4ZSOA

Crystal structure of a complex between b7-h6, a tumor cell ligand for natural cytotoxicity receptor nkp30, and an inhibitory antibody
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
MQIVLTQSPALMSASPGEKVTMTCSASSSVSYMYWYQQKPRSSPKPWIYLTSNLASGVPARFCGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody Light Chain
publication title Crystal structure of a complex between B7-H6, a tumor cell ligand for natural cytotoxicity receptor NKp30, and an inhibitory antibody
rcsb
source organism Homo sapiens
total genus 50
structure length 214
sequence length 214
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zsoA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zsoA01
3OF6A 4K8RC 2P4AB 3U4BL 3TP4A 4ONFL 3O2VH 2VQTA 3IFOA 3IJHA 4Y4HA 5L0QC 1QA9A 5F21B 4NZUH 2IPKB 5ITFB 2ZG1A 5DUPL 1KJ2L 1PW3A 2DQGL 3VD5A 4IDLA 4X9GA 1UENA 1S9XA 2F54D 4Y19E 2AGJL 3HE6D 1S9VA 2UZIH 2F58L 4MLSA 2EDWA 2GK2A 5HYSA 4PJFA 5E8NB 5LWYH 5IBUB 4NZRL 2QQQA 3OR6B 2A9NH 1UXWA 3QO1A 1K3ZA 2AXFA 4XCNB 4CRPA 1ODAA 2NY7H 4F8QA 1JRHL 1ULVA 4NNYA 3VXUE 2AV1B 1DBMH 3VWJA 2P24A 2AAVA 3QULA 1KULA 2P5EA 7FABL 3T65B 3FN0H 5TGBB 4DZBB 2AJSH 4G5ZL 4LSPH 4ALAH 5DZOA 5L8JB 1X44A 3FB6B 1QRNB 3RUGF 2H3NB 1LE5A 3KLSA 2ERJC 3RZWA 1IC1A 2F19H 1MF2H 3OXSA 4IRJC 3GSWB 4NQSA 2C4FU 5HHNA 2X2YA 1EPFA 5HHOB 5SWZD 2NX5A 3AY4C 4JQIL 1WFOA 3RTQB 1XMWA 1T1WA 3QXUA 3VXSD 5J56B 4JG0L 2P7TB 1QVOA 1NBVH 2HT2D 3SDDA 3F12B 1G7QB 5JZ7D 1DQQA 2DQJH 4ACPA 3CSPA 1EZVY 4L4TD 5KSVA 3D9AH 2BJML 1F42A 3MLVL 3VH8G 5HD8C 3NA4A 1QSED 1DQML 1KNOB 3HMWL 2PTUA 3GRWH 4YHYC 3W5MA 4ZUTA 5J11C 2DL9A 4YC2B 5D6CB 4UT6L 4ENEC 1MEXL 3O11B 2KQNA 4JFHE 1Q9OA 3G6JF 1GZQA 4G80B 1WZMA 2HWZL 5CKAA 2ZCKH 2LVCA 4OI7A 3UYRH 2NY5C 1FIEA 1T66C 1UA6H 4PLJD 3B4NA 3F7VA 5EO1A 4UTAL 2YPVH 1OW0A 5DD5L 1HHGB 2AEPL 3UTSA 3DGGB 4PJ9A 5B3JF 5E6YA 1PSKH 1DP0A 2C7UB 2ICWB 2XPGA 1BQHA 5H37H 1YNTB 1IL1A 4U1SA 4TUOA 2NNAB 1FH5L 4BJLA 3ET9F 2A74A 4P2QD 3VFMA 4TQEL 2GYSA 3U6RA 1ZWIA 5E00A 1H8OA 2R0LH 3L5XH 4O51A 1IAOB 3CFJA 4NN7C 4OCNC 5C0AE 2CKNA 1W72H 1IAMA 3M8OL 5FYKE 3ZDXF 4YHMH 3EYFB 5GGSY 1S5HA 3REWB 2EXWD 4PBVC 5DGRA 3FO0H 2XKUA 5C09B 3ES6B 2F54A 4GRLD 1LEGB 2AJZA 4Q58C 3FO9A 5JHDE 3HE6A 3VWKC 3BIKB 3HAEB 1MCEA 5ACLA 5BW7A 1A14L 4NO5B 5E5UB 5DQ9B 1ORQA 3VCLB 2DKMA 2XZAH 2HH0H 5JLZA 2CLVA 2YPKA 3OJ2C 4MZ2A 4NHUB 5JIPA 2AS5M 4KU1A 1RUKH 1FC2D 3FQXB 1OTSD 3M1BB 5D6DC 3T0WA 4MAYC 1Y18A 2DRUA 5F7MC 2FSEB 4PBXA 2YA0A 3BD4A 4J3WA 3TVMC 4PJ8D 5C2BL 2KBGA 3QP3A 5GHWH 4OCRH 1LE9B 4UQ2A 3HPLA 3NPSB 4OLEA 5DVNA 1RUPH 3LKPB 1GC1C 1CLOH 3OHXB 5SWZA 3S97C 2X44D 4RAUB 2IH1B 2GJ6D 3PHOB 4MNQD 1ZLWH 2A9NL 3BD5A 3LRGA 5IK3B 1IZKA 4L4TA 4ODUB 4OGAD 3WV0A 4LQFL 4JN2A 1HYSC 1GVIA 3FHAA 2NY7L 4HCRH 3EJYC 1QSEA 1ZA3B 3G5XB 3C8KA 3H8NA 1DBML 3O6FD 4XTRC 4X7DC 3V6FA 3O41B 3CDYA 2OJZL 4GW4A 3IDYC 4K23H 1W8OA 2ZSVA 3FN0L 1DL7L 5A2FA 4LSPL 3V6OE 4GKZB 4P2RE 4ALAL 2ESVD 4AQOA 3VXNA 4ISVB 5DVOA 1MF2L 2WIIA 3ULUE 1KCSH 2FGWH 3F58L 2UWEE 2Y25A 3PHSA 3DMMC 2KUTA 4X7TB 4JFDE 1VKXA 3BX7C 5LJYH 4W6XB 1F00I 3ILQC 4JVWA 2DLHA 1FAIH 3G6AA 4JN1H 1NBVL 4L4VB 4MCZA 4UNTA 2MCPH 3NCYP 1G0YR 2SEBB 3KXFD 1KGCE 2DQJL 5DLMH 4JGJA 3VFRA 4U1MB 3D9AL 3HAEG 4P2QA 5C0DA 4I2XA 4RAVB 1AR1C 3CSYA 1OD7A 3GRWL 4GBXB 2CIIB 2BNQB 5HGBA 2G9HA 3B9KA 1PG7X 1UADC 5KVEL 4JFED 2W59A 2R1YA 5GRVL 2BK8A 3KPOB 4JDVA 5DHVH 3RA7L 3ABZA 4K2UH 4PLKD 3VU2A 2ZCKL 1P4BL 1T83C 3UYRL 1UA6L 1MI5E 4GRLA 2PXYD 3RY6C 2YPVL 1R5VB 3MTRA 4LCWE 1KT2A 1VHPA 4Z7OF 4PJXE 1NCAH 2OS7A 4GOSA 1UEMA 5DMIH 4M7JH 2WBJB 1CIUA 1AGEB 4I77H 2EC9T 2X10A 2FO4A 3RWDB 1I7UA 3EOAB 3G04A 4RMVA 1T5WA 2IAND 4UINH 2VZVA 4YIQB 5FGSA 2FJGB 1CQYA 3RUGE 4P5TD 3L3IA 3QDJD 4ZOAA 1OD9A 3IRZA 2J8UB 3RKPA 3QDGB 4PJ8A 1XF5B 2OTWA 5DJXB 3QEUA 4XWOD 4JPWH 2CDGB 3X11B 3FO0L 1DN2A 4QRRE 4UBDC 1X3DA 2ED7A 1CDYA 2CDEB 5GRZA 1H9VA 1SQ2N 2VXUH 1JZ5A 3V8OA 4JPVH 5BVJA 2YWZA 2GJ6A 2QQNH 2VDQL 3ARYA 4MNQA 1CGYA 5EU7E 4GRMB 5DHYA 2O61A 3TN0B 3KJ4C 4D0CA 3ZKMD 1S7UB 3QNXB 2XZAL 4NDMA 2AXGA 4WFGD 3BP6B 1QFHA 2EICA 3RWEA 1IM3B 4Z76B 3VD4A 3G6JE 4JRXD 5EOCH 2ZWLT 3O6FA 5JHLH 4KH2A 2X4OA 4X7SL 4NN5C 1JHTA 3UTZA 3KYMB 2P8LB 4GG6F 1EMTH 1U8KA 1J0KA 2ESVA 2JIXA 5D8JH 4OCRL 1XH3A 5B3JE 2DQCH 1QUNA 5KG9A 1RUPL 1FPTH 4LSDA 3X3GH 1I1AC 3UAJD 4HIHB 5JW3H 4K7FB 4OIIL 1E4XL 1D5BA 2X4QB 1SY6H 1DLFH 4MJ5A 4MJ6B 5IFAH 1M7DB 4OLXL 3KXFA 2ORBH 3SY0A 3PXHA 3EYUL 4Q6IB 2Z92B 3IXTA 4YBQD 1IQDB 4D2NA 3WLWD 3ZDXE 4HCRL 1K3IA 1ZVSA 3K4AA 4OCXL 4QRTA 1PKQA 5C8JA 2A38A 2Q76B 4JZOA 4K23L 4JFEA 3PDOA 3AB0C 1A9EA 3G5VA 3VFPA 4F9PA 4M8VA 3T0EC 4GO6B 4KWUA 4UIMA 1P7QB 2W9EH 2WMPA 3FO2B 5TDPA 1IMHC 1CDBA 1VADA 2PXYA 1KCSL 2FGWL 4Y4KD 2NY6C 4PJGB 4HJ0C 1CICC 4PJAF 1QSFD 2WANA 3LPFA 3MLWH 2LAGB 4L8SA 3WS3B 5BXFA 3QFJB 3ORJA 4UUJA 2DKUA 4B0MM 1U92B 1UZ8B 4RAHA 1FAIL 1I4FB 3QEQE 2V7HA 2Y7QB 5CEXA 4JN1L 5E6ZA 1IVLA 1JK8A 2MCPL 4CMHC 4QTIL 1SVCP 5DLML 1MH5A 2IANA 1P1ZA 3QWOB 1MAKA 3Q6FB 4YK4B 1VFUA 3RAJH 2VXSH 5IB1B 4P5TA 3L3GA 3QDJA 3L6FB 3KYOB 3QG7H 4FQXB 3B6SA 4CDHA 3QHZH 4BSJA 3NFNB 1CFSA 4X5LA 5GGRA 3OKKA 