2DWEA

Crystal structure of kcsa-fab-tba complex in rb+
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords ANTIBODY FAB HEAVY CHAIN
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel
pubmed doi rcsb
source organism Streptomyces lividans
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2006-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dweA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dweA02
2D0HA 5EU4B 3U1SL 5ADOL 2E27H 3DMMD 4P46C 4KUCF 1FYTD 2CSPA 2HWZH 5D2LF 4LKXB 1FNLA 3NFSL 2HT3D 5T1MB 1SY6L 3OR7B 1ZVYA 2P5WB 4X4XB 5HJ3A 4FFWC 3H7LA 4MDJB 3ZSSA 5A16B 5LVEA 5I76A 3T0EC 2UUDK 1WEJL 4PGBB 5ITBH 2UY6A 4H5SA 1B2WL 1EXUB 2P5WD 3CVHA 5MERA 2A1WH 1PZ5A 3JZ7A 43CAA 3ZZ1A 3CH8A 4XAWL 4OT1H 5JHLH 2E9IA 4QRPB 3M45A 2K9UA 4IMLA 4OLXH 1F3DH 1ZKAA 4KY1L 4Y2DD 4WI7A 4MD5B 1INQB 1D5ZA 1DLFL 1FRGL 5JUEH 4YHIA 1CZ8H 1MRCH 4KAQL 3VGEA 3FT2B 4ZS6C 5E8DH 5CJQH 5SWZE 4Z7WA 3BJ91 1VHPA 3IDJA 1RMFL 1YEDB 3ARBD 3QCTL 3R1GL 3HE7B 3MR9B 3THMH 3L7FB 3LV3B 5C2BL 3QUMA 1BMGA 5EZLB 1U8IB 5EU7C 2V2WA 1KXTB 4GAYA 4PJ8C 5C0GA 1YN7B 5KTEL 4G43A 4JPWL 4RMUA 3NBNA 2C4XA 1J87A 1S7QA 4DAGL 1BQHA 2APBA 4U0QB 3EDJA 1KCVH 5DJDA 4UU9B 4ZO8A 4LLWB 4HUMB 1EHAA 1N5AA 4XNYH 2XKUA 1JZ4A 1UC6A 2CRIA 3DX7A 4KI5D 4X80L 1JPTH 3RVTD 4U6VH 4OI8A 1IGCH 3PWUA 1N6UA 1YYMH 3SPVB 1SYVB 2BMKA 2NX5E 4WENB 1N4XL 3P4OA 5D7KE 5HI4D 2VR9A 1G7PA 1P69B 4L29A 4N0YL 4PTTA 1JRHH 1I1AB 2YPVH 1GAFL 4IRZH 3HC3L 1S7UB 3BPLB 4XT1C 2DQUH 1RHFA 1ITBB 3NIFF 2H3NA 2W07A 4FFVC 2A9MH 3U4BL 4CJ1A 1CGTA 5SX5H 4ZMAT 5DD5L 2HJKA 3SKMB 1I1AD 4PD4J 4BZ1H 3BP5A 2BHYA 4BZYA 4BFIA 3LS5H 1WZKA 4KQ4H 5GGTH 4YFEA 3NIDF 2FD6L 5D6CA 3QPXL 4NZJA 1BFVL 2VB5A 4KMTL 3HFMH 1FN4A 3HB3D 4LCWD 1CQYA 3MUGA 2VABB 4XBPA 1HIMH 1DEDA 4YHYC 5FEBA 1JNHA 2VH5L 2X4UB 4RMWA 3MGTA 5IMLA 4J2XA 1AD9A 2WLYA 2JJSC 2EE3A 5LGJA 5ID0B 1V7MH 3DUSB 4G9FE 4U2ZA 1OSPH 3NZHL 4QRQB 2QSVA 4RAUA 3FO1A 1F00I 4LIQL 1VPOH 2CRYA 4EDWH 2VMFA 4WI2A 1YNLH 5F93C 2VXVH 2GQHA 4UIMA 4MHHG 1KF9B 2W92A 4YX2H 4ZNEA 5FHBH 2R0KL 4KU1A 5E2WL 3UPCA 5D1XA 3PJSA 1MELA 1LK2A 3STZA 3NPSB 1FV1A 3WS6A 4QTHB 4CDGC 4R7NB 2QADC 3EFDL 1DANT 4U6XB 4KKNA 2DQCL 1OARL 3DGGB 5EOCJ 1RZFH 1D5XB 2CDGA 1EHLL 2XYCA 3QG7H 4YDLB 1FVCB 3GHBH 4P4KD 3NCBB 2K1MA 3ILPB 3VA6A 3GMPA 1BQHG 2GJ6E 3IJSB 4LNRA 1LHZA 4PLJD 3RGVC 1CBVL 3GMLA 3P4NB 3P0YL 2XKNA 4ORGA 2XTJB 1QA9B 3VJ6A 4L3AA 4NZTH 3FN3A 1FYTA 1U8HA 5JOPE 4RNRA 1DLHA 5DC4B 2NY3B 1KIUA 3HS0B 2IMNA 3NAAH 3O2DL 1NUGA 2XTJD 1N7ML 3BPNC 1FVDA 2A73A 2XOTA 4CVXA 1KJ3L 1UM4L 2DKUA 2C7UB 4JPIA 4FG6C 2PR4H 2FB4L 2FNBA 2HLFD 2VDPH 3NIFE 4J4PD 4KZDH 2C3GA 1YPZA 4HJGA 4N90E 5D1QD 1PSKL 2VIRA 1L7TL 2MKWA 3OB8A 3QQ9D 5JW4Q 5ESAA 1EAJA 2GCYB 1KTDB 2K7PA 1WT5A 4Y2DA 4JHZA 5E8PB 3WEXA 1TVHA 1AKJD 2X4OA 1IGYA 3Q5YA 4I0KA 4JFEA 3VXUE 3H0TA 4RGNC 3KHQA 3ARBA 2CLRA 4Y4KB 3CLFL 1OSZB 1B3JA 3SQBA 4KMLB 3OKNA 2BERA 3D48R 3UTTD 1FNAA 1NFIA 3Q5OA 2VAAA 3FB5B 3OG6B 4P49A 4POZC 1DBAL 5GRUH 3BYTA 1HHJA 1G7JA 3BX7C 5KS9A 4GRWH 1WBXB 4HV8A 4OCXL 2OZ4L 3LD8B 3BD5A 3PGDB 3Q0HA 3KYKH 2CPCA 3CD4A 3GEWB 3TNNB 3GGWA 5JOFB 3HAEB 2H45A 4OV6F 1MI5B 2X1XR 1JGDB 4OCSH 3T4AA 1CG9A 1KV3A 2PYFB 5FO7B 2Y07L 1DUYB 2BRQA 2BHZA 4S1SL 4B53A 4ZFFA 2H2SD 4YIQB 3T1WA 5J6GA 4PUBL 4PJHA 2Q87A 4JE4B 2VL5B 3WKMH 3ARXA 2DMKA 2GK2A 2R1XA 1OOAA 3LDBC 3SE9H 3HCVA 4JN2A 4QHKJ 4GXUN 1A21A 5BMFH 5T3ZH 2PYEE 4M48L 3LZFL 3V4VL 4PJDF 5AZEH 1FQ9C 1X5JA 3AREB 1T04B 4YXHH 4OZHF 1C5BL 1P5UA 5I19L 1PVHA 5E5MA 1GHFH 1J8HE 1M7IB 1I1FB 3ARED 3I85A 3I2CH 3DV4B 1HKLL 4JRYD 3T4YA 5C86A 5FXCH 1KG0B 5GGUA 4UDTB 3RAJH 5JQHC 1BM3L 4JVPA 4LCWA 3QFJB 2YPLB 2ZJSH 5EZJA 5J6HB 2DQIH 4PGCA 4PJEB 3FHAA 4JFQA 5KG9A 1T6WA 1FORH 4Y4FB 5AWNH 4HXBL 3P4MB 2BY2A 4OSUL 3UTSA 5CZKA 3SKOB 1CXEA 5DS8B 2M1KA 4PGZA 1SYSA 2WBJA 3MMEB 5KW9L 1D9KC 2AERT 4FQIH 4DCQA 4H25A 1XCQB 1JZ2A 1BBDH 5KVDH 4AH2A 4S2SB 2HVJA 4DOHE 3MCKB 2BNRB 4OGXH 1FCGA 4FFYH 4O2FB 3FQXA 1GYAA 4PV8A 3B6SB 3PDOB 2IC2A 3BPCB 3IAPA 4JREC 1BVKA 3FMGH 2OK0L 4GBXC 1FNFA 4EOWH 3MXWH 5F88A 2CH8A 2EDNA 4MJIB 4K9EH 4AIOA 1R3HA 4P4KA 2VXUL 1MREH 4KPHL 4WTXA 4F9PC 2EIDA 3RWGB 5GRXG 4IHOB 4AJ0A 4F7MA 5GS0D 1I7ZB 1G9MC 1Z9MA 3HI1B 4YGVB 4P23C 1AGCB 1H15B 4XPTH 3JWOC 4P5MB 1XF5A 3EYSH 4YHPB 1JNJA 1H0DA 1N59B 5C08B 5TE6L 1JI2A 4Z7UA 3U4AA 1F4XH 3B3IB 5DJZB 4KK6C 1A7RH 3QBTB 3MOBH 5I1EL 3M17A 3IXAA 5FHAL 5C08D 2X9XA 5GRWA 3K4DA 3BSZL 1HHGA 5DJ6A 2C3XA 4PJDE 1I7RA 4R4FL 4OZHE 5EWIL 4JKWA 5HDBF 4NUGL 5D1QA 5LWYL 1NSNH 1KCSH 3V0VB 5FUCC 2IH1B 5ERWA 3OXRA 4M7JH 4J3SA 3G5XB 5GS0L 3EFFA 4WDIA 1UXSB 3PGFH 4FQXD 1BOYA 4WJ5A 4ZFGL 4EUPH 3GSQA 3ZE2E 2VDOL 1OF2A 2FECL 4C83B 4RQQB 3SDXE 4Y2OA 3R06A 4IOIB 4LAQL 4LFHD 5C7XH 1MCWM 3QRFM 5I6XB 1CFNB 2X4RB 3BUTA 1YMMB 2N1KA 5DEGA 5TQ0H 2OJEB 1TJIL 2G5RA 1MHPL 3GO1H 2IPKA 4L8DB 5GGRA 1OGTA 4XCYA 4FQJL 2W9DL 3O6FD 4Q6IC 4JFFD 3ARDB 2H8PA 2R0ZL 2DQTH 4LVNC 3DO7B 2F54E 3CMGA 2HVKA 2NXYD 4HPYH 5IW6A 2OI9B 4JDZA 4QXGH 4F58L 4PBVC 4XHJC 4O00A 4R26H 5D6DC 1Q94B 5DD6A 1CDYA 3HC4H 5D7LB 5C3LD 1CD1B 4JANA 1UKSA 1T3FB 