3NSCA

C500s mutant of cueo bound to cu(ii)
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
493
structure length
470
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHEDTGMMLGFTVLQGDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase cueO
publication title Crystal structures of multicopper oxidase CueO bound to copper(I) and silver(I): functional role of a methionine-rich sequence.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 134
structure length 470
sequence length 493
ec nomenclature
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nscA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nscA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nscA03
2DYRB 2P80A 1ET8A 2GC7C 4E9SA 4GP8B 4UF7C 1PLCA 1KDJA 2MRYA 2QPDB 1PMYA 4DP0X 5AFAA 3DTUB 1GYCA 3EH3B 2IDSA 4A66A 2FQGA 1AOZA 1PF3A 2A3TA 2PPDA 4DP4X 1NDTA 2WO2B 2YQBA 3UAAA 4YSUA 1N68A 1V10A 2XV0A 4CSZA 2XV3A 4E9QA 1SFDA 2UXTA 4QLWA 1KBVA 1PAZA 4K9JA 1IKOP 4WTQA 4YSCA 4G72B 1NIFA 1AZRA 2BP8A 2FT6A 2R7EB 1JVOA 1AZCA 3U25A 1NWPA 2XV2A 4A2DA 4F7KA 3N2JA 2XU9A 2PCFA 1ILSA 1W6WA 2OV0A 3AG1B 1PCSA 3FPXA 4M4RB 1SHXA 1N70A 2VN3A 5B7MA 1A8ZA 2BO0A 2FT7A 1KGYE 1PLAA 3IE9A 3FSWA 4YSOA 5B3SB 3OMAB 2HX7A 1OCZB 1AS7A 4UAHA 5I6KA 1KBWA 1ET5A 1ASOA 1NIBA 4Q8BA 2TSBA 4A2FA 2IWKA 1T5KA 1ETJA 2CUAA 2Y1AA 3CVDA 3ZDWA 3NJHA 3NJLA 3FYIB 1QNIA 4PAZA 1KYAA 3WNIA 3X1NA 4GXFA 3T6WA 1AS8A 2AFNA 3FSVA 2PPEA 4AKOA 1E5ZA 4GYBA 2XUWA 1AS6A 1OE2A 2OJ1A 2GHZA 4KO9A 2EIKB 2BW4A 4HAKA 1OE1A 1OCRB 3WI9A 4E9XA 1AG6A 5I6NA 2IH9A 4L0PB 2IDUA 1KDIA 5I6LA 3FSAA 4QKTA 5AKRA 3QPKA 3WNJA 1JOIA 3JTBA 2FQFA 1HAUA 3FQYA 5B7FA 1ZIAA 2FQDA 1WA1X 3PLYA 4ZK8A 4BK5C 3IBOA 1FA4A 1JXFA 1ASQA 2AZAA 2I7SA 3S3CB 2VW6A 1AR1B 2AVFA 3X1BA 9PCYA 3PAUA 3DIVA 3OMNB 1GY2A 2PPFA 1GY1A 1V54B 3T6VA 3TA4D 4KNTA 1BEXA 4F2FA 2FTAA 1JZFA 1HAWA 3UABA 7PCYA 1XB3A 1ZDQA 4E9TA 2DWSA 1JXDA 1NIAA 1A4CA 1OOWA 3X1EA 2J55A 3AG3B 4AI7A 1UATA 2VSMB 1FWXA 3AW5A 2XWZA 3QJRB 3QJVB 1OE3A 2HXAA 2I85A 3AZUA 2PP9A 3T6XA 3UGEA 2ZWNA 4HALA 3NJGA 2JXMA 1IBYA 1BQKA 3ABLB 4KO7A 1ZIBA 6PCYA 1ZPUA 2PPCA 4A67A 4BWWA 1PZCA 2BP8B 1WAEA 1ASPA 5B1KA 4A2HA 2P80D 2YAOA 3C75A 1SF3A 4A2GA 1JZGA 3V9CA 3KW8A 1ZV2A 2X87A 1RZQA 3PAVA 4G70B 4TXVB 2WSDA 3OQRA 3CVCA 2FNWA 1NPJA 4DP5X 1EHKB 2ZXWB 3ZX1A 2CJ3A 3JT2A 2AANA 4HIPA 1AQ8A 2HRHA 2HRGA 1URIA 3NJMA 1JZEA 1I53A 5I6MA 2BZCA 3FPYA 4KO6A 3X1GA 5I5JA 5TK4A 4HCGA 4KNSA 1BYOA 2HZHA 2YARA 1A3ZA 1IUZA 2I7OA 3FT0A 4HHGA 1CYXA 2B3IA 3NSYA 3SQRA 5LDUA 1M57B 5B1JA 2N0MA 3TBCA 1TEGA 3S8GB 3MBWB 2IDQA 1JZJA 2QT6A 3HEIB 3FU7A 2BWDA 3G5WA 2GIMA 2OCCB 1EZLA 1RZPA 5B7EA 1SJMA 2J5WA 3QJUB 1NZRA 1NWOA 4BWTA 4BDVB 2PCYA 1GW0A 1L9SA 2GI0A 1KCWA 1JVLA 2QPEB 3RYMA 1E67A 4E9RA 1WS7A 5FC9A 1BXAA 2VSKB 3L45A 3ABGA 3H56A 1KV7A 3OD3A 3TU6A 2BWIA 4DP8X 4KNUA 1CUOA 1A4BA 4AKPA 5TK2A 4NERA 4WKXA 1OV8A 3H4HA 1L9OA 2GB2A 1AACA 2PP8A 2VW7A 2W8CA 1MG3C 4NAJA 3OM3B 5D4JA 2QDWA 3NP3A 3OMIB 7PAZA 1AIZA 1J9QA 4DPCX 4P5RA 4FA7B 3AY2A 3FS9A 3CDZA 2H5UA 3TBBA 3NYKA 2IH8A 4E9YA 5PAZA 4KO5A 3IN0A 1NINA 1L9RA 5B1AB 1NIDA 3WG7B 2X88A 4Q89A 4DP9X 3NJKA 2J56A 1SF5A 4BDVA 2W88A 2FT8A 1PLBA 1JERA 2EIJB 1IC0A 1AG0A 3TASA 4W1TA 3PCYA 4YSQA 1F56A 4FAAB 4G7SB 5F7BA 3D12B 5F7AA 2VM4A 3GXUB 4JHUA 1GR7A 1AZNA 1GSKA 3FYEB 2DYSB 2UX7A 1PY0A 2PP7A 1PZAA 3NSFA 4X4KA 1J9TA 2BP0B 1W6LA 3BVDB 1J5CA 4W9ZA 1MG2C 1XMEB 1JXGA 1OCOB 3NJJA 3X2QB 1CYWA 3FU9A 4G7RB 5I28A 1JZIA 1BXVA 5D4IA 4AX3A 2CCWA 1M56B 1QLEB 3KW7A 2JKWA 1X9UA 1GS7A 1NIEA 4G71B 3IEAA 3FU7B 2YXVA 3EF4A 3WKPA 4YVNA 1AZUA 1HFUA 3SBQA 2CAKA 3BQVA 1GS8A 2FWLB 4BWUA 1TEFA 4HCFA 2BZ7A 4RH4A 4A68A 2XLLA 1VLXA 4YSTA 1L9PA 4JHVA 1IBZA 1SDDA 1L9QA 1MDAA 4YSAA 3SBPA 2BP0A 2IWFA 4KOBA 3NSDA 3HB3B 3H4FA 3GDCA 3NJNA 4JKNA 1MZYA 2WO3B 1L9TA 1XB8A 4YSRA 2IWEA 2H3XC 2XXGA 1BAWA 3PPSA 3ZIYA 2YAMA 1SHWA 4GY4A 5EHFA 1BQ5A 5I5MA 4DPAX 3N55A 3FU8A 2E86A 2IAAC 2GBAA 3ABKB 3ASNB 3UADA 2CALA 2YAFA 3QJTB 4YSSA 2VW4A 2RACA 2J57A 3WIAA 3T6ZA 4YSPA 5ANHA 3CDZB 3MX0B 1SNRA 5D4HA 1OF0A 3IN2A 3NJFA 5I5IA 2CBPA 2XYBA 1AANA 4HZ1A 2UXGA 1A65A 2MTAA 4HHWA 2EIMB 4UANA 5E9NA 2DY2A 2QDVA 2TSAA 3CZUB 3NT0A 2YXWA 4G7QB 1DZ0A 2Y69B 4EF3A 2EINB 5A7EA 1BXUA 3FSZA 5B1BB 2UXFA 3QQXA 2JFCA 4P5SA 3NSCA 4YVUA 4A2EA 1FFTB 1WA0X 4E9WA 2FQEA 2IDTA 1J5DA 5I6PA 1J9SA 1AAJA 2YAEA 5AZUA 1TU2A 2UX6A 5IY5B 4E9VA 2H47C 2ZONA 4DP2X 3AG2B 3CG8A 3ERXA 1R1CA 2GC4C 3S3BB 1J9RA 2XVBA 4M3HA 2YAPA 4KOCA 1RCYA 4AKQA 3NP4A 1ILUA 3QJQB 2Q5BA 1SFHA 3FQ1A 4DP1X 6PAZA 3ABMB 1BYPA 2AZUA 1AZBA 1QHQA 2R7EA 1WA2X 3T9WA 1NICA 3SBRA 4GP5B 1NTDA 1ADWA 2B08A 4N4YB 3UACA 1KCBA 1JZHA 4BXSV 2UXVA 4YSEA 1V55B 5PCYA 1NPNA 1ZDSA 2XXFA 3EH5B 1SDDB 3ZBMA 1MZZA 2YAHA 3CVBA 8PAZA 2FJSA 2HLEB 2PLTA 1M9WA 1DYZA 1E65A 3DKHA 3T71A 2DV6A 2LLNA 1W8EA 4DP6X 5I6OA 1CC3A 1OCCB 2VM3A 4NB7A 4YSDA 1B3IA 4GP4B 1GS6X 1WS8A 3NJIA 1YLBB 3V9EA 3AG4B 2YAQA 5B1JC 1PZBA 1E30A 2BHFA 5I26A 4AZUA 2HX8A 3S3DB 1XB6A 2EILB 3S8FB 4ENZA 3EH4B 4F2EA 4PCYA 3PAZA 4DPBX 4HCIA 2HX9A 2PPAA 3ASOB 2NRDA 1ET7A 1CURA 3FQ2A 4BXVA 1PNCA 2Q9OA 3GYRA 1PNDA 2DWTA 4YL4A 1RKRA 2IDFA 1ID2A 1BQRA 1E5YA 2ZOOA 3WKQA 4CSPA 2XX0A 2XX1A 1A4AA 3EHBB 3PXLA 3UAEA 1X9RA 4MFHA 2GSMB 4N8UA 4DP7X 2BW5A 3QJSB 1TKWA 3X1FA 2VMJA