4JKWA 4ZPVB 1MCBA 4NPYB 5D93B 2Y36H 4K2UL 3PHQB 1P4IH 1DQJB 1KIUA 3F6LA 4N5EC 4W4OC 3GSQA 3IAGC 4UDTA 1F45A 4G8EB 2VLJD 4NWUH 3CSBA 5DHVA 5J6HA 3S6CA 4EI6B 5DMIL 4CADA 5L2JA 1T0MA 4M7JL 3F65A 5DD6B 32C2A 4I77L 4BQCA 2HJFA 4WGVB 4IS6B 4H26A 2EKSA 1NGWB 4KROB 1YN6A 2K7PA 2NR6D 3ECBA 1DANU 1KTRL 2YD1A 5L2KE 4JRXA 4F7TA 5JMRA 3IETA 1U0QA 4LGRB 3LN9A 1WBYA 3V52H 3VXRB 5BZWA 3ILPB 2VLRD 1MFCL 4PRHD 1OAYH 1V8HA 1JIBA 1OGAD 3UPCA 5AUMB 1I3GH 2J8OA 5F7HA 1NMBH 3W81A 1OAQH 5EZOH 5JORB 2DWEA 2EEAA 2WV3A 3B3IA 4MS8C 1NFDB 1T1ZB 2VXUL 4NHCH 4K7PY 5TDNB 4JPVL 1G9MH 2QQNL 1DVFB 3PWLB 4UAOB 4U1NA 4GAGH 2X5PA 2V2TB 3K7UA 5LQBH 1EVUA 1DE4A 4JM2D 4R8WH 4KFZC 2OJEA 1CFQB 4GKNB 4N8CH 4FQCH 1WFNA 3EFDL 1T20A 5IG7B 3U0PB 3NFPB 4WU7A 2FJFB 3FN9A 4KKNA 3ALPA 1U93B 5EOCL 3RJQB 1AIFA 4AQ1B 5JHLL 1TTGA 3MRCB 4BZ2H 3X3FH 4EIGB 5I8OH 4TNVF 3GKWH 4PJ5E 3F7YA 4GRWH 2GUOA 2NLJB 1H8SA 2BOCB 4RSVA 3UJIH 1VESA 2DJSA 3U48A 1CLYH 2QSCH 1M1SA 3I6LE 5D8JL 5EIIB 1C16B 2DQCL 4Y4KA 4BELD 4NFBA 1FPTL 1QSFA 3X3GL 4OLUL 2NY3C 4MNGB 5CJXC 2GSIA 3N85H 1OWRM 5JW3L 4MAUH 5IW1A 2XXMB 1SY6L 1DLFL 5IFAL 1AKJB 4ZDHB 1DBJH 2ORBL 1MCDA 5FYLE 4C56E 3VRLE 3ZE0F 1FQ9C 3QIUD 3CC5A 3S9DB 3QNYA 1GHFH 4Y8AA 1L0QA 3FN3A 1CT8B 5ITBH 4G9FB 4XVTH 1G6RL 4YDIH 4CJ0A 1CCZA 1MCWW 3MRLB 4EI5A 2BSSA 4HIXH 3ARBC 4DN3L 4S1RL 5HYQB 2L7JA 3QIBD 5MEND 3PIQB 1G6RA 4OIBA 4Y5VB 3IFNL 3O0RH 4NQVB 3WJLA 1A6ZB 2EO1A 1EEZA 2W9EL 1ERNA 5CJ5A 3WKMH 4N0UB 4PRPE 4MQXC 5JTWA 3S4SA 2VLJA 3BP7B 3O3UN 1KLUB 3MLWL 4O9HH 2HT3D 1RULH 4KRPC 1UT9A 4APQB 4OZFB 4O5LH 1GGBH 4U6HB 4HH9A 2CLZB 2NXZB 4WUUD 1K4DA 2VDOL 5F1IB 4KK5C 1VB9A 3DVNA 5MP6H 2V5RA 4RGOH 3QPXH 4HG4K 1ZGLA 2PW2A 4G6KH 1WWBX 3GMQA 4UNUA 3RAJL 4HFWB 4KMQA 3HUJF 4X83A 4GQPH 3QEHA 4RMSA 3DRQA 2VLRA 1AGBB 4PRHA 4BQBA 1VA9A 2F53D 1OGAA 5ID1B 3IDXH 5ISZE 5HBBA 3RNKA 1TVHA 1U3HB 1M4KA 1S9YA 4S1QH 4YO0A 1P4IL 2E6PA 3HE7B 4J8RB 4P59H 5M94B 4HJJH 1JHKH 3FQRA 1EHAA 3Q0HA 5CJOL 5CLTA 3KHQA 4OZGA 5LVEA 4K71C 4NWUL 3MGAA 2VDRH 3T4YA 3GSNB 4JM2A 1KTDA 3RPIB 3MBEC 5GS2H 1NMCB 4LBEA 2H6PA 4WEBH 2B20A 3RBGA 1T0PB 3WE6A 2BSTB 4AEHH 4EN3C 4Z0BH 4R4BB 5C0EB 3WS6A 2J88H 2XKSA 2GY7B 3LIZH 3G9AB 4U1KA 1PJ9A 1FL6A 3RJDA 3ZZ1A 5GZND 3MLXH 5KVDH 2VJXA 3SDCD 4PJAE 5KTEH 2MHAA 2K9UA 2OQJA 5DURB 2YKLH 3MA9L 4JG1H 1IGCH 4NO3B 4DW2H 4WHYH 2JB6A 4HHAB 3I02A 1NMBL 2FB4L 1T04B 4MQTB 3DO7B 4NKDA 1FVEA 4E41B 1S7QB 3V5HA 4NHCL 1GAFH 1OB1B 1OAUL 1G9ML 4NYLB 3OL2A 1LEKA 4RNRB 1UWXK 4GAGL 4H5SB 3UTQB 3V0WH 1YDPA 2WBWB 1YYLH 5LQBL 2R0WL 4R8WL 3RL2A 4UT9L 1XGTA 2R1XB 4N8CL 2P42B 1Z3GH 3QIUA 1J8HD 1E0OB 2PTVA 4R2GC 3MLRL 4HMDA 3HB3C 3KS0H 4UTBH 2M1KA 4Z7UA 5GS2D 4WI7A 2V5MA 1P84J 1G9NH 5EBLA 4BZ2L 3VFSB 3GKWL 1KJVB 4P3DB 4F7EA 2R0KH 2W65B 3LQZB 3QIBA 5MENA 3UJIL 2QSCL 1A4KB 5BV7H 2ADJA 4I0PD 4IM8A 4YXHH 3D85D 1EJ6A 1X6LA 3HZVB 3KPQB 2ARJA 1PYWA 1U91B 1B90A 4Y19D 1AXSA 1WC7A 3CPLA 3MRFB 1FVCA 4NIKB 4CN1A 5DC0A 3GMNB 4ZSOE 4MAUL 3ZT6A 4U0RB 5IVNA 3RGVD 3T0BA 2VQ1B 4L5FH 1CDHA 4WUUA 2AV7A 2QADC 5DS8A 3IRPX 4F7CA 3K46A 2NY0C 5IBLC 4Y16B 2I9TB 4L1HA 3I2CH 4O02H 1LK3H 4X6CF 3VE0A 1GHFL 3PWPB 3U2SB 5HI3C 1D9KD 1WSST 3SKOA 3KYNB 4G6JH 5ITBL 1A7RH 4M61A 1N6VA 3D1MC 4XVTL 4YDIL 2JJUA 4JFOA 4RDQF 1BD2B 5CEYB 1FORH 1U8IB 2GK0B 3IDIA 3MNZB 2PW1A 3MNVA 2F53A 4HIXL 5FUZH 3BUTA 3QG6A 3AXLB 3NCYS 4R4FL 4URTB 4JFFE 4R7DB 2XA8H 3WD5H 5J9PA 1SJHA 3O0RL 5HYFA 1P6FA 4O4YH 4AZ8A 1U8PA 4TSAL 1NJ9A 3WKML 5M95B 5SWSE 3UMTA 1PGRB 3NIFF 5EZLA 4XMKH 1P7HL 3LS5H 1IQWH 4O9HL 3LKNA 4NKMB 1JRHI 5E8DH 1RULL 4HIIB 3RFZC 2ATPA 1H8NA 5KN5A 3CLFL 4O5LL 1OQOA 3W9DB 1D5ZA 4P5KB 3CIQA 2DQIH 5HGDB 4F37K 2BP3A 3RVVD 3EKCA 1KEGH 1K8IA 4G6FB 5MP6L 3SCMD 1QBLH 1EFXA 3GO1H 3MRGB 4RFEA 2IQAB 1HEZA 2AEQH 5FYKH 4G6KL 3AS3A 1HHKB 4M93C 1N3NA 3LD8B 4LCIH 4HFUH 3DX6A 4PJCF 1DLHB 5GS1C 3SDCA 2AK4E 2BMKA 2X41A 1ZT7A 3BHBA 1LEIA 3IDXL 1ZXQA 1GZPB 4UB0H 3H42H 4IRSB 4S1QL 4P59L 4HJJL 3F7RA 4PJHA 3DUUA 1OF2A 2IADB 5C0RH 5EU3B 4OKDA 2VDRL 4LSSH 3ZE0E 1UCBH 1AGCB 3SE4C 1EBAA 5SX4I 2NY2B 4X99A 3WUWB 1MHPH 1MFEH 2FL5B 3IDGA 3WSQH 3E2HB 5IEKB 2AK1L 5CZKA 4FXKB 3NCEB 4N0RA 4WEBL 3SGJC 4Z0BL 2JCCF 1GGUA 1IM9D 4DAGL 1J8HA 5L6YH 4AIZB 2J88L 3UJTL 1A7PL 3L9RB 5E99H 1WK0A 3LIZL 4POZC 1RZIB 2VKXA 3BYYA 2DL2A 4F7MB 4GAYB 5J13B 3MLXL 5KVDL 3DURA 5KTEL 4R90H 1CVRA 2YKLL 5DA4A 4JG1L 1IGCL 3E6HA 5FA4A 3JV4B 5D1XC 1I9EA 4I0PA 3U7WH 3D85A 4JFQA 5FGBC 4Y19A 5JHDD 1EGJA 1PZUB 1GAFL 4ZODA 1A6PA 3RGVA 3V0WL 3BPOC 5I1CL 3LEVH 3NZ8B 4YDVA 2R2CA 3OKDA 3V4PH 4YX2H 3HUJE 5CKGA 2BVPA 1HSAA 4BH8A 4OZHB 3RWHA 1Z3GL 2HN7B 5D1QD 4KK6C 5CJQL 1D9KA 2GTZA 3GSOB 1KTLA 3JV5A 1G9NL 4PLOB 3TO2B 1DDHB 4JZNB 2VOTA 3ULUH 1G7PB 2R0KL 4H1LA 4ODWB 4ZFZA 2CK2A 3H6JA 4WW2B 1RZGA 1EAPA 3G6DH 2GCYB 4OZ4B 4YXHL 5FIEA 5I76A 2H45A 1HOCA 5KAQG 3LKQA 3OR7A 1I1YB 1W0VB 3MUGB 2V5SA 3C60B 3UYPA 1RK1A 3SKNB 4Z9KB 4L5FL 5E24E 4OD2A 2VLME 1HHJB 4GJTB 3MRRB 1YC8A 3EJJX 4L9LC 1I8IB 1OCWL 3QUML 3D0VB 4O02L 2FLRT 1NCUA 4KJWC 3TNMB 4JQXC 3EJZC 1KIRB 4HUWA 5KSBB 2C3VB 4G6JL 5AZEL 3WUWG 4QRSA 1B3JA 1S7SA 2IBZX 1RU9H 3QUMA 1YEDB 5C0ND 4AL8L 