3NSCA

C500s mutant of cueo bound to cu(ii)
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
493
structure length
470
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHEDTGMMLGFTVLQGDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of multicopper oxidase CueO bound to copper(I) and silver(I): functional role of a methionine-rich sequence.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase cueO
total genus 134
structure length 470
sequence length 493
ec nomenclature
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nscA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nscA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nscA03
1CUOA 1M9WA 2EIKB 2FT8A 2TSAA 3FSWA 3FSVA 2EILB 3ZDWA 1E5ZA 1AAJA 3T6XA 2BWIA 2QPDB 3NP4A 2PP7A 3MX0B 4HCGA 1TKWA 3EH5B 2PPAA 1FA4A 1RZPA 2XVBA 2VM4A 3CZUB 2BWDA 4DPBX 3MBWB 2FQEA 3AG4B 2AFNA 2OCCB 3FQ1A 3UADA 4FA7B 4GP4B 1AZNA 3PLYA 1NTDA 1XB8A 4W9ZA 3WNIA 4JHUA 1JZFA 2QT6A 1SFHA 2FJSA 3NSFA 3NJGA 5AFAA 2VSKB 4BWWA 5I6KA 1NWOA 1SHWA 2IH8A 1TEGA 2YAQA 1URIA 1NIAA 1SDDA 3PCYA 5F7AA 3QJUB 2P80A 1JZGA 2JKWA 4YSRA 3FU7A 2IDUA 4M3HA 2IWEA 3BVDB 3T9WA 4E9QA 4GP5B 1SNRA 1OE1A 1AR1B 1JXFA 2QPEB 4BWUA 3S3CB 4DP4X 2FTAA 1ID2A 5E9NA 3D12B 3ZX1A 1FWXA 3OQRA 2VW7A 2XLLA 1A65A 2UXVA 1A4AA 2VW6A 6PAZA 1ET7A 1YLBB 1NIDA 2FT7A 1CC3A 3NJNA 1ILUA 3T71A 2YAOA 3FS9A 3CDZA 4N4YB 1OCZB 3WKPA 3WI9A 1A8ZA 1B3IA 3SQRA 2BW4A 2AZUA 5PCYA 2AZAA 2B08A 3IN0A 3TBCA 3CVCA 5I6LA 2XV0A 1WS8A 1HAUA 2DWTA 4WTQA 2VM3A 4MFHA 3CDZB 3V9CA 2CJ3A 1HAWA 4BXSV 1KGYE 1E30A 1T5KA 2HX7A 3NSCA 2ZXWB 1ZDQA 1AQ8A 8PAZA 3C75A 4BK5C 2QDVA 1PNCA 2CAKA 3AW5A 3IE9A 3FSZA 1PAZA 3QJVB 2GC7C 4HHWA 1X9RA 1TU2A 4KO9A 1PZCA 2GSMB 1MDAA 4KNTA 2VSMB 4NAJA 2EINB 3TU6A 4W1TA 4F2FA 1ASQA 1BEXA 4TXVB 1OE3A 1GS7A 4YSDA 4HALA 2UX7A 4KO7A 2PPCA 2FWLB 3GXUB 1EZLA 3EH3B 4DP5X 4PAZA 1JZIA 1HFUA 1IBYA 4JHVA 1KBWA 4DPAX 4YSQA 2IWFA 4BDVA 4RH4A 2I7SA 3AG2B 1A4BA 4YVUA 2XV2A 5FC9A 1AS8A 2VMJA 1E5YA 5B7EA 4HZ1A 1L9RA 1OE2A 2FQFA 4BDVB 2YAEA 5B7FA 1NIEA 1PZBA 1EHKB 1PNDA 2PCYA 4AI7A 2GBAA 1OCRB 3SBQA 3EH4B 1BYOA 1A3ZA 2Q9OA 2OV0A 1CYWA 2EIMB 3AG3B 5B1JA 5A7EA 1V55B 1NICA 4AKOA 2A3TA 1JXDA 3OD3A 3PAUA 1BQ5A 1AG6A 2CCWA 2GIMA 3NT0A 2IDTA 2UXFA 2MTAA 3FPXA 3AG1B 3PAZA 4A67A 4ENZA 4A2FA 1BXVA 3ASNB 1SF5A 3HB3B 1M56B 3WKQA 3UABA 1KDIA 1J9RA 1PF3A 2XV3A 4K9JA 1KCWA 1L9OA 5B1JC 1XMEB 2J55A 3NJMA 4QKTA 1AS7A 3WG7B 2DYSB 2YXWA 2XXGA 6PCYA 4CSPA 1SFDA 3QJQB 2IAAC 3CVDA 2J56A 3CVBA 4G71B 4E9VA 1A4CA 1NZRA 2HRGA 4UANA 2JFCA 2GC4C 2BZ7A 4YSUA 3FYIB 1JXGA 3FPYA 3QJRB 1R1CA 2JXMA 2FNWA 4E9RA 4BXVA 1AANA 4E9WA 9PCYA 2PCFA 2EIJB 4KOCA 4DP6X 5B3SB 3JT2A 3X1EA 4YSPA 4AX3A 3IBOA 5I28A 1JZJA 3NJFA 4BWTA 1J9TA 2P80D 1OOWA 3T6WA 2PPEA 4YSCA 2GHZA 4G72B 1F56A 1AS6A 1RCYA 3U25A 3ZIYA 4YSSA 4EF3A 4CSZA 1E67A 1GY1A 5B1BB 1AZRA 4HHGA 2XUWA 1J5CA 3ABMB 3S8GB 3FQ2A 3FU8A 2LLNA 4GXFA 1ASOA 1GY2A 3WNJA 4ZK8A 2BP8B 2UXTA 3NYKA 2PP8A 4A2DA 1JERA 1AIZA 4JKNA 1ET8A 4DP7X 2DY2A 5TK2A 2GB2A 2QDWA 3G5WA 4E9TA 3UACA 2BZCA 2OJ1A 3ABGA 1ASPA 1RKRA 1AZUA 2Q5BA 2YAFA 3AZUA 3NJKA 3QQXA 5I6NA 4F2EA 1PLCA 4DP8X 2DV6A 4AKPA 2BP0B 1AG0A 1GS8A 2XX1A 3FSAA 2ZONA 1AZBA 4N8UA 1V10A 1NPNA 1TEFA 4DP0X 4HIPA 1PY0A 2BP8A 3FQYA 3FT0A 1NINA 4KNSA 2X88A 2HRHA 1N70A 2E86A 2TSBA 1CURA 1PZAA 5I6OA 4L0PB 2YXVA 1W8EA 4DP2X 2YAHA 2H47C 4E9SA 4YSTA 3S3DB 5I5MA 1DZ0A 3NP3A 1KDJA 1NDTA 5B1KA 2PPFA 3ABLB 2BHFA 5IY5B 1GS6X 4HAKA 1ZIBA 3UAEA 2PP9A 1NWPA 3S8FB 1JVOA 5F7BA 1IUZA 1BQRA 2J5WA 2AANA 3QJTB 2WO3B 4P5SA 1JOIA 3OMIB 4P5RA 1KCBA 1L9TA 2R7EA 1GYCA 3X1BA 4GY4A 4YL4A 4A66A 1PCSA 2RACA 2I7OA 3T6VA 1RZQA 1WA2X 3ABKB 3PPSA 1ETJA 3X1NA 3QPKA 2AVFA 1IBZA 1KYAA 3NSDA 1ET5A 4M4RB 1ZPUA 1ZV2A 4E9XA 3NJJA 2YQBA 5D4JA 1OCOB 1W6WA 3JTBA 2Y69B 5I6PA 4KNUA 2HZHA 3CG8A 2IDFA 3PXLA 1IKOP 4A2HA 5D4HA 3WIAA 3FU7B 4HCIA 1ZIAA 3GDCA 3QJSB 2W88A 3DIVA 1ADWA 2HX8A 1L9PA 1SDDB 2MRYA 5AZUA 1QHQA 2DWSA 2HLEB 3AY2A 2XXFA 2I85A 4YSOA 1JZHA 3ERXA 1J9SA 2W8CA 2XX0A 3UGEA 3EHBB 1JZEA 1OF0A 1XB6A 3NJLA 5I5IA 4Q89A 2ZOOA 4A68A 1SF3A 5EHFA 3NSYA 2CALA 1M57B 1V54B 2PLTA 2YARA 2CUAA 3BQVA 2R7EB 1NPJA 3PAVA 5I6MA 5D4IA 3FU9A 3FYEB 3TA4D 1UATA 2XYBA 3H56A 4G7QB 1SJMA 1BQKA 2B3IA 1MG2C 2DYRB 1OV8A 1WS7A 2N0MA 2VW4A 1WAEA 3IN2A 4Q8BA 1MG3C 7PCYA 5I5JA 4DP1X 1DYZA 4NERA 5PAZA 2GI0A 3KW8A 2WO2B 3X1FA 1NIBA 2HXAA 3KW7A 3V9EA 1CYXA 3N2JA 3X2QB 2IDSA 3S3BB 2VN3A 2XU9A 1PMYA 2FQDA 4DP9X 4QLWA 3UAAA 1QLEB 2PPDA 1BAWA 2NRDA 3L45A 1MZZA 4UAHA 2BP0A 3EF4A 4WKXA 3OM3B 5AKRA 3DKHA 4YSEA 2Y1AA 1BXUA 2IDQA 1IC0A 4GYBA 4YVNA 3HEIB 4G70B 3T6ZA 4YSAA 2YAMA 4FAAB 1NIFA 1MZYA 1WA0X 4PCYA 1L9QA 5I26A 2FT6A 1BYPA 1AACA 2BW5A 1VLXA 1OCCB 4A2GA 5LDUA 3IEAA 2H3XC 1AOZA 1E65A 2BO0A 3ASOB 4AKQA 1JVLA 2X87A 2YAPA 1KBVA 1QNIA 1W6LA 3NJIA 2IWKA 1J5DA 4KO6A 1ILSA 4KOBA 3TBBA 4A2EA 1FFTB 2HX9A 2WSDA 4NB7A 2ZWNA 1GR7A 3GYRA 4E9YA 1AZCA 4AZUA 3SBPA 1SHXA 1PLBA 2UX6A 4KO5A 1X9UA 3OMAB 2FQGA 7PAZA 1J9QA 3ZBMA 1PLAA 1N68A 1XB3A 3H4FA 3DTUB 4DPCX 1GW0A 3TASA 5B7MA 5B1AB 2UXGA 1ZDSA 4GP8B 5TK4A 1GSKA 4UF7C 3RYMA 3X1GA 4F7KA 5ANHA 1KV7A 2H5UA 1I53A 3NJHA 4X4KA 4G7SB 3SBRA 2XWZA 3OMNB 4G7RB 1BXAA 2CBPA 4HCFA 3N55A 2IH9A 3H4HA 1L9SA 2J57A 1WA1X