chains in the Genus database with same CATH superfamily
3P73B 4PCTA 3NBNA 4LSDA 1TMQA 4K3JL 3COOA 1FVCA 2Y36H 3WENA 3UJIH 4YHOL 1KBBA 1CWVA 2F53B 2NY6D 5F6IB 1ZXKA 4A38A 3FHAA 4GMSL 4CL7A 4XTRD 4PVNA 1DN0A 3BUPA 2NY1D 1TU2B 3TBTA 4CKQA 3MCLH 2E9GA 1P5UA 4OZHB 4B97A 1OXYA 2ICWB 2WNWA 2XDHA 1KLUB 3DV4A 1CDJA 3D4CA 3MLWL 1NGYA 4LOVA 4A66A 2QHLA 3O8XC 4KTDL 2F54A 3L7FA 2FQGA 1OAXL 3K6SA 5A1AA 4Y2OA 4AIZB 3QT2A 5I8CB 3GLEA 1SY6A 3MOAH 1I1YB 3JWDC 1SFDA 1UGKA 2OMZA 3K8LA 5HHPB 4PYHA 2AERT 1QUNA 4PRBB 1KLGA 1D5ZA 5L0QB 1JWMB 1R5VB 2YMOA 2LU7A 5TDNB 4N8VB 3FMGL 1U6AL 4ZX4A 3RVXD 4KZEL 3FT9A 4QTIL 5F6HJ 2VRAA 5GPRA 3WTXA 2ERJC 3ZT6A 1HZHL 5JW4R 2DJSA 2X89A 5DWPA 4YXKH 1INQA 3SDXA 4NO0A 2GUOB 1FH5H 4XZ4A 3D3VD 4PRHA 1HESA 1OCZB 4DW2H 2A7BA 3V0GA 4HS8L 2DQEL 4Y1SA 4LNVA 3R0NA 4X7CC 1T5KA 1ETJA 1UZ6F 2VABA 3ZQ9A 4B9ZA 1RLBA 5KBDA 4QRQB 3C5ZC 4Y5VA 5INDA 1NCCL 4L3FA 4EPSA 4LSUH 5C0BA 1T04B 3K8KA 4HAGA 1ZHNB 1GGBH 1TVDA 4TUUA 3VFGH 1UKQA 4G8GB 3GMRB 4MNQA 3L4UA 4GXFA 4FQJL 1E5ZA 1XHHA 2WTRB 5E23A 1L6PA 1LWHA 4PTUB 2H2SD 5GGQL 1J1OL 2PABA 2HJLA 1M42A 4XNUH 2PR4L 5AKTA 5CLWA 2Y9RT 1YN6B 3PL6B 2R2HB 3FQWA 2XTLA 2HT2D 2R39A 3JTTA 4I77L 4UDTA 1KDIA 5J9PA 3CFMA 4GT7A 4YNYA 3BSZH 4GSXA 2QSVA 2BSCA 4JHWH 4JRYA 2EYSA 1U41A 5EN3A 5C0EB 5JPMA 3T0EE 1IAMA 3KZ8A 35C8H 5AKVA 5E7BA 1JI1A 3OMZA 3JTSA 3S34H 1IEAA 1EJOL 3T4AC 1N19A 4PJEB 1QPPA 1MI5E 4PJ8D 4NBZB 5GGTH 5HDWA 1TKWB 4G1MA 1GY1A 4X4MA 3UYOD 3QC5X 1UM6H 2P46B 3MROA 1LO4L 1JZFA 4YHLL 3WFEL 1QSZA 1UURA 2QPFA 2MCPL 3Q1EA 2B5IC 5JA9A 1YSOA 4NLAA 3HC4H 1DQDL 3VWKA 2BHUA 3QZOA 3ZKMD 2WXJA 2JKRM 3MO1A 1NAML 2VSMB 4X7SH 2WCPA 3VD9A 4KUZH 2A6DB 1OE3A 3E2HB 1ZT4B 3MRPB 5E9AA 4ZMLA 4R4FH 3QH3A 3DOIA 1K8IB 1C9SA 4YDZA 1SDAB 3ARRA 5GGVH 3PDOA 4RISL 1E8WA 4UQ2A 3R19A 1KOAA 3JYCA 1S78C 5C07E 1CDHA 1FZKA 3MRDB 1CFSB 4ZNEE 3BP4B 5E2UH 3IAQA 2D2CC 1WGVA 4UV7L 4WW1B 5DGQA 5KSBA 4LLDA 4OM1H 4O00A 3VFVB 3WFBH 1N8ZB 3BDYL 3BZ4B 3EFOB 4WJG3 4GUOA 3RWFB 4JO2L 5BZWA 2AVGA 2DI8A 5JIIA 1CB4A 4DGIH 2FB4H 2OQJB 4P2OD 1F90H 1G4MA 1MAKA 1Z9NA 3DJSA 3LN5B 4R3SB 2DLTA 3S9DB 2HRGA 3IJYB 1M3IA 4TOYL 4J3WA 1KYDA 2GJPA 3HE7A 4JRLA 2WZ5A 2ICEB 2ESVB 4QHNA 4XPHL 5K9OB 2X4PA 3WFDH 3AU1A 3VB9A 1G1CA 3LDBB 1EFXD 4GUCA 4UT9A 4OJYA 4Z3IA 1F6FB 1I1FB 1QSEE 4EZLA 3ZTNH 1DUZA 4HHGA 5IGXH 2HFFA 1KN4H 4U2ZA 4TQEL 3NSYA 1RSFA 3JWDH 4OT1L 2NX5D 3MBEC 4ZZKA 5D1XB 4RRPG 5I1DB 2WZ6A 2WWOA 5L2KB 4NWUH 3FZUD 3SJVE 3RU8H 3QPQC 5J6GB 1OB0A 1S9YB 3FFCE 1W72B 2Q6WB 2G30A 1YQ2A 4U3SA 3UTTD 4GAFB 1MW2A 4IHBA 1UCTA 1NZRA 4K7FA 5CILH 3Q06A 2I25N 2Q7AA 2F7RA 4XCYB 3FO2A 5CS7A 1W0WA 1GW0A 1L9SA 2NXYB 3C2SA 4E9RA 2ED8A 1J0IA 1IGFL 4WJ5B 1CFTB 1KCSH 2EH8H 2YPLA 5FGSA 4EUPB 4UOW0 1KV7A 3GSOB 4DERA 4Y5YA 2BC4B 3LXUX 3DOHA 4YLCA 2PR9A 1OB1A 2V6HA 3KPLB 1L9OA 2HKAA 5BOPA 4RX4A 1P69B 5ESVA 2XWDA 4NBXB 1S7VA 5IBTH 1CDUA 3TA3A 4ZPTA 1B6DA 5A2CA 3S37X 4OCSH 5MEQB 3B9KC 2ZNWA 5K1VA 2XT1B 3B5TA 4ZQKA 1KT2A 3TBBA 3F58H 4AXWB 1HJBC 3ARDA 4O2EA 1F97A 1IM3A 5KBPA 3TT3L 5L9DH 4ZW7A 5DZAA 3NABH 5IEHA 1S5HB 4ODXA 4OQTA 2PO6B 3MA9H 4JEGB 4U1KB 4F5CE 3IGFA 1XTMA 3TASA 2JKSA 2VDNH 4ZOEA 3P11L 2IAMB 4JDEB 4AQ8A 2R1WB 4QO1B 3AQYA 2VQTA 4KRPD 3VUAA 1HH9B 4AQAA 3PGCA 1TQBB 4MJ6B 4PV8B 4YHIA 1H15A 2R29L 4RRPM 1MNNA 3P0YH 1PZAA 4TSCH 3CMGA 2DRUA 4XX1E 3N1PC 3O81A 4LL9A 3Q8CA 4H1LG 2ZKWA 4L3EE 5HDLA 1BFVL 4DK6A 1JXGA 2NY0D 5FLVA 1BV8A 1MVUA 4HKXA 1B6UA 3EBGA 3O6KL 1P6FA 1M6UA 5GJTH 3FQUA 5CJXC 5J89A 1J1XH 2OFQA 4OUUB 1E42A 3I9AA 4QRPB 4RQQB 2AI0L 3HE6B 3VD0A 5J6HB 4OCWH 4LSTL 2Z3FA 2P8PB 4H40A 1BD2D 2X44D 1F1DA 2UUDK 2G5BB 5J0BA 3KJ4C 4O4YH 4WW2A 3L7EA 4YVNA 2ZAHA 1HFUA 3GTVA 5CKGA 2CAKA 3BWUF 5DD0H 1AXTL 1DQJB 2DQJH 3T0AA 2XNAB 1M3JA 4AQEB 4FE9A 2W0FB 5CZXC 2BVOA 1D2OA 1XR8A 3VI3F 3QORD 3NSDA 3G6DL 1SUHA 1AGFA 5DT1L 5EIIA 4UTBA 2IQAB 1A3LL 1TTBA 1JGIA 1LGVA 4HGKC 3CD4A 3ULUC 5IWLA 4D9LL 3GMOA 1Q4NX 4DPAX 1SMDA 1PQZB 3CLFL 1J1PH 3BUBA 1G4RA 4M3JA 3ZE0F 2C7UB 2VMEA 4LVEA 3ZQXA 3L95B 4YSPA 3BT2L 3E8UH 4J8RB 1HH6B 4LCWB 3HPLB 3IN2A 2XKSA 5GS1B 3GKWL 3TO4C 1KB5L 4FLSA 5HI5C 1T1XA 2BSED 2CRIA 5JZ7C 1AANA 2BSRA 2A1WH 2EIMB 3IRZA 4NP4L 5DQDL 4EEEA 1T3FB 4I18B 4M02A 1ZOXA 4PI0A 4FL4B 4KRLB 3O2WH 3VFSB 1TJXA 3CFUA 1OO2A 3T04D 1V3KA 1PZDA 5SX5K 2DLFL 3L3KB 5ADPL 2X40A 4EOWL 4PB0L 3CAFA 2CJSA 5IREA 2DMCA 3PYCA 2Q7YB 4IHOA 5F1IB 4GRWE 4JJ5B 1GGTA 1RP8A 1OW0A 2VXQH 2WMPB 4S1RH 1AAJA 4KUCF 3OLGA 4LSQH 3W0WA 1TU2A 1TPXC 4U7MA 2ICWA 2XZAH 5DEGB 4F7PB 3QSKB 4HIQA 25C8L 2YC1B 2GQHA 2E47A 1UTDA 4AKQA 4P4RB 1D6VL 2LAAA 4AIZA 2J8UB 1IBDA 1DDHB 1T2JA 1IGCH 2VZTA 4M8VA 2VSCA 3S37H 5I8CA 3TURA 2AJZB 4M93B 2DWYA 4KX8A 4L23A 3RAJH 1DBJL 1S7RB 2MPAL 2MQGA 4JY5L 4TLSA 3RB5A 5HHPA 3K2UL 3J07A 4JFDD 3V7AE 5B3NA 5F7HA 1AQKL 1WFNA 2DDQL 4I0PA 4MA1B 2VJXA 3GI8L 5D7JB 5JORB 5TDNA 1F2QA 4DKEH 2P5EA 4RMWA 1ZDSA 3IJHA 4K0OA 4U0RB 4Y4KB 5EN2B 1FNEA 1RMFH 1Q9KB 3HZVB 4GSRA 5DSCA 