5IMOB

Nanobody targeting mouse vsig4 in spacegroup p3221
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASGRTFSSYGMGWFRQAPGKEREFVAAIRWNGGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAGRWDKYGSSFQDEYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Nanobody
publication title Structural evaluation of a nanobody targeting complement receptor Vsig4 and its cross reactivity
pubmed doi rcsb
source organism Camelidae
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5imoB00
4MQXC 1HHJB 1A9BB 3U48A 4XP6H 4I9WE 1WZKA 5FYJU 3S3PA 1D5IL 4U1NA 5DD1H 5KSAB 2VMFA 4R0LC 4P23A 5C0CE 3ILPA 4PLNC 3ECBA 2R4SL 2XKNA 3BQUC 8FABA 5HD8C 4JDTH 4OGYL 1F2XK 3SCMC 1PY4A 3F7VB 3LS5L 1YJDC 4LPUA 4PJCA 4QTIH 4NYLA 1J1OH 3BPOC 5DMKA 4HKXB 3WXVH 1JZ5A 3ZKND 4PY7A 4BH7A 4JPIB 3QEQE 3C60C 4ERSH 4KTEH 4F15C 1MRCH 2F15A 5C0AB 1U6AL 2CK0L 1BFOA 1TQBC 3E6HB 1R3KA 1GXEA 3NZ8A 1PDKA 1S7TB 1Q9KB 2FEDD 1ROWA 4KQ3L 4NQDA 1FE8H 3DUUA 5D1QC 4EI5D 1UACL 5IMLA 3QEHA 4B5EA 5D5MA 4MNQB 3HC0A 3VFTA 5FFLA 3OPZH 3FB6B 2ZWLT 3SE3C 4YJZL 3UTPE 1KCKA 5FA3A 4J4PA 2AJUH 3CLEH 3SGKA 4CMHC 1P53A 3ELAT 3LS4H 3MOAL 4Y2OA 1HQRA 2OP4L 1T1YA 4HC1H 4P2RD 1CFSB 1T0NA 2ESVB 1PKQA 3NABH 4NHCL 5AEAA 2AJZB 3UTTB 4X0KB 3TWCL 4I0PB 2ORBL 3QR2A 4XZUA 2OXHA 2E7LA 5C0IB 2YSSA 2BNRD 4F8QA 3O81A 5HHVL 1SJXA 3MV9D 3REWB 5K9OB 4L8CB 3G6AA 5DUML 2P8PA 3KJ6L 3TF7C 1H3UA 3DX8A 4BH8A 4WWKA 2P44B 4IJ3B 3H42L 4X98B 3I2CL 4H25B 5HGAB 1IM9D 4N0UB 3RWHB 3DVNA 4WHTB 5JW4Q 4DGYL 4X4MA 4EIGB 4WI8A 4LLYA 1NGZA 1XAUA 4Z7WB 1DUYA 4NP4L 5T1MA 4OLWH 5CBAB 1T04A 3UTQA 2A6DA 4P2QA 4ZD3L 5B21A 2NXYC 1L6ZA 4M1DL 2OI9C 5EWIH 3BKYL 4XI5C 2IMMA 1T5WA 1Y0LB 2VXQH 2BVOB 3FO1A 1V7NL 2P7TA 1NKRA 3LRGA 3SGJC 3T77B 4PJ5A 4ZXBA 4W4OA 4BUHA 4PJAB 2WP3O 3GNML 3IXTA 3P40A 2DDQH 2IPKB 2FHCA 1NQBA 2DQCH 5HDBF 1G0DA 5FGSA 4OD3L 1XCQA 3RA7L 3CUPB 4K3EL 4M7KL 5ENWB 3BGMB 5CEZL 2YD8A 4LSSL 1J0HA 8CGTA 4QNPE 4KK9C 3HE7C 5FA4B 3DUSA 1EH9A 3GMQA 2B1AL 4O58L 4HC1A 2R0WL 2XACC 4E42B 5C0DB 2RJMA 3KPPB 1WCQA 4NQDD 1UG9A 4M4RA 3DVFA 5DEFA 1GPOL 3FOLB 3O41B 5BS0E 4XNQB 1W8NA 3L3JB 3TYGL 3ARBB 3CX5J 4UOW1 4KJPD 2Q87A 4O2EA 1ND0A 3MJ8B 3V4UH 1PY9A 2J4WL 4YR6B 5J11B 2R2HB 5LQBL 3H9SD 1TZGL 2EXWC 3TCLB 4OCSL 5EUKB 2E27H 4X4XB 2DQJH 2PYEA 1QSVA 3GSWB 3PGFL 2P46B 3NH7H 3ARFC 1A6AA 1MFAH 1T1WB 2XFXA 5EBLA 1IC7H 2YD4A 1PYWB 4JEGB 3TEUA 1I3VA 1J12A 2WUCL 5C0BE 4LRNL 4G9FA 2ZUTA 3MUJA 3KNBB 3SDXE 2FZ3B 2FGZA 4ODHH 1ETZA 3QCVL 5A16A 5L8KB 2RCSL 4IEFB 3DV6B 3U7AA 3DX6B 4MCZA 2DM3A 4JZOA 5DT1L 4P46C 4AEEA 3KPNA 1RZFH 3VXUD 5EU6D 4LP5A 5I73C 2I9TB 3CU1A 1J87A 4NN7C 2IPTL 1OB1B 3O3DA 3P11H 4WV1B 4XAKE 5KTEL 3J8F7 4D9QE 3TGXA 4JFEE 2MQCA 3FRPA 4M7ZC 1P9MA 5BMFL 5IKCB 1RZGA 1MVFA 4GW4B 4J1UA 4X6EB 4ELME 4F7PA 3MXWL 3QDAA 2OXGA 4F7CB 3S34L 3VWJD 1JN6A 4FS0A 3ARDB 4NSKB 3B8YA 4PJ9A 2A1WH 4J8RA 3RZWA 2I9LB 4GXVH 4Y4KD 1P4IH 5DJZB 2AJXH 4IRJD 4P4KA 1NFDA 4UTBL 1ZKAA 3T0VA 1FNGA 4B0MM 4DGIL 5KVMC 5GXBB 1L4IA 1NGPH 2YA0A 4TVPL 4KK6C 1DSFH 3T1FB 2MOVA 1RJYA 4FHBD 3MRLB 2RBLA 3AU1A 1BVZA 4PY8J 4K55A 4MNGE 1N4XL 2D7QA 3HAEB 4XVTL 2DYPB 1RJZB 3MROB 4UT9L 2AK4A 4YFLI 4QXTB 7CGTA 2AKRA 1MJ7L 4LK4A 3QUMB 1BZ9B 3EDEA 1JPFA 5FGRA 1OAZL 3OKOB 4P3CH 2VLKA 5HI3D 4KI5C 4LLVA 4GUPA 1NAMB 4JFOB 4P9HC 4Y5YA 5E0QA 2O61B 1NDGB 4R4FH 4OKVB 4WTXA 1NGYA 5DTFB 1KEML 2VR4A 3LCYA 2AV1B 3ZLQC 5FUCE 3P9MA 4HIJB 4WTWA 5HPMA 3LEYL 4QOKB 1FL3A 4ORGB 4RZCB 3QT2A 1WBYA 1MF2H 3CH1A 1SY6H 3QQ4B 3MNZB 1FL6A 1NC2B 4ZOCA 5FV2A 3U6RA 5AD0A 5HYJB 3U36A 4OAWA 4XVJL 3BWAB 1T1ZB 1ZGLB 2MTPA 4JE4B 1NGWB 2R56H 3KWWA 2H32B 2ZUYA 3O6KH 1L9NA 3L3GB 4OZGA 2FO4A 3MRQA 1J0YA 4H5SB 1LE5A 2ZOLB 4NHUB 3HMXH 3QXVA 3L5WA 3MRBB 1K8DA 5I17A 3S35X 2AJVL 1DQDH 4E5XA 3I50L 3BMVA 5D96B 3FFCE 3PWNB 1JPGB 4HUUB 3HAEG 3DETD 1JF1B 3LDBB 4TN9A 1LEGA 1RUQL 3D39E 4AMKL 2HH0L 2VC2L 1R3IL 4ONFL 5K9KA 2Q3AA 1ZVYA 2W9EH 4TRPL 1MHHB 4GBXD 4YBLC 1GGUA 4MJ6B 3W2DL 5MEPB 3PP3H 4GRLA 2ZZUT 3NIDE 4PJ8B 5IESL 2ICCA 4IJ3C 3QXTA 2QADD 2WSKA 1KN2H 3MBXH 1P7KB 2XA3A 1OTUC 4K8RC 5GRUL 3UTOA 3O9WD 4FQIH 4PJBE 5E8EB 3RHWF 2GJ6D 3MBED 4NT6B 4YDIL 3T65B 5ADOL 5T3ZH 3GSQA 1IAII 3O6ML 3NCYP 1XGUB 1U9KA 1VKXB 4I3RH 1SY6A 3LVEA 1G7IA 1KLGB 3VXNA 4NIKB 4RISH 3QNZB 3PJSB 5EDXA 2VLKD 3MOBH 3GSXA 2D31B 5DVKA 3ARQA 1I85A 5HHNA 2NPLX 4MMZC 1VFOA 3MLTA 5D2NE 5JDSB 5JNYA 1A6PA 2ZG1A 3MFFA 3MJ7A 4QF1A 1CDJA 4OI8A 4U6YA 3KXFE 3CFKB 4P0DA 3HMXA 2KZ1B 4WW2B 4LBEB 4LHJB 3X3GH 1MCCA 2IBGA 5SWSD 2DOCA 1MCJA 4JHAL 4M03A 4MA3B 1FNEB 3L5JA 3IF1A 4PJIA 4Z7VF 1KLUB 3CGTA 4XCEA 3LRSA 2XTJB 1UVQA 5B38B 2GFBB 1EJOL 2FHFA 2ICWB 3K1DA 3U1SH 4RMQA 1ZOXA 1PBYA 3BP5B 4QRRE 1NBQA 5LCVL 1U91B 2VLMD 3ULUL 2G75B 2VDOH 4LPYA 2DTMH 4ZS6D 2P8MA 2QEJA 2I60L 2YD2A 2P42B 3C2SA 1YNTA 3D1MC 1G1CA 2VR5A 5H37G 1MJ8L 3MLUH 4JFFE 4WO4B 5BZWB 2EO1A 3A6BL 3JVGA 3MRJA 4XCCL 3UO1H 4YIQB 1E0OB 4LGPB 1NC4A 4X9FA 1DBMH 4UAOB 1LO3L 3PWPA 2G5RA 3Q3GA 3VXPA 5C6TH 1AJ7H 1F58H 3MXVH 4NZDA 1XGYL 1RULH 3OAUL 2VDPH 5GGSA 4UUJA 3WFHA 2OJEB 5D7IF 3NN8B 1U0QA 1KNOA 4GMTH 1D9KA 3ULVL 1UB5B 3IDJB 3BN3B 