5IMOB

Nanobody targeting mouse vsig4 in spacegroup p3221
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASGRTFSSYGMGWFRQAPGKEREFVAAIRWNGGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAGRWDKYGSSFQDEYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nanobody
publication title Structural evaluation of a nanobody targeting complement receptor Vsig4 and its cross reactivity
pubmed doi rcsb
source organism Camelidae
molecule tags Immune system
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5imoB00
3CH1A 5D70H 4LVEA 4FRWA 4Q74A 2XPGB 12E8H 5F7LB 4R90L 2AJUH 3IDYC 2VXQH 1LE5A 2P5EE 3V5HA 4XCNA 4U6TA 4LLYB 1REIA 1RU9H 1A1NB 1MJUH 3C6LD 1LD9B 1S78D 2F74B 1YJDL 3GBML 5E99L 3UAJC 3QFJE 4U1LB 3REVB 2I26N 3A6BH 2X89D 1I7RA 4O2EA 2CRMA 2EE6A 1JK8A 5IFAL 2NXZC 1HQ4A 3BKYH 3RY6C 3U0TA 2ZCHL 4C56D 1GPOL 2KUTA 2WINB 3FO9A 3BP4B 4X5WB 2GCYB 4GAGH 4BYHA 1HEZA 4Z77A 8FABA 2AQ1A 1IC4H 1NJ9B 2VJXA 3QIUD 3DX6B 5I8EB 3FRUB 5FCUH 4U3CA 4EI5A 1XR8B 4KJWD 1PG7X 4ZAKB 3U7YL 2NLJA 4M62L 4X99A 3QR2A 4LCUA 4H25A 4Y5XC 3RZWA 2QSCH 2CIIA 3U9PL 3DX8B 4H8WL 4LSUH 4BZ2H 5HGDB 4EN3A 1BJMA 3M17A 4AL8L 2CXKA 3CFJA 5D96B 4IDLA 4NO0A 3QUXA 4OFDA 5CJOH 1OTUD 2C1OA 2DQIH 4R4FL 3MNWA 1R6VA 2D2OA 3VCLA 1MEXH 3QDMB 1OW0A 1WUNT 2EH8L 2F5AH 1R24A 3KYNA 4L3EA 3X3GL 2PO6D 4CJ0A 3THML 3TP4A 4KQ3H 1Y6NR 3LMJL 4TNVF 3IYLW 4GUPA 2AK1L 3KPOA 5K9QI 4BFGA 2C1PA 2ARJB 1D5XA 5C08D 4WI7A 5K59F 3LRSB 4AT6B 1BZ7B 1JV5A 4HLJA 4CKVX 1KULA 2E7LA 4RGOL 2M26A 3N85H 1NSNL 3SDXE 1JGDA 2ZUYA 5EH1A 4Z7WF 4NQCE 3TBSB 5L88H 1VA9A 2K7PA 3NCBB 2VLRA 5E08H 3BEWA 43C9B 5F9DC 1TJGH 3C5JB 2CDGA 5FGRA 3IDIA 2X70B 3SDCB 1GRWA 4DGYL 3QZWA 32C2A 1MHEA 2VMFA 4R4BA 1QO3A 1JNHB 1M6OA 2JCCB 4YHYB 1AKJA 5BVPH 4ZDHA 5CEXA 1T0MB 3ZL4L 5SV4A 4QWWC 1MPAL 4FQXC 2FX9H 4JRWA 1P1ZB 5IKCB 5CGTA 4WO4C 5INDB 1CD1B 5FECB 3VG9C 4HC1A 2IADB 4P2CG 5C0CE 1G7JA 4HF5H 4AIZB 4JPVL 3LEXA 4EIZC 1ZAGA 4NNYA 1M71B 2APBA 5DUML 4TNVK 2QQNL 4QRQB 1DUYB 2ENYA 2ITDA 3MRRA 1CFQA 4X4XB 4N0UB 1FNGB 3WS6C 3H7BB 2W9EH 2OR9H 3EO9H 1YEHL 3BH8B 4D9QE 5IESL 5EU4A 3U2SA 2PYFB 3QHFL 4PJXF 5B39A 3ZHDA 1JTOA 1T7VA 4MS8C 1KN4H 4KZDL 3L3KA 3QAZB 4X7SH 4L4TE 2NY5H 1QLRB 4NRXA 4KGJA 1R5WB 2YK1L 4L8SC 3BN9D 1D5ZA 1BFTA 1I3UA 3O9WB 1A3RL 2E8YA 3C6SA 5SX5K 3QYCA 2BNQB 4G9FD 5GZOC 2ESVB 2CLVA 2VLJE 4JJHA 3T0WA 1TJHL 4LFHD 5FO9A 5D7LB 5IHZA 4ZPTB 2NY6B 1MF2H 3ZMRA 2NY0B 5FAAA 4XNQA 1QBLL 2VQUA 4XHJC 3PL6A 1HE7A 1CGWA 3HRZA 5L6YH 1AO7E 1D5BA 4OLVL 4ODTH 3PUCA 5LVEA 2W1NA 4LHQB 2P44B 3I84A 3RPIA 3ZKMC 4MQ7A 5T5NF 1J0JA 4K94H 4PR5A 5EIIA 1CICA 4AEEA 4QOKA 4PP1C 2EDRA 5HYSA 3MROA 3G5XA 1A6WH 4DW2L 4U1IA 5J11C 1NCNA 3QEGH 1A14H 1DQML 2XZQH 3LKPA 5C0GA 5T1DL 3W2DH 1RUMH 1HHHA 1Q9KA 1CG9A 2O5XH 4Z7VA 3FT3A 5IJVB 3MRQB 1JYNA 4JREC 5H2BA 4AEIH 1HYSD 4U1SA 2OK0H 1WTLA 2QR0A 4ZAKD 3MNZB 1NCCH 2QKIB 3MQIA 1RURL 3FZUD 1GGCL 1GZPB 1K6QH 4ODXA 1XFPA 3PQYE 4Y0GA 1F00I 1HOCB 2W9DH 4MNQA 5SWZA 5I8CB 3RWCA 4WI5A 1VPOH 4XCFL 1ZHBB 3QI9C 5DQJA 1X44A 4JFHD 1LO4H 2H9GA 2IANE 1LP9A 3RL2A 1OGAA 3T4AB 4HWZA 1X4ZA 4PJIA 3QXVA 2VDLH 4K3DH 1D6EB 3TH3T 4RWYH 4Z18A 5GZNC 5IMOB 3NFNB 3WJJA 3P0YH 3CC5A 2RBLA 1N0XH 3J8F7 4K71C 2AV7A 4MD5B 4E42B 2VAAB 3GO1H 2VZTA 5F6IC 4BQ6A 3STZB 3HI6L 1S5IH 4NQSB 3RVUD 4YGAB 1CBVH 4Y4KA 2W65B 3QEUB 1PLGL 4PJIF 3LSOB 3LD8C 2W0LA 3EYFA 5DRZA 3QQNA 1FNEA 1NMBL 1I75A 4WW2A 5ID0A 4L8CB 3VXRE 5HPOA 4TOYH 1KJMA 1Q94A 4I13B 1EO5A 3SCMA 5C09B 3LS4H 5EU5A 4JR9L 4JHAH 3SKOB 3RDTB 2IPUG 2R4SL 1MCRA 1VEPA 3EFFA 5D7JA 4F9LC 1U3JA 2P1YA 3BN3B 4ZMAT 3VXPA 5I1GH 4XTRD 4I3RL 4EUPG 4P46B 2YPKA 2UV3A 2YOCA 2AVGA 1H3TA 2HFGL 4MSWB 3WKNA 3U1SL 3QDJD 4OGYH 3G08B 4NHCL 1DBKL 2L4OA 1FPTH 1FVDA 4GMTL 4XBGA 3V8CA 1KBGL 5B38G 5J13C 4YHOL 3ZE2E 3O0RH 2R0ZH 2ARJQ 1FVCB 1S7WA 1LO5B 3AS3A 3O6ML 4OZGA 5KBNC 1AR1C 1VGEH 1SYVA 4LMQI 1NDMB 4F7EB 1KEMH 2I9TB 5IR1A 1AP2A 1X7QA 1T2JA 1ETZB 4QCIB 4UT7L 5F72S 4A6YA 4K7PX 5LXGL 4HIHA 1L7TL 2XA8L 1AXTH 4JFFB 1M1SA 5DVKA 3MXVH 1JF6A 3QRGH 4KRPB 1NC2B 3D6GA 1A6UL 1PKOA 1PSKH 5FV2A 1WFUA 2XZZA 1LDPL 3L3HA 2I5YH 2DBJA 4OZGF 4ZXBA 1U6AL 3MRJB 3EYVB 4KDTA 3O9WD 2ED9A 1T1YA 4YDVA 5CEZE 4OD1L 2BNQD 2ESVD 3WLBB 4M6ML 5DHVB 3HCVB 2BOCB 3F5WA 3FQXB 3D3VE 2ADFH 2KKQA 2X9WA 3WD5L 4B0MM 2NY6D 2NY0D 5A2JH 3QUMA 5T1MA 4GW5B 2BY2A 5L0QC 5FGSA 4MXWH 4N1HB 3BRFA 1MSPA 1FE8L 5HGGS 2BVPB 4JN1L 4XMKL 4UOW1 1F3DJ 4M1CD 5DHYA 3VRLE 3OKMB 3E2HC 5BRZA 1MWAA 1KJ2H 1HDMA 1II4E 1I9IL 1U8OB 2ZUVA 4WI2A 2ICWI 2M1KA 5GGQL 3RTQB 5ESVA 4WENB 1IT9L 3TA3B 4QXUH 1GC1H 3PV7A 1U8MB 1TZHA 2ENSA 1HHKB 2WLYA 1V7NH 3PJSB 2EDFA 1IAIH 3L6FA 1WCBB 2AEWA 4DN3H 5ICZB 1FQ9C 3C5ZA 1K2DB 5BS0B 3C87A 4ZS7L 4RMQA 3EW3B 3IDMA 2FB4H 1PQZA 4Y89A 1I8IA 1NAMA 4FMFA 2EDHA 3WFHB 2OBGA 3MCG1 2IAMB 3QQ9C 3ZDZE 1NDGA 4DKEH 4EDXA 5HYFA 1EVUA 1G0DA 3IFPB 3MV7D 1OM3L 3OXSA 3C5SA 3BQUC 1LDSA 1ZLUH 3SDYL 4HFWA 2UZXB 3DMMA 3MLXH 2KZ1B 1T1ZA 3P77B 2DDQL 4H88H 5CGMA 5IK3A 5E8OB 3GSNA 3SQBA 4Q7DA 1YPZE 2Y5TB 2VZSA 4D9RD 5GSRA 4XI5D 1MHCA 4HIEA 1DEDA 2AEIT 1JZ3A 2VN7A 4MJ5B 4EUPH 1OAUL 1FRGL 5ESAB 3ISWA 