4IBUA 4MKTA 3GBDA 4LIQH 2DM7A 4DPRA 4F3FA 2FJSA 4MJIA 2VN7A 3DJZA 4DEPB 4WUUD 3VXSE 5JHDE 5AALA 5D6CB 1U93B 4JM0A 3U0WL 3RIAF 4ZXBB 2E9JA 4N0RA 4G8FB 4ZT1A 1ANUA 4G9FE 4M7LL 4C58B 3BZFA 4HUUA 3QXTA 2QQLH 3F7LA 4IRSC 4P2QE 4QRQA 2R0KH 1Y6NR 1NC4A 1EGJL 3WO4C 1IAOA 2J72A 4PLJC 5CHNB 3RGHA 1RJZB 2BY0A 4G8GA 4OV6F 2Q2LA 3GMRA 4KV5F 5H35A 3MNZA 1XB6A 3EF7A 2WTRA 4PTUA 3PAZA 2RHEA 4AEIH 4RMRA 1Z5LA 4ABVA 3V4PA 4TNGA 3RBSA 4Z95H 1OM9A 1QLEL 2NRDA 2WV3A 4J4PC 3PL6A 1CTMA 3N1MC 4P5KB 5ES4B 1OP9A 2BS71 3K71B 3QK0A 4ONGH 3DK0A 3NVQA 1E4WH 5CN1A 5CJ5A 1DE4B 5BO1H 1MJJA 5I1IH 4QTHB 5C0EA 4HDIA 2YK1L 3FU3A 4EKJA 4ZMAT 4WWID 5CEZH 1N6VA 1T0NA 1M1SA 2AJVL 2ZXGA 4NZJA 1WZKA 1NCBH 3RIFF 2OZNA 4YHZH 4PJEA 2Q76B 1QBML 2ADIB 4HHAB 4JAMA 5D2LA 1TKWA 1IIIA 5F2FA 1V05A 3QI9D 1GJIA 1T5XB 5JUEH 1DQLH 3E0GA 1W91A 3CFIC 4TLKA 5HD8D 4CVZA 4KGJA 2X6AA 5AFAA 1UOWA 1QLFB 4OIAA 4AG4L 4Y19B 4IDJL 1USQA 4YE0A 3IFPB 2A6DA 3SCMB 1JHTA 1ZT4A 5IFAH 1OAKL 3HS0B 3MRPA 1PX3A 4G1EB 4JZJC 3ZQWA 5C92A 2PPDA 4ZS7L 3ZGHA 1K8IA 4K7PY 4M62H 3W5NA 3EUDA 1N68A 1P7QB 4H0IA 2COQA 1IARB 1U95A 3MRDA 4YSCA 1Y18B 4XPTH 3BP4A 4TTDD 5D70L 4WW1A 2C4FT 2IGFH 3EGSB 2XV2A 2XWEA 1KCRH 1XSIA 4P23A 3KLKA 3KD4A 4XWGL 1NGQL 1YCSA 4WTZA 4AE0A 2ATAA 3AVEA 4KGLA 3LN5A 1N4XL 2FH8A 2WYTA 3FO9A 4R3SA 5HDBF 3IJYA 2HFGH 2WINB 2UVFA 2GY7B 4DAGL 3LRKA 4TUJA 4EIUA 2ICEA 2ESVA 2YWYA 3FTXA 3MUGB 5J11B 5K9OA 4UU9B 4XI5C 1OVZA 5EF1A 2CJUL 3FYIB 3NDZE 3R8QA 2VERN 4A63A 1I1FA 4GKLA 1QABA 4ANKA 1JZ8A 1OSPH 4QUOA 3RJQB 4ONFH 4YJZL 1DVQA 1GGYA 2CUHA 4KJWD 3VB8A 1M2VB 4ZI8A 1E3ZA 2JIXA 3ARQA 1AS6A 2FATL 3VE0B 3PGFL 3N41F 3PWPE 4H25B 4Z7QF 4KTEH 4XO3A 5D1XA 4OY9A 5I1DA 2PWDA 5L2KA 1YEJH 4P9HC 4FNPA 4GS7B 5J6GA 3I74A 1KMGA 3QPKA 1W72A 3G7TA 2Q6WA 5BW7A 2L4OA 5J3HC 5BS0E 4BJLA 3INOA 5B7FA 1KIRA 2R4SL 1CZ8L 1JGVH 3FKUS 5BV7L 4XP9L 2WLZA 4G11A 5EUOA 4W81A 2W91A 3B2DC 5LBVA 1TYEB 1DL7L 5IQ7L 1C1EH 2ZCLH 2DL2A 3DIVA 2ADJB 4PRNB 4DHLA 3QDAA 4WJ5A 1CFTA 2QVTA 5DJ0B 3WNPA 4CA4A 4EUPA 3V8OA 1U8PA 4KNTA 4UT6A 5L88L 2F15A 1O7VA 3UTSE 3IGUA 3CQFA 3MA7B 4XPBL 1R24B 4FA8A 1XB3A 1QUPA 2BC4A 1IAIH 5T5NF 3TP4A 4HOXA 3KPLA 1A4CA 4NC1C 4BFIB 3TIEA 5DJAB 2G4GA 4QWWD 3QFDB 3N43F 4PGZA 4V1DE 4PFEA 1IZJA 3SPVB 4XO4A 3LJ3A 3QJVB 2CQVA 1FG9C 3P3UA 3K80A 2ZWNA 1IT9L 3W81A 1Y07A 2V7HB 3I2CH 2UZIL 5GS2H 4QHKJ 1RZJL 3JV4B 4AXWA 5K1NA 1YECL 3RNQB 4JFHD 2BFVH 1CMOA 4HD5A 5D1ZI 4J3BA 4Y1AE 1S5HA 1GMEA 5I66B 4ADJA 5DUJA 1I8IA 5FWRA 4KPHL 1QNZH 4RRPA 3OZ9L 5GRUL 4JDEA 5CEXB 4PN6A 2PNDA 4HJGB 4NHCL 2VRQA 4AGNA 5KSAA 1QQDB 3HR6A 1SM3H 4NFBA 3TCXA 2XICA 1CE6A 1ZA6A 3ZDYE 4RA0C 4H8UA 1SN2A 3MKKA 2RIKA 3ARFA 1N5AB 4YK4B 3WAKA 4W9CC 4WW2F 3GI9H 5JQHC 2EVFA 2CHDA 2IQ9L 4Z5RA 1N64L 3SDCC 3S3JA 5JA8B 3PHSA 3ASWA 3JWOH 4KUCD 1B0GB 3O6LH 3MJWA 5EWIH 3S35X 2JI2A 5TTRA 1CYXA 2JKXA 3SYQA 2B3IA 4RQQA 3IBEA 3HE6A 4P2RE 4QMEA 3WIFB 5J6HA 3EO9L 1KB5B 3WV0A 1T0OA 2P5PA 1UQSB 3H0TB 2C9AA 4U6HB 2G5BA 2X89D 3MTRA 4HPYL 4DESA 4KROC 4WGVB 4Y89A 4PRHD 1F0LA 1KXTB 3U1SH 5IHBA 4MTMA 2OYMA 3PQYE 5DFVC 5KS9F 2QQKH 1KXVA 2ICCA 2Z4QB 5CSGA 2XNAA 2WUCH 2LABA 3CVHL 1UB6B 3BISA 2H3KA 2ZG2A 4MD5B 5TH2A 5C0BD 3LIZH 2GEQA 1ZHKB 3ABGA 3T0EC 1G6RH 5L7XH 4K94L 3RA7L 4GQZA 4MNQD 4RDQG 1IGIL 2IQAA 5JYLA 3F65A 5KYYA 3HAEB 5EBMB 3AY4C 4WKXA 4HT1L 4HBQA 1YPZA 1P5VA 1DQQB 2C7UA 5K59F 1U2CA 5GZOA 4JRYD 3T2NH 2BNQB 4WNJA 3NJXA 5AVUB 3AITA 4H1LA 4J8RA 1HH6A 2H6PB 1CLZH 1MHPH 3QZLA 3SDAB 3AAZB 4L2LA 1FPTL 4NUGH 1NSNL 3MU3A 1L9RA 1RPQA 1SMAA 3SDDC 4QLRA 4PG2C 1B0RB 4JO4H 1BZEA 5L6YH 4K7PX 4ZSOB 4AEHL 4R4BA 4LSVL 1RZIA 2IVFC 4JRXB 4AJWA 4I18A 3WNOA 4YBLC 4GT0A 1UFGA 1D2PA 3L6FB 1NOLA 3MRNB 4ZTOL 3GHBH 2QSCH 4OZHF 3ILQC 2KI6A 5JLZA 3AXHA 3VFSA 2AAAA 1UM4L 1KJ3L 4FFYA 2XQYK 1YMMA 3WTYA 5CD5D 4DK3A 1UT9A 2XBTA 2DAVA 2FSEA 4KKBC 5L4FA 2L04A 2WP3O 4ODVL 3L3KA 5C08E 5FO8B 1PY0A 1RUAL 5SWSE 2Q7YA 1F13A 3KS0H 5F1IA 3X14B 4P5MB 4BQBA 4QPEA 3VD2A 3E1F1 2HJFB 4LLQA 4M6MH 2YQ3A 4PU2A 5DJ6B 2YPKA 3A5VA 1QTPA 3IMTA 3P2DA 5F7EL 3U4BH 3V55A 1TENA 3F7PC 4XMLL 1CS6A 3VGDA 4D3CL 1KTDB 1PDKB 2YC1A 4PP1D 3EJPA 4AVIA 2XXMB 1C7TA 1DJIA 3WFZA 4B9GA 2DMGA 4BSWB 4P4RA 2ZX5A 4AX3A 1WFUA 2J8UA 3MV7A 1DDHA 4JUTA 3IS0X 2AJZA 1QLEB 5H2BB 3FRUB 3NRFA 4ODUB 3PWUB 4XAKE 4QRUB 1E4XL 1V3MA 4N2DA 6FABL 3P3TA 4IQHA 2RB8A 3HE7D 5JORA 2E7DA 5MHSD 1NCNA 4LHQB 4JRFA 1KWGA 5G4NA 1O6VA 4JPQA 4HOZA 4PJAB 4Y4KA 3DJRA 1L9QA 1Q9KA 3PDGA 1DEEA 4LK4A 2NY5L 2IWFA 4KOBA 4ONOA 4Q7DA 1UB5B 4LVNC 4Y0GA 1MZYA 1L9TA 1GHFH 3T09A 1FBIL 2FEDD 2JJWA 1IQDB 1XO8A 3VQ1C 1MHEA 1P4IH 3NPSB 4ZXBA 1SHWA 5T5FL 4HLZH 1UWEL 1V3JA 2HFEB 5I18L 3BP5B 5IJVB 4NQEB 1NL0L 1OGSA 3ARGB 4TUOB 4JNXA 4XPGH 1YAIA 1DQML 3S5ZA 5CLYA 2YMTA 3VVVA 1LE5B 1GZQB 1RJZA 2X4QA 2K45A 2Y22A 2VW4A 3FOMB 2FO8A 4N8PA 2VLJB 4GW5B 4NKOB 4P5TC 5ANHA 1YHPA 3MX0B 4Y4FC 4HK3N 5CZKA 4Z3EA 3FT2B 3S35H 4EDXA 4OCXL 1FO0H 3PV7A 4QXTA 3D69B 1A1MB 4ADIA 4P5KA 4WCYL 2DM2A 2IANE 3K71A 4UANA 5E9NA 3V6BR 5HYJB 3NA9L 4R8WH 1DE4A 1DLFL 1UC6A 4XVUC 4PWIA 1LO0H 5EUKB 4EF3A 5E95B 1BXUA 4GI8A 1P84K 3FAXA 1G9MC 2Q76A 4RX4D 5D7LA 1PD1A 