AH 3IKKA 3W0WD 3DRTA 4YWGL 2Q3ZA 2A38A 1DL7L 3C9NB 1NCDH 2DQTH 3MRPA 2W59A 2VLLB 3WUWG 4XP6H 2VDRL 2R1YB 5HI4C 2VDQL 3BP6B 4DFHA 1GGIH 4OQTL 3LKOA 5T1LD 1JGUH 5DD6A 2Z35B 3C5SA 1UB5B 4MJ4A 4YHNB 3OG4B 3MGTA 2BDNL 4ZAKC 5EBWA 4IRJD 4QCIA 4MJ5B 2GY5A 3UDWC 3J7HA 1LE5B 3BEVB 1V3JA 4LLWA 4J12A 4X8JA 2BXZA 3NPSC 3VU2A 4RZCB 2LVCA 1T2XA 2R15A 3QCVH 4G8GB 3L3IA 1HSBA 5CBEA 2P24B 3KXFE 4QWWD 5C0RH 5AYQA 3O3BB 1TVBB 4MD0B 5DD5L 5EU3A 4XGZB 1FL5A 4HJJH 3TZVA 4DCQB 1MCIA 1AC0A 3TO2A 4J3SA 1FNLA 1P7QA 5I17A 1D5ZA 1FAIH 4O2FA 3JTTB 2RFXB 3MV7B 3MRKA 3EHBC 2NY5C 5FGBA 2JELH 5EU5B 1T1YB 2CRYA 1CFSA 2E6PA 4RDQF 4HG4K 1FDLL 4ZFGL 2ERJC 3H2WA 3OKOB 5HYJA 1R5IB 5CIPH 4O9HL 2EC9U 4U1HB 4D9LL 4N0CC 2ZG2A 3LEXB 1ADQA 1T1WB 5CLTA 3V4VL 1MHEA 2GFBB 1TVBA 4RX4A 3B8YA 1VADA 2EEAA 3MLTA 2BVYA 4CRPA 2R4RH 4QHNB 1ZANH 1U8HA 1BJ8A 3PQYD 5I1JL 3S4SA 1AGDA 2ZWLT 3MBED 2V6HA 3NIFE 1RAMA 4NNXB 3FN9A 2OI9C 4K94C 1I8IA 4FABH 4ZNCD 3ZL4H 1NBVL 1CE1H 4GG6B 1QRND 3BD4A 3NFSH 4PJHA 3VWJC 2EDBA 1L7IL 5F3BA 4OLZL 4DKEL 5FK9B 4YHMH 4U1GC 4ONHA 3KLHC 1BVZA 3TIEA 3UDWA 3HPLB 1KOAA 3F7VB 1J0YA 4OZFG 2BHZA 5HGHA 1R6VA 4JO1H 4K7FA 2VLKE 1NEUA 5EZIL 1J0ZA 3HE6B 3V5HB 2DICA 3L5IA 4RWYL 4LCCB 3QQ3B 3PP3H 5LXGH 1J11A 4DGYL 2EYTA 2NR6C 3OZ9H 1ADQH 2H1PH 3TPKA 4HMEA 4S1QL 3BGAA 3DHMA 5MEND 3QNXB 3R4DA 1A9EB 4CGTA 1Z6JT 4NO0B 1XR8B 4RFEA 4DQOH 4M5YL 5BV7C 3WJJA 4G42B 3O3UN 3NN8B 5DD0H 3LEYL 1SMAA 1BFVL 3VFRA 1C08B 1FLRL 4FQCH 3C5ZD 4YHKH 5IF0A 5L8KB 3EFFA 3OKMA 4NN5B 1R3HB 2E7MA 5IJVB 1KT2A 3GGWB 1HQRA 4TRPL 3BKML 4F9LA 5FM8A 3MCKB 3W39B 4Q6IB 1DQQA 1Q94B 3TJHC 2CGRH 3S88H 3GSNH 3SPVB 3VXSD 1VKXB 3RVVC 5FA3A 2V2WB 4NPYA 5JOPD 4YX2L 4PS4L 1FFNB 4NO0A 4RFEB 3SJVB 5J12C 3HB3D 1UXSA 5IFJB 3QDJB 4MSWB 2HTKC 3VFRB 3GDBA 5EUKA 3UTTA 4J3XA 1SMOA 3WS3A 4K3DL 3GJFK 3R8BB 3DROA 5JHDD 4U7KA 3BPNB 5JORA 1ZVYA 4WTZA 1LO2L 5C0IA 5MEOA 5DRXA 4B53A 3VGFA 3W5MA 1EO8L 3MXVH 3LRSB 3HI1A 4Q7DA 4H0HB 1WF5A 2P43B 1DSFH 2ZCKL 3U46B 5DHYB 5KANG 4U31A 4B50A 