4N9GB 5ACZB 1K8IA 4Y4HC 4I8DA 1MRCL 4NKQB 2R4RL 3E3QC 5IVZA 1GGBL 1Z9MA 5ACLA 4NZDA 4OCSH 4IJ3B 3RDTD 5ECJE 3P11L 3RNQA 4HCRL 4BFEA 1CVRA 4JFOA 1ORQA 1VFMA 3SY0A 3VGHA 3SE8H 3KWWB 2R1XB 2C9AA 4N9OB 5I17A 3LN5A 4I18B 3OKKA 4JHZA 4RIRB 5EG6C 5MEPB 2X4NB 2IC2A 4M02A 4M6OH 5E70A 3LPWA 3BJ91 3QO1A 4PB0L 4FFYH 4M3JA 2DD8H 4DAGL 2Y7QB 1DQTA 2Y4SA 3NA9L 4GMSH 4WW2C 3I75B 2YA1A 1ES0A 3QUYC 4F80A 5AWNL 3H9ZA 3X11B 4WHTA 3ULUD 4H0IA 1G7QA 5E94B 1A7OH 2NTFB 5E6IB 2XXCB 2ZKHL 5K9QG 4JFFD 4PJFB 4ODUA 1I7TA 1OAZL 4OCRH 2JB6B 3B2UC 3CD4A 4NO2B 4OM1H 3BDXA 3WXVL 1R3JA 3HAEG 3PDGA 4QHNB 1I3VA 1NKOA 2MSPA 4K55A 3WLWD 2OJEB 1HCFX 1RK0A 3C60B 3ZT5A 5C08A 3QDHA 4KROC 2R8SH 4G7VL 4UDUB 3NIDF 5TH2B 1DLHA 3UZQA 1CTOA 2DQJH 1LEKA 1IQWL 5DTFB 4Z7UA 2EDTA 1HI6B 1J12A 5ITFA 5KSBF 1J7VR 5HI3C 3OB8A 2XKSA 4HPOH 2O5ZL 3GKWH 4PJBF 4PTTB 3DVNB 2BVQB 4YHPA 3RTQD 5GS1A 3DPBA 3TA3D 3WHE0 5KN5A 1MCKA 5I71C 2Q87A 2VE6A 3ARUA 1QFWL 5FA3B 2P24A 4NKIH 3CXHK 1UZ6F 5JXAH 4Y2OA 2CKBH 1KV3A 4BJLA 5ID1A 3VXOB 1R3IL 2Z31B 5K59E 3EJZD 2W38A 4CADA 2IFGA 3TVMB 1G7LA 2JIXA 4L3EE 4UZGA 5CS7A 4ZO7A 1ZLWK 4OFPA 3SQOH 4KVCL 1C8PA 5FM4A 2GAZB 4JO3H 4Z7WE 5DJYB 2BFVL 1U3YA 3FB8A 1QRND 4JDZB 4I3SH 2I60H 3TJHD 4KPHH 3W82A 4D0DB 4YDJA 2FX8H 4G6FB 3EZ8A 5DD1L 2NY5C 3QPXH 4NUGH 2YZ8A 1T04A 3MRIA 1BBDH 1UXWA 1IGYA 2ZSVA 2ZCLH 3MUGA 2W60B 3T4YB 1C08A 3VDCA 1RZJL 2NR6C 3UBXG 4CAGA 4LNRB 4L9LB 4U1KB 2VR4A 2XPGA 5F7EH 2VLRE 3HTLX 4K8RD 1T2QL 1NL0L 4LLYA 5C6PB 5J8OA 2NY4B 1LD9A 2FO4B 1AXSA 1RK1B 2FATL 2BHZA 3HZVB 3REVA 1CXFA 2F8XC 3OZ9H 1RV6X 1P84J 1X6LA 4K94C 2ZG2A 5HHMB 5CKGA 3BUYA 5BV7B 4MAYC 2WINA 5B3NA 4MYWB 2VXVL 3BP4A 3TT1L 2GSGB 4X5WA 4Z7NF 4R2GB 2GCYA 4OCMC 1A3QA 2QQLH 2DMBA 1NJ9A 4U7KA 3DX6A 3FRUA 1SEQL 4XNXL 1XR8A 1MNUL 4A2MA 4U1GB 1I1RA 1NGPL 5AYUL 2EXWC 2NX5B 2PW2B 5DQDH 5EC1B 5JA8B 4YIQB 4HS6A 1FNSH 2X42A 4KDVA 3C6LC 5HGDA 2HH0L 3N0PB 1S78C 3KXFD 1BFVL 1VERA 1OTSD 4UT9L 5E6ZA 3WBDA 1I8KB 1MCEA 3QDMA 3B4NA 1TTFA 3CLFL 1IVLA 3P30H 4PD4J 3CVHL 3VXUA 1HWHB 4L8BB 1C5CH 3QIUC 5MHSE 2OMNA 1HH6B 3MXWH 4JANB 4HK0B 1EBPA 15C8H 3O6KH 1FO0B 3C60D 1QHOA 2DTSA 2FWOB 3LRSA 3DXAA 5DRXB 1BZ7A 4AT6A 4XWGL 1BWMA 1LO3L 2W59A 4M5YL 2Q1EA 3AROA 3IS0X 2ED7A 4LQFH 4CUCA 3UJIL 1GGUA 1UCTA 4QOKE 4ELKB 1NGQH 3TBSA 4NKOB 1WWCA 2NQCA 1KB9J 1F4YH 1OTUC 3WEXB 5IBTL 1NAKL 3ULUH 4WI9A 3R0MA 4M7ZC 3C5JA 3HMWL 4Z7VE 2X70A 3SDCA 3RVXC 5HYJB 3BJLA 2F54E 2PO6C 5F1OB 1QFPA 4ZUTB 1KCLA 5JLZB 5IT2L 4B7IA 4P5MB 1JNHA 4PLJD 1DQDL 3BDYH 1AY1L 1OSPH 1T0MA 1Q1JH 2AABH 2BX5A 3GMOB 5D6CB 1INEH 4M8VA 3TN0B 3BGFB 1JF1B 1P1ZA 3PE9A 5IKCA 4HS8L 4MNQE 3L3JB 5SWZE 1BQHG 1CD1A 5FECA 2WBJB 2IADA 4YK4C 1Y6MR 4JFPB 1U95B 3M1BB 4AIZA 5C9JB 1OGAE 2Z31D 3OR6A 1M71A 3WO4B 4I9WD 4PJIE 3IAGC 3W81A 2B1HH 3CX5K 4QRQA 3TVMD 3ZDYF 5GJSH 1FJ1B 5EN2B 3JUZA 4X4XA 1ZKAA 5E4IA 4N0UA 1FNGA 4XVUD 2D9CA 3K46A 4DK6A 3FQUB 3BH8A 3QXWA 1L4IA 3WV0A 4E0RB 1G7PB 5MI0B 4LSRL 2PYFA 1I7UA 4YFEA 1FYHB 5DJ2B 5I1HH 2ADIB 1RUKH 4YFLI 3L7EB 4WJ5A 1T1XB 2BHYA 1RAMA 1SM3H 1R5WA 1JPSL 4U7SA 1J1XH 4WTXA 4ODWB 4Q6IB 4F2MB 4Y16D 4Z5RB 3MFGB 3S6CA 2BNQA 5IEHB 4LVNC 3VGAC 3CCHB 4E41A 5D7LA 5JW4Q 5L8KB 4PJ7B 4K2UL 3BI9X 1BM3H 1YNTB 4WFED 2ZUQC 2YN3A 4YWGL 5H8DA 3MX0A 1ZANL 4WHDA 1D7FA 1AD0B 3ZE0E 4ZUWA 1QYGH 5AG9A 1T03H 3BXNB 2EDXA 2CRIA 5D1QB 3OMZA 4AG4H 2E9JA 1FFRA 3I9GH 3WMSA 3NFSH 1TQCB 4CU6A 1G0YR 3MOAL 2Q86A 5CJXC 5HHMD 1AI1H 1C7SA 2IWGA 3FMGH 4U6VH 1GC1C 3BN9C 1CDJA 5JNYB 3FL7A 1UWXK 1AGDB 3OKDA 4X8JB 3QNXB 4YQXL 2J6EL 5D1ZA 4FTVB 1CE6B 5HVGB 1O5DT 3VD9A 4MA3B 4OZGE 4ZOBA 5IJVA 2HFFB 1GAFL 4P4KC 3L1OH 2J7LA 4M9OA 3MNZA 1INDL 3DGGB 1GXEA 3S4SB 1B90A 1U8PA 4K8RH 2QKIA 3MLWH 4EIGB 2XTJB 1FFOB 1GZPA 2YD4A 5A16B 5HDQH 1HOCA 3EOBB 5I8CA 4ZFGH 3CUPB 5GRUL 2ILLA 4Y1AE 1ZHBA 4XXCC 3V52H 5I0ZA 1FG2A 2D3VA 3BD4A 3MV8B 3D85B 4J3XA 2BVEA 4UU9A 2DQHH 1CGVA 4TSBH 2OX5A 1AH1A 1NCWL 5IMOA 3NFNA 3IFOB 5DEZA 2MWCA 5CKAA 3HI1A 3V6ZB 1N8ZA 1HHIA 4OQTL 4E42A 2VAAA 4ODBD 4PV8A 1HYSC 3STZA 1U91B 4NQSA 2A6KB 4LSQL 3OSKA 1LK3H 4ZAKC 5F7NC 3RZCA 1AXIB 4KMTL 4QY8B 2W65A 3UTSB 3MSPA 3KPSA 3B9KC 5HVHB 1A7QH 3FZUC 5BRZE 1OL0A 4S0SD 1SVCP 4HBQA 2AJ3B 2BRRL 3WFBH 3A0OA 3NCJH 4L8CA 3CX2A 5AYQA 3RUGB 4S1RH 4V2BA 5D7SL 5C09A 4LSDA 4ZPVB 3SKOA 3RDTA 3ROLB 4RFOL 4NJAH 2Q6WB 3H2WA 3SDAB 4YBQD 2R2BB 2P4AB 1U3HD 4S1QH 2HMID 5F88A 3M8OH 4AQOA 4YDIL 2AEPH 4P46A 2GITA 2V2XA 1OOAA 2G9HB 4HQQL 2QADB 4MSWA 3RVUC 3G08A 5DJDB 3WFCH 5A40E 5D2NB 4G42B 1K4CB 3CMOL 1A7PL 3MCLL 4MHHI 1BX2A 5E1AA 4OF3A 1FVCA 1LO5A 2PCPB 2YD3A 1EGJA 1A1OB 2VISB 3V5DA 1U42A 4WHCA 2O61B 1NDMA 4F7EA 5CILH 2GSIA 4JAMB 1SYSB 1FG9C 1J1OL 4R3SB 4YPGB 3RIAF 3FTGB 1ETZA 4OQ1A 1T6VN 4QCIA 4LQ1A 1T21B 2LQRA 1CR9L 1T6WA 1MFAL 5CZVL 2DLGA 1OGTB 2B5IB 3NGBC 4JFFA 4JG0L 5FUZL 5F9OH 3P4NA 1NC2A 2ORBL 2Z93B 5TE4L 3H42L 4XTRC 4B5EA 1JI1A 2H41A 1Z0MA 4NNPH 3MRJA 3EYVA 4M1DH 1KCUL 2VTFA 3WLBA 4HUWA 5DHVA 3HCVA 3QCUL 1KF9B 3OAUL 3UC0L 3MRCB 3FQXA 4FNLL 1B4JH 4KI1A 4LSVL 5JQ6H 3QQ3B 4E9LA 2A6DB 1P4LB 4O9HL 4HKXB 4GW5A 5IW6A 1D9KB 3CXDL 5GGTL 3GUTA 5IJKA 5GRXG 