4ZSOA

Crystal structure of a complex between b7-h6, a tumor cell ligand for natural cytotoxicity receptor nkp30, and an inhibitory antibody
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
MQIVLTQSPALMSASPGEKVTMTCSASSSVSYMYWYQQKPRSSPKPWIYLTSNLASGVPARFCGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Light Chain
publication title Crystal structure of a complex between B7-H6, a tumor cell ligand for natural cytotoxicity receptor NKp30, and an inhibitory antibody
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 50
structure length 214
sequence length 214
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zsoA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zsoA01
2W9EH 5EORL 3VWKA 3UZQA 5B39G 1AP2A 5IHZB 2OLDA 3H9YA 5GISL 2EDOA 1R3HB 2IAMB 3JV5A 2VMFA 4JO2H 2GK0B 1P69B 4MJ2A 3SKJL 2H32A 3FFDB 3MR9A 1Q72H 3NN8A 5K9QI 1MI5E 1KJ2B 1S5IH 2XQBL 1XEDA 3BX7C 2UWEE 4KDVA 4OT1H 1NGQH 2RFXB 2A9NH 4PYHA 2XIDA 5KSAC 5INCA 4OUUB 4U1NB 4PGCA 2NR6C 2IH1A 3ROLA 2A6KB 5ABDE 2BFVH 3QNYA 1G7QA 4H0HB 4OTXH 2E7BA 2ED8A 1AFVH 1J87A 4U1HB 3VGHA 3QISA 1ZGLA 2XNAA 1RJCA 4NWTL 1TJHL 1Q0XL 1NGZB 1CZ8L 5IQ9A 3HMXA 1GHFL 5D5MB 3O11A 3SDDC 5ACMA 2W1NA 2GT9B 3OXSA 1CFSB 3FO1A 1MLBA 4HUXA 4NO0A 2MCPL 5C0CA 4I0PC 3G5XB 3TEUA 1XFPA 2BNRE 2I24N 4LBEB 4XX1E 4G8EA 3H7BA 1HZHH 4CN1A 3HE7C 2NXYD 2A6DA 3HE6B 1IC5L 1MY5A 3NH7H 1DBJL 1PBYA 3QH3B 4R0LC 3S6CA 5JXEA 4QHUA 1B0WA 5LCVH 1X6NA 2D7QA 5JMRA 3H42L 4RGNC 3PQYE 4OD2A 3G6DL 4FQIL 1IBGH 5EU6A 1BPVA 4LSSH 3BSZL 3VFMB 3IS0X 1UXWA 1CBVL 3F7QA 5GPRA 1ZA3B 4KQ4H 5E99L 3T2NL 5HHVL 3MV8B 2PUQT 5D1XC 3CFIC 5E5UB 5LWYL 3LN5B 5E5RB 4U1KA 4ZNEA 3D0VA 1T80A 1UB5B 4H1LA 4D0DA 1A7OH 1LGVA 2P5WE 5FECB 4JKKA 5C07A 5CBEA 4DVRL 4IIQB 4WU5A 3RL2A 1DDHA 4OD1L 1RUKH 4ZFOL 3TN0D 5CSBA 5C08E 1MCQA 3KPSE 1DUZA 3SJVA 1JHKL 3GI8L 4FTVD 4R4BA 3OPZL 3FN0H 1P4IL 2J8UB 4PRIE 3OJ2C 4R8WH 2AW2A 1DZBA 4G7YH 1MJ8H 1FAIH 4TULL 1OP5K 3SKNB 2W9DL 3DVFA 4BUHA 1X4YA 2Q7YB 1IQDB 5C71A 3WNLA 4Y4KB 3P9MB 2I60H 5GIRA 4JY5H 4AT6B 1MELA 1JGEB 5DT1H 4MCYB 4LSPH 4GLRI 4KMLB 3HZMB 2GUOA 1CTNA 5IBLD 4RFOL 1BIHA 3C5JB 4G8FA 5SWQA 1UZ8A 4Y5YA 3TNMB 2XQYG 1F11B 3TO4B 1U95A 5JA9A 2GTWA 2Y5TA 3WFEL 1F2QA 3EJYC 1QSEE 5JLZB 3FB6A 4IJ3B 3LZFL 1QR1A 4LOUC 4KKLD 3AMLA 1RY7B 5EOTB 4G43B 1I1CA 4HMDA 3GMMA 3IU4L 3OTTA 3X3GH 1ORQA 3RZWA 5H8DA 1N8ZA 4G9FA 3QDHA 2KH2B 4ZUTA 3ZSTA 4LRIA 2VLRA 5J1TC 2CKBA 4PRHA 5D7KD 2QSTA 4JEGB 1YA5A 3BZ4B 3QJHA 5JPMB 1YMHA 4Y1AE 5J57B 1V7ML 4J3VA 5FO7A 1QHOA 3VRJB 1VENA 5BRZA 2VQ1A 4CU8A 2VDPL 2DRUA 4M1CD 2FSEB 2UY7A 1YY9C 3V52L 3KLAB 5E9DE 3L5HA 2I9LA 1LNUA 4UDUB 5EH1A 4MJIA 4ETQA 4X6EA 1CD1A 4S2SA 3IGAB 3JWNC 3VXRB 1UWXH 1LO4H 4XP9H 1I4FB 1JYVA 4YHMH 2H2SD 1HHJB 2EIBA 4QRPE 5DEZA 1IKNC 1ZOXA 2PCPA 2JJVA 4CADB 3NIGF 5IB2B 4LCIH 1RURH 1CLOH 1WC7A 4NO0D 5C0CD 2CUMA 1K2DB 5F1SA 1IAKB 1OPGL 4JHAL 5FYLD 1X5LA 3DHMA 3VWKC 4Q9QH 3LQAL 2J4WL 2UVEA 1CE1L 4PJAA 2QTEA 3IETA 4NGHL 2P1YA 2E7LC 1UWGL 5JXED 1DBKL 1QR4A 4DVBB 4YDKL 1T22B 1CFQA 4M1CC 3MRHA 5HYJE 5EU6D 4OZGB 4POZC 1UYWL 1Z3GH 3IVKA 3GSQB 3GBNH 2OJZH 4G5ZH 4KMQA 4F7TA 2H9GA 2N4IA 4AIZB 3WIIL 4HV8A 4UOW1 4U1LA 4LIQE 1U8IB 1FP5A 5EZOH 2H2SC 5E2WL 4NQEA 3L95B 4LU5H 3H9HA 4JKMA 4CL7A 4HGWA 4XNUL 1NCWH 4P23A 4Y7MA 4YFDB 4ZFGH 4G8GD 3U6RA 5C07D 3MRIA 5J1SC 5K93A 2PTVA 3UDWC 4HUUA 3RPIB 5ALBH 4KHTH 3R06A 2DLEA 3MCG1 2Q86B 3RUGF 4JO4H 1MRDH 5ESVA 5DMJB 3QWRA 4RWYH 4U7MA 4BQ8A 4XCNB 1YJDL 3SJVD 1AD9A 5E5MB 4QRRB 3MLVL 4PJXF 5ESAB 5LXGL 4XI5C 1OARL 3RWHB 4PJFF 4YH6A 4QWWD 1JP5A 3MXVH 3T4YB 3U9PL 4BZ2H 4FQJL 4L4VA 1DUYB 4NWUH 2XTJC 2XG5A 4M6OL 5JHDA 5IQ7L 4LSVH 3NIDF 2GITB 4J1UA 4XXDA 3H3PL 1Q9WB 3EHBD 4JANB 4LNRA 3SKUD 3EFFA 4N1CA 1DLFL 5I73B 4FQXD 2VDNL 3VFTA 4Y2DA 3EOBB 3VD4A 3CFCH 2QQQA 3CLEL 5DK2B 1WBZA 1FSKB 5I1HH 2ZUTA 2D9QB 4Y8AA 4DAGL 1V3LA 3LHPL 5GS0H 1DQTA 3ARED 3M17A 1HH9B 3IF1B 2AGJL 2WAHA 2DQCL 4YXKL 3RJDA 5JOEA 5B21A 1S9XB 1R0AL 5E8PA 1MHHB 5TGBA 4PJCE 1VPOH 1OCWL 3QDME 2YPLB 3B2UC 3WE6B 4PRHD 1JNHB 5CWSB 5CUSH 3UO1L 4HMCA 3BE1L 3T08A 5JORB 3KYKL 3G6JE 5DUMH 2BVPB 1EVUA 3L3KA 3HAEH 1A5FH 1U58A 3I9GH 5BRZD 3VG0H 5KSBF 3C09B 3BESR 3LDBB 3E2HB 3PWJA 2ENYA 4PUBH 1FYHB 4WFHE 2E6PA 1FBIH 1VGKB 5FM5O 3HS0A 2EDXA 4I4WA 3OKMA 1IKFH 2XRAH 3U30B 1UADC 2VL5B 1KJ3H 2CDGB 5C0GA 3C5ZD 1RUPH 1KB5H 3BXNB 4Y5YC 1MCRA 5LGKA 4D9RD 1G7PA 1YNLH 3RIFK 4LLQA 1A1NA 3RFZC 4Z7OE 1EFQA 1V7NH 4PTTA 3VDAA 3IDNB 3CGTA 5GJSL 4MD0B 5CEYB 2Z35A 4JFQA 1E4XH 2WK2A 4WV1A 4POYA 3O4LE 1LEGB 2DL2A 4M43L 5DGQA 5EU5B 4U2ZA 1T1YA 3U48A 5FDWB 4EEEA 2DIJA 3MUJA 3KPRB 5DJ2A 3MUY1 4G3YH 5C2BL 3LKOA 4I0KA 2VXUH 2ZPKL 1W72H 3N9GH 4XB8A 4D9QD 4A6YB 3ZT7A 5KSUA 3WFHA 2GQHA 3PNWA 4NIKB 1P84J 5ICZB 3GJFK 1A7BA 1HHHA 4GT7A 3O2DL 3WFCH 1WVZA 1T03L 1F6AA 4OZHA 2FHFA 5FYJL 5KSBB 1HXYA 2WBKA 4GFTB 4U6YB 3B2VH 3GSOB 3MZGB 5A40E 4UILL 1JHTB 1NBQA 1DEDA 5DJCB 3B4NA 3FN9A 1CGSH 4M5YL 3WFDH 3CC5B 4NJAL 4YHIA 1WBXB 4NP4H 2XN9E 2Y9RT 3WHXB 1Q0YH 4NQED 5C0EB 3WJLA 4XMLH 5EG6C 1JMXA 4HIHB 5JHLH 1S3KL 4QTIL 4M48H 5KTEL 3MUHL 3L3IA 3VRLE 4P23D 4RBPK 3PGCB 