2DWEA

Crystal structure of kcsa-fab-tba complex in rb+
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB HEAVY CHAIN
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2006-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dweA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dweA02
3OKOA 3BWAA 3Q3GA 4U1SA 3DYMA 5E2TL 3QO0B 4TSAH 2BCKB 3T3PE 3LEYL 4G42A 5DRZA 1T66D 3KLDA 2FH8A 1KGCD 1GZPA 5HGAA 3CX5J 4WO4A 4YPGA 4TNVF 3VGAB 2X6MA 2E6QA 5C0IB 5SWZA 4Y4KC 1IGCL 2WUBL 5IESH 5I71C 2EKJA 3X12B 5J11C 4D3CL 4KROC 3C9NA 4RBPK 3TCLA 3IETA 4HULB 3O45A 1ES0B 3GMRB 5DFVD 4XH2A 4ALAL 4PJHE 4Y19A 2ICWI 2PETA 5DDHA 2ZNWA 3DX9B 4ZS7H 3MREA 4R4FL 1OHQA 1A3RL 1KPRB 5C0AB 2Z31B 1W0WB 5JW3L 1V3LA 2F53A 5I75C 3RBGA 2CLZB 5BS0D 4J7RA 2VDLH 3OX8A 3HI1A 2EDDA 3S3SA 3SO3C 3HMXH 5EO0A 1REIA 1T3FB 1FPTH 3PHQB 3TZVA 2ZCHL 3CU7A 3U7YH 3HZKA 1PEZA 3IDJB 4MNHB 4NM8H 4YDIL 3OKDB 4D0DA 5EG6C 2K3TA 5E4IA 3BKMH 3F62A 5I19L 4Y16B 3N1FC 3O9WD 4GXUM 3N0PB 1RZGB 1MELA 1CE6A 4X7TA 3GUTA 1MF2H 1OCWL 4XCNA 3L3IB 1I8MB 3B9EA 4YGAB 5DEFB 5E7BA 4EN3B 2BSTB 5J57B 3KWWB 3K4ZA 4XPAL 3TVMB 5LGJA 1HYRC 4IRJD 5D71H 4NNPL 2HTKD 4G8IB 2ESVA 3KLAA 3DVNA 2OMBA 4BH8B 2DL2A 2V5SA 1BEYH 2VAJA 3C2AH 3OB0H 3UBXB 4KK9D 5E2TH 5AUMB 3PGFL 1QR4A 3LEYH 1N6UA 4FXGB 5A40E 2L4OA 1UZ6E 1F6LL 3MUJA 4X80L 4F9LA 1IGCH 4HPOL 5C0CE 4XZUB 15C8L 5FYLE 2AGJL 3IKCB 1N6QL 4O02L 4J6RL 5FUCC 1IGTA 5DQJB 3KS0J 1BQHB 1C5DA 3B5HA 4XPBL 3LKQA 4JM4L 4Q6IC 4ALAH 3ROOA 1ZGLM 1P9MC 2Q87A 1XGQB 3QJFB 1S3KL 1NUFA 1XEDA 3UTSA 3ULUC 4G8GD 4PJGA 1A3RH 4UAOC 3QUXA 1DDHB 2ZUYA 5JW3H 4GLRH 1U58B 4KMTL 4F57H 1SMAA 4IRZL 4QY8A 4LFHD 3D39A 3MSPA 1JPST 3QBTB 1AR2A 2ZCHH 1B90A 1M71A 5DURB 3RP1A 1INEL 3W0WA 2Z93A 1CR9L 4P5TC 4P9HL 3U2SA 1JUFB 5DQDH 1T20B 4MCYA 4YDIH 3V5DA 3RVTC 5ACZB 1A6ZA 1J0ZA 3RTQD 1F4HA 5GZOC 1NAKL 1WCBA 5I19H 2P44B 4P23B 4RGNC 1G9NL 4OGAD 1AR1C 2VIRA 3MFGB 5KVMC 5C0CA 1FC2D 1I7RB 5JQHC 3X11B 1OCWH 5E5UB 3PJSB 4CADB 4XPAH 3OKMB 4GMTL 1ZT7B 1MFAL 2GUOB 5J1AB 2Z35B 2UZYB 1TQBC 2O61B 3HPLA 2RR3A 2AKRB 4HK3J 4QWWD 2ZZUT 4OZIF 1QFWI 3RWCA 1MAML 3PGFH 1E4WL 3CH8A 3MRGA 4XC3L 1TVHA 3LEVL 1EAPA 2NNAB 4X80H 4E41D 5DQ9A 3MYJA 3JTTA 1FFPA 4HPOH 4IOSD 15C8H 4YC2B 2AGJH 5JDSA 1D9KB 3OQ3B 3QI9D 1N6QH 1CFBA 3R4DA 5HHNB 2D7TL 1GOGA 4YDJA 1OAQL 4XPBH 4G6AC 1RZ8A 4JM4H 3I02A 1FFOB 4NKMA 2MQ3A 1V3MA 1S3KH 4PS4L 3WUWB 1UA6L 5HGBB 4MXWL 4PJ7E 4FS0A 3VXSD 2E7MA 2EE6A 3PWLB 2HN7B 4O2FA 3ARSA 1NC4A 5HYSA 2R2HA 4KMTH 5H2BA 3MRIB 4IRZH 1JPFB 5C8JA 1U8HA 2DYPB 4ZDHB 1QVOB 3LB6D 2KH2B 2YD3A 3NPZB 5FUOH 4E5XA 1INEH 1VFBB 3K2MC 1CR9H 1UJ3C 4P9HH 5T3ZE 4L3CA 1IILE 3VXNB 2ADJA 2F54A 4Z7QF 1BREA 4FMFA 1KUMA 1BVLB 4ZQKB 1NAKH 3PGDB 2J5LB 2APBA 3BHBB 3QDME 4YHZL 1G9NH 3QEQE 4X6CE 2Q6WB 3FO9A 2BXYA 3C5ZA 1KB9K 5C07E 3BPOC 3HS0B 4UQ2B 1V3KA 1QHPA 3G08B 3E2HC 4GMTH 3HZMB 4ODXA 2X4OB 3ROLA 1MFAH 1PVHA 1NDGA 2C3WA 3BISA 4NKOA 5E1AA 3VWKB 5JMRA 2EKSA 3GJFH 5SX4I 5J6GA 3IU3A 4PJ7A 5F7MC 1N7ML 3DUUA 3K1KC 3WN5C 4DKFL 1DVFC 3KXFA 1I9JL 4AY0A 1MAMH 1DUYB 2JB6B 1E4WH 2DICA 5D9SA 4NKQB 3IAQA 4XC3H 1V5JA 4HAFA 1ZT4B 3LEVH 3OKNB 4LLAA 3V9FA 3IJYA 4ELMA 4V1DE 2HLFC 2X4UB 3CJJA 2VLKA 2GTZA 4F15B 4F7EA 3O3EB 5J89A 1HSBA 2RCSL 2FO4B 3BP7B 1YYML 2D7TH 2GCYA 2FIRT 3CK0L 4R0LA 4PRNA 4X6CA 1OAQH 2GT9A 2VZSA 3A6BL 4L9DA 1UXWB 2L7UA 3U0TA 5DA4A 5C07A 2OQJB 1UA6H 4MXWH 3QUZA 3I6GB 4EKXA 4HUWB 4JANB 1MY5A 3LHPL 4PP2B 2FJHA 5C7XL 4XVUC 4ZPVA 3CVHB 2MCG1 4P2QE 3MUZ1 2DQJL 4ZS6D 4F7MA 5A3IC 3VGFA 4WW1B 4R7DA 2ITDB 7CGTA 4J3SA 3FO2B 3S5LB 4D9QD 3MNWA 3UMTA 5JPMB 2Z8SA 4KI5C 5CCKL 1DBKL 1VB9A 1ACYL 4U1KB 1L0YA 4NQSB 2AXFB 4V1DA 2MWCA 4YHZH 1T4KA 5IK3B 2QHLA 5LAXA 2YMXL 2DJSA 4W6YB 4KKBD 2GFBB 4JEGB 5E56A 3I75A 3V5HA 5F88A 2Y72A 5K59E 3DX7A 2IBZY 3EO0A 2QQNL 2VLRA 2WK2A 3OKYA 5KANG 2WINB 3V6BR 5C08B 1HH6A 3I3DA 4MJIA 4G9FA 4MSWB 1HH9B 4P4KA 3C60C 1T89C 1FZJB 1N7MH 3QG6A 3THML 3HA0A 1G6RA 5JIPA 4DKFH 2EC9T 4P2QA 3IFNL 1I9JH 4G8EA 3BZEB 1AHWC 2P5EE 4N8PA 3ARBD 3ZDZF 4LCYB 1NL0L 4POZD 5DK2A 3EO9L 2QQKL 3I6KA 3O4OB 4BFIA 5C0BE 2WMPA 3BMWA 2CLVB 2J8UE 1F58L 5CBAB 5JIIA 4JQIL 3BW9B 3GSQA 5DFWH 4FQXA 3CK0H 4QHNB 1OP9A 3D25B 1P4BL 3A6BH 5E99L 1NBZA 1R3IL 1MJ7H 2P45B 3ECBA 5BW7A 2A6DA 3FCTB 3LHPH 4LNRA 4ZXBD 1JNLL 1I7UA 5IB5B 5C7XH 2JCCB 4PLNC 1BZ9B 4PJ9B 2C4XA 4LLWA 4OI7A 5KSVB 3O3DB 1IL1A 3F6IA 2DQJH 4X98A 5GSRA 3FKUS 2EDEA 2H26A 3F7RA 1OWWA 1NJ9B 1HK6A 3IAPA 2ED8A 3DX8B 5CCKH 1AH1A 1DBKH 1QFWH 1MLCA 1ACYH 4PG2A 4KK8C 1HEZA 5C0BA 2AJZB 4JKKA 2YMXH 1JBJA 4ZFOL 2J8UA 3GJFA 4IMLB 3MLTA 4NQEB 4LLUB 3BUYB 3LPGA 4U3CA 1T6VN 2FWOB 2QQNH 4M8VA 1UCBH 3DV6B 1CFQB 1MEXL 4Z76B 1HI6B 1JPGB 3PQYE 4LDLB 5HYJD 2NMSA 3ETBF 3OJ2C 4OFDA 4RMTA 1HILB 1RPQA 4OFKA 2CK0L 4BQCA 2UYLA 4G80A 3ZLQC 1MQ8A 3IFNH 2H3NB 1U8QA 2ZUUA 3WIFB 3S35H 1L7TL 4WO4D 2D03L 1DANT 2PO6C 1T7ZA 1CI5A 3DMMA 3WNOA 1NL0H 5SWZD 4JM2C 1ZHKA 3EO9H 3QIBA 5HI4C 2QQKH 3E3QE 4AT6B 1F45A 3VI3F 1RIHL 3LDBC 1PQZA 1F58H 4GW5B 4K23L 2ENYA 3K8LA 4U6XB 4PY8I 3VG9B 4JQIH 1TMCB 2CH8A 2A73B 4Z7WE 4LU5L 