chains in the Genus database with same CATH superfamily
1B6UA 1GOGA 3QAQA 1QEXA 4PJCB 5AYUH 3WFCL 4AGLA 2EXWD 4I9WE 2LGNA 4X50A 4F7TA 1QASA 4ODVL 5EPMB 4UUJA 3NIGF 5D5MF 2CZNA 5GJTL 4AQEB 3S88L 1ACZA 4H8PA 3SBWC 1M7XA 1V7MH 2VM4A 2BSSA 4HKJB 5DUPH 3V0WH 1QFPA 1XCTA 4JHWL 3QDJE 1IM9A 2DTSA 4YZFE 2WHVA 4GKNB 3ZZLA 4JO2L 3JTSB 3B9KB 1A1NB 3H6JA 2P5WA 1UVQB 3UYRL 2VN6A 3O6KH 3MRFB 3HPLB 2XVKA 4AQ1C 1KXHA 3LKSB 5IB2A 2A7BA 1BVZA 2PCFB 4F5CA 5F1IA 5HYJA 4RRPA 1QRNE 2P44B 1WP6A 1H3VA 3W39B 3AROA 5F7AA 1KWKA 3OC5A 4RGOL 5LNDA 4HIQA 4HS6A 4YSRA 1ZVSA 2P5WD 5G4MA 3ZL1A 4R8WL 5A16B 1AXTL 5T5NG 2HH0L 4XCEA 1AR1B 4M61B 4XNMA 2ENSA 3HLAA 3QC6X 2X4PA 3QR0A 2FTAA 4JG5A 3CMOL 4LQ1A 1GKEA 1FYTB 2YFNA 1RJZA 1UZGA 3G6DH 4JFEB 3D07A 4W6WB 1NFDA 5DT1H 4L4VD 1A65A 4KV5E 1DN0B 1CD0A 1C5BL 1LP9A 3DOSA 2BY3A 3DV4B 3FW6A 5JQHC 3R1GL 3BUQA 4NUQA 4PGJA 2W94A 5G2NA 1HHHA 1UASA 2BIOA 3IGAA 1UOKA 5IMKB 4N0YH 5DEFB 1MSPA 3UG4A 2XY1A 1EEYA 3JVGA 4JN1H 5FCUH 1IQWH 3DVGB 2FH8A 3VX1A 1OCZB 3GJEB 2EYSA 5J6HB 2EO7A 4MXWH 2AXGB 5PCYA 3LH2H 3OLDA 3OKMA 1ZK9A 2AXGA 2XV0A 3LHPH 4C58B 2AEPH 2WYIA 4RQQB 3DUSA 2VM3A 1QBAA 3IDYC 1T0OA 2VDNH 2VXTL 4N8CH 3ILQC 5DJCA 5E6IC 5IWLA 5J9PA 1KGYE 5CCHE 5TPWH 2R0WH 1PAMA 3LRGA 1CDBA 4UM9B 3KWUA 4R6UA 5DJ0B 2ZNWA 3X3GH 2G3XA 2QDVA 2G9KA 3RNQA 4OJFL 5I1GL 1ZE3H 1JYNA 4OLXH 1A7RH 1IC1A 3GIZH 3CZFA 4OJEH 2OXHA 4JFEA 2NTFB 4LHUG 3QXAA 2WWKO 1QTSA 4HKBB 1RZIA 5DZLA 3NZSA 4UTBH 3FF7A 3BUTA 3NQIA 4PJAF 4KI5C 3GRWA 4QRTA 1A64A 2AF2A 5SWSE 1QFWH 2DI7A 2WC7A 2D31A 2R4SH 3KPNA 4K5PA 4RRPM 3GXUB 3WLBA 1RZ7L 2VISA 2YD6A 4G7VL 4Y16B 1QI3A 3BMVA 5CFAA 4LCCC 1GGBH 1OTSC 2WUBL 4N0FB 4XCYB 2EDWA 2X4NA 4Q9RL 4ZX3A 1BX2A 4C4KT 3GJFK 3UC2A 1RI8A 2CO4A 1A4BA 1C08A 1NH6A 4WENB 4G82A 5IBLC 3BVNA 2VLRD 3P3SA 1UB5B 4X6DA 5CEXB 3L9RB 3DPDA 2GPZA 4EZMA 1NMAH 1YUHB 4NHUB 1IU1A 4A04A 1GVIA 4ORZC 3AJ7A 3MUUA 5KJRH 2WNGA 4MNGB 3SN6N 1QACA 1JPTL 3G08A 3K74B 4NP9A 4EE2A 3TIEB 3F04A 1OCRB 2NLJB 1FRGH 1WEJL 4FZEL 2NY5H 4BH7A 3FT2B 1CF1A 1WRFA 3U30C 3RZCC 4GI8A 3L3JA 3PAUA 4FFYH 1A6AB 3LEYL 3GBNL 4MZ2A 3DRTA 5ICYB 3TBSA 2E4FA 4BFNA 1NBVH 4BELD 1ODUA 5MEND 1ES0B 4HUUB 2GSIA 5FF6B 3TNNA 2R56H 2YRPA 1DLFH 2HKHH 3NCMA 2J6EL 2V2WB 1BF2A 1T83A 1J9RA 3TN0B 1N18A 2CJUH 4EI6A 4OFIA 3IDMA 3UMTA 2E56A 3L17A 3MLVH 5TDNA 1SM3H 2EICA 4YNYB 3H2QA 3QDGE 1ZTXH 2A5UA 2IAAC 1E42A 2ESVB 5HVHC 3AMKA 1SY6H 2QJDA 4YOKA 3H3BC 2B15A 3Q1EA 4MDJA 4UANA 4Y5XC 5GS1B 3L08A 3TF4A 2AXFB 2V2TB 2J7LA 3ARYA 5C70A 2ROYA 4EDXB 2JXMA 3OXRB 4OT1L 3H2PA 4YUEH 1MHCA 3V0GA 3H55A 2DM7A 4AC2A 2K4WA 1S9KC 3KGSA 3CIQA 4BV1A 2DZEA 3M17B 2Q8BH 1XTLA 2OMUA 1XMWA 4I2XB 2YFOA 4DCQB 4WEMB 1SOXA 3O0RH 4YO0B 3D85D 2WAHA 4I7ZC 4ZOCA 2Y3AA 4Y19E 4A37A 4IEFA 3HR6A 4IDJH 1N19A 4PJBE 2AMGA 2C9AA 5KOMC 3RZCB 3UZEC 2ATKB 4NZDA 3QH3B 5JPNC 3GDBA 5DHEA 3T2OA 3BFWA 3LZFH 1XX9C 5FO7B 3QYNA 4IOFC 4JZJA 1WV7T 3TO4D 4HCRA 3BGMA 4GT7A 4X7FC 1TIUA 1KCKA 2APFA 4MSWB 5DYOB 2YBGA 4PI0A 1XD0A 5KYXB 2FB4L 2GJRA 3KYMA 1RK0A 2VZTA 3CK0L 3MV7A 4QRPE 4ZZKA 3WV0A 4NUJB 3QZWG 3UACA 1KPVA 5IROA 1UJ3A 1J8HD 3R7QA 3ARRA 3HBPA 3FOMB 1BJ8A 1LYQA 1RZ7H 1YMMB 2Q5BA 3LAFA 3ETSA 4Q52A 4XVOA 5DJAB 2FCBA 2FZ3B 4OZHA 4F57H 1IV8A 3OG6B 4K7FA 3U83A 5ICZB 2JLLA 5FKPA 1PZ3A 2IO5A 3B83A 3QPXH 3FFCE 4HEME 1MCKA 2OPCA 4Z7WE 2IPKB 1OPGH 3TJEH 4LXFA 3HN5A 3NCYP 1A1MB 3V95A 1JZ4A 3HG4A 4GAJL 1YEKL 5BUPA 3FUJA 2XCMC 1KLFA 1TJGL 3HVDA 3LXAA 2CJTA 3C9NA 3N1MC 3EYSH 3NIGB 3DECA 5BJTB 4HXBL 4ORGB 1P2CA 2WTRA 4PCSA 1CL7I 1J05A 2Q7NA 4LHUA 5I5MA 1NDTA 4UM9D 3ABLB 5B1KA 2NT1A 4O2CA 2FECL 3CSYA 1YEFH 3OJDA 4ZRGA 3C5XA 3B7TA 5AQ0A 3WKMH 2XWBB 4NZFA 3NH7L 1MFVA 5I1EH 4N8CL 1X5YA 1IUZA 3TYFA 4LCVA 4WDIB 2QMJA 5AYTA 4Z5RB 5EN2A 1FVDB 2WBJD 2WKOA 3PF2A 1FCGA 4HIHA 3I75A 2AABH 5AD0B 5EDSA 1BREA 5EU6B 4MJIB 4H88H 3WFHB 4XP1L 1JHKL 2YLHA 3QQDA 3H9YA 4JG1L 2WOYA 1BXXA 3FUDA 4PPTA 3NPSC 3NMEA 1QTPA 1SOQA 3KLAB 4JEGB 2P7TB 4Y19A 2VN7A 4JO8A 3QNZA 5EO1A 3V9FA 3NEOA 1AP2B 3IJSB 4UZUA 5B21A 3BZDA 1MCWW 2HZHA 4D8PA 1BF8A 4ALAC 1V8HA 4HHAA 3IXAA 4OI7A 2ENJA 5D4HA 4R97C 5DT1L 3NIDF 4P0DA 5ALBH 2ZSWB 2NW2B 2W88A 1H3GA 4Y89A 1YO4A 1TPXB 2HX8A 1AJ7H 5E1AA 5J13B 1AXSB 2DWEB 3MNZA 2ED6A 2MQGA 4JRFA 3CSFA 3EXLA 5IESH 3BAIA 5D1QC 2XX0A 4IJ3C 4DEUA 3OKDB 1R3KB 1JPGA 1AKJD 3BKJH 5G5DA 4MXVF 1BJMA 3FQTA 5L4IA 4QHLB 3K4AA 2YD4A 4FXGB 1IBBA 1T7ZA 2ZOOA 3GM8A 3VGBA 2KLSA 4FZ8L 4Z7UA 3MLPA 1ZHLA 3V4VA 1PZ2A 3CPLA 3NFPB 4GMTH 3ZTEA 3TYGL 4QJ4B 4TULL 1B4TA 3FYEB 4AYMC 1SJMA 4P9HC 1BQKA 1AI1L 2HT2D 3RWEA 2QKIB 2N0MA 3DUSB 1ZLWH 1YNTA 3IN2A 4WFED 3BE1H 5J57B 2FR4B 4EQ3A 1D9KC 4YXLH 5MERA 5EU3B 2EDKA 4PWJA 3F85A 1E4HA 3GHBL 2ZCKH 5GIRA 3K6NA 1MI5A 4NERA 1FIGH 5E5LA 4OJCA 5I0WA 5LNGA 2EQDA 4AWJC 5SWSA 3AT9A 1FGVL 2W92A 3QI9D 4GPVA 2DIAA 3NACL 3SKNA 1X4XA 2W0KA 1SQ2N 1EUUA 4IGBD 3NZ8B 3GI9L 5HGDA 4XP5L 4K94C 3GPSA 3QUYB 1ND0B 4LLYA 2F7IA 4XN5A 1G0DA 2J8UA 2OTUB 4O2EA 4Y1TA 4LBEB 3BGAA 