4ZSOA

Crystal structure of a complex between b7-h6, a tumor cell ligand for natural cytotoxicity receptor nkp30, and an inhibitory antibody
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
b'MQIVLTQSPALMSASPGEKVTMTCSASSSVSYMYWYQQKPRSSPKPWIYLTSNLASGVPARFCGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Light Chain
publication title Crystal structure of a complex between B7-H6, a tumor cell ligand for natural cytotoxicity receptor NKp30, and an inhibitory antibody
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 50
structure length 214
sequence length 214
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zsoA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zsoA01
3DTXB 4LARH 1G7PA 3QA3B 3KR3H 5ADOH 3V6OC 3RA7L 2DQFB 1I4FB 5DSCB 1FYTE 4LSVH 3O6LH 4N1CA 3UXFA 3H7LA 3V4PL 1JHKH 1REIA 2B0SH 4N0FB 1A02N 3MUZ1 1RU9L 2W07A 3QULB 4MAUL 3D85A 3GNMH 4NNXA 3MRFA 5GGSB 1F3JA 3KLAB 2BOBA 5LXGH 3BAEH 4UZGA 1FFQA 1EAPB 4B50A 5LGJA 3QJHB 3C5SA 2EH8L 2NMSA 5GSVA 5I74B 3BEWA 1QRNA 5DFTA 2BVQA 5JLZB 5FM5M 3WJJA 3MGTB 1G9NC 4NBXB 2V17L 2GSGA 5CKGA 5ANMA 4C83B 3UTOA 4LSSH 5J13C 3TA3A 1G7QB 5GS0D 3OX8B 2ZCHH 4PFEA 4P4KD 5D7JD 1IGCL 3OJ2C 5C0CA 5A2LH 4EN3D 4LDLB 3DO3A 4DKEH 2WK2A 1BBJA 4XT1C 3TT3H 1WT5A 4JFDE 1DE4A 3FO0H 4PJ7B 5I1DA 4BQ6A 2ZG1A 1TVBA 1RUMH 3V5HA 5IIEB 5DI8A 3H0TB 2Y7QB 2JB6A 3AU1A 3KPQB 1BFTA 1LK2B 4M6OH 3LKOA 4RGND 4OV5B 4MQ7B 2R69L 1FPTH 4NUJA 3VXQB 2KH2B 5JHDA 4JPWL 2JIXD 3O11B 5GJTL 1Z3GL 1U3HB 3OAYH 3ULUE 3QNZB 4FP8H 4JE4B 3UTSA 5IB5A 2Y23A 4C54A 3DUSB 1JPST 5AZ2L 1HZHH 4P23D 1WAAE 2R23A 1TETL 1YY9D 5ISZE 3MBEB 1KG0B 3BJLA 5GXBB 5KSAB 3GDBA 4MS8C 3KPRE 4JLRA 4R2GC 3S37X 4WHCA 2GSIB 4GKZA 3VJ6A 4C57C 1N4XH 4M8QA 3VH8G 4XPFL 3OKMB 2WSKA 1I8LA 1QR4A 5CP3A 3CJJA 4Y5YA 4U1SB 4X5WA 3WEXA 2BERA 1E6JL 3HNTH 5JDJA 2H9GA 4H20L 4GT7A 5DJYB 4XNXL 2OJZH 4JM2C 1PSKH 1MF2L 1LEGB 1OD9A 2A6JB 5I16B 4U1GC 3SOBH 1LE9B 1CLOL 1ZANH 1F4XL 2EIZA 3D2UB 4TSAH 2QHRH 1TZGL 2ZUXA 1QNZL 3MRMB 4KI5C 3CSGA 3IDMA 3WIIL 1PY4A 1LK3H 4PP2A 4LIQL 3DO7A 4S0TD 3D25B 2ZCLH 4PJCB 1JWSB 4NHUA 1QFWH 5EC2A 1R3HB 4P2OC 3RDTC 1SMAA 5DD0L 4Y4FD 4U05A 5EUKB 1F8TL 4QOKB 3MV9D 3U6RB 4QTIH 4U3XA 4M7ZB 3HR6A 4QRSB 3SY0A 4XVSL 2DQCL 4LDOB 2AJYL 2XA8L 4XMPL 5EH1A 5C0ND 1KYOJ 3REWB 4K9EL 4Z7UE 2IQAB 2VZOA 3HS0B 4PJIE 3SJVA 1IKFL 43CAA 1UJ3C 1DR9A 4L3CA 5GISH 2OL3A 3IFPA 4NJAL 1SBSH 2XZAL 4HKZB 4EDWL 4NCDA 1IEAB 3N1PC 3OBAA 3SDDD 5GRVK 3HZYB 3LS5H 1JGDA 3HZKB 3QCUH 2AJVH 4LQ1A 3T8XA 3RVUD 4GRLB 3QCTL 4JRYA 2AXGB 1K4DB 3WUWG 5IHUL 1AKJA 5BW7A 1AJ7L 4AMKH 5IMKA 1RZKH 2V9RA 1BVKB 4FQIH 1BGXL 1LP9A 2X70B 1Z6JT 4K7PL 2DKMA 5I76A 4I9WD 1NPUA 3C08L 3VWJD 4LSRL 4WFFD 5GS1A 4JR9L 4GLRH 3AM8A 4YFLI 4P4KB 3KPLA 5D7JB 3O4LA 2APXA 4OM0H 2X4SB 4S1SL 4YXLH 5CIPB 4ORGA 4ZUTA 1TCMA 3MXVL 5B39A 1A2YA 4MNHA 1FO0B 4GH7B 4Y16C 2HVJB 3PQYE 4NC1E 2F54A 1AQKH 1ZLSH 4L29A 3VFUB 2CKNA 1YYML 4RGNB 4LVNC 3CLFL 4Y1AA 1GVIA 3BH8B 3MACL 3U36A 3QXAA 2W9DL 2NXYB 2FSEA 2JIXB 3SDAA 3BW9B 4KRNA 4OLUH 2PYED 4DGIL 5E6IC 2HAZA 3WNOA 5ICXB 5DWUH 5GGTL 2YR3A 2MQ0A 3MFGB 2Q8AL 1QSVA 5C0FB 2MWCA 3Q48A 3EUUA 1YECL 1MRDH 1JRHL 2NTFA 1BBDH 4RGMB 2UY6A 1MH5A 2HJFB 3FFCD 4IRZH 4F8QA 2RBLA 3H7BB 3ZE1E 1B4RA 5AYUL 1B90A 4I3RL 4AH2B 4F58L 1OGAE 3OKLB 3C09C 1AFVL 3TBVB 1T7ZA 2X1PA 3O6FD 3VXRE 2XKNA 2VQ1B 4CN4A 4XP4H 4S2SB 2R56L 1A4JB 3VG0L 3AXLA 2C5DC 4G6MH 4U49A 3O3UN 3BMWA 2GCYA 2EYRA 3TBYB 2DS4A 5E08H 3O6KL 1DBML 3TIEA 1ADQA 1JYWA 3K80A 3SKJL 4UI2A 3EOAA 2Y06H 2KBGA 3HC0A 1CK0H 4UINH 5L9DL 3FN0L 5IJKA 4CGTA 2V9QA 4ZUUB 3BZFB 2PTTB 4U1NB 3QO1A 5J57B 1IC7L 3MREA 4LF3A 5CAYB 3BOVA 2F74B 3O3BA 1K8DB 4F7TA 2QQLH 4NQUA 2D0HA 3MXWL 1S9YA 5IBUB 2DQDL 4K3JL 4Y4FB 1IT9L 4K94L 1VEOA 4Z7QF 4OD3L 3GSRB 2A1WH 3MV9B 3EYVB 5F9OL 1QUNA 4H1LG 3LKPB 1XCQB 4U1LA 5D70H 5ESQB 4RFEB 4ZFZB 4YIQA 3C8KA 4OCMC 5B38B 4LCIH 4PY8J 1NCTA 3KYOA 3KPNA 2FBJH 3QHTC 4M1DH 3SDDB 4AYFA 5DFWH 4ZFGL 3HAEG 4RRPG 1K3IA 4OFDA 1RULH 1S7RA 3BN3B 3RPIB 4K3EH 5EBWA 2BSSB 1CI5A 4HLZH 4RAUA 4DZ8A 4NNPH 5EN2A 4HFWB 1AH1A 2AK4D 1RVFH 2G5BB 2HYMA 1PEZA 4L9LC 1W0WB 3V95A 3VWJB 1UACL 1IGIH 2AV1B 4AIZB 1LO2L 2DMBA 4S1DC 2QQKH 1EEUA 5EOTA 2DM4A 1MVUB 3M8OL 3BPLC 4P5KB 4UV7H 1ZLVK 1OB1B 4MMZC 3N1GC 1RK1B 4WU5A 2I27N 1R3KA 5TQ2L 3BD3A 2BHUA 5KVFL 1JPFB 4MZ3A 1VB9A 4HGWA 1XF4B 5C6TH 5JHLH 1I1FB 4P2QB 3HCVA 2W91A 3I3EA 1GAFH 4FQCH 4UB0L 2IBZY 1P1ZA 2PYEB 1YEIH 1CGVA 3G6DH 5FCSH 3DVNA 5EG6C 5L88L 1NEUA 3SPVB 1D5XB 1BLNB 1Y0LB 1QFUL 2Y5TA 4RFNC 1SEQH 5EOCJ 5HHME 3DMMC 1PG7H 1KEMH 3VU2A 3FFCB 4D9QE 1HCVA 4EI5D 4ODVL 2HFGL 4JQVA 5C0IA 1WZ1H 4JQIL 1NLBL 2R0ZH 3WXWH 4HDIB 2BSTA 1ETZA 4WEUD 4ZO9A 4DTGH 3RY6A 1HXYA 2A38A 1G6RB 1DVFC 3ALXA 4GRWB 4U7SA 4F7MB 3O6FB 1P69B 1RUQL 3WNPA 3WN5C 3LRSA 1BFSA 4NGHH 4XTRC 4HC1H 4MCYB 4BZ2L 1FZOA 1I9JL 4ELMA 4TTDD 1WFNA 4NM4L 4YPGB 4M61B 3TBWA 2P24B 1UA6L 1WFUA 2NY5C 3KYNB 2APWA 2P48B 4FQJL 4NDMA 2XI9A 2OR9L 1G9MC 1BFOA 2JE8A 3MV7D 1VA9A 2BHYA 2DL9A 4PJ5A 4NRYA 2O93L 3LRHA 2DL2A 4NFCA 1KCSH 1V3KA 3PE9A 2VXUL 4EUPB 5HGAB 4OI8A 3ILPB 4E41D 3G5VB 1RHHB 1Q8MA 