1P6FA 2DQGL 4Y19D 4CN4A 4JHBA 1UKQA 1LE9A 2EDNA 1P4BH 1T83C 5E99H 5J11B 3KPRB 1Q9KB 4HUKB 1PYWB 4NQUA 2F53D 4D8PB 4L8CB 3P4OB 1A02N 5KS9E 1JNLH 1G7JB 4X7EC 1CWVA 3PQYA 3UPCA 4U7KA 3EDKA 5KBNC 5FB8A 2MCPL 4FFVC 3TZVD 1KCVL 2AW2A 2E9BA 4JZNA 5SX4H 4CU8A 3WNPA 1ACZA 4MQ7B 1UG9A 3RPIA 5D2LA 1CT8A 2HTLC 3SEPA 3HC0A 1R3KA 2X4NB 3SO3B 1D5MA 5F8QC 1MHEB 3EJJX 2DLHA 3BKYL 3TO4A 4R3SB 4GOSA 3D5OF 1JCKA 3EOBA 3ZYZA 3RHWF 3O2DL 3BZ4A 2XTLA 2NY4C 3GI9L 3KPSA 4X6BA 4GKSB 4HWNA 3RIFF 3QRFM 2YA2A 1L6ZA 1LP9B 1O0VA 4LHUB 1DJSA 1MEXH 4DUXA 2EXYD 2FD6L 1JFQL 1J5OL 4RZCA 4C54A 2CK0H 2HG5B 1RV6X 4PJCB 1IAMA 1ZVSB 4R4NC 5KS9A 2W91A 3MOAL 5CEZE 4XMKL 5D1XA 3GSOB 2Z91A 1DEEB 1L7TH 4JHAL 5AWNL 1MVFA 3VFMA 2AEIT 4NN5B 4PJBE 4ISVA 1A1NB 3W2DL 1I7ZA 4X8JB 4PJIE 4D0BA 1LEKA 4PJAF 2EICA 4PJXF 3OAYH 4UMGA 5EC2A 4E0RA 1UM5L 4NOFA 2DM2A 4YHLL 2BVPB 4ZUVB 1ZA6B 3FQWA 1Q72H 4LU5H 4KRPD 3GHEL 2XQYK 2P24B 1D5XB 1X4ZA 1QLRB 4Z7UE 5I8OL 2QSCL 2HVJB 4E9LA 1BGXL 8FABA 5DEGB 2PXYA 3KNBB 1FYTA 2BOBB 4YK4C 5FM5O 1XCQB 4JFEA 3W81A 2R69L 3OJVC 4PLKC 5GGQL 1FV1B 4LLVA 3RIAF 1IM3A 3MRKB 3REWB 4MHHI 3LN5B 4XP6H 2I9LA 1B3JA 4CMMA 1BBDL 1CXLA 2MCPH 3CFKA 3L95B 2VTFA 2W60A 5DS8A 2BRRH 4NOBA 3OR7B 1KCVH 1U3HA 1X4YA 1YEFL 1Y18A 1S7RB 1UACL 2E9WA 4KTDL 4MAUH 4IRSD 3MQIA 2NPLX 1IGJB 4U2ZA 1NGZB 3BP6A 3P11L 4WHTA 2IGFL 1NBVH 2GSIB 2MPAL 5GS0D 3GI8H 4NQVB 1IT9L 2CD0A 2OR9L 3IDYC 1BBJB 3QA3B 2OSLB 4LCCA 3KGRA 3OGCA 5EO9A 4N0CD 3U4BL 4I5BB 1S7UB 4PJBA 5IVZB 3GGWB 1LDSA 5EU5A 5C0CD 3BKYH 2G75B 5FYLD 1HZHL 2P8LB 4P5TB 25C8L 4FFYL 3V5KA 3O2DH 1F6FB 5IB1B 5ICXA 2ZWLT 2VLJB 3GI9H 1RZKL 4I0PB 3KYNB 5E24E 3O8XA 3KVQA 4RGNB 2YXFA 4LDOB 4Z7UA 2GW5A 5DWUL 4ODUA 2FD6H 2UVFA 3CSBA 1JFQH 1J5OH 4OV5A 1NCCL 2D9CA 5EA0L 3NCMA 4WVRA 3SDCA 3RQ3A 3MOAH 4XMPL 3OWEA 4XMKH 3KPPA 4HKZB 4PG9A 1VGKA 4OF7A 4IIQA 1Y6MR 1TQBB 1XF3B 4JHAH 5AWNH 3GMMB 5JPNA 4JPIA 2ZCKL 4S11A 5E6ZA 1LWRA 2I07A 4XNZC 3KLHD 3W2DH 4OJFL 5H37G 1HHJB 5IR1A 4PRBB 3D2UA 3LSOB 2AV1B 3CDGA 1MI5E 5C09B 4Z5RA 1J8HA 3SKOA 4NNXB 1VGEH 1ZWIB 1UM5H 3B6SB 5DJZB 1MLBB 3RPKA 4K8RL 2DLEA 2GAZB 5FFLA 1IJ9A 3BD5A 4O2CB 1KIRB 3N50A 3GHEH 3VMNA 5LG1A 4D0CA 1WAAE 4Y8DC 5I8OH 2QSCH 4Z18A 3FB5A 4KJQC 1BGXH 4FTVE 4U6HB 3QFJA 5B4MC 5B8CC 3OKLB 4NRYA 3WNNA 4X4YB 1UKSA 3D3VE 4HMDA 4NQTA 1NC4D 3T4AB 4OCLC 2R69H 3B9VA 1ZSDB 5GGQH 2W65A 3QQNA 4XT1C 1BBDH 4CNIA 5ACLA 5BZWB 1B2WL 4KTDH 1YEFH 1UACH 1MUJB 2P5WB 3D0LB 1I8IB 4ZFOA 3P11H 5L0QC 2IGFH 2HT3C 5C2UB 1MFEL 2MPAH 4XI5D 1R5IA 3VRLE 3BP5B 5I15L 2OR9H 3ULVF 1I1AB 5EU3A 3U4BH 4WJ5A 4K94L 4NYLB 1RK1A 5FDYA 1F3JB 2NW2B 1HZHH 1UVQA 3QIWC 1UJ3B 25C8H 3QAZB 3QRGL 4FFYH 3C5ZD 4RFOL 1MI5A 4P2OD 2DF3A 3C87A 2IPUK 3HG1B 4HGMA 1T7VA 5D1ZD 4ORGA 1RZKH 1S7XB 1K3IA 2WBJA 1EMTL 3MRDA 4F3FA 1X5LA 1OTSC 1K3ZA 1P4LB 2WUCH 1WAAA 4IDJL 1HXMA 5DWUH 4TUKL 1MVUB 4XP1L 4KJPD 4P49A 3ZSSA 1FG2A 2E8YA 5EU7E 3D3VA 4FFWD 1NCCH 1T0NA 2VDKL 3INUL 1GGTA 1II4E 1H5BB 3VFUB 4EDWL 3BP4A 1CG9B 1KULA 2ERJC 1KLGA 3BGAA 1E6OL 3D87B 2UUDH 4J3XA 4LEOA 1XGTA 1XGUB 4HWBL 4DGYL 1A1MA 5T3ZD 2ZCKH 3MNZB 3WN5B 1DVFB 4OJFH 4RA0C 2PYEE 3MRFA 4PLOB 2K1MA 1SYSB 5C9JB 4YE4L 3QDJE 3LKNA 4NO2B 1AGBB 4ONHB 2X4PB 3QEQD 3ZE1E 4K8RH 5DJAB 1DLHA 4HQQL 4HUMB 1F4XL 5CP7B 4BK5A 1TJIL 2D3VA 3NN8A 5C07D 3W5NA 3GMLB 3QUZD 3EOTL 5F9JB 3PWJA 5EOTA 4XX1G 1AGFA 2SEBB 3VFTB 4Z7NF 1ZAGA 2X1PA 4M02A 4S0SD 3L3DA 3P4MB 3HC4L 1FZOB 4HIIA 1P7KB 3VFGL 3DOSA 4XNQB 3UCRA 5I1LA 4Q9RL 3I3EA 4L4JA 2YHGA 3IS1X 4ZOCA 5C0AE 1IKNA 4BM7A 5DFVC 3U1SL 4H26A 1U8PA 4KUCD 1B2WH 4JDVA 1K2DB 3AGVA 3O2DA 4JRXB 4K9EC 3EO1B 3MCKA 2H2SD 3BT2L 1MFEH 3WD5L 3EFDL 5I15H 3QO0A 4DOHE 1DR9A 4V1DD 2BCKA 1VPOL 3Q2CA 4K94H 4WU7B 4LRIC 4MJ5B 3QRGH 2GITB 4DKEL 2DIAA 2BP3A 5C0IA 4RWHA 4YDKL 3D9AL 2XV6B 3VFRB 3X12A 1EMTH 5D2NC 3W39B 4IDJH 5HYQB 4X9FA 4TUKH 4XP1H 1ES0A 1AO7B 4U6YB 4G6ML 3GMRA 1XF5B 1VADB 3O9WC 3TA3D 4JY5L 3INUH 4P2QD 4QRRB 4EDWH 3DX9A 5ESVB 2IALB 3DO7B 3DETD 1KPRA 5C0AA 1E6OH 2Z31A 1W0WA 2KDGA 4F37F 3ZE2F 4HWBH 2CLZA 4DGYH 2F8VA 1WIOA 3C60B 1SBSL 4IRJC 2R1WB 3BO8B 2HTKC 1NLBH 2BRQA 5DMYA 4R7NB 1XCTB 1T3FA 3REVB 3PHQA 3GJFK 2FR4B 1AHWB 2VO5A 3B9DA 3PIQB 4OZ4B 3H3BC 4YE4H 3QEGL 4KK9C 3IDJA 1DFBL 4MNHA 3OKDA 4FQXD 3CVHL 4K3GA 4W4OA 4AZ8A 2A83B 1A7QL 2QQQA 1OAZL 4HQQH 2A6JB 1LO4L 1F4XH 3F7YB 1MCIA 1TJIH 5EUOF 4JKMA 4Y16A 1A7BA 3EOTH 1RZGA 5INCB 5IFJB 3L3IA 1I8MA 3T2PA 4WHYH 5DEFA 3HC4H 5EZIL 4EN3A 2BSTA 4LVEA 3VFGH 3KWWA 1JGEB 4Q9RH 2RHEA 3TVMA 3AY4A 3U1SH 4G8IA 3UTQB 1JI1A 4BH8A 1PG7L 1JP5A 1TLKA 1S9KC 3BT2H 2DJ4A 3L5JA 1GGUA 3OKKB 3UBXA 4KRMB 3WD5H 3EFDH 2WSKA 4HH9B 3EYSL 5AUMA 1VPOH 5C0BD 4XPHL 5HTSA 4FXGA 1UEMA 3DXAB 5BV7C 1V3JA 1GPOL 1FJ1B 4DKEH 5E8PB 1AC0A 4YDKH 3EJYD 1DCLA 1G9EA 3CDCA 3E0GA 4XZUA 2X4RB 4PRIB 1HINL 3IKCA 5A2IH 1IM9D 4M6AA 5D5ME 5F6HJ 4YO0B 4LPXA 5DQJA 1BQHA 4G6MH 4OGAC 4XBPB 3UX9B 1YEEL 3ZYOA 4JY5H 1XGQA 3QJFA 4EQ3A 3FQRB 3WBDA 1LEIB 3DMMD 5F3HB 1GYAA 3QPXH 1X3DA 1DDHA 3QIBD 3TNNB 3NAAL 1U58A 3VGGA 5BZDB 2I5YL 1SBSH 1LE5B 3ZKND 3C8KB 1EUUA 2XQBL 5CZXD 2YD8A 