4XNUH 3QG6B 4NQUA 5IF0B 3MACL 4LCWB 3SOBH 5JHLH 1U8OB 4G6FD 2ATKA 4IRSA 5I1DA 3VXRE 4B41A 4U6VH 2D7OA 4MA8L 4EEEA 4Q6IA 2GW5A 4HS3A 4YK4B 2WBJA 1A5FL 3MLXL 3M1BA 4JQIL 4NM8H 2QL1A 3RX5A 2DM2A 5IEKB 4LSUL 5DRWB 3MV7D 3FB8A 4GRWE 4PJEE 2Y5TB 1WFOA 5LGHL 3H9HB 5EULV 5I0ZA 3DXAA 2EDLA 4M9OA 4NFDA 4F57L 2A9NL 5FGCE 1E4WL 3ARDC 3P0GB 5I1CH 2GHWB 4PV9A 4X7TB 5IJKA 1IBGL 2ITCA 2WV3A 1J11A 4PRBA 3BE1H 1WZ1H 2YK1L 4I1NB 1ZVSB 5DMJB 2EE2A 3DX7A 2WANA 3CPLB 3ARED 3FN3A 2OK0H 4NZJA 5BQ7B 3VFMB 1I7UA 4JFPB 2VABA 4KKBC 4XP9L 3VGGA 4NO3B 1YC7A 1MCWW 1TCRA 4JY5H 4FQXC 4N1CA 2OTUA 4LCUB 3RZCD 2B5IC 4LDOB 3U83A 1XR9A 3MPCA 1DBJL 4XP6L 3T4YB 5I30H 5DLML 2AJ3A 5TF1H 2CJUH 3KYAA 4XBEL 2R0LH 4DWHA 1IAIM 5DD1L 3W81A 1YEIL 4TNVK 3JV4B 1F02I 1ZT1B 5LGKA 4NQED 3L5IA 3IDUA 3OX8A 3OWEA 4JDTL 2VLRB 3I6GB 1MREL 5DA4A 1J1OL 1E6OH 3QUYB 4Y1AB 4ZUSB 1AI1H 4K7PH 3QDMB 4UU9A 3SQOH 1DQQA 4KTEL 1CFVH 1MRCL 5EZOL 4MS8D 1X7QA 5EO0A 1MHCA 1G6RA 3RVVC 2CLVB 2EO9A 4RGND 3UBXB 2MWCA 1QQDB 1U3HA 1DQTA 3B9KA 3UTSA 5J9PB 3S88L 3RGHA 4EOWH 5LBSL 2FX8L 1GC1H 2I5YL 5FO9A 1I4FB 4QHMB 1GGTA 2VZOA 3CLEL 3DUHA 5IBTL 1S5HB 4IRSD 1K2DA 4HIHA 3HI1B 3B2VL 2IAMB 5D7LB 2LVEA 5BW7A 1CDHA 3NGBB 4MJIE 5INDA 1XF4A 4Y19E 3B83A 4OM1L 2J6EH 3EO0A 4M6NL 3F12B 1DEDA 5DO2C 1FBIL 2Z31B 3QFJB 1C5CH 3RNQA 1H3PH 5D96C 4XT1C 3IS0X 4TUJA 3K2UL 4F58H 2FR4B 1YNLH 2GYSA 4U1SA 1YY9D 4DZBB 1KCUL 5MP6L 5IHUH 2K7PA 1OSPH 1EAJA 3IDNA 1BM3H 2DQDH 5DRXA 4Y2DA 4KRNA 1JI1A 1SVCP 3VRJB 4KY1H 1OW0A 4L3EB 3AVEA 3GJFH 1V3KA 3IDXL 5FUCC 2E7BA 3I6LD 3GMRB 2JCCA 1XFPA 3MREB 3EYOA 4EI6B 5FECA 4XCYA 5JA8B 4BELD 3I3EA 4NPYB 1T6VN 4J2XA 2ZG3A 4PIRF 1Q0YL 1ZMYA 2Z92A 1W72B 5E2TL 3HG1A 3MYJB 5IW6A 3STZB 1K4DA 4LIQE 3TBSA 3CSBA 4BSVA 5DJCA 5CHNA 5IWLA 2PXYA 3C8DA 3P9LB 3UBXG 2VXQL 4R97B 4FTVB 3IT8D 3JWDC 4JN2A 4MXWH 3GUTB 2A74A 4QRPB 1FAKT 1B0GA 2IH3A 1VFMA 3BT2L 3VFNB 3GJEB 1R3LB 3X13A 4K3JH 1LD9B 4HV8B 4QRQB 4NBZB 4D0DA 4S2SA 3GMMA 3WEXB 5A40E 2VDLH 3PGCA 2DTSA 1TETL 2HVKA 2XZAH 4OZIE 3KPSE 4X5XA 4K9EH 3TN0D 2WZPD 5I1JH 1XGPB 1JTOA 2XN9B 4HQQL 3WNMA 4WW2C 2NZ9D 1A6ZB 2J6EA 4MD0B 4U1KA 4EJ1C 3MODH 1A1OA 3ALWA 4LCYA 4M48H 3QDHA 3QWRD 3BRGC 1QA9B 4PV8A 3CFDB 4Z76A 3M17A 4ZSOE 2BNUA 1I7RA 2VLJB 4LLMA 1DLHA 4Q9CA 3GJFA 4O02L 1EO8H 5C08B 3MRNB 2DLTA 4KAQH 4GXUM 3MRCA 5FDYA 3VG9C 3SKNB 4G8GB 4ALAH 2DQJL 2DQTH 2VYRE 5T1KB 1R5IA 1HQ4A 4WO4C 4I13B 2VL5A 4PS4L 4CN1A 1XF2A 1IC7L 1I1RA 3FONA 5F1NA 3QUZA 1EXUB 4NNXB 1N2RA 3TBVA 5I66B 3PIQA 1IEBA 4X6CE 3O6LH 4XBPB 2C1OA 4TVSa 2P5ED 1J86A 4KRLB 5I6XB 2WINB 1QUNA 4FMFA 1REIA 3SY0B 1BVKB 1ZHLB 4D0CB 3VXTA 3VGHA 4M6AA 3WFEL 2D7PA 4PLJD 4NO5B 3S98A 2W65B 5C7XL 4JFDD 1K6QH 9CGTA 4L4VA 5JMRA 3P11L 4D3CL 2BMKB 4HF5H 1FO0A 4L9DA 4C54A 2FSEB 2R1XA 1KPUA 4AT6A 4IOIA 1EAPB 3AC0A 2FLRT 1J8HB 2IADB 3VE0B 3K7UA 3HNVL 5CILH 3PL6A 2G2RA 3WFCL 2HJKB 1I1AA 5HGDA 5F1OB 5E4IA 5BJTB 2E7MA 2AJXL 3UPRA 4NKIL 2DKMA 3NPSB 3OKNA 5CJ5A 5EU5B 4YX2H 1KGCD 4IIQA 4OIIH 4ETYA 3VFOB 4HDIB 2DQGH 3BXNA 3HZYB 3MCLH 1EHXA 4QYOA 1DSFL 4UTAH 4LEOB 1F2QA 3SDAD 4JRXD 5E8OA 3HC3H 5IBUG 4H0GA 4M8VA 4Z95H 1UENA 3V0VA 1DVFA 3QEUB 5C0JA 3WIHL 3CCHB 2CR3A 4OGAC 5FHAL 5TDNB 4TTDC 4UV7H 4BSJA 4JRYD 4HAGA 3SDDB 1CFNA 1KCSL 1RIUL 1LO0H 1MCPL 4I5BB 1HN1A 3R1GL 2FJHA 3T04D 1C5DA 5FO8B 1YY8B 2E9WA 2NMSA 2VITB 5L2KA 4TPRH 1N6VA 2NY3B 4ELKA 4XWGH 5EIQA 3X3FH 4DKFL 3WNOA 3OB8A 5DD6B 1FHGA 2O26U 3MR9A 5DEGA 5ANMA 5ESVA 4HZLB 1T5XA 4X7SH 4R4FL 3MGOA 2VXSH 5I2IA 4HJJL 5IVNA 2GAZA 3PDOA 5DQJB 1U8PB 1G7PA 3WE6B 2CUMA 3MJ6A 3OJVC 3LIZL 3QG7H 1MF2L 3BN9C 5FB8B 3UPAA 5DUBB 5JUEH 2V7NB 2BY1A 3MLRL 4D9LL 4Q74A 1BOYA 2R56L 3CVIL 5TGBA 3O6KL 4KGLA 3P0YH 4LEXL 5H2BB 2BSSB 5DK2B 4M5ZH 3PNWA 2I25N 4L4VD 3KLSA 5I15H 4PRHB 5CP7B 5CEYB 1DQDL 3CXDL 1MHEB 3ULUF 1AIFB 4RGMC 2O5ZL 1WV7T 3TO2A 2NR6D 3W5MA 3B6SA 3PL6D 4I2XA 1IFHL 1K8IA 1MWAB 1S7UA 1ZWIA 4PYHA 4JDZA 3O6FA 1N0XH 1PG7W 3IFNH 1IGFH 3CFEA 4MLIA 5KVEH 3CXHK 4X6DE 4KZEH 5HHOD 3CFJA 1DDHB 3SBWC 3ZKSD 3KR3H 2YOCA 4FQHB 5BV7H 3OAYK 1J05B 3JTSA 5AZEH 2YPVH 2NW2B 2WAHA 1UXWB 1HWGB 4KRPB 1TTUA 4BM7A 2VE6B 1KN2L 3MBXL 4Q9QH 1DVFD 3MRMA 3IU3B 4LNRB 3BPNB 2DI9A 1FRGL 4UQ3B 1QSZA 4JJHA 3D3VD 4GW5A 5T3ZL 3ULVF 5D1ZB 4QWWD 1NBYB 3FOMB 1XEDA 3RVXD 3NIDF 3F62A 1ZANL 4G5ZL 2EEAA 5DWUH 3AFLA 1PZ5A 4RAUA 5CUSL 5CGTA 1TLKA 4ZDHB 4LLQB 4LU5H 2AXFA 5EN2A 1H0DA 2IGFH 3C2AH 4EN3D 5F6HI 1NUGA 3RY6A 2CDEA 2OR7A 3WSQH 1OCWH 3PP4H 2XZCH 3BEVA 4AJ0A 3QJFA 3PWVA 1GGBL 2V5SA 3MA7B 5DHVB 1T7WA 3IETB 1CL7I 4GG6F 2YN3A 5MEQB 3RGVD 3E1F1 5D5MF 2VXTH 4PD4K 5C0EB 5AG8A 5L6YL 4TUOA 4UB0H 2MHAA 3LV3A 4MXVF 4KK5C 3AS1A 1PD6A 4YC2C 3P77B 2NY5C 3FTGA 5JQHC 5J0BA 1BZ7B 2PTTA 4Z7VB 3O45B 3F58L 2GT9B 5DSCA 3TBYB 2PCPA 1JV5A 1DUZA 3GSVA 5ESAB 4MJ5B 2GTZA 2F54D 2VDOL 2DTML 2VB5A 3V5HA 4B7IA 1CQYA 2BNQA 5CZVL 1QVOA 4ZNEA 4CJ1A 2R2BA 1BQHB 3IDIA 4NKMA 1ED3B 4XAWL 2IWGA 3K4AA 1AO7A 1IMHC 5JIHA 1QBAA 4GFTB 3S4SA 1U8QB 1BQLL 3KPQB 4YHKH 4EDXB 5GGUB 4XCFH 1DBML 3QPQD 3EUUA 1JL8A 1JYXA 1KTKE 4HSQA 4Y16C 3F8UB 4HUKB 5C6TL 3FO9B 5AAMA 4M9PA 3EYFA 5DS8B 1FIGL 