3VH8A 3CFDA 3FQUA 2EZ0C 3WL9A 1W2KT 5GSRA 5HHMB 2YPKA 1G0DA 4NFDA 2JCCF 5DRZB 1YEGL 2DLHA 2M2DA 4B5EA 3SDDC 4XTRC 2NZIA 2NR6D 2L4OA 3IDGB 3PV7A 4PJXA 5FV1L 3RWEB 4ENED 3EYOA 3BUYB 3MLXL 1L9NA 2EH7H 3LMJH 4HMDA 4PRID 3CDCA 2BOBB 5E70A 5AZ2H 5JHDD 1T5WA 4PJAE 5C1MB 1AC0A 3CDGB 3HUJA 2V7NA 5D72L 1I3RA 2DQDL 2IADB 5FGBA 1DEEA 1DSFH 1KB5B 4XXDA 2IBBA 4KI1A 5H35A 1F3RB 5IB1B 3T0DA 4QHLA 4Z0XB 5JXED 4CUCA 3C8DA 4JRYA 5K9KB 5IQ7H 1CWVA 4AL8H 5F97E 3EO0A 2D03L 5E99H 2FH8A 3EOTL 5IP4A 5HDBE 4XMPH 1Z3GH 3RU8L 1I1RA 4O51B 5KANI 3QG6A 2R69H 4IIQC 3UZEA 3T77B 1IAMA 1IBGH 3WLBB 1KACB 1AFVH 1KEGH 1ZA3B 1F6AB 1MRDL 1TENA 1JFQL 3MO1A 4WFHD 1JF1A 2OQJB 4Y89A 5CHNA 2HFFB 4K2UL 4PRAA 4YEEA 1GZQA 4FQ1L 5DURB 3UP1A 2YA1A 2V2XB 3FZUC 3QEUA 4LRNH 3QULB 3DX6B 1CFSB 1G7IB 2D0GA 1QSFB 2VDRL 5H8DA 1ZT1A 3BHBB 2RFXA 2Z8WC 4U7SA 3QDGE 5DURD 1KXQE 3W11C 1JPFB 5B3NA 3V6BR 2VERN 2R2BB 1NCAH 4P9HL 4MX7B 2H32A 5F7EL 1JPSH 3IXTA 1S78C 3S5LB 3QI9B 5KAQG 1KIPA 3VH8G 3P9LA 2Q8AH 3RWIB 3TIDA 2JCCE 5DD1H 2HJFB 1CDCA 4PJGB 3NN8A 4MS8C 1DUZB 3MUHL 1G6RL 4RGMC 1T7WA 1CE6A 1IC1A 3GBLA 3HAEG 4X6CB 1J86A 4GMTH 3RZCB 5J1AB 3HPLB 3P4LA 5J1TC 4D9LH 1G9MH 4G8EA 2QHRL 1T0NA 1XGUA 4MXWL 2Q1EA 3RVXD 5CLTA 1F2QA 1HINL 2IALA 4K3DL 3KPSB 5GRVK 3JWOH 1KFAL 5F8QC 3PWNB 2NTFA 1HSBA 4S1RH 4LQFH 3DV6B 5K59E 3W9EB 4F37F 1JWMA 4FTVE 4EZMA 1LNUA 4FQXA 1R6VA 1W72H 2EDKA 2PO6B 2LU3A 1MRFL 2J88H 2W65A 5MEPA 2ED8A 2JELH 5IVXA 1WCBA 3IT8D 4QTIH 4P3WA 1ED3A 1CK0L 4M61A 2PO6D 4OCRL 1GGYA 4OLYH 2FWOA 3SHSA 4TRPH 4NDMB 5IMMB 4GKZA 4CU6A 1RK0A 3FRUB 3MRDB 5D7SL 3O6FA 3BPOB 4ETYA 2DL2A 4JFFA 3WJLC 4AMKL 3U4EA 1HXMA 5F9WC 4K94L 3CFKB 4ZTPL 1F3DJ 4CMMB 1OAZH 1MIEL 1QKZL 4PRPB 4M4RA 5FYJD 2I5YL 1XGYH 1IT9H 2DKSA 3G5ZA 3L3KB 3TESA 1RK1A 2CGRH 4PBXA 5I75C 1CDJA 4K3EL 3QDJE 4MWFB 2NW3A 4PRPD 3KLAA 1KYOJ 1GJIA 5E2JA 5JDSB 1H8SA 3GMMB 1S7VB 2HLAB 4HS6A 4FQHB 5KOVC 1MCQA 4PJ9B 3C8KA 2DQJL 1JNLL 4FP8H 4PRHB 2F53E 4HKBA 3C2AH 3VGAB 2AS5M 4GQ9L 4PRIA 4S1DD 4P5TA 2HKHH 5JHDA 5ITFB 2XICA 5TGBB 2PKDA 2WW8A 5FYJL 1QQDA 4IM8A 5F1IB 5JO5A 2I9LA 3U48A 1VFBB 1MLBB 5EORL 1RZIA 2AV1A 2HG5A 2YMXH 3AS2A 4NC0B 1ZLUH 1DL7H 4GRWF 5DD0L 1MY7A 4EXPX 3RVWC 1T83A 2A6IA 1L7IH 3TBYB 3CSBA 2AI0L 1T6VN 4NKMB 4DW2L 1A6UH 2P8MB 5I2IA 5C0AE 1HQRA 2VXQH 2APTA 2VOTA 4QT5B 1PG7X 1F4WL 1FZMA 3VXSB 3VE0A 1M05B 1V8HA 4F33B 3RQ3A 4O02L 1MSPA 1XEDA 4A6YB 1P53A 3JTSB 3A67H 1AI1H 2A9NH 2DOCA 1LE5B 1NAMA 1MCRA 1G6RA 4WUUB 1GGCH 1TJHH 5CD3B 5EZIL 1VDGA 4QF1B 4XP1L 2GFBB 2IGFL 1X5ZA 2MPAH 5KVEH 3ZHKA 1QSED 3C87A 1G1CA 3Q3GB 2MCPL 4DEPC 5L9DH 5K9OB 5I74C 3QCVL 3UAJD 1QNZH 1T5XB 1UB5A 3UXFA 4EVNA 1OM3H 4UILH 1DCLA 1S3KL 1UJ3B 2RR3A 3BGMA 4WO4B 5EOTA 3WN5C 2IWGA 3DRQA 3F7YB 1ZA6B 1JJUA 5I8OL 1EFXB 3J8F7 3RPIB 2XQBH 1IGMH 1IEAA 4NN5C 1MPAL 1SBBA 2J3SA 3IETA 3NH7L 4PLNC 4XPFL 3MBXL 32C2B 1ZLWH 4JQVC 3VFVB 4D2NA 3IGAA 3LH2H 4A6YL 1EFXD 1OGAB 5IJKA 3TF7C 1WK0A 4I18A 2B0SH 4NP4L 5IBTL 1XH3B 3HZYA 2F19L 4TPRL 3BRGC 4NRYA 3VXOA 5GZOD 2AXFB 3EDDA 4U3HA 5HSFA 1HHIB 2D7TH 5EBGA 1JF5A 4X98B 4DKDC 1J1PH 2DQHH 5ESVB 3RVVD 1AR1D 1O7VA 1CL7I 4M1DL 5C09A 1NGQH 2DL9A 1ADQH 4X4ZA 4OIBA 2V5RA 4MGXA 4ESKA 1MCEA 4JGMA 5C8JA 1GZPA 3WHXB 3BRDA 1TETH 1CXKA 4XCFH 1WTLA 3CFBA 3JV6B 4M43H 5H94A 1U8QA 1KJ2B 4JG1H 5F71A 3SOBH 3AB0B 1ACYH 2R9HD 4OBRA 5DJAB 1Q9OA 2FX7L 5DT1L 3ZE1F 4IBLT 5C0BD 1JWUA 4PJ7E 2OL3A 3ZKMD 3ZL4L 3LKNB 1FG2B 2GSIA 4O9HL 5TDPB 5C2UB 3L5XL 3C5ZA 1ZGLB 2AK1L 2FRGP 3ETBF 5IFAH 4X9HA 1JV5A 4OM0L 3TIEA 1TNMA 1H5BA 4POUB 4DQOL 3TZVD 2E9JA 4HWEH 3SO3C 3T2PA 1A2YA 4G8IB 3V5DA 4BELD 5E2VL 2IAMC 3PWJA 2BDNL 5C07D 2P5EB 5T5FH 3QWOA 3SGDH 2ICWA 1E27A 3HNTH 5E08H 4KKCD 3B8YA 1KJ2L 1MAML 4JO2L 2CMRH 4MQ7B 4X9GA 1D5IH 3OX8A 3L1OL 4G80B 1NBVH 5E2TH 3RI5K 4LKCB 4MVBC 4PV9B 2CDFA 3VFMB 1N5YH 1VGEL 4XX1G 3CVHB 4EIZC 4KZEH 4ZUUB 1HH6B 1PZ5B 2HT4D 4JAMA 5GPRA 2DLFH 1JI1A 4QRPE 4OFYD 3PIQA 4EKXA 5D9SB 3IFOB 3ARFC 4X4YB 1S9YB 4IMLB 2HFGH 1F8TL 2UV3A 4JFDD 3F5WB 3EO9L 4D9QD 4CJ0A 3DXAB 4U1HA 5IESL 4PP2A 3EYFA 4PJ5B 3BH8B 5GJTH 3SKUD 1UWEH 2R1YA 3U2SB 5ALCL 3X13B 4UBDD 1KCRH 1CLYL 4JRXB 5CEZH 1QLEH 2BJMH 1CGVA 3O8XC 4PJ5D 4C58B 4WW2A 3SGKC 1FL5B 4XWOC 2AK4A 3X11A 3DVFA 3FOLA 2E7CA 1HZHL 1I9EA 4M5ZH 3QUZA 4JM2C 3FOMA 2AJSH 4P3DA 4N9GB 1QSEA 4M6ML 1MFNA 4YDVB 4FQ2L 4X5XB 2VZ3A 3BDBA 3QZWA 4LSQH 3AMLA 2FCBA 1SVCP 4KKLD 4ONGL 1T7VA 4M7KL 5SWQA 5F3BB 3FQNB 4L8SC 5I1HL 1OCWL 4LIQE 3LEVH 1X44A 1C12B 1DN0A 4OZFA 1OAXH 5DZNA 4M6AA 4H1LG 3TPUA 1TVBB 2VDML 3QNYB 2AEIT 15C8H 4QO1A 4YC2C 2A6KA 3L95A 5F89B 5EULV 4J3WA 5EC2B 1P4LA 5TFSL 1RJZA 3NGBC 2O5ZH 3BZEB 5IMOB 3BP5B 2I27N 5EU6D 3C5JA 4JY5L 3EOBB 4F3FB 4GS7C 4QHKI 1I8KA 1S9VA 1Q1JL 2NY1B 5EOQL 1T7ZA 4C56B 4AEIH 4IRSD 1FN4B 4GH7B 2WQ8A 3VGBA 3UJJH 3LCYA 5CEXB 2JIXB 4J7RA 1U8LA 4GG6A 4DKFL 1H3XA 3MRGA 2KH2B 3MGTB 4YQXH 1CLZL 1YECL 3MLYL 4RAHA 3CFEA 5LCVH 1A22B 1JGVL 5T1KB 3DHMA 4YHLH 1MWAA 1XGRB 4ODVL 4PYGA 4BYHA 4W4NA 4KTEH 3V5KB 3FO1B 4RFNC 3LKPA 4QCIB 5I1DB 3UBXB 1QLRA 5I73C 1LQSR 3QEQB 5T1KD 2EO9A 3I3DA 2FJHA 2XV6B 5C0BA 4E9LA 