4XVSH 4Z77B 4U1IB 4C56B 3FT4B 1BQUA 2FBOJ 1BP3B 2PO6B 3GBNL 3QEGH 1T03L 4QWWC 4JM2B 4HIEB 1DFBH 1JUFA 2M26A 1T20A 3LY6A 2HFEB 3CVHH 4UOW1 5ACZA 1A7QH 1EJ6A 3SGKA 1OAZH 1A21A 1LO4H 4U1JB 2O5ZL 1VESA 4P23A 3LDBB 4X5XB 1BLNB 3DVGB 5IFAL 1I7RA 3PQYD 3X11A 4YFEA 3PJSA 1G7QB 5EZIH 4CADA 3QI9C 4IDLA 3W5MA 3OKMA 3KYMB 1ZT7A 2EDXA 1HE7A 2EEAA 3AXLB 2GUOA 2MFNA 1A64A 3HE6D 2Z35A 5J1AA 4UBDD 4H25B 2O61A 1CGYA 3GMOB 4OD3L 4QOKE 5IWLC 1PG7H 3RWEB 5GHWL 2AKRA 1EFXB 3RUGB 4LVNC 3AU1B 3CMOH 2IH1B 3EYSH 3PUCA 1W0YT 2RBLA 3D1MC 2DD8L 4WW2C 1YDPB 5FGBA 1S5HB 1YNLL 3UYOD 2WW8A 3VXRB 5HDQL 4XPHH 2E7CA 2HFFB 4YAQB 4XMLL 3VFNB 3L1OH 2NNAA 1IRAY 3TFKD 2OZ4L 3RY6A 1HINH 1D9KA 3QIUC 1FNAA 2X2YA 2GJ6B 2P4AB 1IC5L 1IGYB 2G2RB 4XXCC 3MA7B 5HHNA 3MC0A 4HWBA 1CFTB 2NY4B 1CXFA 2Y07L 3WIIL 2WWMC 1BFTA 4WUUB 1FFOA 1MRDL 2CXKA 4JO2H 2WAHA 1ZOXA 3WUWA 5D1XD 5HGBA 3MRQB 1ZGLP 3U0WL 2A6IB 3VGBA 5IEHB 3SDXB 3PWLA 2HN7A 3IJSB 3NAAH 4ESKA 2I5YH 3JWDC 3MRIA 5CWSB 1JPFA 2I26N 5FYKU 2XQBH 2DYPA 4ZDHA 1QVOA 1Z0MA 1BOYA 3BDYL 3S98A 3QNZB 1VFBA 2YD5A 3GBNH 1I8LA 4Y1AB 1T03H 4KKLD 4U31A 4HW6A 1NMCC 1I1CA 3VXNA 5CP3A 2PXYD 5M95B 3NIDE 3GSVB 5C0RH 1BVLA 4ZQKA 3PGDA 3TC9A 2O5ZH 3BHBA 2Q6WA 1MCJA 3FJTA 5B3JF 3HS0A 1M1SA 4UQ2A 3U82B 3G08A 3BH8B 1U3HD 4PJ5B 5TPWL 3HZMA 5CEZD 2X4OA 4CAGA 3AVEA 3SGJA 4OZFB 5J3HC 5CD5D 3VWKA 4LVOC 5DJCB 2DLTA 1KYOK 1B88A 4O51B 4H8WL 1U8JB 4NFCA 1YNLH 1DUYA 1WBXB 2JB6A 4ZS6C 5HDQH 5JW4R 1JI2A 1OGAB 1G1YA 2EDLA 4XMLH 1HCFX 1OOAA 1ZT4A 3KS0H 3OKNA 4L5FL 3SN6N 3O8XD 1C08B 1T7XA 2X4UA 3OG4B 3GM0A 2KKQA 3AAZB 2OZ4H 4TVPE 1A7NL 1XR9B 5JNYB 1QLEL 4FQIL 3O3EA 1IC5H 1R5VB 3ZHKA 4MMXC 3BP7A 2FO4A 1B0RB 2Y07H 3WIIH 5E8DH 2ADFL 2Q86B 5C08E 1JPTL 2NY5C 3VH8B 4ZNCD 1UXWA 4KK6D 1RUMH 3ZYIA 2OQJA 1MCNA 3SBWA 3I6GA 3PG2A 5T1KB 4HUWA 4JANA 3U0WH 4PP2A 4Y4HB 4LMQI 3CVHA 1IGIL 4LSPH 2EEBA 4EI5D 1M7XA 4WW1A 3JUZA 3V2AR 4Q58C 5E2VL 2ITDA 3OSKA 3BDYH 2KZ1B 3FO2A 3LRGA 5C3TA 1C5CL 4K71C 1YEJH 4Y5VC 3S5LA 2BDNL 2RIKA 5JPMA 4XBGB 4XNZB 3MRJB 4QHKJ 3ARBC 2YUXA 5BOPA 4POZC 2NY1B 4U1KA 4NQSA 1FE8H 1GGBL 1KFAL 2AXFA 3VGDA 1L9MA 2GY7B 3MRLB 5IK3A 5I1KL 5EN2B 2GFBA 5FM4A 5JXAL 4IOFD 4LASL 5D6DA 3TBSB 5KOMC 3N06B 3ULUF 4XNYL 4Z7VF 4JB9L 3ZHLA 2WINA 5C08A 5TPWH 1S9VB 2JCCE 3QH3B 3WJJC 5JHLL 2IG2L 4MSWA 1HH9A 1FZJA 3VD5A 4ZXBC 3MBEC 5DF0A 1BFSA 4ZUUB 4Q9QL 1AI1L 3BZEA 3CFIC 1MI5D 2FEDD 5CHNB 4JHZA 4LCYA 4GS7B 5DJYB 1U95B 5T5NG 2EYTB 4X7SL 5L0QB 4DGVL 2MJWA 3M17B 3TV3L 3GKZA 4RGOH 5CJBA 5TDOB 1L7IL 2YUZA 2CLVA 1KJMB 4FTVD 1A7NH 5CBAA 4NQEE 4PP1C 4FQIH 1AXSB 2DTML 3BW9A 3D3VD 5DJ2B 1F4YL 4HKBB 5DGQA 4WFFE 1Q9OB 5D7KD 1PG7W 5F9WB 4QHNA 2ADFH 2F58L 3D25A 2EC8A 3KPOB 1JNNL 5T5NF 2FX8L 1JPTH 1DQJB 2AEPH 1PAMA 4UOJA 3RWDB 3O3BB 2BHUA 1QBLL 2FRGP 1KB9J 4JZOB 3FCTA 5C0FB 1LHZA 3BIAX 5IB5A 2D2OA 2JCCA 1BZ9A 4PJ9A 1IGIH 5KSVA 3O3DA 4OCWL 3T3MF 1WISA 2ERJB 1DN0B 4LVHC 2BVQB 4P3DB 1NJ9A 3PWUB 2UY7A 4NFBA 1IAII 5F1NB 2VDNL 4FFZL 1P7QB 5E2VH 3QDHA 4NKIL 5CFHA 1C5CH 3DI3B 2X41A 1DQQB 2BDNH 1G7HB 2VMFA 4WO4C 3BH9B 3DX8A 2VB5A 1J18A 1ZA3B 3QXVA 3ULUH 4GKOA 1GGBH 1KFAH 4YEEA 5I1KH 2AJZA 4JZJC 5D8JL 2D4DA 2E7LA 1YPZB 5DZLA 5DA0B 3WJLA 4IMLA 4NQEA 4LLUA 5JXAH 5ALBL 3BUYA 4G43B 4LASH 4HBCL 2FWOA 4XNYH 3OV6A 4JB9H 3DV6A 1CFQA 4Z76A 3NVQA 4M3JA 1HI6A 1JPGA 5J0BA 1OY3B 1HILA 1BWMA 5JHLH 1MCRA 1MFNA 2IG2H 2P8MB 2J4WL 2V5TA 2FL5B 5EORL 3STZB 2DQDH 4RSVA 3ZDXE 3RKDD 5C6TL 3RZCB 2OZ4A 4FMKA 2H3NA 2PYED 2EDBA 3MOBL 3IFPB 1AI1H 3WIFA 4Q9QH 4WI7A 3QDJD 3DRQB 4X7SH 5KSBB 4DGVH 3WFHB 3TV3H 4AT6A 3NH7H 1WTLA 4EDXB 1L7IH 2X9XA 3HRPA 5BS0B 4U7SA 4GW5A 4U6XA 3IVKB 2DTMH 2A73A 1F4YH 2DLIA 1LP9E 2F58H 1JNNH 2FX8H 3MV7E 5D2NB 3KPRA 3PP3H 2ICES 5C0AD 1Q9KA 2Z31D 4OTXL 3U4EB 1UYWH 2YBRB 1PYWA 2O26U 4P99A 3F7QA 3LS4L 4OFPA 4PRAB 4PJCE 4D8PA 3P4OA 4L8CA 5FEBA 4L9LC 1G7JA 3O9WB 4I77L 2EXYC 1NQBA 3QT2A 5FUZL 4N68A 3EHBD 3VG0L 3BRGC 4LHQB 3NZ8B 3S88L 2IPTL 3EYUL 3V8CA 1JTTA 2VDNH 4NKIH 4MQ7A 4HIHB 2OTUB 3A6OA 4F9PC 2X4NA 1AD0B 1WFNA 1MHEA 1A14L 5GGSB 1P6AB 1OPGL 3PV6B 4F9LC 4R3SA 2JB5L 2G9HB 4KZEL 2VOTA 5D8JH 1GVIA 3LQAC 5DRWB 2EDQA 5HYFA 4UDUB 4LOUD 2XZCL 2YZ8A 5ALBH 4GKSA 3TVMD 4HBCH 4L4VE 5FUCE 5HD8D 1LP9A 3T1FB 4LHUA 4WV1B 4KRPC 4XCCL 5IHUL 3G5YB 2YPLE 3DVIA 4QKXB 2APVA 5IP4A 4LP5A 4RRPG 2HG5A 2J4WH 5EORH 1R6VA 3JXAA 1H3PL 4PJCA 5IW3A 1ZVSA 5IHLB 5C6TH 4BQ8A 1CGSL 1W8NA 2CIKB 3FONB 3GSOA 1DEEA 3MOBH 1LDPH 3QUYD 5HHQB 3PHSA 4LPYA 3QNYB 4K7FB 1A1NA 4HK3N 2XPGB 4IRSC 4X8JA 1CXHA 5FYJU 4R9HA 2FECI 3S37L 5IG7B 3FO0L 4PGJA 3WDIA 5GS0C 2BVPA 1N6VA 2VLJE 5BV7B 1H8SA 4N0CC 3P4NB 4ZUVA 9CGTA 1ZA6A 1WC7B 2P24A 1CDIA 1D5XA 1QLRA 1XGPB 2HVJA 1YC7A 4OV6F 1QUNA 5DEGA 1NEZG 2XNAB 5K9KB 3KNBA 3KYOB 3MZTA 2BOBA 2ATKB 3F5WB 4K8RD 3LS4H 2ZUXA 4IJ3C 1XCQA 1HNGA 3RJQB 1FV1A 4G6FD 1P9MA 1PGRB 3MRKA 3REWA 3LN5A 1QPXA 5FUZH 3L95A 1LK3L 3VG0H 2AVGA 4I13B 3OR7A 4QXWA 1S7RA 2IPTH 1D3CA 3EYUH 1IGJA 3SCMC 1NGZA 4B41A 4N5EC 2GSIA 1BJ8A 4LLYB 4NQVA 1ZHNB 3QA3A 1BBJA 2OSLA 4I5BA 1S7UA 2WQ8A 3DLQR 3JSSA 5IVZA 3GGWA 1A14H 2H8PB 1OPGH 