2DWEA

Crystal structure of kcsa-fab-tba complex in rb+
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB HEAVY CHAIN
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2006-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dweA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dweA02
3IS0X 3RRQA 3I50L 4NC1E 2P24B 2VITA 2GJ6E 5J89A 4AEHH 1P4LB 1JHTB 3HMWL 2ZNXA 4RFEB 2OTUA 4PJFF 3IJHA 3S6CA 2BNQE 3F7YA 4GLRI 4BK4A 1DJSA 4BFIB 2FB4L 5IFJA 5FECA 1J8KA 4TVSa 4HMEA 3STLB 4Y4KA 4YH6A 3WKMH 2OR8A 2GJ6D 3U6RB 4CU8A 1KXVC 2DL2A 2I9TB 2O26U 3VI4E 4S1RH 5FF6A 5ICZA 5ESQA 2HRPH 4R7DA 3IJSA 4JG1L 5F7LB 3VXTB 4N5UA 3HI1B 4PJXE 4E42A 2EKSA 1H15A 3QI9C 3QFJB 5IBTL 1IEAB 1T2QH 1BOGA 4U7SA 5MP6H 4OCSH 4XBGB 3QNYA 5IBTH 5SWZA 1WLHA 5IW1A 1T20A 3QUXC 1A1NB 3PUCA 2AK4E 3BESR 4Q9CA 5T3XL 1R3IH 4HKBB 4JDVB 1I8LC 4I18C 3FFCB 4M43H 4CDGC 1XGPB 4E0RA 4OGAD 3C2SA 3FO0H 1A1MB 2WAHA 3V5DB 2DQDL 1FO0H 4XTRC 3TN0A 4I0PB 1DE4B 4HDIB 4DN4L 2ERJB 2AK4D 4D0DB 4MJ6B 4WTZG 2GQHA 5I73C 4ALAL 1YECL 3L3KA 3MXVL 2CKNA 4PBXA 3AREA 2JB6A 2EXWC 1RZ7L 3D25A 5A3ID 2HLAB 4DN4H 2R69L 4GKZA 3MQIA 4G43B 3L3GB 5GJSL 3GSRA 4A2LA 4PGCB 4YDIL 3SQOH 1RZ7H 4OKDA 4FXKB 1A3QA 3S34L 4PRPB 5HGBB 1PQZB 4XNUL 1TCMA 5F9DC 2Q3AA 4JRXA 5GJSH 4M4PA 1LP9B 3MRGB 3N1PC 43C9B 4KZDH 4YDIH 1AP2A 5FUCC 2VLLA 5I1IL 3KJ6H 1OTUD 1XIWC 1DUYB 3HE6B 1S9KC 3NCJH 4XNUH 4AZ8A 2WUCL 3H0TA 4BQ6A 3FQUB 3MUHL 4XAWH 3KYOB 4RCAA 1S7WB 2NXYD 4QO1A 3RTQD 5JQ6L 1NMAL 1MFCH 4S11A 2HT3D 3OJDA 5MEOB 1W72B 3MV7B 1MFEL 5IMLB 3K2MC 2ZUVA 3V6OA 3WIHL 5EU3A 4QRSB 1F4WH 1MFEH 2EDHA 4YC2B 1JRHI 4QRQB 1C08B 4F7MB 3ULUL 1UWEL 2LTQC 4FTVA 1S9WA 3VE0B 3MR9B 3O3UN 4LSVL 1T0MA 4C54A 5L7XH 2QQLH 2IMNA 3P4LA 3FOMB 1JF5A 5TDPA 4X6DF 5F71A 1HNFA 4CGTA 2NXZD 5C0ND 3SY0B 5CEZH 5F7EL 3NFPA 4UI2A 4AIXA 3IDGB 4ELKB 3LKPB 3O41B 2NR6D 2AEPL 4YGVB 5DC4B 2NMSA 1UZ6E 2BVQB 1A9BA 1EV2E 4P9ML 2R2BB 3BP4B 3IVKB 1F3DH 1ZGLA 3PWJA 1D5ZA 3QEGH 4CMMA 4GRWE 4LIQH 3ZYZA 1NBZA 3QXDB 3VD5A 3HZYB 4FQQB 2R29H 5E5MB 5HJ3B 4GQ9H 1ZSDB 5E1AB 5H2BB 3CFJA 1NEUA 4HG4J 4JDZB 3GGWB 4QOKA 1IL1A 1RURL 5AYQA 3GIVA 4W6XB 1FL5B 4Q0XL 1OAUL 5B38A 4KKBD 4M62L 4PJ9B 5CJ8A 1S9VA 8FABA 4G9FA 15C8L 3RL1B 1Z3GL 4Y2DB 3C08L 2FGWL 5C3LD 1WISA 3DSFH 4M62H 5E8EA 1FVEB 4KJPD 4FQIL 2EEAA 2XY2A 15C8H 2OTWA 4Y1AB 5IVZB 1Z3GH 2GTZB 3H8NA 1K2DA 5DJ6B 1Q9KB 4FQIH 3T0EE 3BUTA 1NBQA 4QY8B 1G0XA 3V6BR 1C1EL 1WIPA 2I60L 2R0LH 2XN9E 4HCRA 1UFUA 3FQTA 1FZJB 3Q0HA 1YUHB 4NN6C 4YHZH 5ERWA 3VJ6B 3FAWA 5K9KA 1C1EH 1VFAB 1CGSL 1U8JB 2I60H 3T0ED 4NUJB 3KPOB 4UOW1 4FQHA 3QSKB 1LO4L 1C7SA 1WC7B 2XI9A 3R0MA 1BBDH 3KPPA 1IAOB 4U6XB 4OCWL 1NANH 1BBJA 3G5XA 3GFUA 2O5ZH 4KPHL 4WHCA 1LO4H 1U58A 4LHUG 4FQ2L 4OSUH 2BMKA 1E4XL 3MLRH 4JY6B 1B0WA 2QHRL 5F21B 4OCWH 3HPLA 4O5LL 1BZ7A 4JFQB 4JE4B 3U7YH 1U8OA 4XHJC 5J11B 4FQ2H 1BREA 4PJHA 4PB0L 2GK0B 4H8WC 5I1KH 1YMME 1GRWA 5H94B 1S7SB 2FEDC 2QLVB 2UZXB 5IBLC 1YDPA 1P2CB 3UBXG 3MOQA 3HC4H 3HG1A 3EKCA 2M1KA 4XVJH 1B88A 3ARBB 3MRRB 3EYOB 4P3WA 3QJFA 4WHTA 2W0LA 4LVNC 5GZND 2MPAL 1EFXB 1IEBA 2X89D 1YMMD 1HQRA 4HGWA 4JHZA 1AY1L 4N0RA 3B6SB 3EFFB 4M8QA 5HYFA 1CFQA 5C0CA 3W39B 5D7LB 5D5ME 1RZIA 2C1PB 3HI5L 4YO0B 1Y18B 1E4KC 3OQ3B 1AY1H 1JNNH 1K8IA 2J7LA 3B83A 3STBA 3L5IA 1ZLVK 1VHPA 1AFVH 3HI6L 1CFNB 1C12A 4AIZB 1XCQA 3T4YB 5GIRB 3TIEA 1W0WA 3NFNA 1IM9B 3TVMA 2VZ3A 5D7SL 3O6KH 2IBZY 1NGXB 3IF1B 2D9CA 3CCHA 4JGJA 4KMLB 1Y6KR 2X4UB 4U49A 1A7PL 5D7SH 4LLVA 1J88A 1VGKB 5GRYA 2FIRT 5DJCB 1BGXL 4R4ND 1JPGA 1MCPH 1A7PH 5K9QI 5BQ7A 1CDIA 4PJ8D 4CMHB 3QDHA 1YY9C 5C92A 4FQXB 3WO3B 1WV7T 5CD3A 4YHML 2XPGA 3SDAA 3B9KA 3C6LB 2DQFA 1MCJA 5EA0L 5T5NG 4B7LA 4M61A 4YHMH 3KDMB 2FX8H 5ELIA 1CDJA 3DURA 2BNQB 1GVIA 3QDGE 5IG7B 4H1LH 4I3RL 3G6JF 4MQXC 5IVXA 1MCKA 5E94B 3PABB 1G6RB 4UOW0 5IJVA 1KFAH 3HKFA 4IS6B 4AQOA 2HMID 3T04D 3WJJA 2GY7B 1J8HA 3AMKA 2VLJA 3QDGD 4HWNA 1UB6B 1ZE3C 4R90L 1ACZA 2FX9L 1UJ3B 4KUCD 1A5FL 3MSPA 5HGDA 2O61B 1QPXA 2A6JB 4OLVH 3SDXA 4NKMB 5B39A 4DGYL 1EXUB 1FPTL 2LAAA 2FX9H 2BVPA 1A5FH 3A0OA 3CFDB 4JFPB 2V5RA 5FO9B 3CJJA 4I9WE 3KR3L 1IZKA 1BM3H 4DGYH 3RZCB 4F9LC 1OGAA 1DTUA 3CVIL 1OTTC 4YDLB 3QQ4B 1A6VL 3KR3H 5I8OL 2XZQL 3QJHB 4XX1E 3BW9B 2G2RB 1T80A 2P45B 3JV4A 4I9WD 4OZFH 4X4MA 1M7DB 3VXRE 1DQTA 3ZO0A 3NN8B 1CFTA 5EOTA 5HHNA 2PO6A 3QIBC 1T66C 3O8XA 3Q5TA 3Q6FA 2XZQH 3CMOH 5IHUL 5EIQA 1ZAGA 1VFBA 1PYWB 5GS0D 2NY4B 3BP7A 2ADGA 4MQTB 3VXRD 5A43C 3ES6B 5IHUH 4LLYA 3K80A 2Z31B 3O3EB 1A0QH 1Q9WA 1WCBB 5HI3D 3NBNA 3TJHC 2F5AL 3Q48A 4TTGA 2KUTA 5HD8D 3T65A 3DXAA 2FJFB 3GMLB 4N0CD 2R4RL 4YQXL 5E4IA 4EDXA 1UKQA 2XICA 3D3VE 1SBBA 3BGMA 1I7RB 3QRFM 4QHLA 5EIIB 3K7UA 3MNVB 4FNLL 1NANI 5EU5B 2R4RH 1SM3L 1SEBA 3WCYA 5IVNA 4FRWA 3BKYL 1YEDB 3E1F1 3QZWB 2CO6B 1BFVL 5IESH 4FNLH 4P4RB 4L8CB 3D3VD 1SM3H 5J6HB 4NSKB 2GAZA 5CIPH 1E4XI 4GRMB 4DGIL 2CO7B 3T2OA 1YZZA 4KK5C 4UNUA 1BFVH 4JFFE 3CK0H 3I2CH 4OQTL 5DA0B 3VFUB 2XWTB 1EEZB 2Y36H 5AZ2L 2DLGA 5ANMB 1JE6A 1YN6A 5EU7C 2ADFH 3MLYL 3FO9B 4ZPTB 4OQTH 5ACMA 4JM2C 1AXSB 1RHFA 4JCLA 5AZ2H 3PGFH 5DD0H 