3NSCA

C500s mutant of cueo bound to cu(ii)
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
493
structure length
470
Chain Sequence
b'ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHEDTGMMLGFTVLQGDHG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase cueO
publication title Crystal structures of multicopper oxidase CueO bound to copper(I) and silver(I): functional role of a methionine-rich sequence.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 134
structure length 470
sequence length 493
ec nomenclature
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nscA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nscA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nscA03
4X4KA 1GW0A 3TA4D 1J5DA 1QHQA 3NT0A 2HX9A 3EH3B 4CSZA 1SJMA 2PPEA 2X88A 4DP4X 3WG7B 3AY2A 4KOBA 1NICA 3S3DB 1PMYA 1AS7A 4G7QB 1GS7A 2HX7A 3CG8A 3FQYA 3G5WA 4WKXA 2CBPA 1UATA 5B7MA 2YXVA 1NTDA 5AZUA 3PAVA 2IH8A 5I6PA 5I5JA 2B3IA 1L9TA 4AKQA 1NIAA 2UXFA 3UAAA 2DYRB 1KCBA 2ZWNA 3FU7A 1NWOA 2XYBA 3CVCA 1MG3C 1NIDA 2IWEA 3AG3B 3NSFA 3ABLB 4GXFA 4ZK8A 2QDWA 1AZUA 1J9QA 1KYAA 3S8FB 2I7SA 1AZNA 1AAJA 2PPCA 3X1FA 1E65A 3FS9A 3TBCA 4FAAB 1IBZA 1BQ5A 2I85A 3ZDWA 1WS7A 3OMIB 3WIAA 5TK2A 1MG2C 4YSQA 5EHFA 2YXWA 2P80D 9PCYA 3ZX1A 4EF3A 1E30A 2YAHA 4HALA 2N0MA 5I26A 4HCGA 4DPCX 3IEAA 1WA0X 1MDAA 2FQFA 2CJ3A 3FT0A 4ENZA 3IE9A 1OE3A 1ET5A 1TKWA 1FWXA 1SF5A 3ASNB 1WS8A 1ZV2A 2E86A 2XV2A 3H56A 2AZAA 3ERXA 1A4CA 3X1BA 2J5WA 3CZUB 4Q89A 4MFHA 1OCZB 3KW8A 3ASOB 1CC3A 3X1GA 7PCYA 2JFCA 4YSEA 2XV3A 3ABGA 3NP3A 1V10A 3OMAB 1BQRA 3DKHA 1PNDA 3NJLA 4F2FA 5I6LA 2IDTA 3CDZB 2WSDA 2BWIA 2YAMA 3PXLA 2GHZA 1W6WA 2W8CA 2PCYA 1VLXA 4Q8BA 1CYWA 1TU2A 2XU9A 2XX0A 5D4IA 4UAHA 1AG0A 1RCYA 2FWLB 4BK5C 1BXUA 2VM4A 3JT2A 2EIMB 1KDJA 2IWFA 1NPNA 2J55A 2VSMB 1V55B 1WA2X 7PAZA 1OF0A 2LLNA 1ZIAA 1GYCA 4UF7C 3WKPA 1E5ZA 2YQBA 4P5SA 4YSRA 2VMJA 1WAEA 3FYEB 4E9QA 5I6MA 4G70B 4KO9A 1SNRA 2VM3A 2QPDB 3PPSA 3AZUA 4BWWA 3NJIA 1NINA 4A2EA 4E9VA 4W1TA 3NJNA 4JKNA 2GB2A 3WNIA 4BXVA 1RZQA 2HZHA 1AG6A 1M9WA 1SF3A 2JXMA 4W9ZA 2I7OA 5B1KA 5B1JC 3RYMA 2YAPA 1DYZA 1QNIA 4QKTA 1JZGA 4HIPA 1PAZA 5IY5B 1MZZA 1N70A 3X1EA 4HCFA 3NP4A 1JERA 3FQ2A 2CUAA 3AG4B 3GXUB 5D4JA 3DTUB 3TU6A 4E9WA 2J56A 1HAWA 3NJKA 4A2DA 4BWUA 2QPEB 3EHBB 4P5RA 2JKWA 4JHUA 2YAQA 2EILB 3FQ1A 2BW5A 1URIA 4A68A 5AKRA 5I5MA 2Q5BA 4A2FA 3AG1B 4HHGA 1PLBA 2AANA 3CDZA 5E9NA 5A7EA 1AZCA 2UX6A 2DWSA 1KV7A 2BZ7A 1IUZA 1MZYA 2HLEB 1GS6X 1L9SA 2BP8B 1HAUA 2VSKB 1ZIBA 4NAJA 3OMNB 1F56A 1DZ0A 3NSCA 1NWPA 2CAKA 2YAOA 1HFUA 2XXFA 3BQVA 1PZAA 1JVOA 4M3HA 4N4YB 2XLLA 1J9RA 3NSYA 3T6ZA 1PF3A 1KDIA 1TEFA 3H4FA 4KOCA 3GYRA 3NJGA 1SFDA 1ZPUA 4YSUA 4DP9X 1A4AA 1NPJA 5B1AB 2IH9A 4GP4B 1NZRA 2A3TA 2XWZA 1AOZA 2P80A 1M57B 3QJRB 3QJTB 4GP8B 2BHFA 3HEIB 3IBOA 4TXVB 1SDDB 1GR7A 4KNUA 4NB7A 1JXFA 1GS8A 1KBWA 2DWTA 2HRHA 3NJFA 1PNCA 1W6LA 5I6OA 1BYPA 3GDCA 1X9UA 4DP2X 4HHWA 3D12B 4K9JA 3V9CA 4KO6A 1JXDA 2MTAA 3EF4A 4GYBA 2VW7A 3ABMB 3CVDA 2IDQA 3DIVA 4WTQA 3S3CB 2EINB 2PLTA 4DPBX 4AKOA 2PPAA 2XX1A 2J57A 1SHWA 2IDUA 1KCWA 1XB6A 1QLEB 4G7RB 2QDVA 1FA4A 2DYSB 2NRDA 2OV0A 2Q9OA 3SBPA 1BYOA 4KO7A 2IWKA 3QJUB 1AZBA 4RH4A 4HAKA 1EZLA 4YSOA 4E9YA 4YL4A 2PP8A 1BXAA 2XV0A 2BP8A 2CALA 2GC4C 4DP8X 2PCFA 3AG2B 2H5UA 1WA1X 2B08A 2PP7A 4M4RB 1NIEA 4PAZA 3OM3B 4BXSV 2BP0B 4YSDA 2TSBA 2VW6A 1EHKB 1NIFA 1ADWA 5LDUA 3T6WA 2R7EB 4N8UA 1OOWA 2VN3A 2OJ1A 1JXGA 3FSVA 3PLYA 3SBQA 4DPAX 4YSSA 3UAEA 2GSMB 2XVBA 3HB3B 4DP5X 1JVLA 3SQRA 1E67A 5PCYA 4YSTA 5AFAA 3X2QB 2FQDA 2WO3B 4UANA 4HZ1A 4AKPA 3FPXA 2H3XC 2ZXWB 1L9QA 2CCWA 3ABKB 1AS6A 2ZONA 1JOIA 4KNSA 4F2EA 4YSPA 1BQKA 5F7AA 3QJVB 2DV6A 1A4BA 1SDDA 1PLCA 2XXGA 3FU9A 2FJSA 1B3IA 2YARA 2FQEA 1XMEB 1ZDQA 2GC7C 4A67A 4G7SB 4PCYA 3PAUA 1JZHA 2IDSA 3NJHA 1OE1A 4AZUA 3JTBA 1AQ8A 1PZCA 3QPKA 1A8ZA 2MRYA 2UXGA 1ASQA 4JHVA 1JZJA 1ID2A 5B7EA 2BW4A 3FSAA 4DP1X 2HRGA 1ET8A 2IAAC 1GY2A 1W8EA 1ILUA 2X87A 1NIBA 4A2GA 5B1BB 1CUOA 2GI0A 1R1CA 3QJSB 3ZIYA 1PLAA 4A2HA 3X1NA 1JZIA 3PAZA 4YSAA 4BDVB 1X9RA 5I6NA 1IKOP 3IN2A 2FNWA 3FYIB 2RACA 1ET7A 4L0PB 1AS8A 5I28A 3H4HA 2UX7A 3N55A 1NDTA 1A65A 1JZFA 1AANA 2IDFA 3MX0B 3QJQB 4DP7X 2QT6A 1PZBA 3N2JA 2PP9A 2HXAA 2AFNA 5ANHA 3U25A 1OCOB 1ZDSA 4DP6X 3FPYA 4E9RA 1BEXA 2PPFA 1AZRA 2UXTA 4YSCA 1T5KA 2UXVA 2TSAA 2FTAA 2BP0A 2BWDA 3FSZA 4A66A 1M56B 2EIKB 1I53A 1L9OA 2R7EA 6PAZA 8PAZA 4E9XA 3FU8A 3SBRA 1RZPA 3PCYA 5FC9A 2FT6A 1JZEA 5TK4A 4HCIA 2ZOOA 3TASA 2OCCB 5I5IA 2PPDA 4F7KA 6PCYA 1OCCB 3BVDB 4YVNA 1AIZA 1N68A 5F7BA 3T6XA 2WO2B 4CSPA 2VW4A 1PY0A 3C75A 3WI9A 4AX3A 1XB3A 1AR1B 1GSKA 3UADA 3L45A 3MBWB 2GBAA 1ILSA 3UACA 5I6KA 1ASPA 1ETJA 2AVFA 3ZBMA 3AW5A 1E5YA 1L9RA 3NYKA 4GP5B 1OV8A 4FA7B 1J9TA 3S3BB 1RKRA 2YAEA 1V54B 1BAWA 2HX8A 3QQXA 2BO0A 3WKQA 1L9PA 4E9TA 1SHXA 2EIJB 5PAZA 3NJJA 1FFTB 3FU7B 1TEGA 3TBBA 3NJMA 4E9SA 1IBYA 1A3ZA 2Y1AA 4KO5A 3T71A 4BDVA 4NERA 2YAFA 4YVUA 1OE2A 3WNJA 1XB8A 3T9WA 3EH5B 3EH4B 2DY2A 1KBVA 3V9EA 4G71B 1CURA 2XUWA 3FSWA 2H47C 5D4HA 1OCRB 1YLBB 3CVBA 3UGEA 5B1JA 2FT7A 1IC0A 1SFHA 2Y69B 3S8GB 4DP0X 1PCSA 2AZUA 1AACA 3IN0A 3T6VA 1CYXA 1KGYE 1J5CA 4BWTA 3OD3A 4G72B 1GY1A 1J9SA 5B3SB 4KNTA 4AI7A 2FT8A 3OQRA 5B7FA 1ASOA 4QLWA 3KW7A 2GIMA 2W88A 1BXVA 3UABA 2BZCA 3NSDA 4GY4A 2FQGA