2G75A 4JRYB 2JB5H 3KLHC 4J8RB 2P8LA 4P5TA 4KZEH 4Z7QE 5IB1A 3UJTL 1UFUA 1JNJA 1M7DB 2VLJA 2XZCH 3H9ZA 3NFPB 3LKRB 1UADC 3PGCB 4I0PA 3KYNA 4M7LL 3QXTA 2FZ3B 4L1HA 4JY6B 5IHUH 1AGDB 3RAJH 2VXUH 3AFLA 4I2XB 2W38A 1W72B 1RUKL 2FBJL 1Q38A 5BO1L 1H3PH 5ANME 4AEHL 1J88A 1QFWM 4H0HB 1CGSH 5FYKL 4G6KL 4HKZA 1XF3A 4M1CD 1YN6B 3MO1B 2C1OB 3GMMA 4HWUA 3NTCL 1P4IL 1NKRA 4LVNB 1B6DA 1KIPB 1HHJA 1TTUA 1MCPL 4PRBA 3VXSB 2QLVB 1IAOB 3LSOA 2UZXB 2AV1A 1IAIH 4WW2B 5C09A 3S37H 1A2YB 3FO0H 4LK4A 4XI5C 4ONGL 5A2KH 4NNXA 1H3UA 1ZWIA 3B6SA 5DJZA 3U9PL 1MLBA 4TNWK 2GAZA 3H9SE 4O2CA 1KIRA 3WHE1 4LMQE 2ATPB 4U6HA 2CR3A 3OKLA 4P2OC 1TETL 2CXGA 3WE6B 4X4YA 3QIUB 5D1ZC 3BZDA 3RGVB 1EVUA 3T4AA 2VXTL 4Y8AA 1ZSDA 3DUSB 3H3KA 2MMXA 5HDLA 1EFQA 3VRIB 3T0VA 2F15A 2Y4SA 2DYPD 4KJPC 4OIBA 1LK3H 4U05A 1DSFL 1UH4A 2EE2A 4FFWC 4PJFB 1F2XK 5BZWA 3LQMA 1FZMB 2GEEA 1MUJA 2P5WA 3D0LA 2NY3B 1NFDF 2VQ1B 1I8IA 4HAGA 2CGRH 3OG6B 1RZJL 3BP5A 1I1AA 1HN1A 1RHHB 3HI5L 1OD9A 4NYLA 1Q9LB 1F3JA 1YA5A 2NW2A 1UJ3A 2W1NA 4HH8A 4D2NA 1NMCB 3UJTH 4ZFGL 3HG1A 4UV7L 4QRUB 5DVOA 2FECL 1RK0B 1S7XA 3QEUB 4HZLB 1MCKA 1P4LA 4KTYA 3VWKD 5I1JL 1MVUA 3NIFF 5DR5H 5ITBL 2NW3B 3QUZC 1RUKH 2Y36L 2FBJH 1OP5H 5BO1H 2R1XB 1I3RB 3MRBB 4AEHH 1H5BA 3VFUA 5GRWA 43C9B 5CZVL 1CG9A 4ODVL 3FB7B 4G6KH 5D7SL 3LKOB 1XGUA 4LVOB 2NTSP 4MZ2A 3NTCH 1P4IH 2R1YB 5ECJE 3MNZA 3WN5A 1DVFA 1MCPH 1EZVX 2F9BT 5LCVL 3VRJB 3ZDZE 1SYSA 2H2SC 2MHAB 5C9JA 5J06A 4XCYB 3RJDA 2XKSA 4R26L 4NO2A 4ONGH 3BQUD 1AGBA 4NJ9L 4ONHA 3U9PH 3HUJB 2X4PA 1OAUL 4BZYA 5DJAA 5C9KA 3N9GL 1G9MC 3F8UB 4R90L 5CP7A 3GMLA 4TSBL 4NNYB 5F9JA 1TETH 2SEBA 2VZUA 2E7HA 3CXHK 3VFTA 3P4MA 1YEGL 1FZOA 2VXTH 2WBKA 4QRRE 1P7KA 4XNQA 1LO2L 3DBXB 1Q8MA 2N7AA 5IHZB 4WI3A 1DSFH 3TA3C 5ADOL 1K2DA 5I30L 4JRXA 3EO1A 2VZ1A 1KIUA 1EEQA 1QBAA 5ERWB 3DETC 5DC0A 4AL8L 3OAZH 3FN0L 1GGYA 5HJ3B 4TOYL 3IRZA 1ZVYA 3HI5H 4WU7A 4OLZL 4TVPD 4MJ5A 1F00I 4K71B 2GITA 3G9AB 2LU4A 4Y5VB 3ES6B 4CU6A 2JJTC 4BUGA 5EU4B 4ZFGH 4UV7H 4G7VL 3ARBB 4EIZC 1BD2B 2CUIA 3BRDA 3VFRA 5C08D 3W39A 4N90E 4YH6A 4MAYB 5HYQA 2Y5EA 3TYFB 1A0QL 5I1JH 3M45A 4KQ4L 1A1OB 1I3GL 1AO7A 4U6YA 5ITBH 5EBWB 1INQB 4KKNA 1F90L 1VADA 1XF5A 1DQLL 5IMOB 4QRRA 4OGXL 5ESVA 3RVUC 4S1SL 2IALA 5CZVH 4ODVH 3DO7A 4JVPA 4M1DL 5D7SH 4TYUA 1LEGB 5E08L 4NHUB 3C60A 1T89A 4NZRL 2R1WA 3BO8A 3WXWH 4R7NA 4ZXBB 3MBEB 1AFVL 1XCTA 2DM7A 3REVA 5LCVH 4F58L 3UZVB 1AHWA 2FR4A 3PIQA 4OZ4A 4R26H 2FLBT 4NJ9H 4S1RL 1OAUH 2UWEB 3NFSL 3N9GH 2A83A 4R90H 5FYKE 2A6JA 5FCSH 3F7YA 1OT1A 5HGDB 4TSBH 1JJUA 1VEMA 3EJYC 1SVZA 4KKAD 2HT2D 5INCA 1KXVC 5FDWB 5IFJA 2FO1A 3H3PL 4OKDA 4HGWB 4HIXH 4LPWA 3ZKSD 1JGEA 1LO2H 1KCLA 1NDMB 2JIXB 3QXDB 1X6NA 2XWBB 4J3VA 1FC1A 4EQ2A 1WUNT 5ADOH 1UB6B 5E03A 1BZ7B 3UTQA 5LGKA 5FGRA 5I30H 2B7DT 4DEPC 1N4XL 2LQRA 2WWKO 5IBUB 1CCZA 4C56E 5GISL 4AL8H 1KXQE 3DMMC 3OKKA 1RY7B 4HH9A 3JUYA 4LVHB 4J3WA 3FN0H 4TOYH 1ZLWK 3ZKNC 3DXAA 4OLZH 4OZFH 5CZXC 4CKVX 4NQED 4QHUB 1J1OL 3FT3B 1FJ1A 1U8OB 4ZPTB 1YYLL 5E8PA 3SDYL 4OB5L 4G7VH 4XBEL 1QRKA 1CE1L 2X4RA 4PRIA 1ZLVH 2DBJA 1BQLL 4QHMB 5D7IB 4JZJB 2V5MA 5CINL 5J1TC 1A0QH 4YO0A 4KQ4H 1I3GH 4PRPB 4JFOB 4XBPA 1F90H 5C0ND 3STLB 3TBVB 2N7BA 3HAEG 2B2XL 1LO5A 4OGXH 3MGTB 4FA8A 4S1SH 3FQRA 2VDOL 2KUTA 4QRTB 3FQUB 3VXMB 1LEIA 5F3HA 2XXCB 3TNNA 5E08H 1AXTL 2ZNXA 3L7FB 5I0DA 4EZMA 5BZDA 1LE5A 3BESR 2LU7A 3HE6C 3MV9B 4NZRH 4UBDC 1J10A 3C8KA 1ZLSL 2CRZA 1AFVH 3G6JF 4Z77A 4U1IA 3B2UC 4C56A 3FT4A 3ET9F 4N8VG 1JF1B 2PO6A 3KPLB 4RAHA 4JM2A 4HIEA 3CX2A 4S1RH 3S4SB 1XAUA 4WFGE 2HFEA 1ORSB 3NFSH 5GRYA 3T0EC 4PJAE 4PJXE 5GSVB 4J3OC 4U1JA 4LARL 3MXVL 4X5XA 1EDQA 1PEWA 1R3HB 3KJ6L 3RWIB 1BLNA 3DVGA 3TGXA 4OD1L 3L3HB 4WEBL 1MIEL 4WUUE 3V0AC 4PTTB 1G7QA 3H3PH 1T7WA 4XPTL 1T83A 5CSZB 1KTKE 3H7BB 4MA8L 2P1YA 3KYMA 4OZGF 3AXLA 1F6AB 4X9GA 4NWUL 4L9LB 4PJHB 4YNYB 4H25A 3GMOA 3RWEA 1N4XH 5F1SA 2IADB 1EFXA 4U1LB 3RUGA 1IMHC 5GISH 2DIBA 3AU1A 2D7QA 2IH1A 5EUKB 3UZEA 3VXRA 1YDPA 5FYJL 1S5HA 3CUPB 4FABL 1Z9OA 1QLFB 3O3UN 1KJVB 4YAQA 2HFFA 2KQNA 3VE0B 3VFNA 1G6VK 1J1OH 4WGVB 3SDYH 4OB5H 4XBEH 1YN7B 1CE1H 2R2EB 3MV7D 1BQLH 4NQXB 4C4KO 1W2KT 2PXYC 2GJ6A 4ZAKC 1IGYA 2G2RA 4K9EL 5CINH 3MA7A 1CFTA 3T0AA 1CTOA 2YSSB 2Q7YB 2I25N 4PJ5E 3BD4A 1P1ZB 4WUUA 4KUZL 3CFEB 1Z9SA 5F3BB 3TWCL 2B2XH 3MRQA 2A6IA 2VDOH 5IEHA 5JA9A 2PW2B 3SDXA 1N5AB 2FJFB 1AXTH 3IJSA 4PB9L 4LSTL 5CWSA 2OJZL 5CD5C 1ZLSH 1HHGB 3QSKB 4K3JL 2H1PL 3AS0A 1OGAE 3QNZA 4OCRL 1MFCL 2PW1B 4Y1AA 1QSFB 4IRSB 4LCWB 3GSVA 3L6FB 1A6TB 3MXVH 4L4VD 4LARH 1NCNA 4OGZA 3O8XC 5FO8B 3KJ6H 2YPLD 4OD1H 1BQSA 4X6DB 4WEBH 1MIEH 3ZT5A 3QR2A 1XH3B 1JHKH 1U36A 4XPTH 3BH8A 4Z0BL 4MA8H 4PJ5A 3BWUC 3C09C 4QHKI 2IFFL 2X4TB 4QNPE 4MXVF 4NWUH 4OZFA 3MRHB 2CRYA 5F70A 4KK6C 5DJCA 4JFYB 1NBYB 4IIQC 1NFKA 5SX5H 3BZFB 4O51A 3WNLA 1U8JA 1HYSD 1LQSR 2HWZL 4P5TD 1YECL 5FYJH 2XG4A 1WBXA 3KR3L 4LPCA 3SCMB 4FABH 5I17B 5ID0B 3FTGB 4EI5C 3ULVE 1OGAA 2R29H 2VLJD 4MJ6B 1E4JA 4I0PD 3LN9A 1YMMB 1T2XA 1C08A 3AREB 1AR1D 3AAZA 3GMQB 5HI3C 4ZYKB 5I66B 2AK4E 1XR9A 5JNYA 2E27L 4QO1A 3QCVL 4K9EH 