4D0CA 1GHFL 1K3IA 1MLCA 5HHXL 3MLYH 3HNVL 5FYJE 4Q97A 1U3HA 4G9DA 1LE9A 4ZXBC 1NGZA 2ZKHH 3FO2B 1FRGH 3KWWB 1GHFH 5HHXH 3LEVL 4JPKL 2EDOA 5C2BL 3BEWA 2LV4A 3HE7C 2ORBL 1JN6A 3HNVH 3MFFB 1J86A 1EBAA 2FIKA 1MHEA 2R9HC 4RMVA 2ZCLH 3TJEL 3THMH 4XPHH 5FYJD 1U91B 4JPKH 2R8SL 5EOCJ 1S7RA 2ORBH 5IBUB 1IAIH 2YD8A 5HVGB 2JIXA 3RVVC 2F54A 5INCA 5BMFL 1YPZB 4CW1A 3WN5C 4PR5A 5JO5A 43CAA 4WHYH 3INUL 3RY5A 5HHVH 2XTJE 2B5IC 5IF0A 3OKNB 4X7CC 3DO7B 3TA3C 1DEDA 4X5XB 4XWGL 1XR9A 2MTPA 1KGCE 3KVQA 3V9FA 4JG0L 5J6GB 4LEOB 1JWMB 1YEGH 1H5BA 2WINB 1QBML 3RAJL 4XWGH 3PNWB 1JUFA 5GGTA 5I66A 2XTJD 3UJTH 5LGJA 4WV1B 4PG2C 5H8DA 2P8PB 1J5OH 4JFEE 4PJFA 5SWSB 1I7UB 1ZVYA 5DEGA 5T3ZH 3VWJC 1KGCD 4XI5C 3IS1X 2ZCKL 2FHFA 3ILPB 4G8GA 3ZE1F 4RISH 4YBQC 3HFML 3HLAA 1R5IA 3BZEB 2ZCKH 1U2HA 4JFED 1PKQA 3KPSA 3KS0H 2XN9B 5A2IH 5IEKA 4J6RH 3G04B 3OB8A 4Z7VE 3MV8A 5E99L 3W5NA 4HIHB 1NC4B 2P7TA 2VH5L 3BAEH 4V1DB 4PRNA 1HHIA 4NQEB 3MREB 5DJ2A 3M17B 5LJYH 2ZP0T 1CE6A 4F7EB 3WFBH 4GBXB 4KDVA 5FGBC 3OAUL 4HGMA 5I15L 2VQ1B 1Q0YL 4BFEA 3WIFA 4XNMA 2UYLB 1ZLUK 1VPOL 4R3SA 3NPZB 4QRRA 3RNKB 5A2JH 3V0AC 1Q0YH 4C4KO 3NH7L 2RCSL 5E08L 2VDQL 5GGSB 1R3HB 2UY6A 2ZSVA 4IRZL 1X4YA 1FNFA 1DLFL 3RWDA 4YIQA 4RFOH 3O9WA 5AEAA 3KGRA 3NH7H 3O4LE 5EBMB 4NT6A 1YEKH 4A6YB 5E08H 1D3CA 5JA9A 3KNBA 3GRWL 4YGAB 3CFIC 4IRZH 5I30L 4WFHE 1OARL 5C0RL 1G9ML 3FQRB 5FA3B 1R24A 4M7ZB 1F6LL 3I75B 4NQXB 3DYPA 4OI8A 3RJDA 3GRWH 5I30H 2EICA 4PJIF 1YQVH 4X98B 2AEWA 3O4LD 1T3FB 4KAQL 3X3GL 3O3DB 3RP1A 4XGZA 4KK9C 4U3HA 3BOVA 3BUYB 3GJFA 1QRNE 3ZTNL 5EORL 1S9YA 3S96B 1F58L 4NN7C 2HTLC 1D5XB 2YWYA 1MCEA 3MCLH 4MXWL 1IKNC 3BRDA 4Z9KB 4R9HA 1LEIA 2BVOB 1MQ8A 3MRNA 3SE3C 3B2UC 4L3EA 4LCUB 4M7LL 1ORSA 1QRND 4MXWH 2G9HB 4P2RD 2X1OA 1OW0C 4XXDB 3P73A 3CXHK 4GKOA 1MCFA 4M7LH 3D9AL 5C0AB 1OVZA 4WW1A 3PWUA 3U46B 4X4YA 2ZUQB 5K9OB 1I7ZA 2D7QA 5F9JB 1MH5A 2PW1B 3QYCA 5DRWB 4POYA 2W9DL 1C5DA 4CVZA 3BO8A 4L1DA 3DVGB 1NFDB 1NCDL 2L0DA 2RHEA 4X6DA 3IFLH 1CXHA 4OZHB 2FZ3A 4DVBA 1G7QA 4Y4FA 5CGTA 3C60B 3V8CA 5I0ZA 1JHKH 2W9LA 5EZLA 5JHDA 3PGDA 5KVDL 3LKNA 3RPIB 5ITFB 3MOAH 5DVKA 4PYHA 1KIRA 2AGJH 4WNQB 1D5MB 4H20H 2EDLA 4G6MH 4GG8A 4OCRL 1BD2B 4KRPC 3VFPA 5T1KD 4KJWC 3QI9A 1DUZA 2XNAB 4EN3A 1GAFL 1RUKL 3C9NA 2PYEA 5D1QD 2N1KA 5JIPA 5DR5L 4HZLB 3C5JB 4QF1B 1HEZB 5GQBA 1XGUA 2VXTH 4TUKL 4FG6D 3QUMB 4L4VB 4M1DH 1FQ9C 4PRIE 4APQA 5C86A 3QUXA 2PXYC 4I13B 3MV9A 4TUKH 3OAYK 1U3JA 2CIIA 3MJ9A 4HW6A 2VR4A 4GRLC 1I8LA 4KKAD 3EO0A 1Q9LB 4WFFE 4BKLB 5J1AB 2QSVA 2EC9T 4KRNA 1BEYH 1WSST 3JZ7A 4IHOB 1II4E 3FTGA 4LAQH 5T3XE 4HH9A 5FM5M 4UT9L 5GGTL 3KPRE 2VLKB 4RMRA 1JBJA 4K23L 1R3LB 4OFKA 5EN2A 3KLHD 3FCTB 4WFFD 2VL5A 3PV6B 1PKOA 4MJIB 5DRNB 4GAYA 2HVKB 3FB5B 4NPYB 5GGTH 1HILB 1OLLA 3FB7B 4K23H 3EDEA 5IKCA 3S5LA 1CGYA 1XR8B 3TC9A 3KPRD 4BA8A 3IAQA 1P7HL 1UXWB 1DLHA 1XIWA 1FJ1B 4HUUB 5DQJB 1AKJA 4NNYA 5IMKB 4N5EC 5I75B 1KCRL 5AUMA 4Z5RB 4QRPA 3V4VL 3DUUA 2B2XL 2H2PD 3MLSL 3AS0A 1TNNA 1BF2A 5KOVC 3K8KA 1NDMB 3S35L 1A9EA 3CLEL 2B2XH 5FYJU 3MLSH 1ADQH 2V9RA 4P57A 4ZQKA 2HRLA 4E9LA 4KMTL 1MCCA 3QUYB 4LCIL 4FP8L 4Z76B 2AXHA 3CLEH 1CT8B 2GT9A 3GMOB 3MJ6A 3OWEA 4LQ1A 4JFFB 1YMHA 1TCRB 4LCIH 3ULUE 4FP8H 25C8L 1KLGB 5F3HA 5J13B 2L7UA 1CDGA 3AVEA 5I1CH 4ODUA 1F8TH 4I0PC 4NQCA 4HZAA 4ODWB 5I19L 5EO1A 1NEZG 1OSZB 1S3KH 2ERJC 4ONGL 5AWNL 25C8H 1OM3L 4K8RC 2VWEE 1ZHBA 2BHYA 1UYWL 3D39D 4HWZB 2WQ8A 3VXMB 1H9VA 4XVSL 4NDMB 3AS1A 4ERSL 5TE7L 4OT1L 1HZHH 3QXTA 1G9EA 5JXAL 2JCCF 4UMGA 3RWCB 1UYWH 5TH2A 4HJGA 1KIPB 1MNUH 4ERSH 4U1MA 3H9HB 3BP6B 1UG9A 1BX2B 1GXEA 2J8UB 1OTSD 3D2UD 5JXAH 1IFHH 1QG3A 1N2RB 4OFVA 2R0WL 3TIDA 4K3DH 1SJVA 3GBML 3MO1B 3HE6C 1WWWX 4GKNA 5FKAB 1VKXA 4HPOH 4RNRA 2Q20A 5FYJH 2C26A 3GBMH 1QFHA 4UUJB 4P59L 5JOFB 5JXEA 1UJTA 1J05A 5H37H 4JZOA 2F53A 1CD8A 4LASH 1YY8B 1OAXL 4HUXA 4BH8B 4CDHA 3A67L 2NX5E 1TJHH 4YC2C 2DQUL 3ALWA 1AQKH 1PSKH 4OBSA 2UVEA 3NIDF 1OAXH 2CDEA 3B3IB 1KELH 2Q76B 2ED9A 1KJVA 2OMBA 1JMXA 3G6JA 2DLFL 3O45A 2YBRA 2FO1A 4AT6B 2CUMA 2X1WL 3UTSB 3EJYD 3T1FB 4LHJB 3MOBH 5J06A 1IGIH 1U93A 3RVUC 5JW5A 2NZ9D 3V5HA 3GMRB 4RWHA 4Z7VB 4NRZA 4GS7B 1J11A 2VDOL 4I48B 3DMMB 3SO3B 4JFOB 4WJ5A 1A1OB 3HPJB 4L4TE 5HGGS 3T08A 3CXHJ 1IGCL 4Y4KD 4LLDA 1KB5H 3IDNA 4G7YH 5C0IA 1CU4H 3KPQA 3MJ9L 3KYNB 2A77L 1KCSL 4XC1L 2Q6WB 1IGCH 1B2WH 3MRMA 4L4TD 5E8NB 5E00B 2NY0D 3QPQC 4XPBL 4JFXB 1OB1B 1GCFA 5FOBB 1EGJA 4LLUA 4GKSB 4LBEB 4M1CC 1WBYB 2FLBT 4LLQA 1O7SA 4OZIB 3IDUA 5LCVH 3ZTJH 4PJ9C 1BPVA 5KSVB 5HYIA 4LNRA 3V6FB 3ARFB 2E9IA 5EG6C 1TENA 3FONB 4Y2DC 1FZMA 5T1MB 2V6HA 1E4KA 1J7VR 3RA7L 1HSAA 2RFXA 2B4CL 4MWFA 4NJ9H 3TN0D 1N3NA 4DKEL 3MV01 5J57B 1J0HA 1XF3A 4F33A 4L3AA 3WIIL 3I84A 3GMMB 4NHCH 2B4CH 1ZA6A 4JRXE 3WSQL 3O2DA 1AGEB 1T21B 1YYLH 4DKEH 3LQZB 1IAMA 3L5WB 2A1WL 1LP9F 2GITA 4BH7B 1KJ3L 3WIIH 2ICWJ 1P7QA 2XKUA 3NCBB 4P5TD 4AENB 4F2MA 3WSQH 1Z9SA 5HY9A 2A1WH 3PP3K 1DANT 5IW6A 3HRPA 1KJ3H 3DX7A 4JRXD 4KDWA 2YPLB 2YUVA 3EBAA 3MLWH 4M5ZL 4P2YA 2YMXH 1NMCB 1AXIB 2Z35A 3F8UB 2ATKA 1WZLA 4KVNL 1C7TA 3GI8L 3BE1L 3V6OE 