3NSCA

C500s mutant of cueo bound to cu(ii)
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
493
structure length
470
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHEDTGMMLGFTVLQGDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase cueO
publication title Crystal structures of multicopper oxidase CueO bound to copper(I) and silver(I): functional role of a methionine-rich sequence.
pubmed doi rcsb
source organism Escherichia coli
total genus 134
structure length 470
sequence length 493
ec nomenclature
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nscA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nscA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nscA03
1IKOP 2J5WA 2VN3A 2AVFA 1IUZA 2GI0A 2J57A 5B1BB 4UF7C 5I6OA 4E9XA 3T6WA 2YAQA 1OV8A 4DP4X 3H56A 1KGYE 1AZUA 3S8FB 1ZDQA 1FWXA 2YAMA 3IN0A 1KYAA 1MDAA 1GS8A 1CC3A 5B1JA 1GS6X 1CUOA 2NRDA 4KOBA 2Y69B 3ABKB 3ZX1A 2VW6A 1FA4A 5AZUA 5F7BA 4AKOA 1NZRA 3NJHA 3HB3B 1XMEB 1NIEA 5FC9A 1PNDA 2FNWA 4BXVA 2DYSB 4A66A 5I5IA 3MX0B 2VW4A 2ZWNA 4HALA 4DP5X 3WG7B 1ADWA 4KO6A 4W9ZA 3TBCA 3TU6A 1RZQA 1M57B 3PAZA 1BXUA 3X1FA 1KV7A 3AZUA 2DY2A 4GY4A 1DYZA 2RACA 4YSAA 4JHUA 3UGEA 1RCYA 2E86A 1FFTB 3WI9A 2OJ1A 1GYCA 1SF5A 4FA7B 3SBRA 1L9TA 1ET5A 4QKTA 2WSDA 1AG6A 1BEXA 2QPDB 2UXTA 4A2GA 5AFAA 1J9SA 3DTUB 2MRYA 1ET7A 2YXWA 2VSMB 3NP3A 1M56B 3N55A 3FQ1A 2WO3B 4N8UA 3ASNB 1L9QA 5EHFA 2W88A 4HCGA 3RYMA 1T5KA 5ANHA 1A4CA 4AKPA 2XU9A 1YLBB 1B3IA 4GP4B 1RKRA 2BZCA 1JZGA 2AANA 2GSMB 3IN2A 1JXFA 3NP4A 2IWFA 4G72B 2PPEA 1PZCA 1OCRB 4TXVB 1GR7A 1TKWA 1SDDB 3FS9A 3BVDB 4BWWA 2IWEA 1AZNA 1J9RA 1XB3A 3T6XA 4A68A 2GC7C 2J55A 2P80A 1BXVA 2TSBA 4KO9A 2FT8A 6PAZA 1JXGA 3T6VA 2CALA 4HHWA 3GYRA 4W1TA 4YSSA 4GXFA 1SDDA 4DPAX 4L0PB 2IH8A 2XLLA 3QJQB 5D4IA 4HCFA 1GY1A 2QDVA 3CVBA 3CG8A 1PZAA 4E9QA 1A4AA 3PAUA 3JT2A 2HRGA 3DIVA 4P5SA 1URIA 5I6MA 3SBPA 1KDJA 2FQGA 3S3DB 1AZCA 3GXUB 5LDUA 1IBYA 1PF3A 1SFDA 5I5MA 1L9SA 1IC0A 1JOIA 1WA2X 2BW5A 3S3BB 1WS8A 2YAEA 1SHWA 4DPBX 1E5ZA 3NJGA 1JZHA 4G7RB 3S3CB 3WNIA 4BK5C 1JXDA 2DWSA 2BW4A 1GY2A 3HEIB 3ABMB 1PAZA 1AZBA 1ID2A 3AY2A 3NSFA 2A3TA 3AG1B 1IBZA 1WS7A 2JXMA 2H5UA 2BP0B 2CUAA 4PAZA 1VLXA 2PLTA 1F56A 3QJTB 4DP2X 1AR1B 2IDTA 2XUWA 3FU9A 3ABLB 1X9RA 1ZIBA 2GB2A 2HLEB 1L9OA 5F7AA 1A65A 2BP0A 3FSZA 3WIAA 1DZ0A 1SJMA 2J56A 4F7KA 4QLWA 3NJLA 1AIZA 2VM4A 4G71B 1W8EA 2I7SA 3IBOA 3PXLA 2QDWA 1OE3A 4NAJA 2H3XC 2CCWA 3NYKA 2UXFA 2EIMB 2HX9A 3NJIA 1GS7A 3IEAA 6PCYA 2FQFA 1ZPUA 4BDVB 2FT6A 2I85A 4DP8X 4ENZA 1KCBA 4AZUA 4DP9X 1E30A 1HAWA 4Q8BA 5PAZA 2VSKB 2PPDA 2YQBA 4YVUA 3EH5B 2CBPA 5I6PA 4GP5B 2XV2A 1PLBA 2IDSA 5B3SB 1NIAA 2PP8A 4BDVA 3CVDA 4AI7A 3UAEA 1NINA 1NIBA 2AZUA 4E9YA 2DWTA 1JZFA 5PCYA 5TK2A 3DKHA 2GIMA 4E9VA 3PAVA 4YSPA 2IAAC 1N68A 3QJRB 1X9UA 4BWTA 1NWOA 3C75A 5B7MA 5I6LA 4KNTA 1CYXA 1PCSA 2FT7A 1A8ZA 1AAJA 1OCZB 3EH3B 7PCYA 3FYIB 1KBWA 2EINB 4YSCA 3IE9A 4DP6X 2VMJA 3OMNB 2IDQA 1AS7A 2OCCB 3OD3A 3S8GB 9PCYA 3OMAB 2DV6A 3UABA 2VM3A 3CZUB 4F2EA 2BWDA 3NJJA 3FU8A 1MG2C 1NPNA 1QLEB 1OCOB 2BHFA 2IWKA 4YSQA 2AZAA 1WA1X 4DP0X 2R7EB 1NDTA 3FT0A 4HZ1A 5B1JC 2B3IA 4YSRA 3UAAA 7PAZA 3N2JA 1TEFA 5A7EA 3ERXA 1XB6A 3GDCA 4KNUA 1L9PA 2R7EA 3NJNA 2PP7A 4K9JA 1GW0A 1W6WA 2EIJB 4DP7X 4JKNA 4JHVA 4HCIA 4PCYA 1J5CA 2HRHA 3X1NA 4YSDA 1W6LA 3OM3B 1MG3C 1AANA 1J5DA 1GSKA 2FWLB 3QJSB 3AG3B 4KNSA 4BWUA 2XVBA 4KO5A 3V9EA 3WNJA 1WA0X 4CSPA 2LLNA 3T6ZA 2IH9A 4P5RA 1SHXA 1OCCB 1A4BA 5IY5B 1R1CA 3KW8A 1PMYA 1AG0A 4NERA 1KDIA 4UAHA 4E9SA 2UXGA 1E67A 1J9TA 1ILUA 1V10A 1NTDA 2YXVA 4G7SB 2Q9OA 1AQ8A 1EZLA 3QPKA 4DPCX 4G7QB 1KCWA 3TA4D 1SF3A 3G5WA 5B7EA 5D4HA 1V54B 2HX8A 3X1GA 2XWZA 3CVCA 3QJVB 1BQKA 1V55B 1NIFA 1PLAA 1BYPA 2ZXWB 4AX3A 1ILSA 5D4JA 4YSEA 3FSWA 2IDFA 1A3ZA 2HX7A 5I6NA 2BWIA 1OE2A 1AS6A 1JERA 1RZPA 4GP8B 3NSDA 4X4KA 2EIKB 4EF3A 4YSUA 4KO7A 5B1KA 1AOZA 2UX7A 8PAZA 2EILB 3EH4B 5E9NA 3X1EA 3TBBA 1AZRA 3NJMA 2DYRB 3PLYA 5B7FA 4A67A 5I5JA 4F2FA 5I26A 4MFHA 2CAKA 1UATA 2FJSA 2TSAA 1BAWA 4KOCA 1QNIA 2GBAA 4A2HA 1NPJA 1JZIA 4WTQA 4YL4A 1HAUA 5TK4A 5B1AB 2XYBA 2UX6A 3H4FA 2PP9A 2QT6A 3NSYA 2FQDA 3UACA 1N70A 2PPAA 3MBWB 3PPSA 4FAAB 3KW7A 2UXVA 3NJKA 1ASOA 4A2DA 5I6KA 2PCYA 2YARA 3L45A 3CDZB 3T9WA 1ET8A 1JVOA 1NIDA 2XV3A 3PCYA 3ASOB 1ETJA 1CURA 1M9WA 2PPCA 1SNRA 1JVLA 2XX0A 3X1BA 2BZ7A 2YAHA 3H4HA 2B08A 3FSVA 3CDZA 1TEGA 3FPYA 4M3HA 2X88A 1ASQA 1PNCA 2FQEA 3ZBMA 2P80D 1OOWA 3AG2B 1BQ5A 1PY0A 3FYEB 2XXFA 3FQYA 3FPXA 1SFHA 2QPEB 2X87A 1ZV2A 3WKQA 1ZDSA 1ZIAA 1CYWA 2XX1A 4E9TA 1ASPA 3ZIYA 4DP1X 1BQRA 3AG4B 2YAFA 2GC4C 3T71A 2VW7A 4M4RB 4YSTA 3UADA 2IDUA 3JTBA 1MZYA 2GHZA 3NT0A 2HZHA 2WO2B 1AACA 4RH4A 1QHQA 2OV0A 2ZONA 4N4YB 1XB8A 3OMIB 3V9CA 4YVNA 1AS8A 3NSCA 1KBVA 1L9RA 1MZZA 3EF4A 3WKPA 2XV0A 1JZEA 2JFCA 1NWPA 1I53A 1BXAA 2MTAA 2XXGA 2PCFA 3SQRA 4HIPA 5AKRA 4ZK8A 2CJ3A 1E65A 1BYOA 2YAOA 3U25A 2Q5BA 3D12B 3FSAA 2FTAA 1J9QA 1WAEA 2YAPA 2W8CA 2I7OA 3BQVA 3NJFA 3AW5A 2JKWA 3QQXA 1OE1A 2HXAA 1EHKB 4UANA 1OF0A 2PPFA 4E9WA 3QJUB 2H47C 2AFNA 1E5YA 4A2FA 3FU7B 1PZBA 2Y1AA 3EHBB 3X2QB 5I28A 3FQ2A 4NB7A 4A2EA 3SBQA 4HAKA 2BP8B 3ZDWA 3TASA 4AKQA 4E9RA 2N0MA 3ABGA 4BXSV 4G70B 2BO0A 4WKXA 1PLCA 4Q89A 1TU2A 3FU7A 3OQRA 1HFUA 4GYBA 2ZOOA 4CSZA 4YSOA 2BP8A 4HHGA 1NICA 1JZJA