2DB8A 3KPNB 1RZKL 3VRIA 1MCBA 5E1HB 5ANMB 5C0CA 1LP9F 3CFIC 3QDAA 5E4EC 5FCSH 3STZB 3TT1H 4NWTH 4XPGL 5CWSA 5CIPA 12E8L 3MV7B 3OKKA 1QFPA 1FNHA 1NCBH 1MEXL 3ZDYF 5D2NA 2PW2B 3TZVA 3X14B 5FOBB 1T0MA 5A3IC 4K7PH 2BY3A 4F15B 3H3PH 2WZPD 1NDMA 1QG3A 2V7HB 5C07A 2BOCB 5D71H 1FLRL 3NPZB 4DZBA 3IF1B 2G75B 2EDRA 3QZWG 5D70L 1S7SA 3HI5L 1TNNA 3ZKXB 2DDQL 4AQOA 1R24A 2N7AA 5E6YA 3WUWA 4X6DB 3BEWA 5BV7H 5KVFH 1QR4A 3VXMA 4PJEF 1ZHNB 3O11B 2EYSB 4OZFG 5IHZA 5MENB 4L8CA 1FO0A 3WD5H 1T2QL 4G6AC 5E9DB 3TO2A 1RUAL 2J8OA 3VA2C 4HX1B 5J12B 3GI9L 4O2EB 3B9VA 2O93L 1FNSH 3OXSB 1U2CA 5EG6C 3GMNB 1EJOH 4YR6A 1AHWA 4JFDA 4Z0BH 4AIXA 1BOGA 1V05A 1C16A 3U36A 3EDEA 1NGYA 3T0AA 1CFQA 1V7NH 4ERSH 1J1OH 3Q2CA 4P4RB 5JW3H 5I1AB 4R96A 3ARVA 5HGGS 3BGFC 2BCKB 4DZ8B 2IEPA 2NY5L 3QFDA 4QGYA 4W6WB 1CLOL 1KN2L 2VAAB 3K80A 4HK0A 4JM4L 3IJYA 3MA9L 5DJ8A 2ADJA 5D1XC 1MI5E 4FZEH 2YD7A 1Y6NR 3WS6C 3VRLF 1FC1A 5CJXA 1YEKH 5IVNA 4YUEH 4GKSA 4J8RB 4M1CC 4WV1A 5J9PA 4KJWC 5FYKL 1TPXC 1TLKA 4JRWA 4MD4A 4OKVA 4OTXH 4Z6AT 1KJVA 1EZVX 1CFTA 1NQBA 2ESVB 4Y4HD 5E56A 1PJ9A 3HMXL 3S3JA 5LQBL 5JXAL 4I3RL 2D2OA 4HUXB 3ZDYE 1FL6B 1MFDL 4RISH 3RL1B 4YFLF 1AGDB 3WS3B 1IAOA 4JN2B 1PGRB 1ZT7A 4R3SA 3DMMC 2YRLA 1I8LC 3TV3L 1C08A 2HT3C 4QRTA 4PJCA 2PXYB 5HYJB 4NBXB 5HPOA 1BLNA 2VO5A 1KLUA 1ZVSA 2BNQB 4HIEB 2RAMA 5EU6A 4NT6B 2B2XH 5BS0D 1A5FL 1R5VB 1IMHC 1PY9A 4HHAA 2VRAA 3NIGF 3QFJE 2YPLE 2I60H 1YYLH 4PJEE 5KN5A 4Y16B 2D3VA 4IRSA 3VWJD 2FBJL 3WUWG 3OAYH 3DLQR 3VFNA 2AGJL 3B5GA 4OUUA 5EZJB 2DYPB 5HYEA 1WT5C 5DRXB 4GG8A 4Y2DC 5FF6A 2MQ0A 1T1XB 4XVTH 5DF0A 5HGHB 4OJFH 1P2CA 1UFUA 3V4UH 4HAFA 1BBJB 1QFWM 2OSLA 2V2TA 1RIHH 5DK2A 4Q7DA 3E3QE 3BDYL 2WBJB 2F8OA 5HHQA 1R3JB 4LSRH 3ARBC 1U92B 1ZEAL 2QSQA 2BNRE 2XA8L 2IBZX 2BRRH 3OGOE 5F1NB 3Q6GL 3OHXB 4FZ8H 4H20L 5HDQL 3D0LA 4D0DB 2ZKHH 1FIGH 1RUPL 5GRVL 4IJ3B 3CLEH 2GSGA 4FQQA 3IDNA 5I1IH 2E6PA 4RBPH 1UACL 1EO8H 4JJ5A 4JPVH 1JTTA 4X8JB 2PETA 5C0FA 3BYYA 3KYOA 3WMSA 3ULSB 4MJIE 4ODWA 3DYOA 3P30H 5IEHA 3LQAL 3O3AA 3WXVH 2LVCA 1AY1L 4KI5C 4OF3A 4UQ3A 1J1XL 3RVTC 4GKNB 3VRLE 4KHTL 1WWBX 4ODXB 3CDYA 3TCXA 3IYLW 1KGCD 4CAGA 4ZXBB 5F1OB 5HYQA 3K8LA 5HI4C 1VGKA 3SKJL 4OLUL 1PAMA 3GUTA 3MUJA 1MCFA 3M1BA 2J6EA 5C6TL 4LARL 3S35L 4MCYA 5DD3L 7FABL 2R1WA 5DHVA 4TYUA 4LDLB 4M00A 5DXWA 3VRJB 5DZLA 3DSNA 3VXQA 1I1AC 3X3GL 3W5MA 5CUSL 3BESR 3NVQA 4HUVA 5D1ZB 4UB0H 1OL0A 1U58B 1NUDA 2UY7A 4ODTH 2JB5H 5TH2B 3MRKA 1GVIA 3MGAA 3VFGH 4MXVE 5ERWB 2P8LA 2X6MA 3HB3C 5BVPL 4OZGA 1RAMA 1QFWI 3OB0H 4MA8H 2NCMA 4Y8DC 1OF2B 1YMME 1A6TB 3DTXA 2EYTB 3KNBB 5JPMB 1B90A 4FXKA 4OGYH 1S7XB 1C7TA 2W0FA 4RMTA 1R3KA 1UM5H 3HHRB 1OGTB 5K33A 1FJ1B 4E5XB 1CXFA 1XF2B 2R4SH 4X6FB 5CSZA 4FFZL 2AVGA 4WWKD 1MCIA 1QPPA 1WITA 4LOUD 3NA9L 5I1KL 1I85A 2O61A 4MJ6A 5D7LE 4OQTH 3ARYA 1JGUL 1C5DA 2RCSL 5DQJB 5HHME 2MFNA 2DD8L 1B4JH 1UEYA 3FQUB 5T1LD 3WL9B 3WFHB 4Y5VA 3U1SH 2AXJA 1VKXB 4XP9L 4P4KC 3UZVB 4Y4HA 5IB3B 1LEIA 3NFSH 3VI4F 3P73A 4PLJC 4MJ4A 4PD4K 1GPOL 2K7QA 1KBGL 4ZUVA 1WEJH 2E7MA 4M8QB 1B2WH 5FYLE 5IMKA 5IKCA 4HS8H 2LAGB 3G6JB 4CMHB 3LOWA 3KPLA 2XTJC 3QXAA 3D39D 1HNFA 3SCMD 2FBOJ 4XAWH 3QWRD 1TITA 2ZUVA 1LO4L 2KQMA 2XN9B 1RY7B 2Z31A 3DUUA 5LAXB 4K71B 5EBLB 4DVRL 1E4XI 3RY4A 4QHLB 5BS0A 2DMBA 3BP6B 4KY1H 1FSKB 4UTAL 2HYMA 4QLRA 5JPNA 2HLFC 1EFQA 4J4PC 4QOKD 1DLFH 1FRGH 5D1QC 2ZUQB 1ETZA 1XGTA 3VWJA 3MRMB 4KAQH 4BH8B 2WBKA 1XR8A 4LDEB 4RCAA 3TBSA 1PYWB 3DURA 3UJTL 3QXUA 5ETUA 1RMFH 2EE6A 3QCTH 3R1GH 1PEWA 1W0VA 3KPPB 3HR5A 5C2BH 2FR4B 1U6AL 3RNQA 4P57A 3MRNB 1F58L 4MNQE 1I3UA 3DARA 4K3HA 5KTEH 4JPWH 1CGSH 4BK5A 4DAGH 1P5VA 2AKRA 2OTUB 4MDIA 1MNUL 3H42L 4UDUB 3TPKA 3LKSA 3AVEA 5B39B 2H26B 3IU3A 2ZPKL 4X80H 3FO2B 5TQ2L 1AD0B 3P0GB 1QSFE 4M7LL 4MB3A 4P2QB 1NGWA 1JZ3A 1F97A 1JNNL 4KQ3L 2IF7A 3INUH 4NQCB 2H41A 1FC2D 4D9RD 3LN4A 2GEEA 5C0ND 1QTYT 1N4XH 4YPGA 4XVJL 5CGMA 4HS3B 1RJLB 1U8PA 4N0YH 4U1KB 5E94B 1KJMA 2Y5EA 1FH5L 2H32B 1GAFH 3O4OC 2H2SC 3HC3H 4GMSL 4UIKH 2D7MA 2EKSB 4JZOA 3DI2B 2IPTL 1JK8B 3U4BH 3W0WD 3P9LB 2DLTA 2W9LA 1CDBA 5DD5H 4ELKB 3EHBD 3SBWC 1G6VK 2RIKA 1HN1A 4WEBL 1CFVL 3GM0A 2VLLB 1V3MA 3QPXH 3MV9B 1BFVH 3ELAT 1DBML 2V6HA 4KMTH 4I2XA 3KPSE 5FGBC 4WHTA 1NFDA 2LQRA 1IQWL 1KCUL 5IIEB 3G5VA 4KVNL 4LMQE 5SX4I 3ZHLA 3BKYH 2VH5H 1BHGA 3L9RB 1Q9LA 2OMBA 5HHVL 3JXAA 3TO4D 1LNUB 3MACL 3ZE0F 4MNGA 3RVUD 4HZLB 1J0YA 3NZHH 2XFXA 3ALXA 2DICA 4LIQH 3QISA 4GFTB 1WCBB 3WFDL 4NJ9L 4HKJA 3FFCD 5IHUL 1AGBA 1D5MA 1UH2A 1JF6A 1T20A 5E2WH 3D18A 5IT2L 4U1MA 2EEDA 1J5OL 3TNMA 1FFOA 1WZLA 3EFDH 4IS6A 4WCYH 5DMGC 3GI8L 2DQCH 4G6FD 4JGUA 1OARH 4YBLB 4WWKA 1SJEA 1BFOB 4ZYKA 1EHLH 4H0HB 3DVGB 4C54A 3NOIA 4LLUA 2R23B 3U9UA 4MA3A 3MRRA 3UPRA 2BSRA 1YMHA 1HDMA 5ENWB 3MRJB 1A7PL 5FM5O 4KVCL 4J12A 2O5YL 3VFPB 1CBVH 1QD0A 3P0YH 2VITB 5T1LA 1L0XA 2NW3B 5F7NC 4BSVA 1WUNT 5DHYB 5FA4B 3V6OE 4U05A 3VG9B 2FATL 4PRHE 2YKLL 3L7EA 3O2DH 2Q76A 4LPWA 2BVPB 1N7MH 2P49B 3ZT7A 3NCEB 4JKPH 5IW1A 4GAJL 3DYPA 4XPBL 4P5TB 1KJ3H 2JKXA 1UM4H 5F1SA 1JPGB 5MI0B 3LRSA 1F3JA 1MCLA 2FB4H 3VXPA 2Y23A 1P4BL 2J8UA 3D39A 1MFBL 3SCMA 