1N6QL 2APWA 4ODSH 3GMNB 4Z7WA 3SN6N 3GM0A 3QG7H 4O51A 1DVFD 2NY2C 4YXKL 1G7MA 4MD4A 3MA9L 3B5HA 1N6QH 1DDHB 4I0KA 5J11C 1GZPB 2A83B 4FTVE 1EAPA 5ETUA 1DQMH 2J5LB 2HT2D 3F7RA 3KPNA 3ZZ1A 1DZBA 4ODTL 4HS6A 2ZCHL 3S4SB 2FJHB 1DL7H 4PRHA 3ARBC 3A6CL 3T2PA 5MENB 4FTVD 1NGWB 1QYGL 3DRTB 1WGOA 4NM8L 4ODTH 2ZCHH 5CJ5A 3X13A 2VDLL 1GJIA 3A6CH 2A74B 1CI5A 4ZS7L 3EUUA 5FKPB 1A2YA 2VDLH 1GGTA 2VUYA 1BFSA 5TGBB 4PJ7B 1MAMH 2IALB 4N0YL 4PJAF 2WLZA 5GRJH 3U36A 2UWEB 2NY6B 3IDIA 3QAZB 4P46D 4N8VA 4PRIB 1QSVA 1A7QL 1HINH 4F9LA 3MPCA 3GNMH 1D5BB 1RY7B 3FRPA 5DWUH 5FHAH 4DZBA 4Y5YB 3ULVC 4OD3L 3LRGA 4QOKE 4RAUA 4ONFH 4AIOA 3HNSL 5FB8B 2I5YL 3E8UL 1WZMA 3NTCL 4N9GB 1X5LA 4L1HA 5B3JE 1T1WA 3H9SA 3T0DA 1KPVB 4QOKD 4YDVA 2I5YH 1WCQA 5HHQB 3NTCH 4NZRL 4Z18A 3GSVA 1ZT7B 2H3NA 4CMHC 4FQXC 3G6AA 5E24E 1VADA 3TBSB 3BJLA 4KKLC 3C6LC 3QA3A 1RK0A 1HOCA 4NNXA 2EYRA 5DEFB 3OSKA 1AHWB 4JO1L 3DGGA 2IF7A 1U95A 2D7MA 3BMVA 5JNYB 1BJ8A 1LO5A 3RWIB 1N8ZB 3P4OB 3X14A 1U8KA 5SX4I 2P5WA 5EU4A 3OKOB 2EZ0D 5HGHA 2XIDA 1F11B 1CF8L 4KDTC 2JLLA 2XXCB 4OQ1A 2A38A 1T04B 1CFSA 1UJ3C 3S88H 1X5JA 3O2VL 5ADPH 5KJRH 5E7FA 1LO0L 4EBQH 3BPCB 3V0VB 1MCLA 4H8WL 3GO1H 1CF8H 2YOCA 2WV3A 3P9MB 3WUZA 4PRAB 1AI1H 3O2VH 1LO0H 3QDAA 4PGBA 2BCKB 1EGJL 2HJFA 3NCCB 3RZCC 4PJHE 1OCWL 4I2XA 4OM0L 4MS8C 4YDLC 4J4PC 4E41A 3ARQA 3LY6A 1EGJH 4IDJH 3HG1E 2CSPA 4P2OB 4Z7OE 3GB7A 4OM0H 1JWSB 4PY8I 2BSTB 4PJIA 1T03L 4NHUB 4ZXBA 1I3UA 4UINH 3BWAA 1RFDL 1U8QA 1MI5B 2GTWA 4QRUB 4WO4B 3I6KA 1T22B 4NFBA 1WJ3A 3GSNL 5C0CE 2AV7A 3HG1D 3RX7A 2NY4C 1RFDH 1KIQB 2CK0L 4HFWB 5HSFA 2L4OA 2YPKB 2R2EB 2Z31C 2W0PA 3QEQB 2AJXL 3NOIA 3O2DL 3GSNH 3REWB 4HS8L 1P5VA 2VSDA 1LEKA 2EYTA 1UZ8B 3WN5A 5EB9A 3RTQC 5C0CD 3C5ZB 1MLBA 2V9TA 3QHZH 4YDKH 1S7QA 2AJXH 4L3CA 3AM8C 3PWPA 4JM4L 4HS8H 3FT3A 2AXFB 1FZKB 1YEHL 5FK9A 2WP3O 3WHE0 3BKML 4WU5B 4XMLH 3RBGA 4UTBL 4JM4H 1P7KB 3MUGB 5IM7B 1F5WA 1KCUL 4LSRL 4M3JA 3VD9A 2V7HB 3BZDA 4DW2H 4JFDB 3HC3L 4PG2A 4UTBH 3RVWD 3TVMD 5E6IB 2DQIL 1IC7L 3LPFA 4ODVL 1KCUH 4LSRH 4AM0B 5D8JL 1E6JL 2CDGA 4LVHB 1FN4A 1EEYA 1DQQA 4WU7A 2NX5B 4LQFL 4F15B 1HKFA 2ARJQ 1Q38A 2DQIH 1IC7H 5I1JL 5D8JH 4H25A 5I18L 3D85B 4XCCH 4LQFH 5TQ2H 1E27B 2VMFA 6CGTA 4XRCB 3K2UL 5I18H 5BVPH 2OTUB 4NOFA 3IJHB 3O6FA 3RGVD 1KPUA 5IVXE 5C09A 3MXWL 5IFJB 2YR3A 4XP6H 3SDAD 1QNZH 3B9KD 4JB9L 2NY1D 3K2UH 4EIGB 5ACZA 5I71B 4GW1B 5FGBA 3MXWH 1XF4B 1WFOA 1J8HE 2VLJE 4Z0XB 3T77A 4J8RB 2DWDB 4GH7B 5FM5O 4Y16A 3VFVB 5D2NA 1H15B 3ZE2E 3CSGA 3SDXE 2NLJB 3QIWB 32C2A 4YWGH 4C56A 1MRCH 1HQ4A 1J8HD 3RVTD 2V2WA 2YD4A 3FB8A 5SWZB 2HA1A 3NIFE 4NZDA 5IW1B 3QQNA 1F02I 1OGAE 5ID1B 2I07B 4HT1H 2ZUSA 4P9HL 2RJMA 3DUHA 4HXAH 2KKQA 2OK0H 1EAJA 1SJHB 4KJYA 1HWHB 4N8CL 5E5RB 2Q7YA 5ADOL 1RZJC 5ICYB 5IB4A 6FABL 4P9HH 5EO9B 4X4ME 1IRAY 2NNAA 1OGAD 1EFQA 1I1YA 5DQDH 3O81A 4WV1C 3BKCL 4LF3B 1IC4L 1UA6H 3RKDC 3E0GA 1F2QA 3AREB 2JB6B 3D25B 3FQNB 1BJMA 1IQDA 1NUDA 2VISB 1SBSL 1IKNA 3BKCH 4IOIA 2ENYA 1KJMA 1TFHA 3RL2B 2PO6D 1INEL 4B0MM 5EBLA 2G75B 5JDSA 3O3BB 3RNQA 3SE3A 2ADJB 4EXKA 5D7JB 2CRYA 3WS3B 5L2KA 5DF0A 4EVNA 3DXAE 4OIIH 2FYYA 1OW0A 4ZSOA 3LQAC 1INEH 4EDWL 5IB2B 2A73A 3TNNA 3HAEG 2X4RA 3ZKNC 4D8PA 5B4MC 1A7OL 3U4EB 4KI5F 3H0TB 4RZCA 3I02A 2F19H 3BQUA 4KHTL 4Y0GA 5DJDB 1SVCP 4GBXC 4U1SA 1I9RL 1GC1L 1JV5A 3DXAD 1A7OH 4M7LT 3OJDB 5DZNA 1FAKT 1GC1H 3TEUA 1UACL 3PHSA 1KEGL 1OP5H 2VN7A 4LSPH 1BIHA 1RUML 2ATPA 4EUPG 2DLTA 4PJ5B 4X6FA 2DBLL 2H1PL 3S3PA 1RUMH 3K81A 5HHOD 5HHME 5CD5C 5C0FA 1KOAA 2BC4A 3BRGC 4FN0A 4JAMA 4RGNE 4H1LB 1DQLL 4G80B 5FYKL 2C3WA 2JCCA 3OR6B 4M7ZC 1RHHA 3KXFA 1NH6A 5C9JA 5GRUL 4IM8A 4Q2ZA 3FQWB 1DQLH 3N1GC 4U3XA 5FYKH 5HHMD 4KROB 4RGND 5GRUH 1HSBB 5ESAB 2GCYA 1A9BB 2ICES 4CMMB 1N4XL 5DZOA 2LAGB 1U3HD 5D2LB 2BSSB 2DIJA 4X8JB 2DYPB 4JVWA 2V5TA 3EYQD 1FVCB 3GSWA 2W9EL 4JHWH 2F54E 1QQDA 1INDL 5DFWH 1SEQL 1U42A 1YPZF 2WWMD 3SO5A 1HHGB 1IC5L 4MAUL 4X0KB 5DFVD 1AR1C 3L7EA 1AO7B 4Y19B 2XG4A 5GS3A 5TQ0L 5L2JA 4TOYL 1G1YA 2JIXD 3T3PE 2F54D 4M6AA 3L1OL 4MAUH 2ZUQC 3MLVH 4OZFB 2GSGB 2HVJB 8FABB 4G9FB 3SKMA 2WK2A 4DN3H 1EEQA 2PYFB 3WNPA 3L1OH 3M45A 2P24A 3S36H 1VERA 4LP4A 4PJFE 1JHTA 5HYSB 2OTWB 4RFEA 4ORGB 1F3DJ 1FZOB 5H35A 4DVRH 3QRGL 4BFIA 2D03L 4G8GE 5KANG 3CAFA 1MCWW 3RDTD 1L7IH 3OHXB 3STLA 4WW2F 3UEZA 3QRGH 3U6RA 2FD6H 3KPSE 1PKQE 2D03H 4XC3L 1DQJB 4U1HB 1NGPH 3CD4A 4KK8D 1GGIL 2LU4A 3MV8E 1E28B 3QWRA 3L5HA 3PL6B 2H6PA 1F45A 3BIKA 4G8GD 4I4WA 3HI1A 3AXLB 3MRCA 3DWTA 1EO5A 1A7NL 3QFJA 4XC3H 4BFBD 3KPSD 2AVGA 4XBGA 3C8HA 4OCMC 5EUOB 4L9LB 2O5YL 3U9UA 4G6JL 4JFYB 3KPPB 1TJIL 3FT4B 3MV8D 2GI7A 1VENA 1A6WL 4B50A 2A0LD 1SY6H 4CVXA 4QRRE 2HT4D 4HKBA 2WWKT 4HS3B 4JDVA 3HPLB 1XGPA 1U8OB 3F7VB 2YA0A 3LN4A 2MWCA 2R0KL 4I0PA 1QVOB 1DBAL 1EMTL 4BZYA 4MJ6A 4QRRD 3MLTB 1YDPB 1IKFL 3PP4L 4PS4L 2HLAA 4PUBH 1DBAH 1JGDA 3QJFB 4G43A 1JPTL 3JXAA 5I8KL 1TZGL 5I0DA 1W0VB 1HQRB 3QIUA 3FMGH 4PGCA 4WUUA 3LD8B 3DVIA 5SWQA 5J12B 3O9WD 3DX8B 4FXKA 5ITBH 4PRPA 3VMOA 5HGBA 5I8KH 1TZGH 3IKCB 1LP9A 1PG7X 43C9A 4EEEA 1U3ZA 3NGBB 2OZ4H 2V5MA 1DUYA 5DD5H 