chains in the Genus database with same CATH superfamily
2G2RA 3HG1A 2X4NA 4MHHI 1OW0A 2E4TA 1K5NB 5K9OB 3KGSA 3B2VL 3EFFB 2DQJL 2TAAA 1S78D 1Z32X 3GTNA 1JV5B 4V1DB 2NY1B 1YPZB 2ERJC 4ZSOE 2OTUA 4ZO7A 2Q7NA 3ZE1E 4ELMF 1Y6NR 4E9XA 1G7QA 4JFUA 1RUML 3I3BA 1LO2L 4AK2A 2R23A 2OSLB 4I3SH 4YE0A 3NACH 2KZKA 4YO0B 4L8CB 3U2SA 2VLRE 3LKQB 3TBYA 2CKBL 3VGAB 3VD7A 4PTUB 3DWTA 3V0VA 3PFQA 4LOVA 5ANMA 1XSKA 5ACZA 3DMMC 4OCRL 4OSUH 1C5BL 1CUOA 2VSCA 5DQDL 5F71A 3X11A 3QWNA 1S7QA 5ALBL 4PP2A 2CBOA 2XG4B 5J13B 4Z76B 4J4PC 4IKJA 4H5SB 2CO6A 4Y4HD 4M6ML 1RPUA 1LM8V 2VZOA 4K3DH 1EGJH 5BO1L 4EXPX 1CICD 3PWNB 4GRLD 3T0EC 4A66A 1QEWB 1U8LA 4HUWA 3MUY1 4OZFA 2YXFA 3L1OH 4HFWB 1UWGL 1PX4A 5CJQL 1FV1A 4QMEA 5IUCA 4FJ6A 3WD5L 3PAZA 3HLAA 4MXWH 3X1FA 4OZHA 4TVPH 5I82A 5AOLA 3RZWA 2YLKA 4AW4A 2VDPL 4AGMA 1KCLA 1TJGL 1BXXA 3ARGA 3Q1SL 5IUSA 1XIWB 2NZIA 1TJIH 3JWNE 1WFNA 2OMVB 2GTZA 4N0FB 1IQDB 2R2EB 1JPTL 4QWWD 3VFTB 5LBSL 2XFGB 1LQBC 2FYYB 1NFDF 2LT9A 4AIOA 2F08A 5T1LA 4DTGH 3MREB 1A7OH 2GI7A 3FC8A 5EDXA 3ENEA 4F15C 4L0ZA 4GW4A 4NZUH 1N9PA 4WVRA 5F6HI 1BEYH 3G5VA 4NQDD 1OW0C 3JV4A 3C6EA 4MJ2A 1YJDL 3WFEH 4IU3B 5DZ9A 1PPIA 2XN2A 4XB7A 1INDL 5GRXG 3C8HA 1YQVL 3W9DB 4AM0A 2R8SL 3RZCB 1E9PB 3ZE0B 3ARRA 2R2CA 4GINA 4H2AA 3ZR5A 1KJ3L 5TE7H 2BZCA 3V6FB 4QKXB 3MODL 2IWFA 4HWEL 5E1AA 1LO3L 5AYUL 3ZE1B 1TCRA 8FABB 1RZJH 5I1KL 2ZAGA 4X5RA 4LOUC 1XCQA 3J8F7 2BNQA 1OAJA 3DVIA 4NKOB 5C0EB 1ZGLB 2VIRA 2VLRB 4ZFGH 3CH1A 3D4GA 3MLXL 4WK0B 2BWQA 4PWGA 1I1YB 4PJXE 1KYUA 4N0UE 3MCLL 3E6FA 3KPNA 4N1EA 2J7LA 2Y0SA 5HGAB 2AEPL 1U93B 2CA3A 3NDYE 4AQ1B 1UM5H 4EMZA 2QDVA 3Q8EA 1UD4A 5I15H 4Z6AT 4R84A 1PZAA 1JFHA 1CLVA 4YUEL 3BW9A 4UINH 1T21B 3EDDA 2HRGA 2A99A 5F7KC 4MNQE 3ZTCC 2XVGA 5INDB 3LQAC 2YXMA 4XE5B 1RPQA 3WGUB 5E8NB 4YXHL 1AFVL 3ARGC 4IRZL 3IF1A 1YEFH 1FAIH 1F18A 3RHWK 2IG2L 3BCFA 4KUCD 1JK9B 4HX1B 5GGQH 4HKBB 4X7CC 4NQEE 5DJ6A 5C08A 3Q7JA 3W0WE 1GY2A 2DDQH 4L5FE 4AJVA 4ZAKA 1QRKA 4FMFA 1DBJL 1KTBA 2ZKHL 4OD3L 3VQ2C 2G3NA 4JEGB 5CJOH 3D2TA 1QFOA 3SKMA 3T5WA 1F2QA 3SPIA 1D7CA 4MCYA 1P0SE 4P23D 3T08A 4BZ1A 4YXLH 1HC1A 4PRHA 1NGWA 4OUUB 4E41B 1VA9A 5I1HL 3LB6D 3SN6N 5E2TL 2W0FA 3FSZA 3Q6FB 3B6SB 2DMGA 3HBPA 4ZYKA 3M1OA 3MGTA 3N9GH 4O51B 4NYLB 3QDJA 5KJ4A 4D0CA 3TZVC 2A9CA 2E59A 3QUXA 4PJAF 3WCYA 3U0PA 1L9NA 3VD4A 1AGBB 4APQB 2XKNB 3RFZA 4P2OA 1UYWH 4IW4C 3QXAB 5I9QB 1KT2A 1UHVA 4OB5L 5TDOA 5B22A 4QHMA 4LO9A 3WIHH 1KPUA 4XCCH 2FT6A 2AV1A 4OCLC 2I85A 2CDFA 4WI2A 3RWGA 1OK0A 1XGRB 3PDDA 4N0UB 5KOMC 5BV7C 4DP9X 2BNRA 3L9BA 4JR9L 2VSKB 1S9YB 1U3HA 4H1LB 1EIBA 4L23A 2DLFL 3S4SA 5I8OH 3HG4A 2ZUUA 3S3PA 3O6KL 4JGJA 5D1ZA 3J27A 3BWUC 2AZUA 1NIBA 1BJMA 3MHZA 3FAXA 5IQMA 1IFHH 2EEXA 4KJYB 1F1DA 2CRZA 1I75A 4W9JC 5IQOA 3MRHA 5EU6D 5CMAB 2D9CA 2NY4D 3LRGA 3T2NH 4RNRB 2IOOA 3FF8A 5IK3A 3R7QA 2X2JA 3F04A 5BS0A 2WZ0A 1SMAA 4QI3A 5I1JH 1SN5A 2CJUL 1FZKA 5CGTA 2ZICA 1IILE 3GS7A 4NQEB 3NZHL 4U6XB 2DICA 4JN2A 4ERSH 4HOWA 1OWWA 3BGMA 4YHNB 4GKNA 2ZAHA 1HKFA 1A7QH 3GK8L 4HKXA 3D2UD 5DFAA 1YYMH 4A39A 5A2CA 5KVDE 1BREA 3VI3E 2V17H 2HTKD 3H9HB 4GXVH 4WK2B 2EVHA 4GAAA 1TTAA 2Q87A 5CSBA 3MRJB 5DJAA 5K69A 4LSPH 4U1SB 2IBZX 3KLSA 4K71C 5F7YC 1I8IB 4JFYA 4K9JA 1CDJA 3QUXC 1QBML 4M48L 3F62A 1SDAB 1OY3B 4O02B 1J5CA 4X4YA 3C8DA 3PFUA 3K6DA 4P2OC 3RFZC 2WVVB 3JWDC 1MG3C 1N5YH 1CDYA 2H45A 2QL1A 4XO4A 3K8LA 1LP9E 3BPOC 1AQKH 4H0LC 3RGBA 3SYAA 1KTLB 1JUFA 4OGZA 4LRNL 1WA0X 1ZXQA 4OJEH 1PZ2A 5LO7A 3ZR6A 4CSPA 2JVUA 3P4NA 1W72B 1AJ7L 4PGBA 5HHQA 3M88A 4B5EA 2UXGA 1MFDL 3N1PC 2K70A 5DURB 4L3AA 4S1QL 1KWKA 4JL2A 2E7BA 1KFAL 4NPKA 4HZLA 2J2ZB 2K8MA 4JDTL 2GIYA 3K0WA 4HS3B 1C08A 2VXVH 3IDYB 5IEKB 1O7VA 5FKPA 3QCUL 2EQDA 1SF3A 4BZ2A 2ORBH 4XPHL 3PIQA 3CXHK 4KXDA 4XMUA 5D2LA 1Z0MA 3L2MA 2XWZA 1E7UA 4FQ2H 2D03L 4EN3B 2WWMC 4WJ5A 4XBPB 1ILSA 1FCGA 3FTYA 1O7DC 2AERT 5CP3A 5J6HA 3OXRB 4PRNA 2Y1ZA 4TVPE 4F37K 2HWZL 5F96L 1OGAE 2VR5A 4GLRI 1SXCA 1WE5A 2DF3A 3LNIA 1KB9K 4L3CA 5DRNA 2XNAB 1N26A 5KBDA 5C0BB 3ELQA 2A9MH 3ZW3A 2QSVA 3PWPA 4H25B 3FCTB 2LE9A 3LNEA 3S96B 1AO7B 2OL3B 2Q7AA 5JA9A 4M93C 4YDKL 2V7NA 4PIBA 2HN7A 4YEEA 4KJWC 3QQNA 4L29A 5KYXB 1ONQB 1IV8A 4L3FA 4UOJA 4ONFH 3VI3B 3NTCH 1JRHI 1S46A 2FIKA 2LU5A 4ZS6C 1EO7A 2UWEF 1B4JH 3Q3GB 3TV3L 5F7NC 1S7TA 1WAPA 2DTML 5CLZA 5HDLA 3SDDD 2AXFA 3MBWB 3VG0L 3R1GH 2UY7A 3PQYA 5GJSL 4NZ8A 3D05A 1ASOA 3OLIA 3FFCE 4DGIL 2C9PA 5D7IF 1X5YA 1I85A 2Q76B 4MHHG 4CN6A 4Y2LA 1ET8A 2G9HB 4BH7A 3P4OB 2HFEB 2X7LA 2RCSL 5IOKA 1GH7A 4IRJA 3WFDL 2Q2LA 5C3TA 3HI5L 1M9WA 2YJLA 5JO5A 3BZ4B 4G8GE 4IGBC 3FTGA 3VJ6B 4YFLF 1SQ2N 3OV6A 1SEBB 3GZOA 2W07A 5EBLB 4AT6B 4ZMPA 3MGOB 2AMUA 3Q6GH 4GKSB 3UO1L 4UDTA 1E2WA 4FMKA 1ZTMA 5KUMA 4BUQA 1ASQA 1JRHH 3VDAA 2I60H 2WINB 4AGNA 1LWJA 2DQFA 3DGDA 3ARED 5CGMA 2VL5B 4XBEL 4CKVX 3T0WA 3QNXA 4Q9QL 1U8QB 2JKJA 3LIZH 4RBPH 3HG0A 1E2VA 1NCBL 4FG4A 4HPYH 3KDMA 2ADIA 1UZ6E 5FYKH 1JSYA 1E6JL 1NKGA 1TO5A 5L2KD 2MPAH 