4MB4A 4POUB 5JIQA 3OVUB 1NFDB 5CO1A 3HBZA 2WWKT 3P4OB 4KX8A 4XB7A 4YE0A 3TH4T 3E8UL 5SV4A 1RZKC 4R9HA 4XN2A 2XKSA 4M61A 4KK5C 2W81C 5IF0A 2NT0A 6TAAA 2ZXCA 3BJ91 2VDKL 4L8DB 1G1OA 4H8HA 4D0DA 3TEXA 1MHHB 2LT9A 3O3DA 4WUUB 1MZYA 4MRBA 1P7QD 2WSKA 3ROLB 2NXYC 2XKNB 4IHOA 5AG9A 5E8EA 2WY3B 2XZAL 3T77B 3RUGA 2IPUK 3UJIH 2VC2H 2WM0A 3L1GA 4N1CA 3ARZA 1I9IL 4G6JL 4DGVL 2YD7A 2OR8A 2WSDA 3E2HC 4XVSL 3FHEA 3T0XA 3RRQA 4L9LC 4AZUA 1TTGA 3B8YA 1IM9B 3O6FB 1T0MA 1X9UA 2BRRL 4JFHE 5C09D 1SRDA 1XIWD 4WTXA 4R96B 3X14A 3MYJB 4HLZG 3K80A 4YHNA 1KJMA 2YC1B 3PRZA 2COVD 4H8UA 1MW3A 2EDMA 4N6RB 4RDBA 5BO1L 1S3RA 4GG8B 4PRPD 5JHLL 5E08H 3QI9C 3OAYH 5C1MB 4JZNB 5HDQL 3TVMD 3WS3A 4JM2C 5DSCA 1BBJB 4AQAA 2OQJB 2VLJB 1IFRA 1TZIA 1YAIA 4TNEA 1C1EL 2FUTA 3ZDWA 3T2QA 2Q76B 1TCRA 3TURA 3AXIA 3BPNC 4MMXA 4LLWA 2A77H 5C08A 1UB6B 2DMHA 4PS4H 1MRDH 1TKWA 3GSNB 3ZZSA 4RMTA 1QYGH 2WTPA 4PRAB 3CZNA 1L6XA 1WBZB 3MBWB 1XT5A 5DHDA 5DMGC 2LABA 1KJVB 1U8QA 3RURA 4X0KA 4DN3L 3SO3C 4B9CA 5EU4B 3HI6L 3VH8G 1S9VB 4QRSB 4W9ZA 3AVEA 3FT3A 2C9XA 1RP8A 3L7FB 4QHMB 4WW2F 3RKPA 5I1GH 3GSNH 3L4UA 4QTHB 4QXGL 5FYKL 1HT6A 3CZJA 3VW3L 3IDGA 4X6CB 4PRID 5E08L 4F7MB 3KM1A 1RPUA 5CZXC 1JNNH 4FC3E 5JPMB 5IK3B 1KBKA 3KWVA 4JRXD 1RVFH 3T9WA 3BT2L 3WFBH 5FA4A 4TSCL 5I73C 4PJDE 1JXFA 1HHIB 1RAMA 3DDFA 4K15A 2DJ4A 4N3UA 2DMGA 4PJ6A 3WJLC 1DANT 3ZX1A 1FWXA 2V5YA 3O3AB 3DYPA 3Q5TA 4JQIA 4V33A 3MUHL 4A2MA 1XVSA 5T1MA 4E9LA 4A7GA 5J0BA 1PGRB 1TT6A 2HG5B 5F2FA 3D69B 3QIUB 3N91A 4MHHG 5IB1A 5HTSA 1TQVA 3L54A 5I1KH 3WKPA 1HESA 1QNZH 4NIKB 3RA7H 1UZ8A 2DWXA 3GT6A 1Z9MA 3PQYB 2OP4L 3GEWB 5EA0H 1CFSB 1WBXB 5DMIH 5GZOC 3WFZA 3DMMD 3EGXB 5JYLA 1N5AA 3NCXA 3STLB 1VADA 4S2SA 1RUML 1YYCA 3PL6D 4KFMA 4H8WH 5LN8A 1R33A 1T5KA 3LQZB 3MI6A 3Q8BA 2VDRL 2IEPA 2NR6A 3DX7B 1ZV5A 1FSKC 8PAZA 1FL5A 1VGEL 3RILA 3GHEH 3BFQG 2WZ0A 3I02B 2AJYH 4GQ9L 4JFOB 3CQQA 4KTGA 4QXVA 3UJIL 4DFIA 4JVUA 4YX2H 1YEIH 5IF0B 3W0WB 5D5ME 4Q7DA 3L13A 4GRWH 5AOJA 4ERSH 1I1YA 1BEXA 2DMBA 4OD2A 4GOSA 4MAUL 3A4AA 1X5KA 4U4IA 5E4EC 4G80B 3WNPA 3PWJA 1V3JA 3HJ0A 1XZ0A 3CCHA 4NI3A 2IAND 3EO1A 3TT3L 3WLWC 2FJHA 2HKFH 3T1FA 1MJJA 5DJXA 1W72A 3DYMA 5IHZA 4PAZA 3B9AA 4AGQA 4XC3L 4JPWL 1UXWB 3QUXD 4DN4L 3S35L 1UHVA 1NM4A 4IW4C 5SWSB 4PRHE 3ECBA 1GPOL 4PRDA 5L9DH 5E6SB 2XV2A 2CDGA 4ODWB 4CW1B 4DO5A 3RGVB 1FLRL 1CGYA 5LWYH 3ZKSD 3HTLX 4YK4B 2C34A 4HXAH 5D7KD 5JZ7D 3CN3A 1HS6A 5B7FA 1NIEA 4IOIB 4WTWA 5A3ID 4KK6D 1PNDA 1CLZL 2K4AA 4MJ6A 3B9EA 5FW8A 3P69A 3RL1B 3DMMA 1DUYB 3QPQC 2J5LB 4LQFH 2CGZA 2KDGA 2OV0A 4CVWA 1E8XA 1DE4B 1AI1H 2BIQA 3SPVB 4PJGA 2D3VA 3G5VA 3K8KA 4ECNA 5ABDE 1HXMB 2B4CC 3BDYL 3D0LA 4TULH 2PNDA 1XSIA 1E9QB 5D6CB 3NEEA 3EIFA 1KJ3H 1D7DA 3NABH 3OKDA 4AYDC 1ZHKA 2ZWSA 4NKQB 3RP1A 43CAB 4J3BA 3MLRL 4NO0D 4P4KB 2FATL 3HB3B 4XAWH 5T1KD 1OAZH 4EN3A 4RAHA 4GRWB 1TNMA 4K9JA 3T1FB 2LU7A 3B34A 5C09B 3FT9A 4OF7A 3CCHB 4YLBA 1NCOA 3WIHL 3MTRA 1PBYA 2K9FB 2RCSL 3QFJD 1ZVHA 4B7IA 5GSRB 2R2EA 3MRCA 4Z8FL 3NQKA 3QNZB 5EO1B 32C2B 1OP5H 4PJIB 3RI5K 4NBZB 3PJLA 4JUTA 4ZAKB 4UTAL 1B2WH 4J6RH 4XO9A 2IOOA 5MP6H 1R1CA 1G7JB 2EYRA 3QWRD 3UP1A 4WW2A 1F42A 2BCKA 4WCYL 2A9MH 1EEZB 2DYPB 4KOCA 1PZ5A 1L7IL 3D18A 3ILPA 4H88L 5CEYA 1KN2H 3D4YA 4XB3A 4ZMXA 3CFNA 4JFZH 1K3IA 2WWMC 1IVTA 4PRHB 1PU0A 1CDIA 2V7NA 3QPQD 4ZOAA 5E95B 4CU8A 3HG3A 2UUDH 1T7VA 3ES6B 2JIXD 3BWZA 1RZ8B 1FE8H 2ZTBA 1UD4A 2V7HA 1AS6A 4AJVA 4WW2C 5EUKB 2XN0A 1E67A 4PJFE 1HQRB 2BIPA 5E2TL 5LXGL 4XX1E 2EDBA 2M2DA 3MUGB 2VUKA 3EYSL 3INOA 5B22A 4JJ5A 4M4PA 3GZKA 3ZUCA 2BFVL 2X2HA 5EEYA 2EH7H 1AIZA 3MBEA 3VD4A 1AKJA 4R4ND 2IBBA 4FTVD 5E24E 4MD5A 1HYRC 4KJPD 3AQDA 2DQGH 1P7KB 4PGEB 5HPOA 4ES8A 5F7MC 1EBPA 4NQTA 1U3HC 5IK3A 2NX5B 3BRDA 4XAKE 1RK0B 3BAJA 3QCTH 5F9OH 1WQVT 1QLFA 5K93A 3REVB 5C9JA 3ULVE 1NFIB 2BP8A 4L3EE 4P4RA 3I02A 1S4IA 5JYMA 3NAAL 1XGZA 5TJWK 3DPBB 1PZAA 4Y9FA 3DX7A 2VYRE 4MD4A 4Q6KA 4ZBJA 3WN6A 2DBLL 4ONFH 3STBA 3P0YH 4KK9C 5T1LD 2B9AA 5DRXB 3P0YL 2O30A 4FQ2L 3RZCA 2YD5A 1QSEA 1YYML 1SY6A 3SGDI 4G6FD 3OSKA 4LPTA 3UTSA 1WDAA 1XZWA 5F97E 3UO1H 4KKCC 1SLUA 1GS6X 3VWJC 4HC1H 5CZVL 1ZIBA 3GS7A 3TEWA 3SEPA 3UAEA 1K2DB 4XVJL 1FZJA 5D7SH 2KLTA 1YC8A 3N6YA 4MMXB 5IG7B 4DVRH 2R2HB 4QHUA 2HB0A 3MLVL 4IIQB 4E5XB 2YMOA 2EXYD 4Q0XL 1TZIB 1BV8A 3QA3B 3KXFA 1WLHA 4YHLH 3QZNA 5C08D 3ATEA 3T6VA 2R0ZL 1XR8B 2XWCA 4PRPB 3PPSA 2X89A 1AY1L 1O9WA 2EC9T 3CHOA 3LRLA 1LO3L 2X4UB 3PYCA 4LCYB 5EEXA 1JNJA 1YA5A 3N43F 1MH5A 3VB8A 3WTYA 1MFCL 4X9FA 2CH8A 2WZ6A 4FMFA 3A22A 4FADA 3MXVH 5FA4B 3CU7A 2APTA 5FV2A 4KRPC 3RY4A 4FFWC 3OHXA 4UZSA 3QJSB 3W81A 1YDPA 1YEGL 1ADWA 2JJTA 3OF6A 3MLUH 4JKLA 4YDNA 1QHQA 5ANMB 3FFCD 1VFAB 3NESA 3VCLA 2CU9A 3N85H 5BCAA 3II1A 1JJUA 2EIBA 1HNYA 5DRWA 4JDVA 3ILDA 2BSTB 4HJSA 5DS1A 1P7QB 2IADB 4FYSA 4OZGB 4RX4A 5I76B 3PHAA 4NQEB 3L7EB 1U33A 3UZQB 4WUUD 2Y7NA 2E7LA 2K7PA 3KH3A 4ODXB 5FGBA 1IQDA 1XH0A 4OW6A 5KVDL 2EDQA 1T5WA 1UUSA 5LXGH 4KMQA 1WBZA 4HLEA 3UTQB 3GFUA 3IKCA 5D4IA 5GGUA 3TWCH 3HE6B 1ZA6B 5JW5B 2R2HA 4QHUB 3RQ3A 3A24A 4MA3A 2HN7B 3ZDZB 1JN6B 2E5EA 4PVBA 1N2RB 4TNVF 1JZDC 1KB3A 2K0RA 2PW2A 