1K3ZA 1PSKH 4EBQL 3C6LB 4AT6A 1L7TH 2EC9U 2ZUXA 4Q9CA 2FL5B 2VKXA 2XZZA 3EDKA 3QDMD 5I1JL 3BO8A 4BSJA 2A6IB 5FB8B 3VGFA 3SQOL 4GO6B 2ZUYA 5LBSL 1OT1A 4PY8J 3VXSE 4FQXC 2X4PA 5AUMA 4HGWA 3SJVB 3KPRA 1NFKA 1P7QD 2BNUB 3CLFH 4OM1L 3EO1A 1RZGB 1LD9A 3NABL 5IR1B 2YD1A 5E6ID 4RIRA 3ZE0E 5J7CC 2QR0A 5KSBA 3SJVD 2CIIB 1UA6L 1DBAH 3BIKB 2E7LA 2P4AB 2OZ4H 3O6FC 1FFNB 4WUUE 3I6LD 4E42B 3O3DB 3KPQA 4Q9RL 1K2DB 5EFIA 1AC6A 5DYOB 5I1LB 1V3JA 4XCNB 2NXYC 2ICEA 1QBML 1CT8A 1B0RB 1TZGL 1XF3B 3IFLL 3FFDB 2Y07H 4S1SH 4DK6A 3CFJB 4BQCA 3GNML 4PUBH 3O45B 2OI9C 3RY6A 4W81A 4Y1AE 4E41B 3HE6D 3IDYB 2GTZA 4X6EA 3W39A 1ORSB 3BGMB 4B50A 1Z9SA 2LE9A 4XP5L 4AIZA 5HBBA 5K9JL 2ZCHL 4M48H 3LZFH 2DQFB 3FONA 3JV4B 3V4VH 2XQYK 4OCNC 3ECBB 2NR6C 4D8PB 4E41D 4XZUB 1C5BH 4ENEC 3W0WA 5FO8B 5I19H 1NANH 3LAFA 1IEAB 4JVWA 4G3YL 2GK0A 3GSNB 3VFRB 1OGAE 5D5MB 3FQWB 3O9WB 1FZOB 2VZOA 4PB0L 3SY0B 1TCMA 2AJ3A 4F2MB 2R0WL 3KAAA 1HKLH 4MCZA 5IF0A 1T22A 4JHAL 3HAEH 1MJ8L 4YLQT 1OTSD 1I7UB 2ERJC 1BM3H 2EXWD 4MAYA 3VXOB 5ACLA 5BVJA 5GGTA 3VWKB 2V9QA 4LLDA 4ODUB 2BVEA 3C09C 4YHKL 4HXBH 2CUHA 3CU7A 2X4QB 2EH8L 4OSUH 4Z7WF 5HHOD 5FUZL 4FXGB 4JHBA 5C09B 3WFBL 1ND0A 4P2OA 3SE8L 3BN3B 3TO4A 2Y7QA 1T1WA 1J0JA 5KW9H 2NY6B 1OY3B 5CEYA 4NM8L 5LXGL 3UYOD 3KXFB 4HD9A 5GIRA 4N1EA 1NLBL 3FFCA 3VFWA 1NJ9A 1JZ5A 1CF8L 4P9HC 1BZ9A 2BC4A 4YDKL 4UUJA 3QUXA 1N0XL 4JZNB 4HGMA 2OK0H 1A7NL 2VZTA 4LCCA 2YD9A 3B9KB 4Y5XA 3MFFB 1JWUB 1F5WA 2IMMA 1OWWA 1JZ8A 3U0PA 5F7YC 3C5ZB 4LU5L 1Q8MA 4PJBB 5FAAA 2VXUH 4KPHH 5L2KB 1BFSA 1U3HD 3TIEB 3B9KD 3L3JA 3D3VA 2N4IA 4NNPL 4PBWD 2P7TA 3G08A 2OTWA 3VMOA 3UTQA 4Q2ZB 2FJGA 3ROOB 2VQUA 4QRRB 2R29L 3VW3L 4XH2B 3NCCB 4RMSA 3QYCA 2P5EE 3V5DB 1HQ4B 3VXRD 3KPOA 4DKAA 3AU1A 2EDXA 3IKCA 1DN2A 1H3PL 2C1PB 4DUVA 5I66A 5D96C 5I1EH 3QWOB 2WIIA 3CH1B 5BJTB 3EOAA 5FHAH 5I0DA 5DTFB 6FABL 4NO3B 2ITCB 3BSZH 3D25B 3DBXA 3TBWB 4NSKB 3DVNA 4R4FH 5F6IB 5EWIH 3ULUF 5FUOL 4NUGH 2PCPA 5LWYH 1G9NL 3N1MC 4QHUB 4ZSOA 3RWCA 4I0PD 4M4PA 3VMPA 5IQ9A 1EEQA 5GS0H 4V2BA 3RVXC 4U1SB 1QEWA 3PQYD 3QDMA 4P46A 3EJJX 4ELMA 2VDOH 3MA7B 4K94C 3HLAB 4LAQH 1OAUH 2VLME 5IGXL 1GOGA 1J05A 1TJIH 3DXAE 3GMQB 1MHPH 5ICXB 3TJHD 4LSDA 3WNPA 1P7QA 3F7RA 4PJ5E 2FYYA 4Z5RB 4LEOA 5SWSD 1UXWB 4FQJH 2W9DH 4U6HB 3WJJC 5E6IA 1JZ7A 2R0ZH 2Q6WA 4PP2B 3S7GA 4QHNA 3EYFB 2NXZC 2XXCB 4L9LA 4JRXE 3FQTA 4P2RB 1ZLSH 4IOFC 3RJQB 4F58H 3BWAB 3T8XA 1CE1L 2ICES 4HG4J 3BEVB 1HYRC 1N6QL 1Z9OA 2B7DT 4DGVL 2UWEB 2LTQC 1VACB 3X11B 1HOCB 5LG1A 1X5GA 1NBZB 1O5DT 3ILQD 2UZXB 3CCHA 4X5WA 2DWEB 1YEGH 3PP3H 5EU5A 4FABL 3L5HA 1JHLL 4U1NB 1NL0L 1H5BC 3TC9A 1AIFB 1UT9A 4X4ME 4MNHB 1KPVA 1NMCC 3MLXH 1SEBA 5ID1B 2VDLL 3QP3A 5FKAA 1DDHB 4BUHA 5SWQB 4X6DF 4Y19A 2APVA 4HIIB 5E8OA 1HCFX 2X1QA 3Q48A 1VA9A 5D72H 2DQDH 3TN0B 1HSAB 3ES6B 4GXVL 1U3YA 3IDIA 3NCFB 3WO4B 5EUKB 4S1DC 1YPZF 4NC1C 1U8KA 5GS1A 4APQB 4I5BB 3KHOA 1P7KB 3WHE1 4UOJA 1KT2A 2FX8L 4U1JA 1F4YL 4R2GB 3VGAC 4PP1D 1DBKL 5FA3A 4RGOL 5DJ2A 4NZDA 2VR5A 2R15A 2D03H 3FJTA 4JFXA 4C56E 3EOTH 3T1FA 3ULUE 3RU8H 2GI7A 2BSTA 3QIBB 2PW1B 5HHOA 1IEBB 1MJJB 1TZHB 1ORQB 1EEZB 5J3HD 4JDVA 1MRDH 2CLZB 2NZ9D 1JFQH 2OXHA 2OCFD 3GSOB 5DEFB 5TDNA 4N5ED 3PNWB 4EIGB 3U6RA 2A6JB 3BQUA 3MRCA 3QEQE 4K2UH 4M6NL 1IVLA 3PGCB 1UGNA 3PABA 4FQ1H 1FDLL 1MCCA 3GMOB 5ANME 1NCDL 2FJHB 4Z78A 2FIKB 1KYOK 2NY0D 4CN6A 4Q9BA 1WLHA 4WW2C 5C0CB 2VDRH 2Z35B 3MV7E 2RB8A 3T3PF 1F13A 1U3HA 2VDQL 2GIYA 1S7TA 3VFUA 4P9HH 3K8MA 3NACL 2CXGA 4IRJD 5D7JB 1UQSA 4DN3L 4LHUB 5F7EH 3QUZC 1C1EL 2QJDA 2EDYA 4GSDL 1ZANL 4TUOB 3UAJC 5B8CB 2BSSB 2ADIA 3MYZA 1EBPA 5D7JD 3VXRA 2GJJA 2VDKL 4HFWA 4X7DC 5SWZD 1G6RH 3VFTA 1ZV5A 4ZO9A 5EO1A 3ZYZA 2KZWA 4DZBB 1RUQL 4JB9L 3JUZA 4QRSB 4X6DE 4MXWH 4ZFZB 1OTTD 3U46A 1HINH 2IJ0C 4K3DH 1KFAH 2ZG3A 5MENE 2Z92B 2PTTB 2D7QA 3VXMB 5DRNA 3DJ9A 3N9GL 3VD7A 4I0PA 4YZFF 4NQEA 5E9DE 1A9EA 1YPZE 3QQ4B 3N85L 4M9PA 4N0FB 1FO0B 2Q7NA 5GZOC 2M26A 3BH9A 4AK1A 3QIUD 1RU9L 3PQYA 4PR5A 5FYKE 1F11A 1MRFH 3BN9D 3LS4L 3QQ3B 4OAWA 1CL7L 1NDGB 1XCTB 5IEKA 3RVVC 1UZ8B 1TCRB 1AR1C 4LBEA 2LV4A 2VYRE 1JGEB 1DVFB 3CPLA 1CK0H 2VLRB 4OCRH 4DKEL 2UUDH 1DE4A 2NX5D 1EPFA 5SWSA 3OV6A 3BKCL 5D7KD 3F12A 5D7SH 5D2LB 4O2CB 1DVFD 1QHOA 3B9EA 2IPUG 3IAQA 1KPUB 4AMKH 1PQZB 3SDAB 3ULVC 3REWB 2IQAA 3MRQB 4K94H 1I8MA 5CBEB 4MB5A 4ZTPH 1QKZH 4NKDB 3BRFA 4Y5YB 2R9HC 2I5YH 5D93C 4BKLA 3UTZA 3ZKMC 5HTSA 1D6EB 2DLEA 3AAZA 5DJXB 4LQ1A 3CZFA 4K3EH 5C0EA 3T0WA 3FHQA 5I8CA 2VE6A 5A2FA 1WV7T 1NBYA 2J12B 5CILL 3OQ3B 1QO3A 1QFUL 1DQQA 3DX9B 1WAAA 5JORA 3KJ6L 4F80A 2C1OB 4YXKL 4WV1B 2ESVE 4G9FB 2DQJH 3T3PE 5D2NC 3SDCB 1JNLH 3PXHA 4JFZL 3TZVC 1IQDB 4OGZA 3BZFA 1CFTB 3BP4B 5T1DL 4RDQG 4D0CA 4F37K 3QT2A 2CJUL 2FHCA 2AJZA 1DTUA 4LLVB 4G9FD 5EOCL 2IANA 2ENSA 3TA3B 4GXUM 4YFLI 5FYJH 1NGZA 1WWCA 2HT2D 5EORH 4PG9A 5HYJE 1K5NB 3IFNL 4KKCC 2C9AA 4NQDA 2BNQE 1HEZA 5I9QC 4H1LH 5DD0H 3NZ8A 3HNVL 4XNQA 1ZVSB 4L5FL 1RUKL 2PTVA 4RX4D 3FQRB 4XGZA 2AI0H 4DW2H 5H2BA 3GKZA 2GJ6B 3QJFA 3SKNA 3V0WL 2HT4C 4UV7H 2RQ8A 3B9DA 1F4WH 4YZFE 5EO9A 5J13C 5E00B 4Q6YA 4R0LB 1DQJB 1HILA 1K4CB 