2ADIA 3TA3D 3KMDA 1XH3B 3DV6B 4FFZH 1FNSL 2ITDA 3UYPA 1Q94B 1XSKA 5CEZD 4F7EB 4FADA 5DMGD 4OLXH 2X0UA 1ZTXL 2AXHA 3ESUF 4F58L 4N2BA 5FYLE 4N87A 1A8JH 1U9KA 3ARDD 2NZ9C 4LRIA 1IM3D 5HXMA 4PJ9A 4XCFH 4Y19A 4JN1L 3EYFB 3UZEC 3IFPA 5E7FA 3MQIA 3P3RA 1UG9A 3HS0A 3ECBB 4G1EA 3WOVA 3C5ZB 4AV4A 3QJHA 4PB9L 1IBBA 3EH1A 5LBSA 3O6MH 2MOQA 2VR9A 1P7QA 3ES6B 2FJUB 1ZSDB 2OTUA 1MLCB 3MRKA 1ZSHA 3V4VL 3IAPA 1R9FA 1Y18A 3CDGB 4FZ8L 5KG9B 2DQCH 2ZXDA 3PHQB 1NKGA 3CZFB 2BRRL 3EGSA 2J25A 4E41B 5BV7B 1I8AA 1XBDA 3MLTB 4L1LA 4K7PH 3K6FA 1U3NA 2OL3L 3CDFA 1RU9L 1G43A 5E2TL 3I6LD 3C8KB 3H42H 4IRJA 1HCFX 3VFOA 1VFOA 4LDLB 1FDLH 2WINA 4I1NB 2LV4A 3BAYA 3IGLA 5JOPE 2IH1A 4QXGH 4FFWD 4MNGB 3ZE1E 1U2YA 2CA3A 5T1KA 5CP3H 1EHLL 1WS8A 3UTZA 2B5IB 8CGTA 2ZXEB 1MFDH 1UT2A 4UCFA 1CFQA 2DQHH 3NJVA 1M2VA 3HC2A 2W1NA 3D08A 4OZFG 1XXFC 5BRZA 4MSWB 4H25A 2O5YH 1A4JB 4K3JH 3MYJB 3SD2A 1BZOA 4MAYC 4PG9B 5E70A 4N0YL 2AEQL 2W95A 4P46A 4GMSH 1OIOA 1UZGA 4FQ2H 1JXJA 3FCSB 5HPMA 2BNRA 3MLWH 1CICB 2CZNA 5BVPL 1YVLA 4H13C 4KTDH 5I0YA 3Q6GL 1OAXH 3CFJA 3OKNB 4NCDA 2DQ6A 4QCIB 4CSPA 3KJ6L 2UZYB 4KK5D 4RAUB 5GRYA 4PGBA 2HT4D 2P5WB 3BLKA 5CCGE 5DJ0A 5BUGA 3T0DA 2VMJA 1Q90A 4A6YL 2R4RL 2XVGA 3UTPE 5IW1B 3MA7A 1AHWB 4Q4IA 5JHAA 1R24A 2QFRA 4M1DL 1AE6L 1G87A 5CR8A 2Z9TA 4BFIA 3L81A 1U6AH 2CBQA 4LGPB 1DVYA 3QFDA 2LOEA 4KZEH 4R7XA 4RGND 1EA9C 3SPVA 1OK8A 5GSVB 4ZJ9A 1HZHH 1U92B 1HQRB 4WSGA 3UBHA 4L1SA 4KI1A 3BH8A 1NDTA 3NZSA 5HHOA 1VEOA 2V7HA 5F7LB 4YGVB 4HS8H 3CFKB 2DQEH 4MS6A 3JV4A 2UXTA 4PJ7E 5E00B 4WTQA 5LNDA 4AW7A 2WUBL 2FL5B 2R7EB 3Q01A 4PJXB 1L7TL 3SO3B 1NCCH 4MXQC 2NY3B 5I66A 1SJVA 1BMWA 4CU8A 3PAYA 3N2JA 4PIBA 4WI8A 2WIMA 5GS2D 3RIAK 4QJ5B 1G9MH 4FQJH 3RJOA 5CEXA 1PCSA 4L4VB 1J1OH 3W0WD 1GGIH 5B7MA 4HJGA 1TVBB 2PR4H 1MRDH 2HX7A 1QQDA 4JVUA 4LHUB 4Z18A 3O0LA 1ASOA 3P9MA 3ZDZB 1VZGA 2QSQA 4MQ7A 1BF5A 4LQFL 1YG9A 3QG7H 2LR4A 1AH1A 4B7IA 4NUMA 3DSNA 4PJHE 2OCJA 3F7QA 1Y7VA 4KAQL 3DX8B 1EJOH 1B0GA 2OBGA 4YC2B 4HK3J 2HVKB 4LCCB 5DC2A 5E94A 2ENQA 1ZTXE 3QS3A 4XVSL 5DD5L 2YFNA 3FB5B 3FUNA 1LO4H 4YHLH 2P5ED 1M7UA 1LJMA 2XKUA 4U6TA 3RWHB 1DVXA 1SEQL 1UQSA 3H0TA 5I6NA 2JELL 1DQDH 2KT6A 4H88L 2NLJB 1TZIB 4AZ8A 1JGLL 4MJID 5AKRA 2XSKA 3U7WL 1KXTA 1NAMH 2I27N 4GIAA 4OB5L 3BPCB 2OR9L 3DO7B 4Z7UE 3AS1A 5DHXB 2WXQA 3MJ9L 3OB0H 4ZAKA 3STBA 5AYUL 4CVXA 2YKLH 2OP4L 2X7LB 1UB6A 3KE0A 4MD5A 43C9B 4G6JH 1NC4D 4DK5A 1ZHKA 5TDOB 4G8GD 1SVBA 4UV7H 5EZOL 3RY6C 3DX0A 1N2RB 1S4IA 1ZDQA 3MHZA 4FI8A 3CXDL 4X5XA 1ZLUK 3HAEA 3BDYH 3IDUA 4OCLC 1O0VA 3X1EA 2FECI 3AG3B 3FAWA 1IRAY 1TZGH 3PL6D 2EDKA 2P7TB 1SJXA 3GMMA 1DQQA 4PJGB 2YWZA 3BWZA 3EW3B 3TJHC 2XWZA 2PW2B 4HUVB 1ZGLB 3OC5A 3RNKB 4YHMH 3M7OA 4W9LC 1XGQB 2PP9A 4ZDHB 1L6ZA 1E3XA 1OGTA 3NJGA 5DJYB 4TOYH 3F7KA 1F02I 2H6PA 2OSLB 2XWXA 2KPWA 3BH9B 1S7TB 3SDAA 2PPCA 4JL2A 1SHSA 4XPHH 2N01B 2H3NB 1B0RA 2XTJD 1EO8L 5F0JB 3CC1A 4HQQH 1UJ3C 4A2GA 4MBRA 4JRXA 4CKVX 3V9CA 4N20A 2A6KB 1RZQA 3MLUH 3RDTB 4TQEH 3RWEB 3CVCA 4OT1H 3TFKD 3HJEA 4N90E 3WO3B 5A2JH 2PW1B 1HOEA 2BRQA 3DDFA 4IEFA 2J8UF 1AQ8A 2HRHA 2ZOLB 5KW9H 3G6JE 1JF6A 4K23H 3SBWC 3AWFA 1AYRA 4WI2A 1UD5A 3X1GA 2YS4A 3UBXG 1BWMA 5TK4A 2HN7B 4HCGA 3TGXA 1WIUA 3ZJAA 4GRWH 1FGNL 1EGJA 3GBML 3U6RA 4PWGA 1KTDA 1PDKA 1IGFH 5DYOB 2FLBT 2FCBA 3IS1X 5ESQB 3HNVL 3PFQA 1NBQA 1E4KC 4P23D 3WU1A 2BK8A 3SQRA 2GIXA 3QR2A 1KGIA 2C3XA 2P49B 4DCQB 2C9VA 1NUGA 4KKCD 5AW0B 5H2BA 1XGPB 3NMEA 5MP6L 2DTMH 4X8JB 2ZKYA 4FCHA 4ODUA 3PWUA 4YE4L 5T3ZE 4I89A 3SPGA 4OGZA 1EAJA 5AQ0A 3K6NA 1HHKB 3FJTA 4DKFL 3D87B 4HEPG 2ESVD 1E0OB 2QLVB 1D5IL 2EYTB 2VZ3A 5F7UA 4PJAA 2PCYA 3KM1A 4LXFA 1LK2B 3LY6A 2QJDA 1IGJB 1KCWA 1SOQA 2C1OA 4X4YB 5B3JF 5A2AA 2OX5B 1UB5A 2J71A 3VD1A 3S97C 3TT3H 2BWIA 3DTDA 1E5UI 1IQDA 3EXJA 4I7ZC 4LCUB 3OAZK 1CUOA 1XL6A 3JWNE 3BW9B 4H8WL 1PZ5B 5D1XD 3A6BL 4HUNB 2HFEA 5L2KD 3BP5A 4C56A 5IJVA 4PJIE 4ZS6D 5EZLB 2IF7A 5JIDA 5K9KB 1U4EA 3C9NB 4RLDA 1LE5A 3F05A 3MI6A 3DX6A 4LLWB 2X05A 2QHRL 1M2OA 1A02N 1HSBA 3MV9A 3M17B 2VLJA 2R29H 4GW5A 1UH4A 1ZHLB 4Z76B 3NSJA 3FT2A 3O8XA 2NXYD 1E9PB 1BQLL 3D69A 5DEFB 4NAMA 1FCCA 5F9JB 4WK0B 3UC0H 3OJDA 1BFVH 3GXPA 1N12A 4M1CC 3B7RL 5LG6A 1SF5A 4FOMA 4R4ND 4IOIB 3O6KH 3HFFA 2EIJB 1FI8C 1H3PL 2W60A 4KXAA 3X3FL 1KPUB 2OL3B 2XA3A 5ABAA 2AI0H 3EYVB 3GSNL 4M3KB 4N26A 2ZYIA 3TN0B 4LSTH 3D12B 2HLAB 3C8DA 4ZO6A 2BOBA 5F97E 3V79C 3DV6A 3BVXA 3VXME 4DWHA 1Q94A 1KJ2A 5FCUL 2D7MA 4CADB 1DBMH 3QEQE 4KVNL 4PVBA 3K7UA 4K8RL 3QAQA 1AXTH 3BVDB 3DHPA 3HG5A 4G6MH 5C0DA 3FONA 3F62A 1JN6A 6TAAA 3QYMA 1XMEB 1FNLA 2GJ6B 1ZV5A 4UBDC 4W6XB 3EYFA 1Y0LB 3FU9A 4G7RB 3MRLB 5K69A 4GRWF 4KK6C 3ECBA 3JVGC 3C5ZA 4QJ3B 4IRSB 5H8DA 5IVZB 3APCA 4UAOC 3GUTA 4PM1A 2F5BL 1NQBA 1A3LH 2FJGB 2O6EA 2IAMD 3MRJA 3CQQA 1BQUA 3TWYA 1MLCA 4YUEH 3F5WB 4WU7B 4NDMA 4PUBL 2RQ8A 3VRJB 4P4KB 3PHQA 4ODWB 4OLVL 3OVUB 3CZFA 1D5BA 3CLFH 3ZKNC 5EZPA 1EHXA 4FQXB 1WSST 2FWLB 4BWUA 2VLLB 4E41A 3FQTB 1X5AA 3MLTA 3ARFD 5K93A 3QUXC 1DZBA 2BVQA 3PXHA 2E7LC 2P24B 3C8KA 5I1EL 1QRNE 4LQ1A 1KB5H 1WGOA 5HGBB 4A6YB 1Z5HA 3ROLB 3IETB 2WO3B 2JCCA 3T4AA 5AKSA 2CSPA 4BK8A 2IOIA 5DQDH 