chains in the Genus database with same CATH superfamily
3EJQA 5F7EL 4XTRD 1UASA 4JPKL 1BLNA 2ZKWA 3HI6H 3QC6X 5C09A 1UURA 4QRRB 1CLVA 4K9EC 2XFXB 3ECVA 2Z31D 1EHNA 1V3KA 2HKFH 1PYWA 4X5WA 5ISZA 5A2LH 1CL7I 3RHWF 4OFYD 3BUDA 2LLLA 4GT0A 2DQIH 4F33A 4WEBH 1CE1L 2VLRA 1D5BB 5LCVH 4Y9BA 1E4HA 4RGND 4V1DD 3APCA 1Q9WA 1V3JA 4X9BA 5FGCB 1BQUA 3M7OA 4BSVA 1S7WB 1NCJA 2BVUA 4WTZA 4QOKE 2NYZA 4G9FA 5DEJA 5FOBA 3U7YL 1MG3C 2DM2A 4E42B 3CSGA 2WY3B 3PYCA 2RH0A 4HGWB 4M62H 4PJ5B 4A6YL 4BZ1H 2P7TB 2K1MA 2PPCA 2X4RB 2VTFA 2QELA 4EI5B 3FS9A 4IIQB 3H3PL 4MNGA 1BBDH 4OGYH 1P84J 1YZZA 3Q6FA 2W07B 4I1NB 1H3TA 2MOGA 5DHVH 2HTKC 3BMVA 3FCGA 3QORB 3RX5A 1B4LA 1J88A 3V0DA 3AREB 1SMDA 3TLRA 2BZDA 2ZCLH 4JZJB 5AW9B 3FN0L 5CEYA 2CKBB 1KG0B 3ROLA 3EGSA 4MQXC 4YGAB 4F7PB 5HI3C 4B7LA 4KFMA 3OX8B 1FGVL 2EDOA 2X1XR 3BN9C 5I0YA 1E90A 3GBNL 2FLRT 4NNYA 3E7JA 4GO9A 5L2KB 2AZAA 3MUGB 5DEGA 1F11A 1USQA 4FMFA 4WUUE 3TPUB 4AW4A 3CZUB 3FB5B 5TPWH 1VKXA 1NKGA 2YEQA 3X1GA 3O6KL 4FYSA 1ZA6A 3G6DL 1OCWH 4BCYA 2XV3A 3V52L 2G3NA 4O58L 3F83A 1BPLB 4GBXA 1MCSA 1DJSA 4JFEB 4U4BA 4PRPE 3NJLA 4EVNA 1U3HC 5J57B 1I8KB 4XXDA 2BWIA 4BA0A 5BXFB 5JMRA 2APFA 1DVFB 4WGVB 4CMHC 1AKPA 3BSZL 2J25A 5CCHE 1NLDL 4P9ML 4Z3GA 5KYWA 2FO1A 2K9UA 2UWEE 3IXTA 5FO8A 5IROC 3DI2B 3TCLA 2FSEA 1L7TH 4YFLF 4DJMA 2FEEL 1QTYT 3TYFA 3CSTA 1C5DA 3EGDA 5DEFA 3OZLA 5CILH 2JH2A 1OGAE 1T20B 3BX7C 4UF7C 3V6OC 5TF0A 2NT0A 2XWTA 3UC0L 1JZ2A 1MHEA 1SEQL 2XN9A 4XGZB 2ZAGA 2A2QT 4PWKA 3RFZC 4E9QA 3MLRL 3VVWA 5EB9A 1QO3B 4LPYA 1ZS8B 5J56B 1Q72H 1SNRA 2WXIA 3WKNA 1DBKH 4XPAL 3T4YB 2NQCA 3FO9A 2A83A 3FH8A 3RNQB 5HYSG 1E9OA 2NY0D 4KWUA 1U41A 1UCTA 4FX5A 3THMH 2EYRA 4CJ1A 4JKNA 4PWFA 2FNBA 3HVDA 1FVEB 4G6JH 1B4JL 5I76B 2ED6A 4BIKA 4O00A 3I02A 1KXVC 3RYMA 4PJ9D 1G7MB 2WINB 3QPXL 4GIAA 2EICA 3QWRD 4MB4A 2IPUG 5BZXA 3UYRL 3T0EC 4JQIA 5E03A 2YGNA 4X8JB 1ROCA 3DPBA 4Y4HA 1E4WH 4NSKB 2E7LC 1Y07A 4NBZB 4ZTOH 1QQDA 4F15C 2ZWSA 3AM8C 2CHWA 1QSED 5J6HB 4A2DA 4BWUA 3S36X 3LPOA 1WHPA 2HT4D 4U7MA 1YPZF 4YHMH 3ZE2E 1GIGL 3CFBA 3EJPA 4BUGA 4B9CA 5AAWA 3FU0A 2DICA 4U0RC 4R7NA 4WGWB 5E9DE 3FOLA 1XF3A 2HH0L 2B1HH 4Q56A 4F9LC 2NY7H 4JO2H 4K23L 2XBZA 4HUNB 4QCIB 1NGQH 1UA6H 3IMTA 2WLLA 1AQDA 4PJGA 3F5WA 2ZX6A 3A0OA 4O02L 3BAIA 3PXHA 5ADPH 3D3VB 3P2BA 5DFVD 5KJ4A 4N9GA 1U58A 1ZEAH 4CRPA 3K0WA 1JGDB 3SSGA 1KY6A 4ETYA 3TBYA 4GMSH 1TJIH 3VGBA 3D0LB 5CLYA 1A3LH 3ISYA 3LN4A 5FHAL 3VXRA 2MSPA 1VRSA 1H3GA 4NFDA 3FTGA 5F7UA 4P2AA 2NYKA 4CADB 3EOYG 1XH0A 4GSUA 4TQEH 2DEYX 1NCDH 4KV5F 5IW1B 3RWHB 4R5TA 4FNLH 4KY1H 1Z9NA 2OPCA 4F58L 4G8GD 3LKPA 1A4AA 1WEJH 2P45B 4FEIA 4PWGA 4NRYB 5FYJL 1FJ1B 2DLFH 1GYUA 2IH9A 2PKDA 1KCVH 2V5MA 1OT2A 2PYFA 1KLUB 1M57B 5TF1H 1NA8A 2VZ1A 2YJQA 4Z0XB 2FBRA 1C08A 5CKGA 5I5RA 1JTOA 3II3A 4JZJA 2VL4A 3H9ZA 3MUHL 4XNBA 1BZEA 4HCRA 1DQVA 1NBQA 4ESKA 3BT2H 2NNFA 3EFFA 5D1QA 3GI8H 1BF2A 2NLJB 1AVAA 4J4PC 5FLVA 3KE0A 5JORB 3U46A 5EC2A 4EQ3A 3ZZLA 1F3JB 4XZUB 2HLFD 3GRWA 2X89A 2R0KL 2MTAA 3F8UB 2XN0A 4PREB 2BIHA 5E1IA 2H32A 3S35X 5C71A 4N0UA 2B0SL 5JXEA 4DPBX 4MLSA 5CZVH 5C0DA 5KS9F 1QP1A 2VZVA 4P2QB 2N7BA 1MJJA 1F0LA 4ZAKA 4ZMOA 1FDLL 2Y3NA 3I2CL 3NZ8A 4G6MH 2E6PA 3ZHDA 3SBPA 4ZX3A 3DURA 4PP2B 1O0VA 3C6LC 3W9DA 4J3OG 1AZBA 1OY3B 4PY7A 4OCXH 4E9YA 1LK3L 2XETA 1SJVA 4PJIA 4KK9D 2L0DA 2GC4C 3MXVL 1G4MA 1IEAB 1QEWA 3DX8A 1B2WH 2VDRH 3QR2A 1NIEA 3JWDH 4ZYKB 4A7VA 2VDOH 1MWAB 1SVZA 1ROWA 3H9HB 4UQ2A 2OMBA 5GRUH 1CXIA 3GMRA 5E8PB 1KPUA 1R5VA 3GKZA 1HIMH 4KROC 2EH7H 2VN3A 4WWKC 4AE0A 4OH2A 3QJHB 4DPAX 1WVZA 3SCMD 5C92A 5AFAA 5T3ZL 1VGKA 1CF8H 4G1MA 4JHZA 4Z78A 5BS0E 4H20L 2VLME 5EEWA 1PKQB 2WZ0A 3D85A 4BZ2H 2F58L 2NUPB 3DGGB 2H3XC 4PJHB 2F08A 2APTA 1FFNA 1TYJA 1F86A 2DQDH 1JOIA 3O2WH 3K71B 4YSPA 5F7FA 4JMXA 3MAWA 1G0YR 2JCCA 1AZZC 3FU9A 3HAEA 4G80A 2VAAB 5GXBB 1B3IA 1CGWA 4WWNA 2FQEA 4G8FA 2ATAA 2MPVA 3GXTA 4PCYA 4JKLA 1DQQB 3NJHA 2VDMH 3WIIH 2P47B 1AQ8A 5ADOH 2UXGA 1U0QA 1MAMH 4NQEA 4UQCA 2ZSVA 2ENYA 4LQFL 4MAYC 1DTUA 3S8WA 2IPTL 1YEDB 5E4OA 4AYSA 4PG2C 3ZSTA 1ODAA 3B34A 1GHFL 3O45A 1H3VA 3ZIYA 1G7QA 2XQYA 4FL4B 2YD2A 3GXMA 4UDTB 2Z8SA 2QQLH 2WQVA 3DSFH 5EF1A 1YQVL 5EUOB 1ET7A 2FIKA 2P3YA 5CJOH 1AANA 2R69L 4DP7X 5C0IB 4Z77B 3EG9A 1EEQA 3UBGA 4RRPG 1J1PL 2ICEB 3C5SA 5ABZA 2K4WA 3QQ4B 4GRLA 4RA3A 2E59A 5DRWB 4RRPM 2GFBB 3FPYA 2CM6A 3MRHB 3IU4L 4AVIA 5D2LA 1OAQL 4YR6B 1QSFD 2ZUWA 4RFNB 4AG4H 3MRCA 2R7EA 4W9KC 2N01B 4K7FA 1E7VA 5CCJA 4UUJB 5M94B 3A67L 3VTAA 1P84K 4FQJL 4FFWD 4ZUSB 4OZIA 5EC1B 1OCCB 3BVDB 3BWAB 4R5VA 2NR6A 2Z0BA 3BESR 4ONHA 5AUMA 1SXSA 4QHLA 2X2HA 5EZOH 5LNDA 4XMLL 2Q7NA 3MLXL 2K78A 3HMWL 1XGQA 2AEPH 2DYPD 3OLEA 4JM2D 3FRUA 4KH2A 1ETJA 4QRRD 2NOYA 3R1GL 1CTOA 2OMNA 3WKMH 3L2LA 5EZIL 3QDGD 3QWOA 2Y4SA 4DCQA 5SWSD 5KVDE 1L9RA 4PJDB 3ECBB 3OGOE 1KBPA 3AABA 3LKOA 4DETA 1NC4D 1B6DA 5DLLA 1NUFA 2DLGA 4YXKH 3NPSB 3SDCD 4GQ9L 4YHYB 4A6YA 1TTCA 2YBGA 2CKNA 3OG6B 4KMLB 1EO8L 