2WP3O 2GJ6D 4JFYA 1G1YA 4O02H 3L3GA 1Q72L 2LVEA 2ATKB 1AHWC 4DWHA 3KJ4C 3QXDB 2NQCA 3X12A 4NHUA 1IC7L 5T33L 4ZFOB 1S8DB 5HPMA 1WFTA 5JOPD 5EBMB 2DTML 5AD0B 1AGFB 4F8TA 5DRWB 2YBRB 4PRNA 5J89A 2WLZA 4UBDC 3EGSA 5EZIH 1E6JL 4XP1H 2CKBB 3G6DL 3U7YL 2IGFH 4S0SD 4QWWD 5DK0A 1CICD 3RWDA 2MCPH 2H2PC 4O5LL 5CP3H 1X9QA 4EI6A 2Y9RT 3QCVH 4N90D 5FK9A 4Q0XL 1CD0A 4ETQA 5IM7A 5FM4A 4PJXF 1S3KH 3RL2A 5JW5B 4I3GA 4IRJA 4D0BB 5CJXC 1JYNA 4YE4L 4KDVA 1VSCA 4TSCL 1IAIH 5I8OH 3E6FA 1MPAH 3JV0A 4KKLC 3HUJF 1RPQA 1PFCA 1A6AA 1FNEA 4PRBB 3NH7H 4DGIL 5SWZA 3MBXH 3RIFF 4A6YH 4WGVB 4KDWA 2DN7A 2V5YA 3I3BA 5ABDE 4NP4H 2NY2B 5IBTH 4L8BB 1MLCA 4TPRH 3V5HB 3CVIL 3K4AA 4P5KB 2G2RA 1FFPA 2Z4QB 2J5LC 4YWGL 4HIJA 4ACPA 2NY2D 2BFVL 2X4TB 4QY8B 4M1DH 2BVUA 5I1CL 3S96B 3QIUA 4OKDA 3LN5A 4OZFH 2DIJA 1RZKC 4F7CB 1J0IA 4HUUB 4JGJA 4KGJA 3GJFB 4OD2A 4IRSC 1R3IL 1LEGB 1R5IA 1QBLL 5C92A 3AUVA 3LQZA 3PHOA 4EDXB 2H9GB 2PYEB 3REVA 3RDTD 1WICA 2HTKD 2NX5A 3DTXB 4NIKB 1D3CA 4KTYA 3L5JA 3FO9B 5HGAA 4N0RA 5HVWA 3MJ7B 2FX7H 4AEHL 1LWRA 5DT1H 3E6HB 1SQ2N 1GL4B 2PYED 3QEHB 3ZL4H 3RWFA 4O9HH 4LF3A 3L5XH 4UQ2B 2AK1H 4HIXL 4LLMB 3A6OA 2YD4A 3FRPA 4OM0H 4J3VA 5B21A 5CSZB 4L4VB 3DGCR 4P3CL 4DQOH 4NQXB 2ZOKA 3EUUA 2LFGA 2FZ3A 5JW4M 1TJGL 5GISL 4TTDD 3TCLA 1WFUA 3H8NA 5E2VH 4M62L 3BMVA 4ZPVA 3T0XA 2BDNH 2WSKA 1WF5A 1Z0MA 2I24N 2BY1A 2NNAA 1CTNA 5AYUL 1KJ2H 1MAMH 1NC2D 4DTGL 4JO2H 3F6LA 3LKOA 3U30C 3L1OH 3G6JE 2WV3A 3ARRA 1ONQB 3QO0B 3HUJE 3IDMB 1VGEH 4NQUA 2YD3A 2XN9E 2CUIA 1A1MA 1T1YA 1IM9B 3EW3B 5I8KL 4NO5A 1MHCB 3H7BA 4LMQI 5MEQB 2ATPA 2WQRA 4PRDA 3GSUA 4OD3L 1CDHA 3OAUL 4GW1B 1F8TH 1M71B 2NY5C 3O4LB 3EO9H 1R3LA 3HG1A 2KQNA 1KPRA 2CIKA 4F7TB 5DMIL 2NMSA 3F7PC 5IESH 3OKYA 4HF5L 3MYJA 2UYLA 3S37X 3QB7C 3RX5A 1QLFB 5KSAD 3RTQB 1FZKB 5ALCH 3TVMB 1X5FA 5I8EA 1CLYH 2JK5B 4S0TD 4WI8A 4WFGE 5HY9A 2DIBA 4LP5A 2JJWA 1TTFA 4PJDB 4OZIB 1I4FB 1FNGB 4OZHB 3QPQD 3TVMD 3WIIL 4L4TB 4PY8I 3OJDB 1YUHA 4U33A 1HZHH 4GLRH 2W0PA 1CI5A 1CICA 1PLGL 4P2QE 4G7YL 4M5YL 4M6MH 3OBAA 4FQ2H 3I6GB 1LE9A 1I85C 3G04B 3QUYD 1DBBL 4NQCE 1DBJL 5GSVA 25C8L 4ONGH 1VADB 4M7KH 5SV4A 2YD8A 4AM0B 4ZTOL 2ZG2A 4JG0L 4H26A 1NCUA 5I1HH 4GAGH 1OCWH 5I15L 2JJTC 1W0WB 1U8JA 4DVBA 1RZJL 2SEBB 3IU4L 1U8PB 5JIKA 2NLJA 2Q3AA 1NH6A 4Y4HC 5DJCB 3O6LL 3VXUA 1Y6MR 3D69A 4KK9D 1KTLA 2VDMH 3C60A 3AMKA 1WISA 2VXSL 1G0XA 4JZOB 2X4SA 5EH1A 2P45B 3BP7B 5IB4A 1FFRA 2F74B 5TFSH 4H88H 1KXVC 3O41A 1XIWB 1BGXL 3MV9E 4X99B 4JY5H 4MD0B 3MRHA 5GGQL 4BH7A 5FO9B 1BX2A 5J0BA 1K9TA 2F54D 1Q1JH 4JKKA 4GRLB 2GITA 2ZUWA 3CC5B 5F70A 3OKOA 4BSWB 5EOQH 5IB2B 1X5YA 2YSSB 4QHMB 3TGXA 4I2XB 1WTGT 4R7DB 2VQTA 2X4NB 1YN6B 1J9CT 1AP2B 1LO0L 4EN3B 5F3HA 1B0GB 4U1GC 4OGAD 5I71B 4AEEA 5ICYB 3DO3A 4DKFH 4IDJL 4KV5E 1YECH 1J8KA 3MLYH 3VWJC 4KROB 1R0AL 5C0RL 1IGFH 3IRPX 4XMKL 1ADQA 1PZUB 2ITDB 1WFOA 3PWLB 4ODVH 1M1SA 3LQAC 3RDTA 4BZ2L 4N8CL 1UKQA 1X5XA 1I8IA 4WTWA 5JIHA 2V17L 2Y5TB 4YNYB 5H37G 1NMBL 1CIDA 1RZKH 2CRZA 1VEMA 3D2UB 4XNUL 5I17B 1A6VL 1J8HA 1MQKL 4XPGH 4WU5A 4POYA 1ZGLM 12E8H 4FNLL 2J4WL 1U8MB 3QXTA 5HGDA 1FBIL 4PTUA 1MEXH 1U93A 2VJXA 3D2UD 4ZUTA 4LLUB 3U9UB 1GGBL 4MA3B 3EYUL 1U95A 3FB7A 1S9XA 1ROWA 2AXHA 2XY2A 3PL6D 1F42A 1MH5A 4HH9A 4HSQA 4S10A 2P44B 5EO0B 5CZVL 1AJ7L 1FLRH 1BJ1H 1Z6JT 4E0RB 5FDWA 2VWEC 5D70H 1MJUL 3HI5H 1NC2A 1XGQA 2GT9B 3QNXA 3MLWL 5HVGB 3BZ4A 2DDQH 2XWTA 3B2VL 1QRNA 5L2JA 2Q8BL 4IDLA 4KXZI 4P99A 3VCLB 3TBVA 4YHNB 3OKLA 5INCB 1L4IA 2EE2A 1NEZG 3MLUL 1RZ8A 1GOHA 1IGJA 3WFCL 5E5UB 3WE6A 4NKOA 2YK1L 5KJRL 1BIIB 1T2QH 1RUAH 1MY5A 4NQTA 3GI9H 5I1GL 1T4KA 3QDGB 4CKVX 4YAQA 4PFEA 3ZSTA 5K9QI 5BZDB 4XB7A 4K7FB 4ZUSB 1JMXA 3G5YB 4JO1L 3QDGD 1QFWL 1EZVY 4HIHA 1T66C 1X6NA 5DFVD 2JCCB 3S36X 1X5LA 2EDHA 3P9MB 5GQBA 1YJDC 5KSAA 5DHVH 5F7LB 1MCSA 3SGJA 1WIPA 2AXGA 5ICZB 2BVQB 3RY5A 1LO2H 4OV5B 2XPGA 3AY4C 4EXKA 2NY5H 2Y06L 3MZGB 5CBAB 1EEYB 1X3DA 4KRLB 1K85A 1CLOH 1KN2H 2YUZA 2L7UA 3MA9H 1KIRA 3MRLA 4HCRL 3QNZA 1RHHB 3O3EB 5EFIB 1XGPA 2AAVA 4K3JL 4HZAA 1AXSA 1JUFB 1BD2A 5JNYA 4WWKC 4F57H 3KDMA 4JFOA 3OKDB 2Z8VC 3QUYA 3DUHA 1J11A 4N0UB 5B3JF 1T1ZB 1YNTB 1U91A 3L3IB 4X9FA 1TTUA 1F4HA 1S9WA 3HMXH 3RGHA 3H9SB 2G5BB 4FTVD 5DVKA 5JHLL 5JXAH 5LQBH 3ZDXF 5JQ6L 1MFDH 1MCHA 4EI5B 5FGSA 1UWGL 1Y18B 2GTZB 1AO7A 3TV3H 3SDXA 3S4SA 5B38G 5A2JH 4K3GA 1NCWL 4QNPF 3FONB 1KLGA 1PBYA 5D5ME 2IBZY 2CD0A 2AV7A 3GIVA 4K55A 3EZ8A 5FIEA 1MHHA 3TYFB 1UB6A 4JZJB 1YDPA 2F54A 1A5FH 1P1ZA 2OS7A 4HKXB 2D31A 1E4XL 3GKWL 3SCMC 1FE8L 3WN5A 3FL7A 2FBJH 1E6OL 2GAZB 2ZNWA 5CD5D 4MAYB 2AGJH 4CW1A 5M95B 5C09E 3HC0B 4HQQL 3RNKA 2VQ1B 3QDJD 5C0JB 2B1HL 1BVLB 4U6YB 2J8HA 1T1WB 3KXFE 3BDYH 5TF1L 3V6FB 3MBEB 1ZEAH 2XA8H 3R0NA 4U7MA 3MSPA 4N1CA 2F53D 3H9HA 3Q6FA 1N64L 3Q6GH 5IB5A 4YDIL 1EVUA 1VFAB 4KRPB 4X7SL 4H20H 4Q74A 5HDQH 4J3XA 1RUPH 3CUPA 1OQOA 1BZ9B 3MBED 4PJAA 1UACH 2A74A 1T7XA 4UUJB 4IMKA 5HI5D 1M7DB 1IM3B 1GGIL 4KRPD 4WU7A 2A9ML 3LQAH 4KUZL 4PJBE 1FGVL 2ARJQ 5L2KE 2HN7B 2R39A 4BZ1L 1AY1H 1WBZB 4JN1L 5C0AB 5C3TA 2BVOB 4U0RB 3HMWL 5TE4L 4KHTH 4I4WB 2B4CL 1EHXA 4WI3A 1ZHLA 4QRRE 