4HUWB 1MFBH 4JGMA 3OKKA 2UZIL 4XP9H 4QTHB 4PJGF 1YPZF 3VFWB 4OLXH 5GRWA 3PWPD 4JO4H 3IGAA 2IG2L 2P43B 1J0YA 4ZO7A 4WY7H 3DV6A 4DFHA 2EE2A 2EDDA 4C56E 3QHFH 2XZCH 2I9LA 1RJZB 4XB7A 1NCWL 4XI5D 3GJFA 3BX7C 4LLMA 2ZKHL 4U6VH 3GM0A 4XBEL 5I17A 1AGCA 5DJ2B 4URTB 3TO2A 5BXFB 5IB2B 1CGTA 4U7MA 3MA9L 5DUBB 3B5HA 4K8RC 4TVPH 2JLLA 1CFQB 1KEGH 5CZVH 2IBBA 1MRFH 1U8LA 3KR3L 1MCRA 1MFNA 3O6LL 2NW3A 1XIWA 3DOSA 2WWMC 2HTKC 2NY4C 3V6OA 5D1QB 3QO0A 5C0RH 1JHKL 4TUKH 3IRPX 3S5LA 5A43C 4HUVA 1F11B 4GOSA 3GNML 3RWIA 1OAXL 1MCEA 3DI2B 4Q6YA 4QYOA 4QF1B 1T7YA 5LXGL 1BZ7A 4YFLF 1EEZA 5IROC 8FABB 3QDMD 4J7RA 3G5XA 2VMFA 4PJAA 2MFNA 4X6EB 3X3GH 6CGTA 1FGVH 3ULVE 1NCDH 1S9WB 1CDJA 1RK0B 3MRPA 1KIQB 4HUUA 1G1CA 4ZNEE 3DV4A 4M03A 1PKQA 1NGXB 4DN4H 1C5CH 3QUZC 4AENB 4HJJL 3JBG7 1DQDH 2AERT 4WUUD 2XKUA 5TQ0H 5IFHH 2DLHA 5E4EC 2ZCHL 4YHMH 4YFEA 1IC5H 5DK0A 1FVEB 4MD4A 1MIEH 1UM4H 4EI5B 5KSBE 3TT3L 2VQUA 3FO0L 3ZKMC 3G5ZB 4YHLL 3SKOB 1RUML 3KPOB 1FORL 1FAIL 2OQJB 3TO4D 1HXMA 1XGUB 2X4UB 4M6OL 4FQQB 4PRHA 2ADIB 1FPTL 3SDYH 1RJLA 1XGTA 3E6FB 1RUKL 1YPZB 3MLXL 4LVOC 4YDKH 4G8GD 1BVZA 4DVRL 2ZJSH 3T1FA 4F37K 2EEAA 2VXVH 1MCOL 3OGOE 3CU7A 3MLUH 1LEIA 1U8QA 3FT3A 1B4JH 2V2XB 2BRRL 2G75B 4A2MA 5C0EB 3H9SB 1KJMB 4U0QB 1Z9OA 3MV7B 2C3VA 5F7FA 3CVHA 3QFJD 5ID0B 3TP4A 1QBLL 4HWBA 4LAJH 3IKKA 2XQBH 4KUCD 4Q9QH 2GITA 1FRGH 3O2WH 1J0HA 1INEL 3ARBD 1JGUL 1MVFA 2AABH 2NY1D 3RGVA 2RFXB 4V1DE 4XX1E 5I15H 1BZQK 4E41B 2P8MB 1ACYL 1NEZB 2OJZL 3TBTA 3OAZK 5J9PA 3LKNA 1B0RB 1DBKL 1QKZL 3UMTA 3PWPB 1J0KA 4JM2A 1I1RA 2OYPA 3T04D 2ZWLT 3GK8H 3VXNB 3OKOB 4XB8A 2I60H 5CCKL 4LGSB 1ZLVH 3OL2A 4PTUA 3UBXG 5DVLA 1MIMH 4YC2B 4MAYB 4PJFA 4J23A 2FO4B 4E0RB 3QQ9D 5IMLB 5ACMA 2JB5H 4KV5F 5C0BD 1G7HB 5F44A 5C0JB 4YAQB 1E27A 1M7DB 2YD9A 3WO3B 3GJEA 4KUCF 4RMWA 2ENSA 3BEVA 2YUVA 3VMOA 3BD5A 5AUMB 3HG1E 3MV8D 2EYSA 5C9JB 1I3VA 5HHVH 3TPUB 5T1MB 2K1MA 5ALBH 5GS2H 3L5WB 2MOVA 2D0GA 3W0WA 5D7IE 5J8OA 3WS3A 1VFBA 2XIDA 2W92A 1SBSL 3NTCL 3MROB 4YXHH 2MHAA 2X1WL 3AS2A 3LS5L 2EDTA 5DMYA 1F58L 2AJVL 1XR9B 5TDPB 4X4MA 2IQ9H 2COQA 1FP5A 4K7PY 3ZDZE 5IQ7L 3L7EA 3DMMD 5C09D 3QDMB 3MX0A 3B9KB 3SKUD 4M6NL 1S7UB 4D94A 1QQDA 3QPQC 1I3RB 4XVUC 4OZIE 4FQIL 2DOCA 3QQNA 5IFJB 4RX4D 4H0IA 5BZDA 4WUUB 1UQSA 5D1ZA 1KJ2A 4HKBA 1LE5B 3HE7B 2J6EA 3RJDA 3BDXA 5BVJA 5I66B 4J8RA 4X6CA 1HHGA 1FNHA 3ZSSA 4K3DH 4YXLL 5EA0H 5CILL 2ID5A 3HZVA 5FO7A 3DVGA 4ZXBC 4Z78A 5EIIA 3WFBL 2YPLA 3B2UD 4I4WA 5JMOC 4PP1D 1AQKL 1ZLSL 2IADA 2BMKB 3UJJH 4Y16A 3TO4B 2X05A 1UB5A 5JW5B 3VW3L 2VLRE 5DC9B 2CH8A 4YK4C 5HD8D 2XWTA 2OJEB 3WXVH 3BKCL 3FOMA 2IGFH 4Z8FH 1FGNL 4KK8D 5T3XH 4F7EB 4G8GB 3GMNA 2BDNL 1RIUL 4OIIL 4P9HH 5EIVA 3QIUC 5E2TH 3ZLQC 5DWUL 4PJDF 4PJBE 4WNQA 5F96H 4CL7A 2DBLL 3QRGH 1I9EA 5HHOA 1QPPA 1XF2A 1UB6A 5DRZB 2VWEE 3S4SG 1GGBH 3LZFL 3MLTA 1NGYA 1OWWA 3SE4C 5IOPB 5DMGD 5A2FA 3QFJB 2NY3D 3VXSD 4BZYA 4QXTB 3ARBB 4P4RA 2NY1B 3ESVF 5FUCE 5I1GH 5H37H 2EXWC 2XXMB 5BV7B 4L3ED 1JBJA 4JREC 4XP4L 4AG4L 5JNYA 3A0OA 4AIOA 4V2CB 3UDWC 2H6PB 2Q7NA 4N9GA 4OAWA 3JWDL 4P2YA 2BVOA 5L6YL 5E08L 3SKMB 5CEXA 3BD4A 3Q6FB 1A6AA 1DBJH 4N8VG 2F5BH 2Y06L 2XNAA 1SJVA 1XF1A 3DXAD 4D8PA 1U3ZA 4JDZB 4F15B 4XNZC 3R4DA 1NAML 1U3YA 4XX1G 1WWBX 3B43A 4MHHI 5IBLD 3L1OL 1J1XL 32C2B 2BSED 1S7TA 1I9IL 1KPRA 1MJJB 2WWMD 5LJYH 5E5RB 5C0BB 4JY6B 4WI3A 2CO7B 4CMMA 4NRXA 3VDAA 1CN4A 4P5TC 3DRTA 2A1WL 3EJYC 4FQPA 3KXFB 5DVNA 1EIBA 3MV8B 3HI1A 5DJ6B 3V6FA 2FGWL 3SE3C 3L9RB 4OLWH 1XGRB 2DQIL 3O8XD 1E4XI 4AZ8A 2OXGA 2XG5A 1HHKA 1CFNA 4FFVC 3OKDA 3I3DA 1IQWH 3ZO0A 2AJZB 5CEZD 4QWWD 5DD5L 1JPGB 3FQXA 1EUUA 5TDNB 2HVKA 2RGSA 4XNMA 3MRJB 2WBWB 3FMGH 1OP3K 5B21A 2P44B 5C09B 5D2NA 1JTTA 2CR6A 2OS7A 1HSAA 3IDGA 2OR7A 3UJIH 5D93C 2ZCKL 1AE6H 1M6OB 4CADB 4ODXA 5FHAH 1D6EA 5F9JB 3SDXF 1PZ5A 4PJDB 3RIFF 2BNUA 4RCAA 3KYKL 1IGIL 2PUQT 4FQ1H 5CJQH 2Y4SA 1CE6B 2QQKL 4HIJA 4L9LA 1P84J 3UPAA 2CLRB 4RDQF 1HEZB 3QAZB 2G2RB 2A0LD 2DF3A 4UV7L 3AS3A 4PJXF 4Y5VA 2K3TA 2W0FA 3ARVA 5TFSL 5H8DA 5DUPH 5E1HB 4MXWL 3TJEH 5JHDD 2VABA 1OTTD 5EU4A 4JKWA 3OHXB 2UZYB 4ZUVA 5J0BA 3DETD 1V7NH 3OAZH 4JFOA 4WCYL 4JPIA 5EB9A 3UTSD 3W9EB 1S9XA 4BSVA 2H2PC 2YPKB 4BQ9A 1YEIL 3LAFA 3UTZB 3G6DL 4O5LL 3HN3A 5HYIA 1JIBA 2PXYC 3PHSA 1IGJB 3CFBB 4WV1B 4YHYC 4I3GA 2P46B 4LP4A 3MNVA 3NMEA 1A6ZB 1KEML 4QT5B 3FQWB 1G9EA 5E24E 3I02B 5D1XC 3EYQC 4HH9A 2NY3B 1K9TA 5FHBL 1NFIB 3T2NL 3VXSB 3WXWL 3F7QA 5FYLD 4IRSB 2EYTA 4JG1L 4QRUA 3BGMB 4HWZA 3OR6B 2ZSVA 5C3LD 4L3EB 2C4XA 2VIRA 4K3GA 1S9VA 4J1UA 3V0WH 4NGHL 5HY9A 3EO0B 5KN5B 4M48H 4HC1L 1DVFA 4PGEB 3F7PC 5F6HI 4LOUC 3M45A 3WN5A 5FA3B 2N4IA 3VXUE 3O6MH 5KSVB 5IB4B 2OL3H 4JFFE 3DXAB 4M9OA 5GRVL 1PX3A 2OZ4A 2H32B 1HH6A 1HHJB 5FGCE 2QQNH 2EDJA 3K74B 3D0VB 5F6IB 1DBBL 1FLRL 2IPTL 4NPYB 2D9CA 3PV6A 1DFBH 1Y6KR 4HS6A 5I8KL 3DRQB 5K59E 5D7KE 5J11C 4NKIL 1G7PB 1KCSL 4FOMA 4ALAH 1IGYB 3V4UH 2NX5A 2BNQE 1EHNA 4K7PX 4LU5H 4NQCA 1IGFL 5T3ZD 3PNWB 1MFBL 3HRZB 3ZZ1A 3AUVA 3V5DA 1FBIH 3SDXB 1IAMA 4RNRA 3PDDA 5FYKD 2VB5A 3SJVD 4LCCC 4TULH 3E8UH 3GMOA 5F70A 5HYJA 2QSTA 3O8XB 2AGJH 5L2KD 3QFDB 2V7NA 4NNXB 4OUUA 3HUJA 5CINL 