4WI8A 1BIIB 4RGMB 4ZFOA 4R97B 3DGGB 2MNUA 2WUBH 2YKLL 5B4MD 3PWVA 4CJ1A 4Q6IC 3TIEA 2WNGA 4X5WB 3KYAA 1ND0A 5IK3B 4Y2OA 2NY0C 5IR1A 5ENWA 1TDQA 2W9EL 4PJ7E 3WN5B 1X4ZA 2P44B 3GMNB 3QWRD 2EYTB 4M93B 4IMKC 2E3VA 3VFWA 4KKNA 1ZHNA 5KVDH 3AM8C 2AK4A 2ID5A 4FXKA 3N1QC 2BJMH 1CGVA 2Q7NA 1EBPA 4DTGH 4PJHB 3I85A 3SGDI 4HK3N 5I9QC 3PDOB 3Q5OA 4OT1L 3D69A 4L4VD 1IAOA 3CIQA 2A9NL 1T1ZB 5JHDD 3RVTD 2MWCA 3Q5YA 4BM7A 3LRGA 5AAWA 1JUFB 3MRQA 3DYMA 4OAWA 1JPSH 2BFVL 3V4VH 2FGZA 3IKCB 1AR1C 2Z93B 1ONQA 3JSSA 4WEBH 1AFVL 4PJ5E 4E5XB 2KDGA 4Y2DD 4YWGH 1IM9A 1OQOA 5I8EA 4NRYB 4Z0XA 4LKXB 1A4KB 1EGJH 4Y0GA 5IF0B 4HG4K 2NTSP 1NGXB 3H2WA 3O6KL 3L5XH 4YHLH 5DHVB 1HZHL 1AR2A 1W0VA 4F7CA 4DZ8A 1FNSH 4MNQA 1EEYA 3K2UL 4QRUA 5DI8A 3NH7L 4GG6B 1TFHA 2V9TA 5LCVL 1QFPA 1KPUB 2AXJA 2GFBB 3E3QC 4OZIA 3V4UH 1IBGL 4LSSL 3DROA 3HR5B 1SJVA 3BH9A 5IV2B 2RFXA 5DLMH 4UDTA 3ZKXB 4QF1A 4KQ4L 3HRPA 1OSZB 1GAFH 5HGGS 4TSAH 1Y0LA 2ADIB 3RX5A 3V6ZB 2HLFC 4JZJB 3EUUA 2Y4SA 5BQ7A 1TXKA 4RNRA 3QYCA 2Q8AH 2LVEA 4Y2DC 1K9TA 5T1DH 1Z9OA 1A7OL 2GT9A 2RR3A 3QG6B 4HFUH 3RL1B 2NX5D 1L7IH 4X6CB 4H8WC 4LBEA 1EMTH 1IGFH 3UTZB 2MQ3A 4L5FH 4IOFC 1RUKL 3MBED 5HYSA 1IEAB 2NY6B 3HE6A 1KEMH 2GSIB 2DQTH 1U93A 2HT2D 2OJEB 1CIDA 4X4XA 2D31B 3B43A 3MJ8B 2PYEB 1G6RH 1PG7X 4P5MA 3FN0L 3O45A 5MI0C 5HPOA 2XXCB 4R8WL 2A9MH 4G7YL 1FAIL 3C9NB 1A3RH 2DLGA 2AXFA 2ICWA 4UNVA 5D7IE 5TE6H 5CBAB 4OFVA 1W0YT 5DQDH 5HGHA 3SDXB 3LKSA 3BAEH 4G8GB 2F54A 2I60L 1UH2A 3MRLB 4L3EE 1PEZA 1L0YA 4JY5L 2QADB 3T0XA 5DT1L 4AH2B 4UIKH 4LSPL 3I6KA 1WJ3A 2OTUB 4OLUL 1HOCA 1B6UA 4I5BB 3ARUA 4GRWE 1HYRC 1UB5A 5J56B 2AXHA 4IRZH 2WP3O 3BWAA 2FIKB 4OGXH 4YO0A 5CAYB 4OJFH 5IB1B 1HWGB 1LO0H 3L3GB 4QYOA 5DS8B 4U1IA 1IGYA 3MPCA 4MQTB 2ERJC 3TIDA 1I9EA 2NY1B 3C60B 4F7PA 2QEJA 5FKPB 3LH2L 4P3DB 3X3GL 3P9WB 5FGBA 1ZT4B 4LQFH 1KFAH 1JVKA 3U0TB 1TLKA 3T2OA 4JPWH 2ADFH 2GY5A 2Y7QA 3WXWL 2AK4D 1QFWH 3D3VA 2YRLA 5BVPH 2A74B 1OP9A 4C56B 1D6VH 1KT2A 2FZ3B 5HHOA 3MRCA 1KXVC 4PJAF 4B50A 1KEGH 3TO4A 3FQXB 1ACYH 2IWGA 4XP9L 1T6VN 5JLZA 3OQ3B 4YHML 2BOBA 2NMSA 1SBSH 4Z78B 2OR9H 3R0NA 4G43A 3QZWB 2WV3A 3LVEA 4G42B 5DDHA 5D1QD 5IB3B 1INQB 4XVTH 3FO9B 4LCIL 1TJIH 1ED3B 2ITCA 1RURL 4NN7C 1CTOA 3GHEL 1CLOL 5FO9B 4FFVC 1A3QA 5JPMA 3NAAH 1M05B 1NL0H 3EDFA 5C2UB 5F9WC 1TQBC 4Z5RA 4Q9QL 3C5ZB 3O3DB 1HH6A 4MNQD 4RCAA 2Y07H 4KRMB 5IUSA 1IC7H 4L8CA 3U0PA 1NEUA 3C6SB 1QSVA 2V17L 4TTDD 4HIIB 2DICA 2JF1A 4HS3B 1X7QB 4Q6YA 4AQ1B 3F6LA 4KROC 4F58L 1EBAA 3CFJA 2YBRB 4BSWA 4GG8A 3VXQB 1Z3GL 1D6EB 4HIEB 4CNIB 3GBNL 2OJZL 5EIIA 3MYZA 4QXTA 3PP3K 3CU1A 4X8JA 4A2MA 3HI1B 5EZJA 3RWGB 1MHCB 3LV3B 4JZOB 3HUJE 2Y23A 2VITB 2JTDA 3QUXB 5EZOL 2ENSA 3BFOA 4LU5L 2AV1A 1E0OB 1T66C 3DETC 1JYWA 4OIAA 3VXTB 3TA3C 3UEZA 4YDLB 3SCMB 3B9KB 4GW5B 3GUTB 1KN4H 2NZ9D 2E5EA 5ALBL 4KHTL 4ODTH 1D5BA 4F33B 3UTPD 3CMGA 4JO4L 1MRDL 2IAMC 4AEHH 4N0UB 5HHME 5FO8A 2K7QA 3B3IA 3KS0J 3PWPB 4LLYB 1UB6A 4RWYL 1JZ2A 1FH5H 4NQDB 2NQCA 2OSLA 3VFOB 2WIIB 2J6EH 5F6IC 4X4MA 1TTFA 4W68A 5HI3C 2J8HA 4PRAA 1NCTA 2ICCA 5EDXA 3ARQA 3TPUA 4Q9CA 4URTB 5D2LE 4Z76B 4BZ2L 1VCAA 3ULVE 2F54D 5C0BB 4X5LA 1A2YB 1YQVH 4NWUL 4PRDA 4JQVA 4PJGA 1A6ZA 4LSVL 1Z5LA 3MRFB 5HY9A 1DQLH 4M5ZH 5GSRA 2N56A 5IOPB 1KV3A 5D70H 2R2HA 4NKMA 4I77L 3U9UA 3UX9B 1K4CB 4WHDA 3EOAA 2N7BA 3WD5H 2Q20A 3CFCL 2HVKB 1VGEH 5I1HL 2F53A 4KJPC 4L9LB 5GS0L 2D4FA 5ESQA 4ELMB 2GJ6E 1RSFA 4Z8FH 3CZFB 2FB4H 3HE6C 2MKLC 2MKWA 2O5YH 4NZRH 1CK0H 1WWWX 2GHWB 3BYTA 2W65B 5CZXC 3L3DB 5F3HA 1VPOL 1QNZH 4AM0A 5I18H 4WTZA 3DV6B 4ZFZB 3F8UB 3H0TB 5IROA 3X12B 5DUML 1SJHB 1HINH 4RMVA 5GZOC 1F3JB 5ANMB 3UP1A 2DDQH 1A5FL 3VG0L 1G9NC 3MLWH 2BDNH 3CUPB 4PUBL 3D3VD 1RK0A 3BQUB 1DBMH 1FBIL 3BMVA 1EAPB 4YLQT 1UJ3A 1IKFL 2XRAL 1S7TA 4YFEA 1KIPA 1RUPL 1EIBA 1KB5L 1EPFA 1F42A 2VUYA 3ISWA 3GO1H 4FFWC 5D5ME 3BEVB 1B0GA 3OKKB 4IIQC 3CSYB 4OZHF 1UFUA 5B38G 1V7NL 4RAVA 5DEFA 2DQEH 5IT2H 4HLJA 5EB9A 4X6DA 1E4XL 5GRUH 5IMMA 4NC1E 4YBLB 1DBAH 5FGBC 4RGOL 1MRCH 1E4KA 3BPLB 4LHUG 4G3YL 1C16A 4MLSA 2VXUL 1QACA 2HJKB 1U41A 4R6UA 5SWZB 1W72L 3N9GL 1R3KB 1LEKA 4AZ8A 3EFDH 1WBYA 2HAZA 4Y4KC 5HGAB 3Q48A 3D87B 1W0WB 2E9JA 2NX5B 4MSWB 4JPIB 4MCZB 1Q9LA 2XACC 3IAGC 2CDGA 2IANA 2E9WA 4KDTA 4OFYA 4CN6A 3ABZA 4XB7A 4ZTOL 2P47B 3TO4C 1C12B 1JPTH 3WFDL 1CGSL 5EOQH 5BW7C 1P5UA 4WEMB 4NP4L 4IJ3C 3QIWB 3VDBA 3RWDB 3L9RA 1Q0YL 5GGVH 1CDUA 4XMLL 5JHLL 4M48L 1T7WA 2X4QB 2C1PB 3MOAH 5JW4R 2VQUA 5DURB 4OCMC 3CJJA 3VE0B 2WUBL 1IVLA 1RQ5A 3P4MA 1ETZB 4PBWD 3MBXH 3OJDB 4I48B 2PR4L 2NXZD 2WP3T 5I1CH 1DJSA 1D9KA 1FZOB 3TBYA 3BH8B 3JTTA 5ETUB 1BLNB 1RIVH 4G7VH 1IQWH 1HHKB 4LCWA 3LKPB 4Y4FB 5DUPH 5KVDL 3DUSB 4R7NA 5FOBA 3KXFE 2BJML 3GSWB 4ZFFB 4TRPH 4DTGL 2EYRA 1NBVH 4OZFB 4JGUA 5I71B 5JQ6H 4JFYA 1KG0B 5I74C 5IMLA 4WU7A 3FO0H 5DMGD 1MHEA 2ICEA 2JCCB 4NO2B 5C0IA 4JAMA 1S9VA 3EKCA 4I8DA 3FQUA 3UTTB 3WHXA 4WHTA 3CVHH 1JPSL 1F4HA 3V4VL 5C0EA 2YK1H 4P46A 3QCVH 2DQFA 5IIEB 5D2NE 4YWGL 1K8IB 4Y4HB 3DGGA 3EYSH 5HYIA 4UIMB 2QJDA 3P4OA 3GGWB 1T20A 1EGJL 1QQDB 3S96B 2EDRA 1VEPA 2NY7H 1OTUC 4XZUA 3BGMB 2XPGA 3VFRB 4BELD 2X9XA 2VAAB 3L5XL 4YHLL 2MJWA 