1VZHA 2FH6A 3DV4A 1HCZA 4U05A 1VIWA 1P4LB 5IBLD 1FNGA 2DM3A 4IBSA 1WAAF 1XF5A 4KQ0A 1C1EL 1Z66A 1G1CA 2Y1VA 5IB5A 3QIUC 4W9DC 4JAMA 4PJ5D 5IW3A 4OGAC 4XCEB 1OAYL 3V4LA 3ECUA 1XB8A 1FG9C 4OSUH 1BQHG 3OAUH 4C83B 3IDJA 5GSVB 1D7DA 4UQ9A 5D7EA 5IVOA 2HJLA 1JD7A 3QORD 3BUTA 5ERWA 4KKZA 5DMJB 1BPVA 3QVAA 3N0AA 5H94B 4Z7UA 5JW5A 1ONQA 5EIQA 3EYUL 4PJCA 1I82A 1MCFA 1KGYE 2ITCB 4I18A 3OD3A 4OLVL 3V6BR 1OP4A 2YSSA 4IHOA 5B3JE 3QA3A 1CIDA 4ZT1A 4L8CB 3UTZB 3CC5A 5TDNB 1HHKB 5I18L 4ZO8A 2VDQH 2KKQA 1NC2A 1NMBH 5SWZB 5GGRA 1FCCA 2VMCA 4FYTA 4KKLD 3VDAA 2ZWZA 3BSZA 4JM2F 1MCIA 4DZBB 5I1IL 3Q2NA 1S5HA 3F3HA 3IBEA 3QQ3B 1HYSD 2P8PB 1UCBL 4JFED 2NNAB 4FNRA 5C07E 1KPRA 4LHJB 3U2SA 1GXEA 4W9FC 1BJ8A 2C9VA 5JTWA 1FZJA 1HX0A 1SLWA 4QUOA 4AYFB 1GPOL 1MOEA 3MCG1 4DN4H 3ARBB 4RZCA 3WS6A 3FUKA 1F45A 4MMXA 2Y07L 2G75B 1L9TA 5F1NB 1A7PL 3UJIH 4XO4A 1BZ7B 4HXAH 1FPTH 4PLOB 2UXFA 4XMPL 1AIFA 2FR4B 5BVJB 1F3DH 4OUUB 5L0QC 3VXMA 5D6DC 3S4SG 2GITA 1IAKA 5JIHA 4QF1A 3HUJB 4PGDA 3TA3B 1LM8V 4HT1H 2WBJC 4F7EB 3ZDZE 2YUXA 1Z7JA 3B9KB 4HUXA 4CU7A 3CNKA 2XOTA 4C4BA 1UGNA 1X6LA 1EFXB 3FTWA 3ARFA 2QSTA 4M48L 4Y2DA 3RY6A 2XKNB 4NCDA 2ZUQB 2DEXX 3J27A 4GO6B 4NUMA 2AAVA 4WWID 3S9DB 4R2GC 3P77B 1I9JH 3B2UC 4YDKH 3HOGA 4AQ8C 3SDDA 3FRPG 2IDCA 3WJJC 2EYSA 4ZUVA 3WO4C 5HHVL 4K3HA 4Q2ZA 1RZKC 1JV5B 2EC9U 4HCGA 3S7GA 2QSCH 3GXDA 1MDAA 1PQZB 2FQFA 1ND0B 2GW5A 3IRCA 2E56A 3TO2B 5MP6L 4MMYA 1WCBB 2R83A 2QLYA 1FWXA 4UV7H 1UGKA 3HG1A 2Y7QA 4WWOA 3NCCB 1M6OA 4YDJA 3SGEI 1ZXKA 4PGBB 3H56A 2W81C 5HHXL 2ZXCA 4MQSB 1LQSR 1HH6B 2X6CA 5JPMC 2ZUXA 2VXUL 3KNBB 1CC3A 3HB3C 5E08L 2DZEA 3HJ0A 2WB1A 4O02A 1QLEH 3PP4H 3OLDA 4XN7A 3OMAB 5E00A 3CFEA 3FQ4A 5HHOD 3JQOB 1A5FH 4XP9H 4F7TA 1SDAB 4V2BA 3ZOAA 4NHUB 4L4JA 1G7PA 2R4RL 2Z8RA 3QAZB 4L5FL 1DR9A 2R2BA 1V7NL 3BKYH 3D3VD 4B95C 2Q2LA 5AVZB 4XN9A 1U8HA 5CUSL 1BXUA 4F92B 1NM9A 2FHBA 5D1ZC 1XF1A 1VJSA 2NXYC 4TUOB 2AJ3B 2WWKT 1QASA 2DMHA 3FQTA 4J1UB 5GZOC 5FLUA 1E3XA 5HVHC 1BJ1J 3UTOA 1YN7B 4XOCA 1TO5A 1QRNB 2JIXD 1E5ZA 1XSJA 2VDRB 4NUGL 1GGYA 3GRBA 2K6ZA 2VDOB 4KDTC 3BP4B 1BG1A 1S7VB 2OQJB 4OCWL 3S36L 3TT1L 1LMIA 4S11A 2VJ8A 5CLTA 5ISZE 2RFXA 1IAOB 4BWWA 3HS0B 4WY7L 3B3BA 4XP6L 2FYVA 2BMKB 1ZS2A 5EO9B 1JK9A 2YZ1A 5F70A 2OXHA 5B1JC 1JRHI 3H9SE 4N2OA 3V6FA 4GAYA 3ZUCA 3H7LA 5L4FA 4U1HA 1HSBB 4FFZH 5CBEA 1MZZA 3ROOA 2FBOJ 4N8CH 3AG4B 3L5JA 3ZKMC 4X6CF 3I6SA 2CDGA 4PI2A 4NQQA 3WTXA 3QQ9C 2CLVB 4QKXB 5C3TA 4CMHB 2QMJA 5CFAA 2EKSA 5I1JH 3EHBB 4IGBC 4P5RA 2JKWA 2VDMB 5JW3H 4JHUA 3U30C 5IM7A 1FYTD 1UWFA 4D0CB 2IQ9H 2XNAA 2AEWA 5HYJD 2BOBB 5I1GH 1U93B 4L4TB 2XDHA 3PL6B 4Y5YC 3DJTA 5IG7B 3OAZK 2TAAA 4YGVB 1Q8MA 1IUZA 1QFWH 2JQMA 4P46C 3IWVA 3RGBA 3HNVL 2BP8B 4XMKH 3CK0H 5DRZA 5KVEH 4AJVA 5CP7A 5IB3A 4MBRA 1E6JL 2XHNA 5CS7A 2OMTA 4Y16A 2AI0H 1E8ZA 5C0CB 3T6QC 2WTRB 1DVSA 1HOEA 2XXFA 2ZP0T 3QEGL 4M7LT 2EEDA 3GHEH 4UILH 3AY4C 1H9DA 2AC0A 1CQYA 1JNLL 1CTMA 1RJCA 2R2EB 3JWOC 2CA4A 3KBFA 4JFWA 1MFMA 2GKIA 3H4FA 3ILQC 4KOCA 4MB3A 4DTGL 1KTKE 2F61A 5F3BA 1ZPUA 3NABH 4D7PA 1IEBA 1X5GA 2XSKA 4JCMA 4LSVL 4A2LA 2P49B 2Z4TA 2XICA 1PKOA 3S35L 5I74B 4J6RH 3P0VH 1G9MH 4AK1A 4GP4B 2E7MA 3VFMA 2A3TA 1NUGA 2P80A 1Y18A 1J5OH 3PWLB 4U3SA 3Q2CA 1BIIB 5JIQA 1IGIL 2BHFA 3O4OC 4JFTA 4M7KL 3F6JA 4OV6F 2E0PA 5B8CA 3PIQB 4E2OA 4OVUA 1OSYA 2HRHA 5DD5H 3HCVB 3L95A 3LHPL 1KB9K 4O2CB 3RDTC 1TT6A 4DN3L 4PLNC 5BOZG 1OB1B 2A9AA 1P53A 3F7KA 2CNZA 3LN9A 4WU7A 4HMCA 3BQUC 3FQXA 4LVNC 5IHUL 2PWEA 3L4XA 2ZG1A 1WZLA 1CFVL 3MRKB 4WTQA 4K3JH 4ZTPH 2NX5A 3LZFH 2GTZA 4BHUA 4M7JH 4V2CB 2NY4C 3TFKC 5IW6A 1ZJBA 5EZLA 4X50A 1HNFA 2X0WA 1A3QA 2ZKHH 2XN9E 3A24A 3DUUA 1AO7D 2VCOA 4PJAB 4BK5A 4NQDE 4PRHB 3WL9A 4XT1C 1BG9A 2VMFA 4KH9A 4GAJH 4QRPB 3RIKA 3C6EA 1T1WA 43CAA 2IWKA 5KANI 3X12B 4N0FB 3BZFB 3WS3B 2NDGA 1R3LA 3VXOA 1BXAA 2GJPA 1ZT4A 1MFCL 3RI5K 5KBLA 3M07A 4EBQL 3OJMB 3TGXA 2FAUA 4HWZB 4Y5XA 5JIKA 4EUPA 5DRNA 1MI5B 2CR3A 3DYMA 5HGHA 5HVGB 3BIAX 5ACZA 4KTEL 1I8LA 1ZT7B 4JKMA 4H2CA 1ADWA 2CJSA 4MA8H 4S0SD 4JHBA 5TDPB 2DM4A 3VWJD 4ENED 2RHEA 3N40P 5I8OL 5C8JA 4NFCA 3NCBB 5F3HA 3O8XB 4LU5L 1PU0A 5C6WH 5AZ2L 4HKJA 2QKIC 3H55A 5JOFB 3JVGC 4QHNA 1K4CA 1T5WB 4NPYA 2HJKA 3FPXA 2B4CC 2OMWB 4M6NH 4FXGB 2LFGA 2QQNH 1UXWA 4OJCA 3ZHKA 2D3VA 4EJ1C 4PV9B 4Z7WE 5HXMA 3MV9E 1QG3A 3MMEA 3EFDL 1PBYA 4QYAA 3L3HB 5F0MB 1JVKA 1WIOA 1FVDB 1QZNA 1NGXA 2VLKB 1DSFH 3SD2A 4G7SB 1VADB 4IBTA 1TPXB 2N7AA 3T2OA 4JO4H 1IIIA 3VE0B 1BWWA 4LSPL 2VN4A 4Q6IB 4X9HA 1B4TA 3BUYB 1BVNP 4N2FA 3GMQB 1I7TB 1SMAA 2JQZA 3MV8E 3QUZC 2AMUA 4XC1H 3L7EA 4JB9H 4WDIB 1CL7L 2CDFB 2F19L 4K7PH 4I77L 3WKYA 3L4UA 1QFHA 1RU9L 4NNXB 5FYKU 2X70B 4ELKB 2VM9A 4K8RH 3QJSB 2F7RA 3X1NA 5FYKE 4NWTL 1Z5LA 5BZDB 3R06A 3TEZA 3QNZB 1NLBL 2WC7A 3IN2A 4MCNA 4O2FA 5DHEA 4ES8A 2WW8A 4S1RH 4KROB 3ESUF 1OT1A 2D3JA 2AJXL 2EC9T 2XPYA 3RIFK 2PP9A 4XB7A 3LNGA 3VMOA 2BRRL 2QGCA 2X4NB 5CJQL 1IGFL 4B6ZA 3VXNB 3R0MA 5IQ7H 4TQPA 2WQXA 4DAGH 3KPMA 5FF6B 2QZ5A 4YSCA 1CGTA 1UJ3A 3ZMRA 3KYKH 3QI9B 1QFUH 4I5BA 3PXJA 3L3KB 4PY8J 1M56B 2EIKB 3C9NA 2J8UA 4KGLA 3MACH 3WELA 4AXWA 1WG3A 5I0XA 1W15A 2FJGB 5FC9A 