3HE6D 5C09E 1UZ8B 1ZRUA 4JG5A 1C12B 1YMHB 4MNGA 4RMTA 3E8VA 4S0TD 3NCWA 5JXAL 3GBLA 3AXLA 3EJYD 3N55A 2W65B 3BPNB 1NCWL 3UADA 1QHOA 2EADA 1A9BB 2DLFH 3K6OA 5TPWL 4UNUA 3LNDA 2A2QT 5LN4A 4EOWH 1HL9A 2EEFA 3CDZB 3SYAA 1A4JA 4OKVA 5DDHB 5FDWB 3B56A 4NIKB 4PG9A 3WUWG 3L2LA 3QHZH 5DS1A 4X5RA 4FYRA 4GLRI 2DY2A 4NNXB 4Z7VE 1JJUA 3EGDA 3FCSA 2WY3B 3N40F 2ZG1A 1ACXA 1CICA 1DZ0A 3FB8A 4NEHB 2HKHH 2GSIB 4YHKL 3OKNA 3CU7A 3WS6C 4ABWA 1D6VH 1VCBC 2XN1A 2ZXCA 3FSZA 5B1BB 2UXFA 4R0LB 2X4SA 5I0DA 2P5WA 2MPAH 3V6OA 5GZOD 5T1LB 3K2UH 1WAAA 4HXBH 1AQKH 5IW1A 2Z4TA 2X2UA 3KL5A 1OANA 1QWHA 2P47B 3D18B 4G7VL 1CXKA 4MS8D 3GI8H 3ARTA 3MRMB 4G82A 5F7WC 1LILA 3T8XB 4B41A 3WYRA 4FG6C 1R3IL 1F11A 2WPGA 2H0JA 2ZONA 2ZYHA 5GSVA 4BUHA 4IBVA 2C8NA 1HQRA 3AMLA 3MXWL 3A21A 1TZOA 5KUMA 4HOMA 3ULVD 3V0WL 3O41A 1T2QL 4IKLA 3PNWB 4MCYB 3NP4A 3RVTD 5K9QG 4HBCL 2D7TH 3BESR 4Z7OE 1FN4B 3JV0A 4ZFQA 5GZNC 1YMMD 3IVKB 1U2HA 4M7LH 5IB1B 1QHQA 3SOTA 2EDYA 3IDYB 2R7EA 3ATEA 3MLVL 5BUAA 5JXEC 4LGSB 4TVPE 3HG3A 3W11D 1K3ZA 4OZFA 2NNRA 4G6AC 3RWIB 4NGHL 3O3UN 4JK0D 5DVMA 5GRXG 3BN9D 1A4KB 1J5IA 1CK0L 3B5GA 1EUTA 1PAMA 1DBKL 1TVBA 1QLEH 3NFNA 4J23A 5E6UB 2HLEB 4EN3C 4R7DB 2GJRA 1MEXL 4LHUA 3CFBA 1C08B 3RRQA 1ZLEA 2O6FA 2Q0ZX 3AABA 2G5RA 3MV7D 1PG7L 3H54A 3L9YA 4HLZG 4PRPE 5C0CE 2YK1H 1LO5A 3BD4A 1CVRA 3GBNL 1WUZA 5C86A 2AJVH 4JKKA 1AD0A 3MGAA 3C12A 5GGUB 4WK2B 3RGVC 1NFDB 1QBMH 4LPTA 4ES8A 1UADC 2HVKA 3IJEB 2VZUA 3CE1A 3FH7A 4MLSA 5I26A 5D7JD 3Q05A 2WN2A 3FB5A 4CMHC 2Y7SA 2KS0A 3AB0C 4Y4KD 2HX9A 1P7HL 1EO5A 1SUJA 3B9KA 2QVIA 3G3LA 1T83C 4IMKC 5SWZB 1JZDC 5IT2L 2ZZUT 3KWWB 4AG4H 4IDJH 2KH2B 1RKRA 2X4UB 3DO7A 3BIBX 3BD3A 1D5MB 1OAKH 4ZXBD 3P4MA 4ZS7H 2X6MA 2J2ZB 4UIKH 3PV6B 2X7LA 5FHAL 3R7RA 3D4ZA 5LGJA 1UWYA 1IL1A 2BW5A 2EZ0D 3ELAT 3DVNB 5TDOA 1ESOA 5D93C 1RHHB 3VYNA 2ZOKB 3ZKXC 1JV5B 4TUKL 5CO1A 4ANUA 3BGFB 4NI3A 4XNXL 3LZNA 3ZT5A 4XWGH 2P7TA 4HU8A 1NGQH 1Z1WA 4GO6B 4HUVA 5FDYA 2PW2A 3FFOA 3D50A 4LVHC 4D0DB 1N4XH 1R6VA 3RNKA 4AM0B 3FH5A 2VN5A 4ZDHA 3UAAA 5DJYA 1KIUB 1HE8A 3IU4H 2OSLA 1EJ6A 4WI7A 4J3OC 1S7TA 1HDMB 4OIIH 2E7BA 3O4OC 5T3XD 2H3NA 1DFXA 1RJYA 4Z3HA 2IIJA 1Q9WB 1K9TA 2CJUH 4N1EA 1ORQB 4D9QD 2A6KA 5F44A 1TO4A 4N2MA 3RDTA 2V3FA 4X5LA 3RWEA 2FATH 2WLIB 3PGFH 4AC4A 4MZ3A 2FT7A 4PJ9D 4N5EC 4LP4A 4NCC2 4Y19D 1CE1H 2GSGB 3CSBA 2UZXA 3SCMD 1QBLL 2ZOLA 4G42B 4L29A 1NEUA 3JXAA 2EIEA 4TS6A 4Y1TA 4X80H 5E08H 1PFOA 4D9RD 4ABQA 2IALB 2PYFA 4I88A 5T5FA 1P7QD 4AJYV 2R4SH 3U2SA 5BV7H 3ET9F 4XP9H 2HN7A 4BV1A 4F37K 4Q9RL 5FGCB 3WMSA 32C2B 2Z8RA 1DL7H 4ZMVA 1ZE3H 1QNIA 2DD8L 3N6YA 5DYOA 3NIFB 5ESQA 4PJAF 4Z7IA 2GKIA 4BSVB 1AS8A 3BE1L 4FZEH 1R19A 4FKEA 1F3DJ 5L88H 4DCQA 1GAFL 1SXCA 4XPBH 2YGOA 3OX8A 3ZN6A 4GG6B 4XRCB 4AYFA 1SYSB 2G3ZA 4IRJD 3VXNB 3AMKA 2ITEA 1X7TA 1OT2A 3HUJE 1QOKA 3STLB 2RAMA 4OGYH 1HHKA 3D51A 1WA1X 4KJQD 1WFOA 2Q8BL 2UWEE 2WB1A 3MV11 1IT9H 1WEJL 2WQWA 3GSNB 1ASQA 1QX1A 1BM3H 1T89A 2I7SA 1LK2A 2YD9A 3D0VB 5T1KD 1IGJA 2AVFA 2NOYA 4X4YA 1KZQA 4I2XA 3C5SB 1YECH 3L4YA 4LPVA 4U1IB 2NQDA 1EERB 3M07A 5SV3A 3RUGA 5DZVA 4YDKH 4LCUA 5BRZD 1D7CA 2A0LC 5ILTH 4QIRA 4FNTA 4KPHH 2Y06H 2VLKE 1UATA 1OOAA 1F1AA 1SJEB 3OZ9H 4P46D 5EZLA 5GRUH 1MCIA 5K9KA 3C9NA 3AW5A 5FW6A 2QGDA 3LD8C 1DLHA 1X4YA 4LF3A 4BFEA 4XB8A 4YLQT 4PWHA 3T0VA 2L8AA 1ZHLA 2JXMA 4Z76A 2FD6H 3P30H 1BEYL 3F83A 4JANB 4A67A 5DEFA 1I3RA 4Y9EA 4GPVA 2F5AL 5I9QC 5MERB 1N64H 4AQ1C 1ASPA 4P3WA 4ALAL 3BH4A 3KW8A 2WNKA 5I8EB 5FEBA 1WITA 4I9WE 1KPUA 1LO2L 2OL3A 5DJDA 1A6PA 3HBQA 3EYVA 3TN0A 3EO9H 2ZWLT 4XCCH 1CFNA 1YEGL 2HLAA 1CU4H 1LWJA 1TNMA 1ODAA 3TX4A 4QF1B 1T1ZB 5IMLB 2XPZA 3JT2A 2DN7A 4NN6C 4HPYH 2EQDA 4HUWA 4HEPA 4PGCB 5HHQB 1SXZA 2WBJC 2EVGA 5FV1L 4XC3H 4XX1G 3N5AA 2DQTH 4R96B 4PLNC 1OAQL 3CVHH 4F9PC 5FYLH 1IUZA 2H9GB 4Z78B 3V0DA 4WI0B 4IRSA 1XEUA 1P4UA 4J3OH 4K94H 5ENWB 3RA7H 1IGIH 2FJGA 1INEH 1IC1A 2AQ1A 2C7FA 3DBSA 3EG9B 1BCIA 3DTXA 4HT1H 3HEIB 4XBEL 3VRJA 1P1VA 1OTTD 4ODWA 4P4KA 2FECL 4J4PA 2D7NA 4FQXA 1HEZB 1N26A 5E1HB 4XVTL 1MRFL 4HIJB 1FUNA 3D0LA 1LK3L 3ZL4H 4Z0BL 1YUKB 4XOCA 2DIBA 3CXHJ 1HSAB 2J73A 2G9KA 3LZRA 1PX4A 3A22A 4JFQA 5CWSB 1Z0NA 2MTPA 1YEFL 3MLRL 4WFHE 5E6ZA 1FPTH 4FF9A 5HGBA 1NSNH 3BQUB 5BNXD 4U1JB 3IETA 5ABZA 3G5ZA 2Y2YA 1BVLB 4AEHH 4LSVH 3P4LA 1UZ8A 4X6DB 1YMHA 2FGWL 1IEBB 5MI0B 1UJTA 4CU6A 5JTWA 2J12B 2GB2A 1R3LB 1NJ9A 2W8CA 4ZMYA 1MG3C 5HYSB 5IB3A 2W65A 5CXPA 5F1OB 1UM4H 2ZAGA 1FAIL 1KJ3H 4KDTA 1DJGA 4HYTB 1A9BA 2YRPA 4L9LC 4MX7A 5ITFA 2CKBB 1ZLDA 2E6JA 1A14L 3CDZA 3EAKA 4OF5A 3H6AA 4ZAKD 4G3YH 5KVFE 4YPGA 1YY9C 1WO2A 4D94A 5FDWA 4JZJA 2ATPB 2DQIL 3BYYA 1WAAF 2ODHA 3KGSA 5I1KL 3TYGH 1PIGA 2WOYA 5DRZB 4ZUTB 2HUEA 4GKZB 2J56A 3GF8A 2NZ1A 4NNXA 1XZ0A 4YXLL 2EXTA 1HCYA 3NH7H 4XMLH 4D3CH 3DMMB 3DUHA 4YSQA 1JNHB 2J1ZA 3CX2A 3T0BA 4PRAB 3EOBB 4MNHB 3DWTA 2BCMA 5CMAB 3MN8A 5T1LA 5A2LH 1HWGB 1WIOA 3H3PL 3VD4A 2BNQD 2ZF8A 2F74B 3D18A 2NUPB 6FABH 1QZNA 5IFJB 2GEEA 3IDNB 1H5BC 4PJXF 3SDAD 4U1GC 1MFUA 2VMDA 1QPKA 2WAHA 2HT3D 3T8XA 2LU5A 4HIXL 4I87A 1NCTA 1CR9L 2JKIS 3OWEA 4UT7L 4XXWA 3VXRB 4RGOL 5J1TC 4YBQD 2KZKA 4JRXD 2NY5H 