5KVGH 1EAJA 4Z8FH 1X6NA 4P2RD 2XA8L 5DJAA 5BJTA 1YPZE 4MD5A 1S3KH 4BKLB 4RISL 5IWLA 1U6AH 4XX1E 4Z7WF 3PABA 3CDCA 3T0EE 2DF3A 3L7FB 3LS5L 1IQWL 1T89C 4JFDD 5E8DL 5I75B 4P46D 3H9HB 4XPGH 1BAFH 4GW5B 2QQLH 4E0RA 4ELMF 3FB7B 2DQIL 3QHFL 1R3JB 2GFBA 2BX5A 1KEGL 4C55A 5FO9A 2IEPA 3RZCD 1BQLH 1QBLL 5IR1A 3GMOB 3DWTA 3GO1L 3WJJC 2DBJA 2AEQL 4K3JH 3JUYA 1NCWL 4FHBD 3ARPA 3L3HA 3NIGF 2NW3A 4Z7NF 5C86A 4NQEB 2AXJA 1X5IA 5I2IA 4O58H 1Y0LB 4LCIL 5EOTB 4HFUL 4YWGH 4FRWA 4ZO9A 3FB5A 2D9QB 4OAWA 1MCOL 3RNQB 3ISWA 4PTTA 4OJFH 2Y6SC 2HLAA 3EDDA 3VMOA 1J0ZA 2OXHA 1IGFH 4UB0L 1RJLA 2Q6WA 5H94A 5J1AA 2CUHA 4ZXBC 2AJ3B 3LKOA 5JHDA 4LCWD 3OJDA 3DV6B 4QCIA 4Y5XC 5F97E 4EQ2A 4LSSL 4M3KB 1UCBL 3VDBA 3WIFA 2A6KA 4X6CE 4HK0A 1MFEL 3WSQL 3EOBB 4J7RA 3QUXD 3D5OF 3KLAA 5IFJA 5D1QA 5HGHB 3BIBX 5L6YL 1UB6B 4TTDC 5E99L 1KFAH 2WUCH 1CE6B 3GKZA 2Q20A 3JZ7A 5DT1H 1VEMA 3I3BA 3BKYH 3IDMA 3BZEB 3WFHA 2APFA 5GGRY 1AI1L 3SN6N 2A9ML 4FQIL 3W2DL 4YAQA 1GOHA 4WV1B 3BISA 1XGPB 4QLRA 2YA2A 2C1OA 5JO5B 2P47B 4R3SA 2VSCA 4P4KC 5HI4D 4WO4C 4ZFOB 3MRKA 4QWWC 1C5CH 5C71A 4TN9A 2WM0A 3OAUH 4PGZA 1U41A 2PYED 3MV8B 4HWUA 4RBPK 5IMOA 4YX2L 3V4PL 3CDGB 1BECA 1SEBA 2X4NB 4QKXB 4PJCE 4XP1H 1W0WB 5CZVH 3BPNB 1MRCL 3TIEB 3INUH 1R6VA 1ZT1B 3SJVE 2VDNH 3CFCH 2R9HD 4OD1H 3Q3GB 4CN4A 2RFXA 1MWAA 4P2RA 4F58H 4RFNB 3SGDI 3TYFB 2CK0H 5ETUB 2HT4D 3BP5A 5E0QA 1NBYA 5E8EA 3NA9L 4CVZB 3VG9C 2B4CH 4KK8C 3X13B 4Z7QF 1LILA 1EO7A 3W39A 3GI9H 4JFDA 4LLUB 5GJSH 2JCCE 4U2ZA 1WCBB 1IT9H 4P2YA 4JREB 2AJXH 5IMKA 4C83B 4P46A 1OTUD 4R26L 3H9ZA 1ITBB 1N6QL 3VDAA 4Y4HB 3IJHB 3IFOB 3RZCA 5IT2H 4KC3B 1WT5A 4UV4H 5JIKA 1IC7H 2YD9A 4PR5A 1S9XB 3RDTD 5FKAB 4D9RD 3BP4A 3MA7A 4F9LC 2EDDA 3HCVA 1RU9L 3E6FA 5HYSB 4DKEL 4PJFB 4IMKC 4CW1A 1EO8H 5KVGL 2Z91B 4Z8FL 2D7OA 3SDYH 1E4XI 3SO3B 2ITDA 1I8LC 1KYOK 5BOPA 3I3EA 1UXWB 3QO1B 5B4MD 2J4WH 2RB8A 4PG2C 2AXFB 4OT1H 4NN6B 4PP1D 1KPRB 4XMPH 3OQ3B 4K3HA 3KNBA 4LCWA 4NNYB 2IPTH 4PJXA 3VWJB 2P24B 3QULB 2P5EB 4RMWA 1KELH 4XPGL 1BAFL 3VFOA 3QUXA 5JUEH 2QQLL 4HKXA 1LE5B 3AS0A 3V6ZA 2X4TA 3B2UC 3MUHL 3OXSB 4NQSB 5HHNB 3KPSE 4K3JL 3CSGA 1N5YH 4KXZI 4NWTH 2UUDK 4OCYH 3SE8H 2NX5B 4U1HA 4O58L 3TGXA 5SWQA 1T1WB 2MOVA 3NGBB 1NFIA 4XXCA 4YWGL 1CWVA 1N26A 1QVOB 1CDJA 2Q1EA 4OJFL 4QGYA 3SDDB 4QXUH 3P0YH 3GJEA 4NZDA 5BZDA 5GGVY 1IGFL 5D1ZD 4IDJL 5KSVB 1FN4A 3HG1A 2P5WD 5C0GA 4RA3A 5FUCC 5EC1A 2D7PA 1ES0A 1FO0H 3O6LL 5E1AA 5FOJA 4XBEL 4L29A 4HKZA 2PYEA 1CZ8H 4ZUTB 1F4WH 2APVA 4AH2A 5KANI 1IKFH 1IAIH 1QPXA 2CKBH 4MA1C 3DLQR 1Q9OB 3J7HA 4MMZC 1GZQB 2OR7A 3CVIH 1FNFA 1KIQA 1KPUA 1G7MA 1KUMA 1KFAL 2WUCL 3F7VB 5EO1B 5D2LF 3T3PF 4I4WA 2Q8BH 3BZFA 1YEGH 3KLHC 1MQ8A 3UTSB 4PJ9B 4K8RH 4Z7WE 1HINH 2XPGB 1BQHB 2AEIT 3WKNA 4KRNA 2Z31C 2XY1A 1IL1B 4U1SB 4HX1A 1XIWB 4Q9RL 2A74B 3VFMB 2ZUWA 3NMEA 4HKJA 4ELME 3RGHA 3D48R 1JGEA 1XFPA 3U6RB 1C5CL 5FYLH 1FE8H 5DMYA 2R29H 1ZWIB 5E00B 5HVGB 3JWOC 3OAUL 3VFVB 4O51B 3CFJB 5SX5K 4QHLB 1B0RA 4P23D 1S5HB 2XN9D 1Q8MA 3RVWC 4NM4H 4KKLC 4XP1L 2F54B 2PETA 3RDTA 1RZKL 3INUL 4YGVA 3FO9B 3HE6B 4ORGA 2VDNL 2VTFA 5DI8B 4HEME 5A2IH 1ORQB 3E0GA 5DQDH 1DBKL 3V0AC 4OD1L 5JLZB 2CLVB 2YPKB 5D7IA 3FOLA 2CK0L 3I6LD 1WISA 1ZMYA 2Z8SA 4LLQA 1OVZA 3VI3F 3LKSA 1N0XH 2B4CL 1FFOA 4HD9A 1JPGA 4H0GA 3GI9L 1Y18B 1WZKA 3LV3A 1CF8H 2AJXL 1NH6A 4G7YH 1FNAA 2PCPA 3AC0A 1H15A 5DF0A 3OKEB 1Q94A 4C56D 4X5WA 5IT2L 4UQ2B 1JL8A 3HPLB 4OZIE 4UV4L 5TE6H 1N4XH 1IC7L 5SWZB 4P49A 3C5JA 4R96A 1F5WA 3S98A 3VXSB 1B6DA 1HNFA 2XZCH 1AD9A 1CXLA 1EO8L 1U8HA 3SDYL 1YEIH 5D1ZA 1U42A 2J4WL 4L4TB 4MA8L 3A67H 1WWCA 5BMFH 4NP4H 4OT1L 4JN2B 2P5WA 4XMPL 4PRPD 5FCUH 2EC9U 3AVEA 1QSEB 2KKQA 2VDLL 2IPTL 3C8KB 4H88H 1SHMA 3BE1H 4IRJD 4N8VA 3TBSA 1BQHG 5IB2A 3V6FB 2DQHL 4Z7VB 4YLQT 4XNUH 2ZSVB 1BF2A 4OFDA 3BJ91 5JUEL 2VE6A 1A7NH 4XPAL 1QO3A 4OFYD 3BH8A 3VXNB 5C07D 4OLZH 2ADFH 1BMGA 2I5YH 4I1NB 4X4MA 3NCCB 5F3BA 1PKOA 2WIIB 4PGDA 5C0CE 4YQXH 5D71H 4P5MA 1N5YL 4NWTL 1VKXB 1EXUA 3QXDB 1R3IH 4OCYL 3SE8L 1IARB 5HD8D 1UQSA 3OSKA 1I9JH 4Z7QE 3G6AB 3ARZA 4MCZB 4F33B 2DBLL 4MD0A 4QXUL 4ENED 3VFRB 1HDMA 3ARRA 5K9QI 4P2QB 1X4YA 3I50L 2YUWA 2Y72A 5C0DB 1FO0L 2C3GA 3CSYB 5JXAH 3GMPB 1F4WL 1WZLA 4X0KA 2G9HB 2G60L 3L5WA 4FN0A 4XCYA 1A6TA 4ZOBA 1B2WH 4J4PC 4P23A 2R1YB 1FO0A 2XN9A 4JDVB 5ANMA 4LNRA 4X9BA 2PF6A 5EIVA 4GRLB 2Q8BL 1KT2B 3HNTL 1ZT4A 1NCTA 3VD9A 4ZNEE 4K8RL 2BSED 3EFFA 1TZHA 3D3VE 3U9PH 2FRGP 3LDBB 1HHIA 1Q9WA 3U9UA 2FO4B 4KJQC 1I7UB 3P0GB 1GC1H 4M5ZL 1NGXA 3G04B 1T5WB 2WW8A 1E6JH 3UPAA 5LGHH 3CUPA 4R9HA 2EDHA 1FE8L 3P77A 3PWNA 3L3IB 5FYLL 2R29L 1ZOXA 3VWKD 5KS9E 4PJ8B 4GKOA 4Q0XL 3QQ4B 1J7VR 4XNMB 2OTWB 3SKMA 3QEUB 1CN4A 3DARA 3V2AR 2VISA 4C56A 3QXAA 1UKTA 3FT3A 4NM4L 4LHJB 4NT6A 3CFIC 2VITA 1QHOA 2QBWA 4JLRA 5FXCH 5BVJB 2VC2H 2GJ6B 2I27N 4B5EA 3EYOA 2AJUH 1HILA 4MNQB 2WQRA 5DHYB 4YXKL 4MXQD 4LLVA 2O61B 4D0CB 3NABL 3WFZA 5DQDL 1LWRA 1Q1JH 4NDMB 2AXGB 1MREH 3WO4B 1L9NA 3TVMD 5DEZA 4R97C 1JWUA 3MJ7A 3RWEB 5FDYA 1N0XL 4PRPA 4ODVH 4LPCA 3I6GA 4KQ4H 4ZO8A 1TQCC 1RAMA 3O6FB 8FABA 1T2JA 4IRJA 2X4OB 2LVEA 1WF5A 1JHTB 3UTZB 5D96C 1CF8L 4G7YL 3DPBA 3AY4A 1U8KB 