4XCEB 3MCKA 2E6QA 4J3UA 4GT7A 1C12B 3HNTH 3HRZA 4HWBA 1B3JA 1FORL 4XVUD 5I75C 4L3EE 1X5GA 3ARDA 2VR5A 3MV7A 1W72A 5IMLA 3O11B 4QCIA 3OXRA 3H9ZA 4X5WB 3SE4C 3WFHA 1M7XA 2Q7NA 1IARB 3HC0A 1KACB 1CTNA 4K94C 2BDNH 3CCHB 4QRQA 4GAJH 5CP7B 1C08A 4A2MA 4F7MA 5J56B 3CX5J 2DKSA 2ESVE 3EJZC 3QUYC 1CICB 3P2TA 4Z0BL 2P1YA 5KZCB 1JPGB 4JGUA 1PFCA 5DJAB 3UAJC 3FOMA 4X6DE 1NFDF 1U6AL 3TWCH 4OLXH 4OZHF 1RI8A 3QB7C 2ESVD 1OF2B 5JHDE 2DQFB 3BSZH 1X4ZA 1RJZB 1U6AH 3E3QC 4M61B 1AR2A 1S7XB 3IDGA 4QT5B 1KT2B 4ELKA 1GGBL 3LKPA 2OLDA 4YGVA 3CU7A 1I8IB 2VXSH 3IVKA 4PJAA 2YRLA 5JHDD 4FQQA 5JPNB 2PYEE 1MJUL 2HN7A 5E5MA 1ZSDA 5E1AA 1NLBH 5H2BA 1FFPA 1AD0A 1JGVL 1HNGA 3MRHA 2VLJB 3RIAK 5HYQB 4OF3A 1IGJB 3WUWB 4PLKC 1N6VA 4R2GB 5HGDB 2AERT 5EWIH 4JDZA 3GGWA 3QI9D 2PYED 3TFKC 1L7TH 3P4NB 4X6CB 1EK3A 3LSOA 1P4IL 4CUCA 3C2AH 3U7WL 4PJ9A 5ALBL 4APQD 1YA5A 3RL1A 3QUXD 4Y2DA 1L9MA 4HBCH 1P4IH 5I1AA 5ALBH 2YN3A 4PTTB 4Y1AA 3MRPB 5KVFH 3NFSL 1DBJL 2FH6A 5DJ6A 3V2AR 4XTRD 1TIUA 1Q9KA 2GKIA 5D6CB 2ZUWA 2OBGA 2YXFA 2YZ1A 3O8XB 3Q6FB 1HH9B 4QY8A 1RJLB 1VFBB 1U0QA 3U9PL 4W4OC 3LKRB 1AC6A 4OLUH 1KN4L 4ZFFB 4ISVB 1BQHG 3BP7B 1FZJA 2ADGB 1YUHA 2EXWD 4NC0B 3CMGA 3VJ6A 2ENSA 3VFMA 5FUCE 5CJXC 4DWHA 1U8JA 3TBTB 3U9PH 1BAFH 1PG7W 1KN4H 3N85L 3V5KB 4W70A 4NUJA 3KPOA 1MJJB 5C08B 3MRLB 3VFGH 3P0YH 2D4FA 3BKJL 3K8MA 1WC7A 3BI9X 4PD4K 4YUEL 1IAOA 4QRPE 1V7ML 4GS7C 2WLYA 5E2JA 3DMMC 3SO3C 1XIWD 5FM8A 4EDXB 3BKJH 1J0JA 1MRFH 3JUZA 1ACYL 4XBPA 2XTLA 1RD6A 2QQKH 1CG9B 2EDBA 1AKJD 3PDOB 4JY6A 1QA9B 4XPAL 4PJBB 4JFQA 4MGXA 3VFRA 4F3FA 5KAQF 3S37L 4PY7B 3T2QA 1FVDB 1NDGA 1B0RB 4X7SL 2GK0A 5FEBA 4B41A 2DIAA 5H94A 1S7SA 4QXGL 2X44D 3S37H 2E6PA 1SMAA 4YX2L 4XP4L 4X7SH 2C5DC 2A9MH 3ARBA 3MRRA 1LK3H 3EYOA 4K8RL 4M7KL 2VO5A 4QXGH 4OD1L 1KLUA 1FHGA 4YEEA 4YX2H 2IH3B 3ARFC 4JANB 4NQCE 3B6SA 3EFFA 4M7KH 4BYHA 2CR3A 3W39A 5CINH 5D7LA 5CZKA 3ARXA 3HR6A 3WS6C 1RVFL 2C1PA 3S97C 1FNSL 4YO0A 2XG5A 1LE9B 3EYFB 4RA3A 5GJTL 2ZUTA 4FQJL 4NQCD 1NBVL 4GO6B 3S98A 1GOGA 2V2XA 4RQQB 3WEXB 3PHOA 3CZJA 4NIKB 2ITCA 5GJTH 3CVHL 2DM2A 2XV6B 2EH7H 1IM9A 4HWBL 1E4WL 4NM4L 4NO3B 2J8UF 3LRHA 2IPTL 2AXGB 3CVHH 1NGXA 3IF1A 4HWBH 1E4WH 2AJYH 4ZFZB 4CW1B 5I74B 5JO5B 5CGMA 4JN1L 2IANE 4TSBL 4MVBC 5AYUL 1VGKA 4QXUL 1NMCC 3SE9H 4BK5A 2EE2A 1X5ZA 1XR9B 5GPRA 2F53E 5TE4H 3BH9B 4TSBH 5AYUH 4FQXA 4QXUH 3EDFA 4K7PX 3SE8H 1JZ5A 1IAIM 1S5HA 1J18A 1KSRA 2IAND 4X7FC 3C6LA 1QKZL 2XQBL 4NQUA 1NUGA 2J5LC 5DEGB 4ZG1A 2F53D 3KDMA 3G6JE 4C55A 5DLML 3QQ3B 2XQBH 1PAMA 2P5EB 1CFBA 1T83C 3PABA 1ES0B 3HLAB 1KTRL 1IBGL 2IAMA 3BZ4A 5JPMB 1L9NA 1MCSA 1QFWL 4HQQL 1MFBL 1MQKL 1NL0H 4KDTA 4U6TA 4WI5A 1IBGH 1UB6A 3NCMA 2P7TB 1UJ3A 2O61A 1XF5A 4AH2B 1QFWH 2A6JA 4NKMA 1CE6B 3VXOB 2ZWLT 5HI4C 2NY6C 3CFDA 3QAZC 5FO9A 3S7GA 3WIFB 1T1ZA 2J88L 3RZCA 4J4PA 4U1IB 5L8LB 2J12B 3QQ4A 4HK3N 4Y5YC 1RZGB 4AEIH 2J88H 4XHJD 3ABZA 3BW9A 3RI5K 3VXSB 1U8HA 2X9YA 3WHXA 1MJ7L 1M7DA 3NN8A 1QZ1A 3ZL4H 4OZIF 1IGYB 3KS0J 4YIQB 1D6EB 3SGEH 2FEDD 3KLDA 1MCOL 5IBLD 2HFEA 1PYWA 2WW8A 4TVPL 3KLSA 4Q9RL 1R24B 5GGQH 4LGPB 2Z31A 3O3EA 3PXHA 2O93L 2FWOA 1WCBA 4K9EL 2MHAB 1J10A 1CLOL 1IT9H 4MB3A 1PBYA 4FQLL 4DEPB 4J2XA 5EBWB 2VDNH 2FJFA 3AM8A 3BPOB 5FM4A 1CLOH 3GMLA 1AHWC 4Q7DA 5ILTL 5BOZG 4FQLH 5F1SA 2DICA 5EIIA 4OZGB 1LEIB 2Y6SC 5EU5A 2BHZA 3CSYB 4UT7L 1YNTB 5EOQH 4MD0A 4HX1B 4L3EB 1QSFD 5EOCL 2BHUA 1YEDA 3DV4B 3QZWA 4NCDA 4L8CA 4P4RA 1CVRA 4LLWB 4UT7H 5J6HA 4HC1A 3DX6B 3BRFA 4MJ4A 4HJJL 1I85C 3LEYL 2IQ9L 1RZ8B 2B1AL 4X4YB 3VFUA 2XWTA 3PIQB 2Y5TB 5IT2H 5ANMA 3EO1A 1C5DB 1AD9B 4CVZB 2B1AH 1G7IB 1Z5LB 4EOWL 1H3XA 1AXSA 3QHFH 4OLZL 1HIML 2X42A 3ULUC 2FZ3B 1YY9D 4F58H 1QSEE 1HXMB 1Q1JL 2LU3A 4RIRB 1I3GL 4XNXL 4Y4FB 4P2OC 4PRHE 4EOWH 3FO2A 4OLZH 1HIMH 5EZOL 1NGQL 3KWWA 4WO4C 1I3GH 4XNXH 1LO3L 2C4XA 4NO2B 1QSED 4IRSB 4MQXD 4ZMAT 1CQYA 5FOJA 3DROB 2YHGA 1HYRC 1W8NA 3NABH 4PRHD 4EN3B 3TCLB 1RJYB 1LO3H 5CLTA 2X10A 2D3VA 1P1ZB 3M07A 4MQ7A 4PJ7F 3ZKSD 3P77B 1I75A 4WI7A 1YPZA 3R1GH 1GPOL 5DDHA 2VKWA 2UWEF 4I5BB 4ETYA 3C5ZC 3ZYJA 3O6LL 1TMCB 4UT6L 4NO5B 4XMPL 3MV9B 3SEPA 3OKNA 4YXLL 2CIIB 4X5XA 4HIEA 3O6LH 4UT6H 1BLNA 5J6GA 4LEOA 1JWMA 2EIDA 4TPRH 4XMPH 5C07B 4YXLH 1OD9A 3O2WL 3PNWA 1JGEB 2YD7A 1R3JB 4XP1L 3U7AA 2X70B 3AB0B 2EE3A 1OTTD 4WV1A 2P8PA 3H9SE 5E6IC 5SWSA 2V2TA 1I7UA 3GI9H 4Y5VB 1I9IL 3O2WH 5SV4A 1F90H 4RWYH 4LVHC 3ZE1E 2B0SL 2W1NA 2VL5B 4OBRA 4XP1H 4YHOL 1XGTA 4F15C 4LDEB 4XNZB 1LO2L 4M8VA 4P3CH 5M7QA 4WW2A 4ODBD 1WICA 3QIBD 1T66D 5CJOH 4MA7L 3BZEA 1T0PB 1HYSC 2B0SH 1I3VA 3PWNB 4YHOH 3S5LB 4HIIB 4WI4A 3G04A 1CXIA 4MA7H 4HIHA 3D6GA 4V1DA 4NQEA 3MREA 4G8EB 4XCFH 3TJHD 1M1SA 1Y0LA 3V6ZB 3M17A 4F7EA 2EH8L 1OWRM 1FBIL 5I71C 2P5WE 5F7WC 4J3OC 1QFWI 2VQ1A 4QRPB 3VXUB 4FFYL 2EH8H 2YD2A 1EPFA 3TT3L 3RNKA 2VXUL 4PJCB 3QIWC 4L8BA 4J12A 4P57B 4ZQKB 3TT3H 1MPAL 3WFEL 2VXUH 4JGMA 1R3HA 3NAAL 1OWWA 5EU7E 4O2CB 2GT9B 4ZO9A 5EBMA 1BWWA 3TZVA 1CDYA 4A6YA 3JBG7 2OCFD 2ZG3A 1YMHB 4KK5D 3WXVL 4E41E 3FQRA 2DL9A 5FO8B 4UNTA 3I75A 4NQXA 4PJIE 3FJTA 1OAYL 4X9IA 2CLRA 4S1DC 5EO1B 