1R5VA 3IDNB 4BSVB 1B0RA 5A2FA 2AV7A 1NMBL 2Q86A 3NCCB 4ZFFB 1LO0L 4KUZH 3SO5A 1N5YL 3VH8A 4U7MA 4J4PD 3C6SB 3TWCH 4IOFC 5T1KA 5BV7L 3UAJD 4Y4HA 4HS6B 3MODL 4RGMC 2R4SL 1CZ8L 2Z8WC 4LSTH 4MDJB 5IVXF 5JW5B 1FVDB 2OJZH 2ADIB 4K3JH 2H1PH 4DGIL 5KVDL 1TXKA 4PJDB 5DD1L 4OCRH 2R39A 3RVVD 1AP2B 1MFCH 2EDWA 1ZLUK 4XBGA 2VLME 3MRJA 4NT6B 4RBPH 2FEDC 4XP4L 1JVKA 5A2LH 3MRLA 4WI6A 5EN2A 4G6AD 2P43B 3CCHB 5DMIL 1OTTD 3TBSA 3HPJB 4KGJA 4P2OB 4Z0BH 3QXWA 4X4ZA 1S9VA 4NQDE 2IFFH 2ZSVB 5D1ZB 3QH3A 5IF0B 3BPLC 3BOVA 5F8RC 1KCKA 2CUMA 1VFOA 2YD4A 1I1AD 4EUPB 3MLZL 1XT5A 4F2MB 4HFUL 1FVEB 4HF5L 4ZUUA 5GIRB 2HWZH 1B6UA 1YECH 5LGHL 3KR3H 3TEUA 5CHNA 3HG1D 5DJYA 1U95A 1W72L 2EYTA 3QWRA 3M17A 2X89D 1NGWB 5TDOA 5LXGL 1V7ML 1J9CT 4XNUL 3UPAA 1KJMA 4KJWD 5M94B 3OMZA 2E27H 1AXSA 5DJ2A 4HKBA 3QCVH 1Q9OA 1X5AA 3QDMB 3KPOA 4UOW0 1NMBH 4XB8A 1HQ4B 1LO0H 5FYJE 3QEQB 4WTZA 1DQJA 4JRWA 1N5YH 3RWDA 3O3BA 2W0KA 6FABL 4QYOB 5EU7C 1M7IB 1SQ2N 4JZOA 2EH8L 5BV7H 5C0FA 1FORL 4CDHA 3MODH 2R4SH 3ULSB 4EOWL 1T0PB 4WW2F 3QB7C 1DN0A 1T5XB 4FXKB 2BVQA 4P3DA 3PWUA 1KYOJ 5C92A 4DGIH 5KVDH 5F1NA 5KSBE 3RKDC 1I1FB 1P7QA 5DD1H 1O5DT 2G5RA 1DQQA 4PJEB 1G7HA 2DBLL 3T8XB 3K2UL 3BH9A 4Z0XB 4XP4H 1A47A 1ZA3A 1P84K 4XTRC 1S7QB 1WK0A 3KJ4C 1YPZA 3TJHC 1U8LB 3P9WB 5D2NE 3JWDL 5EUOE 4G43A 5DMIH 5FAAA 3M8OL 4Q0XL 1JPSH 5DLML 3UXFA 5JTWA 3HR5B 1QHOA 1YEKL 3QDGE 2P8MA 2FL5A 3STZA 3AB0C 1DUZB 5A3ID 3LMJL 1HWHB 4HKJB 3RZCA 4HFUH 3TA3B 4HF5H 3T2NL 3IFPA 4PY7B 1KCUL 4HEPG 3WFCL 5LGHH 3EHBC 4HLZG 4JN1L 1MIML 3R06B 3DRQA 1KTDB 1W72H 2RJMA 5KSBA 3D69B 3WFHA 3S34L 4Y2OA 4EDXA 5LXGH 5BS0A 1V7MH 3BSZL 1WIPA 1WFTA 1WZMA 4H1LB 4XNUH 4LRIA 3ZYJA 3TO2B 3IVKA 4V2CB 3FHAA 2P46B 1AQKL 3AC0A 5DJ0B 3NFNB 4QRRD 2Q20A 5KG9B 3V52L 5D2NA 1FL3B 4LSRH 1FGVL 1J87A 4OLUH 3U4EA 2YBRA 5HXMA 3LH2L 4PRAA 4N1CA 2EH8H 3I6LE 3C60D 1FORH 5HD8C 3O9WA 1TVBB 2BVEA 2QSVA 4EOWH 5KVEL 1ED3B 1S7TB 5F6IC 3NZ8A 4M7LT 1RUPH 4KWUA 5LWYL 3T4YB 1NANI 3UPRB 1IARB 4HIHA 2NZ9C 2OTUA 3FQNB 2NY5L 5INDB 3QUYC 3K2UH 3LZFL 4CN6A 2P5EB 1AD0A 2P48B 2A38A 4HXAL 1IQDB 2X4QB 5GGSA 3FN9A 1T7YA 3PV6A 5IIEB 3G5VB 2G9HA 4N90D 3BKJH 3F7PC 4FRWA 1IVLA 5DRWA 2OX5A 4UDUA 1YNKH 3EZJB 4P48A 3JWDH 4ONOA 2Y6SD 2QBWA 1N0XL 3T1FA 1DBML 4WV1A 1TNNA 2Y1VA 4Q0XH 3U36B 3G5YA 3TCXA 1J05B 2JKXA 2HYMA 2E3VA 3MLWL 1YEKH 1EUTA 2Y7QB 3ILPB 5I18L 5HHOB 1IM9B 3LMJH 1BVKB 1BX2B 1WWCA 3RA7L 1S78D 2APTA 4BSJA 4DK6A 5MP6L 5F9AC 5FGSA 2CIKA 3FONA 5KJRL 3DXAD 1VCAA 3MFFB 5KOVC 1KCUH 5HHQA 3UTPE 3WFCH 4DEPB 4JN1H 3EKCA 1MIMH 1OP3K 3QNYA 4K7FA 2XPGA 5AD0B 1CICB 2DQHH 3RNQB 4JRYE 3S34H 5F7FA 4P2RB 5FYKD 5IG7A 4HWZB 4JPWL 5L8KB 4WUKL 3OAZK 2VR5A 3P4NA 4DKDC 4RWYL 4JFHE 4ZUTB 1AQKH 1WC7A 3K46A 1D5IL 3GHBL 1XGPA 2P42B 2HAZA 5ELIA 5L8LB 4U4BA 2XNAA 5K9KA 3KYOA 1FGVH 2ATKA 3F5WA 3LH2H 2YZ1A 4QT5B 1OAXH 4NO0D 2OS7A 1KEGL 1KG0B 1FZKB 2I27N 4RFEB 3Q5YA 3MCG1 4C56D 5KVEH 4LPTA 3O4LB 2PO6D 4PBXA 4JM2D 5LWYH 43CAB 4NCC1 1QD0A 3HE6B 4LLYA 1ZHNA 4OLXH 5B39B 1EBAA 2NY5H 4HXAH 2H8PA 2QL1A 4JRYA 3MLPA 4J8RA 3VDBA 1H0DB 4P3WA 4HKXB 4LBEB 2DMKA 2EO1A 1IC1A 2R56L 3T0EB 1M7DA 3PGCA 3LKRA 3NFPA 4U3XA 1FHGA 1JWSB 1LVEA 1N0XH 1J11A 2FZ3A 2AQ1A 4JY6A 4DVRL 4Z7WB 1AGDA 5SWSB 4GRWB 2VITB 1YQVL 5B3JE 3A0OA 4I2XA 1J1PL 1A7PL 1F02I 1W72A 3MLWH 5I18H 1J0YA 5GRZA 4FFVD 3U83A 4PJFE 3RA7H 3PXHA 3WS3B 1E28B 4U3HA 5MP6H 5JA8B 5KJRH 4RMVA 2DS4A 1YN6A 3MO1A 2C1OA 5IWLA 4WFGD 3HZYB 5F7NC 1KIPA 3VXSA 3WV0A 2XN9B 1NFIB 1J0IA 1IAOA 4WW2A 4U6VL 1A2YA 1TENA 4JPWH 5DFTA 5B38B 4WUKH 4PLJC 2J5LC 1SM3L 4WUUD 1XF4B 2N4IA 1D5IH 4R97C 3GHBH 3S8WA 4BK4A 3TBWB 5JORB 2ATPA 1T21B 4UILL 2ZKHL 3WE6A 3QIUA 2DLFL 1A6AB 4ZAKB 2PKDA 4XXCA 5J9PB 1KOAA 2QKIB 2FEEI 5DZOA 1EEZB 3I50H 4ZUSB 3DUSA 1ZLVK 1SJHB 3VRIA 5EBMB 2BK8A 1KEGH 2RB8A 4JCMA 2XWTB 3CFJB 4PJFA 1FZMA 6CGTA 3R8QA 2VQ1A 1HKLL 3T3PF 1IE5A 5ILTL 1NCUA 1JMXA 4FZ8L 4KHTH 2JJUA 3ARFB 5HHVL 3BXNB 1RHHA 4IMKC 5CBEB 5AZ2H 1Q9LA 1VDGA 4PJIB 3WHXB 2R56H 1WV7T 4QRUA 4WI9A 1MCLA 3DSFL 3ZTJG 2CDFB 1RK0A 4HZLA 3QEUA 3BQUC 4PJ5D 4OCYL 4X7FC 1DLFL 4NM4H 4QXTB 2Z9TA 2F5BL 4DVRH 2R0KL 3EOAB 1YQVH 1BZQK 1OGTA 1DBAL 1U9KA 1J1PH 2NW3A 3SBWC 2EZ0C 4Z7VE 3MCLL 1JZ3A 1CD1B 2R1XA 3F65A 1I3RA 1KF9B 4S1QL 3MRBA 3C09B 43C9A 4K7PH 3FB7A 4HJJL 1U8NB 5C3LD 5D1QD 1FO0B 3LKOA 1OGAD 3LQAL 2J8OA 2QSTA 3S97C 2R1YA 3FB8B 3SKJL 1PKQE 1IC7L 4K07A 4LAJH 3VRJA 4HS3B 2MHAA 1QR1B 1RZ7L 4XCYA 3U79A 4U6VH 1NANH 2GYSA 3HUJA 4EI5B 1D6VL 5CSGA 1BD2E 1SM3H 1VHPA 3LPWA 3WL9B 1FDLL 5D6DC 5T1KD 4NNYA 4UILH 2ZKHH 5JOEA 2DLFH 4Y4HD 4PJGF 3RGHA 1EV2E 4BFGA 2XZAL 2XY2A 2O5XL 2YA0A 3DBXA 3LRSB 4PGDB 5HVHB 5IHZA 4Z95L 4W68A 5GS0L 5HDBF 2FGWL 3V4PH 2FNBA 1KSRA 5E9DB 3HE7B 4LF3B 1HKLH 2BY2A 1F4WL 5ERWA 3ULVD 2NY1D 5ILTH 2XQYG 4RQQB 4FZ8H 5TH2B 5HJ3A 5HHVH 5C0EB 3ILQD 2UWEE 2AK4D 3PP4L 4Y5VA 3ES6A 5MERB 5EU4A 4U49A 2MKLC 3DSFH 3ARBA 5B4MD 1BD2A 5IB2B 5JOPD 1QTYT 4OCYH 2F5BH 4MAYA 3TYFA 2R0KH 4MMZC 5GRUL 1A1OA 4MA3B 1DBAH 4OM1L 5EBWA 1INQA 2IANB 1UM6L 1WWAX 4FTVB 3MCLH 1XFPA 5IMOA 2I60L 2HT2C 4DUWA 1GC1C 5CJ8A 1PJ9A 