5J1AA 1FNSL 3IFPB 1XGQA 3QUYA 4CVUA 1S9YB 1K4DB 4OIBA 4LPXA 4ETYA 4DOHB 3QDAA 3RI5K 3K8KA 4YXLH 3V4UL 3RTQA 3F62A 5FCUH 5D1QB 5DLML 4Y19B 3K0WA 4Z7VA 5DMGC 2W9LA 3MFGB 1DR9A 1GAFL 1FZJB 4JQVC 1BVLA 4N90E 4TSAL 3VXRE 2H1PH 1L6ZA 2FO4A 2FHBA 5KOVC 2QQNH 3VXUE 2P7TB 1RZGA 1G1CA 4U33A 5KG9B 1QTYT 3KDMA 4BH7B 4Q0XH 3MO1A 3I02B 3MA9H 1CICB 2FNBA 3QEUA 2Q8AL 1QLEH 3O8XB 2EIZB 4PP2A 5DUBB 5T1DL 3AMKA 4HKJB 4HFUL 2VZ1A 1MVUA 1EMTL 1IGFL 3THMH 2G2RB 4L5FL 4PGEB 4JFFB 2D7OA 1NDMB 3KPTA 2F58H 1KEML 2DQTL 3V6OA 4PBVC 1N3NB 4GG6A 3QEHB 1EXUA 4PTUB 5L88H 3K4DA 1INEL 1G6RL 2OX5A 4L8SA 5IW1A 3VMNA 3T04D 7CGTA 4P5TA 4JRYE 4JFED 2A9ML 4S0TD 5DO2D 2FJGB 4P99A 5I76A 1A3RL 3HHRB 4OV5B 1U92A 4D3CH 3WS6C 4MAUH 5TE6L 5DQDL 3WJJC 3BAEL 4N0CC 3WCYA 2VWEE 4HWEH 4D0CB 5GZNC 4UIKL 3H9SA 3BRDA 2WZPD 1J0JA 2R4SH 4QHNA 2IAND 3EYVA 3AU1B 4OFYD 3STLA 3MRMA 1KTDB 4N0RA 3O9WB 2Z91B 5D4QA 4IRZL 3W9DA 3QG6A 2DJ4A 4XHJD 1OGAB 4OGXL 2FYYA 4OJFL 2EKSA 3N1FC 3RA7H 3HB3C 1LO0L 4R7DA 4XWGH 1ZGLP 1QKZH 2K3TA 2LQRA 2DWEA 2YA1A 1ZT1B 4U1MA 3K8MA 3NIGE 3NPSB 1ZEAH 4ELKA 4F37K 5B3JF 4H88H 2QR0A 4MZ2A 2X5PA 1BGXH 5FK9B 5JW4Q 4ZPVB 4ZO7A 1KIQA 3E6HA 3S34H 2IPKB 3W5NA 5K9QG 3MTRA 4LQFL 1KFAL 1D9KD 3C9NA 4XCYB 5DJAA 2DL9A 4JPWL 2ADFL 4MAYB 4LPYA 3SDXA 3QEGH 3C09C 1YEKH 3U2SB 4LCWD 3LDBC 3E2HC 1X5XA 4LPWA 4XP1H 1QFWL 3FFCE 4JM2A 4UV4L 3PE9A 5BVPL 1BZQK 1H3WM 1VHPA 4PV9A 3ALPA 4J4PA 5JW5B 3U30C 4MXWL 1D6VL 3TFKD 3SGJC 2V7HA 2G75B 5J6GA 4EBQH 5DJ8B 2FIKA 1KEGL 5BCAA 3T0EB 4LDLB 5DYOB 1UC6A 3GIVA 3BPCB 2HG5B 1ACYL 4LMQE 4QXWA 4P46D 3DWTA 3W0WB 5JDSB 1SBSL 3OG6B 4LCCB 5E00A 3F5WA 4L1HA 2OR9L 2WQ8A 5CP7B 4PJIA 1GRWA 4XVTL 4F7EB 1TJIL 1WZLA 2D7NA 1AD0B 1XR8A 2Z8VC 1HILA 4RFEB 4XCFH 5E1AA 2J3SA 2D3VA 1FIEA 1OB1A 1ZE3C 1KF9B 3MACH 3RUGE 4LLMA 2CGRH 5ID1B 4MNGE 1U8NB 1NL0L 4YHPA 3PWNA 1XIWD 2JK5B 4HIJA 1JMZA 4M4PA 2Y07L 1IC7L 4HUWB 3QUYD 4WEUD 2P5EB 4PJXE 4JG1H 4PJFE 3HAEA 3ZKQD 5JZ7C 1UH3A 4ONGH 4WI2A 4JJ5B 3BKJL 5IHLB 5F7YC 1HNFA 5EU4A 3QFJD 1KLGB 1P84K 2E7HA 2FJHB 2XWTA 1CT8A 4JN2A 1LVEA 3NIDE 2CIKB 2BVYA 1SJEA 5LAXA 5IW6A 3RVXD 3SN6N 2E6QA 4P2RB 4ZUVA 3QIUA 1KB5A 5GQBA 3QDJA 3MYJB 4UV7H 1NKOA 4KJYA 2BMKB 5C0NC 4C58B 1P6AB 2K9UA 4Y5VA 3IDMA 3LPWA 1T0MB 3ULSA 3OAYH 1EAJA 3F7RA 2YC1A 1E4XI 3H8NA 4PJGF 3IDXH 1MFBH 1KN4L 4HXBH 4K7FB 3KPRE 4ODTL 2IFGA 3D18B 1JWMB 4ONOA 5FKAA 3O3DA 3RQ3A 3CFDB 1BZ7B 4UUJB 1XZ0A 4AEHL 4M93C 5KS9F 4JM4H 2X4OB 4JDZA 4HEME 1W72A 4YBHA 3S36H 3UYRH 4YHZH 1FH5L 4OD3H 4TSBH 2J6EL 4K7PL 1NFIB 4U3CA 4P5TD 2O93L 4LVNB 3NCMA 1CU4H 4X99A 3RTQC 1E27B 2IH3B 2QSVA 4HIEA 2IMNA 3X13B 5KSBE 5DJ6B 3GMQA 1S7QB 3VFSA 2P8PB 1U8KB 1Q38A 2MHAB 3CCHB 1YQVL 2AJVH 3I6GA 4O2CA 4JZOA 5E8EB 3L1OH 4FTVE 5EO9B 5I6XB 1OVZA 5T3XD 1DQLL 3W2DH 4M5ZL 3H9SD 4U1SB 4X6FA 3KPNA 4NFDA 5AD0A 5I0DA 5D70L 2W0PA 3RWCB 2KKQA 3HRZA 5FYKU 1G1YA 3WD5L 2C9AA 2CK2A 3B9KA 1VGEL 4GW5A 3GUTA 2GTZB 3GB7B 5DA4A 4Z8FL 3MCLL 2YN3A 4QT5B 4XNZB 3NCFB 2FB4L 4C83B 1EX0A 3V6OC 1CD0A 5GRVL 2O5YL 32C2B 3D1MC 4NZRL 1CK0L 3TO2B 4MJ6B 1IAIM 5D96B 1FN4A 3IDGB 1QNZL 3VFNB 2ADJA 3FB5B 4L8SC 5DEGA 1X5KA 5I18L 1JPFA 1V3KA 4PJHE 1KBGH 4P5TC 5KS9B 1ZVHA 4NN5B 1LE9A 3KWWB 3QUMH 3RIAF 4EIZC 5KVEH 4PREB 3ZKXC 2ZNWA 1HINL 1ZLWK 1A2YA 4HJGA 2DDQL 4XMPH 4X6DF 3MLWL 4KKCC 1GOGA 5F93C 1CFNA 2BDNL 4AIOA 4NCC2 2LE9A 1G84A 4JM2D 4PJBA 1DBML 4JZJC 5D7KE 3VH8A 3F12B 2X4RB 3SPVA 1L4IA 1SEBB 1GOFA 4E42A 4OUOA 3LN9A 5I1DA 3QAZB 5ADPH 1HK6A 1IARB 2YD2A 3MREB 5FM4A 5C3LD 4QOKB 3MLZH 4OF3A 1WK0A 3GO1L 2AS5M 3I3BA 4NQXB 2MQCA 1MCPH 4P2OB 5EULV 4CMMA 2DQEL 3MJ9H 5GS0D 2NY6C 4LLDB 5IT2L 4O51B 4RAUA 1EGJA 1CXFA 2IPUK 4JDVA 2R23B 4JRXA 3MJ7B 1DBAL 4MA8H 4AL8H 2IG2H 5DFVD 4F3FA 4AEIH 4WUUB 1MRCL 3EYFA 4CVXB 4ZSOB 5EBWB 4WY7H 1YDPB 3B6SB 4G9DB 3H0TA 3TZVA 1YEIH 1QLRB 3SO5A 2A1WH 4IMLB 4MA3A 5DJZA 5TQ2H 3EFDL 2CK0L 1OAQH 5DQJA 4ZNCD 5F8QC 2QADC 2YPKA 5I19H 5C0CE 2HVJA 1MCSA 3ILPA 4J4PC 5FYLE 3W39B 1JPGA 4LRNH 3SEPA 1A0QH 4ODUB 3LN4A 2Z4QA 5CEZH 1GH7A 4NJ9H 1ES0B 3MODH 4X98A 3S4SB 3BEVA 1VFUA 2EICA 5E03A 3QIUD 3CX2A 1WWBX 2JE8A 4XMKL 1XF2B 3QDJD 3IFLH 3GI9H 4UI2A 4JFEB 4X6CE 5EU6E 1OP5H 3NCEB 3PABA 3KPPA 5I17B 5ITFA 3P4NB 3RNKA 3CDFA 5GGVL 2VLKB 5KOMC 2NY1C 3C60C 2W0FB 3CFKB 3TBTB 4J7RA 3K1DA 5C6PB 1EHAA 5F88A 1I8MA 1PFCA 1JGLL 2LV4A 5IVZB 5AUMA 1P7KB 5I1EH 4PB0L 4X4YA 5FEBA 2VABA 3KR3H 3MBXL 3ZDXF 1KTLB 4PG9A 1G6RA 4ZNEE 5I1CL 2BOCA 2X4NB 1JNLH 2XYCA 5K33A 4G7VL 1KCVH 2VAJA 5TE7H 3T8XB 5ID0A 1PZUB 1BQLH 4UT7H 4G8GE 1UM5H 4RQQB 5C07E 4JPIA 5DUPL 3OKLB 3VFUB 4UINH 1I8KB 1XGPB 1NCCH 3BP5A 2D03H 4TRPL 5A43C 3M1BA 4PJEB 4LGPB 3ECBB 3GSUB 3QNXA 1G6VK 1NBVL 1BFOA 3IFOB 3NFSH 4Z9KB 4JGMA 4NYLB 3S35H 3SE3A 1T7ZA 3FO0L 2DYPB 3V79C 3DVNB 1C12A 4Q2ZB 3SJVE 1AO7A 3LB6D 3T0VA 1SY6H 3L3HB 3QIUC 5C7XH 3VXMB 3CVHL 2YK1L 4MDIA 3DMMA 5IJVB 3QCVL 4BFEA 4ODVH 2BVTA 2ED9A 4Y5VC 1YPZB 1FFQA 3QNZB 3EYSL 4O2EB 4M6MH 4Z7VF 2R0LH 4QRTA 4OIIL 4ENED 3D85A 3BN9C 3DTXA 3NFNA 2KZ1B 1QFUH 1DVFB 4NQVA 2NY7L 4R26H 4YK4B 5ALCH 1G7IA 1ZANH 5ETUA 3UBXA 3UBXI 4PFEA 1IGML 4BFIB 4Y4FA 5EUOB 1A3LH 5F7DA 4IHOA 5EPMB 