1JZ6A 3PL6A 5HGBB 5C0AD 3RY6C 3ARGB 5C0NC 4CADA 1BWMA 3ABZA 1HIML 3GSVB 4UNTA 3SKJH 5F44A 3PWVB 4OLUH 2Z0BA 4CU7A 3GSXB 3ARGD 2WIIB 5C6TH 3S35H 4TNWF 5DD3H 3EYVB 3EOAB 4ORZC 7FABH 4QGTA 3HZKA 5EPMA 3CSYB 3EHBC 5ESQB 3FT3A 5CUSH 3S4SG 3DVNB 3T09A 2CLVB 5HHXL 2P8PA 1BP3B 4UNVA 1JHTA 2IAMA 3D0VB 5IQ9B 4YX2L 1IARB 4KTDL 4V1DB 4GG6F 4WNQB 5BVPH 4YO0A 5J11C 4JO3H 2WUCL 4HCRA 1PY4A 1CGUA 4JY4B 1A47A 1LO3L 3C9NB 3O3BB 3VXNB 3GRWL 5INDB 5D7IA 3ULVF 2FGWL 4L3EB 4P2OC 3T0EB 3TO4C 3RWJA 3UBXI 3K7UA 4DK3A 1RIUL 4XNZC 1EGJL 2AP2A 4P2RE 1AQKL 4UOW0 3FB8A 5E2UL 5DJ0B 2Q6WB 4UT7L 1FL3B 5JLZB 3HRZB 5ALBL 1YEIL 3MQIA 4FFZH 4N0CD 3V7AG 3BD3A 5I1KH 3NA9H 1KELL 2FO4A 5D4QA 4BQ9A 2AEWA 3QUXC 4UV4L 2B20A 1JGUH 1FVEA 2UWEE 1ZHBA 3EKCA 2ICWJ 2RCSH 2X09A 2EICA 4LCCC 2DD8H 4Y5XC 4ONFL 5F7FA 1YEEL 4MQXD 3WDJA 1I1YA 1G7QA 5BZWB 1H8NA 4GRWB 1Y0LB 4XP9H 3FCTB 3GSWB 3V6ZA 3CCHB 2FIRT 2OXGA 4FTVA 4L3CA 3E2HC 4GW5B 1GPOH 3P77A 5T5NG 1J0KA 1KOAA 2IQ9L 4PJ8B 1LGVA 4C59B 1KBGH 3SGKA 2R2HA 3TBTA 4Q58C 2Y4SA 2XA3A 4Y19B 1UENA 3MGOA 3HTLX 1IAKB 2FEDD 5CFHA 3RJDA 1JTPA 4LLYB 5TDOA 3T2QA 3H6JA 3OR6A 1LO4H 4JM2A 3PWPB 4DVRH 2X40A 3VG9C 1PD6A 2B39A 1N2RA 2E9WA 2X70B 3AROA 2MKLC 4UTAH 1U9KA 1TQBC 2EIEA 4R4BB 2Z93B 3D85B 4JFXB 3MNVA 3UJTH 2X7LA 3MNZA 3QDJA 2VR4A 1D5BA 1U6AH 4UAOC 5L0QC 2Z8SA 1F58H 4HDIA 3O2WH 3IS0X 4NZUL 5EN2A 2DWDA 3ULVE 3PHQA 2F53A 1IGTB 3GJEA 5TDNB 2QV2A 3W2DH 1MNUH 3H42H 4FRWA 1TIUA 5E6IC 3MRCB 4F7EB 5E8NB 2X9WA 4LK4A 5AEAA 2EYRA 4L9LC 1PX3A 2WWKT 5ECJE 4BUGA 2ZPKH 1MHEB 5L8KB 3PV6A 5TQ2H 4UT6L 2HJLA 5E8EB 5C0CE 4M7LH 5DUBA 4GRMB 1IGIL 2VISB 1JNNH 4KQ3H 3GSRA 4XC3H 1ZWIA 1FG9C 4ZQKA 1Z5LB 4QRPD 5IK3A 4XVJH 4HT1L 3MLSL 1E28B 3VG0L 1T21B 4YHOH 3MLTA 1FH5H 4PY7B 3O6KL 4GMSH 2YR3A 3I6KB 4CNIB 2ZJSL 2IPTH 3HE6C 2Z91B 4Z7VA 2NY4C 5AWNL 3HE7D 4RMQA 4WEBH 3IJHB 2V9TA 3MRIA 1E4WH 4I48A 1CFVH 2ZSVA 2QADB 2A38A 2ADFL 3QHTC 4R9HA 2FH6A 3L5WB 4G8GB 1DBMH 2E7BA 1EGJA 3OPZL 2DS4A 1IQWH 1KCUH 3VXME 4QRUB 4YDJA 5KVDL 1OT2A 4NRXA 5GS1C 4KVNH 3IKKA 3S98A 1QVOB 3RGVB 2NW2A 1ZT4B 5DRNB 4I77L 1SJHB 4NO2B 1OAYL 5IFJB 4XXCA 5ADPL 5HHVH 2EXWC 3MACH 2GJZA 5F7MC 3U82B 2FSEA 3FMGL 2YUWA 1LDPL 3RGVD 2VLRE 2XNAB 3WFDH 3F8UB 5F96L 4NJ9H 2MWCA 3STLB 3H9ZA 3VFSA 5IHUH 1HWHB 1MREL 4EUPB 5D2LE 3LSOA 1DQLL 5IT2H 2FX9L 3H3BC 2ZSWA 3F12B 3SEPA 1J5OH 3DROB 3I9GL 2GTWB 4HEPG 1S5IL 1S7RB 2VLJA 5HYSA 2DBLL 1X7QA 2MHAA 3GI8H 5IVZA 3BQUC 4XRCB 2XRAL 2C5DC 1BQUA 4N8VB 4PLOB 1X4ZA 2H1PL 1F4XL 3OKMB 5DSCB 1BZ7A 5F7UA 1HHKA 1TVDA 3LRHA 3A6CH 1O7SA 1A7PH 1AQDA 4KVCH 2O5YH 3MLZL 3IVKA 3UTZB 4LPXA 4ZPTB 5BRZB 3OGCA 3CZFB 4OQTA 5C0EB 4RGNB 1CU4L 3KLDA 1Q9KB 5ILTL 1G9NC 1U3HC 3B9KC 2FATH 2ADGB 3MROB 5EBWB 2XWJB 2YKLH 5KSVB 4OZ4B 4K9EC 2E8YA 4G9DA 1FCCA 1K6QL 1EDQA 3PGFL 2GUOA 4GAJH 4QYOA 1SY6A 4KRMB 2JB6B 4XPBH 1GIGL 1NGXB 4PLKD 3KPMB 1BAFL 1FZJB 4X6BB 4CU8A 1A3QA 2O5XL 2EO1A 4XVUD 1P4BH 1MFBH 2RBLA 4C4KO 5I16B 4V2CB 4EBQH 4TSAL 1A4JA 4LLQA 4PJFA 1CLCA 1II4E 4HLZG 3WYRA 1HI6A 1I7TB 4XP6L 4PJ7A 5BQ7B 4JY6B 5DI8B 5C6PB 4NBZB 5I1JH 1QOKA 4NOBA 2JTDA 4OZGF 4XNQB 4I0PC 2G9HA 1KIQB 3SQOH 4XGZB 3LDBB 4NN6C 1BIHA 4MSWB 5LBSH 2QKIB 3DMMA 4FQPA 1I8LA 5EC1B 5IFHL 4OM1H 3NABH 1ZHKB 4BFGA 5EU4A 1A02N 2OR9L 3FTGB 4OLWL 2I9TB 4NQSB 1UM6L 5DVMA 5E7FA 4LKXA 2UVFA 1UA6H 3TJHC 5T1MA 3KYMB 5CKGA 1A14L 2NY3D 4NHUB 3U7WL 2X5PA 3OR7A 4M9OA 2P5WA 2DM3A 4TUJB 4ZDHB 3ROLB 3ALWA 5F7KC 5A16A 4MZ3A 1XZ0A 4Z7OF 4Q9RH 4HUWB 4U4BA 4PGBA 5BXFB 1I75A 5IBUG 1NC4B 1EXUA 1QBMH 3A0OA 1TZGH 4NO0B 3IFLH 5JR1L 3NIDE 4FN0A 4K8RD 8FABB 5E6ZA 3MNWB 3WDHA 1DSFL 2HFEB 3GNMH 5HYSG 2VN7A 1NC4D 5EIIB 4RWYL 4PJIB 4WHYG 5IM7B 3ILQC 1D9KB 4MD5A 1INQA 1JMZA 4XP5H 5K9JH 3FO0L 2ZCHH 3KS0H 3FT2A 3WO3B 3LKQB 2HP4A 1YEDA 4G3YH 1Z3GL 3MR9A 4Y4KD 5DZOA 3LV3A 3C5SA 4JREB 2R69L 5ACZB 1JPST 2R0WH 1U8IA 5EZLA 2IBGA 4GBXB 1YN7A 4K8RL 4JHAH 1KEGL 1MJ8H 3SN6N 4I0CC 4AENA 3SE4A 2G2RB 4KGLA 4RFEA 4YHKH 1LP9B 4TOYL 4UU9A 4Z77A 4LLWA 2EH8H 1J0ZA 5FUZH 1N3NB 3DPBA 1MI5D 5L88L 4PP1C 2CK0L 2ARJB 4P23B 5GRYA 3WFBH 3HI6L 3ARZA 1R5WA 5EDXA 4MMXC 3SE8H 4Q9QL 1S7WB 4NM8H 5KSUA 4CVZB 5LXGH 5JTWA 4P23D 3SPVA 4G8FB 1BWWA 3MOQA 4OZIF 1NLBH 1W72B 2XT1B 1V5JA 4HG4K 1CF8H 2XZQL 4M6OL 5J3HC 2G60L 1I1AA 4YDKH 1A1OB 1S7UA 4WUKL 5HGAB 3H3KA 3E0GA 4HJJH 1A7NH 4OF0A 4N5EC 4G6KL 1AXTL 5EUOA 1U8NB 2QLVB 4LU5H 1LO5A 5DC9B 4U6TA 4L4VE 3M8OL 3CU1A 4U1IB 4Z7OE 4NNPH 3MREB 2MSPA 2NY0C 4RMVA 1XT5A 4OUOA 5EA0L 3QFJD 2YPLD 4R8WL 3L3DA 2VABA 2C26A 1YZZA 2R29H 4LDOB 4Y4FD 3VW3H 2A83B 2WWMD 2X4UA 4IRJC 4HBCL 5DA4A 1H3PH 4Q6IB 4Q97A 5ID0A 3DUSA 2ILLA 4HKZB 2NNAB 3N1PC 4QRQA 2UVEA 3CXDL 5D7JC 3O2DA 3K8KA 4Z7QF 3QJHB 3S3PA 2B8OT 1NFDF 2BNRD 5FUOH 3QSKB 1G9NH 3MTRA 1QSZA 2A6DB 1ES0B 1T1YB 5L8LB 1OTTC 2BXYA 4QTHA 4R7NA 5MP6L 4HLJA 4XCCL 4U6XA 3H7BB 4PRDB 1JWSB 3SDDB 1D5XA 3O4LE 3C08L 5IGXH 4MJID 4NNXB 2D7OA 1FVCA 5FV2A 3ILPA 1KEML 1XGYL 1FPTL 3QIUC 3PE9A 3BN9C 5DDHB 5CGYD 4R90L 3HG1B 3IJSA 3SDDD 3MLRL 3P4NA 1KNOB 1QA9A 3EYQC 3MYJB 1EIBA 4NNYB 3DX8B 43C9B 1JGLL 2XZCL 3OMZA 4NFBA 3HS0A 2C4FU 4OZIE 