2FEEL 5C6PB 2E9IA 3BPLB 4HJJH 1QA9B 1LEGA 3LQAH 4M5ZL 3QWRD 3JWOC 1G7IB 1F3RB 2VRAA 5IROC 5A2JH 3MLRL 4RAVB 4ZXBA 3MBEA 3SKJH 2VLMD 3JV5A 1IC7H 1X5IA 1RZ7H 3SGDI 1JHLL 3QXAB 4X83A 1U91B 5HYSG 2X1OA 1D6VH 2UWEA 1FDLH 4LSSL 1OTSD 1I4FB 3TH4T 5HGDA 2XFXB 4PRPE 3BRFA 4NQDD 5FDWA 2YEZB 1T04B 4GAGL 1T0MB 4HS8H 4HGWA 4UNUA 2XZAH 5EIIB 1QYGL 2O5XH 3VXME 1NDMA 2JIXA 3QXDA 4Z95H 4OBSA 2XWBA 5DEZA 5J1SC 1IAIM 5GS0H 1P7QD 2DB8A 3QQ9D 1UB6A 2FGWH 5C0NC 1BZ7A 3MV9E 1BAFL 4BSWB 4U0QB 1QFHA 2IAMD 3WMSA 5J13C 3JV4B 5KN5B 5FYLH 4LDEB 1F4WH 2XRAL 1QBBA 5A16B 5I8EB 3BAEL 3U30C 1EGJL 1C8PA 3QZWB 4QHUA 2HA1A 3PP4H 5IB4B 1T1ZB 3FT3A 1U8OA 4ZPTA 2PYEB 2YD6A 4CUCA 3MACL 3T2OA 3VG9C 3QDJB 3NABL 2JJWA 1A4KB 4AIZB 4MNQE 4TPRH 5FYJD 5IFHL 2BMKB 4QHMA 3KJ4B 3ARYA 1CDJA 3BEVB 5DVLA 5D7IA 3JBG7 5T1MB 4JZJA 3VDCA 2VDMH 5GRUH 5F7DB 3TN0D 4OM1H 4AH2B 2ZJSL 4PRPA 4JFOA 5DC4B 1UM6H 3SDAC 3DRTB 2BSSB 3RZCD 3WHE0 5J6HB 4L8SC 4PJ7F 3RY5A 3ARGD 2I60H 3STLA 3TBVA 1Q0XH 3CXHJ 1OVZA 3MGTA 5T3ZL 1SY6L 4QRTA 3VA6A 3FQUA 3KYAA 3SJVE 3VXMA 4IHOB 4M5ZH 3AB0B 3IFLL 3L7FA 4AK1A 1G84A 3MV9A 3K1DA 2C9AA 3RRQA 3TIEB 3IU4L 2IPUG 3MLRH 4OF3A 3U7WL 4ELMF 3OF6D 1JF1A 3KPLA 4ERSH 1JHLH 3S4SA 3UROR 1ORSA 4DOHB 3IS0X 3QUMB 1ETZB 3FAXA 4X6CF 4YIQB 2AEWA 5GSVA 2Y9RT 1ZEAL 5ICYB 5J4MA 1YNTB 2K9UA 1R3HA 4JO4L 3VXUE 3RWIA 2WIMA 4H8WC 4LRNL 5GXBB 3L3HA 2HRLA 5EULV 1S5IL 4PTTA 4CVWA 2B1HL 4GAGH 4C59B 1MCWW 5CUSL 3QDGD 5KW9L 4GAYB 5CSZA 4Y88A 1QYGH 3FT2B 3GSWB 2PR4L 3H7BA 1WZLA 5E4EC 5IGXL 4MZ3A 4YFLF 1F6AA 3AMKA 2OTPA 2W0LA 4L9LA 4PJHA 4YNYA 4MCZB 4C4KT 1G9ML 1BAFH 4KUCF 3P9LB 3FAWA 2IADA 4U1LA 4NN5C 1RI8A 2WNGA 2XRAH 4KVNL 1A6VL 3DV4B 1U3JA 2AK1L 4MLIA 4S2SB 5F6IB 5EUKA 3BAEH 2CK2A 4WHDA 3CUPA 1QSFE 1GL4B 1QLFA 2R2BB 1KJVA 2F74B 4LCWE 3VE0A 1UGNA 3MACH 4F9PA 3QUYB 5TFSL 5HVGB 2Q8AL 5GGRY 1YN7A 4FP8L 2YUVA 4X6DE 2R2EA 2N1KA 2WUBH 5IFHH 1G6RL 4RNRB 5ETUB 5JW4N 4NQXA 4JFXB 4WFHE 4D3CH 1G1CA 2JJVA 3EOYG 2Q7YA 2YSSA 2ZJSH 1P1ZA 1JZ6A 1SJXA 4M61B 1GGCL 5E8EB 3CFEA 1PSKL 5F3BA 3GZKA 4ETQB 2W0PA 3L3GB 5CAYB 1RQ5A 5I16B 5T3ZH 1SY6H 3V0WL 1W0VB 2DTSA 2R15A 2PW2A 1TDQA 4ZOEA 3DNKA 4R4FH 1CFSB 1N5AA 2FJFA 2DQFB 2BC4B 3IFLH 4ZUWB 1B0WA 3IU4H 1HHGA 3U7WH 3EDFA 2VUYA 4G6FB 2E5EA 1VFAB 3R0NA 4X4ME 2V6HA 5MENB 1YMME 4U1HB 3G5ZB 2PW1A 1HYSC 2B4CC 4U1NB 5CGMA 5D7LB 1QSFA 4IRSA 3VFPB 4MWFB 3B3IB 4LCWA 1N26A 1FG9C 3C5JB 3L6FA 4M7ZC 1CQKA 1ZEAH 1A6TA 4I0PC 4S10A 1TTFA 3OHXB 4MDIB 5FO8A 4LRNH 4X6DA 3MRRB 5JZ7C 3S9DB 1S5IH 1ZMYA 4GQPH 2B1HH 5CUSH 1XH3A 5F7HA 4HUVB 3FN3A 1H8OA 4K55A 5KW9H 1S9XB 1JF5A 2C4FT 3NIGF 2ADGB 4NHCL 2PR4H 5D5MB 4Q6YA 2CSPA 3HFML 4QGTA 2ID5A 2X4TA 5GJTL 3MRHA 3GO1L 3S6CA 4J4PC 1JRHI 5DI8B 1G9MH 4JFYA 4NNPH 3UTPD 1NBYA 3H9HB 5T1LB 3BZFA 4PJDE 4KVNH 5DHYB 1A6VH 3UAJC 4B7IA 5BJTB 2AK1H 4JRYD 1NFDE 5GRXG 4NN6C 3SCMA 4HSQA 5I17A 3QPQD 5ID0A 3FTGA 4EI6B 4LGPB 4MJ6A 4X4MA 4NRZB 3GBLA 4Y5XC 2J8UF 3U0PB 3VXPB 1YMMA 1RULL 3AREA 3IRPX 5TFSH 2Q8AH 3GMQA 3RVVC 3TH3T 4ZYKA 5I66A 3O6FB 3SGDH 4BYHA 4OM0L 4KU1A 5JXED 1G6RH 1I85C 5DJXB 4LAQL 3IDNA 5A43C 3ELAT 4BSVA 4O02H 4X4XB 4J6RH 5HPOA 4ZFFA 3MUHL 1GGCH 1HXYB 3O6LL 4O00A 1PSKH 3C6SA 1OTTC 2L7JA 3QHZL 4H1LH 4KV5E 1UH2A 3V0WH 1U41A 4HS6A 4K3HA 5F7UA 3QEHB 2IMNA 2OYPA 4MDJA 2HH0L 5JW5A 1DN2A 1FVDA 1PLGL 2VLLB 4HUNB 1WWBX 2EXWC 2ADIA 4QOKB 4PJDA 1I1AC 4NPYB 2B8OT 2DDQL 1MPAL 5IM7B 5K9QI 1AP2A 4NT6A 3QAZC 4QRPE 3QIUD 4KRNA 1VFMA 1CIUA 1TITA 3RGVD 5D6CB 4LPVA 3TJEL 1KLFA 1U2HA 1X6LA 3RX8A 2ZOLB 2WWMD 1WSST 4N0FB 4UT9L 5DSCB 3CCHA 5B22A 4ZMAT 3JWNC 3C6LD 3V8OA 4KJWC 4R97B 5KVFL 2DAVA 4IS6B 3HPJA 5MEQB 4P2OA 3WNMA 4URTB 1EGJA 2V5YA 2ZSVA 1H5BC 2NY3D 1FNLA 5D1ZA 5IF0A 5GJTH 1TQCB 1MCDA 1TPXC 3GO1H 3NA4A 1T5WB 1XIWD 4EUPA 2YD2A 5D2LF 4F2MA 5E5MB 1EO8L 1FVEA 4MX7B 1AIFB 1OQXA 5GIRA 5TF0A 1QSEE 4PJEE 4ONFL 2FGZA 4QRSB 5I74C 1BPVA 4ZO8A 1NGWA 1A6UL 3GSXB 3TF7C 1SY6A 4OM0H 2VUOA 1OSPL 4NDMB 4LAQH 5FF6B 1OARL 3SKMB 3DIFB 3QDMA 3RFZC 3BQUB 4GFTB 1HQ4A 3QEQA 3RI5K 5KS9F 3O6LH 1S9WB 3VFOB 5J3HD 1QKZL 4QYOA 4ETYA 1M7IA 3QHZH 4PS4H 4KPHL 1JWUB 2X7LB 3X13B 3ULSA 1BWWA 2WV3A 5CEYB 3MBXL 2HH0H 2XTJC 5ADPL 3MRNB 1PLGH 1EZVY 1T5XA 3KPNB 4FXKA 3B43A 4WWKB 1JRHL 1I1FA 2DDQH 1MPAH 1FNGB 2FYYB 4B7LA 4PJEA 3T8XA 3ZO0A 2LAGB 4Z0XA 2IFGA 1YZZA 1S7QA 4I18C 3R8BB 1AD9B 3TJEH 5FCUL 3V6ZB 1JYVA 3B9KB 1U8LA 4UT9H 5CEZL 5E8NB 5FA3B 2XG5A 5KVFH 3DURB 2BY3A 1OSZB 2NTFB 5C2BL 4M6NL 5DHXB 3IFOB 3HR5A 4KVCL 5CGYC 4RCAA 1DUZA 2RGSA 3L9RB 4HKJA 1TNMA 4BKLB 1EO8H 2I9TB 3B4NA 3TA3A 4PJBF 5CKAA 4PY7A 3HLAB 4PUBL 1N2RB 4ONFH 3R06A 1KTDA 4N8CL 5DVNA 2D7MA 5F1KC 1BD2D 4JREC 3D69A 5K9QG 1JGVL 4I0KA 1A6UH 4MAYD 2BVYA 4H1LA 1CBVL 2WP3O 4Z7UF 1CVSC 3TO2A 5IEKB 3IKKA 1U0QA 1OSPH 2JJTA 5DJ0A 3EW3B 4MJ2A 1OARH 2NY0D 2P7TB 3NFNA 5KG9A 2RCSH 1Y6NR 1YYMH 1FL3A 1C16B 4L8BB 4A6YB 4BJLA 5ALCL 5HHOE 3BX7C 4FQ2L 5I76B 4Z7OE 4KPHH 5CS7A 1IEAB 2Y6SC 4M7KL 1TVBA 2YWZA 1RJLB 1QO3B 3MBED 4G7YL 3MBXH 1ED3A 1S7TA 1MCEA 1LD9B 1NGXB 2FHCA 1JRHH 5EH1A 3QDAA 1S78C 3T4YA 3UPRA 4P2RE 4UQ3B 3FQNA 4L3CB 