2BRRH 5CMAB 1T3FA 1FDLL 4JM2D 3O3DA 3GIZL 2FDBP 4HFUH 4E41D 4MNGE 1ZHBB 2AV1B 1JZ6A 5IQ7L 3BUYA 1OAYH 3SCMA 1MUJB 4Z6AT 3AREC 1EJ6A 4CN6A 3DO3A 3S96A 3BDXA 3I3EA 4U6VH 1GOFA 1D5XA 1FDLH 4ZAKB 4ZXBD 4M9PA 1EHNA 5TH2B 2DKUA 4HJGB 1AXTH 4B7IA 2BVOA 4YDJB 4UIMB 1MF2L 1UM6L 2Q1EA 3VG0L 2VQUA 2R9HD 5D7JC 2ITDB 4S1SL 4XXDA 3PWPE 1MF2H 3TBVB 4KKCC 3VG0H 4O00A 5JOPD 4HF5L 5FGRA 1BOYA 3LKSA 1HI6A 3RVVD 5KSUB 4HC1L 3LVEA 2JB5L 3PWLB 1JFQL 5F9JA 3MBEB 2CR6A 5DRWA 1J05B 3VMPA 1RUQL 35C8H 4JZOB 7FABH 3TA3D 4G6KH 1NFDA 4I1NB 1TJGH 4OZHA 5A2FA 3QCUL 1TTUA 4D3CL 1JPSH 1RUQH 3C60A 3SDCB 4I77L 3N9GH 3QCUH 1IGFL 1KJVB 5ITFA 4BELD 4WNQA 4D3CH 1D5MA 3VWJD 2YS4A 4XI5D 3QPXL 3CZFB 1EHXA 1BD2A 2XZZA 2XWBB 1TXKA 2NY7H 4YBQD 5LKNA 2XNAA 4NQSB 5C09E 4X4ZA 4H0IA 3WLWC 4HZLA 4NRXB 4QF1A 2XZCL 2Y1VA 1K4CB 4HSQA 3QUMA 5I16B 4L4VA 4XT1C 2VJXA 5EFIB 4KROC 1UVQA 4MSWB 1EJOL 3RQ3A 5C09D 2BNRB 2V9QA 2XZCH 2D7PA 3DYOA 1SQ2N 5D2NE 5EH1A 2BZDA 4YAQB 2E3VA 3IDMB 1MCHA 5IFHH 2C3VA 4GXVH 5DSCB 5C0IB 2OR9L 4NO0B 4BKLA 3KPQB 2OJEB 5J1AA 1E6OH 5E9DD 3U30B 3MRMB 5HDLA 2MQ3A 2OR9H 5A2LH 2VLKA 5C0BA 1R3LA 1PVHA 3MROB 3FCTA 4DOHE 3BEVB 3K4DA 3PV6A 5DRNA 2HVKA 1BQLH 1A22B 5CJQL 1QR4A 2X4PB 4NPYA 1HILA 4PJDF 3FB7A 5I8CA 2PCPB 4ZNEA 1XR8A 2GEEA 3MZGB 4G8IA 4Y4HB 5CJQH 1JZ7A 3QDMB 1I1FA 5M95B 1UXWA 3GSXB 3ZYOA 1JP5A 1O7VA 5IBUG 2IMMA 3T0BA 2RFXB 3NCFB 3VFTB 2MSPA 1FJ1A 3GSNB 5DQJA 2AI0L 3SKUD 5IMKA 4IMLB 4F33B 5IJKC 1GSMA 4TRPH 4KK9D 1TQBB 5L2KE 4ZSOE 1MAKA 3EO9L 4WEBL 2YD5A 2PTTB 1KJ2A 4ZUWB 2HTLD 3PL6C 3NIGF 4JO3L 1VFUA 1P7QB 2LQRA 5BS0B 4TULL 5E2WL 3W82A 5D72H 3EO9H 4BSVA 3B2UD 4MDIA 1NC2D 5IW6B 4KU1A 4LSSH 2DM7A 4QHUA 4L9LC 4M7JL 3X12A 3QUYA 3C87A 3ARUA 4Z76A 1QLEH 1FYTD 3GMOA 4LEXH 4Z7WB 5DUPH 4JQVC 3CNKA 4WEMB 3E2HB 4HULB 1UEMA 4KY1L 4M7JH 1TCRA 1S8DB 1KLGA 4A6YL 4W68A 3F7QA 2GSIB 3U0TB 3Q3GB 3N50A 4ODWA 1P9MC 1OSZA 3V79C 3OB0H 1M71B 3MJ7A 3G9VA 4HS6B 1FIGL 1KTLA 1Q72H 2IBGA 4RA0C 1VGEL 3QWOB 4HWZA 3VXMA 3IRPX 1I9EA 4NDMA 1IMHC 2JCCE 4KGJA 1TPXB 4LHUB 3KXFE 4XVTL 3X13B 4MJ2A 3RWCA 1VGEH 2X5PA 2SEBB 3LD8C 5F7FA 5J12C 3H7BB 1A47A 1XZ0A 2NYYC 3MA7B 4RAVB 3BP6A 1BX2A 2J8UA 4KRPD 4XVTH 1KLFA 1N2RA 4KJWD 3NGBC 2YD9A 1WZ1L 3UC0L 3I6LD 3MO1A 3KXFD 4XZUA 3OPZL 3JV5A 3K46A 1FH5L 3U36B 1T4KB 5JR1H 3UBXB 5FKAA 3QDJB 4R0LB 1YNKH 5D2LF 1Z6JT 3O3AB 4V2CB 4UUJA 5E2VL 5JOFA 2PXYD 1Y6NR 3BP5B 4CU6A 3EAKA 1RMFL 4DZBB 4ZTOH 4M5YL 1UT9A 4GRLD 2YA1A 1NCAL 1YY8A 3SKOB 3ARGB 4BH8A 2D4DA 1LVEA 4ZS6C 5LQBL 4D9LL 3NIDE 1CLCA 4M5YH 4XNYL 5I1DB 1V7NL 4CKVX 1NCAH 3VH8G 3B3IA 3H9SB 1CICC 2XRAH 1CLZL 1WTLA 1A6TB 5GGVL 1OQOA 3ET9F 3GSVB 4S0SD 4AT6A 4XNYH 5GRZA 1ONQB 1YEFL 3UTSA 3OG4B 2X41A 4CN1A 1CLZH 1JTOA 2QJDA 3T1FA 5GGVH 3HAEH 1VADB 2QQQA 1SMOA 3LV3A 4JR9H 1RK0B 5ALCH 2H9GB 4C58B 4NNXB 2ZG2A 2VZSA 5T5FH 3GSQB 4JFOA 2DTSA 4P23B 4JZJA 1A1OA 3HPJA 3W81A 3WKNA 2CH8A 1HH6B 2CGRL 4X9BA 1LO5B 3QFJE 4OJFL 2YKLL 4NUGH 5C6TH 4N5ED 1X5IA 1T7WA 2AJSL 2P5WB 5EU4B 4F7TB 3WJJC 3KYNA 3ARSA 4EUPH 4OJFH 4AL8L 5E8NA 5EUOF 3QWRD 1CFSB 2B39A 4R2GC 1FAIL 1OP5K 3GBLA 5AD0B 3LCYA 3QFJD 4JFXA 2APVA 3F7PC 4NBXB 4WTWA 5FOBA 4RRPG 4AL8H 4GKSA 4LBEA 1WBYA 1AE6H 2WNGA 4OZIA 1FAIH 1A3RH 2JELL 4OLWH 1CCZA 3W0WA 1T89C 2QQNH 3V6FA 2MJWA 3FONA 4I2XB 5JUEL 2VC2H 3S3JA 5CUSH 4UTAL 3U0WL 4P49A 4GMTL 3WS6A 3ZKXB 5T1MA 1M05B 3F58L 4BFGA 2KQMA 3FFCD 5JUEH 3OZ9H 5KSAB 5J1TC 4GXUM 4OFDA 3BWAB 1DN2A 4GMTH 4P48A 4I0PD 4KI1A 3O8XC 3I6KB 4WUUE 4JQIH 5F7KC 4TNVK 5DI8B 4K8RD 3GMMA 4PRPE 2AV7B 4DAGL 1LP9E 3LQZA 3MZTA 1A7RL 3L5WA 5F7DA 3CFEB 1ZEAL 3V4PH 4U1KB 4BH7A 2DTMH 4AENA 4DAGH 4PJGB 4UILL 1KJ2L 3BDBA 3P30H 1A7RH 4PRPD 1ZEAH 1MLBB 5F97E 2H2SC 4L3CB 4ZUUA 4K94L 5AZEH 1RIVL 4POZC 3PWPB 2BSRB 1GGCL 3FT3B 5E03A 3MV7E 4JRYB 1I4FB 4LPWA 4R7NB 1A4KB 3HE6D 4P46B 4RBPH 3GMNA 5FK9B 1H0DA 4XX1G 1RIVH 3JWDL 5HPOA 1YJDH 3UTZA 4Q9BA 1FC2D 4CU7A 1DDHA 2AS5M 1UB5B 1GZPA 2A83A 4CAGA 3MV7D 4OI7A 3BN9C 1QPPA 1N5YH 2CUHA 1VA9A 4OD2A 1ITBB 5B3NA 5LGKA 4WU7B 3PJSB 1T83A 3O0RH 5E8OB 5MENA 1NGWA 3DRTA 4G6FB 3UXFA 5ICXB 3LZFH 3IDXL 3ETBF 3HZMB 3BT2H 3G9AB 2A74A 3RWEA 5FYLD 3O6FB 5FKPA 1PLGL 4FFZL 1KPUB 5D1ZB 4EI5B 1Q9OA 1T7ZA 4PJAE 4PJ7A 3RVUD 5EZIL 2IALA 3NA4A 3QEHB 1QD0A 1MVUA 2AK1H 4S1QL 3SDYL 4NQTA 4OKVB 5EZIH 1LQSR 4Y16B 12E8H 4Y7MA 5D2NB 4S1QH 5DFVC 4Y5YA 4U7MA 2CKBH 4JY5H 3RIAF 2G60L 5E4EB 4C56B 5FB8A 3DYMA 1HQ4B 4U6HB 4X6CF 5I74C 1FO0A 1RUAL 3D48R 4JPVL 3QPQD 1IQWH 2YD1A 1EHAA 1KPVA 4HWEL 1MREL 5HHQA 4Z8FL 1RUAH 1WVZA 4KJYB 1ZT7A 4DOHB 5F9AC 4D94A 4M1CD 4Y1AE 3AMLA 5DVMA 2R0ZL 2E7CA 4PJ9D 4O4YL 2EDDA 4Z8FH 3TBSA 2NNAB 2YN5A 4Y2DD 4DUVA 3VFSB 1NUFA 4UDTB 4TVPE 1MHCB 2R0ZH 4U05A 3SDDA 5DEFA 2DQEH 1N64H 1AHWA 4Y1AD 1IQDB 1U8PB 5JNYA 2YUWA 4URTB 1RZFL 1KJMB 3K4AA 4GAFB 3FHQA 3WXWH 3QR2A 3VDBA 1NCCL 4NC2B 3RWIA 5LXGH 5EBLB 1ZT1B 5F3BB 3RNQB 5IROA 3OKOA 1RZFH 3DI3B 5L2KB 3P0GB 4FFVC 4OAWA 5HI5C 2LE9A 4LHQB 4LVOC 1T04A 4D8PB 4PB9L 2VZTA 4KV5F 4RZCB 1OAKH 3I02B 3V0VA 3BQUB 1I85A 1HHKB 2C3XA 3P9MA 4K7FB 1WBXA 5CKGA 5HDQL 1JV5B 5GS1A 4U6YB 3UZQA 