5IJVA 4DKDC 3QHFL 4PJXB 5JO5B 4R4FH 2I26N 1F6AA 4K9EC 4GAJH 3ARDA 3BGAA 2IANA 2WANA 4YX2H 3LN4A 1AKJD 5LGJB 5BS0D 1XF3A 3P9LB 2ESVA 4MA8H 1QRNB 2BVQB 4Y5XC 1A7OH 3OZ9L 4L4TE 4O2FB 1GGYA 1P53A 1BPVA 2BY2A 1JL8A 3NIDF 2GSGB 5ANMB 4TVPL 4W4OA 2XACC 4WHTA 1AGFA 3JWNC 3IFNL 3O4LD 5C0CB 2A6KB 1AGBA 1BBJB 2DB8A 4JRWA 5E7BA 3NPZB 5EU5A 2P5WA 2A6IA 2F54D 4TUKL 5I1DB 1U8NA 4LHUG 1TVBB 4XCYA 2EH7L 4QHUA 4DJMA 2C3XA 2JCCA 3AU1B 3LKOB 4Z7OE 4FQ2L 3QDJD 4NUJB 1HWHB 5JHDB 4E5XA 1YQVL 3SDAD 4ONFH 1T0MA 4LHJB 2VISB 4YHKH 2B4CL 2A83A 4WI6A 1WQVT 3L3DA 3UTSB 3V6BR 3SO5A 1QSEE 2XZQH 2AS5M 2HMID 3BN9C 4NZTL 2R23B 3SE8L 5L0QB 4BFIA 5DRXA 2VLMD 4P46C 4PJ9C 4ENED 1R5IA 1DQDL 3BE1H 3T0EA 3U4BL 4ONGL 4JLRB 1X4XA 2VE6A 4BSJA 3NPSB 5D7LE 1A1NB 5TJWK 5CJOH 3VJ6B 4GKZB 4CVZA 4GG6A 4A2LA 4LFHD 4YBLC 4HW6A 3OTTA 2B20A 1INDL 3WS6A 1T7WA 5HTSA 1MIEL 2R29L 2XTJC 1UM4L 2WBJA 4Y5YB 3WHE0 1U42A 4F80A 1FZKA 3V4VL 3C87A 5F8QC 3WDIA 4GXVL 1JNLH 3SDYL 3PGFH 2VLKD 3O4OB 4PRPA 2BVUA 2YHGA 1K2DA 3VI3F 2EIZB 4YDKL 4HKJA 1Q9OB 4NO0D 2AJSH 1T66C 1HDMA 5C07D 4M3KB 3IDMB 1YNLH 3ARED 4JZOB 5EIQA 1JFQH 5EU6E 1QEWA 3MLUL 4Y4KD 4AEHL 4Y4HA 3QP3A 5A2IH 1IGML 1B4JL 3BRFA 4JPKL 4NHUB 3EHBC 5EC2B 2D31A 2PO6D 4LAQL 3K1KC 5I0ZA 2LABA 1OP3H 3WUWA 1FYTA 1QG3A 5T1LA 5F7NC 1VGEL 4LPTA 1MY7A 4NZDA 4DN3L 5I9QC 4YR6A 4Q9QL 1MCNA 2ED8A 3RL2A 3SY0B 1FRGL 3D6GA 4XCFH 4TSBH 3PWVA 4XAWL 3P77A 1XAUA 1DSFL 4APQC 1HCFX 3A6CH 3BPOB 3JVGC 4HV8B 3O2VL 3SJVB 1J86A 3RKPA 43CAB 2EDHA 4L3CB 1WFTA 3IFPB 4K94C 1MUJB 1TTGA 5L2KB 4F57L 3MYJA 4LSQH 2D03H 5EBMA 4K71B 5GRJL 1JGDB 5E2JA 3RWDA 1SBBA 3T8XB 1YUHA 1AIFA 3K4AA 1WZMA 4JRYB 4YHPA 3MZGB 3VGBA 1MHHA 1AKJB 1KNOA 5FYJH 3RX8A 1UCTA 5BS0B 2N7BA 5IMKB 5E8EB 3UJTH 2JB5L 1IAOB 5M7QA 2VDQH 3FONA 4UTAH 4I8DA 3D87B 1EO5A 2GKIA 5I76B 2XKSA 1OW0C 1A0QH 4AEEA 1SY6A 1AHWC 4QGTA 5GS1B 5EOQL 1YNTB 4WWKC 4JFDA 2VNCA 5I71C 4G8IB 3RBGA 3O4LB 2HT2D 3S35H 5F3BB 1GXEA 3IDJB 4LNRA 4ORGB 5B39B 4MNHB 2GHWB 5CSZA 2R1YA 1FG2A 2F54B 4HCRH 4L29B 1A21A 4FNLH 3STZB 4YXHL 4OGAD 3L5XH 4G42B 3QDJB 4I0KA 4XNQA 4DGVH 1J1PH 5FEBA 3QXAB 5EU3B 3SDAB 2FSEB 1WAAA 4H26A 5ISZA 1ZAGA 4X7SL 4KC3B 2FECL 4HIEB 1A22B 3KPRA 1F45A 3PV7A 1HYSC 1JN6B 3HC3L 3QNYA 1PLGH 3LB6C 4JY5L 2LQRA 2NTFB 4Y88A 1MH5B 5A1AA 4Y0GA 2D4DA 2WINB 3WHXA 4HXBH 4K3DL 1TMCB 5EA0L 5GRUH 3JV4A 5E00A 3MRNA 5BMFH 2XKNB 2LU7A 1ZTXH 1HYRC 3AXLB 3UJJL 4LLQA 4ZXBA 4M6AA 4JFEE 4H1LA 1RY7B 2VLKB 1MCJA 3TIEB 4GMSH 5T3XL 3GKWH 4TVPE 3EOAB 4HKXB 2NW2A 3HC0B 1LQSR 3VI4F 1JPSL 2E7MA 2N1KA 4UIMA 5C07B 3QO1B 3AREB 3IDNA 1P4LB 3MREB 3QRGL 5KSUA 1BAFL 3O3BB 4PJ5D 3QIUA 4HLZG 5D5MF 2PO6B 1S9YB 5K9JH 5DD3H 2LAAA 4NNYA 5KOMC 3JWOH 2OMNA 4YJZL 1WCQA 2WP3T 4Z7UA 3ZE0F 4U1LB 1I85C 4O51B 3E1F1 4PJIA 1L7IH 2HT4C 2NQCA 3S36H 2Z35B 5C6PB 1DQJA 3C8KB 2FD6L 1T20A 2O61A 1CICD 4N1EA 4FFZH 1UXSB 3KPNB 5JIKA 4XGZA 3NN8A 1SJXA 1CGSH 5DJ0A 2VXSH 4GKNA 2F5BL 1AQDA 3AMKA 5DD1L 4HBCH 3TT1H 1S7RB 2A6DA 2NR6C 5EBWB 5CGMA 2ZUWA 4DZ8B 4JVUA 4NC2B 2AQ2A 5JR1L 4HZLA 3IFLH 4XAKD 4QRRD 3SGDH 5I30H 2Y1VA 2XY1A 1B2WH 1X5IA 2N56A 3PWLA 2I25N 2FHBA 3I75A 1AD0B 3U1SL 3C5ZC 4OFYA 1PQZA 1HKFA 5LCVL 1A7RL 1XIWD 4N68A 3PQYA 2UVFA 4ZD3L 4X8XA 5EOTB 4DAGH 1UYWH 4PRNA 4OLWL 3CMOH 4OLEA 3QB7C 2BC4B 4RBPK 4G9DA 3SE3A 1S78D 5FOBA 1HKLL 4WU5B 1CTNA 4MA1B 5SV3A 2FH6A 1R3KB 3U7YH 1PG7W 3BYTA 4PJ9D 3A67H 5ILTH 3BWAA 4HK0A 4HGWB 3UC0L 3E3QC 3G6JE 1F4YH 4XHJD 3ROLA 3HCVB 3S98A 3U83A 4IBLT 2VWEC 2Q86B 4N9OB 2VDLL 2VQTA 4P2RE 2R9HC 1P1ZB 3BIKA 4WI9A 1QBBA 2XWBA 4J3WA 4IOSD 3DVNB 5C8JA 5IFAL 1EXUB 1WBZA 2BRQA 4PLJC 3KPSD 1HWGB 3B6SA 5FUCC 4NO2A 3D9AL 3MJ9A 4PB0H 4FQ1L 4GRMA 5ABDE 2P5EE 5FDWA 2NNAA 1HH9A 1TTUA 1OGAA 1E6OL 3VFVA 1E4KA 5D5MB 3VXRA 4PGDA 3QEUA 5JPNB 4PY7A 2BSTB 2B5IB 1G7JA 3IKCA 4PRHD 2DDQH 5D2LE 4QXWA 2HRLA 3DGCR 4PGCA 4PJAF 4IOIA 2R4SH 4NN7B 1NCCL 4ELMB 1U9KA 1VPOL 2AEQL 4KHTH 4HEPG 1HQRA 2DRUA 3QWRD 1JHTB 2NCMA 1M71A 5MHSE 3WO4B 1LO5B 2VH5L 4NDMB 4Z95H 4NBYB 3GSVB 1G6VK 2XY2A 1F3DH 2Z4QA 2F8VA 4PJ5B 1RAMA 4XBPA 5ELIA 5D96C 2AXFA 4EEEA 3RGVD 2ICWA 5LWYL 1RV6X 2NLJA 1A4KA 4JRXE 5IGXL 3P0YH 4OF7A 5EC1B 3HMXL 5BRZE 2F53D 2EDWA 3NIGE 2OK0H 5LBSH 3RZCC 1CICB 3V0WL 5SWZE 4M48L 3DV6B 5CGYC 3RAJH 3S37H 3ABZA 4KKAC 1BQUA 1KPVB 1YEFH 4U2YA 3GJFB 4UIKH 4CVXA 4LLMB 3O6ML 3T3ME 3GB7A 5I17B 4MA7L 2FRGP 1F4WH 2DTSA 1FJ1A 5FYJU 5ENWA 2A2QT 1CD1A 3NFNA 2A9NL 2DKUA 3I6LD 5C71A 5ID1A 1E28B 1TJGH 2HT3C 1U8LB 4ALAL 2O5XH 3QJFB 4ZUWA 2ZZUT 1T5XB 1NFDE 1WC7B 4LU5L 3LSOA 1XIWB 1RFDL 5EZLA 3W0WD 1WUNT 5T3XE 1O7SA 2QBWA 3QO0B 4XPBH 3E8UL 1U6AH 3QEHA 1QSFE 3S5LB 4HG4J 2H1PH 5BJTA 4HUVB 4WIQA 2AGJL 4G9FD 5DMIH 3SBWC 2R2HA 3RWIB 1JGEA 4KJYB 4QYOB 2FEEI 1O0VA 1IFHL 5FCUL 1FCCA 4R4FL 2J3SA 3KLSA 3P11L 4YX2L 2WUCL 1EEZB 1T89C 4CU7A 4KTEH 4LRNH 4PJAB 2C1PA 3G5XB 3WFCL 4E9LA 3GGWA 3NH7L 1AI1H 1PFCA 4OZGE 4MA8L 3GSUB 4NUGH 4RWYL 3MRPB 1N6QH 4Q6IA 1KB9J 4Y8AA 2AW2A 4R0LC 3NGBB 4XCCL 4X5XB 5D1ZD 5KVEH 3KPSB 5HHQB 5SX5K 1WZKA 4U3HA 1AXSA 2HJLB 1GZQA 2AJ3A 5DK0B 1FAKT 2I24N 1GYAA 5I8CA 3S88L 3A6BL 1WWWX 4GS7C 4G6KL 2FATH 1EVUA 1U8OA 3NABH 