3L4XA 2CGYA 2JJVA 2OMYA 3MJ9A 4LBEA 2E7MA 2NQCA 2WK2A 3L1OL 3MRQB 4KRNA 4ZYKA 4JZOB 1SVCP 5JMOC 2OMZB 4XPFL 3PU7A 4WCYH 2WWOA 1X5XA 3EYFA 4S1QL 5I16A 3V9EA 1WAAA 3MJ8A 1CYXA 1Y7VA 4OFYD 1GKOA 2VISB 3F7VA 1NEZG 3KS0J 2QTVA 5F7KC 2VN3A 2EH8L 3VB9A 4E41D 4HAGA 2YC1A 2W95A 4S1SH 5EU3A 3BRFA 2WQWA 4N2IA 3UAAA 4Z77A 5D2LF 3BD5A 5C3TA 2C9QA 1KB9K 1EHAA 3B5GA 4X7TB 5KZCD 1KXVC 4WKXA 4RCAA 3V52L 2X40A 3C6LD 1MFDL 5CZRA 5B39A 1UM6H 2G9HB 3AFLA 1CLZH 2NSQA 3RTQC 1EFXD 3LZQA 3M6DA 3DI2B 5EF2A 3IVKB 3VQMA 3ZR5A 1ETZB 1DVYA 1N64L 4PY7B 4J3OG 1J5OH 2Y0SA 3CTTA 3WS6C 3MHZA 5ITFB 3LOWA 4AKQA 1UKQA 4U0RB 5KVEE 3DO7B 1F00I 1I82A 1TETL 1KCUL 3V6BR 2P49B 1KJ3L 1HOCA 5HJBA 3F12B 4Z3HA 5C97A 1E4XH 4PRIB 1N26A 4FG2A 4ICXA 3O45B 4MQTB 3IJEA 4JKPL 4P5TA 4KO5A 4LLMA 3DHUA 3AABA 5DUMH 2EYSB 5J6HA 4ZFOL 5GGSY 5GZOA 2DQJH 3LQMA 3WY2A 1B0RB 5GGRA 3TASA 4LIQL 5DXWA 4EOWH 4GI9A 1N6VA 1NBYB 3US0A 4MXWL 3ILPB 3IJSA 5I8KL 4LLVA 1O6SB 1K9TA 1I7RB 1L7TH 2P7TA 4ETQA 3MV01 3GMQB 4HWNA 4ZQKA 2CDGB 4ODWA 2NY3D 5IUSA 1E0OB 1IFHL 5TE7H 2HTLC 4FLHA 1MAJA 4KH9A 3S34H 1FYTA 3DBXA 1PD1A 5LHDA 1KYOK 2AERT 2DLEA 1A3LL 1C12A 1OK8A 2D7PA 4H8WL 4UQEA 1A8JH 1HVXA 1TFPA 5BOPA 4M7JL 4XNBA 2EEFA 1MWAA 4P07A 2ADIA 1UGNA 1T6VN 4F7EB 5DMIL 5EA0L 4PU2A 1CGWA 1PJ9A 4HSCX 4B7LA 2ZXQA 5EO9B 2BWDA 5K1JA 3V4VB 4HGWB 4AH2B 5KS9E 3RJQB 2DOCA 2L8AA 4PJEB 2DS4A 3GXMA 3GMLB 4OLZL 2Y1VA 4FRWA 3CXDH 2FHFA 1NDGB 4ZFGH 2ZOLA 3UOAB 3DV6A 3V4LA 1Z66A 1YNTF 3MFFA 4O4YH 4F2MB 5JR1H 5HHMB 4HBCL 1MWAL 2DM4A 1KJ2B 1HXMA 4M1GL 2JKNA 3H0TA 4HJ0D 2UZYA 4KQ4H 2FLRT 4WWPA 5E94A 1J12A 4E9QA 4FG4A 3EGXA 1VAHA 1FAIL 4NQXB 4OZFB 3G6AA 3CFCL 5CLWA 2FSEA 4R7NA 4EUPH 5F89B 2GJZA 4AZ8B 3BVTA 1ID2A 2WXHA 5BOZG 3OQRA 4PJEE 1MREL 3SY6A 2F19L 3IBEA 4FTVA 4PGZA 1YRKA 5CINH 3CHSA 4PRDB 1SMOA 1NA8A 2GT9A 4ZUWA 4M43H 2PETA 3UL4A 1RH8A 4AVJA 5FYLH 2E9WA 2FYYA 4U4BA 5BUAA 1MUJB 2L7QA 3BWAA 3NVQA 4FQ1L 1KGUA 4CBPA 4Z5RA 4JPIA 1O9ZA 2V9TA 4Y0GA 2FJHB 4PBVC 2BW4A 4NBYB 1XZ0B 3WXVL 5DZVA 3FZUD 3P77A 2ZYHA 4UYPA 4YO0A 1H0DA 3OKEB 2PXYB 4PLOB 2QVKA 4B3VA 4GIOA 4WK0B 1MKFA 3SDXE 2XBZA 3N1GC 3VDCA 1I75A 3MRRA 4WI0B 1G7MA 3PIQB 3MOAL 1AQMA 2GK0A 3TC9A 3SDDD 3NJVA 5H2BA 2J25A 2XSKA 4XMZA 3IKKA 3W9EB 4O02L 3VDBA 3QJVB 5BMFH 5KBDA 1BMWA 3FU0A 2H6PB 3O11B 4R5XA 5IMLA 1WBYA 4QOKE 4PJ8A 5D70L 1CFMA 4NQDB 3TU6A 2CLRA 4HKZA 3ZE1F 2VZ3A 3O2DL 5F7LB 4RNRB 3AU1A 4KK8D 5CJQL 5E4EB 3ZR6A 1ZXKA 4HIEB 1BGXH 5G55A 3PREA 2C9PA 1J8HA 1TJMA 2ZP9A 3WFDH 3DJ9A 3D08A 4JM4L 4G1MB 4PJAA 4EI6B 1KENL 4WV1C 4N1EA 4OZIA 2Q10A 4PMEA 1T1YA 1LE5B 1HXKA 3B9KD 2DLTA 4NSKB 3CVIH 3HZVA 1HFUA 1IBYA 4PJHB 4I4WB 1YNKL 2VLJA 3ATDA 1IC7L 3FRPA 3KM2A 3NPZB 2QFPA 4NIYE 2D7TL 4KKLD 5CGBA 1B0GB 1IGML 4HZ1A 4YAQB 3AS2A 3LTVA 2EVJA 4K73A 4F8TA 4WV1A 4GXUN 4NQDE 3F7KA 3OAZK 2VTFA 3NFNA 3TIEA 2GUOA 3KCPA 3BPLB 3NCJH 4YHNB 4PS7A 5EZLA 3MV8A 1PPIA 2Y7SA 4PJBF 5GGVL 3OD3A 3VG9B 3A6BL 5MHSE 5KSBA 3DHMA 2GIMA 3NT0A 4RSYA 3RZWA 3MV8E 5IV2A 4QLRA 5KYUB 2DLFL 2E47A 4JDZA 1WHPA 5FEBA 3WKYA 5DRXA 1LO3H 1IM3A 1SF5A 5IW6A 3F7RA 4QCIA 2X1XR 3GKWL 1LTXA 4XWGL 4P3WA 3V0EA 2I25N 5KVGL 1S3KH 5B8CB 2FX9H 4MASA 3SDAA 5FA3A 3ZRFC 1W0WA 2D3JA 3WE1A 2GJ6A 3HN8A 3LIUA 3N42B 3LIZH 3QUML 4MRCA 1K8DB 3L1FA 2YXWA 4NJ9H 1U6AL 1KCRL 3ARGD 2VDRB 3EH1A 2V37A 2X2UA 3SY0A 3K6DA 2WVSA 5EIIA 5T33L 2O5NA 1HE7A 1BAFL 1L0XA 2KZ1B 3ZYZA 4D0CB 5I0ZA 3S6CA 1NZRA 5L4MA 3PGDB 4PLKC 5J11B 3BLBA 2X05A 3B7RL 4NUGL 1QPPA 4RLDA 4WK4B 3V79C 4HGMA 1IKNA 4L29B 5DR5H 4HQQH 2BNRB 3NIFF 2CDFA 3M1CA 4NCDA 4AW7A 3QEUB 2EDXA 4XGZB 1HHGB 4ZJ9A 3ARDD 1U95A 4LCWB 4GBXA 4EPSA 5T3XE 1MCRA 4J3OF 3HN3A 3PDOA 4AGNA 4QRFA 5K9QI 1J9TA 3J8F7 2XKUA 1XGPB 4R7NB 3K2UL 4N8VG 2NY1B 2XYCA 2YGNA 5LBSA 4QYAA 3CFTA 1KPUA 3RHWF 4ZD3H 1GY1A 1TZ8A 2P8PA 4YWGL 3D3VD 4FZ8H 4Z7NB 1IC4L 3ZL4L 4AW4A 5I1JL 2CM5A 2MQCA 3LZRA 4HF5L 4BZ1A 4KUZL 3VWKA 2CR6A 1YMHB 4FHJA 2Q6WB 4YGVB 4I48B 3MUY1 4DGIL 5ECGA 1JHLL 4TNVK 3G5WA 2VITA 5C0AB 2VDPB 1N7ML 3QHFH 4JQVC 5I19H 2G4EA 5I66B 1RUKH 3ZYJA 3JTTA 4Y4FA 3ARFD 2PR4H 1OSZA 4NC1E 5JMRA 2K6WA 1G5AA 2NQ3A 1QI5A 4ELMA 1AG0A 2VXQH 3ME0B 5HDWA 4AJ0A 2J1XA 3BP4B 2R8SH 1WSST 2DIEA 1T03H 4PLKD 1YMHA 2Q6WA 2BSED 4D8PB 1XWVA 5HVWA 5K1VA 5FFOA 4BQ6A 2A99A 3MV9E 4MBOA 1MLBA 1XGTB 5E99H 4ELDA 4DZ8B 2BVTA 4GUCA 4G5AA 5IQLA 3DGDA 1D5IH 1XH3A 3E9TA 4JG0H 1EA9C 1VZGA 2HJKB 3X17A 4GAJH 2N7AA 3RUGF 2XQYA 3UC0H 1Y6KR 3IU4H 1MCBA 4BFEA 3LNDA 2A74B 3AMLA 1KFGA 1AMXA 1YPZA 3BQUA 3CX2A 4H8VA 1CYGA 1E40A 1LHZA 4ZSOA 3PP4L 1BQRA 2JIXB 3DJTA 4RISH 3P4NA 1HHGA 1NMBH 1YG9A 5LBGA 4MJ6B 4FX5A 3TGXA 1QEWB 1L9TA 3ZQWA 3NFPA 2Z31D 4UBDD 3ZDXE 3OR6A 1Y6MR 1QR1B 4FFZH 1RULH 4KTDL 4YL4A 2AQ2A 4NNPH 1R5VA 2YPLD 2WLNA 2BPBA 1DN0A 1F58L 5AB1A 4DVBB 2X38A 4HJJL 5HI5D 3KR3L 3SZ6A 5AW4B 3VXME 1NDMA 1GIGL 2DQEL 1QBLH 3CLEL 4N6QA 1ZEAL 1V05A 4KNUA 1S78D 4LSRH 4OFQA 5J6SA 4A2HA 5I17A 1CXLA 2R83A 4HDIA 4KAQL 4LAQL 4QHNB 5TTRA 4WI9A 3QFJB 5AZUA 5BV7H 2X28A 2W65B 3G6JB 1UJ3B 1P0SE 1DBAH 1E5UI 2EP6A 1BM3L 1P4BH 4I3SL 4UOZA 4HXAL 5IW6B 1S7QA 1TUPA 5EMYA 3MV7B 3HPLA 3VXSE 2EABA 4R2GB 3BISA 