2JE8A 4W4OA 1CE1H 1VFMA 3DVIA 4ODBD 1OP5H 4J4PA 4L4TE 4TNVK 3UC0L 1N6QH 4G6JL 4MLIA 4DGVH 5DGQA 1L0YA 2C7UA 2OZ4A 3ARSA 5EIVA 1U36A 1RIVH 3OKEB 4FABH 1AKJA 1JHLH 1NL0H 3F7VB 4IIQB 3T2NL 3NCJH 2GCYA 1KTDA 2VDLH 5E8PA 1U8OA 3K81A 5EZOL 3SE3A 3U79A 3TJEL 1WWAX 2MOVA 1YMMD 4N9OB 4LCUB 4GXVH 1B9ZA 4TVPE 2VXQL 3UTTA 4Y4KA 2J8UF 3VD3A 3QH3B 4XNMB 3BVNB 2ZUTA 4G42B 1OSZA 3BW9B 1M6OB 3ARDD 5L7XL 2FX8H 3W9DA 1RULL 5C0IA 3OAZK 1PKQB 1F4YH 3WHE0 1DBKH 2HT2C 3IAGC 3FB5A 4RGOH 4Z7QE 3MRHB 1BX2B 4I2XE 1WBXA 1VB9A 1NFDE 3PGDA 4I8DA 3TNNA 5JOFA 4LLAA 3HAEA 5D7LD 3MLVL 1MI5A 1UVQB 1JGDA 3BKJL 5HHMD 5FO7A 3HZMB 3BWUC 3NFNB 1DUYA 3SBWA 5T3XE 4ZS7L 3UROR 4YIQA 3S3SA 4RGMB 5KSBF 3OF6D 2VL5A 3FB6A 1OM3L 4UTBL 2IFFL 4NM4L 3BAEH 4M6NH 4PGEB 3P9WB 3BGAA 3HPJB 4LVOB 1FDLH 3CNKA 1IL1A 3AREA 1T04A 4BQ8A 1NCDH 4ONHB 1ACZA 5E1AB 5FYLD 3L6FA 1KLFA 4NN7C 4XBGB 1M7IA 1I1FA 3NA4A 4NGHL 2VDQH 3DV4A 4HC1L 3NACH 4DN3H 1KG0A 1C1EH 4LSTL 1RJYA 4GSDH 2DJSA 3L3HA 4QWWC 4UDTA 3K4ZA 1CICC 1ZANH 3QFJA 2YPLA 5J6HA 4PJEA 3QUKB 1U95B 4M7ZC 4YH6A 1S9XB 4Y4FA 3HRPA 3P4MA 2VDKH 1MVUB 5CKAA 3SKOA 1QSVA 4MNQB 1NGQL 5DS8A 1RUQH 4X8XA 4JB9H 3MMEA 5FYLL 5F9WB 2X9YA 1OPGL 1KB5L 1UH4A 4HWZB 4MNQD 1QR1B 2Z8RA 4S2SA 3C60C 4KKAC 5TF0A 2C4FT 2MTPA 3TBVB 3HA0A 2BNRA 3MCKA 1J0HA 3VXTB 4GUPB 4O2FA 3N9GH 1KSRA 1PG7L 2J8UE 5I75B 5KZCB 3PDOA 3N85H 5IUSA 3BPCA 3K1DA 3SOBL 1RU9H 3LS4H 5MEOB 1CL7H 1BQSA 1VENA 3FN0L 1CDIA 2MNUA 2NY2C 1T4KB 2W60A 4X0KB 2QQKL 1QSFD 4MJIA 5GJSL 1JN6B 3IDXL 3QXWA 3WSQL 3HZVB 5IFAL 2XACC 3RWGA 4IHOA 3I75B 2X44D 1I7ZA 4BQBA 2C3VB 3GDBA 3KPRE 4NPYB 4YGVA 4M93C 2YWZA 5IG7B 3QI9D 5JIPA 1AGCA 1H15A 5HHPB 1X5AA 2L7JA 1D7FA 2YRZA 3C6SB 5C08A 3RDTC 2HTKC 3B3IA 5DJZA 1XFPA 2AXGB 4B7LA 4KC3B 3W5NA 4TULH 3RZCD 2VLKB 3AGVA 5E08L 4RZCB 2Q86B 1LMKA 4NC2B 1X5HA 4P9ML 1U2HA 2I07B 3KPSD 5E4IA 5CILH 3RVWD 3WLWD 1QFUH 1BVZA 1AXSB 3KJ6H 5IV2B 4N0UE 1BD2B 2ORBL 4YXKH 3V0VA 2IH1A 3G5XA 4JFOB 3H9SE 4JFZH 1WQVT 1UXSA 3QIWB 3RHWF 2H6PB 4JFHD 1S9WB 5GGVY 5T1DH 3P40A 1GXEA 2CJUH 4TTDC 4C83A 4RQQA 4WVRA 2FHBA 4IOIA 5EOCH 2ICWI 1MCPL 1CFNA 2X4RA 4MAUL 4JVUA 1YMMA 3QIWD 3TEUA 3DIFB 1AO7B 2OJEA 4EJ1C 1YEHL 4L8DA 5ISZB 3IFNH 3U0TB 1P4IL 2ZOLB 3EBAA 3ARDA 4W6YB 1F45A 1HXYB 4L5FH 1RUKH 3MJ9L 4XC1L 4OIIL 1UB6B 4LGRB 5I74B 1P1ZB 3L3OA 2BJML 3V0WH 4ODSL 1Q94A 4JEGB 1LEKB 5DVOA 1CN4A 1CD1A 1F02I 2DKMA 1Q9WB 2BXZA 2AJVH 2YA2A 4JLRB 2XIDA 3VFOA 1Q72H 4NN5B 4MA1C 4KHXL 5DRZA 2W38A 2EIZA 5DVNA 1IC7H 5T33H 3OF6A 4GW4B 4PJ9D 1WBYB 2FJFB 3RWEA 4PRHD 3B5TA 4OFIA 2DTMH 5DEZA 1UZ6F 5KSAC 2BOBA 4I9WE 3MJ8B 1S5HA 3SO5A 3SGJC 3Q6FB 2QQNH 2BK8A 3CDGA 5JXEA 2YD6A 1E6JH 3G6DH 2WP3T 3U7YH 3OZ9L 2OLDA 1KB5A 4O5LH 2A74B 1G7LB 5H37H 3QA3B 5IB1A 1YY8B 2EEBA 9CGTA 5IHLB 4Z0XA 4Q0XH 3T65B 4WU7B 3K2MC 4HK3N 3F58L 1X5KA 5K9KA 1NLDL 3PF2A 4HAGA 4YE4H 3T0VA 1CDGA 3U83A 4TSCH 3D3VE 4D3CL 1CCZA 3QUYC 2XG4A 3SGEH 4LSUL 4NHCL 4FQCL 4O51A 4DGIH 4FXLA 3VXSD 3ZYJA 2EDBA 3T77A 4YGAB 3WLBA 4LFHG 1XR9B 4CVUA 1ZA3A 3CVIH 2RHEA 3ZKSD 1F6AA 1HHHB 4KK9C 2OQJA 4YWGH 2B5IC 3ARUA 3HZKB 2IH3A 2BFVH 5EPMB 2HFFA 3WNKA 3ZT5A 1JYVA 4WUUD 5IJVB 2MMXA 2XG5A 4ZSOE 5I1CH 2X89D 1W0YT 4MJ5B 1ERNA 4OF5A 4V1DE 3SO3B 3MRFB 2V2XA 4YPJA 4Y1AB 1L9MA 3QULA 3DX6A 4WW1B 1CFSA 3KVQA 4ZAKB 1G7IA 1QSFA 2QBWA 1R3IH 3BHBA 4MXQD 3NFPB 1QBLH 5LJYH 5TPWL 5CP7B 2R2EB 4L3EE 4OCYL 2R2BA 4Y1AD 5FFLA 4MX7A 5DR5L 3GMRB 4OD1L 3T0EE 4WO4D 5CJBA 1MAJA 4ZAKD 4NYLA 3S5LA 5E24E 1E4KC 3QI9A 4AEHH 1INDL 4NUJB 3IS1X 2JJUA 3RWIA 5I71C 2HJFA 4TN9A 3H3PL 2VXTL 4PJGA 2W0LA 4URTB 4HIXH 1DUZA 5KVMC 2N56A 1YEFL 4J1UB 4JR9L 4XB8A 4X6CA 1OGAD 2OBGA 2IG2L 4RDQF 3RZCA 3UMTA 1UZ6E 3ARFB 5J1AA 3GBNL 3HPLA 4ISVA 1ZSDB 3RIFK 4P3CH 1XAUA 3QAZC 3VDCA 4IMKC 3KPSA 4GRWE 1TJGH 5GISH 5KVFL 3PWNA 4MB4A 5GGSB 3MRPB 4M62H 3JUYA 1DZBA 3DV6A 3VD5A 4AYFA 3WJJA 3Q1SL 4O4YL 3OJMB 4XCEB 2PO6A 4BM7A 5EU7E 5AYUH 4U1LA 4DTGH 1T7YA 2WINA 5C0DB 3PL6C 4MMZC 4K23L 3RX8A 4Y19E 3O8XB 3BMWA 4XBEL 4G5ZL 5IOPB 5IMMA 4NDMA 4Z76B 1Y6KR 1A1NA 1WFNA 3MV8B 3FRUA 3PWPE 3MRDA 5HHNB 5T3ZE 4WI9A 5CCKL 4ERSL 1SMAA 5I8KH 1J1OL 4JM2B 4XWOD 5E5RB 4ODHL 5DQ9B 3BE1L 2AJXL 4OD3H 2CXKA 3CFKA 3AXLB 1JCKA 2AEQL 1A6ZB 4KKBD 4CMMA 4PRPA 4H1LA 4JKMA 1TMCB 3L3KA 5BV7C 4L8SB 4X7TB 5DMIH 2BY0A 2J2ZA 1HE7A 4NZRL 4HF5H 3CSGA 4MWFA 2X7LB 3TM6A 1OAKL 1T0PB 1S7VA 4FQHA 4PB9L 4PJ9A 5HJ3B 5DFVC 3V6OA 2P5ED 4PRHA 5I76B 4Z18A 3NGBB 2DWDB 4H5SB 2ED7A 5ITFA 1MCNA 2D9QB 4GS7B 3WIIH 4LRIA 5MERB 5TGBA 43CAB 3S5LG 5F1IA 1PLGH 1VFBA 4G7YH 1MLBA 4M5YH 1WAAF 5J06A 1DBBH 1DBJH 2K3TA 3RWHA 25C8H 5CJOL 1D5ZB 4ZTOH 2VUOA 1QYGL 4YHIB 5CP3A 1A7OL 4JG0H 3R8BB 3TBYA 1AGEA 5I15H 1YC7A 4AZ8A 3IU4H 4Z7WB 2P8MA 3IDJB 1VFUA 2VLMD 3O6LH 3MV11 4RFNB 1ZLVK 1GRWA 3QUMB 3VXSA 3DXAD 2VXSH 2DF3A 1TZIA 2V2WB 4F33A 4GAYB 5C0GB 2QQLL 4G43B 2P48B 3MODL 1BGXH 5GGQH 4G8GE 1YQVL 4A6YA 1S7QB 2HAZA 1BQHB 3CVHL 3JTSA 4JRXD 1MFEL 5DJDB 3ZE1E 1OVZA 5C9KA 1LE5A 1N5AB 4LVEA 5BW7C 4WUUA 5CD3A 2VDNL 3DX7B 1LO0H 4XAKE 4NQEE 2X89A 3H2WA 5E0QA 3ORJA 5CGTA 4QF1A 3RA7L 2NW2B 4IDJH 2GFBA 3PWUB 3Q3GA 