4EXPX 3OJDA 3WJLC 5E2VL 2V6HA 1JNLH 3FT2B 3V95A 2GITB 2VDPL 3AXLB 4C83A 5IT2H 3VXSA 5GGRB 3NA9H 2A6KA 4L9LC 4GMTL 1MFDH 3GIZL 4S0TD 3GBML 4OF6A 4LLDA 3X12A 5EU7C 4P57B 1URLA 1N7ML 5I75C 5D7IB 4Y4FA 2VXUL 3SOBL 5JQ6L 5D93C 3V6OA 1OSZB 4JQVC 4HWZB 1IC4H 2NY2D 4I48A 4DJMA 3DBXA 4PP2B 3QQ9D 1HH6A 5JW5B 1UWGH 2ED8A 1G6RL 4BFIA 5ABDE 1KJ2L 1NEZG 2Y7QB 1F11A 2P24B 1Q9OA 3DSNA 1FC2D 3ZDXF 5KN5A 4B7LA 3HRPA 1FCGA 4QRTB 5ITFB 1NUFA 4QT5A 1D5XB 3HUJE 5DGRA 1T6WA 5KAQG 1N8ZB 1FFOB 4ZPTB 3BE1L 1WZ1L 1BQHG 5IGXH 1FYTE 3VGFA 2D7MA 1JGVL 2V9TA 4O2CA 2OK0L 2ARWA 2JK5B 1YEEL 5CLWA 1I8KB 4GRWF 1AGDA 1YMMB 4CKVX 2ICEA 1SEBB 2QQLH 1V7MH 3L7FA 3DWTA 4WJ5A 4AENB 4MQXD 4U3HA 4WNQB 2BOCA 2YWZA 4PRDB 3RWJB 1BBDH 4JPKH 3QI9B 3IFPB 3AM8A 5GIRA 3CMGA 3VRIB 2IANA 3SDDC 5MEND 5I30L 4WWID 5TF1L 4U1JA 2R0LL 3BQUD 5HD8D 4CN6A 5GJTH 4KZDL 2OLDA 4ZUVB 5MERA 2GTWB 1SEQL 2V17H 2NY3C 5F89B 1BD2A 1OP9A 3RPIA 3MUHL 1AHWC 4JO1H 1E6OL 4HMDA 1KYOK 1AI1L 4K7PL 4RBPK 5J89A 5AZ2H 1QSFB 4JVWA 5EU3B 5D1QD 2R8SH 1OOAA 4HK0B 1CFVL 3DURA 2MNUA 5IV2A 3BKMH 2LFGA 1JWSA 3P73A 1AP2B 1DQJB 3W0WB 5C09B 5KW9L 3S96B 1U93A 4I8DA 2JIXB 2HJFB 1MNUL 1S7XA 5ICYA 4XH2A 4FQ1H 1XR8B 4Y4FD 2X4OA 2YHGA 5E2WL 4ONHA 2W60B 1RU9H 1VDGA 2M26A 2MJWA 1MI5A 1JPTH 3SJVB 1Z2KA 4U1IA 4HXBL 4WEMB 2IQAA 5FCSH 1Z6JT 2Y06H 4U0QB 1NFDF 1U58A 4KKNA 4NOFA 1NBZA 3DVGB 3QIUC 2J8UE 4R90L 4RQQB 2B4CL 5T5FH 1IGIH 2H41A 1ZLVK 2DIAA 4YDVB 1KG0A 4MLSA 3ULSB 5KSUB 5IFJB 3ZYIA 1OGAE 1UKTA 32C2B 2ATPA 5HYSB 5BVJB 2A38A 4HWBH 3BW9A 4ZUUA 5HVGB 2EDYA 2J12B 3WFBH 4L8DB 4AIZB 4LSVH 4L4JA 5DJ6A 4HKBB 1EFQA 2OCFD 1NLBH 3EFDH 1QFWL 4JHWL 2UVEA 4XI5D 5IR1A 1FORH 3QQNA 4IMLA 1XGQB 3FQNB 4UDUB 5CWSA 4OD1H 5D9SB 3RIFF 1CK0L 5DYOA 3PQYA 2E8YA 4R6UA 4OQTL 1II4E 4QHLB 4Z7QF 3MV8A 3UYPA 5D1ZC 1BIIA 5A1AA 3BP4A 5HGBA 3V52H 3ARXA 3WIFA 1QNZH 4C58B 5MEOB 1I7TB 4HBQA 1WWWX 4UOJA 4JRWA 4HS8L 3TIEA 2R1YA 3MJ9L 4CGTA 5AYUH 4YHPA 1IKNC 2XZQH 4F33B 1JK8B 1C08B 1FO0L 4K3DH 1JMXA 4KV5E 4ODVL 1WAAE 3KDMB 1K5NA 4TQEH 3LMJL 2Z91A 1X5ZA 4JG1H 3WL9A 1U8KB 5ISZA 1LK2B 3WKMH 1HHJA 1JFQL 4PREB 3DTXB 3MCKB 2GKIA 3MMEB 3UJJL 4G8IB 1RZJL 4YHZL 5GS1B 3L1OH 4X7CC 2EXWD 5DDHB 1HI6B 1U8NB 5KSAA 4OLZH 5DC4B 4H8WH 2EIZB 4HWBA 4HW6A 1MI5D 3ARFD 5GRYA 4WI2A 4ALAL 3U30B 4RA0C 4PRAB 5DR5H 4HKXA 1NEUA 1EHLL 4JKWA 3O4OB 4ZFOL 4JPIA 1A1NA 4PJ7A 4G8FB 5F93C 2JB5H 5C0AA 4FMKA 4E0RA 2ZSVA 1FCCA 1HCVA 1S7TA 2Q8AH 3O6LL 1BFTA 3G08B 1AR1C 4POZD 4HX1B 4P46D 3V5DB 1UZ6E 3C09B 4U1HB 2DMKA 1K4CB 2JJTA 4NQTA 4DOHE 2VZ3A 3OR6B 5A2IH 1W0YT 3FCTB 3V0AC 2DAVA 4XNXH 4P3DB 4X4YB 1WZLA 1GYAA 5HYEA 4CVZB 4DGVH 2Q8BH 1BGXL 2ZUXA 2ED7A 3OKEA 1P6AB 3VGAB 1AC6A 2O5YL 1I75A 4X80H 4R7NB 5C0BB 1CFSA 2ESVA 2AJZA 5LVEA 1IM3B 4M1CC 2BDNH 5KOVC 1RZKL 2RFXB 3RVWC 3UTTA 4I0PA 2EDWA 5IVOA 1JYNA 5TF0A 5J12B 1QG3A 2ZP0T 3TH4T 1NLDH 3VFGH 1U8HB 4XTRC 1CVRA 4IMKA 3VI3F 4PJIF 2DICA 5A2LH 1CXEA 3AY4A 4YX2L 5J4MA 2DL2A 1G6VK 4TSCH 3EYVB 3ARSA 4OIIL 1BWWA 1FV1B 1MCKA 1NJ9B 2YUVA 3A6OA 1TNNA 4H25A 3RI5K 5HGAA 4HUXB 3FFDB 2M1KA 3MCLL 3CNKA 4XHJD 1D5MB 4L4TB 5JPNB 3U9PH 5ITBL 4PTUB 4LLWB 5C86A 2G9HB 3O2WH 1XIWB 3OB0H 3GHBL 4GAFB 2VDKH 1MFEH 4U2ZA 1S78C 1NCBH 3T2NH 3U82B 2N7AA 1QSEA 3BH9A 3LPGA 1BQSA 3M07A 5FYKD 4FP8H 2EDQA 1Y0LA 4AEHL 3T77A 4C56D 4P2RE 3V7MA 1KC5H 4JO2L 4PJAA 5KSAD 1T89A 5DA0B 2F19H 4TPRL 2ZUVA 4DK6A 4Z7UF 2IPKA 2VDQH 4UIKH 3VFRB 4WUUA 3KLHC 3BPLB 4PJFF 4EBQH 2X2YA 2BY2A 4K71C 1I9RH 3MRFB 4YO0B 5ENWA 4X7SL 5B39G 2BNRE 1CI5A 4FQ2H 2VXSL 1S7VB 2AEPH 3MV9E 5B4MC 1CG9A 5ID1A 1QACA 3GSOB 4MNGB 2QQKL 1NCCH 5CEXB 3E0GA 4AH2A 1CN4A 5GGQL 1ZA6B 3KPPA 2FWOA 5IVXF 3C6LA 4G6AC 3D85B 3FOLA 3NAAH 4MNQD 3F7YA 4RNRB 4UMGA 4XNQA 3T4AB 1I8IB 3L3JA 5CZXD 3ARBA 4I4WB 3P0YL 4ZAKB 4KUCD 1ZEAH 4YR6A 1Q9LB 2R2HA 4LNVA 1SJHB 1VHPA 1N3NB 1C7TA 4M5ZL 3TCLA 1LQSR 4Q58C 5EORH 4X4XA 1ZS8B 1KCVL 3MFGB 4PJDE 3WS3B 3NZHL 4FABH 2HP4A 5DZNA 1W8OA 1BWMA 1CDUA 4XPAH 2ESVD 1T1WA 5KSBE 1EDQA 3QO1A 3UTTD 4PUBL 3OF6D 4I0PD 3O2DH 5DMGD 4DVRH 3L3IB 2QV2A 5I1LA 3KNBA 5KVGH 1UCBH 3SDCC 1N0XL 3IFNL 2FZ3A 1MEXH 2P8LA 4U6HB 2EDOA 4QHUB 4KZEL 3IFLL 4JZJC 3T8XB 5BV7L 3DX6A 6CGTA 4K94H 4NQDE 1KN4H 1IT9H 2C4FU 4TUKH 5FV1L 1OTUD 1WVZA 2AVGA 5KVDH 2XKUA 4M02A 1OB1A 1IQWH 3WUWG 4WV1A 1F45A 4U0RB 1HK6A 4FG6C 3HTLX 3VXMD 4OF0A 1KBGH 4KJWC 3H9SE 3KPLA 2FB4H 2BVTA 4F7CA 2EDFA 2R2EA 3D25B 1CD9B 1WBXA 4KVNH 5E03A 2BVPB 2Z8WC 4P23B 3ILPB 5DWUL 3ECBB 1VA9A 3OMZA 2H32H 1CFTA 2NZIA 5DJZA 8FABB 2IGFL 3C2AL 4IDJH 1UM4H 3LH2H 5LG1A 4KXZI 4YHYC 1PLGL 3OQ3B 3Q2CA 4JCMA 5GGRY 4WFHD 1OCWL 2BY3A 1BFVL 2ZCHL 4FQCL 4WY7H 4PY7B 5JW4R 2X6MA 2FH6A 3H0TB 5E4EB 2KQNA 4JPVH 5FUZL 2XG5A 1MIEH 3G6JF 2VXTL 5DJ2A 2YR3A 3MRLA 1BFOB 1R3KB 3NFSL 4JM2C 2HMIC 3DUUB 4X4ME 4Z8FL 4GG6B 3QEHB 1SMAA 1T3FB 5ETUB 3VXUE 5D5MB 5INCB 2DYPA 3O2DA 5EU6E 1RJZA 3HC0B 5F7HA 3MROA 5E9DA 4XPGH 1B2WL 4QXTA 3FQTB 1DCLA 3ARBD 2HFFB 5EA0L 2CGRL 2FEEL 4LHUB 4WHYG 1CCZA 5GS1C 2UV3A 3OKOA 3TPKA 1OY3B 1QHOA 4X4ZA 2F53B 5DK3A 2Z8RA 2O61A 1DLFL 3ET9F 3FN0H 4BQCA 1G7MB 4OKVA 4Q2ZA 1IAKA 3U30C 4L1DA 4XCFL 3BIKA 