5CZVL 2BCKA 2ICWI 4PJBF 5DJXB 2GJZB 5L6YL 1NFKA 5HDQH 5IFAH 2WWKO 5CZVH 2NY2D 5DHYB 2EYSB 5L6YH 5GGRB 2YK1H 3REVB 1JWSA 1S5IL 2BSTA 4Z7UB 2NTSP 4NHUA 3QG6B 2AJVL 3HR5A 2DJUA 1MI5A 4QRUA 4WO4A 1T22A 2G5RA 2VB5A 3GSOB 3PF2A 4BQ8A 4HIXL 1MFDL 3UX9B 2HFFB 2AJVH 5D7LE 1KIQA 2IJ0C 3DPBA 4HFWA 5E8DL 3SGDH 3ARBD 1LWRA 2JCCB 1ZS8B 2EE9A 3GHEH 4RX4A 4NRYA 2M2DA 3QEQA 1EFXD 1MFDH 3REWA 5HGAB 4FZ8L 5KW9H 4LRNL 5LBSL 3KPMB 4OF8A 3RVXC 3H6JA 2F5BH 3DVFA 4DEPC 3TYGH 3C5ZA 5D7LD 3V7AE 3BPOC 4QLRA 2CQVA 4NWUL 3B9DA 2AXFA 4X6BB 5BV7L 3SGKC 2EDTA 1CZ8L 3DJ9A 1CBVH 2RB8A 1DSFL 3L3IA 1P7KA 3VG9B 3MUGA 4RSVA 3JTTB 4JFDA 4KUCF 2IGFL 2YPVL 1IM9D 5E6IA 3ULVD 4AM0A 3GMQB 5A16A 4N1CA 2IGFH 2QSCH 1TLKA 4ZPVB 1L0QA 1EH9A 3STZB 1ZT4B 3LKQB 3D85A 3DRQB 3VFWA 1E27A 1FV1B 2A6KB 5B22A 1WEJL 1V3JA 5IV2B 1G1CA 3AY4C 4XRCA 3OX8A 4P5MB 3WKML 5H35B 4FQXD 2YC1B 5J7CC 2DMBA 4Y4FC 3S3SA 4N0FB 1CD0A 1WEJH 3ISWA 4KKLD 3ZKQD 3C6LD 4S1RL 4DJMA 5GGUA 1R5VA 2HRPL 1KCVL 3U82B 1H3UA 4GW1A 1D6VL 4X99B 1XF4A 2ZUXA 1T2QL 2R2HA 3FAXA 2BNQD 4IRSC 1FGNH 4J8RA 4Z0XA 3SJVB 1MHPH 2DWDA 2VYRE 5MP6L 2H6PB 3BIKB 4OCSL 4I4WB 1KCVH 3K1KC 3VFVA 1B90A 3MRCB 1D6VH 1U36A 4EN3C 3RX8A 2NLJA 3QIWA 1P4BH 1S7TA 3BGAA 5IOPA 2QR0B 1KUMA 3U9UB 1C5BL 1R3IL 3CX2A 4OLEA 4APQC 4M43L 3DGCR 2FSEB 2WANA 3FO0L 5ID1A 2I07A 4CVXB 1FO0L 5L8JB 4G7VH 1C5BH 3S4SG 1SJHA 4FXLA 4M6NH 2GK2A 2BY0A 3VD3A 5ICYA 2KZ1B 4PJDA 4YHPB 3FRUA 3IJYB 3LN4B 1TDQA 5EO9A 2Z8RA 1E4JA 3RZCD 2AAVA 3AB0C 4MS8D 4J4PD 1XF2B 4P2QB 4LF3A 4WFEE 3RI5F 5F88A 2LVEA 1XMWA 1AGDB 5KVEL 1XGQA 4Y5VC 1J12A 3SQOL 3FQNA 1M6OB 3CU1A 5EC2B 3UP1A 1JGDB 2VISA 4XNZC 5T1LA 4MNQB 1CL7H 3RL2A 3FZUC 4KZDL 5KVEH 5I9QB 1NCBL 3QIUB 4WUUB 4YHNA 3SKNB 5SWQB 1G7PB 1K5NA 3KJ6L 2G75A 3O3BA 2ADJA 2FRGP 1MIML 1KXQE 3NCJL 5D7JA 3WS3A 3CLFH 2Z8VC 2NY4D 1NLDH 4ZYKB 1OPGH 4XAWL 1NCBH 4D9QE 2B4CC 2P46B 3V0WL 5IB2A 1UGNA 2F8OA 4KI5E 4M1GH 2Z31D 1MIMH 1NCWL 3MCKB 1MFCL 2C9AA 3U4EA 3GM8A 5HVHB 3IGAB 4ZOBA 1G0DA 3MRDB 4R8WH 2UV3A 4B53A 5KSBB 3CVHB 1SYSB 5DJDA 3V0WH 4M93B 3HRZB 1JK8A 4DFIA 5DZLA 1F4WL 4TYUA 1NCWH 4OZGF 1Z9OA 3ARDB 4DKFH 4D9QD 4LSTH 4NKOB 4QCIB 3OXRB 4HKJA 3WFHB 1JWUB 2HTKC 4GXUN 5EUKA 3HC0B 1RZKL 5L7XL 3CH8A 2QQLL 1FL6B 1I8KA 5MERB 5D1XB 1AH1A 4PJ5A 4LKCB 4ZNCD 5TF0A 5ANME 1RZKH 1C16A 3DIFB 2MCPH 1DEEA 2O5XL 1DFBH 5I1GH 4M00A 5L0QB 1EO7A 5CEZL 4H1LA 1TVBB 1BHGA 4G80A 4LARL 3F6IA 3OR6A 3MGOA 2O5XH 1KEML 3SGDI 1RUPH 3FQWA 5FV1L 3EOTL 4LARH 3QEGL 4LIQL 3TH4T 1F3JA 1PZ5B 3RU8H 1HSBA 1KEMH 5ESAA 2X4OB 4RGOH 2R29L 4GQ9L 5ID0B 4BZ1L 4PJAB 5MI0B 3EOTH 4AMKH 4LSUH 5DMGC 2EDQA 5FGSA 5D2LA 4ZAKC 4PV8A 2BSSA 3B9VA 5JORA 5FYLH 4X8JA 2DYPA 2E9BA 2HN7B 2CDFA 4BZ1H 1FVCA 4MA8L 2OQJA 1FFPB 1AD0B 3F5WB 3MRHB 1H3PH 4HUVB 3HTLX 1YPZE 3F12A 4KFZC 5CSZA 5CEYB 2NW2B 1H3GA 2J1KA 1IGTB 1HHGA 2W07A 4XWOD 2W0KA 4X0KA 4MA8H 4GSDH 4AEFA 4Y19A 1AO7A 1NEZB 1EHLH 2LABA 2R39A 4IBLT 3MLXH 3LSOB 3DSFL 4PJXA 1WBZB 1G9NL 4OZFA 2GSGA 2HVJA 3VXPB 3MBEC 2WZPD 3NPSB 3GBNH 1I1CA 5JXEC 2PYFA 4J3TA 5I1AB 1QBLL 1G9NH 2W92A 5SWSE 3CH1B 4XP5H 3OR7B 5HYSA 1PY9A 4ORGA 4XNQB 1FZOA 2R56L 3DECA 2R0LL 1QBLH 3SDCC 4YHZL 4NCC2 3OHXA 2R56H 5IJKA 5SWSD 4H26A 2UUDH 3RKDD 1DQJA 4U1HA 4P3DB 4DZ8B 3ALPA 2IH1B 3VFNB 3VFMB 1E28A 3PL6A 4WGWB 4V1DE 5KG9B 4NQEE 3AXLA 1BBDL 5ESVB 4UZGA 5C6WH 2H32H 3ARYA 2NY3B 2O5ZL 3ZDXF 4HUNB 4OSUL 1H8NA 2XN9D 5EUOA 2BOCA 4HMCA 4L9LA 3MLRL 1WWBX 4JFYA 3FT4A 3L95B 1NC4D 3ZYIA 3ZKND 4V1DD 4NQED 3U7YL 5B4MD 2BJML 2K9UA 2JF1A 4JQVA 3TPUA 3IXTB 5CIPA 4XBPB 4X6EB 3ZLQC 3A6BH 4GBXD 4HS3A 5TFSH 5I1KL 4HHAB 5EU6B 2FCBA 3VFRB 1HHHB 3H3PH 4PJCF 3F7VA 4F3FB 5A40E 1UM5L 2BJMH 3HC4L 3LMJH 3NACH 4MA3B 1NDGB 3Q2CA 1CE1H 5CP3H 1QVOA 4XVJL 1P9MA 3U30C 3MLTA 4OQTA 1UM5H 1I8MB 2VAAB 3UJIL 3MCG1 3JSSA 4R4FH 3ZDZF 1KLUB 3FL7A 3UJIH 4NP4L 1W0VA 4X80H 3ARVA 1T7YA 4OB5L 4M02A 5DVNA 5GHWH 5HYJB 2VZ1A 1JNNL 3DX8A 5CD5D 3VWKB 1VACA 2ICEA 4Y4HC 5GS2D 3IKCA 1AFVL 4NP4H 4ENEC 4OB5H 1I1AB 1MSPA 4NKDB 4MD5A 1BFTA 3IYLW 4HKZB 4XCEA 4HBQA 2XACC 2V2XB 3PHOB 2P8LB 1ORQB 2ITCB 1TQBC 3O6KL 3O11A 2GHWB 3OMZA 4PP1C 4X5WA 4PLJC 1X4XA 1XAUA 3HB3C 3NA9L 5C0AE 2HJLB 1FFOB 5CP7A 1MCPL 1C5CH 3NA9H 1LK2B 1CICA 1AR1D 2OS7A 4G8FA 3K0WA 3NCEB 1NFDE 5DJAA 5C0AD 3E2HC 2OX5A 2CLZA 4OZHE 1QFUH 1S5HB 4K2UH 2FX8L 3ULVH 1H3WM 3LQMA 2Q87A 1OF2A 1G0YR 1RJZA 2EDRA 4KJQC 1S7XA 4QT5A 1KT2A 2RQ8A 1KFAL 3I6GA 1CN4A 2ZOLB 1RULL 1H3VA 3WNOA 1I8IA 1BD2E 1WZKA 5KS9B 3IETA 2IAMB 3BZ4B 1TPXC 4TUOB 5JPNA 1FE8H 4U1JA 4GMSH 5INDB 1RULH 1KBGL 1PD6A 4O2FA 4BSJA 4OLVL 4QNPF 4L4VE 4E5XB 5HYQA 3T0EA 1IGJA 3WUWA 2QSQA 1BD2D 2X4TB 4ZOAA 1EIBA 3UROR 3WNMA 1XF5B 1KBGH 2LVCA 1Y6MR 3RWJB 3VA2C 1BM3L 5CWSB 2FHCA 3P4NA 4X6CA 4R0LC 1U8NB 4FOMA 1A3LH 4ZUTB 1FSKB 4L4VD 1T89A 3C09B 1G6RH 1CYGA 1T1ZB 1HE7A 2HAZA 2JK5B 2HJKB 4NOBA 4P5KA 1B6UA 1I9JH 1VSCA 2BY3A 4PTTA 2VLKE 3CMOL 5C0BE 3MACL 3MRPA 3ARGC 1LD9B 1U8HB 1QFWM 2N4IA 4OFYA 3WHXB 4MJIE 4FA8A 2Y7QB 4P9HC 5D6CA 4EJ1C 3GRWA 1QTYT 1HH9A 1RJLA 3MACH 5C9KA 4QHNB 5C8JB 1A0QL 5B21A 5JIKA 3G5ZB 3LKRA 4YHLL 