3ES6A 4P46A 3CN4A 4NO2A 3E7JA 1FNSL 2J6WA 2ICEA 3MLZL 4YSTA 1E6OL 5BJTB 3LKOB 2V5SA 4TLUA 4HJGA 2FLBT 2D7MA 1SM3H 5E6RB 3ZY7A 5I2IB 2WO2B 4I9WD 4PJEF 5E2WL 2UY6B 4PJFB 3BRGC 3RX8A 5HHOB 4YVNA 2H2SD 1UENA 3IGFA 3EOTL 3CHQA 1UWFA 5AW5B 1OSZB 4WTZA 3EF4A 3C2AL 2GJZB 3TZVB 4L5FL 5BRZA 3KLAA 2PWDA 2VIRB 1EEYA 2WJ5A 3EZ8A 1L0XA 3GKWH 3HC0B 1MCRA 1NWPA 2Y6TE 1MRCH 4KKBD 1NGZA 3SQRA 3RY5A 2YHGA 3PP3K 5FW7A 2OMZB 4WU5A 1LE9A 2WXPA 2Y07L 2WM0A 3ILPB 4JQIA 5DYFA 4IS6B 3H42L 4MQSB 5C1MB 3QFJD 5BV7B 5IGXH 1YEEL 1FGNL 3MLYL 5FO7B 1UD6A 1NPUA 1N8OE 2Y7QB 3L5WA 3GRWH 1UUSA 4TTDD 2H1PL 1YVLA 4O02L 4Z7QB 1OF0A 2BOCA 3WKMH 4QRPD 3ME0A 3TJPA 2HLFC 3LQZA 1G7HB 1TPXB 3DX9B 3ZHKA 4KRPD 4WHTA 1Z9PA 2A83A 4TS6A 1WFJA 1KGIA 4R2GC 3NG5A 4LSDA 4NZRL 4FFWC 4CC4C 1W72L 4EDWL 4UTAL 3MXWH 1YDPB 2NY2B 2J88L 1E4KA 4HMCA 4HIIA 4S0SD 1E3ZA 4X6CA 1E8YA 5JW4N 1T4WA 4NQTA 5C09E 2J6EA 4XC1H 1QLRB 2WAHA 3IAQA 4XOBA 2H6OA 5DJ2B 3QUHA 4Y9BA 1U36A 1IUZA 3D5OF 3DUHA 2VKXA 4NSKA 4PJCF 5KS9F 1A9VA 4JDEA 2WTOA 4OD1H 5IMLA 1GGBL 2BFVH 4EBQH 1CF8H 5D6CB 4X6FB 3AS1A 5FYJH 1C5DB 1RK0A 4K3JL 1I8KA 3H3PH 2DI8A 3FB6B 5JTWA 2BSBA 4PG9B 1FNAA 1GOGA 1NC2D 3KYMB 5B1JA 3ZL4L 4Y4KA 1BCIA 1PQZB 4K23L 5C2BH 2OL3L 4JL1A 3BP4A 4G6JL 2EVJA 1DSFL 4IKIA 5AVVB 3BPOB 3CFEB 3UTPD 4M7LL 3BI9X 2AQSA 4LSTH 3ZDZF 1U91B 5KVDL 2VW4A 1DANU 4LBEB 1G4MA 4JE0A 1H5BB 1OT1A 1ZT4A 4X0NA 4F7PA 1RIVH 2IGLA 2X40A 1FL5B 1WISA 3MRKA 4GRWF 4LPVA 2ESVD 3AZUA 2TRHA 5EZOL 3VGEA 2Y3AA 4YWGL 5AB9A 3FU5A 4RMVA 4UBDD 4DT2A 5JLZA 3EDJA 3AWGA 4ZW6A 3ZMNA 5ID1A 2AITA 4HSAC 3NA9H 4XNQA 3LQAL 3WXVH 1UB6A 1GYCA 4X9BA 3HC2A 4MD4A 3KJ6H 3GGWA 4OU3A 3V4PH 3MRRB 2O72A 1DQQB 3KPOB 5DJ8A 5D7LE 4Z7VF 2F53E 4HH9A 1E4KC 5LN8A 1FC2D 4K2UH 5D7HA 1BVNT 1QFHA 3QDGA 3NACL 1QSED 1YECH 2WSKA 3DTUB 3RPBA 2BY0A 4R96A 1ZLUH 4ALAC 5AWNL 1QFWM 2VXQH 3CXDL 5EZIH 3QQ9D 4OSUL 1TR7A 5F1KC 4NM4L 1NCWH 1WGOA 5EHFA 1JF1A 1C8PA 3WIFB 4OF6A 4GEJA 1YMMD 1WBYB 1F3DH 2CBMA 4LCCA 1IBHA 1FYTB 5C09B 4URKA 4M93B 3HN5A 5IVZA 5L2JB 5F0JB 4XO9A 2CZNA 4K3DL 4AVKA 1JZGA 4TUKH 5E9DE 3UG5A 5HPMA 4UOW1 5ICXA 5LCVH 5MEOA 4PY8J 1JN6B 1NBVH 2WXNA 4G1EA 3L1OL 4R4BA 1JF5A 3MUJA 4E42A 4HXBH 3ZGIA 5I1EH 3N43F 3I50L 2GC7C 2H0FA 2AK4E 4MXWL 2EO1A 4MMYA 1EANA 3J2PA 4TVPL 1UOWA 2EDLA 4B0MM 1AXTL 3MUGA 4HHWA 4YHZH 1QSVA 1NAMA 3MJWA 4LDLB 4MA7H 3W56A 4IDJH 2C5DC 5FOJA 4ETYA 1RK7A 1RU9H 2EDOA 3M8OH 3APFA 2EIZA 2YK1L 3GRGA 2C9SA 4IGBB 1L7IL 2WWOA 2F58L 4Q74A 4DTGL 2ZE0A 1FZOA 2OFQA 1V5JA 5IQ9A 4R0LC 3V6OE 3M17A 4H26B 2NQDA 3CFTA 4KY2A 4LEBA 4X80H 4GUOA 2H3NB 1BEYL 4HCRH 4JRXB 1AMYA 2BW5A 4PJ6A 5ID0A 4P5KA 3WFEL 3E6HA 4DQOH 5FKAA 4QIRA 2D4FA 3TEXA 2P8LA 4MXQC 3UG3A 1QYGH 1C9SA 5EEUA 3MLUH 2E27H 3WE6B 4C56B 1JDCA 3D9AH 3NJGA 2EC8A 2IF7A 5GGRY 2VDKB 3WNIA 4DUWA 4K9EC 4QTHA 4G1MB 1MCDA 5FYJU 1QFUH 4NPYA 1I9RL 3LX9A 1QA9A 2CHNA 4D2NA 3DGCR 5B38G 4HKZA 1WBXB 5FDWA 2F53B 1CGXA 1D9KB 3O9WA 1FH5H 4LLUA 2DWDB 4FADA 5EUKA 4BM7A 4Z77B 5I76B 3L7FA 4PJHF 3DTXB 2P8PB 1EBPA 2HLEB 1PLGL 3EJRA 4ES8A 1MHEB 4YAQA 1UM5L 1UXWB 3FHEA 2Y22A 4Y2DD 4X8XA 2NSMA 4UINL 3AAZA 3PWUB 5FYKE 4GQZA 5AW6B 5J11B 2N4IA 5DFVC 4BIKA 5K1JA 3E0GA 2UXFA 2WYHA 2Z34A 2XTLA 5DHXB 4L4VB 3SO5A 3U30C 4XCFH 4WUKL 5F3BB 1E4WH 2AK4B 1MXDA 1B6UA 2ZOLB 3F5WA 3GSWB 5CP7B 4BV1A 1A6ZA 2ZIDA 4NJAH 2GUOA 2MHAB 3P3SA 3JWDL 3NK3A 1KELL 4PVLA 3FO0H 1BQLH 4RDQG 5E4OA 2DDQL 1SYSA 4IQHA 1DQJB 2DKSA 3MV7D 5GGRB 2ATPB 4W4OC 3RDTB 4NDMB 1J1XH 1M7UA 1EWHA 1DO5A 1OANA 3QZNA 5CJOL 5EPMA 1FL6B 4WF7A 3OZ9L 3N1FC 4IHBA 5GS2H 4AH2A 2IPTH 4LF3B 2HJKB 5B7MA 3N0AA 1G9EA 3C5ZD 5CHNB 3BLBA 1KC5H 1MXGA 1OCZB 3VB8A 2DKMA 4JFPA 5FHBL 1NA8A 1UCBH 2O4EA 3DJRA 1BBDH 5EBGA 5F7MC 2VMJA 1ACZA 5FCSH 1UKSA 2E3VA 3SHSA 1CE6B 3CLFH 3N9GL 4JHAH 1QNZH 3KM2A 5J6SA 3O9WC 4PMFA 1NPNA 3GMNB 5E5RB 1WWAX 4I13B 5BRPA 3G6DH 3ZHDA 1DEDA 2XQ0A 5EULV 3P4MA 2XQBL 4ODVL 5LBGA 1ZA3A 2PYED 1UYWL 1OCWL 2DD8H 3UEZA 2B3IA 1IM9B 4CDGC 5IROD 3FTSA 4QO1A 4I8DA 1TTRA 4XCCL 3G5ZB 1TEFA 1X7QB 4PB0H 3TVMD 3VXUE 3FH5A 4DKEL 1O0VA 5E94A 3L3OC 1TG8A 1XGZA 4FQHB 3ESNA 5ECGA 2BVYA 5DQJA 5T5FL 2NOYA 3WLWC 1MNUH 3BN9D 2HJFB 2VITB 5I8OL 2WK2A 3EIFA 1EEQA 2NXYB 5DJDB 5GS3A 2GFBA 5K93A 5C9JA 3HE6A 2M2DA 4GG8A 1HINH 1RZIA 3V95A 2Q20A 4X6EB 5FYJE 3MLVL 3QSKB 1K85A 5DZJA 2CXGA 2JI3A 2J1ZA 2ZYHA 1TVHA 3SDAA 3IDMB 5AD0B 4GOSA 2YN3A 4PJBB 3BDYH 1VEOA 2YGQA 3QZWA 1RHHA 4FLRA 2L8AA 4ZPTA 3QGVA 3SKOB 4JRFA 5E6IA 1CQKA 1F41A 5H94B 5SWSD 5A40E 4ERSL 3B7YA 1AKJB 2DMBA 2X3AA 2QGEA 3NCCB 3OF6A 4DPCX 4G7QB 5L4FA 4LVHC 2NY0C 2NTSP 1A7QL 4GW5A 1YYML 4X4XB 1B3JA 3EG9A 4TQPA 4AK1A 3X1GA 3MA7A 5AVZB 4KI5E 1R24A 3ROOA 2CDGB 3QXWA 3WFZA 4PBDA 2X6MA 4XN4A 1Q1JH 1TLMA 4LSPL 4XPFL 1MIML 3FZUD 4LZKA 5IMKA 3VWJA 4FERA 2VDKL 3PHSA 2CO4A 3QNYA 4XP4H 3U1PA 4XP9H 1HHGA 3ZT7A 5F1OB 5FO8A 3IFPB 2V2WA 4K8RH 1NGXA 3TCLB 1MIEH 3VFOB 2CIIA 3RWDA 4YR6B 1F4HA 5I26A 2FO1A 3CFBA 3WHE0 1AQKL 2GBAA 5JPMB 5F72S 1CIUA 2X4QA 1WITA 2V9UA 1CJYA 4JVPA 1LMIA 2C9RA 2NZ9D 2DLIA 4YIQA 5B1AB 1EJ8A 5F6IC 4UV7H 1U58A 4JZOA 1QUPA 4K5NA 5ESQB 1KYOJ 1T1ZB 4XI5D 4ODSH 1TTBA 3VXUB 2JJTC 