5DTFA 2PW1A 1TTGA 2UUDH 4JM4H 1M7XA 2ENYA 2V9RA 3KLDA 2CPCA 1DEEA 2AV1A 4HG4J 4HIJA 5T5NG 5EIIA 1I8MA 4R4NC 3O4OC 2XV6B 4RFEB 4OF8A 1EK3A 1JNLL 2P8PB 3QQ4A 5TPWH 4OLEA 1NC2A 5HYJA 3IXAA 3ARUA 1I1FB 4WWKB 1DN0B 4G6KH 2DKSA 3PP3K 4LPVA 4CNIB 1ZGLA 1ZLWH 1CGXA 2H32A 5FIEA 3MLSL 4YXKH 4M62L 4U33A 1DUYB 4GQ9H 2MCG1 1F4AA 5T1MB 4JFFB 1AGEB 2R29L 4H5SA 1T04B 3C09C 4QXGL 2ZOLA 2X1QA 1KJVB 25C8L 3PXJA 4P2QB 4YBHA 1CGSL 3MRBA 5E24E 5T3XH 1V3MA 1MCEA 3QZWA 4CADB 1YEJH 2WLZA 1H8SA 3A67L 5BRZD 1OAQH 2ZUQB 1T5WB 1CVSC 1MFCL 1ACZA 4X9GA 3FO1B 4O5LL 1OM3L 3VGAC 1YDPB 1HNGA 1UWGL 1JPGA 1JF6A 4MAYB 4G7VH 4ZXBB 5SV3A 4DKDC 3BIBX 5FOJA 1UCTA 2MPAH 1F4HA 1PSKH 1FGNH 5IHZB 3ARDD 5B3NA 4X5LA 1EPFA 1U42A 2YXMA 1XCQB 4MA7L 5AUMA 4NZTL 4P5TB 4XBGB 1ZA3A 1J0KA 3TO4B 1MHHA 1KENL 5F7YC 4MJ6A 1YEHL 2PTUA 3DUSB 3LKQA 3IJHA 3V2AR 5MEPA 2EICA 3OR7B 3ZTNH 1CD1A 5E99H 3VXRB 4LVOC 2W38A 1LMKA 1P7KA 3MSPA 1G7LB 4OLXL 1CGVA 2EECA 2X4SA 4NT6A 1OWRM 5GRWA 5L2JB 3T65A 5DJAB 1U2HA 1VKXA 3S5LB 4EUPH 1KLGA 2OBGA 1WIOA 5CSZB 1E28A 1DFBH 3DO7A 2PYEB 5GJTL 4CAGA 1A6AB 1MOEA 5EBLB 3MC0A 3CFKA 3BPLC 1UA6L 1IGTB 3GM0A 1MHPL 1SBBA 5CINL 4G9FB 2LTQC 4LBEA 4I0KA 3Q5YA 4QOKD 2W0FB 1G9NL 2DD8L 1FNEA 4MA3A 3RVVD 1KLUA 2Y23A 4PRPB 3FQWB 1AE6H 1ETZB 5K9QI 5B38A 5A16B 3BKML 5HYJD 4UT6H 2FEDC 3BP5A 3H3PL 4NN6B 4MCZB 5ESQA 2V2WA 4JZOB 5HSFA 3VD4A 2Y36H 4OGXH 4Q9BA 2GJ6E 3DVIA 2J88H 3I84A 3ZSSA 3MNWA 5DJDB 4OI9A 3TNNB 3VMPA 3Q6GH 4L3CB 1YECH 1FNLA 3O3DB 3C5SB 5GPRA 1RU9L 3EDFA 2UYLB 2VIRA 2IFFL 1CDBA 2VO5A 3G5XA 4J1UB 2Q20A 3M8OH 2VLKE 1EHAA 2Y06L 1R5VA 1NBVL 3CC5A 1RI8A 4PJ9B 4J8RB 2Q7YB 2ZKHL 2P43B 1IGIL 5T5FL 2W0LA 2VDMH 4P4KB 4PJXF 1NFDB 1E4XI 4EUPA 5SWSE 2R23B 1G7JA 4L1HA 3WFDL 5ILTH 3CAFA 4MB4A 2OJEA 1A14H 3NN8A 4BK5A 4F9LC 35C8H 4TTGA 3CX2A 1KSRA 3RVTD 1RJYB 5E7BA 3WD5H 4PJ8D 1UB5A 3IDJA 4OZ4A 1JZ2A 2GK0A 3QG6A 1TVHB 1HOCB 5KZCD 4LSVL 5F8RC 3PWLB 1PAMA 4JFHD 1JNJA 2VLME 4LCWA 4OCWH 1U8OA 3A0OA 1X6NA 1Z3GL 3EFDL 3ZKXB 4OZGE 2JJWA 3B9AA 3RX7A 2AK4B 5TQ2H 1CICB 2OL3L 3PF2A 4OV6F 5JHDB 1E4KA 4YHML 5AWNL 1T2XA 4B53A 5HHMB 5IEKA 3H6JA 5SX5K 1JPFB 2Y5TA 1NH6A 3FFCD 4P23C 2YZ8A 5A3IC 2XQBL 1XH3A 1YC8A 1NGYB 4N0RA 4TOYH 5L9DL 3D39D 1ZVSA 1WEJL 2H1PL 3FRPG 1I7ZA 3O4LA 5AYUL 5T3XD 3P9MB 1GGIL 3UC0H 5HPMB 3CPLA 2D4FA 1FL3B 1KULA 2FECI 5BQ7A 1WBYB 3STLB 5AD0B 4JFPA 2VAAB 4OAWB 4HGWB 4JG1L 4NO2A 4O00A 5TE6L 3WKML 4ODSH 3BD4A 3KWWB 4FXKB 4DQOH 3OZ9L 4LCUA 2FO4B 3MRQB 3DHJA 1Q0XL 5I19H 3GBNL 5I8KH 4KJPC 1PFCA 1RJCA 5CS7A 5I17B 4QTHA 3T0EB 3EGSA 1Q94B 5JOPD 4J4PC 1I3RA 3JV4A 3MV7E 3SGKC 4WO4D 3KPSB 4OFDA 1GGYA 4NN5B 3I6GA 1W72H 2NX5A 1JWMA 5IFAL 3QUYA 4Y1AA 4ZUSA 2AS5M 3V79C 3KPRB 5C0FB 5D6DC 1JRHI 1EUUA 4HWEH 4XPTL 1YN6B 2XNAB 5E70A 1ZK9A 5C8JB 4OCLC 5K9KB 2E7LC 3IAPA 3GJFK 3MUGB 2CLVA 2Q8AL 4G80B 3UJIH 1QQDA 4XP4H 1UH4A 4MSWB 4YPGB 5DQ9B 4UINH 4I18A 4GRLB 3D0VB 3DPBA 1MCFA 4WWKC 4XHQA 2NY0B 5KG9A 1DANU 1I4FA 4QHMA 4LCWD 3OGOE 1A3QA 2IAMA 2EE3A 4HXAH 4GMSL 3VMOA 3BEWA 3F12A 1KIRB 4NQEE 2ZUQC 3VXNB 2Z31A 1M6OB 3QFJA 1FQ9C 2YPKB 4ZO7A 4N8PA 4OCXL 1N64H 2FR4A 3GSXB 3VI4F 1QPXA 1P7QA 5CJXA 1GGCL 4W4OC 4DZBA 3D87B 4R8WH 3SKJH 3MLTB 5J56B 4WI6A 5JNYB 1RUKL 2DM4A 1EEZA 4QF1B 3ZE1F 2VWEE 4XNZB 4WEUD 4JPWH 4JQXA 1X5HA 5EU4B 4U49A 4Q0XL 4Y5VB 4RGNE 3GMRA 4YXLL 3RWCA 4GAJL 4PJIB 2EE9A 4XCEB 1I9IL 1UVQB 5IOPA 5KBNC 1W72A 4OGAD 3OHXA 2PYFA 1BJ1J 4TTDD 3MYJA 1QBBA 3STZA 2HTKD 1MFEL 1LP9E 4N5ED 4MNHA 4GW1A 5CIPB 3P9LA 1OF2B 2P8MB 1CXLA 5F44A 3DMMA 2CLRB 3GI8L 3MRDB 1YNTB 2NY4B 3VFNA 2B2XH 2F19L 1R3LA 1WUNT 1XF3A 3PHSA 3MRJB 1SMOA 4HV8A 4UIKL 1EFXA 4QRQA 5EOCL 3EBAA 5CBEA 4EBQL 1NC4B 2VLRD 4I3SL 4FZEL 3AB0B 2YPLB 3PWPB 3Q3GB 3VXPB 1GSMA 4Y1AD 1A7NH 4Z7UB 1T7YA 2VZ1A 3QDMD 2X42A 4JO4H 3QIWB 5FUOH 4PJFB 3RVUC 4WU5A 1XGPA 3KHOA 2R4RH 2XN9A 1NCCL 2AQ3A 4KVCH 1UKSA 3REVA 3I6LE 1CBVL 1CZ8H 4UUJB 4FQQA 5LXGL 1S9WB 3NAAL 2X5PA 5E08H 3G6DL 4P59H 4IOSD 4MYWB 4BFBD 5D2LA 4ZMAT 5GRXG 4ZTPH 2CUHA 5IVXB 1C7SA 5J06A 1F3JA 3BKCH 1S9VB 5C08A 4EXKA 2ATKB 2YUWA 3V9FA 5I1DB 4NQSB 4YDLC 3SKNA 4LVNB 2DLHA 5EORL 5D7LD 2LU4A 2E9JA 4F8TA 2P5WB 2EDKA 5HTSA 3RTQB 1P9MC 4XPAL 3FB8B 4FFZL 1X44A 2B8OT 2Z31D 1L7IL 43CAB 3H7BA 1IGJA 2Z93B 1EXUA 3DXAB 3LQMA 5I66A 4DVRL 4ZOAA 1SHMA 5KVGL 4AL8H 4PJ9C 4GO6B 4LL9A 1XGRA 4XBPA 3TT3H 3OBAA 4PRBB 2HJLB 4L3ED 4P4KC 4WU7A 2EIDA 3DX7B 5I18H 4YFEA 1UZ8A 5HI4D 1LDPL 1ZHLA 4K94L 1WLHA 4D0CA 5KSBF 1I9EA 5ALCL 5FYLH 2BJML 5F97E 2VABB 4NO5A 4OCRL 1J5OH 4FQLL 4CRPA 1BBJA 5HJ3B 3O9WC 4DFHA 3QDJD 4LVHC 1TCRB 3UMTA 2BMKA 2FSEA 3ZKXC 3L3HA 3MOQA 1EAPA 5J1TC 4PPTA 5GHWH 3KYOB 1XR9B 1J8HA 4QHKI 5D7JB 4BKLB 3MGTA 4FTVD 1JTPA 4KVNL 3THMH 2HJKA 4QRPD 4Y19D 1XCTB 2ZNWA 1A7QH 1NCAL 2BCKB 4IDJL 4OF5A 1UM4L 5HVFB 4FFWC 5EU5A 4Y5YC 3LH2L 3R8QA 4NDMA 2CDFB 3VWKB 3CVHL 1B90A 3VFOA 3MLVL 3C5JA 3C6SB 2P5EE 2IALB 3HZYA 4FNLH 1DQQB 4KK5D 4UU9B 4NC2B 2HTLC 5L8LB 4LEOA 4JPVL 5BOZG 5BXFB 1MIEL 2XN9D 1X7QB 1MHCB 2C7UB 1G6RB 2JCCE 1KJ2B 1U3HB 1FFPB 3B9KB 1RUMH 3UTSB 3K8LA 5JTWA 2EEDA 5TDNA 3G6JB 5TE7H 5EPMA 1MWAH 5FK9A 4JFDE 4XPGL 