1Z0NA 3TPUB 3RWIA 1KXVC 1BVZA 4B53A 4Q0XL 2B0SL 4LDEB 4Z0XB 4QTIH 1HK6A 1C5BH 2VWEC 3OKMA 1BD2B 3GB7A 4V1DB 2VDML 2GQHA 5HSFA 1U8OA 4CMHC 3VXSD 5HY9B 1OQOA 4O5LH 2YD5A 3TH2T 4KI5D 4F7CB 4HUXB 3HC0A 3TA3A 5M7QA 1BFOB 3K8LA 3UYOD 1HHKA 2GJ6B 3O9WC 3MRKB 4IIQB 4RAUB 5BW7C 3RIAK 3PJSA 4I4WB 4XPGH 5CSBA 2YD1A 5FM8A 1NMCB 2EIDA 3BZEB 1WCBA 1MHPH 4OZ4B 3WE6B 5ICZA 3B9DA 2NY6C 2NY0C 1T5WA 3GMLB 1PDKA 3NIDE 3QQ4B 5BS0A 2V7HB 2XTJD 3KDMB 1F2QA 2B4CC 4PJ5B 1BBJA 4TTDD 2IAMA 1H8OA 4NNXB 2Q8BH 3OL2A 4QNPF 4APQB 5IB5B 2OL3L 4XNYH 2H45A 4WNQB 4NM4L 3AS2A 1MQ8A 3IFPA 2D03H 3MV8D 3PWPA 5A2LH 5C08E 4I3GA 3ULSB 5M94B 2YN5A 3P77A 4PJBE 5IWLC 4UQ3B 2L7UA 5ALBL 3TYGH 3PHOB 5C86A 1Q9LA 3BESR 3O81A 2A74A 2IEPA 3QB7C 3L5IA 1NGXB 4Z7UE 1X5FA 4LBEB 2Y5TA 4Z6AT 4F15B 5F7HA 3B2VH 1XF4B 1UZ6E 1MFEL 3LN4B 2BY1A 5TDNB 3UEZA 3MUJA 4LAQL 4MJ5A 1LVEA 5ESAA 2BNUB 1VENA 3O2VL 2NZIA 4X80H 3DX7B 4K23L 3WUWG 4ZUVB 4NN5C 5L9DL 4EOWH 1YEIH 3MJ9A 3U48A 2VAJA 1CYGA 3TEUA 1LO2L 3I02B 5BZWA 2H32B 1H3VA 2V9TA 1S7QB 3HPLB 4XPAH 3S36H 3BW9B 1G9NL 2HJKA 3VRJA 2AK4B 5C0ND 5EU7E 3KWWA 2R1XA 2HLFC 3BIBX 3U36B 1FFPA 4I18A 4RIRA 3ARYA 2QADD 5MEPA 5I75C 4S1SH 4UTBH 4XI5C 3MLVH 5FYKD 3BKJL 3KNBB 3Q5TA 1L6XA 4XH2B 4WTWA 1B6UA 4X6BB 3SJVA 4LVOC 1U2HA 5I73B 1I3GH 2Y7QA 5CUSH 3O41B 3I75A 4N0CD 4JHWH 3TJEH 3X11A 3ZKXC 5GS0H 2NW3B 3UMTA 5GIRB 1UWEL 2BXZA 3QNYB 1DL7H 5MENA 1KXQE 1ZSDB 2AJVH 4XP5L 2NTFA 5DO2D 3QO0A 5E6IA 2EC9T 3K80A 3ARPA 1JNJA 5KANI 4PJFA 1UACL 5E00A 5EOCJ 1KN2L 3TESA 4QLRA 2IQ9L 1A9BB 2JB6A 3MLTB 1FLRL 1UGNA 3DUHA 3HB3D 4JFEB 4NO2A 1LGVA 3VGGA 4HC1L 4ONFH 4QHNA 2YPLB 4BSVA 2OJEA 3VFUB 2AJSL 5DD5H 1RUQH 1QRKA 5J7CC 4UDUA 5GGUA 2XZCH 1AE6H 1NC4B 1YC8A 1DTUA 1CL7L 4H26B 2FD6H 1SQ2N 4S1DD 5DTFA 3TT3L 1DBBH 3RHWF 3BDBA 4OIAA 3UPCA 1HI6A 3T2NH 3IDXL 4X83A 3ULUC 3H9HB 2RJMA 1J1PL 2ATPB 1FYTB 5CIPH 1HXYB 3DV6A 4G7YH 2VZ3A 3IKCB 1YN6B 1L7IL 4PTTA 3O2WL 3DVNA 5CJ8A 2BVQA 5F1KC 4M3KB 5FHBH 3KYOB 1RIVH 4NJ9L 1NUNB 4JFDD 4GQ9H 4NZRL 1UH4A 3WLWC 3HNSL 5FA3A 3MLZL 3FN0L 2HVJB 1J0HA 5DUBB 1ZHNB 5FYJE 2A73B 3RGHA 3LQAH 1HN1A 1IC5L 4LLVB 3VXOA 3OG6B 5IBLC 4KJQD 3QDME 3VFSB 1HHGB 3TVMA 4QO1A 1X5ZA 3DECA 4YO0A 3HNVH 5DF0A 1QFWM 4PJ5D 1QNZH 5FYLE 4TULL 4WDIB 3VXUE 1UQSB 4U31A 4APQD 4JDZA 5TDPB 3CSYB 4JVWA 3K74B 5TE7H 1X5HA 1F90H 2V5SA 3VXME 1FZJA 3EGSB 5DHXB 4D0DA 3EKCA 3KYMB 2OI9B 3LDBB 3FCTB 3JZ7A 3RTQC 2BOBB 2OSLA 3TA3C 3DXAE 3U30B 5D70L 4BA8A 3T0DA 4Z7QE 1B9ZA 4OTXH 3RNKB 3VFVB 2W60A 5CGYD 4L9LA 3QBTB 1YUHB 4AENB 3TWCL 2HTLD 3EJZC 3TF7C 2DM4A 3MRNB 1WBXB 2X1QA 4P9HH 4PJDB 1KJ3H 1AGBA 3FO2B 5CMAB 4JFXA 3QXAB 3A6BL 4WUUB 4HIXL 2FO4A 3GHBH 3ZDYE 1EHLH 1RK1A 4NWUH 5DS8B 5IMLA 1U36A 2RQ8A 1U8QB 3HZVA 4UBDD 4YHNB 5KW9H 3TJHC 4L4VE 4QYOB 4GAGL 4JN2B 4WEBL 1JMZA 1IC4L 3B9VA 1ACZA 4W6YB 3VFMB 2GSGA 5CD3B 1VFOA 3W39B 5HGBB 2FLRT 4UOJA 3RX8A 3G5YB 1MFDH 2VDKH 5ENWB 2QSCL 2WAHA 3GHEL 5E8DH 2XOTA 4LSUL 4BZ2L 4QHKI 4TPRL 2GEEA 3MJ7B 2NX5A 2PW2A 4K8RC 3ZSTA 1FN4A 3OR7B 4KXZI 4YIQA 4YUEH 3TBTB 2ICWJ 2R15A 1MCHA 4KTYA 4CGTA 1MEXL 2ZOLB 4I77L 1VSCA 1GYAA 1ACYH 4XNUL 2DYPB 2IBZX 4GAJH 2C4FT 4KQ3L 4I5BB 4E41E 5D7LE 5J12C 2IH1B 2NYYD 1ND0A 5GS2D 3FB7B 4LLQB 1EXUB 1T7WA 2RR3A 4PRIB 5CD5D 4I18C 1HH6A 2YPLD 3MLSH 2E9WA 1WVZA 4HK0A 3RX5A 4FQHA 3C8HA 3P4MB 5L2KB 1UH2A 1FO0A 5E7FA 1LMKA 5DYOB 3AMKA 3HMXH 2BSSB 3TIEB 5FYKH 1T89A 3RVWD 3IFLH 2PTTB 3ARBB 5C7XH 5L88L 4WHYG 4HFUL 5GXBB 5FUOH 3V0WL 5E2WH 1OTSC 2OZ4H 4NKOA 5DURD 3NIGF 4RGMB 1DBAH 4XCEB 3X3FH 3WEXA 5SWQB 1TVHB 5F96L 2BVOB 5DZLA 5DSCB 1FYTD 2FH6A 4Q9RH 4EBQL 3C8KB 4HX1A 5BVPL 5EULV 5HYJA 2VN4A 4F7TB 2FX9L 3GJFB 5JLZA 4P5MA 2VLME 4MHHG 1MCOL 1DFBH 3GMOA 4HXAH 5D6CA 1VGKB 3TN0A 4HF5L 5KTEH 2PTUA 3GMRB 3L3JA 1QBMH 3Q3GB 1WAAA 1F11B 2WBJA 3C60C 3UTTD 3QUML 3ET9F 4HWBA 4PV9B 3V7AE 1FORL 2VKWA 3QRFM 3WIIH 2X10A 5IROA 1U95A 3HLAB 3M1BA 2W9EL 3MRMB 3FAXA 1MY7A 2OTWB 3H9SE 2UZYB 1FJ1A 5EN2A 3FQUA 1BP3B 2EDQA 2KDGA 1KN4L 4ESKA 4X7SL 1WAAF 3WFZA 2X2YA 5DJ2A 1FGNL 3V6FB 2ADIA 2RGSA 3L7EA 4R9HA 2X9XA 4PLJC 1S7RB 1T1XA 4X6DA 3UBXB 2DLEA 3KPSE 3PWJB 4Q6IA 3O2DH 2QHLA 1UZ8A 3HE7A 3RP1A 5IEHA 1TPXB 1MF2L 3CCHA 4U1NA 4WCYH 3MLRH 1YJDH 5E99H 4PJ7A 1XGRA 5C92A 1HXMA 1YNTA 1NAML 2PYEB 2R0LH 4ODTL 2Z31C 5C09E 2KQMA 5GISH 4I48B 2Y07H 5FHAL 5FXCH 3TVMC 4UIMA 4JJ5A 1AD0A 4X6DF 4XVUC 4WUUD 4WV1C 4LLMB 3BXNA 3EZJB 5D1QA 1QBAA 2FSEB 3B83A 4LRNL 4O2CA 4PJ7F 1ZA3A 1CK0H 1L6ZA 3U7YH 2Z8SA 5DA0B 3EHBC 3QEGL 1A14L 2XZQL 1F4AA 2O5XL 3U9PH 3EYSH 4NFCA 3ARDB 4H8WH 1AGDA 4X8JA 1WC7B 5J9PA 3QNXA 4NT6B 4Y16C 3EYQD 4AL8H 3QJFB 4FTVA 4C4KT 1CE6A 1JPFB 5BJTB 1XCTB 1I85A 5J57B 1NCCL 1K8DB 1P4IH 2ICCA 4L9LC 4R4FH 4DUWA 2HFFA 5B8CB 2EH8H 2W9DL 3U0WL 2FGZA 5JOFB 3S4SA 1KLFA 1VPOL 1FFOA 4CN6A 2AQ2A 5A16A 3LV3A 3LRGA 3EOBA 3MYJB 4P5TB 3OAZH 3CUPA 1DQQA 3VFWB 3MV9A 1YMMB 1BF2A 3FT4A 2AV1B 2IPTL 2AK1H 1XCQB 3LEYH 4K3DL 5GJTL 2HKFL 4RWYL 5L2JB 2DYPD 1KCSL 3D85A 3BKCH 1WZ1L 3K8MA 2H32H 3P0YL 2FRGP 2Y23A 5HDBE 3CSBA 1N0XL 3GO1L 3O4OB 3IFOA 2P5EB 3NZHL 4G6JH 1J05A 1CGSH 1U91A 2XIDA 2A6KA 2VLKB 3PGFH 2VQTA 4U1GC 