3FH7A 2V33A 1MFVA 3PJSB 1CB4A 2CCLA 4G80B 3G9AB 5EN2A 4R0LB 3TJHD 2VXVL 1DFXA 2UZPA 3N41B 4HOZA 5KBPA 2D31B 1U92B 2ORBL 2YA1A 4X4ME 1HVXA 1L3WA 1R3KB 3TBVB 2XX0A 5EN3A 3SDAC 3SGJA 1UM6L 4BK4A 4QTIL 4DJMA 1UCTA 4ZNCD 1FE8L 2D3VA 4X9GA 3ZUNC 5E4EB 3MRLA 1FFRA 3VM5A 5FA3A 5E6IC 2FJGA 3CVHB 4HWZB 4I48B 3A22A 2Q8BL 5CWSA 3S88H 4NBZB 4U3XA 3KNBB 4XWGH 4Y4HA 3F7VB 2WD0A 2A9ML 2QPEB 3BC9A 4RFOH 5EO9A 3HZMA 3NJVA 5K5YA 3GTTA 3ZIYA 4F7TB 1CICA 4GRLA 2IFFH 1EV2E 2NMSA 3IM1A 4XBMA 3F12B 3WTXA 1P2CA 3NCWA 4U1MA 5IT2L 3LEVH 4F7MA 1E28B 4ONFL 2HT2C 4UDUA 3VWJC 2FEDD 4L05A 1MZYA 5BW7A 1Y1DA 3NT0A 3WYRA 1JV2B 1SXSA 2X1PA 4YGVB 5D72H 5FM5O 1HZLA 1B4JL 4JFQB 5EZLA 4FG6C 1R5WB 3IETA 1I3RA 1X9QA 3IU3A 1T03L 1I8AA 1MFEH 3MRPB 3S37L 3QISA 3ARTA 2XV0A 3SE6A 2R0KH 1TTFA 1IGYA 4GBXB 2CG9X 2WKGA 1NMBL 2Q8AH 3IYLW 5JDSB 4AL8C 3GHEH 3IJYA 3NFSH 4ZX4A 3Q6GL 3ZHLA 5A2KH 3VXRE 4LLAA 2SEBA 1JNJA 2FTAA 4FNSA 1S78C 2WAQA 4NC2B 1AGDA 3BYTA 2I60L 3ULUF 4RBPK 3CUPB 1BZ9B 5EFIA 3EGDA 3Q8AA 2EXWD 2AW2A 3HW7A 3Q2WA 1N0LA 2F54E 1NC4D 3MYJA 5FYKL 4R3SB 3SGJC 2J4WL 5EEXA 4GT7A 2V3EA 1AVAA 1F6AB 5JXAH 1OAYL 6CGTA 2BP8B 3ULVF 5D71H 4PJ8D 1E40A 3ZL2A 1SM3L 2BC4A 3IGKA 2H0EA 3IXAA 4NLHA 1KACB 1X5MA 4PH8A 2VT0A 5KSBE 2WZ6A 4MDIB 1GC1H 4X42A 3MZTA 3HPJA 3NJXA 3FW6A 3B9VA 1CICC 2DRUA 4GRLC 1JS4A 1XFPA 2J3SA 4PGEB 4X5PA 4AQ8A 4N1CA 1B0RA 1RJYA 5C07D 5LJYH 1EPFA 3QEHB 5IB4B 1NEUA 2FGWL 1QO3A 2BCKB 3LHAA 4ALAL 2VDRH 5DK3A 1JXKA 2QVKA 5ERWA 2EUVA 2NLJB 2BHZA 2O30A 3L3OB 4BFKA 5IGXL 3T0DA 2PKDA 3AT0A 3HC4H 1KYAA 5DZAA 4N8VG 3EJJX 5DO8A 3GRWL 4QWWC 1FL3A 1SLVA 2FBOJ 1P84K 2WYTA 5C9KA 4EXKA 3EYUH 3WKML 5SWZD 3SDXF 4A6YB 4R90L 5EC2A 1NGYB 5FC9A 2W0PA 2PR4H 4M61A 2EACA 3ZMRA 1FLRH 1J11A 5DHVH 4XT1C 3Q8FA 3LN5B 3QO1B 1FSKC 4DP5X 1PKQB 4YHYC 4S2SB 3RX5A 3FCGA 3MGAA 4PRBB 2QHRH 1BD2D 3HE7A 4DKTA 4KX9A 1HXMB 5AW2B 2WXMA 1DBBL 1EAJA 1WSST 4WEMB 1OB1B 2GJPA 1LO0H 4OW6A 3WKYA 5LWYH 1OVZA 2FWOA 2RACA 5HVWA 1WFIA 4XC1L 1DDHB 1KJMA 1KTJA 1OO2A 2CR6A 2MFNA 2A6IA 1IL1A 2A7BA 1AHKA 3LNHA 2NY0B 4LVHB 2YQ3A 3D6GA 1PZUB 3HAEH 3KL5A 4NWTH 1ZRUA 3TF7C 1I1AB 1VGEL 1JWUA 3OJDB 4G6FD 4OD1L 4QCIB 4L2LA 1FPTH 4MXVE 3D85D 4ZOEA 1OLLA 3OLEA 3QI9A 2QPDB 2YSTA 3OKOA 4G8EB 2CDEA 2VR7A 3OLDA 5EUOA 3UBGA 3H3PL 3O6FB 3SCMD 4LLDA 4AQ8C 2VSMB 5KSBB 3CVHL 4HPOL 1F0LA 1UADC 2B0SH 1BX2A 2W88A 3QXDA 2WLNA 3RYMA 1F4YL 4M03A 1YLBB 1ZLDA 2ZUWA 5KBMA 5FB8B 3BVXA 4CSSA 2WNWA 4MJIA 4Q7DA 5D6DA 3V4VA 4LSTL 4CVUA 1EAQA 2ZUXA 4P0DA 5LAXB 1OCRB 1Q9KA 3L3IA 3SJVE 2IPKA 4UU9A 1RIVL 5F6IB 3L1FA 3T8XA 3HG3A 3CC5B 5F1IB 4NNXB 5EU6A 2G2NA 3IE4A 4IEFB 3BUYB 3IDUA 3S36X 2RQ8A 2C9AA 2Z7ZA 3FQRA 4KKQA 5M7QA 4PRPB 2R2HA 2YQ2A 3NA9L 5AKVA 4LP4A 1IIIA 1NCJA 1C12B 4GO9A 2E7HA 3COOA 2WXLA 4Z95H 2XXMB 2J8UF 3N0PB 3ORJA 4P23C 1R3LB 2BZDA 4X99B 4P5SA 4EUPG 3ARFA 1U8CB 1ZLUK 2IH1B 3A21A 3MOBH 4M56A 4AQEA 3LB6C 4W6WB 5IB3A 4PTTB 5E2VH 3T65A 3MRDB 4XOEA 1JPEA 3FB8A 1A6WH 3UP1A 4NC1C 2R29A 3BP6B 3KJ4C 4P2AA 1NCWL 2IH3B 4UNIA 3TNNB 3WEAA 2QEJA 3KPRE 4FQXC 1CD1A 1D5IL 4UT7H 1U3ZA 3N1GC 4TUKL 2CLRA 4KV5E 4IRSA 1ID2A 1MKFA 4HC1H 3QXUA 4UTBH 2AI0H 1NBVL 4UIMB 2VISA 2C3HA 1WS7A 2JXMA 4TN9A 2XY2A 4XPTL 1USQA 2BSRB 2FIRT 3UBXA 4HXBL 5I1EL 4OFPA 1KCUL 4PJGB 2RAMA 1I1RA 2BIPA 5C0CA 1NGPH 4YHZL 1Z0NA 2VLJD 4KPHH 4L4TE 1FORH 4IDJL 4JY6B 3T0BA 1L9OA 5IW3A 3LRLA 1ZLVH 4HJ1A 1A6TB 3WSQH 1KJVB 3WIAA 1ACCA 2XZCH 4QLWA 3GEFA 2ZX7A 4KUZH 3WY4A 1HHHA 4O4YH 2I7SA 5EOTA 3BSZH 2ZJSL 4RMSA 4LLQA 5IW6A 4AYSA 3I3EA 2NY4C 3SJVB 1CGYA 2HX9A 3KHQA 1Z3GH 1A1OA 1C5CH 3IEAA 1ZT7A 4X80L 6PCYA 1S9WA 1FAKT 4HCRL 3NEEA 1JPST 4JJHA 5HHNA 3FQTA 5C0AE 4MMXA 1KG0A 1QYGL 4XB3A 4TNWF 3P9LA 5F9JA 3T0XA 3D9AL 5I0XA 4PJIA 1D6VH 4A6YL 5KBNC 1WCBA 2YEZA 3QJFA 4RAUA 4E36A 4GP5B 1HEZA 2HTKC 2XV2A 3KS0H 2UZIH 1PCXA 1QP1A 3K2IA 4D7BA 1HESA 1QFUL 1JP5A 5IFAL 5FPIA 5PCYA 4M1DH 4RAHA 2VR3A 1U0QA 1A02N 3KL0A 4LSUH 4YXKL 1LDPL 5EOCH 1H3XA 4XMTA 4AYDC 3OC5A 1N6UA 4Y19E 4BKLB 1WC7B 1SXZA 3HZ3A 3ILEA 3QIBD 5JQ6H 5L8LB 4NO3B 2G2PA 3DO7B 5F0PB 5I8CA 3MUUA 1K3ZA 4PJ9B 4TQEH 3VFVA 2HP4A 4JRYE 3KPRB 3MBED 3RVWC 2ZX6A 1ZHBA 4IMLA 1CIDA 1IEHA 3UABA 1KULA 2OMUB 4WAFA 3WFHB 3HNTH 2ATKA 5BOZG 4F8NA 2YA0A 1QLEB 5T3XD 5LBVA 3Q2VA 3UGUA 2AJZA 5C70A 5GHWH 1KIRA 3PGCB 3HOGA 4XCFL 1X7SA 1E4WL 2HKHH 1LJMA 1SJHB 1T1WA 1JWMB 2Z31D 3DHUA 4AIZA 3AREA 4NJAL 2XACC 3FFOA 4ZS7H 1CBJA 3FO0L 5A43C 2BSSA 4NQDB 2J71A 4XP6L 1FSKB 4Y1TA 4LSQL 3F7KA 1YY9D 4FA6A 5L2KA 2DWYA 3AUVA 4NUMA 5EO0B 1AANA 3WEBA 3EZJB 2EYTA 3IVKA 1IGIL 5I1GL 1VJSA 4MMXC 3NCEB 3P77B 1Z5LB 5DJ0A 2IGFH 4RIRA 1H3TA 1KC5L 4DGYL 5HYJE 1MVUB 4OZFH 1CFSB 1R1CA 3VXSA 3AQDA 1UCBL 3U7WH 3WY3A 2WPGA 5FECB 3UZVA 2GITA 2W65A 4IBTA 4FJZA 4P07A 4ODHH 2YXVA 5JIIA 3CFCH 2Q9OA 1JGVL 3FF7A 4PS4H 4DPRA 3G6DL 4M6OL 4HLZG 4MB3A 5D4HA 1QI4A 3SDDC 2O5XH 1PW3A 4U3SB 1WCQA 5FHAH 3I6LE 3X13A 3UH8A 4GKZB 1ZA6A 4KC3B 2GCYB 1V8HA 1ORSA 5E1IA 1L7TL 1CZ8H 1ZSHA 2HVKA 1QSFD 1RZPA 4Z18A 1YZZA 3V5KB 1JTPA 4B9KC 3GI9H 5DRWA 3GMMA 3OKKB 4LSSL 3IGUA 1CR9H 2F7OA 4JFHD 5CEXA 4JRYB 2ZX9A 3J07A 3QJHB 2QR0A 2AS5M 3TBBA 1AZRA 