2R0KH 1S9WB 4HWBH 4NM8H 4U1JB 3PWUA 3QXUA 1ERNA 5K9OA 5ACLA 4X0KB 1OWRM 4MXVF 2CLRB 4YXLL 4PD4J 1KG0A 2YEZA 5FCUL 3IDJB 2R4RH 2VDLH 3MCKA 4YR6B 4GW4A 1IGIH 3V5DB 2BNUA 5IEHB 3HC4H 5HHNA 5B8CB 5D7JA 4K07A 3UTTA 2H1PL 4PRHE 1LP9B 5GGQH 3QUXC 2QQNL 1XIWB 4DUXA 5EU3A 4O2FA 3V8CA 1X44A 1HHIB 3NA9H 5B39A 5I1LA 1WV7T 4Q0XL 5F89B 3MA9L 4JGJA 5BRZE 4X7FC 2Q3ZA 4XH2A 4ONFH 2MOVA 4G8IB 5DTFB 2L4OA 4Z7UB 3B9KC 5HI4C 3MSPA 2C4XA 3GGWA 3JV0A 5CGTA 3QFJB 2JJWA 4NN6B 2F58L 2X41A 4Y89A 4JRXD 5DVLA 5F9AC 5HGBA 4XRCB 1K4DA 5ISZB 5MP6H 4D9RE 4UZGA 1MCIA 5L88L 1BBDH 4K7PY 2YN5A 1U3HD 2A6IB 4HIXH 4I2XE 3FQWA 2XA8H 3TZVD 4EIGB 5E94B 2NW2B 5IFHH 4D3CL 4MAUL 4QRQA 5JOPD 2W60A 1CN4A 4XGZA 3BEWA 2C26A 1FNAA 1ZLSH 1MWAH 2R4SL 4PJAE 1W2KT 4D9QE 3O6FB 1CICA 2NY2B 4HH9B 1FAKT 2VB5A 2EIZA 4WW1B 5J6HA 2VLMD 2WWKO 3HCVA 5E2UL 2CLVA 4L9LC 4V1DA 1UEMA 2YD5A 4QHLA 3RA7L 4JM2F 4XWGL 2DLFH 3GMRA 1QKZL 3MV7A 2Y36H 2OK0H 2EDHA 4H88L 3VXSB 2X7LB 4EUPH 1BGXL 1AQDA 1SMOA 1JWSA 1ZXQA 2FD6H 5EOCH 4QY8B 3VXNB 4NQDE 3MLYH 3S34L 5CGMA 1FFRA 3G08A 2X42A 5DRWA 5BVJB 1OD7A 3RVVC 1H0DB 4NQEE 5EFIB 3I75A 4GUPB 2J6EA 1IAII 3EYOA 4BKLA 3PGDB 5BZWB 4YIQB 3HZKB 2XWBA 1YEKL 4FQLH 1DQQB 1GZQB 3TF7C 4PJIF 4D0CA 2ZSVB 2FWOB 4JN1H 5DVNA 3BQUC 4ODWB 4XP1L 1G0DA 1U8LA 1JK8A 5C09D 1KTDA 3OB0H 4U6XA 4EBQL 3ARTA 4PLJC 2ZSWB 2PETA 2AV7A 1AO7D 1JZ4A 3K2MC 3KPOA 4J3OC 1HHGB 2OL3B 5BO1H 3DMMD 3VCLB 4L4VE 2P4AB 3MNZA 5EO0B 2EXWC 3P9LB 3LQZB 4PS4H 1A21A 1AHWB 5DD1L 5JHDE 1F4XH 4FXLA 4XXCA 3FONB 4XCFL 2DWDB 5GGUA 3D85D 3BPLC 4HKZA 3MACL 4XCYA 2CGRL 4YHNB 2DOCA 1BZ9A 2FR4A 2IALB 4PRBA 1BREA 3FTGB 2Z8SA 5L2KB 3F7YB 5CZVH 1BD2B 3CFBA 2QSQA 4I13B 3FT3A 1Q8MA 3NVQA 5F1IB 4JZNB 4JG1L 4O02H 4ONGL 4ZQKA 3GSXB 4LP4A 1E4WH 3QEQA 4HBCH 2OZ4L 2CDFB 1UKSA 2GCYA 2H8PB 2ZUYA 3ARFB 4UOW0 5EC1A 4DQOL 4EOWH 2QQKH 2BERA 5D7JD 1PDKA 3L7EB 4K3JH 1G7JA 4P2QB 4ZOAA 4Z0BH 3QIWC 4NKQB 1MHPH 1B2WH 2R56H 4UV7L 4S1DC 5GGVY 2Z92B 4PGZA 5E6YA 5CEXB 2HMIC 2ITDA 3FQRB 4Z7NF 4YUEH 5IM7A 4X9HA 4JFXB 3RY4A 1AD0A 3VW3H 3OG4B 4OLWH 3UTQB 3BGAA 2BX5A 3IDXL 1MFBL 4HXBL 2ILLA 4NQUA 2DM3A 3D2UA 1IGJB 5D7LB 3STZB 1JF1A 4JM4L 4Y4FC 3S36L 3UYRL 1CIUA 4JO1H 4OD3L 4TSBL 2AEQH 5H94A 1QPPA 4YHZL 2NX5E 3DSFL 4UT9H 5HDQH 4CW1A 2OI9B 5FYKE 4LSUH 1FL6B 4LSRL 2QHRH 1KNOA 5I71C 4NKIH 3RVUC 3VD3A 2JLLA 3P4LA 3R8QA 2FBJH 3QO0A 4ZS6C 3WDJA 1MFEH 2AJVL 1N5AB 3L1OL 1Z2KA 1XGTA 3BUYA 3MROB 3MYJA 3W2DL 1Y18B 2AEWA 3OGOE 4Z7WB 1QBMH 4Y5XA 1BJ8A 1E28A 2V6HA 2V5RA 3HN3A 5K9KB 1DBBH 1HEZA 1HDMA 2GK2A 4BSVA 1MY7A 4Y4HC 4K55A 4UAOB 1BBJA 2PYFB 2H3NB 2HT3D 3OR7A 2YR3A 1EZVY 5CIPB 1ORSB 1P7HL 1QLFB 4WTXA 3QT2A 1MCOH 4K7FA 1FGNH 4PJBF 3ZMRA 3DX6B 4WW2B 2PTTA 4LIQH 4X9GA 1X5ZA 3LSOA 3SGEH 5DSCB 2OCFD 1EUUA 5EO1B 1T3FB 4U6VH 1EUTA 4OCXH 4ODSH 1KBGL 3NA4A 4XWOC 1H3TA 2UUDH 4BH8A 4HJ0C 3QUML 5KVEL 3RY5A 4GXUM 4OQ1A 5BJTB 4XMPL 1UCBH 2PO6A 4KJWC 3TT1H 2JCCE 4PJ8B 1TNMA 3Q2CA 1A7RH 4KK8D 1JI2A 4OGAD 3BD4A 3D25A 4W81A 4YZFF 3MLRH 1VFBA 1CICC 1KCSH 1WAAA 1N26A 3CVHA 3O8XC 5ADPL 3QXTA 2AK4E 4NQTA 3MLZL 1X5JA 2RCSH 1MI5B 2H6PA 1MCPL 1OSPH 4M61A 2UWEB 4KUZH 3V7MA 5L0QB 3FCTB 4MVBD 2AKRB 3DX7A 4QHKJ 5BMFH 3UJTH 2EEBA 3FL7A 3ULUE 4MA8L 1F6LL 4AL8L 2IG2L 4AEIL 2FLRT 3DX9B 4ONHA 1F6FB 4HULB 1PQZB 1MCWW 4FXGA 1NBZA 1MUJA 1XR9A 2IBZY 4WY7L 2ZCKH 4KKBC 3I3DA 3F7VA 2VERN 3EO9H 1OF2B 2A1WL 2QQLH 4LSTH 4G6FB 5TQ2L 5HDOA 1YY8A 3CLFH 1OAQL 2H2PC 3DIFA 2OXHA 5SX4H 5SWSD 4NSKB 4C54A 4E41A 5I19L 3CAFA 3VGGA 2I25N 1MNUH 4LDOB 2BNRB 4UU9A 4OGAC 3IB4A 3RWIA 1P4BH 3DXAA 4LRNL 3QEQD 1KSRA 2VZTA 4MNQE 1IGTA 2YUVA 1A0QL 3QR2A 4JY4A 3O9WC 4W4NA 4HKBA 1PKQB 1C8PA 5FUCC 5BZDB 5CEZL 4LSQH 4NJ9L 3AB0B 4JO3H 3HPLA 3MODL 4MQSB 3BIKB 1P7QA 3PQYB 4RZCB 5B3NA 3GMPA 3IFLL 3N85H 5I8KH 4CMHB 3NPSC 3BVNB 2DQDH 4JFFE 3S7GA 4PRPD 1U8QA 3PHQB 3MJ7A 5TDOA 4XBPB 1F90H 3ZE2E 4U6HA 5EN2A 4PGDA 3OX8B 4PP1D 1S7RB 3QQ3B 5CHNB 1TENA 3KR3L 1H15B 3MLTA 3SOBL 3VWJA 3QCUH 5JW4M 1BVZA 1O5DT 1GYAA 3T3PF 3JV4B 2WWKT 4MAYC 3D2UD 1JNLL 2BSRB 5HVFB 2BSTB 3RNQB 3NFPB 1KCVL 5TE7L 1BQLL 1UM5L 2V2WB 5MENB 2RAMA 4AEEA 4L29B 2IFFH 2KPNA 1AY1L 1K3IA 3P11H 4UINL 1NCCL 2D03L 3UTPE 2NY3D 2PXYB 1RUQH 2YSSA 1M7DB 2DKMA 3NFSL 1FORH 5C08B 4FA8A 3S35L 4ZYKA 1ZA6A 3F58H 3RGVB 5C0DB 2VN7A 4FZ8H 3T0EC 1TPXC 5E0QA 4EI5B 1RZ8B 3ARGD 4J3UA 2AXGB 2Q6WB 4UQ2B 1OGAE 1SY6L 3E1F1 5C7XL 4PRIB 1OLLA 1I1AB 2FIRT 3OB8A 4XP6H 3QXAB 4LCCC 2VLKA 3P40A 2JIXA 2CRIA 3KYOB 2G5BB 4ODVL 1G7HA 1QP1A 2JJTC 5IVZA 4HGKC 5E6ZA 3TJHC 2IPUG 3D39D 1A4JB 3SE9H 3QPQC 3QCTH 1A6TB 4M6ML 2R0LL 4KI5C 2JKXA 1A9EA 3PL6B 4WGVB 5GSVA 2CJUH 3O81A 4WTZG 1QFUL 5C09B 4R26L 3VFPB 2DLTA 1ZANL 1A1OB 2BNQA 1R3JB 2GEEA 3RY6C 3WMSA 4RQQA 2DJUA 1A3LL 3VFUA 1I8KA 2J7LA 2R0KL 4FFZH 1BOYA 4KKAC 4NM8L 1QSEB 4TPRH 1Q9OA 3CXDL 2I07A 1NPUA 2H26A 2R4RL 3L7FB 2VDLL 2WM0A 3KGRA 1IGIL 1U8MB 4WFFD 2PO6D 4JCLA 3JVGA 4M8VA 1NQBA 4YHYB 4EI6B 8CGTA 5GGQL 2VDMH 4Y5XC 3IJSA 43CAA 3NA9L 3W0WE 3P30H 2YD1A 4HS8H 1IEBB 1YPZA 4KI1A 4MS8C 1S7VB 2FL5B 1P5VA 1R3LB 3R1GH 1FPTH 4O2EA 3C6LD 4P3CL 1D5XB 4ONFL 3TCLB 3D3VE 2JB6B 3QWOB 4P57A 4IBLT 4NOBA 