4JGUA 3GEWB 3O45B 4QY8A 4F8TA 3CZJA 3UTSA 2AS5M 4DGYH 3QFJB 3BP6B 5F7YC 3ARBD 1HWGB 1TTGA 4RGNE 4TOYL 1X5KA 3LS4L 3R4DA 1IGFH 2HT4D 4MJIB 4PBWD 4JHAL 1LO0L 1MPAH 2NY3B 4ZNEA 1K5NB 3RUGA 3SDDB 5HD8D 4ZPVA 1YECL 4QNPE 3ROLA 1J8KA 1RJZB 2P42B 1NFIA 3LQZB 3SDAA 5E8NB 2MFNA 2R2BA 4LGRB 2VERN 4Z7OE 5GS2H 1MCQA 3RKPA 4KKBD 3L7FB 1FPTL 5BS0E 1WBZA 2G9HA 2FNBA 5AZ2L 3ILQC 5DJDA 2C7UA 5D2NA 4G42A 4N0YH 1K4CA 3ORJA 5H37G 1JWUB 1F4XH 4XC1L 1WLHA 2EXYC 2Q7YB 3N1FC 3I6GB 4KZDH 5JXEA 1A1OA 2VISA 2V7NB 2Y25A 3PWPE 2EDOA 4FS0A 1BOYA 2YK1H 5KANG 2O61A 4JAMA 2J8UF 1A3RH 1AXTL 2FHFA 4R3SA 4YPGA 3FTGA 3QRGL 4NWTH 1TJHH 1T21A 2V5TA 1O7VA 1AJ7H 4X9BA 1OGTA 2AXHA 4G8GD 3O3BB 4IMKC 5JOPD 3W5MA 4YBQC 1U3HC 2Z93A 4XPBH 2GYSA 1XIWD 1P4BL 4OLVH 1T7XA 2WUCH 4QF1B 3O8XC 1KELH 4NQCB 3MRCA 5D5MF 2EDKA 5KVMC 2GT9B 1UB5B 1JHTB 3ARGB 3GJEA 4I0PD 3QQ3A 4OF0A 3DI3B 1DEEB 2A6DA 1P4LA 4HKXA 1KCVH 1D9KA 4DW2H 2VSDA 1DVFB 1KYOJ 1CGXA 5T1DH 3V0VB 2Z91B 4Z0XA 5H35A 5K9KB 1BD2A 4V1DA 4YEEA 5MI0C 3U9UB 1P7QB 3QP3A 4QXUL 2VITB 1GC1L 1QSED 5I1LA 5IQ7H 5EU3B 3FQRB 4F7CA 4HGKC 4HUXA 1V7NL 1KPUB 1RURH 1GGCH 3BSZL 4PJ9D 3ARDD 1IAIL 2GJ6A 1FL5B 4RAUA 3SJVE 1IGMH 4DN3L 1A6TB 1IKNC 3S3JA 1XF2B 1JPGA 1MQKH 2UZIH 4JFYA 3BZEA 2L0DA 4OZ4A 2FB4L 2HN7B 4N8PA 4MLIA 3V4VH 1FNFA 3GMLA 3BD3A 4QT5B 4ZO9A 5MENE 4YXKH 2CQVA 1TENA 1MUJA 2V7HA 5FYKU 3P0VH 1RZKC 3V0AC 4OIIL 3KLSA 4PJFE 3B9EA 4PJ5A 4PJ8A 2A6IB 4LARL 4UILL 1ZHLB 2NY1B 3PWLB 4NNXA 1YEKH 4NQED 5IB5A 3HI6H 1S9YA 4WNQA 1IAOB 3T0ED 1KNOB 3G6JA 4KI5C 1PLGH 4Y8DC 3ULSA 3IXTB 4UQ3A 5F7KC 1MIEH 4X4ZA 1AIFB 1IGIL 2P5ED 2PUQT 1RUAL 1WIOA 1RQ5A 3EO1B 2G5BB 1ZLSL 2YMXH 3RWFB 4LBEA 1GCFA 2DS4A 3DWTA 5CBAA 4NKDB 4D94A 4JR9H 4LPTA 2VDOH 4L3AA 4P9HC 2XTJC 3QFJD 2ZUTA 3G6JF 4G3YH 3CDGA 1YDPB 2DQGH 4XBPB 4TTDC 2BNUA 4HUMB 4I3RH 3DX7A 4ZUVA 4NDMB 1DANT 2HFGH 5T1LA 1N59B 4KKLD 3U1SH 3BWAB 1NUDA 3I02A 3K81A 1KBGH 1S7QA 3S96B 3HPLA 2NTSP 1OAQL 1MREH 2H26A 3LKRB 3BW9A 4HK3N 4OT1H 2AK4A 3A6CH 4M6OL 1TDQA 3U36A 4WY7H 1EAPA 1DCLA 4FFYL 2N4IA 2DD8L 4OCNC 2DQFB 1MCLA 5EOQL 4XH2A 2IANB 5D72L 4X6BA 3I2CH 5DD3L 1OSZB 1LDPH 1T1WB 3O41A 1LWRA 1B2WL 4U1MB 3C08H 1U6AH 1SVZA 4QRRA 4W6XB 2NW3A 3WNMA 5GIRA 1A6ZB 3QNYA 1GJIA 2QQKH 1ZSDA 4M6MH 3MUZ1 4OCRL 5AUMA 4XBEH 4MNHB 2D31B 3DSFL 5E9DE 3WD5H 3ARTA 2O26U 4KK6D 3VGEA 1KT2A 2PTVA 4YBLB 1A9BA 5DMKB 5C0NC 4JFEA 2VZ1A 4LCIL 2R8SL 4N8VB 2ADGB 4X5LA 2QADC 3BHBB 5HGAA 3VFUA 2CUHA 4P2RA 2H8PB 5C0BA 5D2NC 5BMFL 2DQJL 3QH3B 1WT5A 1ZA6B 4NQCD 1MAMH 2VABB 3VXRB 1AGEB 3SGJC 3CAFA 3QDAA 2MQ0A 4WWKA 4RSVA 3VWJD 5HHOA 3LB6D 2VYRE 1NC4A 5GGQH 4DZBB 1IT9H 4H26A 5EA0L 3QIBB 4N0CC 5I8OH 4QHUA 4QXTB 4HPOL 1BFSA 4PG2C 1OPGL 4NUJA 5J0BA 4Z8FL 5CWSB 4OFYD 3H9HA 4JQIL 4PJGF 2ATPA 1C1EH 5DO2C 3HUJF 3OGOE 1HXYA 2JLLA 2B5IC 3OKYA 4FXLA 2Y72A 3IKCA 4KH2A 3JV5A 4RX4D 4ZS7H 4BKLB 3V95A 2NX5E 3HB3C 3KYOA 1JZ5A 5C0CD 3OKNB 4BK5A 3OTTA 5JXAL 4YDLB 4UOW0 4JM2B 1N26A 4OAWB 2HVJA 5DUBA 2M2DA 1ZHNA 1F8TH 3OKOB 2A73A 1C12B 2K9UA 1BJ8A 1OM3H 1NQBA 2B4CL 4LLVA 4G43A 1BVLB 3SDYH 4JO3L 4D9QD 3VFSA 4Y4FB 2XG4A 1HHGA 3AC0A 4G80B 5MEOB 4PGDB 4S1DC 2MOVA 2DDQH 3P9WB 5DJCA 2I60L 5TE6H 4KPHL 3P4OB 5MEQA 1OHQA 3VFPB 1UQSA 3G5ZB 3IU3B 2FX8L 4JKMA 4L4TD 2LVEA 5TDPA 2YBRB 3CSYA 5D6DC 4NUGL 5HYQB 1J8HB 2A1WH 1B3JA 2VLJD 3U46B 4R7NB 4IRSB 3FCTA 4HZLA 3KHQA 3VFNB 5D93B 3D3VB 4E5XB 4RFNB 3RNKA 4IIQC 4P23B 3VFVA 3BPCA 1MRCH 3HNTH 1YJDC 1OP9A 1GGBH 4XVSH 3QWQB 2F5BH 4YHIB 1AO7D 5E2VH 1YUHA 1FFNB 4ZD3L 4WUKL 2A9MH 3BRGC 2EYTA 4WEMB 1NEZB 3MRNA 3WUWB 3GNML 4U6YB 3P11H 3FO2A 4J1UB 5CMAA 5HYJE 1ZLWH 4KXZH 3OZ9L 3QXAA 3AS1A 3S35X 4APQC 1U8QA 5HJ3B 4YHNA 2EKSB 2FIKB 4D3CL 4HS3B 4QYOA 4U0RC 4YDKH 1WAAE 2QQLL 4X98B 1IEHA 4BQ8A 3VFMA 5CD3A 1F3RB 2VO5A 3W39A 5HGBA 1JVKA 4HJ0D 2Q3ZA 3NA9H 3G5YA 2ARWA 3HFMH 4OZHA 5AWNH 5ENWA 5CGYC 1D3CA 2APFA 3MYZA 3PQYD 4WU5B 1X4XA 1FNSL 4Z78B 3HE6A 2HTLC 3MJ7A 2FX7L 2ZKHH 4M7LT 3OR7A 1IARB 4Y2DD 1WZMA 3TBTA 5DEGB 4G9DB 5J1TC 3QEQE 3ESUF 2IAND 3BYYA 3HC4H 1OAZH 4LKXB 2XXMB 2IMMA 3RBGA 4PTUB 1YNKL 4KRNA 4B50A 2ZOLA 4X6DE 3WXVH 4UBDC 4OBSA 5MP6H 5DMGD 3TC9A 1RZFH 4OZHF 3OHXB 2Y5EA 1P7KB 1S9WB 1DBJL 3CFBB 2P7TB 4F33B 1ZXQA 4KGLA 4U0QB 4I5BA 3HN3A 4HUVB 4PJ7E 1C5CL 3HAEA 2IH1A 3FB7A 4LLQA 1SJEB 15C8L 2VH5L 1EXUA 3DLQR 4PRIA 3NPSB 3BZDA 5CZKA 5FGBA 5JO5B 5TQ2H 1AHWB 4KFZC 1HSAB 5L2KA 1R3HB 3QEHB 4LQFL 1PG7H 5DYOA 2P8PB 3TIEA 3VXRD 1NGQL 3VFOB 2PTTA 1IAMA 1U8HB 1I1CA 5E8EB 1F4YL 4P4RA 1OQXA 5IB3A 4XCEA 2WM0A 5SWQA 4XXDA 3MZGB 1TVHA 3X13B 4FTVE 2BVOA 4RAVB 2OTUB 3RA7L 3D25B 3C8KA 5BXFA 1OSPL 4GQPH 1Q1JL 1X5JA 4ZSOB 4F7TA 2WUBL 1INEL 1UH3A 1CL7I 2NYYC 1TCMA 3GJFA 4OLXL 2IFFH 1KPVB 4HGWB 5EORL 1AR2A 2Z8WC 3ARQA 2AEQL 5CD5C 3ES6A 3O4LB 5I74C 1VGKA 3T65B 1TITA 5KSAD 4JM2D 4LHUB 3Q3GA 1RIHH 4P2OB 1F11A 3MV9E 4BELD 2B1HL 3RVWC 5GJSL 1SBBA 2WIMA 3HLAA 2CH8A 3P73A 5EOTB 3MRMA 4Y4FD 2HFEB 4MB5A 3ARVA 3ULUF 3LEVH 1X4YA 2APWA 4HH9B 4WI6A 5I1HL 1FBIL 2CRYA 1LE5B 3V5HB 5K93A 2ZCKH 2VR5A 1GOGA 1SM3L 4XB8A 4IRJD 3SBWC 3QSKB 3EDFA 5CEZD 1J1XL 1OAKH 4IRSD 1T2QH 3MACL 1S7RA 1A4KB 