5INDA 2X10A 2P5EA 5F7LB 1IQDA 2X4QA 4PP1D 2ORBL 4X0KB 2BVOB 3ORJA 5IIEA 3G5VA 1CU4L 2VQUA 1RZFL 3VWJB 5FCUH 4POYA 5CEZH 4A2LA 3JTSB 5CEXB 2JIXD 3WSQL 1UKTA 4UNTA 5EU6E 3U36A 5E8OB 1AY1L 5C2BH 1J05A 4M6NH 4KVCH 1HSAB 3PXJA 3ILPA 2Y7QA 5HHOA 5DUBB 3TM6A 1BHGA 1IM9A 3O4LE 1BVKA 1BX2A 4OZGE 2DMCA 2ENSA 5F1IB 1ZE3C 2AJ3B 4X5WB 1Q9WB 3MFFA 3THMH 3BKCL 5TDNB 3WS6C 1RJCA 1PY9A 4PUBH 5J13B 2R23B 5AD0A 1CICA 3RNQA 1JGVH 5JR1L 5IV2B 4P2RA 3U30B 4HWZA 3V6OE 1B4JL 1PD6A 3UBXI 1WAAF 1CBVH 3T0EE 5F7YC 4PRPD 2EECA 4MVBC 3MJ6A 4ZUTA 1XZ0B 1P84J 3JVGC 5SWSE 4GRWE 3T04D 4MD0B 2A74B 3VXMD 1RZJC 2XI9A 3RWHB 4YHOL 1R3IH 4FQ2H 1JWMB 1NPUA 4QT5A 1BOGB 2ZCLL 4M7KH 5KSAC 3MV9D 3SDAB 3Q0HA 1KG0A 1FZKA 4G7YH 4L8SB 4RFEA 2WANA 4YHNB 3Q5TA 3O4LA 3G6AB 5TJWK 3VRLF 3MNVB 3VI4E 43CAA 2KQMA 2KZWA 2XN9E 4OZHE 4WEUD 3HE6A 4FZEL 4UT6L 5B39A 1VA9A 4Z6AT 2ORBH 4DUVA 4MNQD 3WDHA 1CU4H 1ULVA 1KN2L 2HJFB 1H0DA 5E2JA 1RZFH 4HKXA 1GZQB 4LBEA 4KJYB 3UDWC 4ACPA 5HI5D 3IGAB 3T0EA 4HK0B 3WFDL 1U93B 5HBBA 5FHAL 1L0XA 3WSQH 5DD5L 1JWSA 2XA3A 4AQ1B 4Z7WA 5SWSA 5K33A 2VITA 5IJKC 2XT1B 1Y0LB 4YR6B 1ZVHA 1ZK9A 3U6RB 3MV7B 1EIBA 3WYRA 5JHDB 3SHSA 2BVTA 2HKHL 3LQZB 5E4EB 3WS3A 1E28A 4BQBA 1AJ7L 4NKDB 4HUXB 5MEPB 2OTWB 4GQ9L 1WWWX 3BKCH 5DJDB 3S36L 1BFOB 1YC8A 4OLWL 2D03H 5HGHB 2IQ9L 3HZYA 3OJDB 2XN9A 5JR1H 1NFIA 3V0VB 2RFXB 3P9MB 4KY1L 1QEWB 5B38A 1A6WL 1FSKB 1RIHH 3K4DA 3VXUD 4CBPA 5I0ZA 3K4AA 4K23H 1XF4A 1NMAL 2B20A 2X4SB 2A1WL 2DQGH 3GSRB 3TBWA 4UU9B 5JORA 2EDFA 1T21A 1A6AA 1CL7I 3ISWA 4ZAKA 4YHOH 5J9PA 2QKIA 4MYWB 2ZCLH 2YA1A 3DVFA 1EEZA 2VAAB 4KDTA 4L4VB 4ZUSA 1N8ZB 1SJHA 1KIQB 5EBMA 2YPLB 4JO3L 3S35X 2FX7L 1DE4B 2XWTA 3CFJA 3X14B 4GBXC 5J8OA 5IVXE 1QSFD 5EOCJ 4LCWD 4XHJC 4FZEH 1A8JH 4UT6H 5D1QC 5KZCB 3VCLB 2BSRB 3ARFA 4WDIB 3BXNA 1GIGL 4DW2L 5CBEA 5JOFB 4NBZB 5CLTA 1KN2H 4OZIB 1F4AA 4WFHD 3ZE0F 4PJIA 5GS3A 2HJLB 3WHXA 3UBXG 4OLVL 2CDFA 1VEOA 3WFDH 2ICWB 2IMMA 5FHAH 3CSPA 4M7ZB 4QXTA 5DD5H 5E70A 2DM3A 1ZV5A 2VZ3A 3EOAA 4CN1A 1JNHB 5CGTA 3WCYA 1M4KA 1CD1A 1LO3L 4Y4HC 5DYOB 1TVDA 4JQVA 4KXZI 2HKHH 4NSKB 1CXEA 1AJ7H 3B8YA 5E9DE 3SCMD 3K7UA 3H9YA 4GQ9H 1U8NA 1BQHG 1NLDL 1FO0A 4N5ED 2Z0BA 3SGEI 3S36H 3K3QA 1YMMD 4OLWH 2Q76B 3QHFL 1OB1B 3ARED 3CDYA 3FB8A 2IQ9H 5T3XL 2RQ8A 4ZNEE 4HS3A 1QR1A 4H5SB 1I1YB 4KY1H 1P5VA 1U2CA 3ULVC 4NN6B 2NY1C 1A6WH 1MWAB 4EI5A 5DTFB 5TGBB 4Y5XB 3WL9A 4HX1B 4LIQL 1NMAH 3CXDL 3ILQC 4YHLH 1OM3L 2MNUA 1FYHB 4R8WL 2AJUL 1HDMB 2IANE 3VA2C 5C86A 3GIZL 3B2VL 4W6WB 5D70L 3RX7A 4QCIB 2DWDB 5CKGA 1BFVL 3LRSA 2W0FB 1P69B 4PGDA 5ABDE 4JO3H 1NEUA 1UWXH 2V2WB 5DD6B 5ANMB 5E9DA 3HE7A 1H15B 4DWHA 4LF3A 2D4FA 3O41B 4OI8A 4GS7C 4S0TD 1G7PB 1EHAA 2A6KB 1X44A 4RQQA 3QUKB 5J7CC 4JFFB 5TH2A 1ZTXL 3D18B 1IT9H 5C0EA 3SDDD 1GIGH 3HI6L 4DW2H 4UTAL 1NBQA 5MERA 4HV8B 1O7SA 4KTEL 4OLVH 5IB2A 2NXYD 4GG6E 5F9WC 1WFUA 2WLYA 3WLWD 3H9SB 4Y5YC 4MA3A 1NH6A 2IANA 4MXQC 4FTVA 2Y23A 1FGNL 2GKIA 1LO3H 3K8MA 1KTLB 5MEOB 1CGVA 1CL7L 2C3HA 5EA0H 1JTPA 4OCXL 1U8KB 1ND0B 3Q6FB 4MHHG 1NLDH 4XMPH 1QA9A 1TPXB 3T08A 1G7IA 2OL3B 3LN4B 4D9RE 4LPUA 2BY0A 5CILL 3VDAA 3QHFH 3QQ9C 3WUWG 4RAVA 1MAKA 5T3XH 4QRPD 3I9GL 5TE7L 2IAMC 3QXAA 3P0GB 1C5BL 1U91A 1YEHL 3QDMD 3DJ9A 5I74B 2X70B 4LIQH 1WEJL 3CXDH 1A7RL 1I4FA 1OM3H 3JV0A 4R8WH 2AJUH 2XFXA 2W59A 4DZ8B 4EVNB 1WVZA 4WHYG 1F5WA 2YEZA 3SE4C 1MCCA 3B2VH 1T04A 2K7QA 1T0MA 4XXDB 5D70H 1FNHA 5EIIA 4WU5B 5ESQB 2BVUA 1BFVH 4KC3B 3OB8A 5D96B 3BI9X 3TN0C 5FHBL 3RZCC 2CUHA 3SOBL 3ARGC 4BSWA 1QSED 2BNRE 3JV4A 4LCUB 1CLYL 5KN5A 4BFBD 5F21B 3DO3A 2XTJB 3MX0A 4GUPB 5I8EA 5A16A 3SY0B 2FHFA 3BYYA 4F7PB 3I2CL 1X5GA 3HI6H 2LFGA 3ZDYE 3QZWA 5IB4A 1T1ZA 2PYEA 4Y7MA 4KTEH 4RFOH 1OT2A 1SYVB 3QDJA 2AERT 3CC5B 5E95B 3KDMB 1A4KA 4AIZA 4TNWF 4NC2B 4M4RA 2BMKA 4I18B 4QLRA 4PRHE 3BEVA 1DQDL 2E9JA 3ARPA 5T1MA 3IDIB 2XXMB 2X9WA 4P4RB 2R0WL 5F7DA 5E2WL 4AH2A 3DRTA 2BSSA 3QFDB 5DK0B 5J6HA 5MI0C 1FGNH 2VSCA 3GIVB 1CL7H 2VDKH 3MTRA 1GRWA 4OCXH 4KMQA 4HT1L 1CLOL 4IHOA 4PR5B 4FQHB 4I3GA 1KPUB 3CU1A 5CILH 3TIEA 4WFEE 2QTEA 3I9GH 5TE7H 2EH7L 4GMSL 3VJ6B 1C5BH 3BEWB 4UDTB 1YEHH 3WXVL 4HJ0D 3O3AB 4JREB 3LV3B 3QUMA 4UIMB 1ETZA 1WEJH 3UTTE 1A7RH 4YIQA 3H42L 5SV3A 5ICYA 1KEML 1YNTA 5EC1B 2CR6A 2EYSB 3S5LG 4FXLA 3LKSB 4HMEA 2FJGB 4WV1C 5IW6B 3J7HA 5T3XE 1QNZL 2BNQB 1CS6A 2LU3A 4FN0A 3RVUD 4GAYA 3FT2A 3GSWA 4CVUA 5CP3H 4M48L 4M6OL 4LIQE 3MMEB 4MCZA 1X7QB 5I6XC 4RMWA 4JCLA 3P9LA 2BXZA 4KXZH 4TVPL 2P5ED 1DL7L 2VNCA 3DV4A 4HD9A 1JL8A 4S2SA 5GS1C 5MENE 3CZJA 4U0RB 4NZUL 4TTDD 2ZPKL 3I2CH 1IBGL 5D7LE 3SGEH 2R2BA 2F74A 5F96L 3QUYA 4WTXA 4YBLC 5IESL 3TT3L 2DM4A 3TNMB 3AS2A 3D9AH 4RNRA 5ETUA 3R0MA 1DQDH 4JFXA 4Y2DC 4AIXA 3K80A 3F7VB 5FO7B 5HHOD 2VXVL 2DWEB 2R0WH 1HHKB 5JW4M 5DZNA 5E2WH 4L3EE 1UQSB 4M61A 3RVXD 1WZ1L 5E8EA 2YRLA 2R2CA 4ETQA 1CXIA 3L3GA 5I16A 1K8IB 4OD2B 4HT1H 4U33A 1BM3L 1W0VA 5CIPB 1CLOH 3OXRB 4C57C 3PL6C 1NSNL 1CFSA 5AG9A 2DQFA 1CICD 2BC4A 4P2RD 4XCEB 4ZUWA 4H0GA 4A6YL 3FOMB 4NO0B 3HMXL 3ABZA 1OTUC 5DD0L 1VFAA 4GMSH 5MENA 3QULB 4U1HA 3G5ZA 3QNXB 4U1NA 3WXVH 5D7LA 