3KLAA 1JZEA 4EBQH 4JW3A 3OKLB 5IEHB 5HHMD 5JHDA 5SWZA 1NCHA 3S97C 4G8GB 4NO3A 3PPEA 1RU9L 2A4ZA 4WQOA 3P9WB 2YARA 3ZHLA 3BQVA 1BF5A 4MJIA 5I6MA 4PJCE 2YJQA 3LPFA 2XYBA 3RWIA 5E9DB 5BS0A 2DMKA 1G6VK 1IAIL 4JZOA 1DN2A 2NY7H 5D55A 4QHKI 2D9CA 2Z4QA 2QKIC 2WLLB 4HCRH 4NRZA 1TZHB 5B38A 2ITEA 4TSAH 1AHWC 3LEXA 4JQXC 1B0GA 3HNTH 4P9ML 4PTTA 3L3IB 5D72H 3CSYB 3OJDB 1FZKA 2CD0A 5I8OL 4JE4B 5FOBB 2Z8SA 3W2DL 1J05B 2OYLA 1EHNA 2QGCA 1T04B 2Q3XA 1OK0A 3F58L 2R2BA 4UV4L 4XBMA 3A6CL 3KW7A 5HI5C 2JXMB 3N2JA 4S1DC 4OFKA 1BJ1J 3ZXAC 4LEOA 5IM7A 3NRQA 3OAZH 4JO4L 3W2DH 2OAAA 1REIA 2DWDA 3QUXB 4QNPF 1I7UA 4NQEA 3WMSA 1DFBH 2JNZA 2BP0A 1FZOA 5GGVH 2Q87A 3QZPA 4OZHB 3DK2A 1IVLA 5FM5O 2FEDC 4HS8H 1SUJA 4LSPL 1DLHA 1B88A 3KD4A 3QO0B 3DROA 4DZBB 3MFGB 3DX1A 2A9NH 2MNWA 2GK0B 3GEFA 3QQ3B 1XAUA 1JGDB 2WXJA 4GSUA 1FN4B 1OCCB 4Y1AB 3VD9A 1IGCH 4M5YH 4JZJB 3MSPA 5E6UB 5I0DA 1S2EA 5DUBB 4ZS6C 4P2OC 3VFGL 5TFSH 3Q0HA 1DBAL 4PB9H 2WB7A 4E9YA 4N0CC 3K8LA 5EZJA 5ILTL 2X2YA 2H7WA 5JOPD 2G0KA 3NIDE 4DEPC 1DJIA 1GAFL 2X1OA 1Z0NA 3H9SB 4KDWA 5LO7A 5IBUB 1VDGA 3IDIB 5EFIA 4DEWA 1U8MB 3IDXL 1N68A 1Z9PA 1BGXL 1HSAB 2G3NA 4Z23A 4LF3A 4U49A 5B7MA 1UB6A 4L1HA 5B1AB 3U7WL 3ULUF 3SKJL 4PW9A 1ZDSA 4XN8A 4FI8A 4XXDB 4DW2L 1ZVYA 2AJ3B 1R5WA 2Q76A 2B2XL 3C5ZA 3CPUA 4KAQH 4PJXB 4Z7UE 2N7SA 1FCCA 2YEZA 2CUHA 2QADC 3N0PB 1TJIH 2AJXH 2F61A 3AT8A 4FTDA 2JB5L 5JHDB 1GIGH 4G43B 4HCFA 4HV8A 4S1DD 3BIKB 4H1LB 2BJML 3STZA 5BV7B 5DSCB 2OMVB 1NUDA 3VYOA 3QIUD 1ZT1A 35C8H 4YHPA 5F6IC 3SCMA 2GJZB 1G1CA 3FSVA 5GZND 1E5ZA 3PP3H 3AS1A 5ETUB 2DL2A 5D1ZC 2PXYD 4MJHA 3F6IA 1P7BA 2CSPA 3EH5B 4KRPB 4MVBC 4UQ9A 5M94B 3MA7B 4X4YA 4PRHD 1XR9A 2J20A 3CJJA 1J1PH 4B9GA 4DPBX 4P3DB 1H5BA 1UWXH 3IGKA 1CDGA 2CRYA 4F2MA 2A9ML 3G5YA 4QDGA 5FCUL 3FQ1A 2WBWB 3P30L 5BOJA 1JGEA 4KNQA 4GP4B 4JY6A 4WFGE 2M1KA 1AZNA 4HT1L 3HFMH 1PIGA 1Y0LA 4DVBA 1IBDA 4XPTH 3FTYA 4P48A 4YE4H 1KEGH 4ANWA 5AFAA 4P2OB 4X5QA 4EMZA 5DJ6B 3ZTNH 3ARED 4FULA 2G60H 1ZMYA 1URIA 1MCJA 4X5RA 4DPRA 3KPRD 4G3YL 5K9KA 1KULA 4L3CB 4K7PY 3I9AA 5EUKA 3VU2A 4B5ZA 2Z64C 4RQQA 1AQKL 1KELH 4GP5B 4JM2F 4JRYE 5TE6L 2HH0H 3TTYA 5AVYB 1ZSDA 3BQUB 1TZGH 5HHME 1U91A 2GTWB 2HA1A 3ES6A 4N90D 3TLRA 1UACH 5ISZE 4NX0A 4RGOH 3U1SL 3KPSB 1E90A 4OGYH 1VFBB 2UXVA 3U0TB 3BD3A 1N7MH 1XSJA 4MAYC 1MWAH 1WWBX 3QWOB 4N25A 4NZRH 4BRJA 3V5DB 3LN5A 3I6LD 3GLDA 4NO0B 1IX2A 2VLJD 3TNMA 3ATBA 3LN5B 3QIUC 3MKKA 1PLGL 4KUZH 2Y3NA 2O61A 1NCIA 2X9YA 2Y7MA 1LNUA 2WXMA 1NC2D 4KXZH 1OEZW 3GWJA 3LVTA 4RFEA 5MEPB 3L3HA 4Y4FB 1KLGB 3I50H 1ETA1 4O02B 4IBTA 3AQZA 1KGCE 3SO5A 4NQSA 3EUUA 2VN5A 3MODH 1F5WA 2AEWA 1UFUA 4EVNA 1SMAA 2BSDA 3QK0A 3PUCA 3KZ8A 2YA1A 4OLUH 4QT5B 2XDHA 2J8UF 4JNXA 2A4CA 1GZQA 3B3BA 4Z7OE 1AGCB 1IAII 2EDDA 3Q3GB 1WCBB 1KFAL 5AENA 5DR5L 1M6OA 3ETTA 5KVDE 3AW5A 1X5AA 1BVLA 3WHE1 3FQTB 2LVEA 2OMXA 2AK4D 4MCZA 2W9LA 4TQPA 1OLLA 4WLCA 5CGYD 5CP3H 3RVVD 4LEEA 4MJJA 4EN3C 3K1KC 1PZCA 2JB6A 2NXZB 3L2MA 3LKQB 2X4OA 4NAJA 3QFGA 5EH1A 4F2FA 2A4EA 3QIWD 5INDA 4FYRA 5LQBL 3M1OA 3US1A 1U6AH 3OZ9H 2GIXA 4X4YB 3ULSB 3OX8A 5C7ZA 2NX5D 2C9SA 5AVTB 5DHXB 2ZSWA 4X5WB 1QI4A 4PFEA 4TKWA 1U8LB 3L8QA 1OT2A 4OLVH 5A2BA 5LJYH 1UXLA 2DQHH 2FO4B 3FQNB 3H3PL 4F7TB 3CHXA 3F5WB 1E4XL 1UCBH 3RWFB 3VRLE 4ELME 4PJIF 3WL9A 3WIFA 5I1LB 5B1CA 3ASWA 4ELKB 3DV4A 4CW1A 2VXVL 5KN5B 3GLZA 2NCEA 5LG1A 3N5AA 3GXTA 4NT6B 2YIHA 3ELAT 1MCLA 3HI5L 4D0CA 2FJGA 1NKRA 4YK4C 3ARUA 2Z4TA 1JN6A 4R26L 2CPCA 2EDOA 3KPRE 2Z65C 5C6PB 5F1NA 1HWWA 2OP4H 3O4LE 4HW6A 3HNVH 5DJ8B 5A2KH 5LLIC 1BYOA 2G3MA 3V52H 3S35X 3LKNA 3PQYD 5IFJA 2AEQL 3AG3B 1XAKA 4TUJA 4XVTL 5A7EA 1TEYA 1BVNP 4AKOA 4XCNB 1YPZE 3SDAD 4O2CB 3OB8A 1FFNB 2APXA 1Z6JT 3F05A 3H42H 3PAZA 5KJ4A 3M7OA 3ZT7A 1QSFE 3CC5A 4B0MB 1E9OA 1XF3A 1VFUA 1Q9WB 3RVXC 4U2ZA 1KDIA 4OQ1A 2G2NA 2X4TA 1X5MA 1UACL 2V2XA 3O6FC 2JK5A 3GTTA 2BM3A 1D9KD 2KBGA 5F9WB 1KENH 1U36A 3GPEA 4WTZA 2F5BL 3U4BH 3H85A 4JB9L 3QJQB 4Z7WF 4GW4A 3MRMA 5D7JC 3RX8A 4X6DE 5DLLA 1JF1A 1XF1A 5D2LA 2EYTB 5AW0B 4Q9QL 4FQHA 3KYMB 5GRUH 5L2KD 4PJFF 4IGBC 4L8BA 2C1PA 1MXDA 4E9RA 4P4KD 2OL3B 1HL4A 4DN3H 4LDLB 3ARTA 2LLGA 2ZQKA 2Z1PA 1JUFA 1KNOB 3OZLA 4EIUA 4ONGH 1NC2B 1X4YA 4KXZI 1K4CA 3QYCA 5DHMC 1BMGA 1JMZA 4IM8A 3X1EA 4NKMB 4TPRH 4F7PB 3MRMB 5GZOD 1A6TB 3KGTA 1NJ9A 4QRUB 4GUQA 4P57A 1HHIA 1KBGH 5IQMA 5FUZH 5A2JH 1D5XB 2GHZA 2NXYD 1QSEB 4Q6IA 3IK2A 4YBQC 1FGNH 4TLKA 1WT5A 2IFGA 2XFGB 4XBPB 1HHJA 5GS0C 3DX6B 1CZ8L 4GXUM 3LNEA 2MCG1 1M3JA 4NUMA 4U1SB 5TH2A 1QZ1A 3RFRA 3UJTH 4A7TA 5FB8B 4JDEB 3LN9A 1L5GA 4IKIA 2DF3A 4WY7L 3OAWA 3BW9A 2BP8B 5FYLL 3O2WL 3L6FA 4JFQB 1M71A 1D7CA 4MNQE 5CCKH 5JXAL 1SHMA 1G7PA 3QDMA 4Z95L 3V6ZB 5GS1A 2DEYX 3MLXL 2VDLL 4L0ZA 2OJ1A 3FTVA 1ASPA 1BZ9B 1FFRA 4MYPA 2VDMB 1XTMA 1JL8A 1U8CB 4UOW0 2YUWA 3QQXA 1QSFB 4KJQC 1T2JA 2VLJE 4WO4D 5TGBB 2BP0B 5IFJB 2BRRH 3T0BA 5B3JF 5IEKA 4WWID 1TU2B 1ZANL 3RE0A 2AK4E 4ZUSB 3ZTJH 2QQKH 3U9PH 3FT0A 4KNSA 1SBSH 3WKNA 3VSVA 2E86A 4G6JH 3MUGA 5CJOH 2F53D 4XXWA 2IMMA 4OF3A 1ULVA 3DNKA 4JAMB 4ELMF 4HBCH 2UYLB 2V0AA 3F00A 3SQOH 3BC9A 3LVEA 3SE4C 1EIBA 4PWGA 4KC3B 1F02I 3DRTB 