1A64A 4PRHB 4RISH 1RJLB 1XGTB 1KYOK 1P6FA 5C08D 1ITBB 1AY1H 1OHQA 3G6AA 4AQ1B 1NGPL 3U9UA 1CFTB 1DBAH 1JNHA 3T1FB 1LWRA 4JG0L 4YHKL 4UDUB 3VXMD 4WW2A 3P40A 1UVQA 3BVNA 3RIFK 1CE1H 4HF5L 3CUPA 1GL4B 4HAGA 3D5OF 2X7LA 5EFIB 5E94B 3FT3B 5GS0L 4KDTA 1UWEH 3OV6A 4LLWA 1UC6A 4X6CF 3GHBH 4GBXD 4N0UE 1N0XH 3QUMH 4CMHB 2HG5A 1JGLH 4L8BA 5JXAL 3UBXA 4P46A 2C3VB 2JELH 3CVHB 4Z7NE 2H2SD 2GITB 4WWID 3C5JA 3STLB 3NZ8A 2LV4A 5JIIA 4YHIB 3RGVB 1MCQA 3T2QA 4KUZL 3V79C 1W8OA 3RVWD 2X10A 2F53B 1JNLL 5DEGA 4C56A 3PGFL 3P30L 3LIZH 4OD2A 4N5ED 2AEPH 4DEPC 3CZFA 3VGAC 1LO3L 2IH3A 15C8H 1NGZA 1GGIL 3P0VL 4MYWB 1W0VA 4OLZH 4PTUB 4PJ8A 5I1CH 1VERA 1JFQL 4PJFB 1BJ1J 1E4WH 4O4YL 5F7EH 5K9QG 2VDKL 5EZJA 1N3NA 3JWDC 5TGBA 3WLBB 4KMQA 5CLTA 3QDGD 1NH6A 3P2TA 2J4WH 3LPFA 3GJEB 4LLDA 1QFWM 2HH0H 3BEVB 4UT7H 3MODH 3UTQA 1ZHKA 4QY8A 4YDLB 3QIBC 2EYSB 1D5IH 1EGJL 3PGCA 2L4OA 5JXEA 3KLDA 1WEJH 4OCYL 4X6FA 4N8CH 4UBDC 2B1HH 3W0WB 3D3VD 3F7RA 1YN6A 1I7UB 1Q72L 3VGFA 3W2DL 1BQLH 3WS3B 4JFHE 1WLHA 3MLYL 1RJYA 4ETQB 4G9FB 1F2QA 3L3JB 4OQTH 1R3LA 2GYSA 3MUGA 2D03L 4M1GH 4QHNA 2CXKA 4J4PD 2FH8A 2HTLD 5D7SH 1P7KA 4ZNEA 4M02A 5AZEH 3C60A 3ZHDA 4EVNB 4DVBA 4YNYB 5DT1L 1CIUA 1EO8H 1MFEH 1QQDB 3CSBA 5DDHB 3W82A 4UTAL 5KJRH 3K2UL 2E9JA 1A1OA 1CBVH 1VEMA 3N0PB 3UX9B 1CXIA 4NN5B 5BZDB 5DXWA 1UQSB 5AYQA 5KSBA 5D1ZB 1KJ2B 4HKBB 1H5BA 5DZOA 1AHWA 2EKSB 2YRLA 4X6CB 3DX7B 1HHGB 5JW4Q 3S35L 3X13A 5HJ3A 1JWUA 3FCTA 3HZVB 4BUGA 5FO7B 2GW5A 3DVGB 4Z78B 5EIIB 1A3LH 5DS8A 2VLLA 1JYNA 2YPLB 3J8F7 4I4WB 1S7SB 5JW4R 5T5FL 5D8JH 4FNLL 3SGKC 4CVUA 5E2WH 5GGQL 4H8WL 5H37G 2R8SH 5ITBH 3EKCA 4BZ1H 1FL3A 5IMOA 3FOMB 5C08B 4JDVB 3CLEL 1A7NH 3LPGA 3GMNB 4X9HA 1CXFA 4BKLA 4UTBL 3VXMB 2DQTH 3O2DA 3H42L 1RQ5A 3R8QA 4WNQB 1BOYA 3E0GA 4D9RD 3UZVB 5D71H 4CN1A 2A77H 2P8LA 4M1CD 4N8VA 1XF2B 3NCCB 4DUXA 1I75A 2FNBA 4HUXA 1OWRM 2F15A 4GBXB 4V1DA 3VFNA 4PV8B 4IM8A 4HS8H 1C1EH 5K9OA 3K2MC 1LDSA 4ZOEA 5AG9A 4J6RL 4PBWD 5GRUL 4P57B 4IS6B 4P4RB 2X4TA 2HA1A 5BMFL 1ZTXL 1G9MH 1GOGA 5ERWB 4QOKE 3UCRA 2VLJE 1VACA 4Q97A 4OAWB 3WHE1 2YZ8A 3SCMC 1TITA 1R3JA 2RIKA 4I0PC 1BEYH 5IW1A 4GMSL 3GKWL 2NY2C 4POUB 1KLGA 4J3VA 2XNAB 1NBZB 3OB8A 4FG6C 5BQ7A 5GGUA 5C70A 1U2CA 3KWWA 5MERA 3NIFE 3CFCH 1S7TB 2HFEA 3CAFA 3OJVC 1KSRA 4LL9A 3HG1A 1Q0XL 1UZ6F 3QDGB 4CMMB 1IAII 1RIVL 5DD3L 3NCMA 1YEEL 3DRTB 4NQCD 4R3SB 1G6RL 4NYLB 4XCNA 4Q9RL 5D7IA 1YYLH 3V6FB 2ED7A 2FX8H 3JXAA 1KXQE 3HE6C 1H8OA 5CD5D 3S36L 1M1SA 4HJ0D 1I85A 4PLKC 5ITFA 3OKNA 2H8PA 3SDCA 1HHKB 3BP4A 2FX9H 1IE5A 1P4BL 1QBMH 3ZHKA 1NC2D 2GK2A 2FYYA 2Q7YA 4YHNA 3EFDH 1S7QB 1BJ8A 4OLYL 3ARDD 2IAND 1D9KC 1Y18A 3DARA 1RZFL 3FQXB 1WGOA 4HT1H 1U8IA 2HVKB 2X4NA 3U4EA 4U1KA 1ZSDB 2ESVD 3V8OA 4OCXH 3AS0A 4OZIA 2ITCA 3L3HA 5D2NB 4WEBH 4OGXL 2W9EH 4RGNE 3IDGB 1IAKA 4BH8A 4MLIA 1B2WL 4JHZA 1D6EB 4POZD 1CCZA 1PZ5B 4RAVA 3LY6A 3V0VA 1ZGLM 2WP3O 1BIIB 4L8SA 1CFVL 2NY6C 5FAAA 3B9EA 4NC0B 2GQHA 3C5ZA 2P5WD 1HINL 3GSNA 1UYWL 4NZRH 3WFDL 3CMOL 1LEKA 5DHXB 4IRJD 3MRDA 4F3FB 2DLGA 2CUIA 5A3ID 3IJSA 1FZMA 2VLRA 4Y5VB 4AL8H 1C5DB 2JJUA 1CLCA 3AB0B 2E7BA 3BESR 1CR9L 5EU4B 5C7XL 4NP4L 5DJ8A 2OP4H 4MSWA 4XP5L 2X5PA 1VSCA 3A67L 3U2SA 4U1IA 3INUH 3DBXB 4ZUVB 2Y07L 4JFOB 5ESVA 5F7UA 4PJBA 4RMUA 3U4AA 3FQNA 3JSSA 1TENA 1S9XB 4BSVB 1TQBC 1G1YA 4PTTB 4S1QH 3T0ED 3I9GL 2Z92B 2SEBA 2KZWA 4OQ1A 4O9HH 1ZA6A 5K9KB 3LHPH 3MV01 2ZUQB 3MNVB 2B4CC 1MWAB 3MNZA 3H3PH 4HH9B 1WIUA 4P9MH 1WBXB 3FB7B 1S3KL 3B2VL 2R0LL 5EO9A 4IOFD 2XTLA 2EYTB 3EW3B 4X9FA 3UO1L 4M7LT 4HWZB 4LSTH 2ZSVB 1C7SA 4BK4A 1FSKC 3F65A 1WFOA 2VIRB 4PRPD 3ARUA 5DEZA 5HY9B 3JTTA 1V7MH 3MV9E 4FABL 1DVFB 4L1HA 4M93B 2ZUSA 4GG8A 3KPTA 3FO1A 2G9HA 4YE4H 1GHFH 2WQ8A 4WFED 4BFBD 4OCSH 5T1KD 3IAGC 4HLJA 5C92A 2V2WA 1HH6B 2DI7A 2JJTC 4YBQD 1MPAL 2FLRT 1DN0A 4PUBL 3GRWH 4D0BA 3PV6B 4HS6B 5E8DL 1QRKA 4IIQC 3EJZD 4HXAL 4KZDH 4I2XE 3I3BA 4XRCA 2NX5B 4M5ZL 3K7UA 4NQCB 3CFJA 3IU4L 4BELD 3V5DB 3PDGA 2B8OT 3IFOA 3ARGC 1KF9B 1EHXA 2XV6B 3FQTA 1EAJA 4LEOA 3GMOB 3ISWA 3RNQA 4PG9A 1KV3A 2ICWI 1JF6A 5C0DA 4JO1L 4W6XB 4WFFE 3HUJB 4NKDA 5IJVB 4ODHH 1NC2B 2D7TL 5MP6H 5LGHL 1ZHLB 4LLYA 5LG1A 3TBSB 2E5EA 2YS4A 3ARDB 2IANB 1P7QA 4R90H 4UIKL 5DZNA 1MY5A 3Q6GL 1FZJB 1I3UA 2ESVB 3FL7A 5L8KB 3VXPA 3QI9C 4CAGA 3RL1A 4IMLA 2DQEH 5B4MC 1TCRA 4RA0C 1OAZL 4ZTPL 5C1MB 1DANU 1NSNL 3NFSL 3L3GA 4OGYL 1NLDH 4OZHF 1MJUH 1ERNA 4ZOCA 2DLFH 1AGFB 4PYGA 2QQQA 2BY3A 1QLEH 3MC0A 5FYKH 1UGNA 3EDKA 1Z9LA 2ARJA 2YD4A 2PW2B 3I85A 2PYEE 1U36A 1N2RA 3CC5A 3GBMH 5EU5B 2P5WB 4M7KL 1YDPA 1U8NB 3CDCA 4IRJB 3WDHA 2NY4B 5DMIL 1T2XA 2EC9T 5I1HL 3GI8H 4UT9L 3PDOA 2D7NA 3ULUD 1KGCD 1FVCB 1ZGLP 5E2UL 1KB5H 1L0XA 4RFOH 4LPXA 4E5XB 2EZ0C 5FIEA 1C16A 1T0MB 2YPVH 4JFXB 3SBWA 12E8L 2ADGB 4BQ8A 4GSDL 2AXHA 1ZVYA 3L5HA 4ERSH 4Z7QE 1AI1L 1J18A 1DLFH 3L3DB 3OJMB 1B3JA 3H9ZA 1WWAX 4NUGL 3LN5A 4EOWH 1N6QL 3PGDA 3T08A 3OXRA 4BFIB 5DRXB 1KLUA 3JV6B 4J2XA 3T0EB 4OFPA 5FKPB 3C6SA 2VE6B 3UEZA 2BJMH 4PREA 1U58B 4HBQA 3L3IA 4CVZB 4GG6B 4R0LA 2R0KL 4R96A 2ENYA 1IAIH 2XRAL 4PRBA 4OF5A 3GJFK 2WBJB 1X5FA 4KDWA 3U30C 5I73C 3F62A 3HAEH 4WO4C 1DANT 2FJFB 3ULUF 