3Q6GH 5D2LE 4U6XA 2ESVB 4OFYA 4LMQI 3WHE1 5C07A 3VI4F 3WHXA 4Y2DB 3RWCB 1XH3B 5L7XH 3V7AE 5KG9B 2XTLA 6FABH 1N4XL 4LPYA 3EO9H 3ZYZA 1F8TH 1G9EA 3EJYD 3IVKA 2OYPA 4A2MA 1GYAA 2XZCL 4XP5H 1EFQA 4MJ5B 4XTRD 1BVKA 2I24N 3TN0C 4JFFD 2NY5L 3KXFB 2FEEI 3SY0B 2DLFH 4FTVD 5FOBA 1YEIL 3PDGA 3IXTB 1OP5H 5BMFL 4NP4L 1T21A 1NEZG 1ZVSB 4DEPC 4H88L 4QRTB 1PKQB 3BDXA 5C8JB 5HPOA 5JW4M 4GW1A 1Z0NA 3BE1L 1VPOL 4F15B 4OF5A 4XNUL 4JFEB 3PDOB 3ALXA 1KIPA 3OB0K 5BRZE 1A9EB 3CX5K 3G5VB 3VFPB 2JK5A 3ILQD 4JRYE 4OLZL 4MDIA 2B2XH 5EU6D 4UIMB 2I5YL 5TDPB 1VADB 2PXYB 4YQXL 3LSOA 3ULVF 4C58B 3GSRA 1JFQH 4L8SB 2X42A 1R3IL 4XP4H 5CHNA 3VI3E 5BXFB 4UUJB 2IPKA 5DJCA 1I9JL 4FMFA 2V7HB 5CEXB 4RA0C 5EFIA 5DK2A 1JK8B 2O5YH 4PD4K 2J6EH 4XCCH 1MH5B 2BVYA 2IANB 1P1ZB 5CP3A 1DTUA 3FMGH 4V1DE 3QUKA 1AGDB 3ARQA 3BRFA 4DQOH 4P5TB 4WWKC 3L3GB 5JXAL 3QDJB 3QUZC 5HVWA 4NQCD 3VWKA 1GGYA 2HAZA 1V3MA 3I6KA 1NC4D 3B6SB 4F3FA 2OCFD 5FGCE 4L1DA 1HYRC 1B2WL 1CFSB 5GGRB 3SKUD 3OKKB 1ETZA 4NOBA 4PFEA 5F1SA 4LCYA 4HMCA 4QRPE 3DBXA 3GSQB 4LLDA 4UDTB 2B7DT 1FJ1A 1WUNT 1D5IH 4LPWA 5D6DA 4YPJA 5DHVB 3CH1A 4A6YH 3IKCA 3FKUS 4CADB 3MYJA 5L2JB 1T0MB 2N1KA 4HPYH 8CGTA 32C2B 3ARED 4PGBA 2EH8H 4YPGA 1EHLH 3U9PL 2HJFB 5HDBF 4PY8J 3TVMA 4H26B 2EKSB 1GC1L 5GPRA 3AAZA 5I30H 3ECBB 3VD3A 1DEDA 1E6JL 4JRXB 3F12A 2W0PA 2IH3A 3OAZH 4F7TB 1TCRA 4IMLB 4UBDD 1FNHA 1KC5H 3IETB 5DUBA 1RZJH 1WBYB 5B22A 4KI5F 4M7LT 1PY4A 2AKRA 4KKBC 3ZMRA 1KNOA 4I5BA 4P3CH 1AC6A 3FT4A 2EDOA 3UZQA 4ZS7H 4CBPA 2DWEB 3B3IB 2VC2L 4YDLB 4KZDL 1TFHA 3D2UD 2AJUL 4U1NB 3VFWA 5E1HB 1Q1JL 4JFFA 1MREL 4FTVA 2OJEB 5C0FA 3L3OB 2L4OA 4PY7A 5JPNA 2NYYC 3ARDC 1ZVHA 1T20B 2VDPL 5CILH 4ODVL 2ZCLL 4WU7B 2FWOB 4L4VD 1OWWA 4KQ4L 2J3SA 1AIFB 3ESVF 3KPRD 3F7YB 2GUOB 4X6EA 4YFLF 1NBZA 5DVMA 4PD4J 1I1AD 1Q0XH 4I18C 5C9KA 4HUVA 3MJ9L 3ARXA 1R3LA 3HC4H 1D7FA 1AHWC 1MAMH 5JDSA 4FS0A 5EU6A 4DGVL 3ZSSA 1N0LA 4NJ9H 1BVLA 4Y4KB 6FABL 1QSFB 1ADQA 5D7SH 3MJ9A 3F62A 1V7MH 2GSIB 2XV6B 4XCEA 2G75A 4FQ2H 5KANG 5IW1B 1QEWB 2OR9H 4UAOC 2HFTA 4XP5L 1UXSA 4FQQA 5HVFB 3RWJA 4HBCH 2W0FA 2DLFL 3MLZH 4KVCL 1LNUA 5LXGL 3CC5B 3QNYB 3DX9A 2DS4A 3FQTA 3RP1A 1T83A 4NQCA 4HJ0D 1CICD 5E70A 2PN5A 4JO4H 5D7LD 5F7DA 1NC4A 2BSSB 3UTTE 3VA2C 2JJTC 3MV7E 1RJZA 3U7YH 2XTJD 1G6RB 2YN3A 3BSZH 3DECA 2B2XL 1JGDB 1EEZB 3FZUC 4D3CH 1C08A 3S4SB 5IBTH 2VLJB 5DFTA 4XP4L 3MREA 1YEHL 4WTWA 3AREA 1A7OH 3LKPA 1AJ7H 5CINL 4PJIE 4HH9B 1DBBH 5JOPE 4K07A 1K4DB 2DLGA 3HRZA 4RAUA 5ICYA 3CVHH 1T7XA 3TYGH 4D9LL 5K59F 2O5YL 3DVNB 3WNMA 2P8MA 1MCJA 2J6EL 2YZ1A 4XCCL 1OP3H 3R8BB 5I1DA 1ZGLB 4LCUA 2J7LA 3FMGL 3NVQA 2PW2B 1HQRA 3GMQB 4N5ED 4DQOL 3H9SD 1I3RB 2DQFA 5FUCE 3QEHB 2J6EA 5ICZA 3DRQB 2VLRB 4PRHB 1U3ZA 1OGAB 1K8DA 1OLZA 1E28A 5BQ7A 3RNKB 1TVHB 2BRQA 1NAML 1O5DT 1S9YB 4YO0B 3EO1A 3FQRB 3WEXA 4F37F 2EE9A 3GBMH 1QRNE 4OZGB 3D2UA 2D2OA 3MYZA 1NAMA 3GJFH 4A6YL 2J8UF 4TULH 1CFBA 4R4ND 4W6WB 3T4YB 3IU3A 1RVFH 4JM2B 1KTDB 2C3XA 4HPYL 3G9VA 2EH8L 1EHLL 4EKXA 4XGZA 4LBEB 2H6PB 3EW3B 3WE6B 4KAQH 4A6YA 3LOWA 5I30L 1HWGB 3CXDH 4L4VA 5IVXE 1A4JA 3J8F7 4M6NH 4M6AA 4U1KB 2GI7A 1KC5L 3KPRA 4OV6F 1FL6B 4N1EA 1FSKB 1I1AA 3C8DA 2MHAB 2OQJB 3D87B 5A2KH 1XCQA 4DUWA 4DFIA 2JB6B 4OF7A 3I02B 4NKDB 5E8OA 3MLPA 3V5HB 4C4KT 3MCKA 1LEKB 2YUVA 2Q87A 4QOKE 2D9CA 4OM1H 1YDPB 4ZAKC 3CFEA 3RL2B 1YPZA 1XGTB 1QFWH 4RQQA 5F96H 3S4SG 1OTTD 2EYTA 5HYIA 1U95A 4D0BA 3QIUB 2VAJA 3T0XA 2WBJA 2AVGA 3RRQA 5CILL 2KL6A 4Z7UB 5EBLB 1CICA 1BIIA 5D7LA 4F7EB 3TO4C 3ARFC 1BZ7A 3QIBB 5MENB 1Q0XL 5ESQA 2D7TH 5JIHA 2H41A 3NACH 1TXKA 1Q72L 2IMMA 2ADJB 4NJ9L 5K9KB 4OQ1A 2OX5A 1PYWB 3O6KH 1WC7B 3CPLB 3X11A 3I3DA 1V7ML 1FVCB 1S8DA 1ZTXH 5F7WC 4FQ2L 2OR9L 1JNHA 4WUUB 2AV7B 5DS8B 4F7CB 3KWWA 5DJ0A 4HBCL 3ARBD 5J6GA 4WGWB 2N7BA 4LLYA 4PJGF 3O3AA 2Y23A 4UZGA 3SKOB 4W4OA 2R1WA 3H9SA 4P57A 3P0VL 4MQXD 4F8TA 5T3XE 4JFOB 1KBGH 3MNVB 3IDIB 5EH1A 2PW1B 1XF4A 2F53B 3QG6B 4KRPD 2ED9A 3BAEH 3BJLA 5D5MA 3U7YL 4WFHD 5IQ7H 5J9PB 3BSZL 5I15H 1SJHB 4H25A 2EXYD 3I9GH 1U8PB 3GGWA 3O9WC 4KK5D 1NJ9B 3LRHA 4D3CL 3KPSD 5I1IH 5IBTL 5EZLB 1YMME 3LKNB 3MLSL 4NQDD 5FECA 2ATPB 1U2CA 1JYWA 1QQDA 1K9TA 3QEGH 4HS8H 1DBBL 1D5ZB 2YD7A 4YHPB 1KENL 1SBSH 3TYGL 1K8IB 2EO9A 4LRNH 1S7VA 1NL0L 5DDHA 4OQTH 4FMKA 2JE8A 4LHUG 4MJ6A 4RFEB 1HEZB 5CS7A 5C7XH 4M6MH 5IGXH 2NPLX 1N3NB 1S7RA 3DX6B 1S9KC 1IQDA 4O2CA 5EBMA 5KSAC 3SDCB 1V3JA 5IW6A 1IGIH 2BMKB 3MRPA 1ZT7B 3BHBB 4HS3A 5L88H 1LEIB 4JY6B 3OV6A 3AU1B 2WBKA 3MBED 5ABDE 5C0JA 1G7JA 5EA0H 3JWDH 3P4OB 4EN3D 3OJMB 4RGMB 4PJHB 2OL3H 3DUUB 1OF2B 3GBML 4M9OA 3L3JA 4B7IA 1UJ3B 4TULL 4OGYH 1RVFL 4X99B 4GLRH 3IDGB 3NIDF 5TQ0L 2I9LA 4BZYA 1C7TA 3K2MC 3GJFA 5GRUH 1J8HB 3CXDL 4HXAH 1NFDF 3U83A 3O4OB 4PJDE 4XP9L 5IV2A 4ZD3H 4M6NL 1TZIA 1ZGLM 1NANI 5I19H 2NZIA 3MCLH 5CJXA 2JJVA 3DURB 5K9JH 4OI9A 1EERB 3ARUA 3E6HB 5FA4B 5FO7A 4I0PB 3D85B 4PREA 3QRGH 4JFQB 3KGRA 3NFNA 4Y19B 3K74B 4R2GD 3QDAA 1DCLA 3HB3D 1B9ZA 1IGJA 4OM1L 3RGVB 5EO0A 5H35A 1ZLWK 4YDVB 2WK2A 3OKDB 1QFWL 2WWKT 2VN4A 4N90E 5E2UH 1J11A 1HSAB 5KOMC 3UTPE 5TFSL 3RWHB 3SDXE 4BH8B 4FG6C 3VD7A 5F9OH 1D9KB 2GTZB 3C9NA 1KTLB 