2HFEB 4ZNEE 2VLKD 4ZFFA 4ISVA 4LAJH 5B8CB 1LHZA 4UDUA 4KXZH 3H9YA 4FQ1L 4MJID 3OBAA 4IOSD 2FWOB 3TBTA 2XWJB 4YHLH 2Z91A 2YEZA 3V5KA 3V95A 1F4XH 1WWCA 3RHWK 1MJJA 5C08A 3DBXB 3MRLA 3EOAB 4FQ1H 3PG2A 3L3OB 1MJ8H 3TYFB 1WFUA 1J1XL 4X7DC 4P23C 2DBJA 4JJ5A 5IESL 1CG9A 1P6AB 1MCIA 3PDOA 5B38G 1QA9A 3HHRB 1J1XH 4MD0B 1M7IA 4PJBA 5JQHC 3QXUA 3PWVB 4PY7A 1PJ9A 3WE6B 1FVDA 4RMSA 1B0RA 1CD1A 4O9HH 3CK0L 2DMKA 3I2CL 2Y36L 1H3TA 1GC1C 5DJ8A 5F89A 2ADFL 4IIQB 1T2JA 4Z7WF 3KHQA 4ETQA 4WCYL 5F7NC 5JDJA 3PGFL 3EO1B 5DD0L 3EJZD 3QUYD 1HDMB 4ZUSB 2IH3A 4X8XA 2QADB 4JANA 3T8XB 3ZDYF 3JV6B 4WCYH 3E3QE 5JW4R 3UAJD 5GGRY 2ZKHL 3VD4A 4JFFD 1FRGL 3ZKXC 5DJ0A 1I3RB 3VXME 5CKAA 4RMTA 3BWUC 3SPVA 3LRSB 3NCYS 2C1OB 5BW7C 3UPCA 3EYFA 2ZCLL 3CFCH 1KB9K 2CD0A 3THML 1J9CT 4XPHL 5F9WB 1U92A 3MRFB 4CADB 4GFTB 4RQQA 1IAIL 3EZJB 3WEXA 4PREB 4XBEH 4UIKH 2HLFC 2R1YB 3MMEB 5DD3H 2J8UE 3VXMD 4NO3A 4Z7NF 3IFPA 2CXGA 2FECL 2AXGA 3TV3L 5HHVL 4MQ7B 1F2XK 2APFA 4M4RA 3VRJA 5DDHB 4ZFZA 3VGFA 2Y5EA 4O58L 4PLKD 3VMNA 4UB0L 3QNZB 5DMJB 1BVLB 3TV3H 1FFNB 1YEGL 4K3HA 3DOSA 1X3DA 4F80A 3TFKD 1E0OB 4HIEB 1BLNB 3BH9A 4O58H 2ZZUT 4UB0H 3UJTL 3PQYB 1S7UB 2WBJB 5D7IB 3W9EA 1J5OL 1WWAX 2VDRH 4GRWH 3ROLA 5T3ZL 5F44A 2EXYC 5DMIL 4JKWA 4RISL 2V2TB 3MRQB 4BUHA 5E8PB 3BFOA 3IU4H 2XT1B 5FUOH 2YUZA 1XGTB 3QQ3A 3QUZB 3WBDA 4Y8AA 3AU1B 4NWTL 2P5EA 1BP3B 2F15A 5DMIH 4J6RL 3UTSE 2CJUL 3ARWA 3VXNB 4F8QA 1X6NA 4WW2B 1ES0A 4J7RA 3BAEL 3O6ML 1RZJH 3B9AA 3SKJH 5JPMA 4NWTH 1IILE 4NNPL 2CJUH 3MLZL 3WFBL 3O6FC 3O6MH 3EFDL 5FV2A 1BIIB 3UTSD 4HAFA 4AH2A 5D1ZC 1Y0LB 4HGKC 4EI5C 4NNPH 4OGYH 5C70A 3MLZH 3VXOA 5D9SB 3EFDH 3MUJA 1ADQA 2VAJA 2BVEA 1JI1A 3DMMD 4ZFOA 4FZEL 5CS7A 4Y16C 5D2NC 4U1IA 2PR4L 1T6VN 1RZGA 4PRBB 5E4EC 2EO1A 4L8BB 4RFOL 5T5NF 4BQ9A 2WUBH 1T5WB 4FZEH 3VXSA 3ECBA 1YEKL 4OZIE 2PR4H 4KRMB 3OB0K 1IGYA 1D6EA 2FX7H 3TZVB 4P4KB 4CNIB 1AC0A 1YQVL 5F7HA 2MCG1 5M94B 2MHAA 1BMGA 4NN5B 3EDDA 2CLRB 3ARFD 1FLTX 5D6DA 3UPRB 4WDIA 3GHBL 2VLME 1JYNA 4OV6F 3MCLL 4JFZH 1OAQL 5EBWA 5TDNB 1MRDH 4WFHD 3SCMB 3WD5H 3GHBH 4HIJA 3SGKA 1CXLA 1TQCB 4TNVF 5B39G 1OAQH 1UADC 5L8KB 5GS2H 5GRVK 4OZGA 5DJZB 2VLMD 4Y8DC 3CDGB 3CSYA 1YNTA 1QUNA 4HX1A 3BN3B 4PJGF 1W0YT 1UC6A 3DV4A 3QQ9C 1T1XB 2YPLE 1AIFB 5MEQB 3I9GH 4LLWA 2L7JA 3DX6A 3MBXH 5DK0B 3LKSB 1HI6B 3BQUC 1ZTXH 4OTXH 5EBGA 1RZ8A 3G5YA 1REIA 3PIQA 5HDOA 1N59B 2P43B 2Y5TA 3IFLL 2YPLD 1MEXH 4MVBD 1AD9A 2DI7A 1G7IA 3W9DB 1Z5LA 3KPTA 5J1SC 1JHKL 3AY4A 2FR4A 2HFGL 4MHHI 1HXMA 3LN5B 3MOAL 2AGJL 3L3JB 4RIRA 1S9XB 4H20L 1VEOA 4G6ML 2OJZH 5MENE 3DHJA 2HFGH 1XF1A 4TQEH 2J6EH 4QYOB 1IAKA 4NO2A 3W2DL 4IRSA 3I3DA 4OV5B 4MLSA 3DROA 2VXTL 3M8OH 3TCLA 4M1DL 1RJYA 5MEND 4PJ7E 1LEGB 3W2DH 3G5VB 2EEDA 1P1ZA 2DOCA 1KB5A 2UWEE 3P77A 4HLJA 3LKOB 1IAII 2VDPH 4I5BA 2HFTA 1UVQB 4EUPB 4JN2B 4LCYB 1UEYA 4NO5A 3E6HB 1X6LA 3B2VL 1DBBH 4G3YH 4R4BB 3SQBA 1BEYL 1FNHA 2VERN 2ICWB 2FECI 5FXCH 5HI4D 4LAQL 2NY6D 2C3VB 3OJVC 3FN3A 4OCYL 3VG9C 4PRID 5C07A 3B2VH 2N7BA 4L8SB 3WO4C 2ARWA 2ZSWB 4JVUA 4MXQC 1JGEA 3LH2H 1R3JA 4RDQG 5I76B 2X70A 4DFHA 4YZFF 4OCYH 3F6LA 2AJUH 4Y5VA 4NZTL 5C0BB 5TJWK 5IB5B 4LPCA 3QWQB 1MCNA 1JZ4A 4NZTH 5BRZB 2VN4A 5T3XD 4ZD3H 5I8CB 1KB9J 3PWNA 3UCRA 4HIIA 3VD7A 4G8IB 4HKXA 4ZTPL 3QCTH 4FFWC 1AGFA 1IM3B 3T0VA 2E27L 1I1FB 3IRZA 4G8EA 3VW3H 4ZTPH 3V6ZA 2E27H 2EIZB 5GS0H 4TSCH 1KXTB 4EKXA 5C0EB 5DURB 3ZHDA 4GJTB 3VXUA 3BZFB 4RBPK 2NTFB 3QP3A 1KJ2B 1ADQL 3HE7B 5I1LA 1IJ9A 4PJCA 1QRNA 4ZFOL 2Y6SD 3TESA 2CMRL 1MWAL 4P2RA 4BSVB 4MDIB 1W8OA 3HMXH 2AQ2A 2K1MA 1CR9H 3EOBA 4QHUB 3KPLB 3X12B 3U2SB 2V7NB 2CMRH 1MWAH 4O2CA 1ZLWH 1FGVH 5JLZB 1F6AB 1F6FB 4IRJB 5I1CL 2WBKA 1ZHLB 1F8TL 5DVLA 3VCLB 1S3KL 4LPXA 5FO8A 5EZJB 1EO8H 3DV6B 3KYKL 3I3BA 1K6QL 4DGVL 2C4FU 3V4UL 4FABL 4PTUB 4Z7UF 1MI5E 2ZOKA 3GSUA 5CEZE 1HZHL 5CMAA 1LE5B 2X6MA 3MJ7B 3KYKH 1K6QH 1KTLB 4DGVH 3ULUD 2AV1A 3V4UH 4FABH 1MUJA 1MNUL 4P2OD 5F1NA 4KWUA 4ZAKA 4LIQE 4LSQH 3QEQE 2HH0H 1IFHL 1MI5D 3QIUC 5CEZD 5I9QC 4LCWB 4WO4D 4K3DL 1XZ0B 4YDJA 4UIMA 4JREB 2ITDA 2OP4L 3GJEB 4HPOL 1N7MH 5FYJL 3GKWH 2R23B 4K3JL 4KTDL 3TBVA 4RX4D 4XZUB 2QHLA 4WTZA 3QEQD 3L6FA 1H8OA 5HVHC 2OP4H 3EIFA 1J87A 2FL5B 2VUOA 5KSUA 4G6AC 4Q6IB 5CCKH 4M93C 3PWLA 4K3JH 3I85A 4KTDH 2B20A 3MBEA 4LASL 3C5ZD 2VR9A 4LKXB 3ARDC 5J8OA 2EC8A 1CGUA 2EDYA 4JFDE 1TJHL 5GSVB 3QEUA 4PYGA 1A4JA 1AQKL 1PSKL 3TT1H 4YPGB 2J8OA 5E9DB 1KELL 4N0UB 3TO2B 3FOLB 3TLRA 3SDCA 5D1XC 4JFDD 1NAKH 4HXBH 2MOVA 4Z95H 3OJMB 3RPKA 1X5KA 5E6ID 3RJQB 3MOBL 1IGIL 3OTTA 4LSDA 1HXYB 2WIIB 2VXVH 5L0QC 2NX5D 3CZFA 2XWBA 3LPWA 2KDGA 2X7LB 4NQSA 3LV3B 1HYSD 3D85D 2XZAL 5F1KC 1CDBA 4NRXA 4GW5B 3QBTB 2R1XB 5JZ7C 2K3TA 1GGYA 1K4CA 1PZUB 3WL9B 5I16A 1KG0A 5L9DH 4LLMA 5EFIA 1JYVA 1NAMA 4PJEF 1N26A 1HHJA 4MSWA 1KB5L 2X09A 2XZAH 4G7YL 4JZJB 1KNOB 1CU4L 2BNRA 2BK8A 5E0QA 3DNKA 1B2WL 4YAQA 3IDMA 3MRBA 5ISZB 3ULSA 2ZG1A 1F4HA 1B9ZA 5DSCA 4NO0A 2OR7A 2OJEA 5LAXB 1L0XA 4PRDB 5SWZE 3EHBC 3PHQB 4U31A 4TSAL 5DK3A 5LCVL 1MELA 5DXWA 3EGSB 3QIWD 2BOBB 3MROA 5CBEB 3BISA 3BIBX 3BEVA 4TSAH 1NJ9B 4PJDE 