3ZKXC 1KIPB 3QISA 2UWEF 1FFOB 4MJIA 3RU8L 3D18A 4PRPB 1AY1L 5EOCH 1K2DB 2GAZA 3VXUA 2XWJB 1KT2A 2Z31D 1DBAL 2M8XA 4JFFA 2FZ3A 1FL6B 5DO2C 4NT6A 3U0TA 4ZFFA 4Y4HB 5T1KB 1KCRL 2ICES 5KG9B 4U31A 1FIEA 2D31B 3T0VA 5F7KC 1NBYA 5IBUG 5HYQA 4HMDA 4KQ3L 3WUWB 4ODSL 2BNQA 2F58H 2IMMA 4YR6B 5JQ6H 4JZJC 1L7TH 2UVEA 4O2EA 4OZHB 2NZ9D 3PWVB 3P77B 4QO1A 3UBXI 3VD9A 4N0CC 5EUOF 4G5ZH 3D39E 5IEHA 5B38G 2AK4E 1B0WA 3TJHC 4PRDA 3HI6L 3EOYG 1OGTB 1IBGH 5TE7H 3T3PE 3AS1A 3RRQA 4JAMB 2PYFA 1TVHA 2AEPL 5EBMB 1Q1JL 4ELKA 3CDYA 2AQ1A 3RWDB 15C8L 1YUHB 1AIFB 1T1YB 4YHPB 3CSYA 2DYPA 4OLZL 4L4TA 4WUKL 2VXTL 3VDBA 1E4WL 3SKNB 5F7EL 1OF2A 4MNQE 2P4AB 2O5ZH 5IKCA 3I6KA 4KRMB 4U6HA 3DSFL 4XC1L 3FB6A 1FV1A 5F97E 2CLVA 2J4WL 3RA7H 4PJIF 4CDGC 4UT7L 5FM5O 3TN0C 4OFYD 1EZVY 3HFML 1ZOXA 4K55A 5E8NA 1DQML 4MQXC 1MCHA 2ZUYA 2VZVA 5DJDA 3KLHC 4OKVB 4LNRB 2CMRL 4YH6A 4MAUH 1NAMA 4MXVF 4N8CL 4F33B 1SEBB 2B1HL 5CSZB 3MOBH 4NQDE 1FG2B 4LKCA 5DRWA 2BY0A 1Q94A 3VFOB 1BM3L 1J8KA 3O3DA 4XWOC 2J2ZA 4OQTL 1ZT1A 2YN3A 4M1GL 5CD3A 3F58L 2DTMH 4XNQB 2EH8H 1D5MB 2V7HA 5JZ7C 4IHOB 1QSEA 3ZMRA 4JFPA 2XPGA 4FFWC 5AZEL 4H26B 4ZYKA 5ISZB 3PG2A 4NQXA 5D7LA 5L8LB 3QQ4A 1CBVL 4R4NC 1P9MC 4PJGE 1IGCH 3QNYB 3IJYA 1Z2KA 2CJUL 5JUEH 1UEYA 3SE9H 3VXRD 1TPXB 1VENA 4J12A 2BVYA 3TF7C 3GMPA 5E00B 2VN4A 1OL0A 3MRNB 2R69H 3T09A 5IVNA 4TUJA 3NCYP 3IVKA 4JPWH 5D8JL 1BQHA 5KANG 3P9MB 1S8DA 1H9VA 1TJIH 1Z3GH 5E2WL 1HIMH 4H1LB 4BA8A 5I1AB 5IWLC 2YWYA 1R24A 4W70A 5D72L 4JO2L 5EU6A 3SGKA 4BSWA 2NW2B 3AY4C 1BZ9A 2G60L 1T21A 3QUYD 5DVKA 3IDIB 1TETH 4K7FA 2YC1A 5IUSA 1T3FA 3W39A 5CBEA 4UIMB 2NYYD 1NAKL 3IDNB 3KG5A 5IV2A 4HX1A 1RZIA 4L4VD 4OUOA 3IU3A 5I74C 4XPFH 1MRCH 3QIUB 4KKLC 1C8PA 5I19H 4TPRH 4Z0XA 3WNLA 4TNWF 1OD7A 1AR2A 4NNYB 1E6JH 3W5NA 4ACPA 2YRZA 4Z7UB 4HS8L 35C8H 4XNXH 4PJIB 1MF2H 4OIBA 4DUWA 1KPUA 4GKOA 3ULSA 1ROWA 1DQJB 2GFBA 1T20B 4PB9L 1CLOH 4KJPD 4GUPB 1F4XH 2L0DA 1P84K 1TZHA 3LMJH 1TZGH 1QNZH 5F8RC 4JREB 4XGZB 3NN8B 1ZKAA 5JOFA 5DJ0B 1BEYL 4GKNB 3WIIH 5IM7A 1AQDB 4B7IA 3L3OA 4LIQH 3VXOA 2HLAB 3LEXA 4LCWD 4I0PA 4I18A 4ONHB 2A6DB 2I07A 4QNPF 1U3HC 2DM7A 3K3QA 4LCYA 3EYFB 5DD0H 1CD0A 3Q0HA 4OCRL 2E3VA 1JZ6A 2BSRA 3RVTD 1F8TH 3CFCL 4HZLB 2CIIA 3K4ZA 2B2XL 4TSCH 4PR5A 1EEQA 3MBEC 2IF7A 4XVSH 5KSAC 2DQCH 5ALCL 4HC1A 4KWUA 2AJYH 2XA8H 1X44A 4XMPH 3FT4B 3PWUB 3ZDXF 5I6XB 2D0FA 1RUAH 5SV4A 3QDME 4PD4J 5JOEA 1YYLL 3QNXA 1IKFH 5CJ5A 1N7ML 1HNGA 1XEDA 4G9DB 2C26A 4IMKA 2QJDA 3PHOA 4QHMA 5BOPA 5DJXB 4EXKA 2FX9L 3D1MC 3V52H 3HE6A 5FOBB 4WUUE 3RQ3A 2WUBH 3N06B 4NQEE 2DJUA 2R0WL 3EFDL 1T1ZA 3BWAB 2FLBT 1KENH 1AJ7H 2IC2A 3I50H 4HT1L 1BF8A 3ROLB 4YEEA 4S10A 1BGXH 1YY8A 5MENA 2IEPA 4UT6H 2P8PA 1Q0YH 5LQBL 4LSRH 2XWBB 5IF0B 1BD2E 3RWJA 1WBZB 1I8IB 1TZIA 2BVPA 4NO2B 5KBNC 4G8GE 4GRMB 2NNAB 1H3XA 3MXVH 5IEKA 3VFVB 5CZXD 1Y6NR 3VXRB 4PGDB 3NBNA 3O0RL 4CDHA 4F9PA 1A6WL 1T7XA 3IKCB 1BP3B 4JFEA 5DJCA 4AL8L 1T2QH 5CEZL 5E03A 3MACH 1YN7B 4UAOB 5EULV 4ZNCD 4KV5E 4PGCB 4BH7A 2Y9RT 3PHQA 3BHBA 4MB3A 1LNUB 4IOIB 2NY0D 4BK5A 3INUL 5KS9E 4EQ3A 1ZVSB 2FIKA 1Q9KA 4JZNB 5M95B 5GGTH 2QADD 1IM3B 2GTWA 3BWUC 4NQTA 4GRLC 3QUYB 1R0AL 1QHOA 1HQRB 4XXCA 2XXCB 1EMTH 1M71B 4MNGE 1YECH 1JRHH 3MLSL 1SJHB 2ZOKA 1NDMB 3BZEB 2FR4B 3QIWD 2Z4QB 1KN2H 5AYUH 3N1FC 1ORQA 4I3RH 5EORL 4F58H 2M26A 2CRZA 1QLFA 3VE0A 1AFVH 2RCSH 1CDYA 1MHEA 4P9ML 5GS0C 1NEZG 1A4KB 3OMZA 4P4KC 5D7JC 2R56H 3VG0H 1QA9A 4EN3C 4C56D 3OGCA 2W65B 1DBMH 3QG7H 1XT5A 3SKJH 1V7ML 1ZS8A 2YD6A 1EZVX 2EO1A 5HPMB 3LVEA 2ADJA 3MV8E 4M5YL 4RGNC 3X12A 4PJ8D 4YE4L 1IC7H 4CVXB 2DM2A 4PV9A 1WCBA 5C2UB 2X4QA 1FJ1B 2HFTA 3FAXA 4C55A 1EHAA 2A74A 5ENWB 4K3JH 3BSZL 3ZTJG 1CD1B 3NFNB 5H94A 1IT9H 4K94H 3HI5H 2KPNA 4OD3H 2EDBA 1U8HB 4DK3A 3KJ6L 4P23C 5F9OH 2JJTA 1YY9C 4KZDL 4G80A 3FFDB 4W6WB 4ZUWB 4X8JB 4RGMC 5FYLL 3MBXL 3QXVA 4NJ9H 5JXED 3LSOB 2DIBA 5EZLB 3DHMA 4MJ2A 3WLWD 1FDLL 5BJTB 2P7TA 4UUJB 5F1NA 4PJDE 3S35X 5CJ8A 1ED3B 3G6JA 3U0WH 3IF1B 5MP6L 3ULVD 3L5JA 4OZFB 1HOCA 3WIHH 3Q2CA 4P2RA 1XGYH 3C60D 3B3IB 5FKAB 2C1PB 1AC0A 2FCBA 4Q6IB 1U8KB 5KOVC 2DQEL 4GAGL 2PCPB 1BWWA 1UACH 2P5EA 2Q87A 2HN7A 3QI9A 3C6LD 1LO2H 5T3ZL 4F2MA 5KVMC 3N1MC 2Y72A 1QLEL 3EDJA 5FYKL 3PJSB 1AXSB 1GZQB 1KACB 1MLCA 5E9DD 4Y4FC 3RWCB 3M8OH 2BOCA 5CZKA 5I8CB 2DLIA 2ATPB 1X5KA 5D2LA 5A2JH 2YKLH 1XGPA 1GC1L 1X5JA 1T04A 5E4IA 4D0DA 3ULVF 1U8OB 5IK3A 5HDLA 3GI8L 3MRLA 3EDFA 5C0NC 4PGZA 3S3PA 3EAKA 4M9PA 4HULB 4EQ2A 3G6AB 4RFOL 5IMMB 3S97C 3U9UB 2YPVL 4HWUA 3CZJA 3VFGH 4JQXC 1JNHB 3FHQA 3L95B 4HJGB 3SO3B 3BH9B 4EJ1C 3SDDC 1H8NA 4ZPTA 4WW2B 1F6LL 3REVA 3BVNB 2QADB 3JV5A 5GZOD 5L88H 3RVUC 3CUPB 2CRIA 1QFUH 4KDVA 2XT1B 2X7LB 2Y36H 4H8WC 5CJXA 3VWKD 4LLWB 2IAMA 9CGTA 1BREA 2BJML 3K8LA 4G3YH 1BECA 2HG5B 4L8BB 4V1DD 3QIWB 4HH8A 4JQIH 3R06A 1D5BA 4NO5A 5INCB 4JRXA 3C5JB 4HIIA 3VWJC 1OARL 3RVXD 5IESH 5BRZA 2YXMA 2IH1A 2QR0A 4JHWH 1UXWA 5HDOA 4YO0A 1A8JH 5SWZA 3CD4A 2X4OA 2CKBH 4YDJA 5DEGB 4C56B 5ADPL 4OSUH 3ZDYF 3QUKA 4Z18A 1I9JH 4OD2B 5EOCL 4Y2OA 3S36X 4NM4H 3FRUA 3CZFB 3MA7B 3AFLA 2R1XA 1UA6H 1NGZB 3SDXE 3TWCH 1A9BA 2HKFH 5HI3D 1W0VB 3BQUA 1KC5H 