1NL0H 1KB5B 2E7BA 3UTSE 3UBXA 1BVKB 3D3VD 3NABL 2XY1A 3PWJA 4F37F 4NO3B 4PRAB 4U6HB 1QA9A 3EOTH 1JK8B 1HQ4B 4ZNEE 1OWRM 2EC8A 3RUGE 2PYEA 1RZIA 4YE4H 1HEZB 4Z77B 5I16B 1QYGL 3BYTA 3WFDH 4I48A 1T03L 1VB9A 4LU5H 4AG4L 1FL6B 3RL1A 3OF6A 5B21A 1B4RA 4NFBA 4LLMA 3TO4B 1N6UA 3NFSL 3AREA 2NLJB 4GBXB 4J4PD 4LCUB 4YAQA 3R0NA 4XNXH 4N68A 1YYLL 4U6VL 3WIHL 1MNUH 5IB1A 3T1WA 1F13A 4GH7B 5DC4B 1OP5H 1HYRC 4NO0B 3BP5B 3QUXB 2X4SB 1WC7A 2JB5H 4NT6A 3QJFA 3L1OL 5BJTA 1JPFA 3VCLB 1CD9B 4UT9H 2RB8A 1N2RB 1K8DA 3V5KB 1KTRL 3KYNB 3MLWL 2HLAB 4OZFG 3TZVB 3IXAB 5B8CA 1MJ8L 1MLCB 1J10A 1OY3B 4Z7WB 5JOFA 2YWZA 4ZFGL 5F1NB 3AB0C 4LKCB 2XNAB 3CVHH 3F6LA 2NNAB 3JBG7 4KJPD 7CGTA 3MYJA 3MJ9L 2C1PB 4P5TA 5FIEA 4X0KB 3VFWA 4ZQKB 1YMMA 2UUDK 3HZYA 1D5XB 2AV1A 1T83C 4UTAH 1XCQA 1JV5B 3CFDB 2X41A 1BQLH 1CFVH 4WVRA 3WHXB 3EJYD 1EJ6A 4XWGH 3UYPA 3PGDA 1LO3H 1L0YA 3L5WB 4GRMA 1UWXH 2FBJL 3EYQC 4W4OC 3ZYOA 1CU4H 1TIUA 2P5EA 1UVQB 3DO7B 5IBTH 2VUYA 3QZWB 3BFOA 1A7QL 32C2B 2VLKA 5JDSA 2H3NA 2YD9A 3O45A 3KYKL 1M6OB 3WFBL 1AKJB 1BD2E 4V1DE 4ZDHB 5H94B 3BP6A 3NCJL 2I27N 1PBYA 4NC0B 3RI5K 4S1RL 3QULB 5IT2H 2EEDA 4LPWA 4MJIA 4M61A 1DQDH 4N1EA 3VRIB 4PJXB 1K5NA 4NJAL 3QUZB 5DFTA 5HHVH 3SDDA 2GJ6E 4WI3A 1BAFH 3LEXB 3LH2L 4S1QL 3M8OL 1QFUL 2AEPL 1RJZA 4PLNC 3MTRA 4JG1L 2ITDB 1AD9A 4OF7A 5EIQA 4HWEH 5TGBA 5GGVL 3WFCL 3ARFB 2CUIA 1IMHC 3DETD 2X6MA 3U2SB 3R1GH 4Y5VC 2EH7H 3IJHB 3X14A 4LHUD 3L3DB 5E4EC 3QWRD 4P3DB 1JWUA 3WIFB 5T3XE 4NRXB 3B3IB 1X3DA 3PXJA 1TTUA 4GW1B 3ZSSA 5CILL 3ARBC 3FJTA 4PGZA 1ZTXL 2EDJA 2Q7YA 3C6SB 1JIBA 3I6GA 1NCBL 1RI8A 2HT4C 3G6JE 3UYRH 4JQVC 3MOBH 5IFHH 4RGMC 5HI5D 1ZGLM 5HD8C 5AG8A 3CXHJ 5F9OL 1ITCA 3IFNH 4K2UH 1EJOH 1FZMA 4P3WA 3HRZB 1TCRB 1D5BB 1CGTA 5ELIA 4ODSL 1JJUA 5EO0B 3VH8B 3P9LA 4QF1A 2HT3D 5JQ6L 3N1PC 1ERNA 5GSVB 3AAZB 4QOKB 4NQCA 4Z0BL 2DBLH 5D8JL 2GT9A 1UB5A 2ICWA 1JHTA 3ARGA 5GGSY 1NUGA 5EZOL 3KPQB 1DEEA 3OB0H 1BF8A 2IQAB 4JQXA 1Q9KB 2O93L 3U7WL 1OB1B 1C5BL 3FT3B 5SWSA 5F89B 3QFDA 1DVFA 2F54B 4YQXH 2CDFB 2J6EH 3V0VA 4OI8A 4EI5D 3TO4D 2Z91A 4OZFH 1QACA 4PBXA 5C0DA 2AK4E 4O5LL 5C71A 4GBXD 4X5XB 1B0RA 1P7QA 2JJTA 4EN3D 4MNQB 2HJLB 4RRPG 4HKJB 5EU3A 3FQRA 4RMWA 3C09B 2CO6B 3B6SB 2BNRE 1FDLH 1KPUA 4NO0D 1BJ1J 2UVFA 1XIWC 3QUXD 3EFDL 4GRWH 2H9GB 4HWUA 1FL5A 3GRWA 1XF2A 3IRPX 4HWZB 2YUWA 3VI4E 4H1LH 4PJIB 4L3ED 4NC2B 4JZJB 3TZVD 4BM7A 4QRRE 2WBWB 2HN7A 3BT2H 3V6OE 4I0PC 1KXTB 4QT5A 3I50H 5AEAA 4ELMA 1IAIM 5EWIL 4RMVA 1Q38A 2IPKB 4XNYL 4BUGA 5M95B 2A6IA 4F7MB 3PWLA 3JV4B 3BE1H 4NC1E 4OQTH 1AC6A 4JFEE 1FIGH 2R2HB 5DRZB 4P2RE 5C0BE 4KMTH 5JOEA 1A8JH 2Y36L 3HS0B 8CGTA 4L3CA 5KS9A 1UT9A 3E0GA 4PJ9C 3ARDC 3IXTA 4ELMF 1KJMB 2VLRD 1Q94B 5HHOE 1WFNA 3PHSA 3F7QA 4JGMA 1AIFA 3U4AA 2DF3A 2G5BA 3RWFA 5D7SH 1RPQA 3RX7A 4NKDA 1H3UA 5D7JB 1UJ3A 1EUUA 4RFOH 1AKJD 4MJ4A 4FFWD 5F6HJ 5DGRA 3CDFA 3CFCH 2PW1A 5KS9F 1HQRB 3WNOA 1YDPA 4XBPA 4LCCC 1G6RB 1A64A 4XBGB 3JUYA 4NDMA 4XMPH 5CZXD 1VEMA 1H5BB 1N59A 2DL9A 1VFAB 1JGEB 1FHGA 4OV6F 3MC0A 1S7WB 1A7PH 3T0EC 5LJYH 3S96A 1J88A 4BZ1H 3LKRA 4R0LA 4MA8H 1L9NA 5IR1B 1KTDB 1SJHB 3B5GA 3DYPA 5K9JL 4S1SL 4UTBL 1JI2A 1FO0L 1U2CA 2NXYB 3TH4T 3BPOC 2JF1A 5IG7B 3QHZH 1J1OH 4XGZB 1CXIA 1I3GL 2DQFA 1MFAH 1WF5A 4Y1AB 5CUSL 3GIZL 4JG0H 5FUZH 3B5TA 2QV2A 1BWWA 2MHAB 2ORBH 4F9PA 3H6JA 3TBWB 1IC7L 4QHMA 1OSZA 3V2AR 1M05B 1T1WA 1CCZA 2DIAA 4TQEL 2AJVL 4UV7L 4U1MA 4M93B 2RAMA 6FABH 4UAOB 2GFBB 4KKLC 5DA4A 1A6ZA 2QHRH 3QCUH 1K9TA 4MNHA 3PL6D 2QL1A 5MHSD 2W92A 4LSVH 2XN9B 4ONFL 5L7XH 3CX5J 1WISA 4ZUUA 1E4KC 1I9JH 4NGHH 5DMKA 3W0WB 3BGAA 3S35L 4OGXL 5ISZA 3IU4L 4GXUN 4U1JA 5BRZB 1EHNA 4N8VA 1HDMB 2ADGA 4F7PB 2P5WB 2XZCL 2H8PA 1CICD 2P8LB 3QH3A 4QOKD 2VDMH 1ZA6A 2VABA 2AXFB 3VXRA 1KOAA 1AGEA 5HGHB 2YRZA 4NN6C 2X09A 1G1CA 3I3DA 3KPPB 5FDYA 3CGTA 4DZBA 4I2XE 1M7DB 1ZOXA 3F62A 3QIBA 4Y7MA 1I1AB 4QXTA 5JQHC 1K4DB 2F54D 5CWSA 4MDIB 2PNDA 2X40A 1A21A 3D39A 4HSQA 4AIXA 2PF6A 5IV2A 4OZHE 5FHBL 3IDMB 5DJZB 4U05A 2ZG3A 1XT5A 4MNQD 3MLPA 4KK6C 5SWZD 1NANH 4BKLA 3JVGA 5EZJA 3OKNA 2FYYA 1JZ2A 1OGAD 3CJJA 4OAWA 3ZHLA 3FONA 5I6XB 2H2SD 3SKJH 5EC2A 3OKOA 1I4FB 1T1ZB 4TUKH 1C12A 1RZKL 4NM4H 4O2FB 3GMMB 3VWJC 5EBLA 3LB6C 1Z2KA 3ZZ1A 4Y4FA 1D5MB 3K1KC 3T0VA 4G80A 5MEOA 3GSNB 4PGDA 1TETL 2OCFD 4XVJL 5ALBH 1ZE3C 1F90L 3BIKB 4NO5B 2E27L 5GSRB 5J3HD 3VFPA 4HIEB 4U7MA 4FOMA 3IU3A 4Y4KD 4PRIE 4NQDE 1AGCB 4X6CF 3DI2B 1J8HA 5L2KE 4R7NA 4IRSA 2D7MA 1DQLH 4LAQH 3VFNA 3D3VA 4E5XA 3D2UB 4AYFA 4P23A 3SCMD 3O2VH 1NCAL 4TVSa 3VD4A 5C6TH 4K23H 5KSVB 5F7DA 5KAQF 5C2UB 5L9DH 4YHIA 5B3JF 4CMMB 4P9HL 1LO2H 1A47A 4TRPL 5D7JD 3VWKA 5IVXA 5DRNB 5JHLL 3MGOB 1UKQA 5F9JB 1NEZA 3RKDD 3WUWA 4NWUL 1EHLL 4U6YA 1XGTB 3LN5B 4J1UA 4Q58C 1G9NH 4UNVA 1HILB 4PRNB 2ADJB 2DQDL 5I1IH 5HJ3A 4WGVB 4JCMA 4AIOA 2EKSA 3FHQA 4J3VA 1YY8B 3SKNA 5I1AB 2FIKA 4ZUSB 5JORB 4X98A 3INUH 3WNNA 5IVXF 5ICXB 4GW4B 1AFVL 2IJ0C 1ES0B 4MXQD 2LU4A 4DN4H 2DWDB 5E8DL 1UKTA 3TPKA 1FLTX 5LGKA 5CINH 4XWOD 2UWEF 3KJ4C 4Z78A 4LEOB 1I7TB 4XP5H 1PX4A 4Y1AD 1RMFL 1T4KB 4G9DA 3CZFB 4ZXBD 4HMEA 3O11B 5KSBB 1A7RL 3DROB 1KN2H 1KACB 