3PCYA 4N0UE 1X3DA 4WK2B 5CGYC 3HZMA 1FGNH 3KPRB 2MPAH 2VDNB 4L2YA 2OCCB 4XXCC 5BUAA 2CCLA 3T0DA 2ADGA 4W93A 3IGKA 1J05B 1KBGL 5SWZD 4LKXA 3WI9A 4AX3A 4QHKI 3U1QA 1H3XA 4TTDC 3L45A 1DE4A 1SY6H 3D8MA 3WNKA 3OKKA 2E27L 3G6JB 2AVFA 2E9GA 4B50A 2H0FA 3WMQA 3MYJB 1AMYA 2VQ1B 3FB6B 3D2UA 3L3OA 3RIAF 3N9GH 1OL0A 3C08L 1ZGLB 3ATBA 1LNUA 1LE9B 1BM3L 2PTTA 4JBSA 3WFDL 1FFOB 2ICWA 2MCAA 1IVTA 3OR6A 5D8JL 4LSDA 4RQQB 5CAYB 1N7MH 2X4QA 3CH1B 4OF7A 1SM3H 3I9GL 4MWFA 1JPEA 3LIUA 3T3MF 4PYGA 4EXPX 3QWQB 1IGTA 1EXHA 5MHSE 3ETSA 3PUCA 2DLHA 1TZIA 3FO1A 3TA3D 3WJMB 2MCMA 4POZD 3CFCH 5EWIL 3B9KD 2FBJH 1Y0LA 2PO6D 1YUHB 4JFYA 1Q1JH 3L3DA 5ETUB 3GDBA 1O6SA 2HCZX 3T9WA 3ZYJA 1I8IB 1WBZA 2XRAL 1KBVA 2E7HA 4G71B 4LSTH 2X9YA 5E6ID 3VD5A 1IX2A 4Q14A 1Q0XL 4FRWA 4M1CD 2ZZUT 4P07A 1P1VA 3CX2A 4NN6B 2BFGA 5JZ7D 4JKPH 2WO4A 2EE2A 3SJVA 1S9WB 4JFFD 4NQEE 3MOQA 4YDIH 3HI1A 5DTFA 2E9WA 2V33A 1RQ5A 2R2HB 4UTCA 3MUUA 4F9PA 5EFIB 2MQCA 2XWBB 3ULVF 4QGTA 4B3EA 5LBVA 2XZCL 4JQVA 4AVKA 2ITFA 2QPFA 3KDMA 3KWXA 4N6QA 1FI8C 2C1OA 4Z18A 5DVLA 2VLJD 2VWEE 3V4UH 3UTTB 2GIMA 4HIHA 2LQRA 2X40A 3F84A 3K8LA 3POHA 3VG9C 2V0AA 3NCEB 4DGIH 4NQSB 4DOHE 2YA1A 3N85H 3MR9B 1J7VR 1R6VA 2EDHA 4CUCA 4KQ3L 3EYOB 3T8XB 4L9DA 5J12B 2X88A 1HCYA 1JAEA 4ZW5A 1C9SA 5E56A 1PMYA 4P2CG 3KHQA 4DH2A 2Z92B 4ICXA 4WV1C 5D96B 4F8TA 1KC5L 2CBPA 2I07B 1LVEA 4XAWH 4AJWA 1H3PL 1H19A 4JKWA 3DHPA 3OGCB 1F6LL 3UEQA 4AKQA 4YHZL 5EN2B 3HHSA 2C1PB 4OZGF 1W2KT 2DYRB 4XVTH 4GRWE 3FQWA 4U6XA 4P3WA 1S7QA 2DF3A 3FU7A 3SDAB 5KSAA 4N1HB 4PJXE 5D71L 4A7GF 3CTTA 4D3CH 3CVCA 4QJ5B 1BV8A 1XFPA 1NIDA 4MDIA 3C87A 3QNXB 1JK8A 1H8LA 3BVTA 1SLXA 2AGJH 3W82A 3S96B 4N0YL 4HV8B 4B5ZA 3APDA 1QRND 1AAJA 1DQDH 4K3DL 1MFUA 3OTTA 1G9EA 4FAAB 4NQCB 1LEGB 4GSDH 1HL8A 1GGIL 3NIFB 5EHFA 4OKVB 3VFTA 2WQWA 4CSTA 5CIPA 3VI3A 3VI4A 2H6PA 3QXVA 3WHXB 1NFDB 2CRZA 3OHXA 1NEPA 4H40A 3P1VA 3UDWA 4KXBA 4Q74A 1UACH 2IEPA 3TVMB 4FABL 1MRCH 4RZKA 3KM2A 3ASNB 2H2SD 2H26A 1FH5H 1M71A 1IEHA 3TV3H 1HNYA 1IILE 3HA0A 3ZLQC 5HVWA 4NYLB 4D0BA 2BSTB 2GBTA 3KWWA 1OPGL 4OCNC 4OJEH 1ZOXA 1HHHB 2QADB 3TF7C 3KXFE 4JL2A 4MNQB 5GSRA 4AZ8A 2X6VA 4ZS6C 1U3YA 2YPLA 3EHBD 5F0PB 5D1QC 3ZTEA 4AIZB 3W9EB 1JV2A 1S5IH 5CJ5A 4PJEA 5EA0H 2FO4B 2ZOKA 4FI8A 1N2RA 2CHXA 4M9OA 3BPLB 2DTSA 4OM1H 3RWFB 3KCPA 5K59F 4L4TD 4P23D 3U4EA 1XSKA 4ERSH 4N2HA 4JY6A 4Z1PA 5FECB 3CZJA 1TNNA 2N59A 1CYWA 1AGDA 3UAJA 4AMKH 2WXFA 2EZ0D 3QXUA 4IJTA 4CC4A 3OZKA 1HL9A 1NCAL 2ENJA 3GIVA 3PPEA 1NGZA 5CD3A 4Q9RH 2ZF8A 2LAGB 1EPFA 1JPSL 1NPNA 2Y5TA 5DJ2B 5H37H 3U9WA 5C0CD 1U91A 4K5MA 3V4VB 1YJDL 4OZ4A 3ULUH 2APXA 3TNMB 1CR9L 5IFHH 2UY7A 4JR9L 1IBGL 3CZEA 1WAEA 5KYYA 3KYNA 1QFOA 2F5BH 1W0WB 2B39A 3ZGHA 3RWIB 1E42A 4WI0A 3LVEA 4HD9A 3FZUC 4HK0B 4AUYA 4QRTA 4AH2B 1FNAA 4M8QB 2XPZA 4UM9D 3S3PA 5G2NA 4A2EA 3NA9L 5EBMA 5E2VL 5T33L 1MQKH 3ZDYE 2WUCH 1U8NA 3QNYA 4NKDA 3VM5A 5FHBH 3ZJAA 2GSGB 1TMQA 1CZ8L 1F8TL 2XWJB 4L37A 5AYUL 1TENA 2HZHA 1AG6A 5ENWA 1PD6A 2CNYA 5EZJA 5G4OA 3MGOA 4HUVA 4Q9QL 3WTYA 4RDQG 1BZ9B 4UTBL 4OZHE 3QCUL 3C5ZB 3E6HB 5FKAB 4Y4FB 1QRKA 4KRPB 1U8IB 3Q06A 2GG1A 3SE4A 4L3EB 3OB8A 4J3UA 3HBPA 2YAQA 1CDJA 1M42A 5AB0A 1RUQH 1ZD6A 1KIPB 3B2VL 2DIEA 1QUPA 5D1ZB 1FL6A 1TYEB 3U0PB 3U0TA 5FK9B 2NXYB 5EV7A 1TXKA 2ZOWA 3PHQA 2XTLA 3MV7A 2R56H 4ZO6A 4K94L 4WI5A 3GBLA 2B9BA 4RDBA 2ADYA 3GXFA 2WNGA 1WO2A 2GK0A 4HVBA 1OPOA 3QRBA 5EZPA 3A47A 3HNTH 3QDMB 4C4KO 4JG5A 2VWEC 2B9AA 2DBLL 2H0JA 1E40A 1NWPA 1UZ8A 2G5UA 3U36B 3J8F7 1I1YB 3REWA 5IMLB 1OM3H 2PCPB 1FZMA 4JLRB 3NSYA 2WXMA 2DIBA 1XF2B 3T6ZA 5ELIA 3ARYA 3O8XD 2B59B 1J87A 2D7QA 2NDFA 1ZHLA 4PCTA 1JHKL 3WDHA 3BLBA 4ZFFA 1LLAA 4AGLA 2O72A 5IB1A 4RAVA 3MROB 3UP6A 5E5LA 5EOTB 4YHOL 4HEMA 1R3JB 4HXBH 1YNTF 2ZPKH 4FQ2H 2YD8A 1P6WA 1HS6A 1ZHBB 4CU6A 1KBWA 3APMA 4LT7A 3QG7L 2RR3A 4GKSB 4W81A 2VLKD 4G8EB 1O7DC 4HHWA 3D12B 3F01A 3BP5B 4KO6A 1YY8A 4LVEA 4WNQB 4NO0D 4Y5YB 5FYJE 5T1KA 1A6TB 2CGRL 4ODXA 3TBVB 2PLTA 3IVKA 3PWNB 1AFVL 1OT4A 1X7TA 4LLYA 4QTIL 4J27A 1XH1A 2Q2EB 2ZX8A 3JWNH 2BSSA 4X83A 2NRDA 1MY5A 2OV0A 5DZOA 3U0WH 4C56E 4XRCA 2R1WB 5SWQB 2VAJA 5K9JH 2NPLX 5LQBL 3DX6A 4KZ0A 2FGWH 1MFBL 3MLWH 4WO4A 4FNSA 1ACXA 3GGWA 4GQPH 2O5YL 4ZQKB 5KJ7E 5HD8C 3BKML 1A8JH 1HN1A 2PP7A 3R18A 4PGCA 4PJ7A 3Q6GH 4UT9L 5T5FH 2XXMB 5A6MA 3NCYS 1XR9B 5TFSL 4BH8B 4Q0XL 3T1FA 3HE7B 1XCXA 1YMMB 4GPVA 5LGHH 4X6DB 1AD9A 5G55A 5GJSH 1E2ZA 2CO2A 3FF7A 1YEGH 3RZCD 1BQLL 5PCYA 2EE6A 1O7VA 1YN6B 1EBPA 3CPUA 5TE7H 1NEZB 4DWHA 2BSBA 1L9QA 4HOXA 1JNJA 4U1JA 4LMQI 4AEIH 3BRGC 2D7NA 1AHWB 1FNSL 1LGVA 3N44B 2PW1A 4KJWD 5EOCL 4I18C 1R3IH 4WHYG 4AQ1B 2NY4B 3VFSA 2WAHA 4P2OB 1R75A 4JG0H 4N1CA 2A74B 1OTSD 1XF4B 3US9A 1R33A 3IM1A 1ZT1A 4TSCL 5HBBA 4X7SH 2J88L 4QXGH 3M1BB 3HC4L 1Q94B 5EIIA 1MJUL 1UKQA 2ZOLB 3VFVA 5CR1A 2JSFA 2J6EL 2FJFB 4L3FA 4Y19A 5DA4A 5AKSA 5LGJB 1B4RA 3BDYL 3LKSB 4BSWA 5I1EL 4TPRH 1T7ZA 1KPVA 4A2GA 3RGVB 4YX2H 4XPBH 3KLSA 2V3EA 4KI5D 3S4SA 3V6ZB 4B7IA 1B0RA 1S9VA 2ESVE 3CFUA 2F54E 3SY0A 5L6YH 4ZOEA 5J1AB 1AS8A 4HW6A 4KXDA 4JFDB 1NDGB 1GGBH 5E70A 4R4NC 4OM0H 1KTLA 5HI4D 1Y7VA 2Z4QA 3ZU8A 4F2ME 1BEXA 