3QNYA 1FH5H 5DFVD 3QYCA 2DF3A 1A7PH 2VLJD 4NO0A 3C60A 5C07B 5K9JL 2FX9H 5DD0H 2QR0B 4ZS6C 1A1MA 2VITA 1K2DB 1S5IL 2DRUA 3QRGL 4G8GD 5JO5A 5DD6A 5T1KD 3CMOH 5INDB 5J6HA 4HZLA 5JIIA 1AKJB 5FYJL 1T20A 3RNQB 1FG2A 4LSPH 5DQJA 2F5BL 4TUJB 3SE3A 1KGCE 4RSVA 1JGLH 3HI5H 5DRXB 3IDNB 3TP4A 2DBLL 5KS9A 3R0NA 1H5BA 3SKMB 5TPWL 2QSTA 5FB8A 4JRXE 3EOTH 4Y4HB 5FCUL 5DUBA 2KDGA 1AXTL 4R96B 1A6UH 5FECB 3W82A 1JZ4A 4XXCA 5H35B 1KXQE 2Z92B 4JRYE 5DK2A 3HG1B 5IW6B 4TNWK 1S9KC 1BAFH 4F7MB 1K4DB 4R26L 5DHVH 3TBSB 1ZLUH 3F7RA 1YEJL 4M00A 4BSVB 5DJCB 5CHNB 5CEYA 2PXYB 5TJWK 1AIFA 1J8HD 3OKDA 2OTWA 3VFSA 4RAVA 2XY1A 3TJEH 4G7VL 1FPTL 2H2PC 4P2CG 1B0GB 2MPAL 1PSKL 3WN5A 4MD5B 1ITBB 1MWAA 12E8L 3OKLB 3I02A 4M93B 4NBXB 2V7HA 3T3PE 1I85C 3PGCB 3S37L 4EQ3A 2JB6B 2XWJB 3V7AG 4X5XB 1J05A 4U05A 1UXWA 3GRWH 3ZTNL 4E41A 5F9WB 4HCRH 4XPFH 1ONQA 1DBBH 3TPUB 4F37F 1T80A 4U1KB 2R0ZH 4NNYB 1PG7H 2ADFH 1A1OB 1YNKL 4LCYB 4UQ3A 2AQ1A 3SDDD 3EO1A 4Z76B 1T1XA 1NBYA 3M17B 5DK0B 3U7YL 2BNUB 4L4VE 1I7RB 4LLMB 5EC2A 1DZBA 3GJFB 2I07B 2OMBA 3MRCB 2R4SH 4JFXA 4ZDHA 1DFBL 4LLQA 2NY3D 4Y0GA 1R5IB 4OGYH 1HQ4B 3LS5H 2X9YA 3NFPB 4PJ7F 1T21A 3JVGC 4M61B 5FYLD 3ZL4H 3U0TB 3FONB 5F1NB 5DHVA 2X70B 2NCMA 4R9HA 3QUZB 5I74C 4YEEA 3EOBA 4OIBA 5MEQA 1TPXB 3P4NB 5HHOE 3PIQB 4Z5RA 3X14A 2CK0H 1VPOL 1G0XA 3GEWB 2X9WA 2NXZB 2VWEC 4KQ3H 2C1OB 3EJYC 4L5FL 1UACH 4MS8C 3P77A 3NFNB 4JG0H 4UT6L 4YHLL 4RGNC 4LRIA 4KH2A 5J13B 4Z7VA 4P5KB 4QGTA 4ZFGH 1JYVA 1B4RA 3O8XA 3TCXA 2JJSA 1D9KC 4PBWD 3HNSL 4WTZG 4X5WA 2DL9A 3UYOD 4L8BA 1DQLH 5MI0B 2Q6WB 2OP4H 5ID0B 1FO0B 3GRWA 3E2HB 2R1XB 4AT6B 4PRHD 4IRSC 1KTLA 4HCRA 1J1XL 4NHCH 2NY6B 3HZKA 5EG6C 3M8OL 1U8QA 3KPQA 2CRMA 5E2JA 1RAMA 5GGUA 4Q6IC 2WBJC 3TWCH 2GIYA 1FZJA 2ORBH 4P4RB 1S9XB 5ANME 2Z35B 1I1AB 1FN4B 5DS8A 2P45B 1YY9C 4PTTB 3HZVB 5DUMH 3KJ6H 4IIQB 1S7RA 3AXLA 2GITA 3I2CH 3F5WB 4CVUA 1P4LA 3BXNB 3DGGB 5IJKC 1MSPA 3UZEA 4DGYH 4DUXA 4PJXB 2D2OA 2XQYK 1K9TA 1W0WA 4NP4H 4P3WA 4KRPD 4P57A 3V0VB 1MAML 4J3XA 1QRNA 4ZD3H 2HRPL 4OCWL 2F54E 4ZFOB 4M1DH 1OSZA 1RV6X 4HWZA 4X9HA 1TVDA 3BKYH 1JNNH 5B8CA 1VGKB 5TQ2L 2BHUA 2EYTA 5JW4M 5D1ZD 5JW5A 1V7NH 2FJHB 1F6LL 3I6KB 1C5DB 2BSRB 3UJTH 1M71A 2WQRA 4XPBL 2ZPKL 5L2KB 4Y8DC 4YHNB 4KMTL 5DURB 2H8PA 4QRTA 1K3ZA 4KU1A 1D5XA 1FSKB 4K3EH 4M7KH 3EJJX 5DEGB 4I2XE 1N8ZA 1T5XB 5CEZH 1YPZF 1X4YA 1OTTC 4PRIA 2UWEE 4ZPTA 5I2IB 1SQ2N 1L0QA 2B1AH 1EEYB 3C8KA 4O58H 1G7PB 5EO1A 1M05A 1QOKA 3WXWH 4BQ8A 2R0WH 2UZIL 5I1IL 4G3YH 1I8KA 1ZT7A 3BRDA 3DRQA 5LJYH 4NJ9L 1FGVL 3OAZH 1LEKB 1GPOH 4PRDA 1CFBA 3GK8L 3VW3L 4N0YH 1FLRL 3QI9A 4UV4L 1U3HC 3TYGH 4ODSL 3U0WL 4PJGA 2C5DC 3B9KC 4DQOL 1J9CT 4K07A 5IK3A 4NQCB 3VRIA 5CLTA 4OSUL 5LQBH 1TZGH 3PNWB 3HE6A 4OCSH 5D8JL 1CF8L 1CFQB 4LMQI 5BO1H 4ZUVA 3PGFH 1GOFA 5F1SA 5F89A 5BW7C 1NDMB 3TO2B 1W72L 5EUOE 2PUQT 3B6SB 4LRNH 3SDYL 1BLNA 1K8IB 1S7UB 4JDZB 3O6FB 1AR1D 4U7KA 1AH1A 3QCVH 2RCSH 5E8NB 3C5ZA 3CFJB 2AK1L 1AP2A 4Y2DC 1DQJA 3QIBA 3RIAF 1UM6H 2FBOJ 4XP4L 3W0WA 3N0PB 4X7DC 1OW0C 3JTSB 2GQHA 3S96A 5DT1H 1T4KB 1JUFB 3PUCA 3JWOH 4OCMC 5C0CA 4GQPH 1A02N 3O3UN 2UY7A 3TBTB 5T1DH 4RX4D 2O5XL 2C9AA 3RWEA 1R3HA 4YQXL 4PLJC 2W60A 2WUBL 4NFBA 5BMFH 5MENE 1OP3K 4HAFA 1KELL 4GW5B 4ZNEE 3MXWH 2D03L 3RVWD 4FZ8L 3S34H 1EO5A 5IWLC 3DVGA 3VFPB 2ITDB 5J57B 1X9QA 1PZ5B 4RAUB 4XTRD 3D69A 5EN2B 2AQ2A 3ZKMC 4R8WL 4UTBH 3TJHC 4YDVA 5GGSY 2FJFA 3ULSA 4DGIH 1GC1C 5IFJA 4M93C 1I3UA 3TNMB 2EIEA 32C2A 3PWVB 5HYSA 1VADA 2JJVA 3RNKA 2J5LC 2OYPA 4TUOB 5H94B 2MHAB 2A77L 2C3HA 4AIZA 1YMMD 4KC3B 1EMTH 5F9WC 3RFZC 1S78D 1N4XH 3NTCL 4HKBA 1QO3A 1A9EB 2PTTB 3QI9D 1XGQA 4UDUA 3ME0A 2PCPB 5HDOA 1WTLA 3RY5A 3GSVB 2GTZB 3D0LB 1MJ7H 2CDGB 2BNQB 4C57C 1OAZH 5BV7B 4J7RA 4LFHG 4LKXA 4NKMB 1WBZB 2KKQA 2CIIB 1AO7B 2B2XL 2BXZA 1AXSA 4YZFE 2KPNA 5MEOA 1I7TA 4CMMA 1SBSL 3S4SB 4LF3B 4RFNB 5B4MD 1KEMH 5FKAA 3ZDYF 1U41A 4GKZB 5FUOL 1N26A 1DE4B 1QSFD 3EYFB 1JK8A 4F33A 3OJDB 2R4RL 3QUZC 5E6YA 4KVCL 4Z0BL 2X4QB 3KDMA 4CU7A 1UFUA 4G6AD 3T2QA 4XVJH 3VXSB 1U8KA 3W0WD 1XF5B 5C09D 1LK2A 2A6KB 4Z7OE 1MQ8A 2PO6A 4PREA 3DTXA 3RWIB 4MVBC 1JYWA 5J13C 2JIXD 4G8IA 4ZUTA 3O3BA 3TVMA 5DDHA 1FJ1B 5F9DC 1AD9B 3O2VL 2VAJA 2EIZA 2BNRB 2E6QA 1X5KA 3DBXB 3I50H 3SJVD 4K9EC 5I1KH 1HH6B 1H8NA 3E2HC 4BFIB 4I3GA 3K8MA 5GGTL 3MRIA 5DZOA 3QHTC 1F11B 1RUQH 4M7JH 5F3BA 2V2TB 1JNHA 4G8FA 2WK2A 3PL6C 4AMKH 2VC2H 1I1AC 1PEZA 3SGDH 2E7CA 5BS0A 4TRPH 2AXGB 3TT3L 1SYVB 4HX1A 4IIQC 1U8MB 4UBDD 3V5DA 5I18L 5IESH 2ADIA 4O2CB 4U1HA 4HKZB 3S4SG 4PP1C 3G04A 1NUNB 1VERA 2ICEB 5GRUH 3FCTA 3OB0K 2AI0L 3L7FB 4P3DA 2ERJC 4WJ5B 5F7FA 4X4YA 2BOCB 4CVZA 2V9QA 1DQMH 2QHRH 1P84J 1DVFC 4M6MH 4YDIH 4KJWD 3IYLW 3IDMB 3O6MH 3CZFB 3CXHJ 1L0YA 2VLLA 1C1EH 4UNUA 4LSDA 5C0BA 2IANB 2OJZL 1MI5E 1IM3A 4U1JB 2RFXA 3QAZB 1IKFL 3THML 3VGEA 3ARTA 1NCDL 5MERB 1TJGL 1A7QL 5IMKB 2R0KH 2C3XA 2Q76A 2IJ0C 3RPIB 3VDAA 5D72H 3EYVA 4IS6A 1FV1A 2C3GA 1N0LA 3S3SA 4Y7MA 1HILB 4HT1L 3FFDA 4RDQG 2BP3A 4FNLL 1D5MA 4WENB 4JM2D 4K7PX 1VENA 4HUMB 5JPNA 5IV2B 1F8TL 4PTUA 4JFEA 4LLWA 1A0QH 2G9HA 1BFSA 1XIWA 4K7PY 3QSKB 1J0IA 1JWSB 3WMSA 