4LKXA 2IQ9H 2YKLH 1ACYL 1I8LA 2N56A 1EZVY 1FAKT 4PTUA 1QTYT 4GAJL 4LP5A 5FKAB 1B0GB 4HC1H 2EIZB 3PG2A 4PJBB 3IETB 5C8JB 1JF5A 3OHXA 1J18A 1S9WA 2AJSH 3CFBA 4F33A 1LEKB 1UXSB 4HUVA 1KIUA 3GGWB 4YHLH 5FOBB 1N3NB 3L3IB 3U4EB 5ADOH 5C6WH 3S5LG 5ITFB 2PYEE 1SJEA 4L9DA 4P9ML 1CL7H 4OKVA 3CU1A 5JO5A 4L29B 2OMBA 3HMXL 5BRZD 3GSUB 5FYKL 5L8JB 1AHWA 1HSAA 1FVEB 5C7XL 1E28A 1R3HA 2HWZH 1J1PH 1UENA 5FUOL 2P8PA 4YHPB 5T33L 2OXGA 4Y2DC 2OZ4L 3IT8D 3VFOA 1U8HA 1ZMYA 5E8EA 1L7IH 1DBAL 1QFHA 3ME0A 3O2WH 2JKXA 2PXYA 1HIMH 1I1AD 4NZRH 5DMGC 1MCDA 5JDJA 1VEOA 3HNSH 2R69H 5ID1B 3C5ZD 1PX3A 3X13A 4RAVA 2EKJA 2OTUA 1TVDA 3D25A 1IM9A 3JWOH 1PEWA 4ZSOA 1IC5H 2J1KA 4HXAL 5IBUG 1GL4B 4WW1B 3SE4C 4ODVH 3ZYJA 4MB3A 1YEGH 3O4LA 3T65A 3VD3A 3AXLA 5LG1A 2H1PL 2BJMH 4LHUA 4P2OA 4ONGH 4M5ZL 1YMME 4JEGB 5E7BA 1IGCH 3DMMD 2BHUA 5FFLA 4P3CL 1DE4A 3WN5B 5EOTA 2FEDD 4EVNA 1DN0B 4GRLB 3MLYH 1IEAB 2EDNA 3O6LL 4JFQB 4HH9A 2DTML 2EIEA 4Z76B 1IBGL 3ARZA 1PYWA 2DI9A 3TWCH 2VLKE 5I1DA 3O2DL 2ZUSA 2NCMA 4QXGL 1AXSB 4YFLF 1A4KA 1KB5A 4XVTL 2P45B 3S3PA 4WCYL 3MLRL 5JUEL 1QR1A 1BVKA 5HHNA 2LAGB 1U92B 3D2UD 4NO3A 4PRAA 4HIXH 1MVUB 4U6HA 3MBEB 1P9MA 5KSAC 4JM2C 1U8LB 4Y5YA 2R0LL 3QWOB 4MJIE 1S8DA 5GISL 5LAXA 3NFPA 3BUYB 2Y07L 4P59L 4OCXH 5I16A 4WEBH 4MDJB 4XNMA 3OJDA 1FL6A 1WWAX 3HPJB 4X4YB 3KPMB 4AJ0A 3TO4A 1CK0L 3NCYS 4MA1B 4DKAA 3Q2CA 1VCAA 4LMQE 4UB0L 4R97B 4GBXA 5E2TH 4RBPK 5AAWA 3EYSL 4HS6B 3GHEH 4L4JA 4IRJC 4FXKB 3MO1B 4FZEH 4TPRH 4LIQE 4URTB 5I66B 3ELAT 3BP5A 3STBA 1P4IL 2X4SA 2YR3A 2VZOA 2EC9U 1P84K 3TBYB 2AJZB 1DLFH 4I77H 1N2RA 4J12A 3V5KA 5J6HA 4F57H 2HLAA 3TZVA 4GXVH 3IXAA 3IGAB 3NCFB 4LRIC 4XNUH 3RWJA 1MLCA 5ICYA 4PYGA 1E6OL 4Z7WA 4XAWL 5DK0B 3VXUB 1ZT7B 1EFXB 1WV7T 1NFKA 5F1NA 5I76B 1Q9OB 1S7TB 2XNAA 4HW6A 4LKCA 3VXMB 2NNAA 4PRHA 1T22A 3LEYL 4X0KA 4DEPC 4ZQKA 4PBVC 4PGJA 3BKCL 3ZYZA 1I7ZA 3NN8B 2GK0B 3DXAB 2ERJB 4J4PC 5GRWA 3CFDA 1R0AL 2E5EA 2VQ1B 3WHXA 2O5YH 1JZ8A 2PR4H 5GGRY 4G6JL 3DGCR 1I1YB 3DVFA 3L5WA 4HFUH 1CGSL 5IF0A 3V0WH 3PGFL 1UVQA 4EXPX 4A6YH 3DO7A 5SWSE 4YHZL 3PDOB 3Q1SH 2RHEA 5F96H 1NCDH 3EDDA 4NFDA 4EBQH 3GM8A 1IGFL 3RFZC 2MMXA 5H94A 3DHMA 4L4VB 4KJPC 3QULA 1I8LC 4JZOB 3VRIA 1MCOH 4OKDA 1WZLA 4PJXA 3WFEH 1PGRB 3QUZA 3E6HB 3IKKA 25C8L 3JTTB 4CL7A 4AEHH 1UB6B 3OR6B 3QUMH 1FORH 3EJYC 2JIXD 1A7NH 4BQCA 4O58H 3ALXA 4FABL 1G7IB 1ZHKB 4HXBL 4LOUD 3ARFA 4ZFFB 4ELME 2D7TH 4N0YL 5F1IB 5TPWH 1MWAH 3KS0J 1F4XL 4IMLB 1I7UB 3IJHA 3ECBB 4OCWH 1T7ZA 1DZBA 3L3DA 5EUKB 3SO3C 4P3DA 2HVKA 5I1CL 5F9WC 4WJ5B 3ARRA 5CHNA 3WIFA 3B3IA 4GW1A 1FGNH 1PJ9A 2YEZB 3GFUA 4GRLD 1JE6A 4XX1G 4NWTL 4E41B 5CAYB 1QZ1A 2PKDA 4FQLL 3VMOA 1HINH 4TNWF 5KS9E 1AJ7L 3WS3B 3QIWC 3STLB 4KC3B 1INQB 1CXHA 1IEBA 4HLZG 4JE4B 4NZTL 4PFEA 4PS4L 3HG1E 2Q20A 1CXLA 4XPBL 1VFUA 1TCRA 2E7CA 1EO7A 1O7SA 1D6VH 1NAMH 1OT2A 4ZUWB 3OAZK 2EDYA 2WUCL 3UPRB 1QFOA 5FHAH 4U4BA 3DETC 3IDYB 1KELL 5EZIH 1N6VA 5EO0A 3VH8A 1QSVA 3CLEH 4BSWA 5GSVA 3AAZA 2Q86B 1KCVL 5JW4M 4LRNH 1SBSL 3OKDB 3KPQA 4YFDB 3C8DA 2W07A 1W72B 5D1ZB 2IQAA 1OB1A 1A6VL 2N1KA 3GSNH 1JP5A 5F89A 3SGDI 5JPNB 4PJEF 2F54A 1FH5H 2CDFA 3CMGA 2FJFA 4FN0A 3PWNB 5C0JB 5IQ7L 1HNFA 3I3EA 1H15B 1U8PB 4X5XA 1S7SB 4X7TA 5CP3A 1NH6A 1MJJA 5GRJH 2HJLA 3U0WH 2GTZB 4HKJA 1IGML 2R23B 3GK8H 3B6SA 1N64L 5FYJD 1L0QA 1MQKL 2UZIL 4TNWK 3FRPG 2BCKB 2C4FU 3VG0H 2JTDA 5T3ZE 4ORGB 4LFHG 1FG2B 4Y5XB 2HT3C 2DB8A 3V4VL 3QDMD 3NIFF 1HHJB 2C3WA 4P2QA 2IPTH 3EO0B 5HPMB 4YXKL 1HKLL 1YNLL 3H9SB 3MMEB 4HKBB 4JZJA 4WU7A 4UU9B 4Y19B 3P0VL 5GJTH 3QISA 2DQEH 2HKFH 5FYLD 3NVQA 2WZPD 1KCSH 3VXUD 1WZ1H 2LV4A 1CLOL 1EFXD 1KCKA 5K9OB 3HI1B 1FCGA 1N8ZB 1HHIB 3QG7H 1YEKL 4HG4K 2IPKA 4PV8B 1J86A 3VXMD 4CJ1A 4EI5C 4F7MA 2YRPA 3NZHH 2F53E 1OD7A 3RZCB 3JV4A 5SV3A 1MY5A 5ISZE 1DJSA 3DXAD 4GS7C 3KPSB 3SE3A 4UINH 2R2HA 4EN3C 1MIEL 3HZKB 4LDOB 2Y06H 3WJLA 3HS0A 2D7NA 3VXQB 2M8XA 5IVNA 1JRHH 1P53A 3DBXB 3QUXC 2YMXL 1FZKA 3F7YA 3OKEB 1OW0C 1LO0H 2VDOL 3SDCD 1YEEH 5SX4I 4G3YL 9CGTA 2VDPL 1YECH 3MBXL 1IZKA 5F88B 3D39E 2DQGL 3FQTB 3CSGA 1U93A 1E4JA 2GITB 2V2XB 3CDCA 4GO6B 4L4VD 4DFHA 1HQRA 1G9NC 2XA3A 3PXHA 3UXFA 2ZP0T 4OFKA 3ZE1F 4POZD 1G6RA 4X7DC 1LHZA 2G60L 1BX2B 5E1AB 1H5BA 1MREL 5AZ2H 2E7LC 1VFAA 1JGEA 4OT1L 3A6CL 4DCQB 3V5DB 4XC1H 2IG2L 4WO4B 2GSIB 1WFTA 3MRLB 3UZVB 1KTDA 3N9GH 4WY7L 2J2ZA 4FQJH 1MCBA 1SJHA 3M45A 3A6OA 3CDYA 4NYLA 2AKRB 1NUFA 2OM5A 4HLZH 4I1NB 3AY4A 2J5LC 4UI2A 5IG7A 3P4NB 3I2CL 4XGZA 2BXYA 2VXSL 5B3JE 4Y1AA 1J9CT 4WFGE 4FFWC 3C08L 2MHAA 3HI5L 1JWMB 3TBWA 1J8HE 1M05A 5E5UB 4E41D 4HUWB 2QQKL 2BC4B 5D7LD 1P4BH 5FK9B 4XBEL 4XHQA 4OB5H 5CZXC 3HZMA 2GFBA 3GKZA 1YYMH 4L8SB 3I6KB 2YHGA 5D71H 5IW6B 1A1MB 1IFHH 3GUTB 4CBPA 2XN9A 3RWIB 3ULVE 3FFCE 4LK4A 3MJ6A 5IVXE 3W0WA 2CJUH 3ZDXF 1JGVL 4GG6F 2GW5A 3GB7B 1BOGB 3BD5A 1MAML 2VLLA 4F7PA 4RGNB 3MRGB 4PJHF 4HV8B 2P5WA 2P8LA 4NBZB 1CDGA 3HC0B 1XR9B 2AXFA 1MAKA 2BERA 5HGHA 7FABL 5I8OL 1UWGL 3T2PA 3KPPA 4FFVC 5D1ZD 2VIRA 3S7GA 4N0FB 1M7DA 3P2TA 3BSZH 5CJBA 1C1EL 4X7EC 43CAB 4OLUL 1I1AA 1K4DA 2B7DT 4TUJB 1KEGH 5DMIL 4MDIA 1E6JH 1T5WB 4JFZH 2VLMD 4KKNA 5DK3A 