3FT2A 4LEXL 1WIOA 4PJ8B 1MJ8H 2OR9H 1BOGA 3GO1H 1IEBA 5CJBA 2I5YH 5C0AE 4CJ1A 4ZUSA 2FJHA 1V3JA 5EZJB 1I7ZA 1UM5L 5TGBB 3H9HA 3FRPA 4PJXE 1NQBA 2QSQA 2F58L 1NFDA 4AT6A 4JKLA 3UTQB 1J0JA 3T77A 4QY8B 4NZUH 4D3CL 2UZIH 5EU7E 4LKXA 2YBRB 3DROB 3PGCB 4LRIC 1CDCA 3ES6A 1QSFA 4XPHL 1P5VA 2IG2H 4JZJA 4G5ZL 2DQGL 3SDCD 4OLVL 3HPJA 1YN6B 1EV2E 5F9AC 1RJYB 2O5YH 1NCWH 1R3LB 3MUGB 4Y2DD 5DK2A 3O6FC 2VZUA 4QHNB 4RMQA 2EDFA 4XBEH 4F7PA 2OSLA 4OZGA 1CXKA 1JPTH 1CS6A 3AROA 1P7KB 4I77L 3C60B 4WI4A 4Z77A 5C0GA 3R1GH 1ZT7A 1IM9A 2O5ZL 3I6GA 3MA9H 1E4XL 4W68A 2VDOL 1A1OB 5DR5L 5HVHB 4N0YL 4ODUB 1K8IA 1VESA 2ZUTA 3LV3B 4U7KA 5KSBB 5DFVD 3C6LB 1H5BB 3BPNB 4YUEH 1H3UA 1AHWB 4H0HB 3FO9A 5FGBA 2MCG1 2OXHA 1HHHA 5E9DB 3X13B 5HJ3B 1JWUB 4J3TA 3DGGA 3FCTB 2VLRD 3ZDZF 5DS8B 1UT9A 2VLLB 1S7XB 3PL6A 1OAXH 3MOBL 3UPRB 1XH3A 4GRLD 3W9DA 3KPPA 2M2DA 1EFXA 4I0CC 4PJCF 2K7PA 4NSKA 2EE9A 3X14A 4GW5B 1FL3B 2DTML 5JW4N 2EC8A 4G6JL 1FFNA 4MA3A 4AEIL 4YHOL 5D4QA 3ALWA 4BKLB 5AD0A 3VXTA 4HJJH 5FYLE 2LE9A 2YK1H 4N90E 1FVDA 4N0UA 4JFQA 5J3HD 4N8VB 2L7JA 3VWKB 5JUEL 4U1HB 4FFYL 4QCIA 4V1DB 2VR4A 4CNIA 4MJ4A 4XZUA 1OVZA 3SE9L 5D6CA 3VFNB 1OOAA 5K9OB 2HWZL 2NXZD 4YHLH 4ZAKA 4CU8A 1FORH 4XNYH 5MEQA 1FAIH 1N5AB 2YA0A 2X4TB 4WGVB 1RUKH 5D1QC 2DQFA 4LASH 3MLXH 2NXYD 1TJIL 4DVRH 1HIML 4PRAA 2UUDK 2ARWA 3NIDE 1MCOH 1R3JB 4GW1A 1KLGB 4MX7B 4Y8DC 1NMBL 3ZYZA 1OM3H 2BRRH 5FYKE 1A1MB 3AY4A 5MERB 4JEGB 5T33L 1MWAH 1OP5K 4MXQD 2HFEB 5EWIL 5L2KE 1MRCL 1EAPA 1CT8B 3PF2A 3HG1B 1DL7H 1QBLH 5I19L 2EDXA 3QJHA 4TPRL 1H15A 2B1AL 2FB4H 1O5DT 5HI5D 3TYFA 1INEH 1JGUH 4PS4H 3MGTA 2WW8A 1MOEA 1ACYH 2CDEB 35C8L 1F6FB 4MDIA 5BS0E 1CVSC 4NO3B 1CU4L 1WVZA 4ODWA 1X9QA 1SM3H 2ITDA 1T1WA 3PWNA 5I75C 1DBKH 1QKZH 4K3HA 1FIGH 4EI5C 5L2JA 3C2AL 5ITFB 2ZG3A 3OKNB 2H8PB 3KYMB 3LRGA 3BP4B 4RDQG 3SDCB 5EO1B 3LMJL 5CCKH 2FYYB 2JJSC 2Q7YB 4YHNB 3CXDH 4Y2DB 1Y18B 2B39A 1U8IB 2X4NB 3KPQA 4OV5A 2X9YA 4MQ7A 2VSDA 2XN9E 4QEGA 2F54E 1JZ2A 4GQ9H 1OQOA 3L3HB 3DX6A 2EEBA 4TTDC 5J7CC 4BH8B 3CXHJ 1NCUA 4TSCL 3QDJE 4HMEA 1YA5A 2R2EB 3MJ7A 3GKZA 2DLTA 3DUSA 3V0VB 1ZWIA 1AO7D 2CUMA 4L8SB 1RUAL 1UM6H 3VI3E 1NUDA 5DHVH 1CGXA 3GSNB 1EK3A 5FO9B 1ND0A 1B0GB 3MRDB 3NTCH 1EH9A 1FZMB 3IJSB 3OKMA 2VLRB 4TRPH 3V52L 3V0AC 1F58H 2WQRA 2J8UE 2WUBL 1OLLA 4MVBD 3L6FA 4WENB 2J88H 5DJ8B 5JIPA 3QHZH 5DJYA 5DQJB 5IQ7H 1KENL 3I50L 3MRIA 5ESVB 1QVOA 3ZE2F 1I1AD 2E9IA 1VFMA 4M6NH 4PJBB 5ICYA 1F4HA 5JPMB 5D6DA 2VR5A 5IT2L 4JO3H 5GGRB 4UT6L 4XI5C 1Q0YL 1TTFA 4YC2C 4MAYC 3KJ4C 2VLKE 4IDJL 3RX7A 4KVCH 4I5BA 3MYZA 3MPCA 4LLUB 2FWOA 2WLYA 3H3BC 5HPOA 2CR3A 5CILH 3MNZB 5C07E 3WFBH 2ZOLA 1AP2A 2YD7A 2NXZB 4QOKA 1HK6A 2VLJA 2E6JA 4EBQH 3VW3H 1WITA 4G43B 1T2QL 4QRSA 4MJID 5L7XH 4P2QD 1W72B 3BKCH 3N50A 1X5XA 1FGNH 1UZ8B 4JY4A 5GJSL 3JTTB 2JK5B 4LGPB 3REWA 2Q3AA 3K0WA 1MI5E 4JFFD 3ARFA 4HG4K 2IQAA 4GG8B 5DQ9A 2BDNH 1RIUH 4OIIH 3HRPA 3BPCB 3FO1B 2RB8A 2DQJH 2DBLH 3P3YA 4S1RL 4JN1L 2MCPL 1IEAA 4MCZA 1EMTL 2YN5A 2DBJA 2V2WB 3HZKA 4L8DA 1J88A 3LZFH 2WLZA 5E8OA 1DN0B 4DZBA 3LEVL 2VC2H 1YZZA 3MMEA 2BNQD 4D0BB 1EJOH 1KN2L 1MJ7L 1JMZA 1KB9K 4YWGL 1K4CB 2DWEB 3ZYIA 1A14H 4XRCB 2RCSL 1T6WA 3CFJB 1N6UA 5IVOA 3HE7C 4AG4H 3LQMA 1FFPA 3VFMA 3FQTB 4LEOB 4XMKL 3SHSA 3RNQB 3JWDH 4PG9B 5L6YH 1JJUA 2NZIA 5D7JA 5C0DB 3QG7L 1OTUD 1CGYA 3WE6A 3QUXD 3CMGA 3WCYA 4EN3A 5CSGA 1VADA 1N26A 2HVJA 3TO4C 1KFAL 1NAMH 2Z91A 4L4TD 2LTQB 3VFUA 1TNNA 3L1OH 4HWEL 1J1XH 2AK1L 4TNWK 3VRJA 1I9IH 1MHPH 3CVHL 3MLZH 1QACA 1KULA 2ICCA 3AVEA 3VXPB 3BH8A 4AM0A 4HWBL 1F02I 4IMLB 5KTEL 1TCRB 1LD9B 1FLTX 3QCVH 3HI5L 2JIXA 1G7LA 3L3GB 1P2CA 3HNVH 4MDJB 4ZSOE 4GRWF 1QOKA 2FGWH 3DX9B 1AO7B 2ARJB 4P23A 5C0FA 4NJ9L 1G7IB 2DQIH 5B39G 5F7WC 1N2RB 3CC5B 1YMHB 5F89B 3VI4E 1S7VA 5ESAA 3ARBC 2NY1C 3H7BA 4FQXD 4TVSa 4DOHB 2X9WA 5BV7C 3PDOB 5DD5H 1JE6A 4KK6D 3U0WL 4AH2A 3HPLB 1EPFA 3OKLA 1I7RB 1C16B 1QSED 3WIHL 5D5ME 1XGYL 4M4PA 4S2SA 1A4JA 2Y6SC 4OF6A 1LO0L 1I1AB 5FGRA 3ZE0E 3PGDB 2ZCKH 4KZEL 4X7EC 3OXRB 4F15C 3U7AA 3KYKH 3C6SB 1DQLL 3X11B 1BFVH 3QQ9C 4PREB 1PD6A 1U8PB 2AP2A 43C9B 1QZ1A 4U1NA 5D1QD 4R96B 4LFHG 4PJHF 2E7CA 3RI5F 5HDQL 3QWOB 4PRBB 3MLVH 1IKNC 3TESA 4FRWA 5TFSH 4NFBA 5IBTL 2YKLL 1UJTA 4LIQE 4MXWH 4Y4FA 4BQBA 1IQDA 3UTTA 4WFHD 3GSRA 1RURH 4MJIB 3D18B 4RFEA 4WCYH 1FYHB 2GAZB 5EU6D 3VXUB 1KT2B 4ZFZA 3VFGL 1A9EA 2LFGA 2W59A 1QP1A 4JFFB 3X3FL 1GZPB 5B38A 3K46A 4G6FD 1MHCA 4FQHA 1VFAA 4P3DB 5FGCB 4O5LH 2IWGA 1A6UL 5EO0A 3U0TB 2E7HA 5GGVL 4ZFFB 3TVMD 2VO5A 1CDIA 1RZGB 1MCFA 2Y36L 1T2JA 4OJFL 3TNNA 5T5NF 1NBYB 4HCRA 4LCUB 1SYSB 4G3YL 1S5IL 4I2XA 3EO9L 2BNQB 2BSSA 5FHBH 3P4OA 3T2NH 4HFWA 4U0RB 4O2EB 4ODTL 5IESL 4JG1H 1G0DA 1AXTH 5E6ZA 2G5BA 4JHWL 4A6YH 4KROD 3OKYA 1OPGH 5IEHB 3VWJA 4Y89A 1KBGL 3QAZC 2AV1A 4PRDB 5K9QI 4QRRE 4AIZA 5J12B 1MAMH 2AV7B 2CKBL 5JOPE 5E95B 4OSUL 3EOBA 4OCWH 2PYFB 1TVHB 3B2UC 3QUXB 2FECI 4PP1C 1NGQH 3BT2L 3TWCL 2HKFL 3CSYB 1KC5L 5EZOL 3HB3D 4L4TB 3H9SD 5HD8C 1RK1A 1MJ8L 3GO1L 4P3CH 1QFOA 2I5YL 2UYLA 4KK8C 1DBBH 5LGKA 1FLRH 2IPTH 3IDUA 1GGCH 3I6KB 5CFHA 5I8KH 3FB6B 1FV1B 2VSCA 1X5YA 4NKIH 4WI8A 1L4IA 1ACZA 4J3OC 