1T03H 1JNLH 1FYHB 2D31A 5KZCD 2X1PA 3X14B 1LO5A 2H2PC 3GEWB 5E2VL 1F3RB 4K3EL 4H1LB 2D7MA 2XICA 4ZFZB 2W0LA 1J9CT 1T0NA 1I8MA 3NACL 3TT1H 3ARTA 4DVRL 5I1EH 1RZGB 3QDGE 2QADD 1EAPB 3ILPA 3AS1A 4LIQE 5IBLD 4RGNC 1HOCB 3KPSA 3OGOE 1IJ9A 1SJEA 4ZTPL 3LKQB 5I9QB 4IOIA 3O6KL 5KOVC 4NQDA 3S8WA 5HI3D 1ZTXL 1LDPH 4ZO6A 1RK1B 2CSPA 3ZO0A 3K0WA 4XB7A 1U2HA 4WCYH 3IU4H 4OD2B 3EHBC 3H7LA 1C5DA 5DD0H 3LY6A 3SCMB 2CO7B 4YJZL 2HFEB 1CG9A 4KTEH 2VIRA 4HUWB 4NRYA 3ZT5A 4QXGH 4QRSB 1NFKA 1S7SB 3QUMB 4M7ZC 3BDYH 4LSUH 2Z8RA 1KBGL 4F7PA 2UZXB 3B43A 5GSRA 2IG2L 1GOGA 5C2UB 1MJ7L 3ARGC 5J7CC 1FG2A 4LRIC 4RDQG 1FNGA 3BAEL 4NO2B 1U93A 3OTTA 3MOBH 3R0MA 5DJAB 3TT3L 4MD5B 5BJTB 5I15L 3DSNA 3MBEA 4M1CC 2APXA 4GAFB 4EN3A 3I9GL 3PABB 4XVSH 5I1IL 5TF1H 5SV4A 3S36H 2UY7A 4QHKJ 1JZ6A 3BXNA 3QEGL 4WTZG 4HS8L 4E0RB 1X5JA 4HC1H 1SBSL 3KPLA 1IM9B 2CQVA 2FNBA 4LRNL 3S34H 5FO9B 2GITA 5IR1B 2DKSA 2E9JA 4OQTL 2N4IA 5D7KD 3VXTA 3QRFM 1PEZA 4QHNA 4M6ML 2BVEA 2NW3B 3L3HB 5IGXL 3T0DA 5I2IB 3RWIB 2FR4A 3QQ3A 3FB5B 4OQTA 5I1LA 1FFQA 4U1GC 4OAWB 3ZKSD 1IGIL 3MLTA 4PTTB 3WYRA 1JPSL 5L88L 2HLAB 3V6BR 1RJLB 2Q6WB 5H94B 5J1AB 5J1SC 1O0VA 2XWJA 5E9DD 5EA0L 4LLWA 4DK6A 3P4LA 5HYQA 1BWWA 5HHME 3LKOB 2OL3L 5JHDB 1UWGL 3OJDB 1YEEH 4QCIB 4HGWA 3VFNA 4P99A 5E2TL 1A6ZA 3P11H 4H1LG 4OGYL 4W4NA 2A6KB 4HK0B 4POZD 4PJGE 5EZJA 2GEEA 3D3VD 3E8UL 5GRWA 5FF6A 1J1XH 4ZMAT 1VCAA 3QFJE 1HCVA 2NMSA 3KLAB 5IFJB 5D1QB 2J2ZA 1VERA 1G7IB 4U6HA 5D1XD 5F1IA 3AM8C 3KPNA 1TZGH 3LH2H 3SGEH 2YSSA 3IDMB 3WFHB 1JPFA 4Y16D 1JI1A 1OL0A 1UZ6F 3QI9C 5K9JL 4ETQA 5BV7C 1U8LA 2C1OB 4KRLB 3HPJA 4K3DH 1OARH 2HKFH 4Y5YC 4U3HA 4PUBH 4ZPTA 4OZIA 2BXZA 4R3SB 1MQKH 1XEDA 3P9LB 3V4VH 4FQJH 1KCRL 3MRKB 2ZPKH 4KK6D 1NEUA 2C5DC 3H3BC 4Y8DC 1UM4H 4NQUA 1ZVYA 1UVQA 1J0YA 5IMOB 3O2DH 1CTOA 5EUKA 2P49B 5E2UL 4WRLA 1DBAH 4OB5H 4YHZH 1UB5A 5A43C 5F9OL 2X1OA 5HHQA 3MPCA 3U4EB 1BIHA 1ZLUH 1T03L 1JNLL 4ZS6C 1XZ0A 4HWEH 3N06B 3V5KA 2ZOKA 4B50A 5AYUH 3EGSA 5GGSA 3DJ9A 2RFXB 4P2RB 2H9GA 1MPAH 2YK1H 3BP5B 1K2DB 1NBYB 5I1EL 5E8EB 3TLRA 3NIDE 4DWHA 3NPZB 3W39B 4JFDB 1T3FA 4BYHA 4PJ7A 4KJWD 3ZE2F 3EJZD 2Y5TA 1LDPL 1T04A 3HC0A 5IMKB 4P46B 4ZUUA 4CU6A 3A6OA 4WCYL 3IU4L 5FYJU 2FYYA 3C5ZC 1VFAA 1AH1A 3IFPA 4XC3H 1DQLH 2VERN 5DD0L 4RNRA 3RZCB 3GBNH 5JOFA 2FLBT 3QDHA 2EDBA 4KTEL 5LKNA 4PR5B 5A40E 3BP4B 3MA7B 1BFOA 4WW1B 4KKCC 3HCVB 3BDYL 3E6FB 3C09B 2VB5A 1RI8A 5FYJD 4CW1B 2V2XA 3SE4A 4FABH 1HZHH 5BRZD 3SQBA 2ITDB 3HC3L 3UCRA 4YHLL 3MOBL 3EDEA 4JJ5A 1AQDA 3S35H 2YMXH 1EH9A 5E9DA 3SGJA 4XVSL 4TNWK 3KNBB 4LCWB 3UO1H 2FX9H 4PJXB 3S3SA 5TF1L 1CFVH 4PJBA 4JFPA 3D3VA 3DETC 3S37H 3U4AA 4JREC 3VFOB 3QUXB 5T3ZD 4MNGE 2I07A 4EIZC 4HC1L 2IGFH 4HKXB 5H2BA 3S34L 2A1WH 2MQCA 4KUCD 4V1DD 5D1XA 1WBXA 1FL5B 4HC1A 4JE4B 4ZXBD 4NCC1 4U1HB 3U0TA 4Y16A 3P3YA 4JZJA 5SWQB 1NFIB 5KS9A 1QD0A 4G9FE 4GMTH 5CD5D 3W11C 1X5FA 3GJEB 4QRPD 2CGRL 5BZDB 4QRRB 1FN4B 4WDIA 5DFVC 3BKMH 1GIGH 2CRZA 3SE9H 4QYOA 2W60A 2HYMA 5C0GB 5EC1B 4CVWA 1ES0B 3DVGA 4NZTH 4TTDD 5E1AB 3S5LA 1J12A 1GGCL 2ZUQB 5L9DH 4L29B 3VWJC 3P11L 2VH5L 4HKZB 2PYEB 4N0UE 2A6JA 4AH2B 2WP3O 2DTSA 2FH8A 1AGFA 3O2WH 1J1XL 3HNVH 3LN4A 3B9AA 2OBGA 1KIQB 3V6OC 1CYGA 1CS6A 1G7MB 2WIMA 1JMZA 2ZSWA 3UTOA 4I4WB 4I9WE 1D5XA 3U1SH 3RVTD 3HMXH 3QFDB 5CBEA 3BZFB 3ULUC 1S9WA 1TZGL 3LH2L 4WO4D 2E7MA 5ACMA 4OI8A 4QWWD 2IQAA 1HHKA 3W82A 3H7BA 4K3DL 3SDDC 1OARL 4M48L 4OZHF 4HX1B 1JF5A 2G2RA 4CUCA 1INDH 43CAB 1MQKL 5E8PB 4HKJB 3V4VL 4FQJL 3LEYH 1JGEB 1T80A 4HUUB 4JQXA 2ZPKL 4CKVX 3BGFB 5I1HH 1HI6B 1UM4L 4HXBL 25C8H 1B0RB 2MKLC 3O2DL 2WP3T 4WW2F 5LCVH 1AGCA 4QHUA 5FYJL 1EDQA 1DBAL 2OZ4H 3RDTB 1CU4L 3HI1A 3DV4A 4KK8D 1JYVA 4HWEL 5AYUL 1T89A 4K7PH 5DVLA 5BRZA 2ZUXA 3IXAA 1NUNB 4GXUN 2BHZA 2R4RH 3WNKA 3N50A 5D7IB 1MPAL 2YK1L 3FOLB 1RZIA 4LLQB 4NJAH 3LKSB 1FFOB 1P2CA 1HN1A 4MGXA 5DUMH 5T3ZL 3V0VA 5KSBF 1PY9A 4MA7H 7CGTA 1TITA 3TA3B 3WJJA 1NMAL 1F6AA 4P3WA 5MEQA 3LV3B 4KI1A 3OG6B 3RKDC 4E41E 3BPLB 2PCPB 3L7EA 3MUY1 1MJJA 2D7QA 4HAGA 1H15B 2V9RA 2WNGA 3EYVA 4LPUA 1CIDA 3D25A 4N8PA 3MJGX 2EC8A 1EVTC 1Q94B 1DQLL 4XPTH 4X5WB 1UZ6E 3TBYA 3GBNL 3THMH 4V1DA 3O8XC 4BA8A 2D0FA 5HVHC 4BFIA 4ZXBA 3C5JB 4R96B 4LVOB 3HE6C 1NSNH 4OZHA 3MZGB 5TE4H 3UTTD 3CXHJ 1AD9B 1U8HB 4LDLB 4FABL 1HZHL 5EU7C 4HS6A 5F6HI 2CDFA 2A77L 4YHOH 2CMRH 1UKQA 4JZNA 4QRPA 3ZHKA 5B8CC 5D1ZB 5DWUH 5ALCL 3BKJL 2P5WB 2ADIA 3PGCA 1HIMH 4Z6AT 5F8QC 2FX9L 3B8SA 4JO3L 3B2UD 4HAFA 3UO1L 4EZMA 5DJ6B 3EYQC 3R4DA 1OGTA 5B38G 4N8VB 1CFVL 3D39D 4N0CC 3TBSB 3JSSA 5IB2B 1JGUH 3N0PB 2GCYA 1IC5H 3PV6A 1JYNA 2J5LB 4YZFF 2VE6B 1EO5A 4NBXB 2HTLC 3A6BH 1QO3B 2IGFL 1S78D 1TNMA 2PO6D 3NCBB 2A1WL 5F3BB 4PGDB 3WN5C 3JWOH 4OTXH 1T1YA 4P5MB 1KJMA 5AZ2H 1EXUB 4WO4A 1WZ1H 4XB8A 4BSWA 3PWPE 1T1XB 1UQSB 4OM0L 4D8PA 2NW2A 1XR8B 3VW3L 2DI7A 1WVZA 3SDAD 4GMTL 2HT2C 3DO3A 4MD0B 4YFLI 3ZE2E 1BD2E 5DJ2A 1HDMB 1T7WA 3BKML 4HWNA 1I7TA 5MEOA 1GJIA 3RIFK 4NZTL 5EZIH 3N1FC 3BZ4A 3HZMA 5L9DL 3TCLB 4PBWD 4X0KB 3NCFB 2MKWA 3L5WB 3KLHD 4XCYB 1A6TB 2WSKA 1BJMA 3O2WL 4P23B 1FO0B 3HNVL 3VGAB 2XN9B 1OOAA 4YGAB 4LNRB 3MXVH 2Z31D 1FYTE 5GRXG 5FM5M 3U1SL 