5ICYA 4BUGA 2VZVA 1ACYH 1MJUH 1SOSA 3B7UX 3HE7C 4HETA 5D7IF 1TZHA 2N1KA 3UH8A 1Y6NR 1JV5B 3IJYA 2DYPA 1ZGLP 1T1WA 1TTBA 2MQ0A 4P5RA 3VXOA 4EO5A 5C92A 1FAKT 1QRNA 1PEZA 2NYYC 2BVYA 4J3UA 3RDTA 4WW2B 3BPCB 2R7EA 3RWGA 5GS0D 1MAMH 2KHAA 3DUHA 5INDB 3WTUA 4EN2A 2PCPB 1JK9A 2JH2A 1FBIL 3QUYD 4D9RE 5I1AB 2X4OB 1UWGH 3OAUL 3SSGA 4JRYB 3BH4A 3D0AA 5AW7B 1KLUA 4FHKA 4L3AA 2X4NB 1M6OB 3ZRCC 5I8KH 1CFNA 1VCBC 3X12A 3GHBH 4EXKA 5D5MB 2QKSA 1GZQB 5I75C 3RB7A 5K9OB 4LIQH 4OB5L 2P45B 3TEUA 4XCNA 4H2CA 5HYQB 3KWWB 2AP2A 4YHML 4OZIE 4HCRL 4KJQD 4PJCF 3GDCA 4UM8B 1T3FA 3U48A 1B9ZA 2ZP0T 2PKDA 2CE6A 4L8DA 1OSZB 3B37A 1TQCC 4NP4L 5DJ8A 3J7HA 1UD5A 1KLGA 2BERA 3EKCA 3MOQA 4FG0A 1FO0B 4YSOA 1FHGA 2QHRL 1E6OH 3JZYA 1HH6B 1ZT4A 3ERXA 5ESVA 3VAEA 5FUCE 4K3HA 3BFOA 1KCUH 1EAOA 4FP8H 4UT6H 3DIFB 3QUYA 5MP6L 3TJPA 1SEBB 5DJZA 3EJCA 1UWFA 3QIWB 5DJYA 2CALA 5IVZA 3OR6B 4LLVB 2YQGA 4PW4A 2VZ1A 3C12A 1XGRA 3O9WD 4QHKJ 1Z9OA 4N2KA 3EJZD 3Q2WA 1BM7A 3RPIB 3D7PA 3KPSA 3QCUH 5E2WH 3DMMC 3ZGIA 3QJOA 5HP5A 1U93A 5C2UB 1U92A 1LO0H 3GI8H 4V11A 1WAEA 3P0VH 3MV11 1S7WA 4I89A 2R0LL 4WI7A 5FUOH 3ZKND 3M46A 4F93B 2ZZUT 2G2RB 1U95B 4PWEA 5ABAA 3GTVA 1OT4A 2XOTA 1OGAD 2Z93A 5CKAA 3OHMB 4KBPA 5D1XA 1IM3D 3DX2A 1INDL 2BCMA 4XO4A 2BNRA 3S3BB 4UQ3A 4OVVA 1T2XA 2ARWA 1KACB 1RZGB 3REWB 1JGLH 4AVHA 2DQDL 4MBRA 2PPDA 3PL6A 3AS3A 5E70A 4NQSB 2CO6B 3PY9A 1DQML 1ZGLA 3LHPL 3DTXA 4PVLA 3IGFA 3JWOL 4JRLA 3VFRB 2Z35A 4IMLB 4HPYL 5MEPA 3GUTA 5FPIA 5B3JE 2ZG3A 1SXCA 2ZJSL 4P9HL 5D1QB 1W8OA 5B8CA 3A21A 2L7EA 3IJHB 1CQYA 4PB0L 4BZ2A 4B9PA 2RD0A 1WIUA 5T3ZH 1RIVL 1UEYA 1E65A 1ZPLA 3ASOB 2UY7B 4M5ZH 4JPWH 3VQ2C 4KO6A 4DN4H 4AUJA 3L3KB 4NB7A 3QR2A 1IGCL 1HYSC 1MAKA 3SDDA 3B9KA 4KJYB 1BFVL 1X9LA 5D2LE 1NCDH 3VWJD 4DEPB 2ADFL 4PJAE 4WWOA 5ACMA 1SJHB 5E6IA 3WAJA 2QSQA 1J9QA 5HHNB 2Z8RA 4JPKH 4W9KC 4IKJA 1CGSH 3R06A 4KKAD 4MNQA 5EU5A 4OU3A 4H0GA 4M7ZB 1F4YH 1WK0A 1DQDL 4Z7QF 1H6FA 2DPKA 2WLIA 2Q7AA 4AEHH 2R4RH 4MDIB 2G0LA 4OGXL 2ZCLH 5D4QA 3UDWA 4PP2B 1J5HA 1DBJH 3IT8D 4H25B 4GUOA 3L5XL 4APQC 2K7QA 4YN3A 2PWEA 4DWHA 2UWEF 2YGQA 2C3VA 4B60A 4KI5E 3A6CH 2IPTL 2QTEA 4FQJH 3UAJA 3AS0A 1BAGA 3VXPB 3K71B 3EO9H 1OB0A 4J3SA 2AHIA 3EGSA 4D9RD 4L0YA 2EXSA 2EZ0D 3EG9A 3M8OL 2BOCA 5E8DH 1M05B 3TL5A 3BAWA 4PJ5A 1BG1A 5FYLD 4WJG3 4N2LA 3VXRA 4GRMB 3UO1L 2YKKA 4HKZB 4QTHA 5IR1B 2FGWH 1BZ9A 3UAJC 2CKNA 2NYZA 1UQSA 2VMCA 1VENA 3NCFB 3RPKA 3S2CA 4X80L 1NLDL 3IETB 4J3OD 3T4AA 3WNIA 4ZX6A 3JV6B 1ORSB 2WMPB 4UB0L 2WKGA 1YQ2A 2ID5A 5L2JB 4ODSL 3EJYC 4M8QA 4RMQA 4RWYH 4BWWA 5I1HL 2IH8A 2B0SL 3E2HB 4AUYA 4KKNA 1DBML 4UYQA 4DH2A 3SE3A 4I2XE 4QWWD 1JGVL 4YDJB 3OC8A 3ZE2F 4F2ME 4ZMAT 1DVSA 2IWEA 5FO9A 5HHPA 4BA8A 3O6LL 4CUCA 1SNRA 2AQRA 2GUOB 1OE1A 1BIIB 2Q2EB 1AZZC 1SEQH 4NM8H 4DP4X 1OSPH 1UEMA 2W59A 4G2AA 2FX9L 5B38B 3MZTA 4Z95H 5FW7A 3WTXA 4R7LA 5JPNB 3CVHH 5BS0B 5J1AA 2A6JB 2ADJB 3L4ZA 2I9TA 1ET7A 4EKXA 4Z7OF 2KQMA 5ESQB 3R4RA 4U1MA 1DP0A 5IHUH 1KTBA 4LDOB 1AO7E 1C8PA 1U8OB 2KKQA 2Y6TE 1XXDC 4D7PA 1MHCB 3D50A 1FNEA 1GGUA 1T1YB 2GYSA 3EJRA 3IGUA 4OR1A 1RUQL 1FGNL 4PP1D 1LE5A 5EOTA 3BZ4B 2K1MA 3PWUB 4QOKD 4PV8B 4N4YB 1WCQA 4LCWD 5EF0A 1A8ZA 1CZ8H 5DHYB 3CSBA 3UBGA 3D2UB 3KBHE 4B0MM 2B08A 1OAYL 5F89A 5I6LA 3OGCA 2W65A 4MXQD 2WOBA 5IR1A 2Z9TA 4JVPA 4OM0H 3IMUA 4PJ8B 2UY6A 1JFQL 5LBVA 2MPVA 1HAWA 1VEPA 1ZWIA 4BSWB 4Z7NF 5ADPH 3MBEB 5CCGE 2HX7A 1A7OH 5LCVA 2NY1D 1J1OH 4JJ5B 1NSNL 3ESUF 3UTTB 1MRCL 4GAYB 3T0ED 2YLKA 4OIFA 2HVJA 3EJYD 4JFYB 1B2WL 1NC4B 5TE4H 4M9OA 2ZOLB 4KO9A 2C1OB 4AMXA 1MCWM 2EINB 5EIQA 3HCVA 3HMXA 1TQBB 3WFDL 3LS4H 3OKEA 3TZVC 3LQAC 1G1KA 3LEXB 5DF0A 1INQB 2IH1A 3I9IA 1NGYB 1MOEA 3FUHA 5AUMB 5CEYB 3U1PA 4R2GD 3UCRA 1RHFA 1WZKA 3QSKB 1BZ7B 1EZLA 3E6HB 1I8KA 5FIEA 4DP5X 2X6UA 2G5BB 4LEXL 1RUKL 4DK3A 2VDOH 3VGHA 4K71B 2KL6A 5J4MA 1EXHA 3O41A 3L5IA 1NBCA 1NEZB 1JHLH 3U0PA 4DGIH 4DFHA 3WNNA 1E6JL 4MZ3A 1OAZL 4FEIA 5CZKA 1JXJA 4BSJA 4GEJA 1Q94A 3QWNA 1CLOH 3PXJA 3HJEA 1NMCC 5DQJB 1CD1B 1PZBA 1FVCB 2L7JA 3UZVA 4AJWA 4X5LA 1BWMA 1HXYA 4D2NA 4OZFA 3IJHA 2L3BA 1IFGA 1ZE3C 1I3GL 1EBAA 2B16A 1S7TB 1XGUB 3OX8B 4PLNC 1V55B 5MEOB 3IJEB 4P5TB 4U7KA 4L5FL 5EO0A 2QVFB 4BK4A 1WZ1L 3EJPA 4X6DF 2VITB 3B3IB 4OZFH 3HZMB 4UOQA 5IGXL 3B8SA 2IALB 1ONQB 3S35H 3QBTB 3B3IA 4Y4HC 1S9YA 4HD5A 4Q9BA 4GMSL 2NZIA 3VI4F 4L5FE 4P2RD 5HVFB 3DETD 5LGJA 3PABA 4IMKC 1R46A 4S0SD 4M8RA 2BMKA 3ZL2A 3NJMA 1F11A 2ZAHA 5DD5L 2DQHL 3H3PH 3JWNH 4HHAB 3M1BA 2ARJB 5G4OA 1KXVA 1RJCA 2W91A 3W11C 5B39G 5J6GB 5HYFA 3HG1E 4KZDH 3CVBA 1OGTB 3V6OC 1ZGLB 4NJ9L 3KPPB 1KPRA 2FWOB 3SE9H 4Z78A 3LS5L 3HAEA 1OALA 3K5SA 1JYWA 1XEUA 4N20A 5IVXB 1UXWA 4MS8D 3X3FH 4HPOL 4GQQA 4XXWC 2E7HA 2P5EA 1S8DA 3MROA 5MENB 2DQIL 2X3CA 2EIJB 4OLZH 3RGVC 1MFBH 1CO1A 5F3FA 1EAPA 4J8RB 1SLWA 2EDYA 2ZYSA 4X9YA 1U2YA 4EJ1C 1KIQB 5D71H 2HJFA 1B4LA 3D9AH 3PGDA 4PG9B 4GXVH 4E41B 1INQA 1SDYA 1WISA 1HC1A 4BWTA 1OQOA 5EU7C 3BVUA 4XNMB 3K6FA 3AGWA 4LHUB 1FO0A 4G72B 2PYEE 4BJLA 2X53A 3PGFL 3ZIYA 3HZ3A 1W0WB 1IEAA 2YA0A 3O3EB 1AZRA 4OV5B 4GKOA 2NOYA 4UU9A 5TE7L 5FECA 3HC4L 4FJYA 3VWKB 4ODXA 5GGQH 5C0IB 4HUMB 