2DH2A 5DTFA 3MROB 1P9MA 1UOVA 2CPCA 2DYRB 3PLYA 2F5AH 2IANE 4K94C 1CL7I 1UH2A 5I5JA 3RWHA 3IMWA 2FJSA 4S1SH 4Q9BA 3WFBH 1KWGA 2FSEA 5E8EB 5IEHA 2VRAA 3D18B 1BG9A 4PWEA 4WTQA 1T04B 3AREC 1ZGLP 3V6ZA 3VO0A 3H4FA 4XMLL 4L18A 2PO6B 4UV4H 2WBJA 3QO0B 2PP9A 4M4PA 5M94B 3EGSA 5JOFA 5AL8A 2CHWA 2V6HA 4B0MB 4CVZA 3PGDB 4P23B 4ZUSB 1BQHB 1F4XH 2G5RA 4IIQA 3VFUA 1EHXA 3TYFA 1NIDA 1KSRA 4PUBH 3ASOB 5K59E 3BT2H 3LXUX 1SJXA 1KEML 1YEHL 1IEBA 1RHFA 4OT1H 1KEGH 2YAHA 3CFUA 5IW1A 2H2SC 2B08A 1DVFA 3ETBF 4KMTL 5HYIA 2V2XB 4FQXB 2AXGA 3GBNH 2OCJA 2IGTA 3QA3A 5T3ZH 3NMEA 5FGBA 1PNCA 2BSEA 4N26A 3BAJA 3FB7B 1OM3H 5D5MF 1HKLH 1HNFA 4KKBC 4XP4L 3FPXA 1A4KA 1RURH 4QYOA 1DTUA 2QFRA 2ITDA 5DUJA 5C0RH 4FXGB 4ZNEA 2FECI 3EGXA 3W3BA 3NIGF 2YAFA 3NZUA 2AJUH 1HILB 4ZW7A 1GL4B 1KGCE 3IXTB 4TTDC 2QPFA 2ESVA 2PCPA 3IDNA 4TUUA 4DETA 4B9ZA 3IK2A 3L2LA 4ANUA 1XGTA 4XVOA 4WEEA 1CO1A 4ODSL 1AS8A 1WZAA 1I7ZB 1P7QB 4LRIA 1N4XL 1P9MC 2CO7B 1MH5B 1AHWA 5HJ3B 4KRPC 2YFOA 2IEPA 2NNAA 5HVGB 2Z1PA 4XX1E 4BZ1H 4A7VA 5IHBA 1NAKH 1ED3B 1M9SA 3PL6D 1QLEL 1EVTC 2BOBA 4D8PB 1ZVYA 4UZGA 2IANB 2E9IA 4URTB 3F84A 1TT6A 3HZVA 1QSEA 3SQBB 3MXVH 5IVXF 4QOKD 3PXJA 5EF1A 2JELH 3D2UB 5BPPA 3GJEB 4IIQC 4ES9A 3CPUA 1BA9A 1IQWH 1YMMA 3S88L 1KUMA 1YNKH 2VLKA 4XWGL 3MV11 3MRBA 1PAMA 4RFOL 1N2RB 5BMFH 2PPFA 2XN9E 2IFFL 3WEMA 4GPVA 5ETUA 2C9QA 2JLPA 3F01A 2X28A 1AMXA 1I7RA 3RTQD 1U8JB 1UOLA 1EO5A 1RP9A 5ALCL 5FGBC 2BO0A 2GSGB 2X4OA 5G4MA 4N6RB 5HHMD 5JHDE 4HAFA 3L1EA 4XCNA 2ZOOA 4NOBA 1JYWA 1P7KA 1R34A 3NDZE 4JG1H 1IJ9A 5KJRH 3CFJA 2ICCA 3WDIA 1NICA 2FJHA 2JF1A 3W81A 32C2B 4H1LG 1C7SA 5FO9A 3KHOA 6TAAA 3T3MF 4P3CH 5BUAA 3S35H 3CDYA 1CK0H 3CFDA 1HQRB 2A0LD 2BH0A 2QADD 1E7VA 3MLWH 4ZO8A 5ESVB 4POUB 3GSVA 3QAZC 1FZMB 2EO9A 4GIAA 4LRIC 2PTTB 3CK0H 3IN0A 4XTRD 4Y16D 3NVQA 3CSPA 2DWXA 4X7EC 4XVJH 1QFWL 2YPKB 3QIWD 3ETSA 1OLZA 5T1DH 3V0DA 3NFPB 2VW6A 3TONA 1D5MA 2Z8RA 3FH8A 5E7BA 2CE6A 3X12A 5F2FA 4DKAA 1AXIB 4IBZA 2JK5A 3VMOA 3SY0A 5FDYA 3GJFB 4F91B 2APSA 2FNWA 5DEFA 4TL4A 4UNUA 3VGFA 3ZKSD 3G04A 5B3JE 5H2BB 5JW4Q 2QKIB 3OHXC 4UOZA 2VDMH 3LPFA 4MDJA 3P9LB 3VW3H 3NAAH 3AUWB 3QQ9C 4PV9B 1PG7H 3HG1E 1DQDH 1OALA 4HXAL 5DEGB 4AIXA 5AAWA 5IF0A 4YE4H 4MQ7B 2WNKA 5JDJA 2ZSWA 3TBCA 1DLHA 3TU6A 2X6BA 3G9VA 5JXED 3Q2NA 5IFJB 3MX0A 4JKMA 3KYKL 3ZTJH 2WGNB 2UZYB 5DRXA 4XXCA 3BAKA 1RXLA 2QV2A 2OULB 5ES4B 2M1KA 4JHBA 4WNQA 3AWEA 3L5HA 2XN9B 1I8UA 4MJ4A 3SDDB 4OZIF 2JCCB 4DVBB 4ZXBD 4EZLA 3MRCA 4TNVF 2VDRL 5ANME 3QYMA 2ENSA 4OIBA 2WVSA 3BSHA 1YPZF 4BZ2H 5KVFH 1KPRA 2KUTA 2CRIA 2PXYD 1WV7T 3K3QA 2IPUG 1ZS2A 2W60B 2XU9A 3BH8A 1Y07A 3EYUL 4XXDA 1GSMA 1RKRA 5DMIH 3RX9A 4EI5D 4HUKB 2PR4L 5L7XH 4G72B 1FLRL 1L6PA 1IBDA 2I5YH 3DRTA 3KXFD 5JIQA 3IWUA 1T5XA 2WBWB 5HBBA 1TKWA 1CBVH 3ASWA 4HVBA 4J23A 3MBXL 5ESAB 4X5XB 1RULH 2FGZA 3QDMD 4G6KL 2OAAA 4HJTA 3JUYA 2X05A 1AGFB 4N2CA 1XB3A 2FSDA 2IFGA 3C5ZA 3DHJA 2YD2A 1C7TA 3RIFK 1G7JB 2FT8A 4A7SA 4BFOA 2NYKA 2GAZA 1FLTX 5LWYL 1C16B 4X8GA 5I66A 4RX4D 4R7DB 2IOMA 4LPYA 4RISL 1FO0A 5KOVC 4HCFA 5CGYC 2DWEB 4JM4H 3CG8A 5HDRA 4N0RA 1A4AA 3PAUA 3KE0A 5E0FA 3JT2A 2G30A 3BUPA 3L5JA 2NY7H 2WLLA 1QMUA 1QR1A 2BHUA 5D96C 2PYEA 4KK6C 4F27A 2OZ4A 5IB5A 1TZGH 2A38A 5IROA 1RZKC 3IFLH 3TVMA 5DRZA 2OMXB 4Q97A 1H8OA 1RZ7L 2D2OA 4Y2DC 3RWJB 3S3BB 3U1SH 2IMMA 1RVFH 5A16A 2QJDA 4Z3HA 2QQLH 1MWAH 3LS4H 3CZKA 4JZJB 1ECYA 1M4KA 4PD4K 4PR5B 3ARBD 3TTSA 3VGGA 4YC2C 3OAYH 3QFJB 5E5UB 5H37H 2Y5TB 3HS8A 5IQ7H 2DWSA 4WUUD 2X42A 1W0YT 4FQLH 1UD8A 1HZHH 2VO5A 2VERN 5EWIH 5GGTL 4U1NA 1WWBX 2QQKH 4TPRL 1CGSL 2BCMA 3AACA 4GMTH 3AGVA 1QFPA 3TBWB 4QRPB 1KCRH 2HFTA 2VNCA 2WB7A 4PGDA 4GJTB 3ZE0F 5B8CC 1EVUA 1INQB 2CK2A 2J44A 3DO4A 3UIYA 4C54A 5T3ZE 1EZUA 1GIGH 3BZDA 4Y8AA 1ETZA 3T0VA 3I6SA 3QWRD 4UUJA 3QORD 2YD1A 5SWSA 3DVGA 3ARDD 1M3IA 3WENA 4X7TA 4PJ5D 3HS9A 4QHUA 3FT3A 4GAJL 5F89A 1Y0LB 4NENA 5ICZA 1FVDB 5FF6A 2EXTA 2R51A 3N44F 3ZXAC 3U36A 3C5ZC 5EEZA 1TYRA 3BGFC 5E2VL 4P4KB 4R9HA 3M07A 3TYFB 2W9EH 1CT8A 2APWA 2FQFA 2LVEA 1JPSH 2A6JA 4I2XE 3NN8A 3WNOA 3BGAA 5TQ0L 3VXMA 1CD8A 4IU2B 4I0PA 3R18A 1SBSH 4JQIH 4Q8BA 4XH2A 4R8WL 2Q86B 1QW9A 4UT7L 4YVUA 2NNRA 2R1WB 1S7RB 5DDHB 4G7VH 4JPVL 1NC2B 3OG6B 4HQQL 4YN3A 4DKDC 4B5ZA 2ICWJ 5IROC 2HKAA 4G82A 3VGBA 3TVMC 3L9RB 2ZUSA 1R47A 4ABWA 3BJ91 2IAAC 4H0HB 4D3CH 1NCOA 4MA3A 4JFDD 3SOTA 3JV0A 1QI3A 3C75A 4JLRB 5DEZA 4OTXH 3BN9C 4NKDA 4QXGH 1ZLVK 1NGPL 1PCSA 2L4OA 3T77A 1Q9WB 3ZVVA 2YPVL 1DBKH 3U79A 6FABH 2XZCL 1VCAA 2D8KA 3B56A 2R1XB 1IEAB 2WUBL 4L8BA 3A4FA 4KY1H 5J6GA 4O4YL 3FU8A 2RHEA 5DC4B 1IVLA 2H2PC 4P5MA 2A4ZA 2J6EH 1J87A 2X9WA 1EEZB 3WTVA 3MRQA 1VEMA 1Z3GL 4K4KA 4IJ3B 1KXVA 3UJTH 4XR8C 3NOIA 4G5ZH 4IKKA 2WZPD 1CLYL 1A1MA 1LLAA 1MFNA 4UMGA 2XZQL 4WFED 3BDBA 4OAWB 4QHNB 1A7NH 1OK8A 4YZFF 3IWVA 4KNUA 5FV1L 2FBJL 4V33A 2Z35B 4UYQA 4XMWA 4UQ2B 5CBAB 3OHXB 5FM5M 4RAVB 3FOMA 3VA2C 1MFBL 2UZIL 3EYOB 1JNLH 1G1OA 3MLTB 3IS1X 3QVAA 3OXSB 5H4ZA 1DQVA 3LY6A 3IJHA 1PVHA 1U8KA 2YD0A 4D9RE 3FZUC 5BS0E 3K6SB 4APXA 4PP1D 4LSUL 3B7RL 2B1AH 4YLBA 5EOCL 2QKSA 4I87A 5IBUB 4N5ED 4P2QD 1CXFA 1TYJA 3ZO9A 4M8UA 1ZANH 