4KI5E 1DVFA 4HUKB 2QHLA 2GSGB 5B3JE 3GJFB 3OKYA 1NGPH 2GKIA 2HFFB 5E9DB 4JFPB 3PP3H 2X05A 4BFIA 5EUOA 1DANU 5K9JH 4WDIB 1TCRB 2P5EE 5MP6L 1UXSB 4HT1H 5F72S 1BBDL 3R4DA 4U1JA 2J5LC 4HIXL 4R4FL 4X0KA 4R90H 2CSPA 1I1YA 1IM3A 4LEXH 4LVNC 2XA8L 1AGFA 4XAWH 4X7SL 3DUHA 5GGRY 5IFHL 1KB9J 4YFLF 3G9AB 2ESVD 5HI5D 2ATKA 4ZO9A 2COQA 1WITA 5I6XC 3KLSA 4E41D 5M94B 5F3BB 2DQGL 3MFFB 1VA9A 3U0WH 2W07A 1ZLSL 1MWAL 3DXAD 2F8OA 1BJ1J 4MD5A 2BCKB 1CD8A 1RVFH 5HPMB 3EGSA 5DZOA 1D7FA 4G6JH 5JXAH 4P4KD 4M1GH 3U46B 5EBGA 1QRNA 1P7QD 1YEDA 3I2CH 5HYJB 3ROOB 2DLFL 4XNZC 3AXLA 2OK0L 1RJYB 2APBA 1CQKA 2X1OA 1A6AB 2P8LB 1FZKA 3DUUB 4ZXBA 2XZZA 1YMMA 5CD3B 2YHGA 3G5ZB 2A6IA 2FD6L 5EOCL 4HWZB 3C5SA 3QUZA 3MLYL 4W6YB 1LD9B 3VWJD 3TVMB 4WVRA 2EDLA 5BV7H 4NN5C 2NW2A 4OQTH 3RWFB 1URLA 4QHKI 5FIEA 4I9WD 1C1EL 3ZYIA 5JNYA 2EDNA 4NO3B 5IW3A 4YEEA 4NHCH 1XF5B 4FQLL 1H8NA 5GGRA 3A0OA 3GKWH 5ERWA 4JN1L 4DN4H 3CPLB 4JHWH 4PJ9A 3HLAB 5MEOB 3O6FA 3EZ8A 4HH9A 3D0LA 1B0RA 3QAZC 1I7RB 5D72H 3JV6B 2YWZA 1FFOB 5D9SB 5SX5K 1RZIB 4MNHB 3KJ6H 5BS0D 4RRPA 4WFED 4JREB 3RWJB 4NPYB 4P2OC 5DC9B 5BO1L 2JIXD 1Q9KA 1YNTA 3ILQD 3V7AE 3VXSA 1GGCH 4ODXB 2VIRB 4PS4L 4PJGE 3L6FA 3VXNA 1F4XL 4X7DC 3FRPG 1ZWIA 4GRWH 2F9BT 2VR4A 3K8LA 2EC8A 2VLLA 4XPAH 1M71B 4QHMB 1CS6A 1JI1A 2P48B 4QO1A 3W82A 1X5HA 2GJJA 1HI6B 5KS9E 1PVHA 1NEZB 2NNAB 2BNQD 3HZKA 1DE4B 3TYFA 1QD0A 3MZTA 5CZVL 2DLIA 3QUMA 4ODWA 3SO3B 4O02L 1T83C 1R5IA 3EDEA 2P8MA 4AG4L 4HC1H 2EDEA 4OI7A 1I3RA 4MA1B 3D5OF 3CDYA 4MXQD 1E4WL 3F65A 2KZWA 4N0YH 1FIGL 4OBSA 4EOWL 3DECA 2QQKL 4F9LA 1XF1A 4R4NC 3MRKB 4K3JL 4KHXH 5KZCD 4Z0BL 1MHPL 4DK3A 4GW1A 5ACZB 1B2WL 2R56L 1N6UA 2X70A 1SYSA 3KPLB 3G6JB 2BVUA 4PJDB 4YUEL 1M7XA 1LQSR 4OM1H 4ESKA 3MJ9A 4HZLA 3FONA 2AERT 4J3TA 2YXFA 3WL9B 3BZEB 3VW3L 1EFXA 4OLWL 2V5MA 4WUUE 3FQTB 1II4E 4PY8J 2WMPA 1AGDB 2VLJA 4LEOA 5IMKA 5BOPA 4L8DA 5AG9A 2F19H 2WINB 4GAYB 2AEQL 3P73B 2QKIB 4Q9BA 4UT9L 1Q1JL 5HDQL 4LSUL 4KC3B 1JRHI 2QHRL 2R39A 1ZSDB 3OR6A 4NKIL 3CXHJ 4NQCD 1FNEB 3BP7B 3LKNA 1M7IA 4MXQC 5CJ5A 1I7ZB 2H8PA 2FBJL 2LU4A 3AVEA 1JF5A 4TSCH 1I7UB 1AXSB 3DOSA 4BSJA 3BKCH 1MFEL 3ZKND 2XKNB 4JFDB 3QULB 4NRZB 1NGWA 3SKOB 3NGBB 1XF4B 3LEXB 4HHAA 4HKXB 4JFEE 4Y16B 2A83B 5CEXA 1DBBL 4PGBB 4WJ5A 3S37X 5DD5H 1NMBH 3FT4A 4MHHI 5I66A 1A22B 3NCYP 1T4KB 4KK9C 4GKZB 1EVTC 1QRND 4ZODA 2GJZB 1C7TA 3MLPA 4J23A 1A6PA 1MCOL 1HWHB 4LK4A 1DVFC 1FGNL 2IANE 4YK4C 3MUZ1 3SE8H 5DRXB 1ZMYA 4D0BB 4LF3A 4LIQL 4K3EH 5FUZH 4ZXBD 1WAAF 3ARGB 1A64A 4GAFB 5E4EC 3B5HA 3VXPA 5IB5B 3QUZD 5IWLA 4U6VL 1FGVH 4HMEA 3UZEA 4CU7A 5TF1H 1FL6A 4OCXL 5C0FA 3G5YB 1T5WA 1SMAA 4PJEE 3TNNA 2BY3A 2BVOB 2X6MA 2NY4D 1RHHB 3IYLW 4XCCH 1UKTA 2Y6SD 3D39B 4W70A 1T1WB 1F3DH 5B8CC 1WQVT 1UCBL 2VDKH 3TT1L 4PD4K 3RX8A 1S7UA 1U91B 4NNXB 1RIHH 3PWLA 3EYQD 4IRSB 1A7RL 1WFOA 4PJ9D 3VXME 2K1MA 1NAMH 4PJ7B 4JY6B 4HSQA 1SY6A 1I1FB 2DI7A 2VSCA 3MLRL 2BVQA 1GVIA 1KCSL 2C7UB 1DQJA 4NFBA 1OTSC 3QHTC 1QLFA 3X11A 1CXIA 4TUJB 4PRNB 3ULVH 2RCSL 2NW3B 5JQHC 3P0YH 1NFDA 1K5NB 1OSPL 4EDWH 4NN6C 3QI9B 3SKMA 4OFDA 3O3BA 5JR1H 2NLJB 2X10A 4L3CB 5C8JA 4MWFB 2Y25A 4KXZH 3RKDD 5BMFL 3OKNB 4JKLA 1T3FA 3UJTL 1XF3B 1NC2A 4YNYB 5EC2A 3RDTB 2EE9A 3OKEA 2W59A 4HPYH 4K8RC 4MQXD 5T33H 2ZCKL 4HWBA 5JO5B 5DJXA 4LVOB 5JW3H 3EO9L 2Z31D 2C4FT 3HMXL 4P9MH 1KLUA 4LSTL 3C6LB 3REVA 1P4LA 5EZLB 3CLFL 1KYOJ 1ZS8B 5I8CB 4PJ8A 3C2AH 3UXFA 1J0IA 1OAKH 2WBJA 4P49A 1MNUL 1IRAY 3HI5H 1AIFB 4PJ9C 3O6FC 2NY2C 1P4BL 1WF5A 3QXDA 1KPVB 1RZJC 1J5OH 1KJ2H 4LSQL 1ZHLB 4O58H 4JO3L 4Z7UE 4D2NA 2VNCA 5KN5A 2VO5A 5T1KA 1CDIA 4YGAB 3N85L 5I8KL 3BDBA 3QFJE 3FCTA 1QBBA 1YQ2A 5J12B 2ESVB 4FS0A 2DQDL 4NKDA 1FL5A 1XCTB 5FM8A 4Z7VE 1NCBH 2CLZB 1VSCA 3OGCA 2V2TB 3QUKB 3TBVA 3VMOA 1F90L 5D1ZA 5A16B 4E0RB 1EFXD 3T2QA 2XWJA 1PQZA 3ESUF 2Z8WC 3N50A 3QCUL 3SOBH 4DKFH 3PJSB 1YC7A 3M8OH 1OF2A 2VLJD 4JR9H 2HTKD 3IU3B 4WWKA 1HXMA 1SEQH 4HG4J 4P4KB 5FA3B 3PGFH 3ETBF 3MA7A 2IFFL 5HJ3A 3VMPA 2BNRA 3S88H 1YYLH 4YX2H 5EBMB 2VDQH 1RUQL 1YZZA 3WDHA 1FORL 5IHBA 3F58L 1MWAA 1CDJA 1F00I 4MDJB 3U82B 4F9LC 5CEZD 1UVQB 4MJ5A 1JN6A 5DJ0B 3AAZB 4LHUA 4XP6L 1G9NH 3FB7A 3CFEA 4IOIA 1N2RB 3FAXA 2WUCH 5D7IB 1CI5A 1AHWC 2A0LC 5KSAA 4L3EB 2CDEB 4N9OB 3SE9L 3SY0A 5T3XE 3QCTL 2ZKHH 4YGVA 1ACZA 3H9SE 4PBXA 2CJUL 2IQ9L 4EUPA 4KU1A 3ZYOA 3OHXB 3JV4A 3PV6B 1PG7H 3IFNH 1F58H 4X5XB 3HG1B 4LLUB 4NUJA 4JFOB 1JE6A 4QTHA 2P5WA 3MRRB 3RIAK 1R3IH 2EIEA 3WEXA 1U8PA 4RAHA 3SDDA 3DRTB 3GK8H 4FFZL 3KYMA 4TPRL 5DVMA 5D6DC 3NABH 1D3CA 1T7XA 2K7PA 5C08A 1S7SB 3HE7A 3L5JA 3RGVA 2XZAH 3ARFC 2CXGA 1AXTH 3KPSA 3LKRB 2VE6B 9CGTA 1FVCB 3KPQB 3C8KA 5FA4B 5A2FA 2A73B 2EYSB 1XMWA 1J11A 2R0ZH 5SV4A 2XZCH 3C8HA 5DK3A 3NTCH 2X4SB 5EA0H 3P30L 1MVFA 4HS8L 1LK3H 1MJ7H 4JQIH 5IGXH 1KJMB 1UWEL 4CVZA 1CFTB 2VISB 1FPTL 4AMKL 4FG6D 5DD6B 4V2CB 3WV0A 1AGCB 5D1XA 1MH5B 1EV2E 1NGPL 2C1OB 4O4YH 5MEQB 3T0AA 5K9JL 1QA9A 2ATPB 4JVWA 4HT1L 1NC2D 3QJFB 5KZCB 5IWLC 3VJ6A 3GNMH 3R0MA 2OI9C 3MGTA 1VADB 3K74B 3QBTB 4MX7B 4R90L 4LEXL 3ZE0F 2MQ0A 4XAWL 1J8HD 2W0KA 4PJIE 2EXYC 5J13B 5IKCA 4XNYH 3DVGB 4P5KB 3BZFB 2NYYD 3DURA 2BVEA 2WBJD 