5HYQA 3P73B 4ELMA 4N0FB 1RUML 2E3VA 4LVEA 2EXYD 1QBLH 3ULUH 2XI9A 2RB8A 1S7XB 5ICYB 4XH2B 2VN4A 1DBKL 1EJ6A 1T0MA 4PD4J 4ONHB 5EZJB 4TVPD 5F71A 1MJ8H 3VG0L 3WDJA 3UTZA 3A6BH 3EZJB 3FT4B 1FLTX 1RZ8A 3SQBA 3WV0A 1Y6MR 3VFRA 4QRSB 3L3KA 4YO0A 1LO3H 1U58B 1ZE3C 4MZ3A 5F1KC 4LSPL 4U6TA 4DEPB 3TBWA 3GM8A 4MNGA 1XGYH 3G5ZB 3MO1B 1TVBA 2KL6A 2VKWA 2VZSA 3EYUL 3OAUH 4QRUA 4HJ0C 1KG0B 3QUXA 3UDWA 4GAGH 1ZA6A 4MA1B 3BAEL 4WW1B 3S35L 4HUVB 3JUYA 1QR4A 3D85A 1A22B 3ULVH 1FVDA 4ZUUB 1A6UL 1I8IA 4QLRA 3MACH 4LGRB 2X89D 3VWJB 1F4XH 3RBSA 5SX4I 4XGZB 4XC3L 2LQRA 1Q9LA 5FYKE 1BAFL 1SJHA 5A2KH 4Y4KB 4AY0A 3NCEB 2BRRH 4C56E 1KLFA 2HG5B 4CJ0A 3WS3A 2NY2C 1Q72L 1A5FH 3MLXH 1H15A 4DVBA 4LSUH 3MV8B 3R0MA 5D1XB 1XF1A 4ZS7L 2AEWA 3QQ9C 1BIIB 3TJEL 5LGHH 4LMQE 4MHHG 3DNKA 2M2DA 1E4WH 3WIFB 3HCVA 5A43C 3LKRB 4KGJA 4U6HA 2QSQA 1F97A 2FJGB 4QHUA 3HFMH 2YK1H 5DVOA 3RY6C 4ZFZA 4CUCA 3T8XA 5HI5C 3F65A 4L4TD 5AAWA 3RWFA 4HCRL 2QSCH 4ZOBA 3L3OA 2FL5B 4MNQE 1XIWD 3BPCA 4XP9H 2R0ZL 3CFCL 1PG7L 5ISZB 4M5YL 4LLUA 4MDIA 3JTTA 3EZ8A 1J1PL 3JXAA 1J8KA 1BF8A 2Z4QA 5IJVA 1DBJH 2GK2A 5DLMH 1C5BH 3D25A 4XBEH 2BVPA 1YEIH 4W6WB 2ESVE 5IEHA 5C70A 3VRLF 2CIKA 5BV7C 5ICZA 3UTTE 5IQ7L 2D4DA 2QSVA 1A4KA 1MREH 1UGNA 4CVXA 3ZTJG 2UUDK 3ZE0F 4ZG1A 3ZL4L 1ZLSL 3ARRA 4RFNC 3H0TA 4PBXA 1A1NB 2OL3B 4PJ7B 3A6CL 5EZOH 5IMOA 5EO9A 1Q8MA 2ICWI 4O51A 4E0RB 2ZSVB 1KFAH 4N0UE 4BQBA 1O0VA 1PX3A 1UXSA 4GG6A 3S88H 4JG0L 1T3FA 5ETUA 4Z7WE 5INCA 5LBSH 2FX8H 1ZLWK 4S1SH 2CKBL 1S7WA 1O5DT 3IRZA 2I5YH 3D9AL 4ZFGL 3FQTA 2HFFA 1UYWL 3DRTB 3VXME 4ZAKD 2VH5L 2Y72A 4LHUA 5D2NA 4JVUA 5IBTH 5IB2B 5K33A 3U79A 3B2VH 4HUNB 4Y4FC 3OKEB 1H8OA 1DQLL 1MY7A 3CK0L 2F53A 3UPCA 3V6OC 4OM1H 4PJAE 4M6NH 1RJLB 3OTTA 1G7MA 2X4UA 4UOW0 1T7VA 4GBXB 1CLZH 1FBIH 4ZO9A 2MFNA 2ARJB 5HVWA 3QXAB 3K2UH 3ZHDA 1FYHB 2JE8A 1KCUH 4GRWH 2QADB 5MP6H 5AYQA 3PXHA 2IG2L 3ULUD 4WFHE 2D9CA 4RFEA 5ALBH 1HXMB 2OR9H 3IDXH 1I1FA 1DN0A 3DYMA 1NSNH 5HHXL 4CNIA 2K7QA 1VSCA 4ZUWA 5KANG 1Q0YH 4JFFA 1AGEA 5E2TH 3ARPA 3QCUH 4S1RL 1KJVA 3IU4L 3K81A 1X5GA 4QCIA 4JO3L 1KPVA 1OAYL 4CADA 1BJ1H 1QSEB 3BH9B 1ADQL 1JNNL 1U8JB 5GISL 1IGMH 3AM8C 3ETBF 1YDPA 3ORJA 4MAYA 3UJTL 1HINL 2HT2D 1K85A 4FRWA 2HKHH 3BT2H 5IHZA 4P23D 1EEQA 5A3ID 3K8KA 4NCC1 3GMNA 3ULVD 3OKYA 2XIDA 2X4TB 4WUUB 1CXKA 1TETH 4P5TA 4XBGA 1KIPA 3TO4A 2HWZH 4HEME 3AS3A 1NAKL 2DQUL 5LGJB 1A21A 1CG9B 2OMNA 3TLRA 5ID1B 3OR7A 4HQQH 3WXWL 4PJHE 1YPZB 3VXRA 4G3YL 4AH2B 1G7LA 5D2LF 1MPAH 2FWOB 3C6LB 5TDPA 4U4BA 1OGTA 3LKOB 3WO3B 4N0YL 5L2JA 3F7YB 1S9YA 4K8RL 4KMLB 4JKMA 2WIMA 5DJAA 5E5MB 3SE4A 2X1WL 3S5LA 5BRZE 4O02H 3I9GL 1F4YH 2NYYD 4J4PD 4LHUD 1F3DH 1OPGL 5GSVB 5CSZA 1UWEH 5BO1L 2WWKT 1IZJA 3ZE2E 2GSIA 4PS4H 3Q48A 5GSRB 5DFWH 3GIVA 3QO1B 1IGTA 3HB3D 2A9MH 2HLFC 5DJYB 1TFHA 3T0AA 4AEIL 5I1LB 3BRFA 2W0FA 4XMKL 3UBXI 4PRPA 2P8LB 1A47A 3FQWA 3BX7C 4U1GB 4G6FB 1PKOA 3CFIC 5EOTB 1Y18A 4HFUL 2IMNA 4WWKD 1UM6L 4BFEA 4POZC 3BKJL 1WIPA 3Q1SH 4OLUH 5EUOF 3JWOL 3WFEH 3IB4A 5DJDA 5C7XH 5T1DL 3TNNA 4MDJB 5I71C 4L3CA 3BZ4B 3C5SA 4P2QD 3BGFC 4D3CH 2UYLA 3KPLB 3NCJL 4I77L 2R2EB 3HNVH 1WBXB 4MAYD 4PJ5D 4ZXBD 3WFCH 1NGQH 1YEKL 2Q7YA 1FDLL 1CFTB 1R0AL 3N9GL 4NKIH 4LAJH 2V5YA 2A6JB 3HS0A 4KJQD 1HXYA 4QOKE 2R23A 2GUOA 4P5TD 3TO4D 3MZTA 2DWDB 4UZGA 4IOFD 1GAFL 1QLRB 1VEMA 2HLAB 5D7SL 4BQ6A 5CD5C 5HYJE 1RK1B 5DJ2B 1FFNA 3RZCB 1TVHA 1HOCA 4YHOH 3V4PL 4XHJC 5DC9B 1CQKA 3PWLA 3WIHH 1EMTL 4M4PA 3NIGE 4MJIA 1A64A 1F90L 5FHAH 4NQEB 4JAMB 1KCSH 1RIUH 5E9DB 1CICA 5JHDA 1MCPH 3OV6A 3R1GH 1QKZL 4Z77B 4N68A 5B3JE 3ESUF 2J3SA 1N59A 2XTLA 3DJ9A 4DKFH 4YHIA 2PYED 5KSAC 5LWYL 1NANH 3TA3A 1IAIH 3BP7B 4Q2ZB 5KS9F 1GHFL 1IAKB 1OAKL 4HJJH 3BIKB 2PW1B 1HSBA 3RVUD 4ENEC 1MVUA 1IGYB 1DEEB 4JHZA 4EDWL 5I8OL 4G9FD 4YE4L 1JVKA 5EIIB 2HVJA 1I8MB 5GS2H 2XWTA 3TH2T 5IM7B 1D6VH 2A73B 3LIZH 4PRPD 3TZVA 4LKCB 2LE9A 3STLA 3IXAB 2VAAA 1HHKB 4HGWA 3MLRH 5F7KC 3SO5A 3ZKQD 4D9LH 1JGDB 3KPTA 4JFHE 1NUDA 3CVIH 4FXKA 3L95B 5C6PB 2EC8A 4LEXH 4Y16A 1T83A 5CZXC 3U2SA 2H9GB 3CVHB 2ENSA 2JJTC 1CLYL 4DW2L 3WJLA 3T0EA 5D6CA 1Q94A 1S3KH 4HGMA 3ZDZF 4OTXH 3QZWB 2XY2A 3LEXB 3WNLA 1Y6KR 4K2UL 3KPSA 3CXDH 2O5ZH 5I1KL 3WIHA 5HDQL 3MLYH 4PR5B 5DRNB 1ACYL 1IFHH 1PGRB 1ZHNA 3NIFF 4M7JL 3KPRA 4PJ9D 5C0FA 1PZUB 1INQA 1YN6A 2XNAA 1EGJH 2DQIL 3BH8B 4I0PC 4BQ9A 5C8JA 3OKMA 4P4KD 5DMGC 1HDMB 5CIPH 5AUMB 4HPYH 5T3XE 4QHNB 1ZA3B 2PNDA 3MUGA 4G80A 4LDLB 3ZT6A 4ZSOA 4IMKC 4MSWA 5DQ9A 4YPGA 3P9WB 3LKQB 3IJHB 2NY7L 2XXCB 5HHPA 3AY4C 4X6FB 5DJ0B 3D0VA 4HUWB 1T66C 1CD1B 4S0SD 1KOAA 3RUGE 4HK3J 1U92B 2EDBA 1OAXH 4H8WC 2HFTA 4KKAC 1J0JA 3AS0A 2GI7A 4G42A 1FRGH 1CXIA 2ZUWA 3C08H 3FJTA 5EZLB 2A2QT 2X4SB 1DQML 2QHRL 3GKWH 4M6ML 4RGOL 1U95A 3KPOA 3TV3H 5JORA 2EYRB 3BUYB 2AK4D 1CICD 5JHDD 1PQZA 1C1EL 5JOPE 3S6CA 2A0LC 1KIRA 4G5ZH 1ZANH 5HHMD 1M6OA 4X6CA 2YPKA 3TN0B 5CUSH 1E28B 3E6FA 3DO7B 4L8SB 4FFWD 4W6YB 3UROR 3QO0B 1KXTB 1BVLB 2R0KL 3T0WA 2E9BA 1P69B 2VSDA 2YD6A 2HTLD 5D72L 1GGBH 3QZWG 4KTDH 1P5UA 1L0XA 1WT5A 2VQ1A 5EU4A 4Y5VA 2COQA 1WWCA 4P99A 3INUH 5L6YH 4V1DB 5DXWA 2Q1EA 1F3RB 5L0QB 1E6JL 