3NIGF 4HQQL 5L2JB 4FQXB 2XWEA 3AB0C 2BP0A 3RWCB 1MH5B 5KYNA 2YRBA 3PE9A 4HKBA 4BKLA 3OAYK 1KIQA 4I0PA 3D09A 2LTQB 3SBRA 2LFEA 2K8QA 1J8HB 2OULB 4QMEA 3U9PH 2IFFH 3POCA 5C0BA 1MCCA 3PWPB 3HAEH 4AMWA 3KPLB 5EUKB 4G3YL 2DQUH 2YD1A 3UTPE 1UEYA 1QTSA 2X12A 4P5TB 2YRZA 2VW4A 3DHUA 3SDXA 5KG9A 1XL6A 1E4JA 4Y7MA 1OAZH 3ESMA 2X3CA 5C09B 3C09B 1X5MA 3C6SA 1NOAA 4HOZA 1EJ8A 4LRNL 2DTML 1ASPA 3O4LE 4PRBB 1PYWB 4HWUA 4XWOD 4A55A 5HDBF 2C9PA 3H8NA 3VSQA 4JFHE 1RUAH 1T7XA 3O2VL 1CI5A 2IAMC 4F33B 2AEOA 2B14A 3TBWB 4ZMPA 1JN6A 1RKRA 3LZNA 5FM4A 1EJ6A 3DROA 2AQTA 4LOFA 3QQDA 5LKNA 1DBBH 1Q9WB 4ZO9A 4X7TA 4BSVB 1RSFA 5DVMA 4LPCA 4HF5L 3RPIA 4G9FB 4KI5F 5FOBB 3ZL4H 3RVVD 3SDAD 5GGSA 4JO8A 5FWQA 4OJFL 3RLSA 1DO6A 1OP3K 4D9QD 1C16A 2AV7B 3B7TA 3TN0A 5INDA 1S6NA 4RMBA 4OLEA 1NGYA 2DY2A 3Q6FB 4QRAA 4XMWA 5GZNC 1CFSA 4BK8A 5BQ7A 2W9EL 4BUQA 4PLJC 1HK6A 3SGKA 3CVBA 5E9AA 3QJFA 1KTDA 1XT5A 2AK4E 3KLKA 5EH1A 3AS0A 2Q87A 3MLUH 4Z7QF 1F6AA 2X38A 2ZAHA 4Z95L 5CEYB 2A1WH 4DUWA 3ROLB 4EN3B 2LU3A 3EGSB 3QUKA 3B5HA 4OLWH 3TVMD 4NNYB 1GY1A 5DVNA 5DEGB 1F11B 4U6HA 3D05A 4DQOH 2YC1A 3ZDXB 2W60A 3NSJA 1VKXB 3B2DC 1NCBL 3N41F 5E8DH 3NGBC 2EKJA 2X10A 3H42H 4MJIA 2HMIC 4ELMA 3ZE0E 2F53D 4GBXB 1EJOL 3D18A 3SD5A 4B9PA 4OCLC 3EH3B 1Z3RA 2F7QA 2JJTA 4PRAA 3L9BA 3LSOA 1MIMH 1Q0EA 1QWHA 3H3KA 3IJHA 3MU3A 4GUCA 2DDQH 3DDFA 2NY1D 1GS7A 4FJZA 4PS3A 2VOTA 3D34A 2OSLB 4FXKC 1T2XA 5KYWB 2XJLA 3IXTB 3QRGL 5FO8B 1K72A 5TH2A 3SDYL 2WBXA 2XA8L 1HH9A 1NAKL 2FSEB 2Z31A 2FX7L 3ISWA 4YE4L 4KZDL 3TYFB 5DEFB 4PTTA 4OFYA 4IJ3B 1U8QB 2W65A 4X7DC 3GZKA 2EACA 2OSYA 4R5XA 4DSYA 4PB9H 3NSFA 4E9LA 2XWTB 2D73A 4EE2A 5F7HA 1MHEB 5K69A 1IAIL 5B39G 4EN2A 4V1DA 1E65A 2CJUH 5DD1H 2YKLL 3CAFA 1ADQH 1OW0A 2C4FT 3GSUA 3RB7A 1N0XH 4K9EH 4JM4H 1KF9B 2D0FA 5TK2A 3FCUB 4DW2L 4KUCD 3OXSA 1UG9A 2A83B 4UTBA 1E9OB 3AXLA 4HALA 4LZKA 2EYRB 1WZ1H 2P5EB 4LCUA 2HG5A 3CC1A 3IEAA 4QNPF 3RHWK 1QFPA 4DPCX 2VXTH 2A4ZA 4MD5B 2CJ3A 3RVXC 2BSEA 2HPOA 5B38A 3QFJD 2CO4A 2BNRE 1FFQA 2WVVB 3EJCA 1UUSA 3ZTNL 1WS8A 1EUUA 2Z7WA 4FQIL 3DPBB 4Y4HB 4ZOAA 2AXJA 1QQDB 4PS7A 1GKOA 1EFQA 1BECA 3U6XS 4Y4FD 5B8CC 3QO0B 4M6MH 3CFBB 4N25A 5C08B 3EUUA 2HVBA 3FB7A 1I85C 4W6XB 4X5RA 5BJTA 4IBWA 4R7NB 3FOLB 4W9GC 1XF3B 1CT8A 2D4FA 3K4DA 3H9YA 3VH8A 4DNLA 3K81A 1BQRA 4F37K 1YEIH 2GUYA 2DQHH 1T89C 1A7RL 2WLLB 1AQDB 1EXGA 1YQ2A 2RTTA 3N40F 5GGQL 1T04A 4JY4A 1HXMA 1WTLA 3A23A 3NRQA 4KJQC 4LIQL 1CICD 5H8DA 3F5WB 3SE3C 4DPRA 5DWUH 4KY2A 3VD7A 1EHLL 2CKBL 4N9GB 4K8RD 1YPZA 1JGLH 4RBPK 3TBYB 4ZRGA 2XU9A 3A4EA 2WXKA 1BAFL 3QDMD 4BK5C 1MFAH 2X6MA 3GBML 4CVWA 5J4MA 2X3BA 3FTGB 3CQFA 4ADJA 1TEYA 4KRNA 1F18A 2DN7A 2C7UA 5J7CC 1K2DA 1CDBA 3FUHA 2LLNA 5D7IF 1UD4A 1Q9KA 3WKPA 4MXQC 4PB0H 2L4OA 3UG5A 4BYHA 1ZJAA 3WFCL 2FH8A 5J11C 2VMJA 1CDYA 3LKPB 1KXQE 3Q8FA 3IF1A 1JHLL 2A9ML 1BVKB 4Y5XC 2AXGA 1RAMA 1S7UA 3V0VA 5AZEL 12E8L 2NCMA 3NIDE 5I75C 1SYVA 5C0RH 3Q2LA 4DEUA 4GI9A 3OAZH 1XGTB 4LCCB 1C08B 1LO4H 2VDKB 1JI1A 1DVYA 1JFQL 1Z5HA 1F41A 1HESA 2K0RA 3B7SA 1X5XA 3EFFB 1URZA 2JXMA 3NRPA 3V0WL 2K7QA 4NJ9L 3U46B 5DJAA 5EC2B 3T3PE 1HI6A 3SB3A 1AGEA 1KGUA 3WFBH 5T1MB 1DSWA 5JOPD 2H32B 1CLZH 4M56A 4E41E 2CMRL 1B0GA 4E9WA 1QW9A 2YEZA 3AC0A 3CN2A 1IFHH 1MHPH 3KLAA 1ZWIA 2P5WA 5EEZA 2FJUB 5C0DB 2X4OA 3QIBC 4PJ9A 1MJJB 1BGXH 1FYHB 3QWRA 3CVHH 3P54A 5DZJA 4ZAKB 1AGFA 2X5PA 3NZ8B 1EUTA 5GS1A 2AQSA 3DURB 4LLQA 3VXSE 5BV7L 5I0WA 4UT9A 3D0VB 4PS4H 3WV0A 3SQOL 2QHRH 1QSEA 3VI3E 1J0YA 4H8WC 4PJIB 4R26L 3D7PA 4LEEA 4NAJA 1QEWB 3DX8B 1F1AA 3FCTB 4YZFF 5KS9A 5MENE 4YE0A 1B0WA 3F58H 3IJ8A 4A2MA 1F56A 1N0LA 3DSNA 4OIBA 1NCOA 2VXVL 1PIGA 1H5BC 4W68A 1N64L 3GMRB 3OZ9L 4QT5A 1KPUB 1R5VB 3HE7D 5DT1H 1YMMD 2DQTL 2YD3A 4JZNB 3WEXA 3G5VB 4JDEA 5DD0H 3ZKXB 3A4FA 2C3VA 1WV7T 2VXSL 3WNNA 1F00I 1VGKB 5DYOB 1MLBA 4Z78B 2DKUA 3D85B 1UJ3C 1ZXQA 1WSST 2XWZA 5BRZD 3SPVA 5ILTL 1KGCD 1OWWA 1SUJA 3MVSA 4R9HA 2VUYA 2D31A 2JCCB 3L5WA 4NM4H 1N9PA 5EG6C 3HAEB 3TYGL 4G80B 4B97A 4G8GA 2DS4A 4WU5B 5J13B 1UADC 3F7YA 4GXUN 2MFNA 25C8H 1D7CA 1UB6A 4YHKL 3IJ7A 2WUBL 3QG6A 1A6VH 3BGFC 4TNEA 4PSRA 5IOKA 5EU5A 2Y0SA 1HWWA 5HDOA 3UL4A 4HPYH 4ZW7A 4F7MA 2DQCH 3TT3H 4IDJL 3VXUE 1RMFL 2P44B 4OGQC 5IVNA 3TIEB 5I1LA 3ZR5A 4S0TD 1KCSL 1L5GA 2FWOA 2XTJD 3S3CB 4RGMC 1SUHA 1A9VA 2WN2A 1H6FA 5DJCA 1XMWA 3O45B 2I26N 4RAUA 3IDXL 4CNIA 1G7QB 3AROA 2JJUA 5F6IC 3PGCA 3VYOA 4P2RD 2K6WA 2VMEA 2FIKB 4OCSL 2IC2A 3R0NA 1JDCA 4GH7B 3RJOA 4D9LH 4R83A 3KLQA 3D39D 3F00A 6CGTA 5ITFA 5A16A 3EG9B 2PP8A 3C5SB 5KVMC 1K6QH 4XVSH 4BQCA 2AXFA 3RWGA 4GRLB 1A3RL 4D0DA 4NBYB 4TVSa 4MD0A 4KK5C 5FIEA 5SX5H 3N42F 1OHQA 4NQVA 1RZFH 5IQOA 4X9YA 3OM3B 5D2LB 3T0VA 4DKTA 1GMIA 4FQXD 5F6HI 4CKQA 3IT8D 2R9HC 4I88A 3MRCB 5CP3H 5AW7B 4PHXA 2R7EB 2NYYC 3I6LD 3JV4B 3O3AA 4K7FB 5LG1A 2BCMA 5AOIA 5AKTA 3X3FH 4OZIB 5I8KH 2XG4A 1CD9B 3L3GA 1CN4A 4LARH 3H7BA 4J2QA 2J8HA 5AOJA 4PJFB 4LSSH 1FO0L 5GGTL 2Q6WA 4QHLB 2QR0A 3EH2A 5JNYA 1XGQB 4YWGL 5JA9A 3FRUB 4F9PC 4BQ8A 3SCMA 4GKOA 2WLMA 1FAIH 2YD4A 5FX3A 3QWOB 4ANKA 3E8UL 3L3JA 4I3RL 3SO3B 1JE6A 4GINA 1MDTA 3LKOB 5IEKA 2DLIA 5DS2A 2A6IA 2Y1YA 