3PIQA 4P2QE 1KCKA 3O3AB 5GS1B 4XBGB 3B83A 4IS6A 4Y1AA 4ZOBA 3U0WL 1YN7B 1HSAB 4XNMB 2FJFB 1R3LA 2EEAA 4AENB 1D5XA 1FVEA 2V5TA 3WXVH 3TCLA 1RJZA 5JXAL 4G6JL 6CGTA 4M1GL 4HFWA 1T1XA 3I2CL 5T1KD 1CG9B 2VZ3A 4NQCB 4PV8A 1FC2D 1T21A 4WW2C 3SDAA 2DQUH 2F5BH 4JFPA 2VYRE 4QLRA 3S5LB 1IZJA 3WIFB 1WICA 1RK1A 1TCRA 3U1SH 3VFVA 1NBYA 4FQQB 3ET9F 4QRSA 5DRZB 4XPFH 5FV2A 5D1ZD 1XGRA 3QA3A 4G6AC 4N8VA 3QDJE 3HZVB 1TVBA 4DCQB 4QRPA 3MMEA 5BV7L 5FUOH 5I1IH 4OQTL 3ARSA 1K8DA 4GRLB 2X4UB 4WWKD 5C0AA 1J12A 5CMAB 4ISVB 4LPTA 4PJ8C 2NYYC 2V9RA 3GKWL 2Q76B 2UYLA 1FFPA 3T4AA 1IL1B 1A9BA 4DN4L 4Z7WE 5HYEA 3BKYH 4KK5C 4HH8A 1H5BB 4XCEA 5DK0A 2EH7H 4UQ3B 5D72L 4FMKA 5HGDB 3AY4C 3GSNB 1NAMB 5CLWA 2HRPL 3U4EB 1RFDH 5HYJA 2DLHA 3VGBA 3WNOA 1S7XB 3KJ6L 4NO5A 4APQA 4Z7NE 3T65A 4LHUD 4NQSB 4ZUWA 1RJYA 1KPRA 2YXMA 2JJSA 4P9HH 5D2LB 5JA8B 5L0QC 2UY6A 4I0CC 3UBXG 4FZEH 1CXHA 4MB4A 1GGCL 5FV1L 5CD3A 1INDL 3KNBB 4M7ZB 5KSAD 1MCFA 4LLVA 4GBXA 5FHAH 5AEAA 2NR6D 4XPAL 4OZFG 4L4TA 1YEGH 2PNDA 1U8OB 1HQRA 2PW2B 2LAGB 1NCNA 5AZEH 3VRIB 4K7PX 3I6LD 2P5WD 3QDGD 1FJ1B 1QEWA 1X6LA 1Z0NA 4H8WL 3SDDD 1WZMA 4I0PD 4HC1L 4ZUUB 4FQHB 3UTSA 3HE7D 4WNQA 2EDKA 3JV6A 5E70A 2HA1A 5IG7B 1DN0A 2AQ1A 3KPSD 3MRNB 2E7LA 1G7MB 3AB0C 3OF6A 4EQ2A 4N0YL 5GGSY 1XGUB 1RZIA 2R2BB 1MCCA 3K46A 1G7LB 4WO4B 4RGND 1U8JA 4P4RB 1JWUB 4CMHC 2Z31B 3HPJA 1YC8A 3QFDA 4K9EC 5J3HC 4YDJB 2DTML 4G80B 4D94A 4OM1L 1VDGA 2NTFA 4NRXA 1EEZA 3IDIA 4PJBE 1C5DB 5D1XD 1WFNA 4BUGA 3BMWA 4WI6A 1SM3H 1HI6A 4HK0A 1IMHC 3ZHLA 1ZLVK 2C4FU 4LNVA 2FX9H 1UQSB 3A67L 5AG8A 3B5TA 1LDSA 2F19L 3RX7A 3RU8H 4ERSH 4H26B 3BOVA 3UDWA 4PR5A 5AZ2H 3U83A 2KL6A 5D6CB 2PXYC 4ORGA 5SX4I 1FO0H 3T3MF 3UAJC 3FHQA 1VACA 3RGVC 4JRXE 1O0VA 3FB8A 4RDQG 4EI5C 2QBWA 1PKQE 4PJCA 3BKCL 2D7PA 3QDMA 5JOFB 3ZYZA 4I18B 4YZFE 1I1AC 1T04A 2X40A 4Y1AD 3NZ8B 5GGSA 1UZ6F 4GSDH 4U0QB 5ADOH 3FOMA 3BPOC 5DD5L 1NMBL 4N5EC 1ZT7A 3WS3A 5JOPE 2C3VB 2W0LA 1LO3H 5CD5C 5CS7A 1SVCP 3PL6C 2R1XB 5FOJA 2EDYA 1AGDA 1PYWA 4NM4H 3SE8L 5IJKC 1EHLH 5TQ0H 4K3EL 5FUZL 3UPRB 5EBLB 1K6QH 2VLME 3P73A 5MENE 3STBA 3HC0B 2YPVH 1H8SA 1XH3B 1FGVL 1A1MB 1HNGA 5E56A 5TF1L 3EJYD 2QSCH 1PZ5B 1ZSDA 4IOSD 1NFDF 4LOUD 1XGYH 1MJJB 5KVGH 3CU7A 5C0AD 4XCCL 2KQMA 3O4LA 5E6IB 1J0ZA 4NRZA 3REWB 2VDKL 5F70A 3TM6A 4YHYC 3DRQA 1RIHL 4HJJH 3CDGB 1NLBL 2R1YA 3TJEH 4A6YH 4Y16A 1NDGB 1I9IH 3LKQB 1T89C 2V5YA 1U3YA 1KCLA 3RZCB 1ZVSB 3VI4F 1I8IB 3NCBB 1S9KC 4KTDH 3JTSB 3KXFB 2AJZB 1A6VH 4KAQH 3ULVL 3FRUA 3NIFF 4YBQC 5I0ZA 3P0YL 1YY9D 2V7NA 4EDWL 2ADGB 5C09E 3SDAC 1NC4D 1RPQA 2ARJA 5JR1L 1KELH 4S1RH 4N0FA 2DAVA 2VZUA 1BQHB 3T0DA 1AO7E 3HMWH 4P2YA 4TUKH 4RIRB 2XN9A 1WCBB 2G9HA 1FRGH 4KVNH 4L4TD 4MQ7A 5EIQA 4C4KO 2CIIA 4HPYL 4FN0A 3ZKMD 2APFA 4DUVA 5T33L 5DRNA 5D2NB 1AKJB 5JW3L 4P9ML 4PYGA 1QOKA 1CE6A 2HFEA 4EDXB 4Y8DC 3O4OB 3N1GC 3GSRB 3C2AL 2HT4C 5IEKB 1KB9K 5F1NB 1OAKL 4PJ7A 2DBLH 4YAQA 3QQ4A 3UTSD 1DEEA 3HI5L 3VWKD 3K1KC 1FCGA 4HS6B 3G6AA 5DJYA 5C6TH 1J5OL 4ZS7H 1KJ2L 2R1WB 4O58L 3KS0H 5IVXF 1I9JH 5BXFA 4APQC 4F9PC 1OP3H 4POZD 1VESA 1EZVX 2JJSC 3L5WA 4KRPB 2EE2A 3H3BC 1NCBL 4M6NH 2B1AH 1KOAA 3ALWA 5E08L 1J05A 4GBXC 3NCCB 3UCRA 3TVMC 1QYGH 3VXUB 5D7SH 5E24E 2NY5H 5JPNB 4DKFL 4LLWB 4PJ5A 3ZKMC 4GMSH 1U8HB 3M8OL 4ZAKB 4JR9L 1NGYA 1IGCH 3PF2A 5EZLA 2BC4A 1SEQL 3HZYB 1T5XB 1ZS8A 2BSSB 5I8CA 3QIBB 4PY7B 1PJ9A 4GKSA 2VZOA 3PGFL 1YN6B 4Q6IA 5DHVH 4G6MH 3SDCA 4FQ2H 1FYTA 4JJHA 2HN7A 4NCDA 4JFHE 2WW8A 3U7AA 1YYLL 4KUCD 4YX2L 5FFLA 3MRDA 2VDQL 2SEBB 1QBAA 3EO1A 3RJQB 5LVEA 1G9MC 3KJ4B 4IMKA 3CH1A 3I3EA 1FNGA 1MREH 8FABA 3AM8A 2HLAA 4ZUSB 3HR6A 4XI5D 4JREC 4H25B 5CKAA 4JRYB 4KTEH 4R3SB 12E8H 5FF6B 4HCRH 1G9NL 1X4XA 4LCUB 1MJUH 3DGCR 4R96A 2WUCL 4KWUA 4JDTH 1TTUA 4NBYB 2XTJD 3OKDA 5H2BB 2F74B 3TBSB 4R2GB 4DGYH 3ES6B 1WLHA 2ZKHL 4I3GA 5DQ9B 3W11C 2VDOH 3FZUC 5TH2B 5DJDA 4OZ4A 3DV4B 1JGDB 1PG7L 3IFNL 3IU3A 1F58L 3Q3GB 1I7TA 3LRSA 2GAZA 3RGHA 4OQTA 3QQ9C 2ICES 1LK2A 2IBZX 1R3IL 1WWCA 3SO3C 1D5MB 4N9GB 3GK8L 4OCSH 4HX1B 1C5BH 4MA1C 5T1LA 1KULA 5E8NA 3NABL 3L3JA 3MV9A 3TH2T 5KSVA 1R5WB 3V0AC 2XZAL 4NZUH 1YEFH 1ITCA 5JIKA 3MNVA 1KGCE 4LKCA 5HDLA 2XFXB 3X14A 3B2UD 3IJHA 5AWNH 3CVIH 5LGJB 2R0ZL 2XZCL 1DLHB 3NTCL 4XVSH 3WNKA 4S10A 3ARDB 3ZL4H 3QDGB 5EA0L 5IMOA 1LK3L 1Q94A 1MJ7L 1BQUA 4JQIL 4D8PB 2CDEA 5T1MA 1TZIB 1CXEA 2HJLA 4PLOB 4F2MA 3MLXH 3FFCB 4I0PB 5TDPB 3OHXA 2X4PA 3UPAA 3Q6FA 3O6MH 4LVHB 4UBDC 4LLAA 4WFGD 2KQNA 43C9B 3OXRA 4XNQA 4OKVA 3DHJA 3BP4A 3MRGA 4HDIB 3FJTA 4OSUH 4U3XA 4HC1A 1CGTA 1X5IA 1FVCA 2HP4A 1FO0B 2A73A 4G9FD 1M6OB 3CXHK 2VLRD 3F7PC 5H35B 3NGBC 3RUGB 3ARBA 4MNGB 3TGXA 4Y16C 4NUGH 2F8VA 3CX5J 2EZ0C 4Y88A 1YUHA 4B0MM 4PJDE 4DKDC 4PJXB 4JLRB 1T0NA 4QCIB 5SWSE 3PP4H 4PJFB 4LARH 2VRAA 1S8DB 2Y5EA 4DN3H 4J8RA 4J3XA 5C0JA 5FAAA 3QEQE 4GKNA 2NXYB 1KC5H 2DQUL 2F5BL 1IFHH 4MB3A 4MJID 1QVOA 3U1SL 3BRFA 4O9HH 5E8OA 2X4TA 4XPFL 1HQ4A 4FQ1H 1VADA 4UOJA 4GO6B 3V0VA 1OGTA 2ZOKA 4H5SA 3BP6A 4PJ5D 1L0XA 5FUOL 5I1IL 4PRPE 4YDVB 1KIUA 1ZHKA 5I15H 2XOTA 3S4SG 2YUZA 1MIMH 5DMIH 4IRJA 3SDCD 4IRSC 5J9PA 4HUVB 4JFDE 1FYTD 5A2LH 4RMWA 2QV2A 2NY0D 2WQRA 3VDCA 