4EKXA 4DGIH 2EIZB 3LS4L 1BX2B 3EFDL 1WBZB 1YDPA 4TSAL 1VESA 4POZD 4Y1AB 1A1MA 2IGFL 4ZUVA 3UROR 2X70B 1S7TB 3C5JA 1UFUA 4OCYH 5I16A 1G1CA 4GW1A 3H7LA 3ZYOA 1CL7L 3EDJA 2R1WA 4KDWA 4D0CB 2VXQH 3VFPA 1ZSDB 5D1QD 4J8RB 5D7JA 4PY8J 1KPRB 5F7UA 4ODWA 3O2DA 1YN6A 4YHML 3HNVH 1YECH 3WBDA 4OLWL 3WN5C 4ONFL 4JO2L 4NUJB 4K8RD 5IEHB 5GIRB 4KK8C 3B2UC 1H15A 2R0ZL 5JA9A 5E8PA 4IRJC 2VXVL 2P8PA 4LSVL 2CDEA 1FZMB 1PX4A 1MY7A 5DMIH 2FLRT 5GGUB 4I0PB 1UG9A 4P9HC 3ARFA 4Z76A 1P84J 2W91A 3L3GA 5AAMA 1T2JA 3LEYH 1G9MH 1B0GA 3ARBB 4ZTPH 2AQ1A 5IK3A 1K4CB 2H2SD 4JG1L 5FHAH 1X9QA 1ZSDA 2GAZA 4OZHB 1MELA 1IFHL 1S5HA 3PGDA 1BZ9B 4GT7A 5DJ6A 2AXFB 3VI3F 2ZSWB 3OJMB 4GRWH 3MOAL 4WHYH 2V7HA 4UTAH 3O45B 5GIRA 2DTMH 2UWEA 4ONGH 2NXYB 3NIDE 5CINL 4DEPB 3QHZH 3P0VH 4KJQD 4HF5L 7CGTA 5B39G 5C3TA 1IGJB 3BRFA 3C5SB 2DQDH 3UJIL 2Y25A 2A74B 2CKBA 4HK3J 3X17A 5I1KH 3RAJH 2OSLB 3N0PB 5JXAH 2DIBA 4HH9B 3VFOB 1M1SA 4BFBD 4BUHA 5GSRB 1QTYT 2QADD 4Q97A 1EGJH 3ULVL 3P2TA 3CVHB 1UKQA 4XNQB 5JOEA 5JIKA 1OTUD 3PABB 3GMQA 1G7HA 4WO4C 2DI9A 4DTGL 4OLUL 3RL1B 3TNMA 4UOW1 1CGWA 3SE9L 3N85H 1CS6A 4AENA 1HXMA 3RA7L 2V5MA 1L9NA 4S1RL 1G6RA 4I77H 2AJXH 4PJAF 2AJYH 3HZVB 1PX3A 3RQ3A 2YSSB 4U2YA 5SX5K 1M7IB 4LFHG 3IDXL 2FSEB 3PHQB 4CU7A 2WIIA 1FZJB 1IKFH 2Y1VA 1NMBL 5DK0A 2KBGA 4XBGB 3BVNA 3EFDH 5E6ID 4D0DB 4NQVA 2X41A 3FCTB 2NY4C 4WO4A 4QHNA 2NY1C 1AGDB 4M4PA 1EO8H 4PJCF 3TP4A 2EH7H 1DUYB 1IGCH 1QSFD 1WTLA 4P23D 4X7EC 5HPMB 5IMKA 5C08B 2ADFH 1P1ZA 4C55A 4JAMB 3ZKXB 3EBAA 4LHUB 5IT2H 3FFCA 4KRMB 5GHWH 4X80L 4KHTL 1S7QA 2GJ6E 2R1XB 3H9ZA 4FA8A 3KLAB 2C26A 1X3DA 2W0PA 5J9PA 5T1KD 3HPLA 4JFDE 5GS1C 1KCUL 1RZ8A 4LARL 3MREA 4EUPG 4OF0A 5BQ7A 3C60B 2BMKA 4AM0A 3FCTA 5EORL 3I85A 2X7LB 4N68A 4QRRE 4WEUD 1JGVH 5DJZB 2RAMA 2VQUA 2NYYC 3BGMB 2H26B 1UH4A 2R8SL 3LS4H 4MMXC 1AE6H 4WFFD 5JPNA 4Q0XH 2V17L 1S9VA 3QQNA 1LO0H 4APQA 4QHMB 3NA9H 1YEGH 4ELKB 1KGCE 4JPIA 1MCLA 1C8PA 1RY7B 2F19L 1HINL 2X10A 1OTTD 4WUUE 3ARFC 1ACZA 1BOGB 1AHWB 4G9FB 2WAHA 