2BFGA 4P59H 3BHBB 4CSTA 3CXFA 2WXRA 5IY5B 4I2XB 2Q2EB 4U1JA 2HMID 2F7PA 4TQEL 3CV5A 3MNZB 4NOFA 3CAFA 1E67A 1OD7A 1U8PA 5C2UB 1K8DA 4L4JA 3OJ2C 1LL1A 1G1KA 4F8OA 4OBSA 5FM4A 1S9VA 3I3DA 5T5NF 2NZ9C 2P5EE 3SE4C 1A5FH 3GBEA 1I7UA 2QFPA 4HYTB 5GHWL 4XI5C 1BQKA 3PJLA 4I5BB 5IBTL 3WJLA 4UM8B 1MW3A 3FUIA 3P0GB 5D7SH 2QMJA 5EDSA 3TJHC 2V5YA 4U6YA 5IMMB 3HC3L 2ADJB 1WGVA 4OCYH 2GSIA 4G9DA 1AD0B 4H88H 1M7DB 3ATAA 2VXSH 2GTWB 4QTFA 4B9IA 3EH4B 5FUZH 3HI6L 4L8DB 3O3DA 4GSXA 5F93C 5E51A 1KXVC 1LEIB 2OK0L 1MWOA 2OMBA 2A9NH 3U0TB 2BY3A 2DKUA 1XF3B 1BAWA 4OLUH 3D39D 4F7EA 1G9HA 1Q90A 3DOSB 2LHAA 4XVSL 1KLUA 1O7SA 4NQCA 2IGFL 4PJEA 4G6AD 4B9YA 5CCKH 1NBZA 5FYLE 1T0NB 4OLVH 5KVFE 1CLCA 5D2LE 4Z8FL 2AXJA 3AGWA 4Z0BH 1E5AA 1FP5A 4B3VA 2VN4A 4R7NB 3FT9A 4ODHL 1MPAH 1WZKA 2GHWB 3CDZB 4QXVA 3CFCL 5D96B 3TIEB 5I1AA 1ZT1A 2FEDC 1YUHB 1NANI 4JMXA 1NAMH 4PS4L 2JQMA 3F7YA 3LKPB 4RGND 2FHFA 4UNVA 4D94A 5IOPA 3SQOH 2BZ7A 4Y2DB 3HUJA 3H4HA 2OJZH 4HIEB 3OGCA 3PWPE 3FCSA 1CZ8L 1XH1A 4YC2B 5LGHH 3AQXA 3BZEA 1BQ5A 5CINH 4LDEB 2EDBA 1AKPA 4CJ0A 1MI5D 1MCBA 5E8PA 1ZV2A 5SWZA 3RWIB 3LYRA 3DECA 4D0DB 2CGYA 3FU0A 3IRZA 1TJMA 3SDCD 1J88A 1OAQH 3F7QA 4W9FC 4Z3FA 2F5AL 4Z78A 2GC4C 5B8CB 2P5EB 2PTVA 4OM1L 4UOQA 3MV8A 2VXTH 4KXBA 4JM2D 4WV1B 2BSTB 3D4CA 4LSVH 3VE0A 3PQYE 1L3NA 3RVVC 3G5YA 4GUPB 4LEOA 4FYTA 5F3HA 1ZHKA 2XVKA 3EOAA 3MV7B 2YFNA 1H3VA 2EXWC 3B8YA 2C9VA 1DSWA 2IV9A 5IIEA 1HNGA 2NNCA 1QVOB 3K1KC 3HNSL 3LRMA 4B9FA 3NZ8A 1KBVA 5J5EA 3MFGB 3VI3F 3X17A 1U2HA 3ARPA 2XWTA 5HGBA 4XNMB 4KTDH 4BH8B 3GXPA 4PJ8C 2FBRA 5BZDA 5KS9A 3BGFB 3BT2L 1OGSA 3X3FH 4Z7OE 1KPVB 4NNPH 3QT2A 3NCXA 4OT1L 4ZK8A 3ZE2E 3Q44A 4N90D 3WTTA 2QSCH 3SCMA 1UZGA 2JIXD 3GHPA 1P4LB 1MNNA 1INEL 1JD9A 5JHAA 1ZSDA 1RD6A 3NESA 1TETH 4QT5B 2DJ4A 3G6JE 4L1LA 3EXJA 3DJSA 4F2MA 5HDQL 2HKFL 4XMPL 2G75B 3DIFB 4YK4B 3MCKA 3KYAA 5C0RL 4B9GA 1Z9SB 3ROLA 1E5YA 3V52H 5K9QI 1JZ4A 3MUZ1 2WGXA 3ZKMD 5C0JB 5JZ7D 4PWKA 4HHAB 1HDMA 2WXKA 4N0YL 2XWXA 4RMBA 4A2EA 2RFXB 3GLZA 2WTRB 1IGJA 2N0MA 2GEEA 3DSFL 4CADB 3M45A 2N01B 3TN0D 1O9ZA 1HXYA 1SYVB 4AENA 1HFUA 3O3BB 1JGEB 2XRAH 1E4XI 3B2UD 4XNUL 4M7ZC 2FX7H 5SV4A 3S5LA 3TWCH 2Z0UA 3FUKA 3WU1A 4H44C 4K3EL 3WV0A 4HS6B 1E50A 2L7UA 1DJHA 1LEKA 4WHCA 1DJYA 4WFFE 5DI8A 4PJFF 4MD0A 1NSNL 2OPCA 4L8SB 5HPOA 4X6DE 3IKKA 3CCHB 4DCQA 4Z7VA 2X4TA 5SWSB 3DX4A 3ARUA 3H2QA 1BZ7B 1A3RH 1KN4H 5FGSA 4NPJA 1MDAA 5FUOH 1K4CB 4Y2NA 3X14B 2CBQA 3CMGA 3DX6B 2J5LC 1VFMA 1D7DA 1YNKL 1ZVHA 2K6WA 4GAYB 3RVUD 1E4XH 1MWAB 3ULSB 5HGHB 1FN4B 3VFWB 1JFQL 1JL8A 3A4EA 1PZ5B 2MJWA 5LNGA 1O75A 3H3BC 4POZD 4EZJA 3MRMA 3SCMC 1GJUA 2M26A 3BT0A 3FFDB 4Z7OB 3ZE2B 1BZQK 4GH7B 4Z7QF 3BWUF 3HI1A 1BG1A 5I8EB 1KV7A 3O8XB 1ZWIB 3DXAA 4DAGL 3N06B 3G6JB 4JG1L 1PFOA 3B7UX 3NFNA 4ZQKA 4YSAA 1WEJL 2KLRA 1LO5A 1FFTB 2ZX8A 3FQUB 2V8LA 4HIHB 4B50A 2X70A 4UQBA 3UC0H 3KPSA 4P3CL 3S35L 2ENQA 1CK0L 4LLVA 5L8JB 2NW3B 5H35B 1SY6L 1NUDA 3FOLB 3MLWL 5TPWL 1PS3A 4QRSA 1V3KA 2EYSB 3PWJA 3IMRA 4A7QA 1KV3A 5AFAA 3GM8A 5GRYA 4MNHA 1IKFH 4J39A 4P04A 1FFPB 1N5AA 4XVJL 5IZ7A 3FQNB 1PJWA 4K7FA 4RSVA 3IU4L 5K39B 5T1DL 1ZD6A 3VXTA 3ZHNA 4AYMC 5C6PB 1JMZA 3DURB 4J6IA 3OR6B 3SYQA 1N59B 2VMFA 1XCTB 4OZ4A 5HDOA 5DA0B 3U6XS 2XKSA 1M71A 1B0GA 3STLB 3NP4A 4LGPB 2QELA 4PY7B 4Y8DC 2OQJA 1H15B 4TXVB 3NAAL 4X6DB 1PG7L 3JUZA 2K1MA 4G2AA 4JJ5B 2YPLB 4RRPM 3QIBA 5FUCC 2NUPB 2HH0L 3I75A 4Y5VB 1KIQA 4PJHA 3WNLA 2GBTA 3O6LL 1KGXA 4MA8H 3RWFB 1XTLA 4LKXA 4ODUB 3QP3A 3TV8A 4GXFA 1FCCA 3MBEA 4ZUTA 1OARL 4OV5A 3GSQB 4TUOA 3TO2A 1R0AH 2HRLA 3GMQB 5T1KB 1RZ8A 3WS3B 2X4PA 1T6BX 3Q8BA 4G59C 3BH9A 3IDGA 1URIA 4QXTA 1RIUH 2ZT9C 2F15A 3EJUA 2COQA 4M1GL 4X5QA 3A47A 3ZT6A 4Z7WB 2FO8A 4DN3H 3G5XB 4LMQE 4DGWC 2CM6A 4ZX3A 2CA4A 2J72A 4PLKD 5B39B 3QG7H 5FYLL 5HVHB 2A1WH 5KVFL 3IKCB 4XAWL 2YAEA 1SHWA 5DLLA 1YYCA 3RJQB 4ANWA 4NN5B 4ZQTA 1CDBA 5I1CH 4AE0A 4PI2A 2JTDA 1Q94A 2GKIA 2IADB 4UIKH 4WWKA 4Y2OB 4OF7A 1TZIA 4LL1A 3CJJA 4XZUB 3KGRA 3UTTB 3O3EB 4AVHA 1Z5YD 1IBZA 2I9TB 1NMCB 5E2UL 3Q9PA 3ZHFA 4DSYA 1RULL 1NC4B 4Z3JA 1I8MB 1VLXA 1HX0A 1CCZA 1J10A 1AD9A 2XTJD 2YSSB 5EU3B 4BYHA 2GB2A 5I5RA 4PJ8B 3BIKB 1YN7B 4AOFA 1FG2B 2BP0A 3S48A 3C2SA 1N0XL 3ZUCA 2GG1A 3GSXA 1UFGA 4OQTA 5A2IH 1HOCA 2VM4A 2XZZA 4G71B 1DBAH 1Z9OA 3D06A 3EBIA 4S0HA 3CSYA 3QIBC 2CMRL 2FHCA 2NY7L 3NIDB 1U3YA 2BNUB 1VADB 2YRZA 4N1HB 1JCVA 5C07B 3CXHJ 3NJIA 4BE5A 4HBCH 4ORGB 4LK4A 3O4LD 4WHYH 3IFLL 3MBEC 5AW9B 1AQDA 1QSFA 3OAYK 1XAUA 4IHOB 5FO2A 1NDMA 4DP8X 4X6BA 1E9OB 1MWAL 4M1CC 2LAAA 2MPVA 4JDZA 1RL1A 1ZEAL 1KB9J 2YQBA 1QW8A 1PLBA 4FQLL 1S5HA 4G43A 3UJIH 1MAJA 2ZSVB 1KENL 3CVDA 2B14A 2WXGA 3M1BB 5I18H 5ABZA 2DQCH 1BAFL 2WOYA 4ZMZA 2Z31C 2X89D 3BVVA 3FTWA 4GMTL 4P48A 3RZCD 4JQVA 1KCRL 4CU8A 4B97A 4CVWA 4BHUA 1X9UA 3P9MA 2R56L 1TQUA 1BECA 2A5UA 3A6BH 2O61A 1YY9C 1BD2B 5HHXH 1G7LB 1B4LA 3VI4E 2LTQB 3VRLF 4M9PA 1YEIL 4OVUA 4HJJL 4YHKL 2VLRD 3N3EA 3GINA 4WI3A 1CLOH 2ZXAA 5TDNB 3P54A 3KPQB 2R7EB 5GXBB 1QKZH 4LHUB 2ZOWA 3EFOB 3O2DH 1T7XA 2YOAA 4ZMVA 4F5CE 2DIJA 3D85B 5C0DB 4AYBA 3JTTA 1A7PH 3DX8B 3EO0A 4PCSA 4UT9A 1A8JH 3UZQB 4LEXH 1G7MB 