2W9DL 4ODXA 1A0QL 4EZMA 1EZVX 2FH8A 3ZYOA 1ZHBB 4MD4A 1UEMA 3PWUA 5DZLA 1EZVY 3F58H 5ESQB 3L6FB 2V2WB 5EZIL 1QBLL 3C6LC 1OD9A 4LCWE 5E56A 1EGJA 3WNPA 1H3GA 1QEWB 5CIPA 3MNWB 1OF2A 5FKPA 5CZVH 3ARBC 2CLRA 3MRDA 1N5AB 5EOCJ 4PGBB 4NC0B 3LQAH 3T0ED 4XAWH 2VIRB 5J11C 4OZFB 1LO5B 3G5XB 3S7GA 4X9IA 1BQLH 2KZWA 3RP1A 2PF6A 2C3WA 1R5VB 2YPLA 3BIAX 3CC5B 4Z7UA 4W68A 3QIWA 4PJFA 3KPRD 1FIGH 4NKDA 1NMAL 3QRFM 5E2VH 1XT5A 1BPVA 4H0IA 3D6GA 1MFBL 4EUPB 1FNHA 4GAGL 1LE9B 1G7JB 2APBA 5IB5B 1S9WA 4GRLD 3KS0H 1MUJB 3GIZH 4OZ4B 3GBMH 5DRZA 2GK0B 3V6FA 3DYPA 4PGZA 5IMMB 1N7MH 1OLZA 4ESKA 5IVXA 2J1KA 4V2BA 2VXUH 1F4XL 5JQ6H 2VNCA 1S9VA 3OXSB 1CDCA 4OF7A 4NQSA 1JPSL 2NLJB 2BRRL 4Z7NE 4WV1C 5B38G 4R4BA 2P5WA 1RHHB 2DLIA 2H2PD 1G6RH 3RTQA 1KJ2H 1BJ8A 2JELL 2B39A 1R24A 4JFZH 43CAA 3FT3B 2VLRE 2Z93A 1FZKB 3SDAB 3H9ZA 4Y1AE 3KLAB 4K3HA 1YZZA 3QDME 1XH3B 2BHZA 3B9DA 2HJLA 4GT7A 3HFML 2J2ZA 4KI5F 2QHLA 3ZT5A 1I7ZB 3C8HA 3O4LB 4OZFG 1JGVH 4NCC2 3IJSB 1YEEH 1HH9B 5M95B 4PJGF 2QSCL 5CSGA 5IVZB 2VDRL 1ZVHA 2I27N 5I1GH 4NO2B 5DD5L 5C6WH 2H2SC 5HJ3A 3QNXA 3MQIA 2AEIT 1VB9A 2F5AH 3DYOA 4EUPG 4EQ2A 4NGHH 4D0BA 3KYOA 1RIVL 5D7JA 4BKLA 5D7LE 3HPLB 1IKNA 1C5BL 1OD7A 4QTHB 3EGSB 5FM5M 4KZDH 1I3RB 5FGBA 1XCTA 2Y1VA 3QFJE 1KTDB 1SEQH 2BCKA 3K0WA 4K94C 3FO0L 5JR1H 1NC4D 2NX5B 4KUCF 1JWMB 5E6IA 2CDFA 4ETQA 2YPLD 3PWPD 3VWKA 2YKLL 4BJLA 4WIQA 3C6SA 2Y4SA 3MRRA 2IALA 4KK8C 4IM8A 4XVUC 3ALPA 3QIWD 5GRVK 4L3EE 1B4JL 5BXFA 3EJYD 1OLLA 5T3ZD 3T0BA 4AIOA 4LAQL 5GGVH 2FYYA 2C7UA 3RHWK 1KFAL 1KJ2A 3FQRB 4GSDL 5DEZA 1FFPA 5F9OL 5KW9H 5DMIL 5F3HB 3GBLA 3G6JA 4I18B 2BFVL 4S1SL 1D9KD 1WIUA 3CLFH 2LU3A 1NFIA 1MNUH 3QDJE 1FNSH 1VEOA 5KG9B 1U3JA 5E2WH 5C07A 5I1AB 2F9BT 2QR0A 1RZ7H 2EDHA 2ZCLL 3LB6D 2BXYA 2HN7B 4FTVE 1X5FA 3RDTA 4F9PA 4K7FB 4HXBH 5LKNA 3R8BB 2WBJD 4QRPE 2P5WD 4LGSB 5HHOB 3BEWB 4MCYB 1AKJA 3RTQD 4RMVA 1W2KT 1CLZL 4XRCB 3QHFL 2QBWA 3BFOA 4R90H 2AV7A 2B4CH 1TCMA 2B0SL 1P7QB 4YAQA 3DXAD 3WJJA 1Q1JL 3LDBC 1EEZB 4PLKD 5E8PB 3SKMA 5ALBL 2OR9L 2JKXA 2XN9E 2YA2A 4M7LL 4Y4HA 4DKEL 1YEFH 1NSNL 4R96A 4RAHA 3D3VB 3RWCB 1INEH 3SE9L 4GLRI 5J1AB 2QKIB 4YNYA 4DCQA 3RVTC 5H35A 4PJ8C 5IOPB 3KJ4B 5CFHA 3OHXB 2PYFB 4M8QB 1U2CA 3QCUL 3MRKB 1QFWH 5ICXA 1FVEA 4JHWH 2K1MA 1XGTA 4F7MA 5IROC 4MQ7B 15C8H 1UJ3A 2VLJE 4EN3B 4YXHH 1CK0H 4BZYA 5TQ0H 4OQTH 4MNHB 1IGML 4GW1B 1NMCB 3LD8B 4NZUL 4G8GE 5F7WC 3DMMB 3D2UA 2HKHL 2IPUG 1A7OH 1N5YL 4MD5A 2VXVL 3OKLA 1XF3B 2B20A 3WO4B 3VFWB 1CU4H 1OTTD 1EFXB 4HS8H 5CBEB 4APQA 3U9UB 4G6ML 2JB6A 3MJ9H 2HWZL 2XWJA 3VWKD 4ZFFB 3DI2B 4WTZA 1CR9H 1QPPA 4WU5B 1FO0H 4ODVH 2F54B 1R3JB 1OTSC 3REVB 4HMCA 3TPUA 3GI9L 3LMJH 4HBCH 5EU7E 3KPMA 4NNYA 1MPAL 2VN7A 1P5VA 5L0QC 1U3HD 2XTJC 3B9KD 3E3QE 4FQQB 3UTSD 3VGBA 4LPTA 1JFQH 1QFHA 4CDHA 1B6UA 3WNNA 5BZDA 5EBWB 2YD1A 4YLQT 3UJJH 1RZJH 4QNPF 4YHZH 5D2LB 5DK0A 3G5VB 5FYKU 1NL0L 2D9QB 2WBWB 1FG9C 1F3JB 2I07A 3FZUD 5C07D 1F4YL 3HUJA 4OLYL 1B9ZA 4UNTA 4PJHF 1X6LA 2E8ZA 1JZ6A 1J8HE 2DLGA 1UWEL 2BOBB 4JZNA 1Z0MA 4PG9B 3NFPA 1X5IA 3LKPB 4M61A 5CJQL 5GS0L 4M6OL 3U0TA 1EHLH 2NTFB 3H7BB 1IGJB 2YA1A 2X70A 4UAOC 2A9ML 1KB5B 4LQFH 1I1CA 3P4NA 3EFFB 3WHE0 3AAZB 4OQTA 1DL7H 3PGDB 3S3JA 4Y2DD 1XGRB 3ARYA 1WC7B 4WU7B 4YDJB 3NFNA 4R2GB 1TXKA 2P1YA 4Y4HD 3ZZ1A 1HKLL 3S9DB 1IARB 4P5KA 1AQDA 1UZ8B 1F13A 2WIIB 3MNVB 3Q1SL 4OLUL 2NY5L 5JIKA 1CGYA 4BK4A 3MJ9A 3HG1D 1JGUH 2CLZA 4X99A 1BGXH 1BBJB 4N0CC 3SDXF 4LASH 1A2YB 4YUEH 2Q6WA 5EUOB 4AYFA 5ID0A 2Y25A 5SWZB 2O5YH 4GKSB 3L3HB 4LIQL 2PXYD 1FAIH 1JMZA 3EO9L 5HVHB 3MGTB 1RZKH 4YK4C 1RZIA 1E4KC 3ZKMD 4P4RA 3QFDB 1NGQL 1QBML 1S9XA 2Z35A 5FYLE 1FN4A 3LSOA 3TJHD 4LSRH 1YEGH 4PTTA 1A3RL 3HZVA 4NDMB 1EBAA 4HPOL 3SKOA 2VTFA 3B9EA 3F5WA 3C5JB 3DGGA 4AM0B 4ELMF 3EOAA 3GGWA 4PJXA 1A6WH 5E95B 5ITBH 1X3DA 4R0LB 3GMOB 4YHOL 2FNBA 1FZOA 1ODAA 3OAZK 4M43H 2EKSA 3MV11 3EAKA 3GHBH 1OVZA 4OIAA 4Q6YA 5KVFL 4OLVL 4ODTL 3OL2A 1UKQA 3SCMB 4ZFOA 2J7LA 4OM0L 5EPMB 5FK9B 3DGCR 1VGKA 2HYMA 3BPOB 3QNYB 3LKNB 2J8UA 2HTKC 5CKAA 1KT2A 4AEHH 3NCYS 4HLZG 4NO0B 3C60B 4N5EC 3QJHB 2BSRA 3I6KA 3U4EB 4PRHE 4JO2H 3WLWC 1A1MB 4F2MB 2APFA 3WHE1 4YHNA 5D1QB 3GDBA 4XMPL 3F7PC 5JO5B 4M7LT 3NIGF 5J6HB 1JGEB 5EC1B 1IAIL 1T20B 2FGWL 3IJYA 3HRZA 4RMTA 4H88H 3T1WA 1FG2B 4JKKA 1F5WA 5JXEA 1EEYA 1YN7A 3QUZD 2QQKH 3QUYC 3DV4A 3N1PC 1V3JA 3VH8B 4CMHB 5KS9B 1D6VL 1H5BB 5GGQH 3MLPA 1LEKA 5BCAA 1M4KA 4MVBD 2DJUA 3BDBA 3UX9B 4HEPG 2AJYH 4I18C 5SV4A 4NQCA 4D94A 3KHQA 4KHTH 2Q86B 1C12B 1CFQA 1KCVH 1S3KL 5JXAH 4HGKC 4OTXL 3NZHH 4LHQB 2APWA 2IAMC 4A6YL 3I3BA 1UQSA 1NDMA 3OKDB 1LO4L 3NGBC 2OTWB 3VFSB 4RAVB 1WAAA 4PUBH 3LPWA 2OTPA 3MLYL 4GKOA 1IAMA 3WN5B 1S7SB 3QDGB 1I1AD 2Z31C 3I02B 4JGUA 3N50A 2V7HB 1EGJL 1I9JH 4N5UA 2NXYB 2HFEA 5CJXC 4HPYL 4RRPG 4PB9H 5E8NA 4KKCC 4RWHA 5TDOA 3IFLH 4X6BB 1CE1H 1G7HA 3GO1L 3K4ZA 4PP1D 5CMAA 1T4KA 1JUFA 1GH7A 4E41B 4JQXC 1ONQB 4LCIH 4S1DC 5HI4C 5IIEA 1OAXL 3TBTA 5IUSA 3C08L 2VERN 3KJ4C 5J6GA 1DTUA 3GKWL 3VH8G 4P2OA 1QLEL 3EO1B 3TV3L 1T1XB 3HE7B 5EC2B 4ZPVB 4TSAH 4NCDA 3VFPA 2ITDA 3LD8C 3RUGF 4R97C 5DQDL 4JFXB 5L2KD 1MCOL 3DMMC 