3O41B 4B41A 1KUMA 2IFFH 4Z7VE 1EVTC 1IGFH 2D7OA 2M1KA 2PYEA 3HA0A 5HDBE 4WV1C 5E8NB 4NZUL 3SPVA 1Y0LA 5DMGC 2VJXA 3O9WD 1CD9B 1CLYL 4PJHB 2XTJE 3GBNL 2EE6A 4LRIA 2NY3C 3F7VB 1N64L 5E99H 5CINH 4BFEA 5DRWB 3EYSH 4JHAL 1Q94B 4IRSC 1ZEAL 3KPSE 3RNKA 3LS4L 3O3DB 2O5YL 4KK9D 4FQXB 1A5FH 4MAYD 2AJXL 5I0DA 3GSOB 1U41A 1QLRA 2QL1A 2V7HB 1JPTL 1G6RA 1QSEB 2XPGB 3OZ9H 4ZYKB 1UWGH 3KYAA 5MEND 3R1GL 1E4JA 4HQQL 5H35B 1T83C 1FE8H 4MCYA 3DSNA 4NKMA 4ZQKB 3QQ4B 4P48A 4WTZA 3DYPA 1EO7A 1YC8A 3IFNH 1OAQL 1T7VA 5IBLC 5B8CB 1ZLUK 3GBLA 5F6IC 1I3GL 2Q8BH 2CD0A 4YUEL 4W81A 3RGHA 4H25A 4HWNA 3W81A 2YD3A 5IW6A 4U6TA 2EH7H 3GMPB 1U3JA 1RUPL 4FQ2H 4TUJB 3IVKB 1SJEB 1CZ8L 1YQVH 1BQHB 5C3TA 5TH2B 1ZGLB 1S8DB 2A9ML 4HUWA 5TE6L 2QTEA 3O8XC 3MJGX 2B4CH 3B9KD 4K23L 2EDLA 4OF3A 2W38A 2ZSWA 3N85L 5EU6B 3MR9A 3NFPA 2YMXL 4BSWB 2OTWB 4R7DB 1BZ9B 1T21B 4NZTH 3SE8H 2C9AA 2VZ1A 4K7FB 3EDDA 5J4MA 2YC1B 2VAAB 1T3FB 4G6FB 3W39B 5CBEB 2XQYK 3U4BH 2YK1L 4ONGH 4QWWC 3IXTA 2F53E 5IV2B 4HX1B 5GIRB 3QDHA 3IU3B 5EU7C 1RJZA 3HE7D 3TVMB 2RR3A 3LD8C 5HVWA 1INDH 4Z0XB 4EIZC 2R29H 4H88L 2VXQH 5SWSE 1S7WA 2EEDA 5BXFA 3LH2L 1GPOL 3VFPA 3D39A 3V4VH 2AK4A 4XNYL 5DUBA 3ROOA 1JF1A 5DHYA 4GXVH 3ULSB 4KROB 2GFBB 4LASL 1I8MA 1JYXA 2DWDB 3I6LE 5F6HJ 1TZHB 3TC9A 3RVVD 4BM7A 3BP5B 2A0LC 5CWSA 2H26A 5JOFB 5MEOA 2PTUA 1J0IA 1R3IL 2YSSA 3L3OB 3SGJC 1U91B 4AEHH 2R2CA 4MNQA 3VXOB 1OTTC 3BGFB 1OM3L 3LEXB 1IGMH 3LDBB 4JPKH 4I18B 2I07B 3DETC 3CFKA 4LCYB 4LAQH 2ZUUA 5DTFA 1MWAL 1IGTA 1SVZA 2BSRB 3UAJD 4G7YH 1BMGA 4G9FE 2CIIB 1OLZA 4MJ5A 5HHNA 1VGEH 1DL7L 4DN3H 5L0QC 2FB4L 5GZNC 4PR5B 1QSZA 1YMMD 2N7AA 1RK0A 3C9NB 4PS4L 1KIRB 3NPSC 4XAWH 5ICZA 1KIQA 1NGXA 1DSFH 4ONOA 4KKBC 1U0QA 1OY3B 4HUMB 3O2VH 1SM3L 4NQDA 3V7MA 1BJ1H 1ES0B 5EBLB 1FIGL 3S5LG 4ZG1A 3NOIA 1F00I 2Y6SD 3O9WB 3PHOB 4QHMB 4D0CA 4F57H 4P2CG 3QEQE 4KTDL 5GRJH 2VITA 4YXKL 3BZ4B 1ORSA 2OZ4L 4P2RD 1T1ZB 3CXDL 1DDHA 4E42A 3O4OC 4EZMA 3RTQD 2JJSA 2X4UA 1J0ZA 5C2BH 4KPHH 5DJZA 5LAXA 5DMKA 4GQ9L 4PJGA 1YY8B 5MENB 4OT1L 2P8PB 2BHZA 3RDTA 4FTVE 4P2OA 3RWJB 3KXFD 5EOQH 1T0NB 2BVPB 5C08E 1XMWA 3L7FA 4QXGL 5HHXH 5J6GB 3ZYOA 3MRQB 4XVJH 3VXME 1UM6L 2DI9A 5IEKB 1CDHA 1AGDA 1KJMA 3OWEA 1H3PL 1KXVC 3G6JF 5K93A 2NY6B 1JVKA 4OZFH 4TRPL 5DJCB 4X4YA 5IB3A 4OF0A 1UJ3A 3GSXA 3TZVD 2HJKA 5IVXF 3UP1A 5DD6A 4DW2H 3BPOC 1WF5A 2RFXA 2J88L 3BHBB 3PHQB 4KK5D 1T03L 5GHWH 1JTOA 3QHZL 1S9KC 5F3HB 1NEZA 5E2VL 4X7SH 1GGUA 4GW4B 2JJWA 1Q9KB 4K71C 4JHBA 5GS2D 1GC1C 3MCKA 4DGYL 1HQ4A 3B8YA 4JO3L 2J12B 3HC3H 3ARTA 4JY5H 2IAMD 5FV2A 3MRKA 3F6LA 4TOYL 2APBA 4KVCL 1KCKA 4E0RA 1ORQB 5IMLA 3X17A 4MB4A 1QLFB 5DQDL 5GS1C 4ZS6D 3VE0B 5C0JA 1MHEB 3BFOA 3AM8C 5KVDH 3NCYS 3PP3K 1QA9B 4EBQL 4KTYA 5SX4H 3D48R 3QDGE 5L7XL 2ORBH 2WV3A 4ETYA 4HGKC 3TPUA 4FN0A 3D0LB 4P59H 2EDOA 1ZS8B 5FUZH 3Q3GA 4OCNC 1JPSH 2GEEA 4HFUH 3BQUD 4QKXB 4H5SA 1U93A 2DQJL 5J1AB 4PV9B 1T5WA 1WCBB 3SDAC 1BAFH 5E6IA 3E3QE 1NGWA 3CK0L 2X4QB 1MFCH 1TQCB 3D3VE 4QHKI 3R0NA 5H94B 5DJAB 2VC2L 1WIPA 2FEDD 4G6AD 1EJOL 4KJWD 2HMIC 3QDMA 2GI7A 4G80B 1JTPA 4ENEC 1YMMB 1S7UA 4IRSD 5A40E 4OV6F 1A14L 4AJ0A 1I3RA 1PY9A 1QSFD 1N6VA 3P0GB 3CDGA 4G8EA 3UZEA 1CL7L 1MELA 2FD6H 5IFJA 5HVGB 1H3GA 4WUUA 4JDTH 4NQEA 2P7TB 5F1NB 3OXSB 2RAMA 1UCBL 4R4BA 2GK0B 3J7HA 2XA3A 5TE4H 3G6JB 3QUMA 4G8FA 3P4MA 1A47A 5DD1H 4NFDA 1HOCB 5BVPH 4P2RB 1EEYB 2WIIA 5IVXB 2VDNL 4WRLA 4LVHB 4OKDA 2DQHH 2BMKA 3RTQB 3QZWB 5JR1H 4YFDB 1VGKA 1BD2A 3HZMA 1MHPL 4KVNL 1J10A 3MLZL 1NFDF 2OJEA 1KIUA 3QEGH 1X5ZA 1JK8A 3U1SH 2VDRL 3QCVL 4F7EA 3T4AB 3AREC 4G8GA 3HNVL 2P5EB 4LSPH 2HN7B 4Y4KC 5LCVH 1A7RH 3NAAL 5BCAA 3ARQA 3DI3B 1GCFA 4ZD3H 3U9PH 2PO6C 2AI0L 4XC3L 4L8CA 1C08A 1E0OB 1MLBA 1PYWA 2BOCB 3D85D 4CW1A 5DRZA 1HKLH 4X98B 1U92A 3F7YB 4NHCH 1W2KT 4KRPD 3DVIA 5ACLA 2BXZA 4JGUA 4D0DB 3IDYB 1D6VL 3MRLB 5KS9A 2EXYD 4QXTA 3TZVB 3D69B 3UC0H 1QRND 4M8VA 2H3NB 4OBSA 3T65A 1J12A 1UZ6E 2VDLH 4KAQH 4O02H 4OFVA 2QV2A 4MNGA 4ZPTB 1SY6L 3REVB 2YD5A 5IFAH 1V3MA 3Q1SH 3TA3D 2Y5EA 4GAFB 5DYOA 5C0CD 3D9AH 1MAJA 3TEUA 2IAMB 3ZKQD 1BFVL 2E27L 1DUYA 1E6OH 4OQTA 4V2BA 1FNLA 1KLFA 1NBVL 1D5BB 4NO5B 3MLVL 1KTLB 4JRXB 4ZAKD 3CH1A 4HIIB 1IAIM 4X6BA 5BRZB 2IH1B 2WM0A 3MUHL 3H9YA 3ULUL 4YO0B 1IKNA 4X9GA 2R2BA 2GT9A 5SWZB 1RURL 3CDFA 2HT2C 5D9SA 5I73B 2X4OB 1NCCH 3MNWA 3MV8A 2DJSA 3IJHA 5J89A 5DJ6A 1J87A 3QUKB 1VPOH 2AEQH 1XF5A 3FRUB 2RHEA 3NZHH 3MCG1 4MA1C 5GZND 4GAYA 1A9BB 3BQUB 5FOJA 4OGAC 2HKHL 3EYOB 3ZKND 3FT2B 2GUOA 5SWQB 2CLZB 2VH5H 2HRPL 1BOGB 1IEBB 1UFUA 4FXKB 2ZUVA 3O3EA 1TJHH 4KKBD 2FJHB 4ZUSB 1I7ZB 2AJZA 1AXIB 1JPGA 2MQ3A 3GM8A 3H9HB 3G5YA 3MRJA 2X4PA 1NFDB 5DURD 5LWYH 5CMAB 3DMMA 5MI0B 1WICA 3BZDA 2YEZA 5IGXH 2XICA 2XOTA 4LKXB 1AXTL 3ES6B 1QSFB 1YJDL 3HMXH 3ILQD 1M6OA 1ULVA 2YA1A 3OR7A 4A6YL 1OPGL 4PJDA 4RX4A 1MCCA 4KKCD 2MMXA 3Q5OA 5FK9A 5EBGA 1MAML 3ZSTA 2B5IC 4RMVA 2V2TB 1CQKA 4OCWL 4LPVA 1HEZA 1F97A 2C7UA 4KJQD 2G2RA 2V5YA 4R9HA 2OSLB 4F7PB 1NGQL 4MA7H 5HYSG 5IG7A 4N1HB 4NN7C 3QRFM 1M7IB 4P3CL 3SEPA 2A9NH 3OHXA 1IM9B 1GGCL 5GPRA 4Q7DA 3OSKA 3W9EA 1K8IB 2BX5A 3WO4C 4NWUH 1U95A 2IFFL 3VA2C 2YPKA 1MQ8A 