3ML8A 5F7DA 4PN6A 2JLPA 3G5YA 4A6YB 5CEXA 4JN1H 5E51A 2F7OA 4PG9A 1YEEL 4IRSB 1T4WA 1GY2A 4IRZL 1LD9A 3HKZA 3GMLA 4HFUL 2ZXEB 5JHLL 2OMUA 5K59E 1D5RA 1FNGB 5BVPH 1XF5B 4G6KH 1R1CA 3WSQH 2R8SH 5CO1A 1V5JA 5IB5B 3GSOA 3QJZA 5AVQB 4JAMB 2FE0A 3GSQA 3I9PA 2CSPA 3L4ZA 2N3JA 2PTVA 2MKWA 4L2LA 4BELD 4RDQF 4EEEA 5DA0B 3L9YA 2ZP8A 3IDJB 1YYLH 2JKJA 2HRPH 2AFNA 1WAAA 2HJLB 3ULUD 4DP6X 3HI6L 1MN4A 4HSQA 5ERWB 3ZIMA 3FO2A 3WIHH 4M4RA 1H8OA 4Z7UB 5BZWA 1ONQB 1X4ZA 4PJCB 4ZUTB 4EN3D 3KVQA 2R59A 3PNWA 3UIYA 1L9OA 2DQIL 4OGZA 1TYRA 1T0PB 4WEBL 5KYUA 5L8KB 1WQVT 6TAAA 5LCVL 2B77A 4HAFA 4IHOB 4M4PA 3S34H 1KJ2H 3QA3B 4JFPA 1JBJA 2YOCA 4GG6E 2NXZB 2XKSA 3CC5B 3T6XA 1P5UC 1NC2B 2HFFA 5GGRB 4CSPA 1QPKA 4QLRA 4X4YB 1QSFA 4QRQA 1P9MA 4TUJB 1PY0A 3DUSA 4JUTA 5ALCH 1GSKA 4UI2A 1UB5B 4GKZA 2GQHA 3P2DA 4HJJH 3WDJA 4YN3A 3ZBMA 1KPRB 2E6JA 4M62L 4BZ1L 1RURH 2ID5A 5I6XB 3U2SB 4J3XA 2GJ6D 3L4VA 5FGBA 5DSCA 4OGYL 1BBDL 1A6UH 2H1XA 1D6EA 5EF2A 1BJ1H 2WNWA 3ZHFA 4XBGA 3PFUA 2CCVA 1VSCA 5C0EB 4MMXB 1G5GA 3PWJA 4FLQA 2DYPA 4JM2A 4XO8A 5IP4A 2Z7UA 1M6UA 4QRRA 4Q6KA 4LAQL 3VXMB 3CZFB 4LCIH 1ZHKA 3N1GC 1IAKB 3QDGA 5SWSA 3L5XL 1UD8A 4PGDB 4DEPC 4JUSA 2M2DA 2V37A 1KGXA 3MRRA 3QUHA 3BLKA 1D5BA 1NC4A 4J3OC 2X42A 5LN4A 4OBSA 4JJ5A 3SDCA 3UAJC 3ARFB 3T71A 4BDVA 4Y2DB 3LMJH 3BWUC 3HVNA 4WSKA 1AP2A 4KHXH 3M7FB 5JIDA 1OE2A 3QUXC 2O5XH 4CC4C 2E5EA 5TPWL 3B2PA 5J06A 3MX0A 4UYQA 3DHMA 3SDDB 4U49A 1D5XA 5TE6H 2YN3A 3FSWA 3ULUF 3AITA 2EYSB 3LQMA 4E42A 4Q2ZB 3ZHNA 3GM8A 4Y1AA 2KHAA 3PDOA 4FYRA 4PJ5A 2P5ED 4DP0X 1BD2D 4MCYB 3KPQA 1PCSA 3BRDA 5IF0A 1OIOA 1UWGL 4RCAA 1NBYB 4LRIA 1AR1D 3UAFA 3HG1B 2Y7QB 3Q43A 2R0ZH 4ZD3H 1GAFH 4YDJB 5IK3A 2NY2C 1NANI 3ZY7A 3QORA 4WHDA 4KNTA 2YD9A 4Z7VF 5ECJE 4WNJA 5IBTL 3OQRA 7TAAA 1J86A 1L7TL 4FLHA 3G04A 2QTVA 2IF7A 3BYYA 5C08D 1KG0A 5CILL 3GHBH 4ODVH 4JDTH 1BBJB 3IDYC 5E7FA 5EU6D 3PP3K 4ZW3A 4LFHD 2FEJA 5FOJA 2KI6A 3CFEB 5KBDA 4BQ9A 2XG5B 4IK6A 4JRYE 2PPEA 1XXDC 4O4YH 2ZTBA 2A4CA 2FZ3A 2ICWJ 3MUGA 4F7TB 3FB5A 3ALPA 5EBGA 4C57C 1DVQA 5FA3A 1G7HA 1Q72L 3SE4C 3SPIA 1NOFA 1J10A 1DBKL 3EO1B 2YUZA 2LVCA 1DVTA 1U8HB 4PI0A 2NMSA 3WN6A 4JFEA 4JE0A 4M3KB 3U83A 1KCBA 3THML 3FQTB 1HQRB 1K4DA 4G6JL 3NH7L 3V5KA 5I71C 5BXFA 1ZGLM 4DVRH 1FBIH 1JMZA 1OGPA 1TTFA 1E4XH 2AXHA 3KZ8A 1JHTA 4XP4H 3W0WE 3SDXE 5D6CA 1TQSA 2NY6B 3X1FA 3WEMA 3SN6N 1E4WL 4ZTOL 1BQ5A 2X1OA 4NC1E 4YHML 1BF5A 4KNQA 2RFXB 2BC4A 4EF3A 2B1HL 2YAHA 4R8WH 1JK9B 1UH2A 2NY7L 1YMHA 3A6BH 4JO2L 1WA0X 1G4RA 2J71A 2OXHB 1NGQL 1UA6L 4QEGA 5HHQA 5E5RB 2YZ8A 3W56A 2IOOA 5HGDA 1L6PA 1OQOA 1QO3A 4GAYB 5D5MF 3V6FB 3UZVA 5FO7B 3DJRA 5ADPL 5BO0D 5DMIH 1SF5A 4WCYH 3SKNA 3ROOB 5CBEB 4FI7A 1ZEAL 4X4XB 1HL5A 1CXFA 1UA7A 4HULB 5KBMA 5LNGA 4N6RA 2X89D 1TJIL 2CDGB 1A3LL 4IKIA 1Q4NX 4A38A 2EKSB 1NAMH 4TLUA 7PCYA 3DYOA 5I76A 1JUFB 5IM7B 2WINA 4TQEL 4MQTB 4ZAKD 2FX9L 3BPNB 3IKCA 1NCDL 3DKHA 5JQ6H 4C58B 2EDDA 4FNLL 4KY1L 4G8IB 4X8JA 2CBQA 2VQTA 4NSKA 2E9BA 1WEJL 4EIBA 1DBML 3CX5J 4X6CA 5DK3A 2EEBA 1RZKH 4UYPA 4WUKH 3T0BA 3I3EA 1IGYA 2DLFL 2W8CA 5DRZB 3B56A 3Q3GA 1A1MA 2E8YA 3VWKC 3VFPA 1MCRA 1AE6H 4ZSOA 1GJUA 1H6TA 5HHOA 3B7YA 5IOPA 1OAJA 1MIEH 4Y16B 4FC3E 3AU1A 4MASA 3F12A 2WMPB 4OLUH 3GI8L 2FRGP 3ZHLA 3KLHC 3RL2A 3D3VA 5DXWA 4TTGA 5FUZH 1DSYA 2Q3ZA 5T8IA 1JGDA 4ONGH 4M7ZB 4WO4C 3HPJB 1IEBB 1JXKA 2P48B 4ZMNA 2DJSA 5I6MA 4ELME 4ZNEA 2WPGA 3VFMB 5ABAA 1EHXA 4MZ2A 5CZVL 1Y18B 4U3SB 1HXYB 4MMZC 4MYPA 3HG4A 2SEBA 3SGJA 2JIXA 4QRFA 1OLLA 3DVIA 4G6ML 2GB2A 3WNIA 3L95B 1F4AA 3LD8B 4LEXH 4TUKL 3VRIB 3F2LA 3UG4A 1FJ1A 3GS4A 4OCXL 3B8YA 3FQXB 2XWXA 1KLUA 4M61A 5T1DH 2HFGH 1T83A 4AY0A 1B2WL 1DO5A 2NX5B 2J56A 2GTZB 2VDRL 4LEOA 3TU6A 3JWDL 3IMBA 2VDOL 4WI3A 3Q05A 1WIUA 3DUUB 4JPQA 1S3KH 5GRUL 3CXDH 1RIUH 5F8QC 1HIML 3WL9B 2EH7L 2BW5A 4G7VH 5EEVA 3FMGH 1T4KB 3DHJA 3LXCA 1F3JA 2QJDA 1T1WB 3UBHA 43CAB 3QE5A 5CU9A 3K8MA 3NCXA 2F8XC 3O0LA 4KKAC 1CF8L 4OZFA 5FPIA 1R3LB 2OMYB 3L2MA 3P3SA 4BZ2L 4C54A 1ZT4B 1XBRA 5AALA 3MLYH 3NAAH 1FYTA 4TVPH 1MCWM 2DQDL 4W9IC 4URTB 3P02A 4DFIA 3O2WL 3VCLA 5HYJA 5DRNB 3L1FA 5KEZA 2J21A 3NSCA 1U3ZA 3GD1C 3Q01A 5ACZB 3RY5A 4JN2A 1FO0A 4ZPVA 5GGTA 3CVIH 3MXWH 1JVOA 2MMXA 3ARZA 2E9IA 4QHPA 5C8JB 1O6TA 2VDML 3WIIL 2BERA 1A4JA 3D30A 4ODHH 4B9FA 3MGTA 4YAQA 5ADOL 3EJYD 2WCSA 4HKJB 1MAML 4WQOA 1SN2A 1T1YB 4I4WA 2Q8AH 4QHNB 4L1HA 4NPYB 5E1AA 3V95A 2HJKB 4AV4A 3CHRA 3PRZA 4N2KA 4UAOC 3L7FA 1A6AB 4NX0A 2I32A 4J3BA 3V4PA 1VACA 5E8PA 3G5ZA 1QBMH 3D4ZA 1BQSA 1PD1A 4FQPA 4APQB 2QQLL 3LPFA 1GS8A 1INDH 3DSFL 4JANA 4IRZA 3ZTJH 5JHLA 5KSBE 4E0RA 3BVNA 4DP2X 3BI9X 3P9MB 1PKQA 4K9JA 5CJOL 2NUPA 3DGGA 3IB4A 1J0KA 3IMSA 3CDFA 2NY3C 1M7DA 1JXDA 3L7EB 2ZXQA 3ABMB 4IRSD 4NC1C 4K7PX 4XCYA 3NEOA 2VAAA 5HGBA 1ZLDA 4UZUA 4ZMAT 2J57A 1WBXB 4PRIA 4AG4L 1Z5LB 3R06B 5D7KE 3QK0A 3SKMB 1LO0H 4O2FB 1LP9F 1OXYA 3FT4A 2AQ2A 4HETA 5I8CB 1YEHH 4I13B 2NSMA 3SE6A 2VERN 3KG5A 1KACB 4YBQC 4XMUA 5EZOL 1AO7A 1KELH 3BD5A 3L2NA 2A73A 4I9WD 4UT6H 5LCVA 3RVWD 1M9SA 3RTQB 2AEPL 5DC2A 5ANMA 4YEEA 3AS1A 4PAZA 1UJ3B 3LZPA 1YYMH 3WKML 4TNWK 1HILA 4I5BB 3ZE1F 4Q9CA 4HJ0D 4L0ZA 3VU2A 4AXWB 