4TSBH 5DURD 4XP5L 4PJBF 1T21B 1PLGH 3ARGA 4J3TA 3TNMA 1A4JA 1BFVH 2ZCHH 4FQCH 2HFGL 4KTDL 3QXDA 3EOBB 5FUZH 3W11D 4Z5RB 5JA9A 3FL7A 3X14B 1F6FB 3QQ3B 3INUL 5E8DH 1YEDA 5H94A 4HG4K 1PX4A 4O2FA 3EHBC 4TULL 3NFSH 4WFGD 3HC4L 5DMYA 2BVQA 4Z8FH 4J6RL 4KPHL 5DUPL 5F21B 1A9EA 5DI8B 1JZ7A 3S36H 1H3WM 1HHHB 3ARFB 1B2WH 5D7IE 3SGDI 2EDJA 5I8EB 3IS1X 5EA0H 3O8XB 5H8DA 5SWQB 3D0LA 2CGRH 4LARL 1RUAH 2CDGA 2EE6A 4NQCD 3QUKA 4X5WB 3SHSA 1AGBB 3OJ2C 3KAAA 5DFVC 4BZ2H 4L8BB 1KJ3L 4OCNC 5D7KD 3LQAL 1WBZA 2JLLA 3Q6FA 2CIIA 1KTLB 4N9GB 1DLFH 3GSNB 1GOGA 1MRDH 3MJGX 3HZKB 2HT3D 4EI5A 4LF3A 2EC9T 3U4AA 1VFUA 1FZJB 1Y6NR 4YGVA 3EJZD 4GKZA 4HJ0D 5I73B 1DE4A 4UIMB 3TH3T 3O6FD 4NN7B 1T22A 2X4QA 4IDLA 2C4FT 5IFHL 5I8CB 1S7RB 5IB4B 2QLVB 1P4LB 1ORSA 1XF5A 1YMME 3ZYJA 5F9JB 5I6XC 4R2GC 4P2RA 3MLSH 4LFHD 4M62H 1W0WB 3RWIA 5FDWA 1DJSA 1MCRA 1KPRB 4QXGH 2R29H 4DUWA 1QRNB 25C8H 2WM0A 1CGSH 3E3QC 1M7IB 1FJ1A 2X4NA 1AD9A 3A67H 2BNRA 5EFIA 5B8CB 4RWYL 4G7YL 2EYTB 1MFCH 4O5LH 1OM3H 5JLZA 3EKCA 5IQ9B 4QKXB 1M71B 4A2LA 4JGJA 1UB6B 1IM9A 4JFZL 2CKBB 2V2TA 3WDHA 3WLBA 3F7QA 3RBGA 2FIKB 2H8PB 4Q97A 1KUMA 4MA7H 4GG8A 4NZTH 3VDCA 4MJ4A 3V6ZB 1EBPA 1QSFE 2AXGA 4PRIB 1KENH 1YEHH 3T08A 3NPSC 2UVFA 1SYVA 5HI5D 3WS6A 3C8KB 5EO1B 1U8MA 1M05B 4OJFL 4HKZA 4XP1H 3W0WE 5C09E 4PJEF 1ZT7B 2FCBA 3DRQB 4C56B 4CW1A 4OLXH 4JFQB 4PJDA 3PDGA 4FFYL 3IGAB 5I1GL 5CEZE 5KSBA 1MCSA 2FRGP 3IDMA 3NA4A 2EIBA 4PJGB 3CZFA 1A3LL 1L7TH 3J7HA 3L7EB 1CXFA 2F5AL 3IFOB 5IK3B 4YBQD 4NGHL 2BNQD 1I1YB 3SJVE 5EOQL 1S8DA 3HE6B 2MKLC 4OBRA 1AO7D 5ACMA 5IMKA 3HI6L 3LZFL 1P4BL 4V2CB 5FOBA 5JR1L 4NRYB 1UA6H 4OT1L 3ZTJH 1MHPH 5CINH 1BLNB 1HILA 2GSGB 1G9NH 2DD8H 5E2UH 5HY9A 5D71L 4YGAB 2VQTA 2XOTA 5GGVL 3C5ZB 3N85L 3H9SA 3LN5B 3H3PH 3QIBB 4N0FA 1H5BC 3VXSD 3SO3B 1LDSA 2YC1A 1HZHH 4OZHE 1N6UA 4NUJA 3CLFL 5C0CB 2R9HC 1FNSL 5F7NC 5D6DA 3RWEB 4XXCC 1R3HB 1RZ7L 5EZJA 2IFFH 3FT4A 5FEBA 5F96H 4YBLB 3BJ91 3QEQB 4QRSA 2QQNH 4UNVA 4KHXH 1EA9C 3B43A 2H3NA 1NBVH 1IGCL 1OQOA 2DN7A 2ZKHH 3D69B 2YD3A 4G9DB 3G5ZA 3MO1A 2MMXA 1RK0B 5J7CC 3VXUA 3IKKA 1OAUL 3WN5C 5EU6A 4S1QL 1VFAA 2FJFB 1MCLA 1MJUL 2CKNA 3WFDH 4YFLF 1XMWA 2ZJSH 4PFEA 4WW1A 2W0PA 4NWUH 5GRJL 4HUVA 3VXMB 3G9VA 1VADB 1YEFL 4GXUN 3RNKB 1RMFL 4WGVB 2PR4L 1INEL 4AEFA 4ZNCD 4D9RE 2IFGA 1A7RL 3U7WL 1G9MH 1IEAB 3VWJA 3TFKC 3PABA 4XGZA 4KRPC 1T03H 1Z3GH 1QO3B 2XYCA 4QGYA 4Q9RH 4Y4KA 15C8L 4IRJA 2OL3H 3BPNC 4YXHL 2AXJA 2HG5A 2Q7NA 4TVPE 4YHMH 5TQ0L 2X44D 5AWNH 1HEZA 3BGAA 3MRGA 3VCLA 2R15A 4ONGH 2IAND 5D1XA 1WJ3A 1FNFA 2R2CA 4N90E 4LKXB 1A7OL 4UQ2B 1INDL 1AXSB 4CMMB 3LKRA 1CU4L 2XQBH 5L9DH 2FJGA 1BD2D 2VDNL 4H26A 1WEJH 2H1PH 5FKAB 3W39A 3I75A 1GGIH 3CDGB 1FVCB 1CR9L 1RVFL 4G6JL 4Z9KB 2ILLA 5F7DB 4D2NA 5C3TA 2FL5A 3NPZB 3WYRA 4HBCL 4HJGB 5TE6H 3MRHA 2PO6B 3OZ9H 4P48A 4LRIC 1YA5A 4DKAA 4OZIF 2QTEA 1Q0XH 3O11B 3GBNH 4ZUTB 1CDIA 3O3BB 3TVMB 3LQZA 3O8XC 5HYSG 2DQEL 2Y6SC 4LQ1A 2JJSC 3EYSL 2R1WB 2WWMD 3FKUS 4S10A 3UYRL 4FXGB 4OV5A 3RKDD 4MJ2A 5IFAH 4PJHB 1VGEL 2HLFD 3MRIB 4ZQKA 2YN5A 5F3BB 1EERB 4XPTH 2OL3A 4LQFL 1JNHB 1DL7L 3ES6B 5BS0B 4QXUL 1P7HL 1V8HA 4L4TE 2V5RA 3KYNB 5L7XH 5BRZB 1VACA 4R3SB 3T2OA 2ADIB 4XNYH 4KJYB 1OARH 3G04B 3DRTA 3RAJL 4KDVA 4WHCA 3TC9A 1MAKA 5IB2A 1RHFA 1C16A 1JGUL 4X6CF 2E7HA 3P30L 4LASL 2NQCA 4YUEL 3QULB 4UDTB 2VLLB 4K23H 4GMSH 1X5AA 2DLEA 5BVPH 3PQYD 1JCKA 1RJLA 2J8HA 4GBXA 5B8CC 3T0DA 1FAIL 3KYKH 3SDXB 3MV8D 1NMBL 5D1XD 2ARJA 4JY4B 4OCXH 3QXAA 4WCYL 4NOBA 4ZYKB 1GGCH 3RL2A 1KIQA 4LSRL 1YEGL 1RUKH 1Q9WA 1WFTA 1BJMA 2ZOKB 2Q76B 3O9WA 4WFFE 3HR5A 1HXMA 4N8CL 3CJJA 2GJ6A 3MBEA 4FQXB 4IS6B 5F8QC 5CD5D 4Q0XH 2B5IB 4HMEA 1P1ZB 4YXLH 1JHLL 4JDVB 2P47B 3P2TA 2ADJB 4GAJH 3ROOB 1I9IH 1A6WL 1T2QL 5F7MC 3DSFL 4JFEB 4KTYA 2DBJA 5HYQB 4M43L 4ELMB 5CJBA 1I3GH 2C1PA 1CT8A 2FX7H 4WI4A 2BY0A 5ISZD 6FABH 1GZQB 1U8JA 3GZKA 5F1IA 3UAJC 3QI9C 1SM3L 3GI8H 1T0MB 4PYGA 4PG2A 3V5KA 3V0WH 3QA3A 5SWSA 3UTZB 3HNTL 1SJVA 1RZ8B 5HYFA 2X4TA 3HE6C 5EOCH 4I3SH 3L3KB 4FZEH 4ENED 4XCNA 3EDJA 3ULUE 1T7XA 1MRFL 4H88L 5LGJA 4PB0L 2X10A 3BVNB 3TBWB 3NBNA 1ES0B 4F80A 5JDJA 3MRPB 4G8EB 4LDEB 1YPZA 1TVBB 5C0AD 5IHLB 4PGDB 4QRUB 1CBVH 3QUXB 3KYMB 5I1EL 3ZYZA 4KXZH 5FXCH 3RIFK 5LXGH 1CGWA 3C5ZC 1ZTXH 1DANT 3LKOA 4UILL 1FVDB 2OM5A 5F7EL 3G6DH 1HIML 3QIBC 1CL7L 2G60H 3SO3C 1SYSB 5E5MA 2AJYL 4NUGL 4RIRB 3S97C 3MA9H 4KHTL 5E94B 3IDGB 2YD5A 4DZ8B 5GSVA 5JXAL 4TNVF 1H15B 4DVBB 5GSRA 3ULVE 4FFZH 2FD6H 1HHIB 1L7IH 1L9MA 2G5BB 4C55A 4PJCE 5DJYA 4IRZL 3HCVB 1XZ0A 5KZCB 1HE7A 1JHKH 1I9JL 1CE6A 1IAOA 1ZT4B 5CSBA 4PB9L 5EOTA 1SJEA 1T66D 1TNMA 4ZFZB 3HZMB 2OX5A 1CE1L 1LDPH 3EW3B 1NANI 4KKAD 2X41A 2WMPA 4NQXB 1JE6A 4J23A 5FM8A 3MZGB 4LCCA 4OFIA 4GG6E 2BRQA 4UBDC 5ALCH 3PV7A 3RWFB 2C4XA 1G9EA 4LCIL 2BJMH 3L3OB 5D5ME 4ACPA 3L5XL 5GZNC 3MV7A 4MXVE 4OCRH 2AJSH 3BPCB 1E4JA 4MDJA 1KCRL 4FQLH 3BZ4A 1TDQA 4LLUB 4MDIB 3FFCB 4JKPL 3JTTB 3W5NA 1PG7X 1QSED 2A0LD 4X6DF 2Z4QB 3SKUD 5IJVB 1LEIB 1JI2A 1YYML 4NM4L 2F53E 3D39B 4Y89A 3BO8B 4TSAL 5JOEA 1G7QA 5HHQA 1PKQE 3AREA 5IEHB 3E8UH 1GCFA 1QYGL 2CIKB 1JZ3A 4TSBL 2ADGB 1NCAH