3UTZA 1RFDH 3HC4L 3FO9B 4M6ML 3QQ3A 2EKJA 4QGYA 1F4AA 2BY1A 3DGGB 3D85B 3VFTA 4IDLA 4TQEH 1A6ZA 3KDMA 3PL6B 5FFLA 3IRZA 3MRFB 1F3JB 1XH3B 4HS3A 5E99L 3P9WB 1DEEA 3W9DB 2BOBB 3EYSL 3FQWA 3SQOL 3KPPB 4JRYD 1IFHH 1ZHBA 4KRPB 3MOQA 4XPTL 5FCUH 3AMLA 1A5FL 3P11H 1RZJL 3PP3H 2WUCH 3X14B 3C5SB 3WFCH 4Z6AT 3NH7H 1CICC 5GSVB 3BEWB 5JQHC 3TYGL 3OR6A 4RWYH 2MNUA 1FFNB 4MA3B 1DUZA 1UWGL 5AD0B 1AR1D 3VXTB 1FE8L 2BP3A 1A3QA 3F12A 4XCCH 4N0UB 4ZFOA 3TA3B 3TFKD 5GRZA 4X6DE 4PGBA 2X6MA 5CHNA 4YPJA 5GRYA 2Q8BL 4QCIB 3S88H 5F9WB 4CNIB 4XZUB 1DE4B 3A6BH 4WFEE 4NN6B 4XP6L 4ZAKB 3V5HB 3VH8A 5MEQB 4G6KH 2VLJD 5DI8B 1TNMA 2JB6B 1PDKA 4HK3N 4U6XA 1XIWC 4Y1AD 4U4BA 1HILA 4QRPE 4PD4K 1IGYA 5E5MA 3OPZH 1NGPH 4YBHA 2ZNWA 2D7PA 3DUUA 4LSUH 3PNWA 3ARFD 3HRZA 4PRAB 3VMPA 3SDXA 4JG0H 4ISVA 3TV3H 1LP9F 4YQXL 1VKXA 5IB5B 2WBKA 4GW1B 4DKFL 4OZHE 5AAWA 1HN1A 4U2ZA 1S78C 4HF5H 1A3RL 5C0AA 3O8XA 3DUHA 5IROA 3SGDI 4WDIA 4Q58C 5GS0H 3QFDA 2F19H 4R8WL 4PG2C 2D7MA 3RI5K 3MJ9L 1CGWA 4WU7A 4XHJC 4PJXA 5CIPH 5JO5A 5JXAH 1FO0H 4M8QB 3QUZA 2C3WA 4X83A 1NMCB 5DGQA 4EDXA 1H15B 2HLFD 2QLVB 4RMRA 3TYFB 3P9LA 2VDPH 2VXQL 4X5WB 5F9DC 3WEXB 3OKEA 1NUFA 3NGBC 5DURB 3MRGA 4O2FA 2H9GB 5FM8A 4KUZH 4MDIB 1W72H 4ODWB 2ITDB 1T1WB 3PWNB 4W4NA 1HSBA 5HGHA 3SGEH 3O3AA 3P30H 5L2JB 2ZPKL 3S7GA 1QD0A 2A6KA 5DVMA 1LO3H 3NIFF 2V6HA 3AAZA 1GGIH 3P0VH 5I1JL 4QRQA 3VGEA 1YEHL 2VN7A 4PP2B 5J56B 3GI9H 1JYVA 4FXGA 4O4YH 5GQBA 3DO7B 2VDKH 3MOAH 4Z0BL 5JW3L 4WW1A 1M05A 3SGJA 3DX6B 3FN3A 4G7YL 3S34H 2VISA 1MFDL 1KGCE 3MJ7B 4IJ3B 3WL9A 1EGJH 3VG9B 1ZWIB 3CX5J 1NUGA 2UWEE 1W8NA 4CMHC 3WUZA 4JFYA 4K2UL 4OCYH 2YUXA 1ZLWK 4QHLA 1ND0B 1A1NA 1Q72H 1TLKA 4LPWA 2OL3B 4ZS7H 4LDEB 3W2DH 3MLYH 2MPAL 1UH2A 3RGVC 1KJ3L 1JGVH 2J5LB 5GS3A 1JI2A 3GRWA 3L6FB 5DEFA 1NCBL 1RD6A 4M43L 3MRIB 3WD5L 5DT1H 5I1LA 1QVOB 4OF8A 5J1SC 5ICYB 1DQTA 2IPUK 5C2BL 4KPHL 3K2UH 3BDYL 1LP9B 4LLVA 5JMRA 1G0YR 3QG6A 3FZUD 1RZ7H 1MEXL 2CDGA 1Q9OA 5EUOE 4OB5L 4YDIL 3M1BA 3KPLB 4I5BB 1JF5A 4JZOA 5HHXL 1BIHA 2YOCA 2IMNA 1WBYA 2FWOB 4XVJL 4ZUTB 1A2YB 3P4LA 1MCWW 5CUSL 5FYJD 2ZOLB 4XNUL 1AP2B 4YDLC 2BFVH 5T5FH 3UTTD 3WYRA 2VLJB 3A6OA 5GGQH 4H8WH 3VMNA 4WEMB 4Y1AB 4DW2L 3U36B 5FGSA 4JY4B 2NY7H 3MRHA 3CLEH 3JTSA 5GHWL 1CVRA 3ARFB 4PJEE 4UTBH 2LVEA 5DQ9B 1PAMA 4HV8A 1RPQA 3H42H 3IETA 5FF6A 3M07A 2FO1A 4Q0XH 1MUJA 1URLA 4MCZB 5L2KA 2EDNA 5DUMH 4L8DB 5M94B 5E8OB 1IARB 5DK3A 4MXVE 4DZBB 3VGDA 3MMEB 3MUY1 2ERJB 5BS0A 3T2OA 1KB5A 5E8EA 4J6RH 1QFPA 3WIFA 1IAOA 1ZHNA 3LQAL 4NN5C 1HE7A 2V5MA 4XMLL 3RWHA 5D1ZC 2DIAA 3U46A 4Y19E 5KVDL 5HBBA 1FFPB 2EE3A 3VD5A 1OTSD 3VFMB 1KELH 3AC0A 1A7PL 2GCYB 4TTGA 2EYRB 5DA0B 1YNTA 1PZUB 3FO2A 2ORBL 4G8IA 3VCLA 4B5EA 4JB9L 3WE6B 5JORA 1CWVA 5F3BA 4P59L 4NQVA 5FUZL 3VD3A 4EN3B 3IDJA 3B5GA 4I3SH 2JJVA 3WSQL 1VADB 4HFUL 3WNMA 1NJ9A 2FHCA 2XN9A 2Z91B 1WISA 1OAYH 4LF3B 3EOTL 1CDBA 5AAMA 2CPCA 3STZA 3VRJB 4ORZC 1MFCL 4F7TB 3HAEA 3T0AA 4G42A 3QDJA 4RRPA 4AM0B 1KCVH 1Q0XH 2RQ8A 4EKXA 1RIVH 3ZHLA 5EU3A 1G7LB 1YEEH 1P2CB 3BUTA 1G6RH 4GRWH 4PRIE 5EPMA 4Q9RH 3SE4A 4HIEA 5IHZA 2UY7A 4GBXC 4P23B 1JN6A 1BVLA 3NACL 1JV5A 4YIQB 2FHFA 3VFSA 3KYOB 4ELMF 1P4BH 1OCWL 1YEDA 2H2SC 2J8UA 4JDTL 4DFIA 1EBAA 1S7VB 5ESAB 1C5BL 5B3JF 3MRBA 2WINA 3EYUL 4OLYH 1X5AA 3UDWA 1U8JA 3RKDD 1RZFH 5TE4L 5TF0A 1ZK9A 4JFZL 5IR1A 3CCHA 5BVPL 3RVWC 5E5UB 4RAUB 3TIDA 5EN2B 2DQHL 3LKSA 3GMMA 3KGRA 4N5EC 4OGXH 5JW4M 1CDUA 4R7NA 1MNUL 1A6PA 5FB8A 3FB8A 4EUPH 2W0PA 5I8OH 4R97B 2VLKA 2GJ6E 3QEGL 4XPAH 4HKXA 2P1YA 4L5FL 4XP1H 4LSPL 1CFVH 2YZ1A 1HNFA 2BZDA 4NO0A 4POYA 3S8WA 1J1OL 5C07A 4P5TA 2A73A 1SYVA 1HINH 3U9PL 3AREA 3WFDH 1P4LA 3JV0A 2BNRE 4Y4KA 2Z0BA 2HP4A 5I18H 2EDKA 3WFHA 1IC4L 1B6UA 2PO6A 1OAUH 1MCBA 1UKTA 5E8PA 4NHCL 4L4VE 1IQDB 1CR9H 3UTTB 5C7XH 4NP4H 3ULVL 4QNPE 4XP5H 1MI5A 2Y07H 4O51A 1WK0A 2DAVA 1OSZA 1G0XA 2Z35A 1A9EB 4O02L 4KAQL 5A2KH 2J8OA 1MHCB 4FQHB 4Z7WE 1VFAB 2X1OA 3I9GH 1UXSA 3MFFA 3ZDXE 4Q74A 2EDQA 2QKIA 4HEME 4J4PC 3Q1SL 5EO0B 2HTLC 5MEPA 3TNNB 2Y5TB 1P4IH 3BKMH 2D4FA 4LP5A 2X4RA 5D2NC 1MAKA 3GUTA 3KNBA 2Q76A 3WBDA 5HHPA 5HYFA 4I2XB 5INDA 1GIGL 1RIHH 5C0IB 4HZAA 5DRNA 5F7MC 3LN9A 3P4OB 3D39D 1S3KH 1ETZB 3B2VH 3WMSA 2R0LH 1HXYB 1KCLA 3UO1H 4LCWE 2W60A 3JUZA 3I2CL 3MLPA 4TN9A 1AD0A 4WJ5A 4WVRA 4JCMA 3LRSB 4UDTA 1WJ3A 4FABH 4KMTL 1WTLA 4KHXL 1ZLWH 3S3JA 1UEMA 4Y5VC 3EOBB 3O2DL 1FZOB 4O58L 1BHGA 2GJZA 3AB0C 2BC4A 3E6HA 3NZHL 4FQLL 3TBWB 4MNQD 5DMJB 3ARYA 3RFZC 4OD1L 1BFOB 1MPAH 2YD2A 2IALA 2UYLB 1X6LA 1FC1A 1TJHL 1I8KA 1Y6MR 4PUBH 5JA8B 4MS8D 4NRYB 5E8DH 1WSST 4ZSOA 1J05A 4R2GD 3T0WA 4WFGE 4HXAH 2PXYA 2Q86A 2PETA 4M5ZH 1IC1A 3THMH 5HYEA 3IU4H 3RJQB 4M1CC 3OKKB 3T3PF 1S5HA 4NQDD 2LVCA 2QHLA 2ZUQC 4U6YA 5D1XA 1EXUA 4P49A 5I2IA 5E0QA 3IGAB 3TM6A 4JM2D 2VAJA 1K3ZA 4JO1H 1YEGH 2OMBA 1NCNA 3BXNA 2D7TH 2EDYA 3RNKB 5LGHH 4GXUN 4XH2A 3E2HC 1G7MA 2I9LB 4W6YB 5D5MA 5JPNA 4S11A 4L3AA 1CFBA 2I9TA 3Q6GH 5HGBA 1H3WM 1N8ZA 1L9MA 1QLRB 3QYCA 3VGGA 3N9GL 2BCKA 4KI5D 1AGCB 3TO2B 4M93C 3RUGE 3EZ8A 4ZTPH 1OAZH 5E1AA 1NSNH 3NFSH 3PP4H 4NKMB 4OGYH 3RDTD 4P2OD 1F2XK 2DQUL 3FTGA 3B4NA 4NWUL 2KUTA 1OT1A