2BVTA 2J8UB 4EZJA 4Z77A 3DX3A 3RUGB 5C0IA 4NCC1 3HZMB 4YXKL 5CLWA 5AW4B 5I15L 3LNHA 4YDVA 5DRWA 3TNNA 4BZ1A 2ADGB 2E4TA 1IM9D 5DGRA 3BGFB 3HI5H 1RFDH 2B1AH 2ORBH 4LKXB 4XOAA 2M83A 2MNJB 1N4XH 1M3JA 2JNZA 1EHAA 3VWJA 2DH3A 1JTPA 4ZW6A 5DHVA 2DPKA 4N9OB 1SDDA 1MFEH 2X6UA 2HVKA 3L3OB 4L1BA 2W94A 3D2UB 3MLVL 3V5DA 2DQJH 1MEXH 1LNUB 1QAWA 1ZDQA 3BWAA 2PTTB 3K2IA 5GISH 1A1NB 1JZHA 3WJLA 1V7MH 3RA7H 1ZLSH 1JZJA 2X4QB 3OAUL 4K2UH 3MRQB 5B7EA 3BKCH 3Q13A 3OAYH 3NG5A 4MWFB 1M1SA 1ECYA 1FL3A 1D6VH 3G6AA 2HTKD 1IGTB 2JJTC 2Q20A 1MF2H 2C3GA 1PDKB 1TZIB 3FO1B 4PRDB 2H2PD 1N8OE 5IVXF 4A2HA 4A7TA 1A2YA 3MODH 3CFTA 2B4CH 2ZNWA 3O3DA 4XTRC 5HI3D 1YJDC 4YSAA 4JFYB 5I6NA 4Z7OF 1DJGA 1E2WA 4L0PB 3L3DB 1O6SB 1ORSB 2O6PA 3MDJA 4ELDA 2N7SA 1EZVX 1GZHA 1WBZB 2VDQL 2IDFA 1NMBL 5AW2B 2VN5A 5K9KB 5A3IC 3MO1A 2C9XA 3AU0A 1E28A 5AW6B 2AP2A 4KI1A 3WLBB 3GT6A 3RG1C 2TSAA 2YK1H 4NHCH 1CG9A 3HI1B 5DTFB 4A66A 3RWEA 1OW0C 4YDZA 3PDDA 8PAZA 5HI5D 3BISA 5KUMA 3F7PC 2BS71 5E23A 4C83A 4DN4L 5IQNA 2PPDA 3DDGA 4YVNA 3UJIL 4HXAL 1FPTL 5GIRA 4HIHB 1D9KB 4K5OA 4FF9A 5H94A 1JSYA 5IROD 3TZVC 3MTRA 2BS8A 4C8XA 3MJ7A 3S0PA 2X0VA 3TF4A 1EDYA 1WWCA 2FVNA 3QEQE 4K5LA 1G7LB 3BPOC 3O0RH 3U4BH 1ILSA 5A7BA 1IC7H 5FKPA 4TL5A 1XH2A 2O5ZL 1X5AA 4B0MM 4HJTA 2Q0ZX 3GBDA 3T8MA 1MCQA 2IPUK 1BFVH 3GBEA 1T2QL 3HRPA 1NEZG 4ALAH 2A9NH 4FG2A 1VA9A 4IOSD 5SWZA 4K94C 4OQTA 2XIBA 1I9JL 2BP5M 4YDKL 4LDEB 3EOTH 2YD6A 3UJTH 1TETH 4M3JA 4MD4A 4DZBA 5JLZA 2YMXL 1EERB 3L16A 4L3CA 3E2HC 3HHSB 3CXHJ 3O2DH 2EIJB 3FQWB 4U6XB 1S7QB 2NNAA 2QSCL 3FU7B 5KSAB 2P8MA 4M5ZH 1WE5A 1JK8B 4DO6A 1IBYA 4TUUA 1PSKH 2BSDA 3LDBC 4UV7L 4AYFA 5LNEA 1F2XK 3UTSE 1YHPA 1ZVSA 3LKRA 1FZOB 3CLFH 3CX5K 5IFAL 3BEWA 1DJWA 2G75A 2IANE 2J5LB 2NY6D 2VQ4A 3LNFA 4OZGA 3HFFA 3HUJA 4HK3N 2WWMC 1FORH 3TA3A 4A7GA 2XWRA 1QLEL 3PP4L 4RMTA 5CIPB 3VI4B 1X9LA 4FFYA 3B9KA 2H6PB 3GQFA 4WHTA 2PO6A 3RIAK 3OHXB 4AEHH 5DRXA 4QR7A 3EYQC 2XKNA 4LCWE 4XP9L 4L3AA 3VGAC 4YS4A 4ZI8A 2QVIA 2ZSWB 4K15A 4X2UA 2C3HA 5E6IA 2H26B 3KS0J 1M71B 3BKYL 3P0YH 2Q8BH 2YPVA 4D0BB 5HTSA 3KWWB 3ORJA 1HNGA 4NI3A 5GSRB 2C3XA 4AZ8B 2L7JA 5HPMA 1CTNA 1PQZA 3NSDA 4JFFA 2YPLB 4GY4A 3H6AA 3Q5TA 3A5VA 1GSMA 3ESNA 1JV2B 3NCFB 5DS1A 4PJEB 1DFBH 2KLRA 2ZOKB 3RX7A 1N2RB 1INEH 4KOBA 2FYYA 5E4IA 1AS7A 3U4EB 4Z7NE 2VLJA 3CG8A 3LZLA 4JY6B 2F1BA 1VZIA 4ONOA 4WJKB 3OB0K 1AGDB 2F9BT 3ILDA 5DJ0A 1CFQA 5IHBA 2H1LM 2UYLA 4LGPB 5I5JA 3X17A 2BINA 3PGFH 1E3FA 3GIVB 5GS1C 5CD3B 1NGZB 1U36A 3KPNA 1KYOK 5AENA 2Y5TB 4H0IA 4LPXA 5I82A 2XYBA 4MAUH 4GAGH 3MPCA 2HT4C 1UM6H 3N0PB 4OZ4B 3FUMA 4KTDH 1AZUA 1DEDA 4FFZL 3FFDA 3O41A 4HPOL 4JG1H 2EDEA 5KYYB 3KYNB 4NUQA 1KWGA 4FFVD 4QRUA 3V0AC 4N8CL 5MEPB 4WTZG 3OKMA 4WI0B 4WIQA 3HHRB 4QRTB 5I1JL 2AJ3A 2NY2B 1FRGL 4HS6A 5JW3L 1JZ5A 2P80D 1YN7A 1SZNA 5EBMB 3BWSA 4AYGA 5IHLB 1DN0B 2F6AA 1QRNA 5DJZA 4JRXB 1U8NB 1ZPLA 3QNYB 4NKDB 4RBPH 5CCKH 4PJBF 4GOSA 1CFNB 5I1GL 2Y5QA 5ENWB 5EZJB 3MGOB 2OKMA 1QFWL 2VC2H 4QRRE 3C6LD 3IMVA 3JV0A 4XMKL 3CK0L 2XV2A 5KVEL 3HS0A 3RI5F 1QPXA 3ERXA 3EXJA 4Q89A 4JDVA 5EO9A 4RFOH 4NIYE 4WUUD 4YPJA 1MSPA 2AI0L 1SHSA 4PBXA 3ZQXA 2RQ8A 3GHEL 4P04A 4UILL 4TNVK 5FGCE 2V7NA 2JJSA 4JZOB 1DJZA 1UKSA 3Q1SH 3PHQB 4WWKD 3MV7B 3NABL 4PRPD 4ZXBC 3HHMA 5A2CA 5DK2A 3DRTA 4J6RL 4RSYA 5IWLA 3P0VL 1G9ML 2GK0B 1PZUB 3BEVA 4PJ5E 3QQNA 5CNHA 3FL7A 4UAHA 1OOAA 4QRSB 1J5OL 4PGZA 4M8RA 3UH8A 5FYKH 4MDJA 4Z3JA 5KYXA 3WMPA 1BX2A 3TJEH 1UZ8B 3DOSB 4HMDA 4JMNA 1SOQA 1MCJA 1U93A 3D06A 4HK3J 4L4TA 3REWB 4P23A 3EOBB 5DD5L 1FZMB 3MLSH 1ZIAA 4GFXA 2J1ZA 5EBLA 2C9UA 3DXAB 4JW3A 2ZOUA 1RZJH 2OI9B 1ZHLB 3WXVH 3BFQG 3COOA 4ZFFB 4K3JL 4ZTPL 2OYLA 3LZFL 5IB1B 4RAVB 4GI6A 4KO9A 4M7JL 4MAYD 5C0CA 1Z3GH 5L2KE 2AHIA 1B6UA 2ZKHL 1H0DB 3NJIA 1DJYA 3S97C 3U7AA 3T65A 2GYSA 1CBJA 2R2EA 3FUIA 4N28A 4GAJL 1OVZA 4APQD 4BXVA 3CLEH 4WW2C 4HUCA 1USZA 2W38A 5DVPA 1SRDA 1OAUH 4JK0D 2OYKA 1YY8B 2DD8H 1UZGA 4RWYL 5JW4Q 5T1KB 2EXWC 2ZYSA 4UM9A 5HHPB 5E0QA 3RIFF 4AYID 4HIXH 4ODXB 2F5AL 3GXUB 4J6IA 4AVJA 4J5VA 5TDOA 3OKYA 1YNTA 2Y23A 1N26A 3NJKA 5D55A 3QYNA 3IVKB 4QHUA 1UC6A 2H7WA 1X5HA 4MA8L 4A7QA 4O2CA 4W9CC 1LTXA 2BSSB 5E9DD 1E2VA 4ZJ9A 4EI6A 4WFGE 1FAKT 3MCYA 4YFDB 3BE1H 4NNPH 1I8AA 3G5XA 1WITA 1MZYA 1UOLA 3DX6B 1BVNT 5CCGE 1DJIA 4LFHG 1ZTXL 4M6NL 2Y25A 3GGWB 2QQNL 4A1RA 2PW2A 4NPKA 3BO8A 2UWEF 2F8IA 3I84A 1L9NA 4PJ7B 1N5AA 4FQQA 4PGCB 3RTQD 1PCXA 3VQ2C 5GGVH 2JELH 3T1FB 3BQVA 1QNZH 1DSFL 1WBYA 2P28B 1K8IB 3ETBJ 2C3WA 1JD9A 4N0FA 4D8OA 1AD9B 3JWNG 4JO4L 1U92A 5MEQA 1II4E 3EJJX 5K9QG 2MCPH 3ZR6A 4XC1L 3C2SA 2B5IB 1HXKA 4JB9L 4K7PL 2OS7A 3BGMB 1DN2A 4I48B 1CXEA 1NZRA 4U1JB 1ZT7A 1XGUA 2Q86A 2XC8A 5TDPA 4GP8B 3T09A 2PW1B 1TDQA 2IBZX 3N06B 3ZYZA 2V7HA 3O8XA 3GO1L 4IBYA 3VFSB 5EOQH 1E0OB 2WNKA 2ZXDA 2BOCA 4FZ8H 4S1RL 1X9UA 2R39A 1T5WA 5EIIB 1SXAA 1P9MC 4BH7A 3KYMA 2D9QB 2D7TH 2OMWA 4Y19B 3U1SH 3V7MA 3M46A 1U8KA 2G3MA 1KPVB 4DAGL 1GL4B 3D3VE 1MFDH 3MRLA 3ZE2F 4FFWC 1H8SA 3KYKL 4L18A 2DI8A 2VLKA 2ITEA 1QFUL 3DRQB 1TZOA 1SHWA 5FGBC 2ZUVA 4Z3FA 1B0RB 3MACL 1S9VB 3BJLA 3ES6A 3GM0A 2R1XB 4NO0A 3PHAA 3SY0B 5BW7C 3GMQA 1FGNL 