4U7SA 1I8KA 5IUSA 4AMKH 1ZT4B 3AROA 5IB3A 3EFFB 3UYOD 1TZHB 4Z95L 2WZPD 5IM7A 3JVGC 1HHIB 1Q9WB 3U9UB 4WY7L 4UNVA 1NGXB 5EOTA 1CL7L 1MIEL 1FG9C 2XZQH 4IRZH 1F13A 1INDL 5L0QB 1A2YA 3HAEH 3RVWD 3CUPB 1A1MA 4JPIA 1WTLA 2VDMH 3LEYL 4M4RA 5C0BE 3P77B 4G7VH 4QOKD 2XXCB 5GIRA 3EOYG 4JHAH 4IMKA 3B9KC 1MAJA 3SKMB 5D2NC 5I74C 4BFEA 1X5KA 4UIKH 5T3XH 2VISB 4C56B 1I8LA 3FT3B 2EDEA 1TJHL 4NT6B 2VITB 4PG2A 2OZ4L 2VL5B 4JLRB 1IE5A 2MSPA 5F7EH 5I1KH 3EYOB 1HILB 4XT1C 5HGHA 5D70H 1AXTH 3UTTA 4K7PL 4MDJA 4LLVB 2Q7NA 2XG5A 2OZ4A 1YNKH 4N0FA 4Y88A 1FLRH 2R4RL 1H3TA 4G3YH 4LF3A 4YH6A 1PAMA 1YY8A 1JWUB 3MJ7B 2HKHH 4WV1A 4PRPB 4ZO7A 2ICEA 1FZJA 1TTFA 5DUML 3I6GB 1OTSC 4NCC2 2ERJB 5F1KC 3BN3B 3QIWC 2O5XH 5DEGA 8FABB 1UG9A 4IRJB 3D39A 1S7TA 2R2EA 4PJFF 4OLYH 4L8CA 4DOHE 3LMJL 1YNLH 3OKMA 3QWRD 4U6XB 5E56A 4KVNH 4HT1H 5C07B 3V4UL 3WHXB 2PO6A 4J6RH 4XPTL 4EBQH 1RD6A 4FFWC 3QJHA 4R7NA 3KYAA 4M7LH 3T0AA 3PWUB 4TUKL 5T3XD 1NSNL 1RUAH 3MV9D 3IVKB 5TE4L 3CDFA 1MHEA 3SDAA 5J11B 4UILH 1MLBA 2CXGA 4EUPG 2CMRL 2CR3A 1QSZA 4OCMC 5FOBB 5DWUL 3OAYH 5TF0A 4P2OC 1TTUA 3EDJA 1BZ9A 4PGEA 4DGIH 1T21B 3KS0J 4OGAC 1HIML 1YMMD 4GW1B 4TVPE 1JGUL 3TV3L 1XIWD 3BVNA 3ALWA 4M4PA 2VZSA 5TPWH 1KIPB 4LP4A 2JK5B 3A6BL 1F58H 4MDIB 1F90H 4ZNCD 3WNOA 2Z31A 1M6OA 3S3PA 3JWOL 5IVXA 3QCUH 5I8EA 3LSOB 2APBA 3IS1X 4L3CA 5AYQA 3GSRB 5AZ2L 4XNYH 3MUJA 5CHNB 2MCG1 4AG4L 5DJCB 3DX8A 3PWVA 1SMOA 5EFIB 5FKAA 5DK2B 2V2WA 4ERSH 4LGPB 4NN7B 4J4PD 4HLZG 1KJ2A 2Z91A 3QUKB 1FL3A 3V5DB 5CWSA 5EZIL 4S0TD 4CMMB 2BVOA 5AD0A 4QOKA 1J88A 4YDKH 3VWKB 5DRWA 1KPRA 1JN6A 1FIGL 3I6KB 5IMMA 4F3FB 5HYJD 1JPTH 1XGRA 1ETZB 1JHLL 3K8MA 4LCYB 3EAKA 3DBXB 3STLA 2EECA 1MHCA 3WDHA 2ADGA 4KJQD 4P0DA 4LLDB 5GGTH 1FJ1B 4JQVC 2PXYC 3DRTA 4HK3J 1TJGL 4M1GH 4JGMA 3CH1B 3IKCB 4AMKL 4I3RH 4L8SC 3ZKXB 4LIQH 3MYJB 4LARH 4L3EE 3MUZ1 4PGBB 4YPGB 3DNKA 3QWQB 3OMZA 3TVMB 1H5BA 3QZWG 4V2BA 3AAZB 2H32A 1RHFA 3X12A 2YA1A 2XZQL 1NLDH 1EBPA 4YZFE 3ROOA 2IH3B 2VDML 1TCRB 1BHGA 5DUBB 1JVKA 3LQMA 4G7VL 4QF1A 2AKRB 4OFPA 5DHXB 2I25N 3QWRA 2VRAA 4I5BB 4UIKL 5T3XL 3BGMA 3FT4B 1NCDH 4FA8A 5IESL 5F7EL 2YS4A 5D70L 1A7QL 1OSPH 3MV9A 1AXTL 4R6UA 4UT7L 3VFWB 3RI5K 3L1OH 3ZHDA 5C3LD 4JFFB 1J05A 1YNKL 3ZKMC 1I3VA 1IFHH 1J10A 1FLRL 4FTVB 4M7KH 5C0FB 4G3YL 3EO0A 4PY7B 4CAGA 5JPNB 1P5UA 1TENA 1QACA 1QFWI 2HKHL 2P48B 4RFOH 1HH9A 3S3JA 2RHEA 1YMMA 2O5XL 3EUUA 3STZB 3DMMB 3I84A 5GISH 4OLYL 1XIWA 4AIXA 2KQMA 4PB9L 4X6EB 1NBZB 1NAKH 1YNLL 2HVJA 4HUVB 1R3LB 3A6CL 5IBUG 5JDSB 4HT1L 1N64L 1UM5H 4J6RL 5EU6B 3VFVA 4EBQL 3CGTA 3BWUC 1BVLB 1PX4A 4EQ3A 3KYKH 4QRUA 4QHLA 3B2VH 2YPLD 5EUOE 4M7LL 4HWBH 4S2SA 4XCEB 2G75B 2M2DA 1YQ2A 4Z7VF 1RUAL 5FUOH 4GH7B 1MIMH 2AK4B 1UXSB 1ZHLA 3FQWA 4FQQB 4KV5F 1RZ7L 3C2SA 3RWJB 4GSDH 2W0FB 3SE3A 4J4PA 2YWYA 5DI8A 2Q3ZA 5BVPH 1LNUB 5GZOC 3DX9B 3FQTB 5F72S 4ZQKA 3W0WD 4EXPX 4NQCB 4U6YA 4PIRF 1NDGA 5E6IC 5EC2A 1NC4B 3CNKA 5F7DB 5HYJA 2CJUH 1PQZA 1RJZB 4DK3A 5TPWL 4P4RB 2DDQH 4XPHH 5J8OA 2I26N 4X6DE 1FGNH 4F57L 2B1HL 2VLKD 1R5WA 1QBAA 1C08B 1INEL 1UACH 4W68A 3OKEA 3O2VL 3MREB 3KPMA 4NZUL 3JUZA 1BWMA 3AREB 4WWKD 3DXAE 3QUZD 1ZE3C 5ICYB 3HRZB 3GSXA 4ERSL 2OMNA 1B4JH 2CRYA 4G8FA 4BQ9A 2UZIL 4PJFE 3VXSA 2P8MB 1A5FH 5I1DB 1C12A 5LWYL 4LCUB 2E7LA 1J0HA 4MXWH 2O93L 5CGYC 1HQRB 4NC0B 2FIRT 2DQFB 2HMIC 4X6FB 4YDKL 5DTFA 5ICZB 5E7FA 5F1NA 1QP1A 2MQ3A 1JPTL 1CK0H 4EI5C 1K8DB 5MHSD 4U2YA 1E28B 3NFSH 3KJ4B 2P5EE 5BQ7B 4PRNA 4WI6A 1I9IH 5F71A 5E08H 2XKNA 3SDXA 4KPHH 1CDGA 4Z7VA 15C8H 2XA3A 5B3NA 3EO1B 5GGTL 2BOBB 3WEXB 2AJSL 1AFVH 3D2UB 3PQYD 4M1GL 1NAMB 1AR2A 4Y2DD 4I3RL 2ZJSH 5F70A 4LIQL 3IU3B 2F19L 1JWMA 4LARL 4NN5B 5GGTA 4XGZB 2NX5E 1EV2E 3QXDA 1BLNA 2MNUA 1ZA6A 1ZEAH 4A6YB 2GT9A 4KKBD 1C1EH 1NLDL 2EDLA 2EIZA 1A6VH 1A4JB 4F33A 2ATKA 4V2CB 5EBWA 3KPRB 1I3UA 1YJDC 1JF1B 1ZLSH 1UJTA 1EZVX 1I1AB 5DRXA 2BSRA 1YUHB 5IB4A 4CU7A 1XCQB 1GL4B 2HFFA 3GMPA 3QUYC 2CRIA 5E8OB 1NCDL 2NYYD 5CD3A 2YPLA 1RK0A 3WIIH 3GRWA 3MCKB 3QB7C 2YUZA 4LAJH 4N0YH 3LKRA 3O6MH 4MB3A 5CJ8A 1TVBA 3H3KA 1B6UA 3CFEB 3GIZH 3OXRA 4J2XA 1IFHL 1YPZB 3UTSE 4RQQB 5D7JC 1U9KA 2RAMA 5F7LB 3AB0B 2EYTB 1U95B 3OPZH 4D0BB 1PSKL 4RFOL 1UM6H 1WFUA 3W0WA 2X89D 3LRSA 3TH4T 1WAAA 1CICB 1BIIB 1W0YT 1DJSA 1KJ3H 5D7LB 5GISL 4EEEA 1YEJH 4MQSB 1MVUA 5C6TH 3HR5A 1BZ7B 1JGVH 4MX7A 2XTJB 5ESQB 2RCSH 2FECL 2UY6A 2WUBH 1X7QA 4MHHI 1UM5L 3NN8A 2AJYH 3KVQA 2R0LL 3L5XL 4CMHB 2VLKA 4KK9D 5DA0B 3WNLA 3QQ4A 4GQ9H 2MMXA 1W72L 3KYKL 3T3MF 4XNMA 2XT1B 3B2VL 1M7IA 4YHML 2G5BA 2Z35B 4L8DA 1PVHA 4HWBL 1VDGA 1S8DB 4WWKA 5FUOL 3HZKA 2F54E 4NNXB 3QUZA 1MIML 1JNHB 1W72A 2OSLA 2OMBA 1JUFA 3KWWB 3BQUD 5DJ0B 5J6GB 4GSDL 4HWBA 2DM2A 3C6SA 4LQ1A 1MCPH 4LLYB 4Y0GA 1K6QH 3O3AB 35C8H 2HH0L 1FRGH 2R1WB 3H9SB 4P57B 2H2SD 4OZFH 1TVDA 3FZUD 1K5NB 1RUKL 4G8GD 1WLHA 2DB8A 2FX8H 5F9JA 1XF4B 1PG7H 2CJUL 4M62H 5D5MB 3TIDA 1L7TH 2ZUTA 4R0LC 4KRMB 4S11A 2DDQL 2BY2A 5KJRH 4H25B 3GGWB 4K94C 2ZOLA 2LV4A 3MRNA 3BIAX 3PQYA 3RWGA 3P4MA 5ENWA 5GHWL 4Y2DA 5FECB 3RWCA 1IGYA 4M6OH 2F15A 4NO0D 1N8ZA 1QQDB 5SWZE 1YMHA 4IJ3B 1CLOL 3CFKA 5CUSH 1DZBA 5IQ9A 1S7VB 5DDHB 2W9DH 