3B83A 4OD3L 1J05B 3PNWA 4MCYA 4X6BA 5DF0A 5ABDE 1GGUA 2IPTL 4ZODA 3EHBC 5F0LB 3KPRE 3Q2CA 2DYPA 4O02L 5IB1A 3IEAA 1E28B 3PP4L 3IKCB 4KFMA 1CGSH 3H2PA 3ZDZF 4DZ8B 5MENA 2JB6B 2X09A 4KKAC 3VRIB 3IGAB 1DQMH 1J8HE 3V7AG 5KANG 4B0MB 3UO8B 2E7HA 1E5CA 4FERA 1A4KA 4M7JL 2JK5A 3IJSA 4MDIB 1RUKH 2EDRA 4YSTA 3WUWA 3BUYB 4R26H 3LKPB 4Z7NE 4YSAA 1TJMA 4OFYA 4B0MM 4OCXH 1OQOA 1HEHC 5BJTA 1NLBH 3ATBA 3PJLA 4WCYH 2AJUL 3N91A 2VXTL 3TCLB 5JNYB 1O7DE 4E5XG 3NA9H 1PYWB 2CLZA 1ZJAA 2XG4B 3BUDA 2J5LC 5EHFA 4GG8B 5J7CC 5I74C 4PJFB 4X9FA 5GGUA 5HGAA 3HCVB 1NFDA 3BP6A 4KVCL 3T1FA 2MHAA 3IJEA 3JWNC 5DEJA 2Z93B 1EZVY 1FNSH 3TNNB 5B21A 1BYNA 5I16B 3SN6N 5F7DB 1ZTXH 2P42B 3O4LB 4F58H 3MRIB 1PGRB 3MCG1 1QACA 1HXKA 1M1XA 4X9IA 3ETBF 4OBSA 5SWZA 1HHGA 3J27A 1VFUA 1GJUA 5CAYB 2X4UA 1DO6A 1TJHL 1TJIH 2OXHB 4D8PB 1M4KA 4IS6B 4GXUM 4PB9H 4PJGF 2VE6A 5FIEA 1KJMB 2J2ZA 1SN5A 3TEUA 3BT0A 3ARGD 4MB5A 2JFCA 2IFFH 5J13C 3PJNA 3RX5A 3V4VH 4NPKA 1RHHA 5D8JL 4FZ8H 1FFTB 1JV5A 2VLJD 1RIVL 4EI6A 2BRRH 1KJVA 3VYOA 1RZKC 1AMYA 1RIHL 3STZB 4M00A 4KK9D 2B0SL 1Q9LA 4OJFL 4DUXA 1RU9H 4K3HA 4OTXH 5E2TH 2MCMA 5HYJD 4NUQA 4D0DA 2YUXA 5DVLA 1VESA 3EDEA 4PJ5E 3SDCA 3NIGE 4OV5A 4KHXL 2CO4A 2CU9A 3C6LC 1HDMA 4KI5E 4ZMZA 3U4EB 5F93C 4G9FB 4JKPH 1U8IB 2K6YA 4BZ2A 5AYTA 1URZA 3VNZA 4LRNL 3EBAA 4MJ5B 1MCHA 4ELMB 3TVMB 2DEWX 3PJSB 1ORQA 4N4YB 4BE6A 1KCBA 5IK3B 5IUCA 3W57A 3Q0HA 2BY1A 3EH5B 2WLIA 1NUDA 2EE0A 3JUYA 4X8CA 5FAAA 3QXVA 4JREC 2GSGA 1AC6A 1GYVA 3CVBA 4ZMTA 8PAZA 2MPVA 2AEQH 2BCKB 4N0YH 1LP9E 4N8CH 5I0WA 2HG5B 3X13B 4G42A 2Y6SD 3C5ZD 3LCYA 4LPXA 4OI7A 1ZK5A 4K3GA 5I1LB 4N0CD 5CZRA 5BVPH 4C4BA 5I23A 3QFJB 3G08A 4HJUA 3KJ6H 3C5XA 3L9EA 4YHNA 1H3TA 5DURB 3AY4A 1ECYA 4L5FL 3RL2B 4LSRL 3Q7JA 3GC3A 4BSVA 4LNRA 4E41D 4V2BA 4FI7A 4IJ3B 2R4RH 4A6YH 1ECZA 4WGWB 3LPOA 4HVBA 1JRHI 2YR3A 5CCHE 4GG6A 4F2ME 3AM8C 1DP0A 3ARXA 4M1DH 4XRCA 1AE6H 4W9JC 1CYGA 5FM5O 1SYSA 5CGBA 1PNCA 5JDJA 3X12B 2DWXA 3VXNA 5HGHA 2DM4A 1KXHA 1E3FA 2AXGB 3BPLB 3O9WC 3STLA 2DQUL 3ECUA 2CDGB 5EIVA 4RMBA 5FHBL 4IIQC 4PG2A 2EVHA 1LL1A 1D7BA 2VR6A 4J39A 3GSNA 2WBKA 2J8HA 3U82B 4FQLL 2GTZB 5SX4I 3C5SA 2HB0A 4Q6IC 4Z7UF 2EDJA 1A6ZB 4LESA 4BHUA 2WUBH 1VDGA 1F4HA 2EAEA 3C2AL 1U3HC 1X44A 1WQVT 2IG2L 1MFNA 4FN0A 4BA8A 1RH8A 1ZAGA 2KLSA 2HTLD 5IVXE 3JWNH 5KBNC 5BZZA 1A66A 4AEEA 4BZ1L 2IMNA 3U30C 2NNAB 1CICD 1S78D 3KPQB 2A3TA 3BSHA 2NY2B 2YKKA 4N9GB 3UERA 2CM6A 3A24A 4LEXL 3WHE1 2YA2A 3U79A 1PKQB 4LQFH 3KLLA 4ANVA 4L3CB 1MHCB 3N40P 2FJFB 2L7UA 4BRVA 2P5WD 4ESKA 1IFHH 5D1ZC 1BIHA 1OL0A 2BSTB 2ZD0A 4KAQH 1PCXA 5EC1A 2RA1A 4R5VA 5CLZA 3H9HB 1NBZA 4X4XB 1LMIA 2VC2B 4XVSH 3JT0A 3U2IA 1U30A 1SHXA 1T80A 2AQNA 5KSUB 4N2LA 1SEQH 1P9MA 2P8LB 4EN2A 1UOKA 5M7QA 4QF1A 3FTWA 5B3SB 3SJVA 4UAHA 4H88H 3ATFA 3M8OL 4PLKC 3FUEA 5KYUA 3U7WH 4PGCA 1GGCL 4Q8BA 4OLZL 3VGAC 4BELD 4OB5H 1SQMA 3QWRA 3QQDA 4ORGB 3WFHB 1FRGL 4OVVA 1NLDH 5KBMA 2H1XA 2VKXA 3CLEL 4R96A 3MJ9H 5IHLB 3RVUC 4OAWB 3QDJE 4W9EC 4KTYA 3O2DL 4WFFE 4O5LL 2L7JA 2NY3D 5CSBA 5B4MC 4WI0A 2WSPA 3VM7A 5ENWA 5E9DB 1X7QB 2GBTA 4HX1B 4POZD 4HS6A 2HA1A 4EZJA 4LP8A 1E9OB 1HYSD 3ARZA 1WCQA 2WWMC 4ICWA 3EG9A 3UIZA 1I85A 1KN2L 1CTOA 2NCMA 3BKYL 4PV9B 1HNFA 4QOKB 3FFDA 4EE2A 3T65A 3DIFB 1BF2A 4LHUD 2FQFA 1K8DA 2CRZA 3GHPA 3HMWH 4HIJA 2F7PA 1X3DA 2LW3A 5D72H 1NH6A 1FA4A 3REVB 1DQVA 3IPBA 3CFQA 2AZAA 1HSAA 2VL5B 5DD1L 1Y1UA 5CWSA 5IEKA 3Q48A 4M7LT 2AABL 2E9BA 4M8RA 1QFWI 3BQUA 5LNGA 1I1CA 4U1JA 2XN9B 2MMXA 3D1MC 1EO8H 2J7LA 4G83A 7PCYA 1BVLA 2A9CA 3KDMB 4P3DA 4WWKC 5HVWA 1AGEB 4X6DA 2WLYA 4IJTA 1IEBA 1S3KL 1R3LA 4NOBA 5EZIH 2WXRA 4GAAA 2B1AL 2C5DC 4GQRA 2X3BA 4YN3A 3VI4E 4EI5B 4MXVE 5IVOA 3T6XA 2CKBA 4B27A 3RKPA 1EPFA 1IBYA 2AK4E 3R1GH 1G0XA 1UOLA 1Z3RA 2V5TA 5TQ0L 2ATPA 2UZPA 4O02B 2G5UA 1G6VK 4XPAH 4ZUTA 5L8KB 4GKZA 3HB3C 3MRCB 1FGNH 4ZTPH 1E5AA 4MVBC 3D39B 4QYOA 2R2EB 5CEYB 3DMMA 3DYPA 1GW6A 1CQYA 2X87A 2WTOA 3HNVH 4JCMA 4KH9A 5ESAB 1R34A 4PRAA 2MQ3A 3EOBA 5JW4Q 2FNWA 4BFKA 4MZRA 1VZIA 5CUSL 5MP6H 3ZX1A 2MNWA 5C9JB 1KTKE 2N7AA 3MRRB 3DI2B 5FYKL 3QAZC 3CFEA 1FZMA 2F74A 5I6MA 2BZCA 3X11B 2OK0L 2HJKA 2OMUB 4DKFH 5C7ZA 4FD0A 3CHOA 4NQCB 1UEMA 1ETZA 2JV6A 4ONHB 4Y7OC 3Q44A 2B9BA 1I1AB 1KGUA 4ZO8A 4ZUSB 4AITA 1OP5K 3RDTD 3EOAB 3P3YA 4NQVB 4JFZL 4XHJC 3X17A 3S8GB 4JLRA 4JO5A 4H8WH 1WT5A 4Y2DB 2EEDA 3U7AA 4QRSB 2NZIA 3A6BH 1H19A 3IKCA 4RSVA 4XN4A 3VRIA 1KELH 4MAYA 1JPEA 2WKOA 1CTNA 3OLDA 1YDPA 4GKNA 2QHRH 3Q3GA 1JF5A 3M6DA 4MDIA 3HI6L 4B9IA 3IMRA 1J86A 3LKPA 1O5DT 2QPEB 4XT1C 5F88A 2M26A 2WXKA 4B9YA 5TF0A 3NACH 1MCNA 1BQLH 2JQAA 3ULUD 1AC0A 1MQ8A 3TCLA 2CXKA 4DKTA 4KNUA 2CJTA 1LHZA 1E2VA 2GYSA 2XG4A 2WZPA 4AKPA 1H3PH 3MJ6A 2A73B 4GG8A 3SE6A 2LFEA 3UBFA 3X3FH 5EPMB 4PJFA 3EYSL 5E4AA 7PAZA 2RFXA 5JHBA 1F8TL 3FF7A 1MH5A 5DI8B 2Z93A 3IXTB 1PG7X 5JZ7D 3H9SB 4OQ1A 3GJFH 1P4LB 3TNNA 1QR1B 3KDPB 3RTLA 4KU1A 5F7DA 5DC9B 3IN0A 4O2FB 4HZLB 4HFWB 4JDZB 4CMMB 4L1DA 1DQKA 5IR1B 2O6PA 1PLBA 3HNSL 4XMKH 4X5WB 3ROOB 3T3PB 3ZHFA 2OXHA 2A9ML 3C60B 1TQVA 4HG4J 1FFNB 2OTWB 4U1LB 1NDGB 2HVJB 3LH8A 4S0SD 3ZKSD 2FE0A 4G7SB 1KJMA 5L2JA 1T22A 