4BZ1H 1B4JH 2YD9A 3BKYL 4XNMA 1I9RH 1N59B 3KYNA 4PIRF 2MPAH 4XHQA 3MUGB 4NKOA 5HYQB 2EH7L 2RJMA 3QO1A 2I9TA 5F7FA 2CUIA 5DMKA 1AGBB 1AI1H 4TUOA 1RFDL 3QI9C 3TN0B 1A6WH 4P9HL 5F9JA 4Z77B 5KANI 4FZEL 1OQXA 5ICXB 5DD3H 3DO7A 1QSFA 2WIMA 5E2VH 4FTVB 1NMAH 5FHAL 1A7NH 3HUJA 5KJRH 3RDTC 3C08H 4F7MA 1FZMA 5F7EH 5JIPA 1YEGL 1AR1D 2OQJB 3S36X 4LVOC 1C08A 5C9JB 5AZEL 3A6CH 4M7LT 4KZEH 3D39E 3G04B 2AVGA 5DMYA 3FOLA 4ZPTB 5CSZA 4JKPH 2IMMA 3NCYS 3SDCC 1QSZA 2B4CH 3FQNB 2J2ZA 3QP3A 1XCQB 3LRHA 3IDYB 5HD8C 5T1LD 1H5BA 1KYOK 1NC4B 3MV9D 3CSGA 4UNTA 3AS0A 3RPKA 5E2JA 1NAMA 5GS3A 3L3OA 4C4KT 4JO2L 4EN3A 4ZO8A 5I1JH 3GMLB 5C0RH 5MERA 4M8QB 2B39A 3GSVB 2VKWA 2ZOLA 3O41B 3T1FB 1MCWM 5EUKA 1Q72L 1VFAA 2A6JA 3MGOB 1S5IL 1LEIB 2R2EB 1QO3B 4KUCF 5CKGA 1L7TH 2BK8A 1NGQL 3V6FB 2V2XB 1BVKA 3BW9B 4PJCF 2WLYA 3O3EA 5JIHA 1BOGA 1Y6MR 4KXZI 3BHBA 1U8OA 2HLFD 1NFKA 2VOTA 1AP2B 5MEPB 1T7VA 1SM3L 1YEHH 4OTXL 1JZ7A 3MRBA 2FDBP 5BV7C 2H32B 1T7YA 3TA3A 5TDNA 1UM6H 2X09A 3MR9B 2BY0A 1FFNA 1F45A 3BO8A 3ZZ1A 5I16A 3S8WA 3RU8L 4ERSL 3NN8B 2GJ6A 5AZ2L 3GBMH 4ZOEA 1JGVH 4N1HB 5F8RC 4IOFD 4OF6A 2RIKA 5IHZA 3QHZH 1R3HA 3ZHKA 2IAMA 5HVHB 4XAKD 2APWA 2GK0A 5INCB 4PGCB 2HKFH 4NNYB 3FFDA 2IH1B 3ROLB 1TJGH 3QNYB 1JWUA 3T0BA 2FH8A 1G7QB 4Z95H 3ARBD 15C8H 1KJ2A 4Z7OF 4GSDL 2DF3A 1ZGLB 1CQYA 5HXMA 2XNAB 5ADOL 2ESVE 3WHE1 1GGIH 2OP4H 1DSFH 5IQ9B 3O11B 4OUUA 2VXTH 4GMTH 1LO3L 4U1NA 4E41E 3FO1B 1MLBB 4HUXB 4NO0B 5C0CB 2A6KA 1A7PH 3D9AH 2L7UA 4G8EB 3H7BB 5GISH 1UCTA 4CAGA 3DXAE 4U1HA 2A6DB 2ZUVA 4NM4L 5FCSH 5H37G 3DI2B 3V0WH 1NGZA 3T09A 1ZTXH 1EHLL 5TQ0L 4QHUB 5IFAH 2BHYA 5D5MA 1K6QL 1CFSA 4OD2B 2YPVL 5FB8B 3G5XA 5EU6B 2QSCL 4JB9H 2R15A 5EOCJ 4ZG1A 3EOTH 1UXWB 1OTTC 1XGYL 2EDDA 5GHWH 1TZHB 5FXCH 5KVGL 5GRVK 1I85A 4M62H 3QH3A 1JBJA 4UT6H 1HKFA 4RRPG 4HJJL 3ARBC 3TJEL 4A6YL 2O61B 2XQYK 4KZDH 3NOIA 5CJQH 3VFMA 5ITBH 1MCHA 3D0VB 35C8H 4I9WE 1MJ8L 1CZ8H 2O26U 4H1LB 4D0DB 1ZA3A 5FYKH 4YPJA 2CKNA 4I3RH 3ZYJA 4KTDL 3MV8A 5C07B 5CBEB 5C92A 5C9KA 1FDLH 4X9FA 1A6VL 4KAQL 4WU5B 3RL2B 3LN5A 5FGCB 4F15B 4EZMA 3UMTA 2XI9A 1DL7H 2AP2A 4OGYH 1KELL 4S1RL 3HG1E 4NHUB 1DUZB 1QSFD 5FECA 3SJVB 5EZIH 5GXBB 1ZLUH 4R4BB 3G6DH 3HMWL 4FQIH 4PLKC 5BS0E 4TUKL 4WFEE 3BSZH 1FRGL 4IIQA 4KVNL 4ODBD 3H6JA 3PV7A 2CO7B 5J89A 5EU7E 1DQDH 3LS5H 1DFBH 5J13C 2XT1B 5GIRB 3UYOD 4IRJC 4FFVD 1NDGA 5GS1C 2J8UA 2DBLL 3D6GA 3SKNA 4FQXB 4MMXC 4G8FB 2Q7YA 5SWQB 4OV6F 1IQDA 1ZAGA 3EW3B 3Q0HA 4Y4KA 3EJZC 3P9MA 2HJFB 1U95B 5C6TL 4ZS7L 4OZFH 4AT6A 1KENH 1NUGA 1JGEA 2GTWB 2Y5TB 4Q74A 3AREB 4MCYA 4KROD 3FB6B 1I9JL 3HZMA 3O6LH 1MQ8A 4XC3H 1QR1B 5CGYC 2ZCLH 4AIXA 3ULVD 3PXJA 3C5JA 3GMMB 5J8OA 1ORQB 3TNMA 1F11A 1N8ZB 1UKQA 4G9FB 4ZUTB 1GIGH 1J1PH 2B1AL 2VLRB 4M6NL 1UT9A 2CKBB 4PRHB 2FO1A 1LO4L 5BW7A 1QYGL 3QJHB 5D7SL 1YMHB 2NY5L 4GQPH 4XTRC 4KRLB 5FO7B 4GRLC 5EOTA 4GMSL 2IF7A 4YHOH 4NNPH 1IGCL 5BRZB 1T66D 1QZ1A 1IM9D 3DETD 2VQ1B 3O2WH 3TA3D 2DIAA 4OF5A 2GJ6D 4G6ML 4FQ2L 3BDXA 4WIQA 3BZ4A 1AQKH 2N7AA 1H5BC 1EK3A 2J88H 4KMTH 2I9LB 1LNUB 2R29H 3ULUH 2IAMD 3VRJA 4CDGC 4JQXA 4MHHG 3OJVC 4ETQB 4X6EB 1CD1B 1ZVYA 4S2SB 4EN3C 4N5UA 1U42A 1MREL 4TNVK 4I2XB 3PDGA 2FSEA 2YRPA 5HI3D 4NZJA 4KTEL 1BP3B 12E8L 4NQCE 3PHOB 3KLAA 4HCRL 2PCPB 4UDUA 3RRQA 3ULVC 2BSED 1MJUL 4G5ZL 4M7ZC 1H3VA 4JDTL 3IGAA 3VXRA 1WC7B 1F8TH 3VXUA 1I4FA 4DGYL 3G9VA 2P43B 4QXGH 3P77B 2VDOL 3EIFA 1HHJA 1NANI 2ARWA 4ZAKA 4PJAB 4XNXH 3IETB 4CADA 5IB2A 3QIBA 3RKPA 1CFQB 1NCWL 4KJPD 5IESH 4ZFGL 4RWHA 2EIDA 3MRHB 3ZE0E 1K2DA 5I9QB 4UTAH 4OCSL 1IAKA 3IVKB 1OY3B 1C5BL 4XPHH 2SEBA 4F7TB 2H9GB 4GRWF 3HE6D 3TLRA 4NZUL 4DVBA 4HV8B 4ZUSA 1T22A 4U1LB 1ZGLM 3VG9B 1UJTA 5CZXD 4WO4C 1IAIH 5AWNL 3CVIL 4NQEB 4OZGA 3GSQA 3MXVL 3H9HB 4HGWB 1EO5A 3ZL4L 5GZOD 4OI8A 4P23B 4AIZA 5JW4N 3U6RB 3MV8D 3MRIB 1CDHA 4HUUB 2DD8H 2VQTA 3MLXL 3R06B 5DQ9A 1U8IA 1FG2B 3LQAH 1CE1H 1IE5A 2XY2A 2LU7A 3L95A 3Q3GA 3U4AA 4YDKH 3O6ML 1AD9B 4YEFA 4EVNB 2D7TH 1Z9SA 3OJMB 3N1MC 4FFWD 3RPIA 4U6TA 2LTQB 2Q86A 4L4VB 4K71B 5T3ZE 3BI9X 4NC1C 1P1ZB 2YZ8A 4QGYA 1I85C 4OSUL 5JHDB 4XCNA 4J1UB 5E5MA 4XXDB 4QRRA 5ESAA 4P48A 2L0DA 4I18C 3ELAT 3RWHA 4LNRB 3EFFB 3T4YA 1DLHA 4NUGL 5CUSL 3LD8B 3VFTB 5L6YH 4Y2DB 1DUYA 1WBZB 3WS6A 4Y4KD 3WJJA 3I9GL 1WFTA 3P0VH 4CRPA 3PP4L 1JZ3A 4LARL 2GITA 4Q7DA 3M17B 4JANA 1Q9WA 4DN3L 2UZYB 3UJIH 4QEGA 1DQMH 3GBLA 1KJ3L 1KC5L 5HHOD 1IFHL 1YJDH 3EOBA 5DK2A 1JNNH 5LXGH 3MLVH 3TO4D 3J7HA 5TGBB 1OARH 5DZNA 4O9HL 4W6XB 4FQ1L 4LMQI 5MI0B 1YNLL 4TVPH 4XX1G 3JUYA 2DMKA 1HH9A 3IF1A 4U7SA 3L3KB 1U58B 4M6OH 2EDBA 5E6IC 1S9XA 1FO0A 5I15L 3JUZA 1MHHA 1NUNB 2HWZH 2YPLA 3FAWA 3HS0B 3WE6A 1KXTB 4MNGA 1JNHA 4I4WB 5CWSA 3OKMB 1FNHA 4BZ1L 1B4JL 5JORA 3ZTJH 1I9RL 3RZCC 5C0GB 2BVPA 2MPAL 1G7PB 2DM4A 3DI3B 4LLQB 3Q5TA 1A1NB 1AI1L 3WFCL 1VGKA 4EUPG 2DQCH 4PTTB 3KLHC 2ERJB 4N1EA 2VL5A 3MBEB 2Z35B 1BWWA 1A6WL 4WV1B 3B2VL 4L8BB 3SGJA 1N4XH 3BXNA 5DD3L 1AC0A 1T1YB 4MJ4A 5A2KH 5E2VL 1NMAL 5JTWA 1A7NL 3ZSSA 5CEZE 5DJ2B 1OHQA 2AQ2A 3WO4B 3C08L 3BE1H 2HKHH 3LKOB 5F7EL 3IDNA 1KN2H 1SJXA 4V2BA 3LEVH 4YDVA 5D2NC 4MD0A 5CEYA 1BFSA 3WFHB 5KSUB 3ULVF 3A6CL 3PNWB 