4GG6B 3WNJA 2FBRA 2GVYA 1L7TL 2UXTA 1CFNB 3BO8B 1X5IA 4U6HB 4XRCA 4PREA 3C5SA 1AGBB 4WW1A 1JERA 5T1KA 4A2DA 2KH2B 1R3IH 2J12B 4U1NA 5I76A 5F7DB 4BKLB 5I1IH 3BH9B 3NCCB 1P5VB 1RKRA 2P4AB 4JPQA 3SPHA 1A6UH 2XA3A 3GINA 4HAFA 3JV4B 5D7IE 1JK9B 1AQKH 1XGPA 1TXKA 3L4TA 3NIGE 1LP9E 1TZGL 1URZA 1V10A 4JGNA 4AK2A 3BT2H 3WFBL 1FPTH 4KH2A 3C08H 3HE7A 1P53A 4OKDA 4NCC1 4KKBC 3QIUA 1HEZB 5F1OB 3VXUE 5FGRA 4AYGA 1YZZA 2Z34A 4OUUB 2B59A 4E9SA 1UH2A 1N64H 1D5ZB 1PKQA 4PGDB 1WD9A 4K07A 1XXFC 4M7LH 4N2BA 5JIHA 3CX5J 3FCSB 5IBUG 5ADPL 2DMCA 2MQ3A 2CCVA 2VC2B 4E5XG 1J8HB 1Q72H 1DSWA 1QYGL 4LNRB 4D0BA 1IC5H 1RSYA 2V4LA 3B1TA 1TQTA 2Z7ZA 3MX0A 1IO4C 3K3QA 4OSUH 2I7OA 2VQ4A 1FNGA 1FH5L 1RZQA 1NFKA 1WBYB 2XICA 4BK5A 2BOBB 2FVNA 4LAJH 3KLQA 3ALWA 3L7FA 4BH8B 4QCIB 1YSOA 1T5XA 2HT3D 1KYAA 1U3NA 5DUBA 2HYMA 2ITCB 2P28B 4RAVA 5E0QA 5HHXL 1OCOB 2WN2A 2D7NA 4X98A 1OP3K 4NC2B 2FGZA 1FL6A 2XVGA 2EC8A 5KYYB 2XA8H 3UO8B 1MVFA 3FU7B 3FQUA 1DANU 1TQCB 1H19A 3ZKQD 2Z8VC 3DJSA 2DWSA 5GGTA 1H0DB 1JPFA 1RQ5A 4KDTC 1FAIH 4AV0A 5CCJA 4WV1B 3ULUE 4XVSH 1J9SA 1MCHA 3VG0H 1EHXA 1CI5A 1UT2A 3D09A 3EHBB 4LMQE 3BN3B 4NKDB 4F24A 5E8NB 3P54A 4CNIA 3BCDA 1KY7A 3K6OA 5AKVA 4ZDHB 4DGVH 3Q48A 1LD9B 4NEHB 4Q89A 1SF3A 2X89D 1RP9A 1JFHA 2XIIA 5GRJH 1V54B 3KXFB 1CFVL 2H2PC 5C0GB 5K69A 4M5YL 2E9BA 4XP9H 5AEAA 3VFOB 2R2BB 2I26N 2VQ1A 4WK2B 5KSBE 1BD2A 1GGTA 4X83A 3VSQA 1T4KA 2EE6A 4N86A 2QPUA 4KJWC 4XNQA 5KYNA 1IIIA 4NPKA 3BWSA 1EV2E 3F65A 4HIEA 1DFBL 3LEVH 2YUZA 5ABZA 4GLRH 4NQXA 1P5UC 2R27A 1H6UA 4H5SB 4P04A 2QPSA 4QRRB 5HDBB 1MFCH 1S5HA 1RUPL 5D7LB 1W2KT 4UTBA 5D9SA 3LYRA 3MLSH 2HT3C 4XCYA 2VXVH 1NL0L 2PCXA 5JIPA 2R56L 4LLAA 4IMKA 4JRYD 2F8OA 2CWRA 5I71B 1A9EB 2HRPH 5E1QA 5DFVD 1FIGL 2XU9A 4BYHA 5ISZD 2X1QA 4QXUL 3R8BB 5B8CC 2F18A 1NCNA 3LEYH 5HHOE 3GUTB 1FGVH 4KKQA 1U42A 2Z92A 3NGBB 3HNTL 1BAWA 2RALA 4I9WD 1VF5C 3L45A 4QRTB 3BLPX 3SE8H 4YXLL 3G5ZB 2R1WB 2GITB 3BAEH 5I8OH 3MDJA 1R4XA 3DKHA 5GSRA 2O6PA 3BUDA 1X44A 2YSTA 5IJDC 5FCSH 3AITA 4EOWL 1VERA 4HC1L 3P0GB 4FAAB 2FRGP 1A7NH 1ND0A 2MNUA 5JQ6H 1CDYA 4Q2ZB 4Y5YA 2X41A 2VLME 3KBEA 4JMNA 3W57A 1ZVNA 4M1DL 4WEBH 3EHBC 3WSQH 1CLYH 3UEZA 5KYWB 3TYGH 1MJ7L 5C6WH 5HDBF 3TT1L 4EBQL 5IJBC 2YPKB 2F58H 3U4EA 4L8CA 3EBHA 2L4OA 1FNFA 1TETH 2H9GA 3KLHD 1W6LA 2IFFL 3CZEA 3HE6D 5JTWA 1ILSA 2F53B 4JO1H 1FFTB 4KROB 3CBJB 4NNYA 4H40A 3UDWC 4ETQB 1SHXA 2WBKA 4FFZA 2ZX5A 2UX6A 1RK1B 2P8MA 3LKOA 2BNQA 3Q44A 1R5IA 4JRXA 4P9HH 4WO4B 2EVIA 5EEUA 4NC0B 3KPOA 2R9HD 3M1BB 1MFDH 1GGYA 1TG8A 1G4MA 2M26A 3KPOB 4JJOA 5C7XL 1GSKA 1XF5B 2ZG1A 3MV9B 3X1GA 5HYSB 2Z31C 1LMIA 1KV7A 2OK0H 4OZGF 4N2GA 5C0EA 3FC8A 1FNSH 4NENB 3TBYB 4FNLL 2D0HA 1G0XA 4G7SB 2WXOA 3D4ZA 5E1GA 2RQEA 4QHLA 1HEJC 1CB4A 2CBTA 3OMNB 3P2TA 2EUVA 2F53A 4XHQA 3ZO9A 4X6BB 4OQTA 1EXUA 2H32B 2JTYA 4KY1H 4XWOC 4KZ0A 4NC1C 4XTRD 4L8SB 1CBJA 2E6PA 2N7BA 2OMXB 4MCZB 5ESVB 3TO2A 3BHBB 5FDYA 1NDGA 2EILB 4ZMWA 5C0AE 1ML0A 1YC7A 5I75B 3P3TA 4XPFH 4GS7C 1JZ5A 3T6XA 1RULL 3ESVF 4PJEA 4Q2ZA 2QPDB 4Y5YB 4DUXA 4LRNH 2R0KH 2NW2A 1IGIH 4HCGA 3TP4A 3L1OH 5L6YH 3C6LA 1V3KA 5HYQA 4G80A 3KVQA 4XP6L 4OZGE 2B9BA 2BDNH 2OFQA 3EFOA 1DVFA 3NCYS 3GI8L 1LO0L 1MN4A 1YY9D 2FEEL 4XPBL 4JK0D 4UIMB 3LQAL 2D4FA 4TTDC 5CJXA 2X0UA 1LWHA 3PHQB 1M7UA 4IIZA 4NNXB 4PJ9D 4TOYH 5JIIA 1SFHA 2FJSA 1OW0A 3SJVA 5JHAA 4XP4L 3ARDC 2DQUL 3WFHA 1RIUH 4I0KA 1SHWA 2OYKA 2BSSB 1I7RA 3D34A 4J8QA 3TH3T 12E8H 2GQHA 4MAYA 4CAGA 2DQMA 3GMNA 5JW4N 3V5DA 1AQDB 2SODB 3QIBD 2Q7YA 3GXIA 4F8LA 3FB5A 3VQLA 4M7KH 5H37A 5AWNL 1R17A 1K5WA 3PFUA 4LFHG 1D9KB 2NNCA 2FX8H 3JV0A 2VR6A 1EGJA 2CMRL 4CKQA 3MZGB 1FFOA 5CD3B 4DKEH 2VT0A 3SQBA 4LPVA 5T3ZE 5AZEL 3SE3C 1NC4A 3ZYOA 1T22B 2NQDA 2YPVA 1TTRA 1MNUH 4P3CL 1NIDA 3D69A 1LD9A 1ZSHA 3JWNG 3DA0A 3GSUA 5BQDA 1Y18A 1AY1H 3TN0C 1IC4H 2WLKA 4RX4D 3ZL4H 1DTUA 1J1XH 1FBIH 2DH2A 4KZEH 2WO4A 3SQRA 2AZUA 2FZ3A 3O2VL 2AZAA 4BSVB 4B95C 5HXMA 5IVXF 3TBCA 2Q1EA 1MFNA 2VN4A 4NRYB 1WS8A 1HAUA 43C9B 4UT9L 4DQOH 3MRPA 5AAMC 5FK9B 3QJHB 5EOQL 1RZFL 3V9CA 4UMGA 1IGYA 3C09B 5IB3B 4QF1A 4U1GB 1K8DA 3K5RA 1NCUA 4JGJA 4F7MA 2NDGA 5KYYA 1RMFL 3V0DA 2A9CA 4OZ4B 4XOCA 1M7IB 1TLKA 5I1HH 5L9DL 2CHZA 4JO1L 2DEWX 5KVMC 5K9JL 5TH2B 4DKFL 1CL7L 5EWIH 4YHPB 2CPUA 1OTSD 1CLYL 1T5XB 4YDZA 1HZHH 4K7PL 3T2LA 2WYHA 4H20L 4S2SB 5KSAB 3CVHA 1VZHA 4OLWL 4OFPA 3PV6B 3RL2B 3QA3A 3T8XA 3IAPA 3CE1A 3OLGA 4BM7A 2PW2B 3JWDL 4MMXC 1TVHA 2PPCA 2FWLB 5F9OL 1ACCA 1UM5L 2OMUB 3EZ8A 5DVOA 4RDQG 1XL6A 2HMID 2W1NA 1FZJB 1XGYL 1GZHA 2HVKB 4MCYB 3IKCB 2H1XA 2AJYL 3JYCA 5C0BB 4YR6B 4YSQA 2BK8A 2DDQH 3PV7A 3T04D 3PJSB 1N59A 3JV6A 1DBJL 4RDQF 5FGBC 4E41E 1BVOA 1NPUA 4DAGL 3SGDH 5ECJE 5DRWB 2OSLA 1ADQA 2LLLA 4FFYL 1K72A 3CQPA 1FVEA 1NLBL 1F4HA 4R96A 3EBAA 3MRLA 1LMKA 3THMH 2BS9A 3GSQB 5D1ZI 1WG3A 2VABA 3O6FA 1EMTL 4PGCA 3IMVA 5I1DA 1RIHH 1BFVH 2V2WA 5SV3A 1GYUA 4XP9L 4N2EA 3DDGA 3Q2VA 3I2CH 1IC7H 3RLSA 4XRCB 3KLLA 5B4MD 1RIVH 5SX4I 1GGBL 1Z5YD 2WUBH 5CSZA 1UUNA 2VLLB 4WNSA 3RY5A 4XR8C 4Q9RH 3GGWB 4OSUL 1IM9D 3EXJA 1L3NA 4IKNA 4MCYA 3FOLB 3FO9B 3S4SB 4G7VH 3Q2CA 3ML8A 1XFPA 1SFDA 1E43A 