1R0AH 5C0RH 3SGEI 5CD5C 4XMKH 2BMKB 1T5XA 3P4OB 1FLTX 4L29B 1G7PB 4BZ2H 1UJ3A 4N8CH 4Y0GA 1C7SA 4PTTB 4WO4A 4OCWL 1TQCC 1I9IL 3QUML 1ZMYA 1INEL 2V17H 1ZA6A 3F7YA 4OLZL 1EFXA 2A0LD 3RPIA 2H3NB 3VFSB 1JYWA 1NMBH 3QXVA 2B4CC 3O0RL 4XP4L 2HJKB 1CFBA 4BFIB 32C2A 3WDIA 3MXVL 3VFVA 1MQKH 1OGAA 5D6CB 2MHAB 4FNLH 2J4WH 2Y1VA 4PJIF 1FBIH 3WCYA 1XH3A 3MBEC 3KLHD 3BIBX 4WEMB 1GGBH 2AXFA 5HI5C 1HHKB 3EYUH 3MUGB 3N1FC 5BRZE 1HHIA 4KRPC 4MJ2A 4XBPB 4X98A 2NY1D 3BJLA 5ESVA 1JNHB 4RGNE 1C5CL 1YC8A 4C56D 1D6VH 3VGHA 3ULUD 1WAAE 3K74B 5IMLB 1AD9B 5CZVH 2JIXD 5LGJB 1AJ7H 2KDGA 4LPUA 1MJUH 4RAUB 3MLWH 3WXWL 3WHXA 3BGFB 2MQCA 3B2VH 4G9DB 1A6PA 2Q8BH 2WAHA 2DJ4A 6CGTA 1MAKA 3JV6A 4UIMB 1KJ2A 2C3WA 1KCKA 5D1XB 1A3LL 3PJSB 3WFCH 1LK2B 3QEQD 2YK1H 5DJAA 3VDAA 5KJRH 1FV1B 3ARGC 5I1GH 3LKNA 1FG2A 5TDPA 1IFHL 2CDGB 4PJFB 1TPXB 1ZGLA 1RSFA 3ULUL 3FAXA 4UI2A 2R4SL 3GMPB 3MV7D 3SDYL 4LNRB 4M1CD 2HKFL 1QFWH 2G9HB 3GMLB 2XKNB 4ORGB 4XXCC 3VJ6B 2PNDA 3DMMB 1K3IA 1FYTB 3MUZ1 1DR9A 1U8HB 4XI5C 4G8IA 4RNRB 1DLHB 1B4JL 3BT2H 3JBG7 2P5EA 1LILA 2Y06H 1FVDB 4Z7NF 2A73B 1PX4A 5JA9A 2CR3A 4CVXB 2HTLD 5GS2D 2ENYA 5DQDL 4JPIB 4MQ7A 1CXIA 2YD5A 4HCRH 4G80A 1XZ0B 1YPZB 4HJGB 2EXYD 4LKCA 3I50L 2VIRB 4K3JH 4OFYA 2X1WL 1JE6A 4PV9A 4N0CC 3VFMA 3O6MH 1DP0A 4KK5D 2OP4L 1DQTA 4TTGA 4HS8L 5MEND 5ESAB 4L1HA 1DANU 4ZUUA 1HH6A 2XXMB 1BJ8A 4Y2DB 5E9DD 3WEXB 1TVHB 4PJIE 5D9SA 3IFOA 4X9IA 4X4YA 1S9YA 2X4OB 5JQ6H 5FYKD 1IGYB 4JFEB 4MQXC 1EBAA 3D6GA 3H0TB 4I3SL 1KUMA 1UWGH 2UZIL 4MYWB 4WFFD 3ARBB 5GRJL 1KB9J 3F5WA 1YNKL 2CLRB 3UTPE 1NCWH 4PS4L 5CSGA 4X83A 4JFED 5DUMH 2X42A 3DXAA 1RJCA 3OKNB 3NTCL 4HEME 4PJ5A 4YK4C 3BH8A 1PDKA 1NFIB 3QR2A 3C5SB 1HHJB 3U2SA 1G7JB 3X13A 5KS9B 4HV8B 5DFWH 4JRXA 3G6AA 3KWWA 2FEDC 3RKDD 1E4XH 3GKWH 5K9QG 1FE8H 5HXMA 3GGWB 1FL5A 1CGSL 1E6OH 1LP9E 3QWQB 4AENB 2NY7L 2NTSP 3RFZC 5EIQA 3T4AB 2R4RL 1CG9B 4RFEB 5HDOA 4Z77B 4HQQH 4ZFFB 2B1HH 4ZOCA 1NCCL 4N9GA 5J6GB 4PJHB 3AS0A 4YDVA 3NCYP 1R5WB 4X5XA 2R1XB 3HCVB 3B43A 4LEXH 3B2UD 5TF1H 1RFDL 2ESVD 4X4MA 5KSUB 1QRKA 5F3BA 3FQNA 3INUL 1N64H 4PYHA 4YDIH 4X7SH 1C12A 2E3VA 3N0PB 5HI3D 5E5MB 4TQEL 4UIKL 1Q0YH 1TVBA 5FUCE 1GGIH 2J1KA 3QNYA 5DWUL 3WFEL 2GYSA 2PXYD 4Z7NE 5HYJD 1JL8A 1UKTA 4KUZH 4WIQA 3T4YB 5F89A 1FGVH 5EC2A 5GGUB 5EUOB 3RBSA 1FGNL 2BNQD 1IILE 5IMOA 3BZEA 1LO5B 2DI7A 4JN1H 4OQ1A 1MFCL 4LCWB 3EOBA 3WNNA 4F3FA 4M02A 4PGCB 4DGYL 3HMWH 4JFQB 5TE4H 5KG9B 4W70A 2B4CH 3IB4A 4ONOA 4Y16D 3UTSB 4C56A 2DYPD 3L3DB 5CEXA 2JIXA 1SYSB 2EDJA 3ZKND 3BKYL 2Y36L 4FA8A 4DCQB 3UTSD 4H25B 4O58L 1CS6A 4AH2B 2GW5A 2HVJB 5T1KA 1QUNA 3UZQA 4DFHA 2D7NA 1XGRA 2WBJD 3FQXB 4PV8B 4JQIL 3RRQA 3HE7C 3V5KA 2WNGA 4QCIA 5I1DA 3UBXA 4XNXL 3CJJA 1VCAA 5TE7H 1AH1A 1BVKB 3QEQA 4GJTB 3DNKA 3LRGA 5HHXH 3KPNA 5F88B 4WWID 4KTDH 5ANMA 5SX4H 3SE4C 1R3HB 2WUCH 4P4KB 4WCYL 1LO3H 4W6XB 4NCC2 1EO5A 4HLZH 3MV7A 4F7MB 4OF6A 3GRWH 2FGWH 2YC1A 5M7QA 1OAQL 1BQLL 3HG1E 1UADC 2PW2A 5F7DA 3X14A 5FOBA 3RPKA 1XF5B 4LSVL 1H0DB 1RIUH 1DQDL 5E03A 3MFGB 4Z7UB 1EGJH 3KYAA 4Z95L 2V7HA 1AQKH 4QKXB 4ZXBD 3MOAL 5E2UH 3B4NA 4UT7H 2BOCA 5ALBH 1YEIH 3IF1A 3IXAB 3M17B 5A2KH 2G75A 1KELH 5DO2D 1HHGB 4B41A 5DJ6B 1I7RB 4UV4H 1SBSL 3BPLC 3IRZA 1UWXK 4JKPL 4YXLL 4X6DA 1XF4A 5D1QB 5IROC 4FQLL 2WIMA 4ONFH 1YEEH 1ZHNA 3O11A 3OXRB 1TDQA 2EYSA 3EFFB 4WDIB 5MENA 2QL1A 4TNWK 5D1ZD 4WJ5B 3NIGE 5E9DA 3HN3A 3GSQB 3FT4A 4HX1A 1AKJB 4O2EA 3R06B 4QXTA 4OF8A 3TFKD 3OXSA 3VDBA 2IQ9H 3GMNA 3HMXA 5DEGB 1U8OB 2DI8A 2IPKB 5GGRB 4CN1A 4UOW1 4XCYB 4WHYH 3D9AL 4DUWA 2B1AL 2H8PB 1KTKE 1KENL 4KJQD 1G7MA 4P4RA 2HVKB 3UTTB 5IW6B 4PLKC 4WTZA 4JDZB 5I1AA 1PKQE 1N6VA 4RA0C 2EDTA 5L6YL 2HRPH 2BCKA 3DYMA 3I84A 4XVUC 4DZ8A 5DD6B 3W9DB 1MUJA 5C0IB 2APWA 5CMAA 4JANB 3VH8B 3CFDB 2JJTA 4XWGL 1FIEA 5GSRB 1RURL 5ADOH 2YPKB 3NPSC 1MF2L 3UBXG 1IEHA 4U2YA 3O4OB 1SY6H 4J8RA 4PJXB 4JO4L 2RGSA 4NKIL 3EYOB 4YDLC 4NZUH 2ESVA 1MIML 4HUXA 3ZHDA 1FL6A 1T5WB 3RL1A 1AGDA 1RUML 3FB6B 3HUJB 3WS3A 2V7NB 1I3RB 3T2OA 3WFZA 1ULVA 1DEEB 4XXDB 5DLML 5H35B 4QEGA 2NY3C 4UMGA 4UT6H 1IL1B 3QQNA 4TUKL 3ZTNL 2DTSA 4W4OC 4S1QL 2PXYA 5BOPA 1RZ7L 5HYJA 3L6FB 4JRYB 1IGIH 2ZZUT 2XN9D 2BNQA 4HIEA 3EO0B 4NT6A 3QQ9C 4HT1H 3WKNA 1R5VA 3MLSH 3VG0H 1BREA 3AM8A 4K8RC 3DRTA 3ZE2F 2WWKO 3T04D 3O6KH 2V5SA 3WIHL 1RJYB 4Y16A 3R4DA 3L3HB 3SDXF 3ZMRA 3QG6B 3V0AC 3OL2A 2DYPA 3QRGL 5DRXA 4XPHL 1T1XA 3O2VL 5HGHA 5CSBA 3SE3C 1BF2A 1BBJA 4H0GA 3MO1B 4N1HB 1JRHI 3P0VL 2ADFH 3P11L 1QHPA 1JF1B 3WUZA 1QRNE 3BD4A 5AG9A 5CHNB 1R3JA 1U92A 2HH0L 3OPZH 1Q0XL 4PRAB 4Y4KC 1GZQB 2BX5A 1NGPL 4WFGD 5F1NA 4NKQB 3OHXA 5DMGD 4D0DA 4KMQA 3QEUB 4I77H 1OAYH 5ADPH 1ZT1B 4X8JA 2RFXB 2VZ1A 2QSCL 5FKPA 3ULSA 3LD8C 4WTZG 4P2QD 3TT3L 4NWUL 1LDPH 2E5EA 5BCAA 2W60B 3V9FA 4NQCD 3IXTB 5F96H 4P59L 1A6WL 1KIPB 2OR8A 4GKNA 3TIDB 1EERB 4ODXA 1DQLH 3VI4E 2FX9H 3NN8B 3UO1L 1CE6B 4PJAF 3I9GH 4ZXBA 1S5IH 5I18L 2DBLH 2FD6H 2XRAH 2A77L 4G8EB 2F15A 1T0NB 1XGUB 2H1PH 2VLKE 5T5NF 5L8JB 3RX7A 5JZ7D 4OFDA 3CX5J 2IALB 3AREC 5BO1L 3U0WL 3MV9D 3MLZH 4LASL 5CEZE 1T2XA 1UCBL 2NTFB 1HSBB 4A2MA 3VRJA 4BA8A 4JFHE