4EOWH 2MPAL 2DLEA 1RV6X 1DBJH 3EJZD 3MJ9H 1L0QA 2YQGA 3AMKA 5DF0A 1XQ4A 1JZ7A 4ZNCD 3CXHK 1KTLB 4FD0A 3W37A 1J18A 2W95A 1BOYA 2WNXA 3E6FB 3TESA 3Q1EA 2EDJA 4U1GB 3SDCC 2BP0B 2VW6A 1INQA 5L4IA 4HKBB 3D4CA 4BFBD 4BKLB 2CLZA 3VD9A 5EOCJ 4N8UA 4I0PB 5IBLC 1CXHA 4F27A 5KVGE 4X8CA 1L4IA 2AVGA 1IKNA 5C0BB 3S48A 1E67A 3ZZ1A 3DUHA 1N7ML 1SXBA 1SM3L 1E9PB 4DEWA 5CGMA 1RL1A 1XWVA 5BS0D 5KG9B 1D9KD 1J1OH 3OKOA 2NY3B 5AB9A 4TOYL 2PCXA 4PVNA 3FFOA 3HW7A 4KNSA 1G9HA 3PWVA 5CF3A 3CFCL 3RZCA 2XZAH 5FB8A 2FBJL 2WBJD 1I1CA 4MXVE 3QORC 1Q1JL 3A6OA 2J73A 3MNVA 4WSJA 4Y9GA 1MAJA 4LPUA 4P2QE 3PAUA 4DKEH 3P3UA 5IB4A 1OP9A 1EVUA 1RIVH 1JN6B 3AREC 4GJTB 2VITA 3VRLE 1A8ZA 4JZJC 1ORQA 3D50A 3HTLX 4LSTL 3KDPB 1GZQA 3GSXA 3HAEG 3QQDB 4R2GD 3B6SB 3RX8A 4DP1X 2BJMH 2ADFH 1DP0A 3CD4A 4X4MA 1OTUC 1FLRH 3RPIB 3KJ6H 3ULAB 3FB6A 2NTSP 2GUOA 4YDIL 5GGSB 2Q76A 4KKLC 5J9PB 5M95B 4FG6D 3WO3B 3HN3A 1BZDA 1C16B 2VKXA 3P3RA 3WNLA 1HYSC 3TN0B 1ZTMA 2J1KA 4ETQA 1NDTA 4LDOB 1NGYB 3UP1A 3V4UL 4Y2LA 4ZX6A 1CFSB 2XQYG 5BQ7B 2LOEA 1CU4H 2HXAA 1P7BA 4DGIL 1KYDA 3HB3D 3WJMA 8CGTA 1DVFC 3N85L 3QJFB 2L3BA 1M1XB 2D8KA 4OLYH 5I2IA 1PKQE 4PJHE 1ES0A 2UXTA 3NSXA 1UHVA 5KAQF 5A2AA 4F57H 5ETUA 3EBGA 2CIIB 3C60A 4XAWL 4ZODA 1JZEA 1UXMA 1VFOA 2BCKB 4HCIA 2UVEA 4U6HB 4CN1A 2YC1B 3RVUC 4PWIA 3WYRA 5AOLA 1MQ8A 1PL3A 1XVSA 4XVTL 5E7BA 2HWZH 1S9WA 1CGYA 1T3FB 5LHDA 4MJIB 4D3CL 3SE9L 2OA9A 1XR8A 4PSPA 1VEPA 4ZFZA 4AK2A 1NBCA 2XWBA 4NZTH 2RGSA 5FR3A 2A6KA 2VISA 5GZOD 3EJUA 2AGJL 4PRAB 3UGXA 3LSOB 1DQDL 3IJHB 5BV7C 2V5RA 4GMTH 4GSDL 4YLQT 1QW8A 3ZUNC 2EVHA 5EUOE 4X80H 4NQSA 2HX8A 5TH2B 1JWUA 3K72B 1RP8A 3B83A 3HC3H 3IU3A 2Z31B 4XBPA 3EYOA 3NFSH 4PTTB 3SPJA 3BZDA 4DUVA 3UYRH 2W65B 1UACL 2W0FA 1MRCL 3ELAT 4ABUA 1HCVA 4TVPD 4RGNB 2IOIA 2KDYA 4V1DB 3AGVA 1FH5L 1GIGH 3TV3L 4B9JA 2YAFA 2X4SA 1KNOA 3GSUB 4NKMA 1JYWA 2A4EA 3U4KA 1FF5A 1JRHH 3FBQA 5F71A 5IMMB 2OW6A 2OXGB 4IOIA 3VW3H 3QCVH 3ZKMD 1E27A 1OAKH 3ZO9A 3GIZH 2PUQT 2D0GA 2YN5A 1KCRH 1YLBB 1S5IL 3AXLB 4IGBD 2DOCA 3QNXA 5EA0L 5KVFH 2HG5B 2V9QA 1B3JA 2EIDA 4JRXD 3RKPA 5B38B 4OM1L 2WLKA 1FNEA 3VACA 3FUEA 3T6VA 1LEGA 3C5JA 1CYXA 3MTXA 4ERSL 5HYEA 3SYCA 5I30H 1OALA 3OKEA 3FSOA 3JT0A 1TQCB 2LLGA 3CQQA 5K93A 4P46D 3WUWB 1N6QH 1T22B 4AMKL 4H1LH 4PJDE 4S1SH 1IIKA 1X5JA 3WHXA 4Q9RL 1NFAA 4F80A 2XV6B 1ETB1 1CT8B 4Y5VA 3TVMA 1GW0A 4H8PA 1U6AH 2RQEA 2IGFH 3VH8B 1DLHA 4HOWA 4ZFGH 1FV1A 5F0JB 1QHQA 1HEZB 2BNQB 1R47A 3DO4A 4JY5H 5T5NF 5IFHL 1OEZW 1T04B 4JY4B 1HXMB 3U48A 1JZDC 3ILQD 5C07D 3EDKA 2F5BL 3FQYA 3VD3A 5I66A 4LCYA 1YPZB 2XZZA 4X42A 4AIZA 5JXAL 2F53A 1QBLH 5HDQH 2YSTA 1QPPA 4CMMB 1UZ6E 2EVGA 3LRKA 1NCCH 1RI8A 2YXMA 4ORGA 1MQKL 4HISA 2WUCL 4JFSA 4UNUA 3RWFA 5FHBL 43C9B 2C7UB 1K2DB 4H88L 3AFLA 4IIZA 3LEVH 3BXNB 1Q9KB 1JPTL 1W8NA 1TTUA 2R4SH 5FECA 2KQMA 3DXAD 1NFKA 3T2LA 3VGAB 3T2NH 1BVLA 4LBEA 3BQUD 1S7UB 2YHGA 3FCBA 4MHHI 3V0VB 5J6GA 1RZ7H 2P24A 5E6UB 4YNYB 4NUJB 4EAEA 1N8ZA 1RUQL 5BO1H 3TFKD 1THCA 5D7IA 1HINH 5AVYB 2N0MA 1EAQA 1HKFA 3TNMA 5IHZB 2D0HA 4CN6A 2Q3AA 1ZVYA 4C47A 2JXMB 1JL8A 32C2A 2R56L 2WP3T 4YBLB 5DJAB 4NO5A 4IRJB 4UT7H 1KYFA 1HI6B 4HK0A 5GJTL 4LPWA 4Z5RB 3LV3A 3GWJA 4PD4K 4XOEA 4KU1A 2TRHA 2WJ5A 5B3JF 1A25A 2NY0B 3HNTL 2J5WA 1E4XI 5ICZA 1B0GB 1AI1H 5DJ8B 2P5WB 1JI2A 5CZXC 2GSGA 3QFJA 3E9TA 2X4OB 4HWEH 4PJ9B 3ZO0A 1VAHA 1OM3L 3S3JA 4JM0A 5GS1B 4M5YH 3GSVA 4H25A 2WOYA 1BZ9A 5A43C 3HUJE 1BAGA 4BJLA 3E6HA 2WCGA 5JDSA 4P0DA 4XVOA 2NSXA 3H1ZA 4OW6A 1W72H 1ZVNA 4F8NA 3CBKB 4Q8BA 2YGVA 1H6EA 1YC7A 5KS9B 2PWGA 2AABH 1L9MA 1AYOA 3U0PA 1N0LB 2ZPKL 5FK9A 4FQ2L 3S5YA 4RESB 2L7EA 1CICA 4M8UA 4P3DA 7PAZA 4URKA 3ZDZF 4U2YA 3WEXB 1BSIA 4JDEB 1QHPA 3UBXI 2VR4A 2V17H 1F5WA 4HIIB 2C3VB 2XI9A 1QBAA 1QWNA 2Q1EA 3QDMA 2AERT 1MLBB 3BZ4A 4XNQB 4FL4C 5AVWB 3O81A 4J39A 1HZKA 3FTUA 3RILA 4KGJA 3SEPA 4LLWA 4ODTH 1N6VA 4XODA 3QUZD 4JHWH 4ZFOB 1IGJA 3I50H 4PFEA 2QPDB 3BUQA 3PPSA 1UT9A 4KITB 1SQMA 2PCPA 5CU5A 3RVTD 2X7LB 4JLRA 2D31B 4PH8A 4NXSA 1L3WA 2X2JA 4PUBH 2YBRA 2ICEC 4G8GB 4GIOA 2O6FA 1IARB 2Z0UA 5EN3A 3F7YB 4E5XA 3FTSA 1L0XA 3SIKA 1UB6B 3UYPA 3U0WL 3QG6B 2PXYB 5EU5B 1T21A 5K9JL 3DC0A 3WDIA 4F7MB 4AGOA 1RP9A 1WDAA 3H9SD 2FGWL 4RFNC 3MLWL 2GTWA 1OAQH 3VWJC 2AK1H 4CC1A 4ENEC 1TTAA 1R3JA 1L5GB 2FWOB 5D4JA 1KTCA 2ZWKA 3DGCR 3VQ1C 1MVFA 1EXUA 4JQXA 1RD6A 1ZHBA 3Q6GL 5T5FL 4KKCD 3VDBA 1RJLB 4AV5A 4CNIB 1JNNH 4I1RA 1E6OH 3PGCB 3LVTA 4AE1A 2A7BA 5LGHL 1W0VA 1M7XA 3BP5A 4N85A 5LAXA 5I5MA 5GJSL 1SY6A 5DJDA 4BE5A 1YEGL 5D4QA 1A6TA 2VDKL 1RPKA 4YO0A 4PV8B 2Y1ZA 3TBVA 4XMLH 1KV7A 2YUVA 3MJ6A 5ITFB 5A16B 5TE7L 4LOEA 3BAEH 3TO4B 5C1MB 3UZEA 1QRNE 3PWNA 2AXFB 2EDTA 2Y7MA 4AEIL 5G4MA 4J3SA 4JCWA 1ZIBA 4KX8A 4XVJH 4F8OA 3ETTA 4NQVB 1SVBA 2GIYA 3WAKA 1MRFH 3QZOA 1R3IL 4Z8FH 3NPSC 4TTDD 2QGEA 1VENA 4JG0L 1PZAA 4PW9A 4X7SL 3P69A 3O3AB 1QMUA 1SJEA 3HBZA 2AMGA 3ALXA 3DGDA 2EQDA 3MOAL 4J8RA 1AH1A 1XO8A 4O51B 4NKOA 4HU2A 2XG4B 3L3GB 3VO0A 3H7BB 5EPMA 5B3NA 1C1EH 3LKQA 1TSRA 2HPTA 4TPRL 2Q6WB 5F9OH 2QR0B 5CN1A 1KBBA 5JNYB 1AXSA 4PY8I 1DQLH 1Z9SA 2HUEA 4X6DA 3SCMB 7FABH 3B9VA 1IFRA 4H8WH 4JFXA 3SGDH 4W4NA