4MXWL 1D5MA 1RZJC 3PL6D 4L4TE 1MFDH 1I85C 3LB6C 4N5UA 1S7RB 3EOTH 4O2CB 4YHIA 1QSEE 5EBMB 3HNSH 5D9SB 5IW6B 3MRPB 1CK0L 3VRIA 1F97A 2NTFA 4HS3B 3H0TB 3NFSL 3K4DA 1I9IL 4ODTH 5C0JB 1G7JB 5F89A 5GS0H 15C8L 4HCRA 4JVUA 4KV5E 5GGVH 2BNRD 3HRPA 2WINA 1Z9SA 1AFVL 1BQSA 3E3QC 3L3JB 2ZJSL 2VR5A 3GI8H 2HLFC 2VUOA 5LGJA 4CVUA 2I9LB 3PJSA 4KY1H 1ZEAL 3GJFB 3DI2B 1C1EL 1LP9F 1AHWA 4M00A 4HIEA 3QH3A 5IV2B 2X89A 1TZIB 2A6IA 1TMCB 6CGTA 1ZLSL 1CXEA 4J1UA 1I1RA 1WIPA 4I2XE 5J0BA 1AGDA 4PLNC 4Y4FC 4C54A 3OKLB 4ZAKD 5FO7B 2DLIA 3TJHC 5D2NE 4PREB 4OBSA 4M43H 1IGTA 3L3KA 3O4LD 3QSKB 2RBLA 2UV3A 3WIIL 2X9XA 1INQA 4N0YL 1IGJB 1IEBA 3WO3B 3O6ML 5EO0B 1AO7E 5C3TA 5H35B 2ZNWA 4W70A 3GIZL 5L8LB 4TYUA 3BQUA 3ARBB 2JJTA 3TO4D 1NCAL 3ARFD 1FP5A 4ODXA 4KMLB 5E2WH 3OPZL 5ALBH 2I60H 1UM6L 1HXYA 2X4PA 3C9NB 4EDXA 5CP7A 4ZTOH 1AC0A 2D31B 3BWAA 1DEEA 1LO5B 4G8GA 4XP6H 1G1YA 1KJ3L 4X5XA 4UINL 5C6TL 3LS4H 4KRPB 3MRMA 1JGVL 4X4YA 2RCSL 1T0NB 4IMLA 1I8MB 3AGVA 2WUBL 1MRFH 3K8KA 1DANT 5KSUA 5I6XC 2APWA 5J12C 3QDMD 3IJSA 3FHQA 2Y9RT 1IEAA 4GQ9L 3KPSB 4RCAA 5IMLA 1SJEB 4GXUM 4IOIB 4JFZH 4JPWL 2BFVH 3UPRB 4NQDB 4XCFH 4NO0A 1LP9A 3ZE1F 1QYGH 5ELIA 4JAMA 4Y7MA 2FDBP 2VMFA 2VO5A 2YUXA 4MNQE 4NCDA 2X6MA 1C5DB 5A16A 3TBTA 1MCPL 2NY1C 1CG9B 2EH7H 5ERWA 2VIRB 3QR2A 35C8L 4NRYB 1FRGL 3PL6A 3DUSA 3G08A 1D9KC 4PTUB 3L3OA 4NC1C 1UH2A 4IOFD 4K71B 2J1KA 4F7PB 4BH7A 5GSRB 3PNWA 1PG7L 5IHZA 2FWOA 4M62L 1FG2B 2LAAA 2IAMC 1FNGB 2YRZA 4KDTC 1CLZH 1TQBB 1L7TL 4TOYH 1JTTA 3MBEB 5HJ3A 5KJRL 4EN3B 2W9LA 1F3DJ 3WDJA 1EMTL 1HSBA 2ESVE 4LP5A 4NC2B 4Z7OE 2BNRA 4XVUC 3C5SA 4WIQA 1A1NA 2ILLA 4JB9H 3REVB 4M6OL 3BXNB 4WFED 2Z9TA 3BZDA 1RHHA 5KSAD 3KPLB 4KQ3H 5CUSL 1QEWA 4CU8A 2GITB 3VXTB 3KXFE 1HWHB 4OZGF 4QHNB 4NM8H 2H8PA 3RX5A 1MFDL 1NC2D 4TNWF 2FR4B 4JM2F 1YN7A 3QQ3B 3T3ME 1SY6A 2GW5A 3MRQB 5I1LB 5CEZH 3MLTB 1PKQE 1G1CA 4ZAKA 1ZLVH 3VMPA 2XWJB 3B83A 3OBAA 5FHBH 4LLWB 1CGVA 3IF1A 3WXWH 1FYTD 5IWLC 1QFPA 5GGVL 4D0DA 5I71C 3O4LA 1A3LH 4R2GB 1CDUA 4HGWB 3VFNB 5TE7H 5TQ2H 4XWGH 3ZDZF 1JGDA 1IGMH 2BVQA 5EZJB 5FF6B 3TO4A 3ARFA 5BO1H 2C1PA 3S96B 5CBAA 4KY1L 4K9EC 1P84K 4U1LA 4NUGH 3BUYA 3VDCA 3KPNB 5KZCB 4PRAA 1J0JA 2YSSB 5C08E 2IANE 4GG6E 2EZ0C 4FFZH 1JPFB 2QEJA 3T1FA 2XRAH 5FV1L 4ETQB 4PY8I 3JV6A 1U8LB 2VXSL 3QDJE 1I3RA 3HPJB 4NQTA 3KPTA 4O2FA 2VABA 1MFAH 2QADB 1BM3H 3QDMA 3QG7L 3UDWC 4ZPTB 2NY0B 4OZIB 5B39A 3QHZL 2GAZA 2X09A 4Z7UF 1CL7I 4M43L 5CEZD 2P43B 1BP3B 5INCA 4ONHA 4UV7H 1Z0MA 1OAKH 2ZUVA 3Q5OA 2Y36L 3C6LC 1MCNA 4N68A 1UVQB 1DUZA 2HFGH 4KDWA 4TVPH 5EUKB 1Q9LA 3MROA 2CRMA 5E2WL 2JB5H 5ALBL 1UH4A 1UB5B 2I60L 1MELA 3FFCD 4U05A 4WFGE 1OP5K 3T4AA 5C0IA 5J1TC 1OAZH 5HHQB 5DSCB 1XR9A 4RGND 3VJ6A 4ZTOL 2XG4A 1A3QA 1XZ0B 5E5RB 3V5KB 2ZOKB 4XP6L 3EGSB 3R06A 4UOW1 5GGSB 4JRXE 1RSFA 1T22B 3LS4L 1ZSDA 5KW9H 3EYSH 2X1WL 5KVFH 2H9GB 4BK4A 1MRFL 3JBG7 3VXQA 3AFLA 3V52L 3EHBD 3S88H 4AYFA 4DJMA 1OAYL 1TETH 4JFZL 1T3FB 4PJ7B 1I3GL 1G7LA 5BS0E 4M93B 2Y5TB 1IC4H 3HC0B 4XCFL 1OAQL 2Y4SA 5EZOL 4ZUUB 1PBYA 1QYGL 2A0LC 2FYYB 5D4QA 1VFAB 5DK3A 5KSAA 3IFPB 3TESA 4K7PX 3ARGD 5FV2A 3RL1A 5JOFB 2C9AA 2EH7L 4M1CD 1G84A 2V5TA 1BFOB 1N2RA 4MJID 4FQCL 3W5NA 4LEXH 2V2XB 5HDOA 1TPXB 4OZFG 1QFWM 3JWDC 3HN3A 4JJ5B 1TDQA 4PJEA 1AQDB 4TOYL 2EIDA 3X3FL 5A1AA 5I8OL 4OV5A 5E9DB 3OKNA 2PNDA 1R0AH 1FYTA 2B0SH 3NH7H 4NSKA 1EEUA 4LLAA 4M1DH 3Q1SH 4XAWH 1CLYL 4RIRA 4XBPA 4PJBB 4JFPB 3P9WB 4XNZB 1BOYA 5A2JH 3D3VB 5CGTA 5K9KA 3QJFA 2I07B 3RIAK 2DD8H 1VGKA 4KQ3L 2V17H 3N85L 5HSFA 5H2BB 4XNQA 1X5ZA 5F7UA 2JF1A 4PJHF 4PGCA 5D1XB 1WBXB 2FBJH 1F6FB 4NM8L 1DBJL 5JW4N 4G42A 3V79C 3OAZK 2E9BA 3U0TB 4JZJB 1M71A 5KS9B 2F8OA 3VXUD 5CEZL 3BPOB 3OKYA 3OB0H 1YA5A 3WXWL 4WDIB 5FHBL 3B5GA 4QYOB 1SYSA 2W60B 1WV7T 3DVGB 1A3LL 4OFVA 3MACH 5TE7L 5LAXA 4XWGL 5TQ2L 3S5LB 4J3SA 1UKSA 3OB8A 4IBLT 2A6JB 2VLJE 4L3ED 3CZJA 1AGFB 2B5IC 2BVTA 3U30C 5BO1L 1ZHKA 3QI9D 2CIKA 4MHHG 3LN4B 3H9YA 3FFCA 2ZSWB 2VZOA 1GGBL 1F4XH 4LKXA 1D5XB 4YHPA 1BFVH 5CBEB 4LSVH 4CNIA 3NBNA 1S9WB 1KG0A 4X98A 5T5NF 4FFZL 5H8DA 4RGOL 3QPXL 2LTQC 3RIFF 1QBMH 2YZ8A 3H7BB 5C92A 3CFBA 1MFAL 2YR3A 4I48A 1BM3L 2G2RB 1KEMH 4WNQA 1T6WA 9CGTA 4S10A 4JFHD 4RZCA 3RPKA 4JY6A 4UV7L 43C9A 1OAKL 4LVHC 3AU1A 3P4OA 2WLYA 2YXMA 2GJZA 3ZTJG 1JHKL 2RJMA 4OZGE 1F4YH 4ZS6D 4AT6A 4JHZA 1MFNA 4H8WC 1MCKA 2HFGL 1PG7W 4TVPL 3ARGA 4LRIA 1UJ3A 1CGXA 4QHUB 3RVUC 5AWNH 2JB5L 3ZDYF 2F74A 5EORH 2YD4A 1RV6X 3DX7A 2VZUA 1CD0A 1OAZL 3WFCH 4P9HH 4PS4H 4AEHL 2FATH 3HI1B 1T4KA 5FYKU 3DV4B 1JZ3A 4MJIA 5F6IC 4OGXH 4GXVH 3OGCB 5KW9L 1T5XA 1WGOA 3IXAB 5BRZB 4HUXA 3EYSL 5KVFL 2R9HC 5IIEA 2O26U 3C5ZD 1BGXH 1HQ4A 3S88L 5C0AD 1P2CB 5MI0C 2OXGA 2R2HA 4Q2ZA 5FYKD 1E4JA 3U4BH 3V0VB 1FZKA 1F6AB 4S1SH 1R24A 4S0SD 4DW2L 5MEQB 4G6MH 5F9WB 2AGJH 4UDUA 3L7EB 1MJJB 4KKCD 2F58H 3EYVB 3MRDA 3D25B 5JNYA 2GQHA 1JCKA 2EIBA 4JHBA 3TBYB 2R2BA 4V1DB 1YYLL 1OP3K 3FCTA 5DO2C 4XXDA 4BFIB 3MO1A 4ZXBB 3TNNA 4JHWH 2H26A 1JRHH 4XI5C 4LEXL 1WWWX 2XWBA 4Z7UE 3VXUA 4HS6B 4UTBL 2CDFB 4QRPB 3DETD 4AY0A 3X14A 1FGVH 5EU4A 1ND0B 5GRYA 5B4MC 1JNNH 4WJ5A 2AI0H 5MENE 2B0SL 4HF5H 3HI5H 2ADIB 