1CGWA 1GIGH 1U8MA 2X4PA 5SWZD 3W0WB 3EYUL 3SHSA 3NPSC 3S8WA 5DEZA 4F7CB 2PCPA 2WSKA 1LILA 3EW3B 4LOUC 4Y4HA 1RU9L 1V8HA 4NJ9L 4OM1L 3EYUH 3QDMA 5F96L 3GSXA 2KQNA 4KQ4H 3VFTA 2DLIA 1RU9H 2P8MB 4NHCL 5SV3A 3GSNA 3LDBB 1YYLL 4G42A 4OM1H 4S1DD 5F96H 3D39A 1L6XA 4IMLA 5HXMA 1PG7H 4UNVA 2MQCA 4K9EC 3ARED 1BWMA 3LS5L 3NIGE 2PTTA 5F7DB 4ZUWA 1JJUA 3MLWL 2YMXL 1ETZB 5BS0A 5D96B 4JKPH 2FO4B 3D2UA 3LS5H 1TZHB 2NY3C 4JZNB 4ODSL 4LU5H 5D7JD 5BV7B 3QG7L 5KSBF 4ZUUB 5ENWB 5DD6B 1RAMA 2Q3ZA 1MVFA 4KKCD 5T33H 1H0DB 1J1OL 1QACA 2VZVA 1DQML 1BQHB 3UTTB 1S8DA 1YC7A 4J3XA 3UTZB 4PLNC 4F7PB 2CK2A 2GSIA 1J1OH 5DQ9B 1P6FA 3U0TA 3ZSSA 3Q3GA 4PJ5E 5A2KH 3S5LG 1DL7L 4JJHA 2R2CA 1M71A 4OD2B 4QXTB 5AAMA 3QWOA 4PGJA 3RWHB 3P0VH 3ROOB 2EC9U 4PJ5D 4LHUA 4ZFGH 2A9NH 1P53A 2SEBA 2D7NA 4YBLB 5DO2C 3C8DA 3H7BA 2DQCH 4O2EA 4LLAA 1MAML 3VWKC 2J4WH 3MA7A 4RAVA 3RZWA 3RWEB 3M1BB 5GRJL 1AQDB 1JHLH 3OKLB 5LGHH 2X4NB 2IWGA 1I1AC 2NPLX 1Q9OB 1FNAA 3WLWD 1HINL 3GNML 5D2LE 1T4KA 1D5IL 3UBXA 3QDJA 4R0LA 3CXDH 1MVUB 5DWUL 5FHAL 3T2NH 3O3AA 4MAYB 3I50H 3IDYB 4KROD 3ZT6A 4ONFL 1LNUA 1D5IH 3HMWH 3BP5A 3MJGX 2YSSA 2R1WB 2FJGA 3LOWA 1JF6A 2FB4H 4Y19E 1AO7E 1FG2A 3WNLA 5DC9B 3SKOA 2DYPD 3ARGA 3ZT7A 5I17B 4CBPA 4L4TA 2DB8A 1KTDB 1FO0B 1INQB 1T1YA 4G9FE 5I1DA 1CVSC 1A6TA 4Y19D 1AO7D 4JG1H 2WMPA 5I2IB 5BJTB 2W65B 3WDHA 3C8KA 1ZWIB 1ONQA 4M6ML 4TUJB 5HPMA 2B8OT 3TBWB 3R0NA 4QHMB 4G9FD 3RUGB 4B5EA 4M6MH 2H9GA 5CSGA 3SDDB 5BXFA 5T3XH 3GSQA 1JZ8A 3TBYA 4C57C 2C7UA 4P23A 2RR3A 1NAML 1HH6A 2DQDH 3AC0A 1V3KA 2IAMC 1P69B 1KPRB 3UJJL 4IMKC 4M6OL 2X9WA 3S88L 1NGYB 5ADPL 4UQ3B 5KJRL 4F7TA 4EBQL 2XQYG 4KGLA 1NAMH 3GO1L 4OLYL 4OAWB 5EUOE 2Y07L 4ALAH 1YECH 3MXVH 4P5TA 3UJJH 4M6OH 3WV0A 3PL6D 5F8RC 1AI1L 1WIUA 2R69H 1MY7A 4KUZL 4OUUB 5AD0A 4OLYH 2Y07H 5KN5B 1QBAA 1R5WB 1WBXB 5GS1B 1Q8MA 4KUZH 1FSKC 3S34H 4NQDB 1MFNA 3C09C 2OL3A 4IDJL 1DVFA 1U9KA 1UQSA 2WP3T 2UZIL 4R96B 5F8QC 2FBJL 2XFXB 5I1IH 4UINL 4PGDA 3U0PB 1M05A 2WUCH 4TTDC 1RV6X 3RKPA 5JA8B 2UZIH 5MEPB 2FBJH 5KSAA 5BW7A 5JQ6H 1G84A 3HR5B 1NMAH 5DI8A 3WIHH 5B8CC 3CFEA 2FATL 4U1KA 4NRYB 3QHZL 4YDKL 3ULUH 1UWEH 4PJGA 4PG9B 3ARPA 2NYYD 4J3WA 4LSVH 2FATH 1OOAA 4XMLL 1CIDA 1WT5A 2BSRA 4JRYA 4KI5C 1I4FA 4R7NA 4KZEL 3FQXB 5GSRB 3BD5A 1A4KA 4P46A 2LU7A 2P47B 3LHPL 3MRJA 4DW2L 4JLRA 2AQ3A 3L3IB 3D18B 1RK1B 4KZEH 4OCXL 5F7EH 4K7PL 3LHPH 1UB5A 3NZ8A 2OXHA 5EC1B 1X9QA 2AEPH 5FO7B 5C1MB 4HEME 4OCXH 4HLZG 4P9MH 2COQA 4K7PH 5A16B 5T3ZE 4XCCL 3PJSA 5TQ2L 4IIQC 1QO3B 4ZS6D 3R8QA 5C0DB 5E8OA 3JWOL 4FMKA 5BVPL 5ICXA 3FB6B 2UUDK 3VDAA 1CICD 3VFWB 3HZMA 2QADC 4XP6L 5KZCD 1QNZL 1RPQA 5T3ZD 3C5SA 3JWOH 3GEWB 3OX8B 1RURH 5GGVY 2PTVA 1X7QA 5DC0A 4I3SL 2RGSA 5D1ZA 4Q0XH 1OAUH 4EI5A 4JCMA 3BYTA 5GGUB 5IQ9B 2H32B 1R5VB 3QEHA 5KS9F 5SX5H 5TDOA 5F9WC 5IB3B 2GIYA 4I3SH 4Q6YA 3C08H 5HBBA 4YLQT 2FGWH 4MJ5B 2R2HB 4OKVA 3KHOA 4YWGL 1MRCL 1A7BA 2DWEA 2DD8L 4XWOC 2E5EA 1SY6A 4NYLB 2VE6A 4KRLB 5EIVA 1S7TB 5IOPB 1NFIB 1WTGT 4X6CE 4HT1L 2DD8H 4G5ZL 4U6HA 4HXAL 5C3TA 2VLJD 2DS4A 2OK0L 3L7FA 5IW3A 4R2GD 3MRIB 4L8DA 2E8YA 4G5ZH 1CGSH 4ELMF 2E8ZA 3QT2A 5DQDL 4PJDB 5IB1B 2WBJC 3FRUB 5DTFB 3CX5K 3VU2A 3KLAA 2Y06L 1UA6L 2G5BB 3ARTA 1DANU 1VFOA 2NY2B 4J23A 3TO4B 1MCDA 3VFSA 4UDTA 5FCUL 2D31B 3OL2A 1MHCA 4KPHH 2Y06H 5F88B 1PDKA 5CHNB 4Z78B 1XGQB 1E4XH 1D9KB 1WAAF 1QLFA 2QHRH 5FCUH 2OZ4A 1U8PA 3QUZC 4OFYD 4O5LH 5T1LB 3PE9A 3MUZ1 3CGTA 4OIIL 4WW2C 4YHNB 3O8XD 2ED8A 5E2TL 1K5NB 4KTYA 1ZT1A 5F3BA 4N8VG 5C08E 4PB0H 2PNDA 2VZOA 4QHKI 2F19L 2GJJA 4YNYB 5E2TH 4KV5E 3RHWF 4EI6B 3FRPG 5FDWB 1U8IB 2P48B 3RY6A 4AQ1B 3LAFA 2MPAH 5C08D 4WWKB 1HHKA 1JK8B 2JJTC 2V5SA 2XKNB 4K7FA 4PJBE 4U6YA 3NMEA 2H2SD 1ZVHA 5I8EB 4NQVB 4POZD 4LSPL 4TNWK 5DJXA 2GJZA 4DUXA 4HKJB 3HI5H 3V8OA 1MCBA 2QTEA 5DRXB 2P44B 5EUKB 2OL3L 2VLRB 1QR1A 1ERNA 1XGRB 4QWWC 2XYCA 5DHYA 2EYSA 3HI6H 1AGCA 2D0GA 5GGRA 5DS8B 4YJZL 3REVA 1I8KB 3N06B 4Z7UA 4OZ4B 4MCZA 3OXSB 3QG6A 2OL3H 3WFZA 5F6HI 3BN9D 3ELAT 3BH8B 1WF5A 1C16B 4IJ3B 3GSOA 2KL6A 2DDQL 2A6IA 1DEEB 1OT1A 3TZVC 4P4KC 4WGVB 2HFFA 4D9RE 1ZS8A 2DDQH 3OGCB 5DMYA 3MGOB 3AUVA 4NN5C 5HGAA 3RGVA 3KPMA 1F3JB 1BGXH 1K8DB 2VNCA 2PETA 4D9RD 2AXJA 3SCMC 4Z7QF 5HVFB 4FXGB 4JHWL 1BVKA 4X6BA 2GJ6B 4KK6C 1TQCC 4PV8B 4Y5XB 5JORB 3VGEA 4MMXC 2CDFB 2OQJB 1TITA 5EA0H 3F12B 5CSZB 5FA4A 5IMMB 1JZ2A 3JTTA 5GZOC 3MX0A 5IR1B 3MLVL 4I3RH 3GMQA 3X11B 4OI9A 4DN3L 1R0AL 2K7QA 1ZGLP 3MNZA 1MIEL 3P4MA 4R97B 4PJXB 3S36L 4ZPVA 3VGAB 2XXMB 3STZA 4OF6A 1T7XA 1ZT4A 5D7IF 1R0AH 2BRQA 3LKQA 3DRQA 4DVRL 3RIFK 2N56A 4LP5A 1GL4B 1MIEH 4R90H 1FV1A 2A6KA 5IV2A 1L7IL 2Z4QB 1WQVT 4KQ3L 1IZJA 4P5MA 4W6YB 3OKEB 2YC1A 2AK4B 2FD6L 5GISL 1FPTH 1NGPL 3C60C 2P5EE 4N0FA 4XPFL 4KQ3H 1YNLL 4PJEA 5TF1L 4H26B 5GISH 4X99A 1JIBA 3CVIH 3NZHL 1ZOXA 2NW3B 3VGHA 4XPFH 1A6VH 1FC1A 5I8OH 3SJVA 3QUKA 1YNLH 2P5ED 4XMKL 5TF1H 5HYEA 1T7VA 3VFOA 3NZHH 1PY4A 4CJ1A 4FMFA 1VESA 1C8PA 1JL8A 2FNBA 3U79A 2QR0A 1SY6L 4XMKH 4FFVD 2BOCB 5KBNC 5HI5D 4HCRL 4YE4L 1K3ZA 3HN3A 3GKZA 3UBXI 5K33A 2FSEA 1OY3B 2NXYB 3RTQB 5CIPB 3TPUB 3K3QA 4HCRH