5IBLC 2VZOA 3VFPA 4MWFA 3B3IA 4XWOD 1GC1L 3RWFB 3QPQC 4PD4K 3C5JA 1P7HL 4UV4L 1KEMH 3OHXA 4MDIA 3WFEL 2EIZB 3MRRA 5GRJL 3JWOL 4MQTB 2J2ZA 2J1KA 1QNZH 4UB0L 1HIML 5TQ2L 2JCCF 1G7MB 5CJXA 5JXEC 4HUVA 3EDDA 3MGOB 1S9XA 3O4LD 2ADGA 2EIBA 5D5MA 4M48H 4DVBB 5E7FA 2HMID 1J0JA 4M6OH 1QG3A 5DI8A 5KSAB 3HNSL 1DQML 4YHML 4JG1L 3TIDB 4G8FB 3H9HA 4TVPH 5T1LA 3B2UD 3C2AL 5DHYA 1DL7H 4J3UA 4QF1B 5BJTA 4TRPL 4Q7DA 2XZZA 1SVCP 4NZUH 2PF6A 2FIKB 2ZPKH 1IBGH 4BZ1L 4FG6D 3LS5L 4EI6A 3T0ED 1F97A 5F96H 2H6PB 3MJ9A 4NRZA 3VXPA 3U0PA 4OIIL 1FLTX 1GPOH 3T1WA 3NA9L 5SWSD 4KDWA 3TT3H 3O6FA 1R24B 2XZQL 1K9TA 5DJXA 4PJAB 4JFDB 3ARRA 4PJXB 2VXVH 3FRPA 4U2YA 1S7SB 3MA9L 4MA1C 4X4XA 1WT5C 4X99B 3QHTC 1C12B 3RGVC 5CSBA 2R0LL 4YDLC 4XVJL 1HXYA 1WZ1H 1YEEH 2ESVE 3MV01 3C6LC 4LSVL 1BM3H 1EXUB 2NYYD 2YKLL 3BDXA 5DUPL 1R3JB 4JFQB 3IAGC 1NSNH 1EJOL 3QEHA 2XN9D 2NY3C 4OLEA 4F57L 3QG7L 1ADQA 1D5ZB 1PW3A 2VLLA 3M1BB 3BGFB 4A6YH 5KVGL 3EYVB 1PZ5B 1T1XB 1N64L 4QOKA 5HVFB 1XIWC 5DD0H 2CQVA 4NPYA 2D0GA 5IM7A 1CD9B 5DQDL 1EHNA 4E42B 3MRMB 3FRUB 1GC1H 1MCSA 3FZUD 4UV4H 4ZAKD 5D6CA 1DTUA 1BIHA 4MD5B 2ZOLA 5DSCA 3RX5A 4N0FA 4NZTL 3V7AG 5GRJH 3JWOH 3VXTB 3WFEH 1FFRA 5F7KC 1CDBA 5IFAH 4J1UB 4UB0H 1HIMH 4J12A 3KPQB 5TQ2H 1NCBL 3DHJA 4IS6A 2ZOKB 3UTSE 5MEQA 4PJGE 5EIQA 3ZDXF 2DRUA 3RWJB 4XWGL 1BF2A 1T5WA 3HNSH 5ICZB 1DQMH 1T6WA 1EEYB 4YHMH 3D39E 4JG1H 4G6JL 3GDBA 4OD3H 3ARFD 4LHUG 5HDBE 3IDUA 5E5MA 3LKPB 5GHWH 4TRPH 4MX7A 1HHHB 1AIFA 3W0WE 3OTTA 1WGOA 4TUJB 4GBXB 3QJHB 4BZ1H 4Y0GA 3LS5H 2DD8H 4N0YL 2LVCA 4YLQT 3W9DB 3CPLB 4QRSA 2GY5A 2E8ZA 1I8KB 5GRVL 5D1QB 5F89B 4OIIH 4YHYB 1EHLL 3NA9H 3BGMB 3GSXA 1LP9F 2AQ3A 4IMKA 2XZQH 4NC1E 2X1QA 3QXUA 4N5UA 3KPTA 4NDMA 2R4RL 4LSUL 5FF6A 3FQTB 3SKMA 3DIFA 3MA9H 3BQUA 1S7WB 4LKCB 3BJLA 4PJCF 2R0LH 4XVJH 1S9WA 2J6EL 3VFOA 4CW1B 1MRDH 4TULL 4YQXL 2MTPA 1PG7X 4FOMA 1VACB 2OK0L 4LSVH 2JTDA 1JWUA 2AJXL 2YKLH 2X7LA 3X13A 5DUPH 1EJOH 2ZUWA 3P77B 1X5ZA 1BF8A 3F6LA 5CEYA 3QG7H 2CDEB 3MRNA 1ZLWH 3RDTD 4L4TB 3KPNA 4WWKA 5D93B 5KVGH 1N64H 4WNQB 1YUHB 4MD4B 5FUOL 4ODSL 3TBYB 2IH3B 2P47B 1FNGA 2FYYA 1KN4L 4ODHL 5EDXA 4S1DD 5HI3D 3S96B 2CRMA 5ENWB 1AD9A 1LMKA 4XHQA 2AXGB 1ZXQA 3V6ZA 3B9KA 4NZTH 4MAYC 5E8NA 5FA3A 4NRXB 1MAJA 2AK4B 1NCBH 4J23A 3DURA 3UEZA 2H45A 1OSZA 2NTFA 3NCYS 4OBRA 2NY0C 3IFOA 4GH7B 5E9DD 2DL9A 3HE7D 2B4CL 4JN2B 2WP3T 4OFVA 5GQBA 4WGWB 5TE4L 4G9DB 4M00A 1CXKA 4XWGH 3MV8B 3L9RA 4G6JH 4LLDB 5I1AB 1K4DB 4BKLA 2PTUA 2I9TA 5DJ8B 3PWVB 1FP5A 4H8WH 3KG5A 3HLAA 4ZG1A 4ZODA 5IMKB 3MRCB 1N2RA 5DRXB 2Z4QB 3HCVB 4N0YH 2F54E 1Z5LB 1MJ8L 4M4PA 3D85B 5IJVB 1EHLH 4L5FH 2ZUSA 3IDGB 4MQXD 3EYFB 3I85A 2CLRB 2DQTL 5IEKA 2IAND 3KLSA 4WTWA 2R4RH 1QLEH 3K81A 4LSUH 2KPNA 1OF2B 1FIGL 2P7TA 5C0DB 5KANI 1EVTC 1YY8B 2DQEL 1X5KA 3QCTL 4L8BA 1C16A 2ZG1A 4A6YA 4RMSA 4LP4A 4NZJA 4Y5YB 3HMXA 2J6EH 4TULH 4DAGL 4YQXH 5I76A 1MWAL 2OK0H 1IEAA 1CDCA 2EE3A 2AJXH 2B5IB 1RJZB 4HC1L 1RJLA 1QO3A 3KXFE 3GMPB 4NQDB 2FX9L 2ZG3A 2CDGB 1C7TA 4P2CG 1KT2B 1LD9A 1NGXA 4RISL 4V2BA 4OT1L 2COQA 2OBGA 4ODSH 3UC0L 1B4RA 4AEIL 3FOLB 4ELME 1KN4H 5IROA 4FQQB 5CJ5A 4ODHH 4UQ3A 4FHBD 2R8SL 2VLKE 1RAMA 2ZUVA 2IAMB 4X0KA 1CLZL 2BVOA 4ZOAA 4PRDB 4ZTPL 3VWJA 4K7PY 5DMGD 3ARVA 4Y4FD 3JTSA 1ITBB 5CEXA 5E8OA 2CJUL 4CMHB 4M9PA 2DKMA 5E5RB 1HSAA 2B4CH 1A5FL 3IJHB 4DN3L 5DUBA 1GGIL 5TE4H 3TYGL 3VFSB 5IBTL 4D9RD 3CFCL 1MHCB 3TN0B 1WBYB 5F1IA 2VQTA 1NUGA 4F8TA 3RL1B 2AJ3A 4GT7A 4X5WA 1Q9WA 4HLJA 4X7DC 3ARGB 5TDNA 3MJ8B 4EJ1C 1UWEL 2R23A 4PREB 1T2JA 2Y5TB 4XTRD 1MJ8H 2D31B 1EHXA 1UWXK 5IV2A 1KBGL 3HMWL 2AXJA 3TJHD 2DQTH 3ARDB 2Q3AA 1BIIB 2D9QB 1XZ0A 2OL3L 2X44D 5E6IB 2VLRE 4R2GB 1QFPA 1FIGH 4MD0A 2DQEH 3QCTH 3G6DL 1HWGB 2A74A 3E6HB 4MJIE 5HI5C 1MJ7L 4G9FE 3RWHA 5JHDE 3U46B 3V6FB 4DAGH 5EUOB 1OAYL 4HZAA 4APQC 1JWMA 4MGXA 1BOGA 1MWAH 1QBLH 3WO4C 3SDAA 4U1GC 1MJJB 4HC1H 2OXGA 1I9EA 2BNRD 5MI0B 4L8SA 3ZMRA 2NY6D 2O93L 4PV8B 5ITFA 3T2QA 1A6PA 4XC1L 2FX9H 1FLRL 1JYNA 4YHNA 1AQDB 3QDGB 1RMFL 3G6AA 4OCWH 4RISH 3MNVA 3LVEA 4XGZB 5F9DC 4OT1H 4P3CL 3BJ91 5DJ6B 3GMNB 1FL6B 3UC0H 3ZKQD 4P46D 4AEIH 4FFZH 2R8SH 1QFWL 1CLZH 5GGVY 4P59L 4YXKL 2HJFA 4PRHD 4ZTPH 3STBA 1GZQA 4KJYA 4JY4B 1EEUA 5BXFB 3IGAA 4HK0A 1U93A 2Z8VC 4MNGB 4M93C 1KXTB 1IGFL 1UCBL 1IZJA 2CJUH 3BIKB 1QQDB 3L7EB 5L2JB 2AQ2A 1Y0LA 4YR6A 3MLXL 2IF7A 1A5FH 4G5ZL 3U6RA 3MV7A 3BFOA 4DN3H 5JHDA 2DKUA 2FSEB 1GGIH 3NIGE 3TYGH 5IBTH 3CIQA 3X3FL 1JZ7A 3LQZA 3CFCH 5CJOL 4NKDA 4WFED 4HUXA 5MEPA 2OTWA 4O5LL 1N59B 1ZLUH 3S35L 4H88L 5DJDA 5I6XB 2NZ9D 2H9GB 1BFOA 4BUHA 1UWEH 3OL2A 4YWGL 5HGHA 4UT7L 3OJDA 1BECA 3CLEL 5GS1B 4KI5F 3V0VA 3UTTD 2RFXA 4OZIE 3P9MA 1KBGH 3L3JB 5F93C 32C2B 2J6EA 4WRLA 2CKBB 3HMWH 1QEWA 2QEJA 3OKEB 3BUTA 4DTGL 3EJZD 1ZT1B 8CGTA 1JF6A 1QP1A 2OL3H 1LK2B 2ZSWB 3CFDB 5T3XD 2X4SA 1EPFA 4YBLB 3GSRA 4UU9A 1OAKL 3G6DH 3VD4A 4Y2DB 4GRLD 5TE6L 1OAYH 3RVWD 1F42A 4OTXH 2YPVL 2VAAA 4L4VA 3X3GL 3CMGA 1N8ZA 2J8HA 1KIQA 3VW3L 2VWEE 2YPLA 4P0DA 3U7AA 1FFNB 1DE4A 2GJZB 1FLRH 1GH7A 4I77H 4XC1H 4XRCB 5MEND 3X14A 1RMFH 2NZIA 1NAMB 5D7LD 3PL6B 4RX4D