5ILTH 4QRRA 4HWNA 4G7VL 1GW6A 1YEDB 5J1AA 5LHDA 4EI6B 5I73C 3QJXA 4JFEB 3CZJA 3X1NA 1FFNB 1M05B 3QH3A 2A9BA 2DJSA 1ORQA 1A7RH 2OR8A 5GRJH 1Q0YH 2W38A 4EKXA 2Y7LA 4J3OH 5AVXB 2H6PB 4OTXL 1Y7VA 1SUHA 2E6QA 1LTXA 2EDKA 3D09A 3EYFB 5CO1A 2IBGA 3OKDA 3QIUA 5IV2A 5KSVB 1HHJA 1TQVA 1XF4A 4KKRA 1UVQA 3QG6A 1I9JL 1WBZA 3UG4A 1JYNA 5LGKA 4CGUB 3PL6A 4BFFA 3GUTA 1YAIA 3ISYA 1H0DB 1YEJL 3E3QC 2FJFB 4NFCA 4NM8H 3S8WA 3GMPB 2I69A 3WY1A 3QUKB 2J6EL 4GQ9H 1FJ1A 3E8VA 3FTXA 5DC0A 1E4HA 3FT4B 4IOIB 3RTLA 2MCAA 3UJTL 2QGBA 1GJWA 4QOKA 5F7DA 1KYOK 4G5ZL 3T2LA 2VJ8A 1HE8A 5TH2A 3SYPA 4W68A 1XGYH 2BWIA 1HI6A 1A7NL 2JB5H 3OKEB 3WLBA 3NSDA 4YSUA 3QEUB 2V7HB 4LLYA 3DROB 4GAFB 1X6NA 3NPZB 5TTRA 1JVKA 1KOAA 1DVSA 4P3DA 3TCXA 5C7XH 4ATTA 3AWFA 1UUNA 1JNLL 1U95B 5EBMB 5K9QG 1G94A 3RTQA 4BJLA 3QRGH 2OA9A 2AQPA 5ITFB 1U2YA 4G3YH 3K6IA 2BY2A 4U1LA 4G8AC 1DJXA 2B1AL 3V0EA 4DK6A 5JQIB 2XYBA 2UX6A 4TOYH 1ZOXA 2YKLL 3MI6A 2A74A 3VACA 2QT6A 1LD9A 2OKMA 2YMTA 3KBPA 3PHAA 3TBTB 5DEJA 4BELD 3B5TA 3A24A 4JFFA 2B7DT 1MQKH 2OR9H 1JG9A 3L9YA 4NRYA 4NI3A 2X4RB 5EOQH 4WWPA 2XV3A 2VLJB 3J7HA 1ML0A 1W9XA 2DJUA 3KL3A 3CGTA 1RJZA 1NCAL 4H0IA 1A6PA 1F8TH 2WBXA 3C8KA 4PJBF 1BF5A 1VZIA 4OLZL 3FRUA 3KPMA 5BZZA 5AZ2L 3CZGA 5D2NA 4LNRB 4HPHA 1T22B 1DN0A 3DUUA 3KG5A 1KN2L 4NQED 2J1YA 4Y16A 5D7SL 2A6DA 2I32A 4F3FA 1WTLA 3QIWA 1R3JA 3WDHA 1Z1WA 3BKYH 3PL6C 4OCYL 4WWID 5B38A 1RUKH 4H88L 3VXNA 2DEYX 4E9TA 1TSRA 1ZIAA 1HHKA 4NO0D 2NW2A 4QDGA 4HKJB 3NIFE 3QZWG 4LCYA 2OW7A 5BO0D 5JYMA 2JKNA 4IOFD 4JHWH 2VW7A 4M4RB 1F4WH 1T0PB 3FONA 4XHQA 4WTXA 3JTBA 5JXEA 1VGKB 2GHZA 4AQAA 2XPGB 3INUH 4KDTC 5AVSB 5DUMH 4HG4K 1FVEB 1H3GA 7FABL 1EHLH 1IGCH 4DESA 4Q6IB 4WKZA 5K9JH 2AJVH 3BZFB 4Z0BL 3IDJB 5J3HD 3VFNB 4J8RA 3RTQC 1WHPA 4MZIA 4G5AA 4ZXBA 4Q2ZB 5KSUA 2X4UA 3HCVB 3G6AA 1I53A 1HHIB 3MNWA 5AKRA 1FNGB 5D7LB 5DD0L 4D9QE 3SQOL 2VMEA 2A74C 1ANUA 2NSQA 1BJ1H 2OJZL 4UZSA 1P1ZA 5KBLA 1ZV9A 3D12B 2F5BH 3FSAA 4N2MA 5LGHL 3HMXH 1ES0A 3D0VB 3N41F 1RI8A 5CINL 2GIXA 1G9MH 5HJGA 2OYLA 2A0LC 3TP4A 1EERB 4UANA 1JCKA 4F9PC 4EN3D 2WMPB 1R3HA 1HN1A 3BJLA 3QJUB 1QRNA 4Z0XA 2Z31B 3DJZA 4H7VA 3KXFA 3FQWB 5CIPB 3IJSB 2CO1A 3VXOA 3IJ8A 5D2NC 3GO1H 1FC1A 1T1YB 3LKNB 4XTRC 4GG6E 4AKQA 2DIEA 2C1PB 4ODXA 3WTWA 4IBWA 3QIWC 3BUQA 4IBUA 1IZJA 2KZ1B 5J12C 5C0BD 3L4UA 2H32B 3AFLA 4O2EB 3FU7A 1X4YA 1AO7D 3VTMA 4HUUB 3D3VA 4OM0H 4QRFA 2O93L 1D5ZB 4LAQH 3WBDA 3FO9B 3Q2LA 3UJJL 1GVIA 1OKEA 4H8HA 5IHZB 2DBLL 1PZDA 4LASH 2CR0A 2N7SA 1S7WA 4KI5F 4KTDL 4P8QA 3VX0A 5GGVY 2ZNXA 3X3FL 3OKNB 4B6ZA 4NNPL 1JGLH 3OAUH 1NLBL 2W9DH 1AIFA 1UG9A 4U1IB 4UILH 2QSCL 3POHA 1NJ9A 2AGJH 2BRRH 1GCFA 3OAZH 3RA7H 1JDAA 1TETL 2E7LA 4KK8D 4KVCH 4FEMA 3AU1B 4ZXBC 4IK7A 5ISZE 1YAZA 3GSOA 2ZYSA 3BLKA 1KTDA 3EAKA 4XPAH 1AC0A 1LNUB 2E9GA 4BUGA 4Q0XH 1S9XB 3VRJB 4RFEA 4KXZH 1HCFX 1PNDA 1XGPA 4G42A 4F7CB 1QOKA 3EYQD 5J1SC 5I1DB 3OKMB 3CDFA 4Z7NF 4HWUA 2PXYC 1D3CA 3GDBA 3HR5A 4CVXB 4XCEA 2VYRE 1I9IL 4LCWE 4I77H 3C60D 1RZQA 4MQXD 4QNPF 4R83A 1E5BA 2VSDA 2XRAL 4IKNA 5F6HJ 3MJ7B 3EYVA 4EI5C 3DPBA 2B16A 3QWRA 2BDNH 3O11A 4HGWB 2ID5A 4MASA 3IJEA 1FGVL 1CFNA 2H26A 1XF5B 3QEQE 4HETA 4QHLA 5LXVA 1W16A 3SE3A 5DMKA 2P46B 3QPXL 2J8UA 3SBRA 1ITBB 3PWLA 4FD0A 3AB0C 2OI9B 3W57A 5IBLD 3C08L 3DHPA 4TVPD 1PX8A 3NABH 2WSDA 4GG6B 1BEXA 1OGAD 4P9HC 4KZEH 2B8OT 4A2GA 1KN4L 4MZ3A 4MAUL 1KNOA 4RZKA 3I2CH 5JQHC 2FR4A 5FUOL 2C1OB 1M56B 3BD5A 2JKRM 2D3LA 2F7QA 1KYDA 1T1XB 2ZYRA 2WY3B 1FNEB 4RQQA 5DQ9A 3RNQB 1KMGA 4GQRA 1T5KA 5E8DH 1JPFA 2OMWB 3C09C 4YGAB 3RAJH 5CR1A 4FQCL 1DUZB 4PRIA 2ZAIA 1WFUA 3KGUA 1VKXA 1JXFA 2ZNWA 2X3BA 2ITCB 2PPEA 2JB6B 1RSYA 1PZCA 4C47A 3U4AA 1PG7W 2H4EA 1K5WA 1BIIB 1SDDB 4MQTB 3I6GB 1OXYA 2E7LC 3AQYA 4NC1E 1G7IA 1GMEA 5KUKA 2F0CA 3BEVA 3QUMA 3ARBC 4ELDA 3Q5YA 2P80A 4PCKA 4OQ1A 2GJ6B 1LWRA 3LKSB 5C0ND 3D0LA 1P4BH 4ANKA 1IGMH 2N59A 3EDKA 1ZLEA 3KVPA 4FQQB 1VFAA 5ISZB 4W9HC 1ND0A 4G8GD 3AQZA 3RI5K 1HL8A 1HE7A 3UC0L 3BWAA 3WY2A 4I4WB 3L3GA 1HXKA 4LPCA 2NY2D 4K7PH 3TNMB 1FIGH 1TO4A 2WUCH 3H8NA 1BQUA 2AKRB 3QQ3A 4Q4IA 5DUBB 4LAJH 4DOHE 4DZ8B 3K71B 1KDJA 2GW5A 1N3NB 1TQTA 3R8BB 5ADPL 3WMPA 2WZPA 5T3XL 3QORC 4LCWB 1EFXB 1K6QH 3ZRSA 1QBBA 3ARDC 4MJIE 1XR8A 5DVLA 4X5LA 3UPRA 1Y6KR 4DPBX 3ISRA 1ZE3C 1CXHA 1E5ZA 3L48A 1NMAH 1M6OA 2ZXCA 4QYAA 4NLAA 4YNYB 1BQHG 1F11A 4XO5A 2Y3NA 1JXDA 1V7MH 3QEQB 2E0PA 1ID5I 4G11A 5L4MA 1PAZA 1K72A 1PDKB 3EJQA 1BAGA 4LIQL 5GS1C 5KSBF 3NSFA 2X9ZA 5J1TC 2XQYA 2OR7A 3Q8CA 3DDGA 4ZODA 3BE1H 3ZDXE 3BUIA 4OF0A 5KN5A 4ZUWA 4P2QA 4AEHL 5AUMA 4ZZFA 1E2ZA 2Y6SD 3N85L 4FFYH 2IDTA 4BFGA 1UKTA 2EYRA 4K3GA 1RUPH 5MI0C 1IARB 4ZPVA 5IB2B 3VH8B 4EDXA 4J8QA 5DR5H 2A74B 4HJEA 2VDQH 4G8FB 5EB9A 4E2OA 1WAAA 1GGYA 2YA2A 3GUFA 3UMNA 4PI0A 1OE3A 4Y4FB 1IBGL 4YOKA 4DGVH 4R4FH 5DLML 5CLTA 1DZBA 4FYRA 1FVCB 4HS8L 1EXUA 5HD8D 5MENA 1QTPA 3FB5B 1JPGB 3LH2H 3QG7L 1IJNA 1BVNP 3GMLA 43C9B 2A1WL 4BDVB 2PW1B 3W11D 4GQPH 2GK0A 4U31A 2R4RH 3QR0A 5EBWB 3QULB 1T80A 3BVNB 4BKTC 1V7NH 3VD9A 5L9DH 5DK2B 4UIKL 4XMVA 3IMTA 2MIZA 4P5TA 1EUTA 1KLGB 2E75C 4FKKA 5C0CE 4LBAA 5J12B 1U8HB 4JK0D 1IAOB 3D39A 3MMEB 