4H88L 3WD5L 4KDTC 1IL1A 3DX7B 4TNVF 3WFBL 4OFKA 2FR4A 3C8KA 4MHHG 5BQ7B 1AP2A 5D1ZD 1YMMD 2BY3A 2AEIT 3HG1A 2IAMC 5JHLL 3BAEL 3D39D 4PYHA 5JW4N 2DQEH 2JIXD 4E5XB 3E6HA 2V2WA 3THML 5HHPA 3U82B 4JGJA 4WENB 3LKQA 3FB7B 4POZC 5M95B 1PBYA 1HHIA 4PRHE 3SEPA 4XH2B 3IDUA 5A3IC 2AEQH 4NO2B 2DIJA 3QFJA 3WO4C 4J6RL 3SDCD 4WRLA 4YHYB 5HDLA 5C09A 2FD6H 4L9LA 1T4KB 2OXGA 3FN3A 3P4NB 4YWGH 2VDPL 3D0VB 1Q9KB 1MHHA 3Q5YA 4MWFB 1KBGH 1ZA6B 1FG2A 5C1MB 4R3SB 4JDZA 3RTQA 1R5VA 2ZUVA 3MV11 4LKCA 4O5LL 3SJVE 1OP9A 2WUCH 1F13A 4DW2L 3WKML 3BX7C 3ZE0E 4KTYA 1UQSB 3QUXC 4NKOB 5I8OH 4QXUH 1OOAA 1CXFA 1UACH 4LLDB 3ETBF 2ARJB 4WNQB 4PB9L 2VAJA 5F88A 1UXWA 1OP5H 2HH0H 1AD9B 1YYLH 2C1PA 3UYPA 3MO1B 4ZMAT 1N2RB 2R1WB 2J88H 3IVKB 1FH5H 1U8MA 2Q3AA 4OKDA 2R0KH 3L5XL 4JY4A 2W0FB 4X5XB 5D2LB 3P11L 1I1AD 3LB6D 4DUXA 4UAOC 1NAMA 1INQB 3K2MC 3FB6A 1UA6H 3HMWL 3C6LC 2BVEA 2F53A 3T1FB 5EDXA 5FA4A 4WV1A 4PJ7E 4IIQA 3RUGF 3N1QC 1PJ9A 1CGSL 5JQ6L 1S78D 4MVBD 3UYOD 1TJGH 1YN7B 3DHJA 2AEPL 4F3FB 1WEJH 4PGBB 5ALCL 3EOAA 4OUOA 3UTQA 2FB4H 3KHOA 4GG6E 5C0BA 5K9KB 2NY4D 4LU5H 2LVEA 1HILA 2BRRH 3QPQC 3LQAH 4WFHE 4RFNB 5L8JB 2AEWA 1BJ1H 5C0DA 4N1EA 1WBYA 3GM8A 1X5KA 3FB6B 4NKIH 2FX7L 1SYVB 5J89A 4OZGF 1Z9OA 2ZZUT 5ISZE 1OAZL 1QSFA 2DQEL 4HZLB 2WWMD 1QSEA 1OF2B 3PGFL 4YHKL 1JGLH 4L8SB 4WEMB 4XPTL 2UUDH 4ZXBA 4IIQC 4I2XE 3BKYH 5D1ZA 5I30L 1II4E 1VEPA 4RSVA 2IAND 2PR4L 3U6RA 4UILL 3T0BA 2MQ3A 5KSVA 1MF2H 4BK5A 2PTTB 4POYA 1I1AB 4JFFE 1XGTA 2R29L 3NFNA 3B9KD 1UJ3A 4LKXB 3X3GH 1D6EB 3E6FB 4DGYH 5EZLB 5F6IB 4OD2A 3K8KA 5MEQA 4DVRL 5CFHA 3JBG7 1KACB 4LLVA 2H45A 4D94A 5D7LE 1OP5K 3P9MB 4PRBB 5DD1H 2JJUA 3OXRA 3MACH 2GITB 3ARGA 5DJCB 3H0TA 3INUL 1HE7A 1M05A 1E28A 5LWYL 1TCMA 1XGUB 1YY8A 1UWEL 3KYNA 1Q9OA 1KEML 1OGAE 4XHJC 3SO5A 1Q9LA 3WL9A 4L4JA 4KI5E 1BMGA 1MFAH 3TA3D 2XN9D 3MLYH 4MA8H 2FATL 1MCKA 2PTTA 4HJ0C 5I19H 1J0HA 1KLUB 3Q6GH 2Z4QA 1X5XA 3DMMC 4FTVA 5J13B 3IB4A 3LKPA 3ILPB 5SX4H 4TPRH 3H9HB 4P5MA 1GJIA 1CN4A 5B3NA 1MLBB 3TZVC 3U7WH