2F5BH 4UQ3A 5EF2A 5IROC 2ZKHH 1IFGA 3OGCB 5IG7B 3IU3B 5CU5A 4DUWA 4PUBH 2JJVA 4OLVH 1NGPL 1L4IA 4X4KA 2BP0B 4X6EB 1I4FA 1PTZA 4GBXB 2ARJA 3P9WB 1J5CA 4CNIA 1B9ZA 3NJJA 4MMZB 4WENB 1BJMA 4Y5XC 5FGBC 4KDWA 5I1EH 1GC1C 1TZAA 1KCKA 1BZQK 1MWAH 2V9TA 3QUYC 3RIKA 3W2DL 4C57C 4J3OG 1AQDB 3VXSA 5JHDA 4AGOA 2VDPL 2CCWA 5FA4B 4PS8A 1QBAA 3TN0D 2YBRB 4PCSA 3BAWA 4G9FA 1U8IA 3IDXL 5JXAH 3F12A 4P2QA 2VDLL 4MJ5A 3FN3A 4JFFB 3WJMA 1OKEA 3TVMA 3SBQA 1B3JA 3VXQB 2QKIC 2W0LA 3PJSA 1NCWH 3N0AA 4D8OA 4Z7OF 2VNCA 5TPWH 1XF2B 1RZGB 4F57L 3WEXB 2FX8L 3RTQC 4Y4HC 2GJ6D 3NIFF 2KQNA 3D5OF 4MB1A 2I5YL 2QMJA 2Q3XA 5DVKA 4R6UA 4HKJA 1DJSA 3GDCA 3TT1L 3FNKA 2F58L 3QO0B 3O2VH 2TAAA 3QZBA 4IRSD 4U1HA 3KPOB 3SOBH 3LQMA 3SYPA 2E0PA 5JMRA 3GRGA 3ECVA 3GO1L 4QNPF 1A47A 4YHKH 3CVIH 3RHWF 1OAZL 5D9SB 4JO3H 2NX5E 4P4KD 3QUZB 1TVHA 1O5PA 4L8BA 3NEXA 5E5LA 4F7MB 4J4PD 4FQXD 1UWXK 3T6ZA 2DICA 2H45A 5HJDA 1GOHA 43CAB 1GL4B 3D3VB 1UWGL 4CW1A 4YH6A 3G5XB 4RFNB 3UTTE 4X2UA 4NQDB 3K8MA 3TZVC 1A65A 1JPGB 3R7QA 4YX2H 4Z7WE 2QDVA 3CH1B 5D5ME 1OP3K 1R3IH 2AXGA 1JTTA 4G7QB 3BWSA 2CDGA 3MNDA 4RNRB 4XP1L 1FL5B 2HCZX 1OM3H 4HV8B 4WU5B 5DMJB 3ECWA 2YXMA 3O45B 3OTTA 4FJYA 2GTZA 4JDVB 3MRBB 3BC9A 2WVTA 3EZJB 4P5SA 5T33L 3PHOB 1A6ZA 3NSCA 3U1PA 1EHAA 4YAQA 4E9WA 3MLVH 1T0PB 2CO2A 1TMCB 5BQDA 4GQQA 4NGHH 4WRLA 4NRZB 3PGDB 4UMSA 5EA0H 3DX7A 1E8ZA 4DGYL 1CK0H 3TJPA 1K2DB 1RULL 4K71B 2M8XA 3CZSA 1DBKH 3O3DB 4NSKB 2B4CL 2X2YA 4WFGD 2NNAA 2XVBA 2HMIC 3KPQA 4GQ9L 3G5YA 1FNAA 1MEXH 2NNFA 4K4KA 4AM0Q 2GK0B 3BP7B 5AL8A 1PG7H 4S1DC 2FJHA 4L3CA 5FF6B 1AZBA 5DHVA 4K5OA 2I60L 3VXUE 3GBNH 5HDOA 3QUKB 4GP5B 4LSSH 5T1LD 5KWYC 3QRGL 3OR7A 3GM0A 1KYOK 3H9HA 2CA4A 3BAJA 1CG9B 5PCYA 2OMYB 1MJ7H 4UYQA 2GJZB 5KVEL 5IB2B 3BZDA 2BVTA 1BVKA 2ICWI 4XI5D 4GRMB 1G0YR 3DKHA 3LMJL 4FP8L 4MCNA 1MJ8H 4OGQC 3T4YA 3WFHA 1DANU 2H2PC 1DJHA 3WKNA 5F0MB 4AL8C 1GC1H 2AEPL 1O7DC 1JPFB 1G7HB 2AV7B 1B4JL 4LB8A 1X4XA 3S3DB 5E9DA 2GK2A 1FYTE 2AJXL 3UTSA 4TUKH 3L3OC 1I7RA 3GSXA 1V27A 2EO7A 1P0SE 2PPAA 3DVIA 3HS9A 4HIHB 2OR7A 4XBGB 2NYYC 5EC2A 5D2NE 2XPYA 4OFYD 4XNXH 4NQXB 3VQLA 1IX2A 1FCGA 3KYAA 5DUPH 4DQOL 1PL3A 4QOKA 3N0PB 3QQ9D 4X6DF 3DIFA 2WXFA 3KCPB 5DXWA 5BQ7B 2P52A 4KFZC 3DETC 4WHTB 4IGBC 4M6OL 3UP6A 3DVGB 3VWJC 4AUYA 1IGML 4N6RB 4DT2A 1C16A 1AD9B 1HCVA 1JWSB 4N8UA 2MH4A 1ZT7B 1G0DA 2K4AA 2NTFB 1T20A 4Y1AA 3UJTL 1UZ6E 1COBA 4GEJA 4LSPL 3KDMA 3MCYA 4YDMA 3U36A 5IV2B 2PTVA 4UM8B 4P2CG 3MR9B 2P26A 3B43A 4A2LA 2HG0A 3US0A 5SWZD 1B88A 2FX7L 2WO2B 5B39G 4YSUA 4QHMB 4APQB 2R23B 3MJ8B 3OSVA 4IIZA 1I9RH 3M88A 3RFZC 3QBTB 1A6WL 1Q0YH 1V10A 1OD9A 2ZX6A 3VMOA 3JVGA 1INDH 5LGKA 3ARBC 2NDFA 1DBBL 2Z7YA 1A6TB 3CZJA 3WLBB 4Q9RH 3ULSA 5D71L 5EBLB 5KVFH 1YN7B 3DHJA 3D39A 3U25A 4JM2B 5JHMA 2PN5A 5HYQB 1R46A 1F6LL 2R2EA 5CEYA 2DD8H 4KI5C 5M94B 1T7WA 5C0RL 1ZGLP 1W6WA 5CJQL 3BE1H 4YFLI 3US1A 5GISH 5E8EA 4HH8A 3HBPA 1GAFH 2IH3A 3Q2WA 3QNXB 5ANME 5HI4C 4G5AA 5TGBB 5C9JA 1JRHL 4LPUA 3MRRA 4WO4C 1A5FH 3FXIC 4MGXA 1KBWA 1NIBA 3SDCD 1FZOA 2X4TB 3B7TA 4G9DB 4K9EC 3X11A 1BFOB 2WZAA 4A2FA 1NPUA 1S5IL 5CP7B 2OMUA 2Y1AA 3GMNB 2JJTC 3B9DA 3DNKA 2Q8BH 3O6FB 2J88H 3PWVA 3T0XA 2WKOF 1FL3B 4NQCA 1HILB 3I85A 3IJ7A 1G9NC 4ZMNA 4K3DH 3TEXA 4ONHA 5AZEL 4LPWA 1Z6JT 2AFNA 4AKOA 4ZUSA 1IEHA 4KROD 2OMXB 2YD5A 4KRPB 5LGYA 2YD7A 4HOWA 4NJAL 4NQVA 1SYVB 2E74C 5FO9A 2J20A 2I07B 1JUFA 5LCVH 4QRSA 1A7RL 5D1QB 1EHNA 4XN2A 1JAEA 4Q74A 1CGWA 1JOIA 3QFGA 1W0YT 2NY0B 1C5CL 5I8KL 4AK1A 5MEOB 1PY9A 3ATAA 4ZK8A 4PJFF 2Z34A 4WUUE 1KNOA 2NXZC 1C8PA 4UTAL 3UZQB 2VW6A 1F3JA 1BEYH 1NMBL 1UCBL 2IXQA 3E9UA 1SOXA 1NGXB 2F5AH 5KZCD 1BD2B 1KPVB 4GO8A 2XIDA 4U6VH 1A21A 3QEUA 3VA2C 4PGDB 3UABA 3WTVA 5ICYB 4CDHA 4ALAH 3POCA 2O4EA 1KB3A 3IKKA 3S3SA 3CN4A 1N18A 2OXGB 2VYRE 1LO2H 1GKEA 2ILLA 3OKDB 2XG5B 3HRPA 5EPMA 3T8VA 3JWNG 2V8LA 4ICXA 3B2VL 5E6IC 3RPIB 3T3MB 1YEGH 2AV1B 5C0AE 2X0WA 3IXTA 1KCVH 4NRYB 4OD2A 3H9SA 3MUY1 1DVSA 3RY4A 1QR1A 2VDPB 5SWSA 2Z91B 3FO0H 5DQ9B 2KC0A 3D07A 4MQXC 1J5OL 3KBFA 2WO4A 2NTSP 4J3VA 2NUTB 2ZKXA 3QDGB 4O2FA 2W9LA 1SPDA 2VDLB 4HZLA 3SGDI 4HFWA 2Y0SA 4JDZA 4CMMA 3GFUA 5ID0A 2OYKA 5IIEB 2OSYA 5EEYA 1H9DA 1OAQH 5B1KA 1SY6L 2YAOA 3ROOA 1JCVA 3CX5K 1A6AB 4TM9A 3HKZA 5GZNA 5DVOA 5AEAA 1HZKA 4K8RD 2PCFB 4U1LA 2OTWA 3EFFB 4FX5A 2BINA 3DXAB 4KKBD 4M29A 4RA3A 4NUPA 5JXEA 2VH5L 3OQRA 1CLOL 4ZFZB 4B9JA 2OKMA 4W68A 5D7IE 3OGCA 3IDMB 3L5WB 4XBEH 3IU3A 4LOFA 5HJ3B 4HK0A 3MTXA 2V4LA 4BK5A 5IJKC 2R0ZL 4RWYH 1CLVA 3NCEB 1I7ZB 2R69H 3HC0B 4GBXA 4XVTH 5AOLA 4EN3A 3UTQA 1MRFH 3K5RA 1T1WB 3QEGL 5I73B 1LK3H 1ZLWK 1A1OB 1MCPL 2LVEA 3JZYA 1BQHB 3LHPL 4ELMF 5HPOA 4Z0BH 4F33A 3CSTA 1FIGL 1BZ8A 3RZCB 4R97B 3FOLB 3MLRH 2EO9A 3FT0A 1AQDA 9CGTA 1QFWL 4ZOCA 4HWBA 5GGSB 3GTTA 4ODTH 2RQEA 5FA4A 2ZWKA 3RGVA 4HJ1A 3MBWB 1JZ2A 2YBRA 5AW5B 2FGWH 2WQ8A 3GGWB 2BWDA 1XF3B 4NKMA 2K6ZA 3W39B 4JFFA 4KJPD 3VXQA 1CVSC 1FAIH 1GMIA 5B7EA 3BRDA 4M5YL 3C6SB 2ZYRA 2ZSWB 3HHRB 3QWRD 4IMKA 1WPCA 4YOKA 1RZGA 1G7QB 1XGTA 1XGYH 3ME0B 3WEXA 3JBG7 2X38A 1GCYA 3HRZC 5E8NB 3VFNB 4APXA 2BHZA 1WS7A 3M46A 1G84A 2DQIH 5DMIL 2EIZB 2QELA 2VJ0A 