5J11B 3PL6C 3JWOC 5DJZA 3KYAA 4KRLB 1XF1A 4MJ2A 1BBJB 4JREB 1N4XL 3AGVA 2WWKO 5I1KL 3EYUL 3S34L 1WWWX 4OIIH 1EBAA 1F8TL 3S88H 4JRXB 3X17A 2X1WL 5FKPB 1I1FA 2BY3A 4LARH 4UILH 1CICC 3PWPB 2X4RB 1I4FA 1NFDA 3H9SD 4JRYB 3JV6B 4O2FA 3GI8H 3GMMA 4EKXA 2E6PA 3QI9B 3KLAB 5TE6L 3MNVB 1Q9LB 1D5MA 2A74B 3NACL 1CQKA 1FC1A 1MRDH 4GFTB 2R0KL 4XP4L 2OL3B 3BIKA 2BY0A 4NO5A 1IGIH 4HHAB 5A3ID 2A1WL 1RUAH 5EOCL 3RZCD 2VRAA 3CVIH 4KRMB 1ZLSH 1AGCA 2Q76B 3KPSD 3PV6B 1NFDF 4TVPE 5F6IB 3C09C 4G6ML 1BECA 3VA6A 3HNTL 2IALA 4XVSL 3D2UA 4X4ME 2F5BL 3B8SA 3LS5L 5MERB 5E2VL 4IOIB 3FOLA 5C09D 5JMOC 3RIFK 3LD8B 5BZWB 5KSVA 2A9ML 1C5DB 1S9KC 1ZLVH 4F58L 4CMMA 1NMAL 1HZHL 3GJFK 5FYLH 5DRNA 4YXLL 3MGOA 2HJKB 4M4RA 3WJJC 3VRJB 4KZEH 5F9JA 4G6AC 3I6LE 5IFJB 4P46D 1OAQH 5I19L 5EO1B 1FFPB 1XGTA 2J3SA 4LEXH 2WQRA 2HG5A 4RZCA 4ZSOE 1HILA 3SKUD 3UTOA 3OGCB 1CD0A 4PRNA 2FJHB 2G2RB 4LF3B 5J3HC 2ADJA 1AQKH 4Y4KC 4YDKL 5C07B 4LNVA 2IMNA 3T3PF 3O4LE 4KKCD 1YY8A 5I1AA 5IGXH 3SJVB 3Q6FB 4HCRA 4ZUSA 5JORA 3UJJH 5EOQH 1PEZA 3HFML 4K7FB 5ICXA 4GW4A 5CJQL 2DMKA 5D72H 5DT1L 2R29L 5DK2A 5DD3H 3SCMC 1KTLA 2DWDA 4LLDB 5J13B 3F7VB 5MENB 1B2WH 1P6AB 3QO0B 2XFXA 2E3VA 1QUNA 2GJJA 2R1YB 2YD2A 4KRPD 3IDUA 3HC4L 4LEOA 1NC2D 5D7JC 5E00B 3D9AL 2H6PB 1KGCE 4FQ2L 2FCBA 3GSXB 1XEDA 4XP9H 3RKDC 3DSFH 1DSFH 1T4KA 5L8LB 3CZFA 3O11A 5KSBA 3DROA 5MP6L 2Z35A 2AQ3A 1RZFL 4M7LH 4BSVB 4JHBA 3S37X 1MJ7L 3CFKA 5FKAA 1B0GA 3KR3L 4LCIH 4DGIH 3ZTJG 2EIZA 4PJBA 3IETA 5C8JA 1DP0A 5GGUB 5BVJA 3B8YA 5BMFH 2Z8VC 2D9QB 3RGVA 1UXSA 2P8MA 3GGWA 5GZOD 5FOBA 1N3NA 5TQ2L 3L3IA 3U4EA 4MXQC 3T1FA 5EA0H 1PG7L 4L29A 3DV6B 3GSUA 1RY7B 4XWOC 1OPGH 1EK3A 4RGND 5L0QB 1DBMH 1FVEA 2HJFB 4Z8FH 4UIKL 4JQIH 3RPKA 2AP2A 3BOVA 1FZOB 2B39A 3DSNA 1X6NA 3KAAA 4ZXBC 4KHTL 4R8WL 1JL8A 4KDTC 1JPTL 3UTQA 3E2HB 1ZVHA 4NP4H 2P47B 4M93C 4NOBA 4RA0C 3AM8A 1F6LL 4J8RB 2HP4A 3V4UH 2IFFL 4PB9H 5BS0D 5TQ0L 5C70A 4WFHE 3H0TB 4YO0B 2B4CH 1OLLA 1HKFA 4OIBA 4WW1A 2FGWH 5A1AA 3GZKA 2IAMD 5F7MC 1RIHL 2DM3A 4PJAB 4BUHA 4P57B 1V3KA 5EPMB 4HPYL 4PRHE 1FZJB 1RIUH 3FN3A 3PWPD 2OSLB 1KFAH 4LLUB 4MVBD 3WN5A 3U83A 3LEVL 1DN0A 4GRLA 5DFVC 3SE9L 3DRQB 1Q8MA 3FQWB 5IM7B 1IEAA 5E9DB 1BLNB 3BQUB 3S98A 2ZCKL 5DFWH 4BFIB 4JFQA 2JJWA 5EBWB 4KK9D 3LVEA 3C5ZC 2J4WL 1OAKL 2WSKA 4Z76A 2W91A 1QHPA 1AGBB 4NZUH 4JFXB 4ZD3H 4WUKH 3O6FA 4YHML 1OCWL 1DANU 3GRWL 4FQIL 1GOHA 4NQUA 3GNMH 3EOTL 5IMLB 2VUOA 5CFHA 4KTEL 3MFFB 1BIIB 1U92A 1MVUA 5DJ8A 3MBEA 2K7QA 3SDXF 1P5VA 5I6XC 1U8LA 3B43A 4YE4L 3QWOA 3WFDL 4PJXE 3DMMC 4Y4HB 4LU5L 5IMKB 1LQSR 1QEWB 2D4FA 4D3CH 4LVHB 3ARXA 3GIVB 2VB5A 4MDJA 3RVVD 5EFIB 5DUPH 3HPJA 4X4YA 3KPMA 1TQBC 2DJUA 4ZTPH 3FB5B 1FN4B 1HSBA 1H3GA 3QDGA 1ADQA 3N1QC 4FXKA 1U8NB 3MO1A 3SJVD 2XY2A 3MPCA 2JB5L 4K07A 2IBGA 2FX7H 1SJVA 1BGXH 5I66A 3K2UL 5BQ7B 3EBAA 4PRPA 1IC1A 3TBYA 3ZTJH 2AJZA 5MEND 1YNKH 1S3KH 5E6ID 2DM2A 3IGAA 4L5FL 2FZ3B 2X1PA 2X4OB 1DBJH 3MR9B 3QUYB 5DK0A 2QQQA 1ND0B 1ZT7A 1EFXA 2DKMA 5I76A 4UTAL 1Q9OA 1S7TA 5CLTA 3VXMA 5I1EH 4FQHB 2F19L 2VH5H 4KJWC 2YRLA 3NCCB 5IB4A 1BQLL 3D18A 5CLWA 3ESVF 1CFVL 1F4HA 1R5VB 3NN8A 2GK0A 5ETUB 4KU1A 4OCYL 3RU8L 2VQ1A 3TYFB 5I1JL 3CVHA 1KUMA 2X4TB 3AU1B 1EGJH 4IM8A 1CU4L 5E2JA 3PDDA 1I1YA 1EEYB 1LEGB 2P43B 4KROB 2LABA 4O02H 5JW3H 4X6EB 1OP3H 4HX1B 1JWSB 4PY8I 1ODAA 3U4BH 5EUOF 4LCYB 1QBBA 3NIFE 3PDOA 3FHAA 3SGKA 2V6HA 2MKWA 5GPRA 3RA7H 1IM3B 1P69B 2WUBH 4L4VA 4JDVB 1D5IL 3G6AA 5HHVL 4M03A 1IGTA 4OLXH 3RVTD 3LY6A 4JZOA 1BAFL 4KMLB 1WFOA 3L9RB 5EORH 2UUDH 2AEQH 5DHVH 5C0IB 4PLKD 3E6HA 4QRSB 1OAXH 3JTTA 1UB6A 4HWEL 4P2QE 1RHHB 4PGCB 3D0LA 4YC2B 3JWDH 1VKXB 5C3TA 1RHFA 2XWTB 3R8QA 3R1GL 1G7IA 1ZHKA 2EH7L 3K4DA 4JVUA 1J11A 4MQSB 5FYJU 4KJYB 4ZFFA 4LCWB 3KPRB 5F1IA 3QEQB 4IMLA 4LSSL 1PZUB 4K3GA 3ECBA 5EUKA 4GXUM 1FBIH 1OP5K 4G6FD 5IW3A 5GS1C 3UYRL 4X6DB 3MOBL 5IFHL 1ED3B 3SN6N 2YEZA 1NGZB 1UZ8B 3HE7B 3MACH 1FFQA 4LASH 1ZK9A 5INCB 4JPIB 4U1NB 1DR9A 3IFNL 1XGRB 3NABH 1HXMB 1EJOL 5E9DD 3WS3A 1WGOA 2LTQC 3STLA 1INQA 3ZE1E 3SGDH 4Z95L 1ZT4A 3O3EA 1PKQE 3NCEB 4HKZA 5EU7C 2E7HA 2WBKA 4UMGA 4UIMB 4JJ5B 4EEEA 1CN4A 1YMHA 2NY4D 4FG6D 4ZODA 3U0PB 3UPRA 2FLBT 3X12B 2DBLL 4O2CB 4U2ZA 4R6UA 4OZIA 1ZA3B 5DJ6B 5DRWB 4WTZA 2WWMD 3DUSB 1T3FB 3PWUB 2CGRH 3WIHH 1YYLH 4NPYB 4EJ1C 1P2CB 2IF7A 4R2GD 5J9PB 1W72A 4MCZB 3ZKSD 1CFBA 4ZNCD 5JPNA 4U6XB 3RY6A 3U7AA 1F45A 4K7PL 3PWNA 2JJUA 4MAYB 5EU6B 4AEFA 5CEZL 5C0JA 4OZIF 2NX5D 1H15A 3RWDA 2YUXA 5D7KE 1FDLL 1S7SA 3PGCB 1H3WM 1MJ8H 3LV3B 4D9LL 3GI9L 4LLAA 3WNPA 1M7IB 2GTZA 3VFTB 2R23A 3BGMB 1H0DB 4Q97A 1DQQB 2J6EA 3MV9B 3BRDA 3FT4B 4BK4A 4OZFA 2BCKA 4W6WB 1CZ8L 3MJ9H 4ORGA 3MA7B 4Y5XA 3BT2L 2MNUA 1HHJA 3IVKB 5HPMA 3EO0A 4Q9QH 3I50L 3C6LB 1YC7A 3BAEL 3H9SA 3MMEA 4HKBA 3VW3L 4Y19A 4IEFB 3E8UL 5SX4H 3QUYD 5K9OA 4OLZL 1CE1L 3BE1L 3NCYP 4JZNB 5C0RL 1J05B 1FIGL 2XN9E 2FBJH 2COQA 1CIDA 3W0WE 3UO1H 4M4PA 4PRDB 5FUCC 3V4PL 3QIUB 1NPUA 3VMPA 1ZT1B 2P5WE 3HZKA 4ETQB 3FB6B 1S7UB 3KYKH 5D96C 2FHBA 3VXQA 1MIMH 4GRWF 3DBXA 3BH9B 1UEYA 2A9NH 3OKEA 2VOTA 1J0ZA 4OFIA 3EOYG 1MCFA 5HYJD 1NFIB 4DKFL 4NSKB 3CFCL 3WL9B 