3BO8A 3PGCB 5T1LD 1VACA 4M1DL 3Q1SL 4CN6A 1OGTB 5BV7L 3BEWA 3LPWA 4LMQE 1OSZA 3ZKND 3GJFK 4L3EA 3PV6B 3DXAD 1IRAY 4QT5A 5IROC 3U7AA 4DN4H 3QI9A 2DD8L 3LQAC 2V17L 5K33A 4WUUE 4Y5YA 1X9QA 1T1YB 2FBJL 3FRUA 1XCTA 1KJMB 5DFVD 2BJMH 4WO4B 3SCMA 5F3HA 4BSWB 3PGFH 3ZYOA 3I2CL 4KKAC 1LK3L 2NW2B 2HFEA 1OP9A 1DQMH 1QLRB 4G8IA 4LVOC 5SX4H 3ZHLA 5CZXC 3MODH 4XH2A 3ETBF 5GRJH 3NTCH 5F7NC 1A7RL 2K3TA 4UT6H 1MEXH 5DJ2B 5CMAA 1FORL 5FUZL 5A3ID 1I7TB 5MEOB 4NO2A 3WD5L 2X05A 4RRPA 4JRWA 3MACL 3BZ4B 3HZMB 5CCKH 3WXVH 4O4YL 4A2LA 3ULUD 2CR6A 3E3QE 5DD5H 3D18A 5FM5O 4XMKL 2OI9B 1H3WM 4NKQB 4ODHH 2EDRA 1Z9LA 4RMQA 1F4XL 1ZANH 3VG9B 1NKOA 1BFVL 1ACZA 4LSVL 5CGMA 4J3UA 5CIPH 1KGCD 1IM9A 1I8KB 3GMLA 1S7XA 2X4UA 5IB3B 4TQEH 5IM7B 5FYKL 3BMWA 5KBNC 5ILTH 2UVFA 3RWIA 3T8XA 3C5ZA 4NFCA 5C0AA 3VGDA 1A2YB 1W2KT 5JXEC 1WQVT 4JPIB 1A1MB 3QNZA 3H42L 4OSUH 1ZAGA 5DJDA 5GIRB 5JA9A 3MX0A 2DIJA 1MI5D 1P6AB 1F4YL 5C0RL 2EYSA 4OCLC 4YBLC 5DK0A 5AWNL 5HGAA 1X5GA 1MHPL 4FXGA 5GJTH 3VRJA 4WI4A 3VGGA 3L5HA 1J8HE 3O45A 4U6TA 1FNEA 4X9FA 3ZL4H 2IC2A 3UTTB 4MDJB 4GXVL 5ADPH 1G7IA 4N9OB 4P9MH 1EEYA 3RKDD 5FO8A 2VUYA 4N0FB 1PEWA 3TEUA 1MCSA 4LF3B 1YY8B 1NUGA 3FJTA 1BGXL 2Y06H 5EULV 5T1LA 2ICEB 4NKIH 2X4SA 1FZJB 3NIFE 4R90L 3KJ6H 4JM4H 5DEGB 3D39B 3O8XD 1S7TB 3X17A 2R2EB 4IHOA 4S1SL 3PP3H 4G6ML 4L8CB 3U7WL 4QRRD 3DXAA 4PJIB 2VNCA 3L95A 3P9LA 3QYCA 3OKMB 3HLAA 1Q0YH 3RI5F 2PO6B 5IJKC 1WICA 1QHPA 2FECI 1HH6A 3LEVL 3QJHB 4R7NB 4PJXF 5FA3A 2XI9A 3BYTA 4LQFH 4JHWL 3B9DA 3EYQD 3OG4B 1QRKA 4NC1E 4N0CD 1DR9A 1MHEB 3SDAB 3UZVB 2C26A 3U4EA 1MLBB 2OJZH 4MA1B 1FGVL 2Z93A 1DL7H 1BZ9B 1JNNL 2HTLD 4PGEB 3ULUL 3TCXA 2AI0L 1YC7A 3WLBA 1LO0H 4HF5L 3HI5L 3V6OA 3VGFA 4WU5A 4LDOB 1I1FA 2XWTA 2Z0BA 1K2DA 2R39A 5DJYA 3F58H 2NXYC 3G6DL 5T1DH 4FXLA 1F02I 3ZDYE 4HUMB 2UWEA 3BVNB 4RWHA 1C7SA 2YRLA 3MFGB 3VFUA 3L5JA 1GH7A 4DN4L 1E6OH 2Z31B 2QSQA 4MJ2A 1M6OB 5JW4R 3MLUH 1N59A 5IVXB 1ZS8A 5I8EB 1CD1B 4L3CB 3TBVA 3VFGH 4QHKI 2DWDB 1V3KA 3PGFL 3DX8B 3PWVB 2IPUK 3MODL 4U1JA 5J57B 5GRJL 2V2WB 3NTCL 1XF2A 4U1IA 4WW1A 1ROWA 3MCG1 5KVEH 1KJ2B 3JTTA 2DJUA 4ZUVA 1FL3B 3RA7H 3TZVC 5CWSB 3M17A 4PV8B 1CDIA 4IOSD 1S3KL 3DOSA 4XNXH 1P4BH 2BVOB 4GMSH 5CCKL 5AD0B 4QOKB 3WXVL 4S1DC 1U6AL 5DRWB 2ITCA 1TJIH 1JN6B 1MI5A 3PV7A 1P9MC 4N9GA 5IMMB 1XGRB 4XAKE 3TA3D 2NY4C 3STLB 4ODHL 1MHCB 5HDQH 2ADGB 5E03A 1X5LA 4XHJD 3QEQD 5CSZA 1ZANL 3DRTB 1KCVH 2XFXA 4RMUA 1QLFA 1BQLL 1FL5A 2E6JA 3EZJB 2D4DA 3RUGA 2EE3A 5ILTL 1H5BB 5CIPA 5HTSA 4X6BA 2H32B 3B9KD 3VXOA 3X12B 1ONQA 2IMNA 4PGJA 4RMRA 5DQJA 3F8UB 1WJ3A 3ROOB 2IBBA 3MGTA 4HKBA 1MSPA 1RFDH 1K4CA 3O8XA 1ZHNB 2A6DB 5GS3A 4JO2H 2JJSA 4OSUL 4QRRA 4HV8A 4WENB 4QF1B 1AO7D 1FVDA 2VDQH 2DMKA 5D7IF 3SBWC 3SGDH 1XT5A 2VKWA 3BGMB 4YUEH 5B8CA 3WFBH 5GJTL 4HUKB 1A6UH 4FZEH 3MV9B 1MNUH 3QIWD 3ZL4L 3ZKXC 5ADPL 1VFOA 4MXQC 3G6JA 4X7SH 2Q86A 5L2KD 1J05B 4P9ML 3E1F1 2GJJA 3QFDA 5DT1L 1GGIH 3BKYL 4Y89A 3EO0B 3IAQA 3RTQC 2Y06L 1SJXA 2BZDA 1E4KC 4NKIL 1QZ1A 1HH9B 1YMMB 3KJ6L 4JM4L 4FFWD 3WN5A 4J12A 2JTDA 43CAA 5HYSG 5E8PA 3SGKC 2HVJB 1KPVA 2WWMC 4HUUA 4OIIH 1E4XH 2VR4A 5FK9A 3ULVC 1Q0YL 3GSUB 1CGUA 1TCMA 4OLXH 1HI6A 2E9WA 4QRUB 2QKIA 3EYUH 3NIGE 4YC2C 4P2OD 4Z7NE 5I73B 5TH2A 2FIKA 1MCLA 2DM3A 4JCMA 4S2SB 5CZVL 2BRRH 4OCXH 1ZHLB 4UQ3A 1MHHA 3FQWB 1UWEH 1GXEA 3QISA 2MPAH 1CXIA 4IIQA 3CFCL 4PJ5D 1UC6A 3FO1A 3ZSTA 1LO0L 2JIXD 5HI5C 4F58L 3P2TA 4JPKH 4I0CC 4ZQKB 3MRBA 4KXZH 4U31A 2BHYA 5T1DL 3K4ZA 4K8RD 4U6YB 1NDGB 5EC2B 2A73A 5HYJB 1PQZB 5HDLA 3QT2A 1F3DH 3BGAA 3Q5YA 1U8QA 3TA3A 5GJSL 1IEHA 1FLTX 3JVGA 3NCJH 1IT9L 2ENYA 4TTGA 1E6OL 3QEQA 1G7HA 1R5WB 4PJDB 5GGQH 3MLUL 4QTIH 1JTPA 1J86A 3VFGL 1BFTA 5AEAA 5FYLD 3KPMB 4CL7A 4YE4H 4OLVH 1NQBA 2R56H 3GSXB 4G8FB 4LVNB 4AK1A 5D2NA 1C12B 2DIAA 1H3PH 4DKFH 2W0KA 2EIEA 3FQUA 3F6IA 4KI5C 1L6XA 1J87A 4XNXL 4GMSL 4TUJA 4U0QB 5DTFB 1AO7A 2X1QA 1TJIL 5F1NB 4W6YB 4XHQA 1A47A 1B0GA 2D7NA 5DJ6A 4PRNB 1NEZA 2XKNB 4X7FC 3SDXB 1KELL 3PWJA 5HDQL 4I3SH 4H0HB 4R97B 3ESUF 3MGOA 3FOMA 4BQ6A 1KCVL 4MYWB 5C08D 1ZLUK 1TQCB 3QIWA 1JWMB 3UBXA 2VWEC 5L2KA 3NPSC 5D96B 4LCCA 3AREC 4YBHA 2DYPD 3VRLF 1BLNB 2HTKC 1ZA6B 1MFCH 2GT9B 1T1XA 1KF9B 1X4ZA 3KLDA 3T77A 1XR8A 5JQHC 2EIZB 4JGUA 2RQ8A 5ISZD 1RFDL 5DMKA 2ATKB 3C08H 1YYMH 3P0YL 5EBWB 4B53A 1BEYH 1DN0A 3HG1E 4JO2L 3MZTA 1FV1A 5DRXB 2BSRB 5IB4B 2YRPA 3IDNB 3CU1A 2IALA 1T66D 3VXME 2PYEE 2HFFB 5ESVA 3TCLA 4YUEL 1CZ8L 1R5IA 1IKFL 1IAIL 2VAAA 4U49A 3CCHA 2EYRA 2CKBL 3WFBL 4P2OA 5CD3B 5JW4Q 2YPLB 1RK0B 1A6UL 4FZEL 3CVIL 3EFDH 1AP2A 3TH3T 4Y1AE 2BNUA 4DEPB 3LKRB 1MNUL 1N6UA 2CKBA 1WBZA 1TVBB 3OXRB 1UGNA 1YEGL 1GGIL 4PJ5A 1F11A 2WQ8A 1A1OA 1HINL 5FB8A 2AQ2A 1EK3A 3W0WB 3LRSB 3EDFA 1A9BA 5BS0D 1HNGA 3AMKA 3RQ3A 1MVUB 3HR5B 5B21A 1DUYA 4OLUH 4POYA 4MX7B 1X7QB 3BI9X 3NN8B 4B41A 2GSGA 2VLKB 2IFFH 4GBXC 1M7IB 5GZOD 2G5BB 4L8DB 4ZFFA 3RWFA 1QBBA 4KMTH 4WWKB 3HZKB 1XAUA 3QUZB 4D9RE 2BRRL 1W72B 5I1JH 1G6RH 2VL5A 2OSLB 3MJ6A 1UWEL 1JUFB 1MCRA 1TIUA 1Q9KA 3BN9C 5E6ID 1BPVA 2MPAL 1CLCA 3WIHH 4AENA 4LEOA 3HS0A 4DN3H 3C6SB 4S1RH 4MAYD 4QXTA 3DYMA 3GMMA 5HHMB 5D7IE 2WBJC 3IFNH 1ZHBA