5BQ7B 2FRGP 4MCZA 2AXHA 5C09D 3VD1A 1FYTD 3FO2B 5D8JH 2Q1EA 3BAEH 4WEUD 5TJWK 5F9OL 3B3IA 2PABA 3QAQA 5HYFA 5E03A 5GSRA 4KFMA 3EH2A 2IBBA 4DP6X 5IKCB 4WWOA 2OXHA 3OMNB 3VYOA 1LEGB 3DOIA 1K4DA 4PJGF 4PP1C 3WJJA 1XT5A 3FRPB 1DBAL 3NJJA 5GGVL 3F58H 4N5EC 2HFFA 3UEQA 3BZ5A 2EIDA 3PDGA 4X7DC 4YSQA 1KB5A 1P5UA 2FD6H 3ZDXB 5EIIB 3CSBA 1GYVA 2HMIC 1ZLSH 3TF4A 4WDIA 3IGAA 4PRDB 5FR3A 3OKYA 4ZTOL 5F3FA 4KAQH 2EE0A 4I89A 3OJVC 4MAZA 3AC0A 4JO8A 1V3MA 4KK5D 4KJPD 1QLFB 2COVD 1MI5A 4EIZC 3TX4A 1VACB 3EOBA 4DN4L 2PP7A 3U0WH 4JO2L 1XH3B 3H9ZA 3U7YL 2DQ6A 4N87A 5DCCA 4ETQB 1KIPA 4U0RC 2PXYB 2WYIA 1Y6MR 4JRXD 3GLEA 1W6LA 1L6ZA 3CHSA 3EBHA 5I18L 3L3JA 4ZG1A 2DQCL 1D5XA 1HQ4B 1YNLH 1KJ2B 4QD2E 4MAYD 4BWUA 2XVBA 4EI5B 1IC1A 3EDFA 2F1AA 2V9QA 2LLNA 1WK0A 3CFKA 3A6BL 4NFDA 4ISVB 2J73A 1AE6H 5GS0H 4GMSH 4M6NH 2QSTA 1AG0A 3QDMB 4YHPB 3BPLB 1F4AA 4Z5RB 4NT6B 4U7KA 5D7LD 2F53D 1DHKA 1UXMA 1S7VA 15C8L 1D9KD 3VXPB 3PXHA 3KR3H 2WLMA 2OMTB 2W9LA 2EDMA 4AYID 2FO4B 3EJYD 1CLOL 1QSZA 1W2KT 4G6AC 1WZ1H 2HX8A 2Y7OA 4HUXB 5T1MB 4JG0H 4C83B 3OVUB 2B20A 2JIXA 2Q6WA 3O2DL 3U6RA 4ZFZB 5GRVK 1JNNH 3FSWA 5E6UB 1EO8H 5FA4A 1XSIA 2YUXA 4OFVA 4OCXH 5E9DD 1J05B 4WI0A 5GRVL 5MEPB 5L6YH 5C3LD 2N1KA 5B1KA 3WJJC 1J5HA 1MAML 4LOEA 4W9IC 4RGNC 2G9KA 2UX7A 4JO1L 3VXQB 2EILB 3LKRA 3P40A 1AQHA 1P5UC 3ATEA 5F7LB 2CKBA 4GKOA 4MJ5B 2AK4D 3CZLA 1ZHNB 3ARBB 3VXSE 4RGMC 2BVOA 2CD0A 5AOZA 3H7BB 3H9SE 4LVNB 4MKMA 3KCPA 1A7RL 3KPPA 4WUUB 3TN0A 4RZCA 2W0LA 4NQSB 4OJDH 1XX9C 3O2WH 4F9LA 2VLLB 3IPEA 1A1NB 4LLWA 3RDTD 3SDCC 2UYLB 4FXKC 2HUHA 2HSIA 4MJ6A 5DYOB 1UGKA 4EUPA 3BP5A 3PV6A 3WIIH 4JM2C 1TLKA 2Z8SA 2M8XA 3VFPA 3L45A 3H0TA 1BVKA 1RUAH 4JW3A 5DSCA 1HTYA 2XT1B 1HIML 1VEPA 4OI7A 1XHHA 3QORB 4GQ9L 4CILA 4KHTH 3ARDB 5HDBB 4PJ5B 3U4KA 5IVXA 2VN6A 3FSVA 5DUPH 4ACPA 1TMCB 1JK8A 2ZG3A 4Z7UB 5B21A 1X5XA 2YS4A 4JPSA 4AITA 3DX2A 2JB5L 1BFVH 1YHPA 2CIKB 2BIOA 2DL9A 4N9GB 5LBSA 3GNML 5GS1B 1J0ZA 1X9LA 2WWKO 3VRIA 2ZWZA 2HG5B 5MERA 3TEWA 5C7XL 1IM9D 2WBKA 4QR7A 4ZTPH 5CFHA 2B15A 4GSUA 4D0BA 1S7SA 5D70L 5E9AA 4AM0Q 2D3NA 4PJ7B 4TLKA 1N7MH 3U46A 1WICA 3QWOB 4HFUL 1SEQH 4P3WA 3O3AB 3P1VA 1MJJA 1OL0A 2IQAB 3A67H 3CPLA 2X1QA 2NXYD 1LGVA 5EZPA 1VFBA 2FZ3A 5EU7E 3QCTL 1MQKL 5FYKD 3ZKMC 5JZ7C 1CG9A 4X9FA 1UD3A 1PSKL 4JFDB 3TFKD 2NYZA 3PHOB 5JW4M 5EOQL 4K7PY 3BXNB 3QPQD 2K4AA 4FP8L 3TN0C 1Q9OA 2JFCA 4OD2B 3RWCA 4HOMA 1DCLA 3OKLA 1F8TL 1NCDH 2X1XR 2OJEB 5D1XE 4F9LC 5JYLA 3B2UC 3MRIA 4QJ3B 2R69H 3H9SB 2YC1B 2WQUA 4NP9A 2AJSH 1KLFA 4ZNEE 4MBRA 3AT9A 5CZVL 1AKJD 3WO4B 4Q9RH 1A25A 3BKYL 4U1HA 2W8CA 2E8ZA 4XGZA 2Z91A 5GRWA 3P3UA 3KWTA 4PB9L 2E9WA 2ESVE 3OPUA 3L2NA 2AFNA 4A2FA 3AXLA 4M8RA 3EHBB 2EIBA 4IRZA 2VDNH 3FQ2A 1KJ2L 1E27A 4F33B 1TMQA 1F4WL 2JJVA 3TA3D 5D4QA 5DMYA 3RVUC 5TGBA 5EUOF 5JIDA 4Q89A 4ZO6A 3INUL 5JMOC 2F19H 2HT4D 4ELME 3CNKA 4WW2C 4W9LC 5JPNA 4POZC 1CFQA 4X7SH 4FHJA 4HHGA 5SX5H 3O41B 1TVBA 3IDIA 5K9JL 2AJVL 3C5JB 3VVWA 3WKNA 4YPGA 4OZIA 2AHIA 1YJDC 4PWHA 2VZ1A 2ED7A 5KYYB 1II4E 2J57A 2QSQA 5DJCB 4MWFA 1G7PA 2C3VA 5IG7B 2GY7B 3T6WA 2VABB 3IS0X 1YMME 1X3DA 2APXA 2BM3A 3CHOA 2ICWB 2VLKE 3VXUD 1K5NA 5K9OA 3EFFA 4X5WB 4YBLC 4V1DA 1JV5A 2F5BL 3C12A 1YPZA 3DC0A 4NP4H 3HMXL 2EE9A 1IAII 3DBXB 2MOVA 4WEBL 4AVJA 1G9ML 3ZX1A 4U0RB 3T0AA 2OSLA 1FHNA 5AZUA 5F7BA 2DQIH 4YO0A 4L8CA 3LKQA 4DF9A 2XPZA 1W0VB 4PTUA 4RDBA 5GRUL 2HTLD 1TITA 1XTMA 4NNYB 3GO1L 1TZ8A 5D1XB 2ALAA 2XG4A 4IMKC 4M5TA 1MCPH 4MNGE 4Z76A 4XVTH 1DQMH 3DRQB 4H5SA 3BISA 1MHHB 4IBLT 3RG1C 3FMGH 2ZKWA 4MS8D 3PWNA 2F61A 3QR1A 1NFDE 1QEWA 1TZHB 3I6KB 3F7RA 4HJIA 3UGEA 3T4YB 4Y7MA 4XZ4A 1IC4L 1UZ8B 4HFWA 2QTVA 2DN7A 3FK3A 4LASL 1IAIH 1J86A 4GUCA 4KI5D 4O00A 2WLYA 4O58H 2WLKA 4OCMC 3QARA 2CK0H 4IM8A 1MFMA 1B2WL 3DBSA 3LZNA 4K5PA 3OAZK 1XIWA 5TF1H 4UILL 5IBUG 2OMVA 4N0FA 1Z3RA 5ADOH 1KBKA 2AGJL 2BRRL 3D87B 1IQDA 2P8MB 2R2EA 1X5JA 2MTPA 2X2UA 3VFTA 4E0RB 1QHPA 4RGNB 4YX2H 2FYYA 3LPPA 4E5XB 4ELMB 5KYUB 3GZQA 2CM5A 3MREA 4N8UA 1AGCB 4GBXD 4XPAL 1ZK5A 4FTVE 2X4SB 2HRPH 3KVDD 4HF5L 3PU7A 3BVUA 2HT3D 4AC2A 4TM9A 3IMVA 4IU3A 1EH9A 3QW9A 4PLKC 4ELKB 2X0UA 3W9DA 4KROB 1GR7A 1G0XA 3SY6A 3RZCA 2Z92B 1E9PA 4JY5H 4WGKA 5TFSH 5A7BA 4ZUVB 3SDCB 4I77L 1MEXH 1XGUB 4XNDA 2OMYB 1XV8A 3E80A 4FXKB 3V6FA 3BUDA 3QC6X 8FABA 4JM2B 3WHE1 4ODTL 4OY9A 1MREH 3VGAC 4WQOA 4BFIB 2IWGA 2WLZA 2SODB 1E9QB 5E1HB 4DPAX 5BVJB 4PJIF 1D2OA 4L0PB 5C0EA 3QJQB 2ZCHH 3N04A 4NKOA 3TH3T 3HN3A 1ZGLA 1F1GA 2V5TA 2VLRA 1JGUH 5DFTA 2HJLB 5J13C 1I1YA 3MACH 3NPSB 3G7TA 4K5OA 2CCVA 3BCDA 4Z3IA 5HGAA 3DGGB 2IAMB 2XTJC 1U93A 3PE9A 3ZYZA 1TTUA 2YMXH 4WLCA 4AQ1A 2H0JA 4IBYA 4MNGB 5IHWA 4F20A 2UZXB 1LE5B 3TL5A 3KYOB 3HZYB 4N3UA 3B3BA 1YY8B 1T21A 1WJ3A 2DYPB 2JCCF 4XVUD 3V5HB 1WS8A 1MCJA 3GI8H 5INDA 4XCYB 4M43H 1JZHA 3S3CB 4FLOA 4NBXB 3RAJL 3VFSB 3CIQA 3D30A 5E8NA 3QHZL 1FZJB 1S3KH 2KPWA 4U7MA 2DLHA 5I8KH 1QHOA 1C1EH 1LWHA 2EZ0D 3LN4B 3HFMH 5HI4D 3AG1B 3QFGA 3WS6A 1CFMA 1JK9A 4HX1A 3MC0A 5EA0H 4HKBA 5CBEB 4PAZA 3EDEA 3OMZA 3U9PH 1F56A 3STZB 3QJTB 2Q3AA 3V5DB 1UT9A 2R0WH 3ABLB 3RFRA 3BKJL 4PJAE 1GZHC 4N8CL 2J1XA 4EJ1C 3LSOB 3P30H