3PF2A 3LH2H 1KJVB 1QFUH 3FQTA 4ZG1A 5I30H 5FM5M 2J8UB 1W0VB 4JG1H 4M7ZB 5FOJA 1WBZB 4NRZB 4OLEA 4NQVB 4UQ2B 4XMPL 3TN0D 4JCLA 3WUZA 3BISA 5GGVH 2C7UB 2WBJD 3HA0A 5E95B 4R26H 3U6RB 2PO6B 2E6JA 1FGVH 3QXDA 4BZ1L 4QRTB 3T0BA 4MA8L 3OB0K 1GGIL 5LCVH 4JY5L 4FQXA 2DICA 4PJCA 4K9EH 4DCQA 1NFDE 4WO4A 1ZTXH 3MRLA 3PP4H 2DLHA 3QHZL 1NCBH 3G5VA 3D1MC 5D5MB 1RJYA 2HAZA 4TVPL 2AKRA 3OJMB 4YK4B 4CVZB 1ZGLB 1MRFH 1OD9A 2CK2A 3K4ZA 3SDCC 3QEQD 4PP2A 5DVMA 4UDTA 5CJ5A 1QOKA 4DUXA 1AGFA 1WBYB 3ZDZF 3WS6A 4YHYC 4PJCF 2XG5A 6FABL 1JWMA 3HE7D 4OSUL 4ODSH 4POZC 2BC4A 2QHRL 1I9RH 5FK9A 1WIUA 2K3TA 3G9AB 3GJEB 3WDHA 4J3WA 4FZ8L 4L8SA 3I6KA 5L7XL 1A5FL 1A1MA 1I9JL 2DAVA 4NGHL 1GHFH 3T3PE 4Z0BH 5D8JH 1YPZF 1WITA 2X9YA 3H9YA 4KQ4L 1RZ8B 4LVNB 2Z4QB 4KK8D 5EZOH 2JJVA 4Y88A 3S8WA 3U7WH 5J1AB 5H35B 5D1QD 3BPLB 2ZUQB 4N8CL 1BOGA 4NBXB 4LP4A 3JTSB 3QT2A 3FO0H 3MRGA 4HV8A 5I1LB 2OTPA 4G6KL 4PY7B 1GVIA 1WEJL 2JK5B 1MFCH 3QAZC 1EZVX 2X7LB 4JKWA 1XR9A 1S7XA 5FA4B 5GGTA 3CFEA 4FTVD 4MD0A 5KOMC 1KJ2B 4N0FA 1AQDB 2Z92A 3I3BA 1JPGB 1TNNA 3EFDH 4JFYB 4XRCA 43CAA 2MJWA 3DV4B 4TUJA 5HXMA 4UT6H 2AXJA 4RRPA 3DX9A 4L1DA 1XGQB 1MUJB 1KB5L 3OBAA 5DVOA 1KYOK 4PJ8B 3QUKA 4M1CC 3MV9D 4P4KB 5C0AA 3SKJL 5EWIH 3S37L 2EXWD 2XZAH 1S9YB 4JRXA 4TUKL 5FKPA 5KSBE 4N1CA 4PUBL 1PVHA 3PHQB 5KAQG 2YC1B 3D85D 1YZZA 3OXRA 3G6JB 2X4RA 5AZEL 2N7BA 5BV7H 4JRYA 3JV6A 1N6QL 1FSKB 4HDIA 3QI9A 1KENL 3KLAA 1UCBH 5D1ZC 3MNVA 1KIQB 1U41A 2Y36H 2XACC 2I9LA 1UA6H 2IGFL 2G75B 5CBAB 2OL3A 1MLBB 4HHAA 1B88A 2CK0H 3UTSD 1DQLL 2Q76A 3PV6A 3CDGB 2MPAL 1EEZB 2XKNB 3Q0HA 5BOPA 1F3DH 1QSFA 2HTKD 4GKSB 5ESQB 5C6TL 2LE9A 4PIRF 2WNGA 1IAKA 4RAHA 2VL5B 2V17L 3GSWB 4NZJA 5T1LB 5MERA 4IOIA 1JGUL 3B9KB 4KY1L 4EUPB 1RUPL 1C5DA 2H26B 5DC0A 3SDAD 3S4SG 1ZS8B 1QR4A 1NBYB 5IFJA 5B38B 5EO1A 3HKFA 5I1IL 4OD2B 5LWYL 2H2PD 2VZVA 1EAPB 3RVXD 5K9JH 3OGCA 1F6AB 2FJHA 2G2RA 4LF3A 5A3IC 5JR1L 1FO0H 3RZCC 2BNRB 4F9LA 3INUL 5C07A 3T0XA 1SY6A 3Q6FA 2OP4H 4DN4L 5JXED 4M8QB 3GIZH 1UJTA 4K7FA 1TLKA 3FQNB 2C3VA 4QRRB 5CINL 1IC7H 4LLDA 3F7VA 4L1HA 4NBYB 4TQEH 4UV7H 4CVUA 5IHLB 2CIKA 3RDTC 5AUMB 4YXHL 1VADB 3WYRA 1EH9A 2EYRB 2J8HA 1PD6A 3FFDB 2R1YA 3DO3A 4J2XA 2H6PA 1KT2B 2YKLL 3GSXA 4P46C 3VMNA 4Z7NE 4ZFOB 5IQ9B 1RFDH 4PJGB 4FQPA 3TO2B 5HGAB 1V3MA 3HUJB 3NGBB 4P2RB 5C0BB 1CLZL 3S35H 4OGXH 2VXUL 4YZFF 3IU4H 4HWBH 5DLML 2WWKT 4YHLL 3RY5A 3TNNB 4KKCC 3ALWA 4WWKB 5HHOB 5ADOL 1D9KD 1T5XB 2KQNA 3QDJB 1GIGL 5ANMA 1F6FB 4QHUB 4JPWL 4NUJB 4X6FA 2HWZL 1R3LB 3NAAH 1BD2D 4V1DD 3L3OA 4DJMA 4DTGL 2KL6A 2HJFA 3SPVB 4DK3A 4KRPC 1LILA 2A83B 3KVQA 4M7KH 1FZOA 5FB8B 3GSVB 3QDGE 3EDEA 1E27A 1JN6B 1HIML 3HC3H 2GJ6D 4DQOH 4HAFA 4LPXA 2R69L 4IBLT 4KUCF 3TGXA 4CMHB 3C2SA 3ZYIA 3JWOL 4PRPE 2A77H 2NY7L 1TVBB 4HK3J 4M9PA 2OJZL 4G43B 4J8RA 4BH7B 3H0TA 1MI5E 1RZKH 3JWDC 5IJKC 4ODVL 5DJCB 3IF1B 1YEGL 3F65A 4PJ8D 5MEQB 2BJML 2CKBB 4P4KD 5IHUH 4ONGL 4PJAA 5T3XD 1TETH 4P57A 4XVJH 1IGCL 1JHLH 3DOSA 5EPMA 4RGNC 2Q8AL 4HMDA 2E27H 1F4WL 3GDBA 4KKAD 4Y8AA 4HZLB 3UBXI 5HHXH 5EUOE 1X5YA 1F97A 2CPCA 4LLUA 3MLYL 3BPCB 1TZGL 3DRQA 2DQCH 3FQWA 5IM7A 4FFZL 4MNGB 5E9DA 1BLNA 3BQUA 4PJAF 4IOSD 4BFIA 3V6BR 5EBWA 1NCAH 1WSST 2XQBH 4O4YH 2EYTB 1MCIA 2IBZY 3IAQA 5IOPA 1CF8L 4DUVA 4HT1H 4TRPH 5B4MD 1P6FA 5JHLH 3OV6A 1YN7A 2IAMC 3L3GA 2HKHH 3A67H 4JO1H 3MFFA 1BIIA 2XQYK 5T1LD 1VFBB 4XB7A 4OCXL 3DNKA 3B9KD 2BZDA 2DQDH 4I2XB 4RFEB 4NKMA 3RWEB 2I25N 4Y4HA 5IMKA 1QEWA 4MVBC 1HH9A 4NN5B 4EDWH 2ZNWA 3GIVA 2AK4D 4CU8A 4Z7VF 4GAFB 1AFVH 2FECL 4OZHB 3MV7B 5EFIA 5E2TL 2R1WB 3HE6B 4FZEL 4KK9C 4JKKA 3D48R 2BNRD 3FB5A 1KLUA 4JGJA 4Q6YA 2OR8A 1UG9A 1U8NA 2RCSH 1MFBL 3SOBH 1RMFH 4JO2L 1DLFL 5HVWA 5I75B 1A7RH 3UX9B 2Z9TA 4QRRD 5BQ7A 1LP9F 4F57L 1EA9C 4GXVL 4YX2H 3KHOA 4IJ3C 1Q0XH 4LVOB 1JBJA 1A2YA 1ORSB 3QCVH 1NEUA 3HAEB 2FZ3A 4WFFE 5IP4A 1GH7A 1NCTA 2X4OA 3MR9A 2QJDA 3QUYA 2DM7A 3GSQB 3ZKXB 4JFED 4NQDB 3RVVC 1G6RL 3VFRB 3BPNB 5JZ7D 2X4UA 4P9MH 2AW2A 4P2RD 5E1HB 5C0BD 5F70A 1R5VA 5ETUA 2O5YL 3W9DA 4XAKE 1X5LA 2PR4L 3GSOB 4RBPH 4MZ3A 1N5AB 3TYFA 4WWKD 3E6FB 3S5LA 5HHOD 4OZIE 2EECA 1NC4D 2X4TA 4P4RB 4WW2F 3AU1A 5T33H 5K33A 3OX8B 4A6YL 5IB3B 1EEYA 1LEGA 2XWJA 4XXDB 4M48H 5IHBA 3Q1SL 4XZUB 2CMRH 4IS6B 5E6IC 4KK5D 4X6EA 1NCDL 3BEVB 3ZE0F 1JWSA 5BO1H 5BXFB 2ZUUA 3MRBB 3P40A 5IEKB 4LCYA 3TBVA 4N0RA 4KMQA 3EUUA 1IM3A 4OM0L 5FF6B 5JHDA 1IE5A 3WFEL 3ES6B 3RJQB 4JDVA 5E8PB 3UTPE 1W0WB 1TZIB 4AEHL 4RMUA 5IMMB 3L9RA 4GSDH 5C0IA 3V9FA 3OG4B 4QRSA 3LZFH 5KVEL 1QLFA 1H3PH 4OLWL 2H1PH 1A7NL 3P73B 3W9EB 1EHXA 4O58L 4M5ZH 4RQQB 1G9ML 4K9EC 4QRPA 1RHHA 4PGCA 5E2UL 1PW3A 1MOEA 2EYSA 1CFSB 5FO7B 1X5AA 1JUFB 2D7TL 4P3CH 4Y19E 5ERWB 5TPWL 3Q6GH 1VKXA 1MWAL 2XWTA 2X05A 1GOFA 1C16B 4OCWL 4GRWE 3PABB 3D69A 4KJYA 4LCWA 3KPRA 5C2BL 3O6LH 3QEQA 2YD6A 2DTMH 1ITBB 2C26A 4OF8A 1A3LL 1IBGH 4MD4A 3E1F1 5EIVA 1HINL 1ED3A 4NM8H 4QXGH 1NGZA 1QA9B 3RVTC 5INCA 5ITBL 4JPIA 4XVTH 4NHUA 2GUOB 5TF0A 5JUEH 4PLKC 1G84A 1MCWM 2EDLA 1D6VL 3MJGX 4HD9A 1RZIB 3VI3F 1RZ7L 4P59H 4HMCA 5I0DA 4IDJL 5EBMA 4MQXD 5EZIL 3RL1B 3K4AA 3U0PA 2EZ0D 3IRZA 2B1AL 3CLEL 3AREB