4N0UB 2IANA 2Y3AA 3QO0A 3BIKB 4K9EH 1MFEL 3QC6X 3KPOA 4X8GA 2V2TA 1E6OL 3GPSA 4JFDB 1MREL 2FX9L 1OV8A 5IVNA 4NAQA 5K9JL 1G9NH 5EEVA 4ES9A 2C9XA 2A74B 2QDWA 3JUZA 2GBUA 3QUZA 3QZWG 2BVPB 4BZ1A 1WWBX 4JPIB 4F7MA 3KLHC 1XAUA 1SDYA 3K2KA 4LFHD 2VDRL 1OHQA 4FG4A 1KULA 4NO2B 3H3PH 4R2GC 3W3BA 2EXSA 2CE6A 2Y7MA 3FRPG 5KAQF 5CU9A 4GAJL 5BOZG 1JPGA 1JGUL 3KL0A 3KPSE 3P4NB 3BQUD 3CH1A 4HIXH 4NZDA 4BDVA 5AVYB 3FQNB 1CR9H 3V5KB 4UT7H 4JPSA 4RNRA 2XWBB 2RR3A 2Z35A 1NEZG 3QIBC 4WU5A 4OD3H 3IFOB 1N3NB 4JFOB 3WLWC 3O45A 2AW2A 3JV6B 4KQ4L 5DR5L 3ZTJG 1YNTB 1U8CA 3RVVC 3PHOA 1EMTH 1VPOH 3MV8B 1A2YA 3KLQA 5L4JA 2ZAIA 2NZ9D 1LD9B 4X6CB 2ZX9A 4XXCC 2NY6C 2OMVA 1CI3M 4NRZA 4R7LA 2A4CA 4XNZC 3ZE0E 5AAWA 3H7LA 2VUOA 4BQ8A 2NY1C 1NDMB 1BG9A 4NQQA 5EBWB 4PS3A 3O3DA 3O2DA 4NSKA 2V2WB 1JZIA 4JFHE 4XHQA 5D4IA 5EDXA 3DMMD 3MLPA 4CRPA 2R56L 2AJUH 4U49A 4PV1C 4UT9L 1I7TB 2XKNB 3ZR5A 5DD6A 4E36A 2XWRA 1UA6L 2GK0A 3BP7A 4Y16B 6CGTA 3MFFB 4L8SC 1XTLA 4PJBB 3FU7B 3L08A 3EF4A 4JFYB 4MAUL 4B3EA 3QUKA 3RFRA 3KPMA 2AS5M 1VFBA 4ETQB 5C0FA 1NBYA 1J12A 1N59B 1ZY9A 3RVXC 5ECGA 5EF3A 4PVLA 2QR0B 2B39A 3QULB 5DRNA 5E8OB 3WDHA 5IB2A 1IE5A 4NENA 2PMZA 3HPJB 5DU7A 2A9AA 4NT6B 5DRWB 1C5BL 3FCTB 2J6EL 1BGXL 3P0GB 3RJDA 1H6FA 2BS9A 3JQOB 2Y5EA 2YXFA 4L4TB 3HMXL 1A9EA 3PPSA 3IDIA 1DSFH 5ICXB 1TJHH 3GSVB 5CCJA 5TFSL 1T7XA 3QUML 1N0XH 3ORJA 4P99A 5C0ND 4YHPB 3S8WA 4U7KA 1X9LA 1LP9F 4L05A 3CFNA 2AITA 1JPFA 4GAYA 4PH8A 4MZIA 5K39B 3VH8G 2CALA 2AV7A 5HJBA 4MAYD 4ZD3L 3GK8H 4XO8A 3SDXE 2YRZA 3QW9A 4PRHE 4OZIA 1RIVH 4FXGB 1U21A 4HIHA 1AIFA 2ZT9C 2HT2C 2UXGA 15C8H 3I50L 1RIHH 3UFIA 2EKJA 1EVTC 2FO4B 3WKYA 3ESMA 2AJSL 4PJDB 4TYUA 5IHZB 1JCKA 4OJFH 4Q2ZA 1JZ7A 5BQ7A 2QEJA 4JVPA 5C0BE 1QSFB 5D96C 4HF5L 3DVGA 3GXIA 1QFUL 1GKOA 1AD9A 4QHLA 4MNQE 2ZUYA 2EINB 2WZPD 4AQ1A 4FG2A 5JOFB 2YJLA 4BD4A 3KH4A 3SODB 1MCRA 1R3JB 4PJ8C 3EJQA 5B8CC 4F93B 4XN7A 4PJ7A 1ZT7A 3HN8A 3IM1A 2VISA 2VUKA 1ZHBB 3TWCL 5IM7A 1T5WB 2Y5TB 4DN4L 3CIQA 4TPRL 3FL7A 5CD3B 5EU5B 4JRYE 4V11A 1J9SA 4KXCA 3V95A 4JM4L 1S7UB 2ZWZA 3MR9A 3PPEA 4ERSH 1SN0A 3ZKMC 3H55A 2WC7A 3V0FA 4KV5E 1H8OA 3ZSTA 4DP2X 1ZWIA 4B5ZA 1AP2B 4U3CA 2ED7A 1WC7B 3J7HA 1J9RA 1VGKB 2E9WA 5INCB 2E59A 3DARA 4X4ME 4APQA 2AHIA 3ZSSA 2H6UA 2W9EH 4F9PA 1RPUA 3FT1A 3IMVA 5GGSY 4BSJA 3VAEA 4GLRH 3OQ3B 3D2UB 3FDWA 1A6TA 2MSPA 1LYQA 3WLBA 3VFTB 5EBLA 3CV5A 1NICA 3HLKA 4N2HA 5TD4A 4JM2A 4XMWA 3RWCB 3K6DA 2KKQA 4L5FH 1JZHA 3Q8BA 3VU1A 4X7EC 3VW3L 5I1AB 2H8PA 3WGVB 4P2OC 3QNXA 2XBDA 5KVDL 5TGBA 2UUDH 4I3SL 2P3YA 1M9WA 1KYOJ 2X6BA 3N9GL 1TTCA 4G9DA 4HETA 3VXSD 5JHDD 3WXVL 2DQUH 1CC3A 1OCCB 5CP7A 1IC5L 3GMNA 5FHBH 1I82A 3QGVA 4UTBL 4G9FD 2F7IA 2GAZB 3V9EA 1PZ3A 2UY7A 4FQLH 5DLMH 4C83A 2QZ5A 3BKCH 3TVMD 2PYEB 1FV1B 4LT7A 3UEQA 4ENZA 1P5UB 1XL4A 2OMXA 3DV4B 4XZUB 3ZYOA 1QRKA 3FHEA 4DPBX 1NGYB 1SYVA 2IJ0C 3WDJA 4FMFA 1ET7A 2F54B 3C2AH 3K81A 4L9LA 5MHSE 2I07A 2IG2H 3K6SB 3FHQA 3FZUC 4LDOB 5EZJA 2VMFA 1RUQL 3VM5A 2CHXA 3LN9A 2DWTA 1HQ4B 2APFA 4AVHA 2X1WL 2CLVA 2G4EA 2J43A 1QUNB 2EKSB 1KLGB 1D5ZB 3PXLA 3EFDH 3RILA 3UZQA 4RMSA 3PY9A 5I71B 1I8MB 3OKMA 4LEXH 5HDBE 3H4FA 2YUVA 4HAFA 1KWKA 3BAXA 1KPVA 1ET8A 2WK2A 4DZBB 3NCYP 1BIIB 2J1KA 2Z31C 5ICYA 1LEIB 4EXPX 4NO0B 2Z6FA 3MCKB 5C0IB 2AC0A 4TVSa 4U7SA 1IQWL 2OXGA 3OKDA 5A2BA 2XG5A 1F1GA 1A9VA 1GYCA 4R90L 1UFUA 4H20H 5E8PA 3T3PF 4LEBA 4S11A 1HKLL 4NKQB 3RPIA 1H5BA 2VABB 1L7IL 4NRYA 5SX5H 5IW6A 4C4UA 1H3GA 4Z7QE 5INDB 3TS8A 2OZ4A 3EXLA 2A9NL 1HU8A 3G6JA 3M8OH 1GGCH 5ACLA 4OLZH 1E2WA 5F72S 4QLWA 1KBVA 2B1OA 1FRGH 4HC1A 4GH7B 4IBTA 5DHEA 4KBPA 3CLEH 4MXVF 3TF4A 2HJLB 1MCDA 1MXDA 3FQWB 5AOIA 5J9PB 4IRZA 3ZKQD 1U3JA 2PCFA 5FKPB 5CEZE 1NGZB 3L4VA 3QIWB 4WEBL 3GMQB 1EANA 4ZFZA 4V2CB 5F7MC 3L5WA 4JR9L 3P4OA 1AS7A 3BKYH 3NZHL 3OAUH 5G55A 1IEAB 5HJ3A 4KHTH 2NY2D 4HZAA 4TLUA 3VG9C 1UASA 3D9AL 4G1MB 2X0VA 1I7ZA 3HC0A 3FH8A 4L37A 1T1WA 2AJ3B 2Y4SA 3MROB 1A1OA 1VFMA 1IBFA 1HIML 1BQHA 4FA6A 2HPOA 3EO1B 5DD1H 4NZUH 3RZCA 3FF8A 2AABH 3VWKB 1YEEL 2VDRB 3MPCA 2CMRL 2QVMA 3GHEL 3HI1A 2EYRA 4PRIE 3MO1B 2ZCKL 3GTNA 5A3ID 2BVEA 2KQMA 5GGSA 3KGUA 2BW4A 4HAKA 1JD7A 3WI9A 1CXIA 5E4OA 2VQ4A 3QH3B 3V8CA 1S3KH 4DN3L 3GGWA 3GRWH 1IAKA 4FXTA 4B60A 4AOFA 5JIPA 3V4PL 2BPBA 2H32B 2B1AH 1F00I 2R1XA 3PDOB 3OHXC 3MXVH 2EUZA 2YD6A 3C6SA 1X7SA 5D2NC 3OKKB 3KXFE 4HIIB 2NT1A 4YMPA 3ME0A 5KSBB 1KEGL 4JFEB 4LLDB 2DS4A 5E8NA 2D7PA 3SE9L 1NCAL 3VFNA 3OMNB 2K4WA 2AK1L 3SY0A 2AKRA 2EIZA 3QORC 5BZWB 2E46A 4N0UA 3T6VA 4KKZA 5KVMC 1BEXA 3BIKA 3WY1A 4F2FA 4GFXA 1HI6A 4K07A 4LLUB 2MCAA 3AS2A 5E9DD 3UTSD 2MEJB 4CVUA 4WEMB 4G80B 4AI7A 3WMQA 1YJDL 2JTYA 5KVDE 2A74A 5LXGL 1ACZA 4QHNB 4QOKD 3JV5A 1CPUA 2X4PB 4JPIA 1VHPA 3H7BB 4WHDA 5CUSH 1J8KA 3VXMA 4FLHA 2HWZL 4MYPA 1MWOA 4WI3A 4NO2A 3GEWB 5FYKH 1U8NB 4L4JA 2HFFB 2OK0H 2NMSA 3I9GL 2A4EA 3K4DA 5KS9E 2XN9D 3E9TA 1XH1A 4Y1AD 3WY4A 3EO0B 1FC2D 4RVBA 2NSXA 2ATKB 4LASL 5A43C 1UD3A 2XWBA 4FTVE 3IFOA 1N3NA 4IKIA 2R51A 2V33A 4U3SB 2D9QB 1X5YA 3JV6A 1OAYL 4JFZH 4EBQL 1YNTA 3IPFA 1TTAA 1BJ1J 5TE7L 3MV8A 3FO2B 3U2JA 3NA4A 1TQCC 1W0WB 2Z7ZA 1LD9A 4RGNE 1GOGA 1KZYA