4GKOA 1LEGA 3GKZA 4Q58C 3O4OC 5EU5A 4KZEL 1HHHB 5FDWA 1F6AB 4OZHB 3HNTH 3KPRA 2B4CL 3JZ7A 1HXYB 1OTUD 2XICA 3MUGA 3FHAA 4A6YA 4JQXC 4P0DA 5ICZA 1KTKE 4YHIB 5I1JL 5C0RL 3NPZB 1UZ6E 3TV3H 5KSBA 4U6YA 1MCEA 4KRPC 3L3IB 3GSOA 5KAQF 1L7TL 5FYJD 3RBGA 1JHTA 3DLQR 4ZFOB 3WKNA 1PX3A 4FTVA 5DJCA 1RZKH 3CC5A 3TIEB 5C2BH 3TWCH 1WBXA 1ND0B 5IR1B 3DJ9A 1OT2A 5ENWB 3RVWC 3L5IA 5F9WB 4ZAKC 4FNLH 1YEHL 3V9FA 4OZIF 4K3GA 4HIHA 5MHSD 4WEBL 5I1GH 3ARVA 5CLTA 3VFWB 3OAYK 3PGCA 1ZHNB 3O2DH 1BIIA 3QIBC 2AK4B 4FXKB 1UM6L 4NZDA 1GGUA 2F53D 1NFDE 4X5WA 4Q97A 5IK3A 1GCFA 3WLWC 3GBML 1JGVL 3WN5A 3D69B 4UILH 3GMNA 3EZJB 3QHZL 1EJOH 2EYTA 3KJ4C 4LL9A 4KQ3H 1KIRB 2HKFL 4M8QA 5LGHH 4QRRD 1U0QA 3MRQB 3FRPA 4OAWB 5D5MF 1TJGL 4QKXB 4PJHA 4Z95L 15C8L 1ONQB 4QTIH 3PDOA 1J8HE 3VI4E 1JFQH 1IM9B 1CFVH 2E6JA 4BFBD 1GGIL 2OP4L 3RP1A 1DSFL 1T1ZA 4N0CD 2VWEC 4P9HC 4Z0XB 3NIFE 2VXTL 4GMTL 1BWMA 1B6DA 3IAPA 1JUFA 4N8VG 4R9HA 5GZND 1PSKH 4NT6B 1A7PL 3D9AL 5MEPA 3IKCA 1M4KA 1F4YH 2Z93A 3WNNA 1J7VR 4E5XA 1W0VB 4F7CB 4DZ8B 3K4AA 5CFHA 4MNQB 1EEYB 4QRUB 5DI8B 4KFZC 5A1AA 2W91A 4OF7A 3V0WL 1ZTXL 5F6IB 2OMBA 5IFAL 4NRYA 1B88A 4LKXA 1A4KA 4OZIB 2V5SA 5IF0A 1SQ2N 3HB3D 1L7IL 1NGXA 3DROB 3BH9B 4JB9L 3EOTL 5DHVA 4UDTB 2JJUA 5GHWL 4QF1B 4O00A 4M62L 4NNYA 2ZUUA 1Y0LB 2YPLD 1KPUA 4UT6L 4DFHA 2GFBA 4N8CH 5BQ7B 5TF0A 2YD7A 3HR5A 4KV5F 4KZDL 5IV2A 4RNRB 5CJQL 1MCNA 3ARDC 4OCLC 5ITBL 35C8L 2YMXH 2IJ0C 5FYKL 1OSZA 4HCRA 4I3RL 3IDUA 5IVXE 4HUMB 2BZDA 2ADIA 1FDLL 3O6KH 3V6ZA 2WBWB 4JZJA 4MYWB 3EDDA 1RULH 2J8UF 5HYSB 5I73C 3K2UH 4Q9RH 1U93B 4LVHC 1DL7L 5F1OB 4OGYL 4X4XB 1FSKC 4XP4H 5EZIL 3RL1A 1FC1A 4KY1H 5FB8A 4P5MB 4X6CA 3O45B 3UTZA 2Q87A 2AXFB 2ICWB 1TZHA 1IEAA 1VERA 3B9DA 2GSIA 3EJJX 1DQDL 5HGHB 3LKSB 2F54B 3LS5L 2OJEA 1DFBL 4PLNC 3BYYA 2D31A 3MJ8A 4EKXA 2PYEA 4S1SH 4KDWA 3I6KB 3KPRD 2O61A 1HOCB 5F7WC 4OFKA 5LG1A 3N0PB 1VEOA 3GMOB 4S0SD 3I6LE 5CBAA 3BWAB 3QDGE 1WTGT 4G8GA 1P2CB 1CVSC 3MRLA 4YO0B 3CX5K 1KENL 5JZ7D 4QYOB 4U1IB 1BAFH 4AH2A 1IGYB 3K3QA 2OTUA 4C57C 3O6LL 4XC3L 3TIDB 2ZCLL 4I5BA 2NXYC 4LVEA 4F7PB 1NEZG 2Q1EA 4NHUA 1WZKA 1GIGL 2CO6B 1J1PL 4MD4B 4WHCA 5IB1A 4RGNE 3L3GA 5DS8A 5I1KH 5DD0H 1HCFX 5C0ND 2Y7QB 3C60A 5J11B 4YHOL 4NNPL 4WGWB 5FKPA 4CGTA 4P3DA 3O2WL 3HI6H 4K23H 3D3VB 3S97C 1ZT4A 2DTSA 2YD4A 4OLUH 5L9DH 3U0TA 4FQXA 3IXAB 2A77H 3NAAL 1AQKL 1CGUA 1KT2B 5HHOB 4KMTL 2J88L 3MRCB 2R29L 4K94C 3ULUL 5E7FA 2HJFA 2R0WH 3E6FB 3BD3A 3AREA 1SYVB 5DA0B 2A74A 5F1KC 3UJJH 3ORJA 2HRLA 2BOBB 4C56A 2X1WL 1J0YA 5DWUH 3TN0C 3RTQD 5DDHB 3U4BH 2ZUWA 3LH2H 2FZ3A 2ITCB 5JMOC 3V4PH 3FQXA 2FX7H 1O7SA 2EDQA 4UMGA 3M45A 1F8TL 3JWOH 3K81A 2XXMB 1FHGA 4QXGL 4Z5RB 4Z78A 3TP4A 5HDBF 4YE4H 3WXWH 4OZGF 3W81A 1HH6B 4XNXL 3QZWA 4G42A 4L8CB 3Q1SH 3U0PB 5IB3A 1INQA 3FO9A 1ED3A 4RGMC 4R97C 4NDMB 5IESL 5FO9A 3CFJB 4BSWB 1F5WA 2ZZUT 3IDYC 4GG8B 5IBLC 4UTAL 1M05A 5I74B 3WN5C 4XPHL 1GXEA 3C5ZA 5EIIB 4X83A 1SBBA 2WANA 4QXTB 3C6SA 4X8JB 4HIIA 4JVPA 5EZJB 4HS3A 3S3SA 1X7QA 4I2XA 4K8RH 3LPFA 2BHUA 4TYUA 1IAIL 1F3DJ 2YBRA 4GH7B 1KXQE 4KKLC 5H37H 3VXQA 3PHOA 4KGJA 2UZIH 2AV1B 1D6EA 5C0AE 4CNIA 1MPAH 5K59F 1NCAH 3GHEH 4WCYH 3HI1A 3MOBH 4KKCD 3RWGA 1MHCA 3LV3A 2DD8L 1GGTA 1D5BB 3P77A 1FNFA 2NXZB 2VITA 3QUXA 1RZJH 1WTLA 5FO8B 2V17H 3B3IB 1UB6B 2NY5C 2DQJH 4UNUA 3VXTA 2IBBA 2OSLB 2EH8H 4F58H 3SCMA 2VZVA 2D2OA 1TCMA 2D7TL 4PRAB 1LILA 4XP5H 3TPUB 4F33A 5CINH 3WNPA 2NY6D 5T3XH 4N0UA 3X3FH 5HVHC 2FH6A 4BFGA 4LLYA 3PWPA 4PRDB 2GYSA 4PJGB 2VUOA 1A6ZB 2PYED 4NQDA 1Z5LB 3VFOA 2WIIA 5HY9B 1RU9H 5GSRB 5L8JB 5ILTH 3ALXA 5ECJE 4L4TE 2R2HB 4NKMB 1ZLVH 3U9UB 3EOAB 4Z76A 3LIZH 1S7WB 5L6YL 3JBG7 4JPVH 5C0BA 2MMXA 2F53B 1V5JA 2C3XA 2QADD 3P0VL 3MRFA 2YA2A 1FG2A 5ESQB 3QPXH 1BF2A 5IOPA 3UTSE 4J4PD 3UJIL 1DQML 1K4CA 5F7NC 4HZAA 1GL4B 2DM7A 5JXEC 2OL3H 3HTLX 1JNNL 2HVKA 4EVNA 5F3HB 1LMKA 4AM0B 4L9LA 4ELMA 4TVPL 4YDIH 3CZFA 4M7JH 3LMJH 1J18A 2ZJSH 2NY1D 3C60D 1P1ZA 2EC9U 5GRUL 2B8OT 4M9OA 1RK0B 1HSBB 2W65A 4RMQA 2HWZL 3L3DA 4I77H 3MLSH 5T5NG 5HVGB 1UJ3B 3B8SA 3DV6A 4ZFZA 1S7TB 3D48R 4FABH 4OF0A 3X12A 1SJHA 1U9KA 1F3JA 3RHWF 5ANMA 1KIPB 2R2CA 4U1GB 2CRMA 4FQCH 3CUPA 1JRHH 2H41A 4BYHA 1B0GB 1FL3B 1OAZH 3WFZA 3U7WH 3BQUA 2E7CA 1JZ6A 4C56D 4F15C 4RAVB 1EAPA 5DEFB 4FP8H 3OB0K 2NZIA 4X6DB 1OAYH 2ICWJ 5IMMB 2BP3A 1N4XL 1MRFH 3ESVF 2EDFA 1WEJH 5HBBA 1I1RA 2X9WA 1JPTL 3P0GB 4QWWC 5EOQL 3OKKA 1RZ7H 3CSYA 1EDQA 2HKHL 1C16B 3TH4T 4OLYH 1LEKB 1KN2L 4F57H 3LEVL 1WBYB 4DJMA 1A6UH 2VZSA 2XTJE 1A14H 3MOAL 1MFCH 5HHPB 3PDDA 4M9PA 3EHBC 4GAJH 2DI9A 3HNTL 1Q9LB 3BN9D 3NACH 2G60H 2IANB 1GOHA 4FQXC 1QBLH 1VB9A 2HJKA 1MAMH 5SWZA 1R3KA 4S1QH 2E9IA 5HGAA 1RIVL 3S37H 1IQWL 1W0WA 3BJ91 1R24B 2NX5A 4MSWA 2WLZA 3AREC 1QFOA 4MCZA 1G9EA 1A47A 3ARRA 2APTA 3L9RB 3MBEA 5FGCE 3TV3L 5F6HJ 5L2JB 4L8BA 5JQ6L 4RGOH 4LRIC 1RZKL 5GJTH 3P4MB 3ARYA 3KHQA 3TWCL 3QUXD 3QIWA 1D9KB 2VKXA 3RWDA 3TBYB 4PJHF 5CIPH 4FNLL 3JTTB 5F96H 2AJUH 1P9MA 2X4QA 2C1PA 4LCWB 1JIBA 5I1GL 4R7NB 3ZKSD 3SCMD 1BJ1H 3B9KD 5HI4D 3VE0A 5FOBB 3IS1X 3WFBH 1ETZA 2EYRB 3OJDA 4I48A 1V3JA 3INUH 4AK1A 1WZ1H 1FZOA 4JFYB 3BH8A 4ZTOH 5IMLB 3C5ZC