1HE8A 1CICB 1UC6A 4JFSA 5F9WC 4UTBL 1UOLA 1JNNL 1H15B 1VFOA 4G71B 4U3XA 2O1AA 5JOEA 4NLHA 5LNEA 1JGLL 2JELL 1URLA 3JVFC 3NEXA 3MRIB 4OTXL 4WNJA 3X13B 3NZ8A 5BMFL 3QDGD 5F8QC 4U05A 5BV7C 2CUIA 4YIQB 4AIZB 5A1AA 4NNPL 1HOEA 5GS0L 1EXGA 4RFNB 3PXHA 4QPEA 4G8GA 3TO4C 4F15B 4RVBA 4W70A 1EJ6A 4FTVB 2D31B 1MI5B 3KPNB 4F3FB 3WXWH 4YBLC 3KDMB 4DQAA 4F7CB 2X2JA 4D3CL 2MHAB 2OXGA 1DEDA 3QJHA 4WHTB 2DI9A 4IDLA 1QW9A 2AEPL 4Z9KB 2JMRA 1DDTA 2XPZA 3CZLA 3ETBJ 4PJ8C 4BFJA 3BH9A 3ATFA 4W9IC 4KKPA 2YOCA 3VRIA 1NAMB 1QA9B 4R26H 3LKPB 5FUCC 2CXGA 2WIIA 5DO2C 2ETWA 1HTYA 1MVYA 4MS6A 4PIRF 1OB1B 4Y19D 4XPAL 4FXGC 4UM9A 4YDKL 4JDTH 5D1XB 3HS9A 3BAYA 3NYKA 3QUGA 1JGUL 5KANG 4M43L 1EXUB 2H32A 4WHCA 4OV5A 5CINL 1MHHA 3O3DB 4WUUA 1EWHA 1VPOH 4CVZB 3FQRB 1QVOB 3DVFA 3C60D 2ZWYA 1F1GA 3V7AG 3IB4A 1GH7A 2OS7A 4RFEB 5H37G 4HGWA 4AH2A 3WNMA 4CN1A 1KXTB 4AOFA 2J1WA 4KQ4L 3SBWA 2FWSA 5JUEH 4N8UA 4GXVL 1RFDH 3K2KA 4UINL 4EXPX 4ZAKD 1G9HA 4APXB 1JPSL 4BKTC 2HRHA 2Q7YB 1H3WM 1CD1A 2TSBA 3O3UN 1AP2A 4J4PA 1TYJA 3T6QC 3D0VA 3IXTB 1RK1A 2OR7A 2P8MB 3SKNB 2VC2L 3S7GA 1CXHA 4HISA 1OWRM 5IVXA 1UWXK 5EBLB 1WFMA 3DIFA 2X2IA 1QFWI 4WUKH 2WXLA 3S3DB 3QI9A 4U1IB 5B3NA 1GGCL 1KDJA 2LFEA 2W60B 5IREA 4ZQKB 5I23A 5DD3L 2C26A 4H0HB 4JMXA 2ZWLT 5KYWA 1COBA 4IBVA 5DVMA 4AJYV 2VSDA 3QAZC 2C9RA 5F3HA 4G8GE 2J5WA 5A40E 4WU7B 5DZAA 5DD5H 3LPGA 5DA0B 3SDAC 1VPOL 3MV7E 4QRPA 1ZHLB 2YJLA 4GY4A 3SDCD 5CBAA 3RA7L 1B2YA 2WQAA 4ZS7H 3FUEA 4FXGA 5BXFB 1QVOA 3MRFA 3C6EA 2AVFA 2NY3C 1NCAL 3FT4A 4YDLB 2HFFB 4QNPE 3EYQD 3TA3C 3I9GL 2NY4D 3JTSA 3JTBA 1IARB 5I6PA 1A1MA 2HRLA 4IK6A 2A9DA 1H5BB 3GBMH 2VJ8A 4J3WA 4L9LB 4YEFA 3O6FD 3CG8A 3TBYA 2LR4A 4FGMA 5F0JB 5C0EB 1N4XH 3MA7A 3SYAA 4C4KO 2XN9E 3U4AA 3Q8CA 1P6AB 3LKPA 1IZJA 3VA2C 3EJSA 2YMXH 2OL3H 1YMMA 3FH5A 1JG9A 4ES9A 1CFSA 1WBXA 2MOGA 2I85A 4MAYD 4POYA 1MY7A 2AJSH 2BC4A 3VJ6A 2BVPA 3UGEA 1NAKL 1T21A 4FCAA 4ZW3A 3TIDA 2FNBA 3BZ4A 3PWUA 4GSDH 2VO5A 4ANXA 2OW6A 4Z7QB 2VQ1B 4JDTL 4QXTB 4ZMOA 3BGMB 3LXUX 4XXCA 4QXGH 5FYKH 2JCCB 1M57B 2RGSA 4LCUB 2JI3A 2O6FA 2ATKA 1I8KB 4G7QB 2J8HA 5AVSB 1V5JA 4P46C 4UMSA 2XWDA 1UA3A 4D94A 1HINH 5AUMA 2VW4A 5TGBA 1W15A 2NUTB 3PHOA 1G9ML 5A6IA 2OMYB 4TPRL 3UPRB 4GNKB 4JPVH 1LO5A 1FUNA 3H9ZA 4OFDA 4ONGL 5JPMA 1P2CB 3APFA 3IF1A 5CU5A 4L23A 2HXAA 1LEIA 4JFOA 1KEML 4O58H 5I71C 4XNUH 3D30A 2P48B 3R18A 1A3RL 3C2AL 5FYKU 2AQTA 1QLEB 3QO0A 1GJWA 4FQPA 4CDGC 4NWUL 4OZGA 1DL7H 5DS8A 4ENEC 2NRDA 2WUCH 3Q8FA 3GNML 1KG0B 1MJ8L 3QB7C 5IT2H 1KIRA 3VI4A 2ESVA 4KQ3L 5BO1H 4F7PA 3FOMA 3L4YA 2DM2A 2ICEB 3KYNB 1WJ3A 1NBZA 1EZUA 4LNRA 3EG9B 1CBVL 4I8DA 2Y7QA 3T0WA 4TF4A 5IROD 4UNTA 3AWFA 4LK4A 5D70H 5I8EA 5KVDH 1G7IA 1MIML 4MA8L 5KSUA 2ITDA 4FN0A 2PW1B 4DUVA 3IEAA 2H3XC 4EUPG 1OAUH 1GTNA 4DF9A 2JKSA 5DA4A 3ZDYF 2BVQB 4XHJC 3TO4A 4NBXB 2VXQA 4BFOA 2AJZB 2KZKA 3TBSB 3PWVA 4UOJA 4ACPA 2A6JA 3GBEA 3WS3B 1D5MA 2V9UA 2GY5A 4TUKH 5EULV 1BOGA 5CF3A 1OSPL 4MQ7A 4GG8A 3CHPA 4IEFB 4IYKA 3CNKA 3GMOA 2MCMA 1PLAA 5JXEC 2IV8A 2LFGA 3T0VA 3NG5A 4RIRB 1JI1A 4DPCX 4P2AA 2RTTA 3WE6A 2XI9A 5DRNA 4CVXA 5FHAH 2F9BT 4Y9EA 3P11L 3B9KC 1I53A 4C56A 4MYWB 5I18H 1BD2E 3QUZD 3QZLA 1FSKB 4L37A 3LRSA 3SJVD 1QKZL 4HOMA 1WFNA 1EAQA 3NN8A 2IH9A 3HMXL 4IRJD 2VKWA 3H4HA 4I18A 4MNHA 4U1NB 3T4AB 4BKSC 4CU6A 2E4TA 5EC1A 4HFUH 1HU8A 3G6JA 3RUGB 4XE5B 2Y5EA 4KXBA 1SZNA 2O6EA 4WAFA 2KC0A 4X4XA 2CIKB 4YNYA 3G5XB 4UT9H 4PJ5B 4BZ1H 1QWNA 4IRSA 2NDFA 2XVBA 5D72L 5AW8B 4BZ1L 2YBRA 4TM9A 1A6VH 1SXZA 1S7SA 2A6IB 5LQBH 5IQ9B 3SKMB 1TCRB 1RZIB 2A73B 3QORC 3QQNA 1J1XL 3C09C 3KHQA 1P7KA 2GI7A 3VSUA 4PGEA 3UADA 1U4EA 3K71A 3CZFB 1U8PA 4O2EB 2DBLH 4L05A 4ONFL 5F96H 4C56D 4G8GD 4JZJC 4XHJD 4UQ3B 1DVUA 4FQ2H 5CBEB 4MGXA 5MENA 5F7WC 3MCYA 3VFVB 4ANVA 1MFAH 5CN3A 3QG7L 3CXDL 4ZFGL 2P46B 3BLKA 2WLIB 3P11H 3EJZC 5EOCH 4LCWE 5TD4A 3NAAH 5DDHB 3HE7B 2JIXA 3T3MB 3ARGC 2X7LB 3CFQA 3M8OH 3PWPA 4XNXH 5DFWH 4M7ZC 5E8DL 3TCLB 8FABB 4HIXL 5J6GA 5EU6E 4BCYA 3N06B 1E4XI 4HC1A 3ZHDA 1RIUL 1XH3B 5DGRA 2ZXAA 3U7AA 3CLEH 3LXCA 1AQDA 1BVLB 2DJSA 2KI6A 2UY7A 3MR9B 1NBVL 1JZ2A 3M07A 3SOBH 3VGGA 3NJNA 4TOYL 4GW1B 2BIMA 2V8MA 3D2UD 4I77H 5HGGS 3SJVB 5F7NC 3WLBB 1L9MA 3FS9A 3CDZA 4JG1H 4QOKB 5D7KE 4FZEH 4AV5A 4ZAKA 3FO2A 1CBVH 4NZ8A 3HLAB 3QC5X 2AABL 2R1YA 2DWEA 3MNZB 1DQMH 2LAGB 1KF9B 3GMLA 2M83A 4OKVA 2BIIA 5IT2L 4Y2OA 3QXAB 2Y1ZA 3GSVA 3VGAC 3M7FB 2MSPA 3P4OA 1BQHB 3NSCA 5D96B 1ZDQA 2X1PA 2Z7UA 3UZVB 1SOKA 2BH0A 3UC0L 3FTZA 5IMOA 4BK5C 3NRFA 1Q38A 4HWEL 4NQVA 1MF2H 4JG0L 1DJXA 5AVXB 3B7YA 1KLUB 3FF8A 5TDPA 1E7UA 1L3WA 2F8IA 2P5WB 5ACZA 5KG9B 2VSMB 3RDJA 1LWRA 3MRDB 2XQYG 4TXVB 1OE3A 4ZFZB 2WBJA 4LKXB 4NENA 1J1PL 1ZHNA 1S7VA 1V7NH 4XMUA 3VGDA 4ONOA 3K81A 2IF7A 4PHZA 2VXQL 4M1CC 4TRPL 1UKTA 2R0KL 3IU3A 2LU4A 2ARJA 4H8QA 2QQLL 4WI2A 2IQ9L 5DDHA 3ZDXB 4PJBB 4PJFB 5I19L 5BVJB 1R5IB 2BMKB 4BFFA 2F54D 2IWFA 5L0QB 1CK0H 4OLEA 2FB4H 2NSMA 3O45A 4IGBA 1U8KA 2GABA 4YVUA 3OV6A 3QRFM 1UCTA 4P2RE 4XNZC 3WO3B 4GSDL 2AJXL 2P8LB 4UT6L 1S9YB 3VI4E 3MJ9H 4CMMB 4J2XA 2H9GB 3TX4A 3S3PA 5AVWB 4I9XA 1K6QH 1GOFA 3WLWD 4R0LB 4Y7MA 2L0DA 1WO2A 4LP8A 2PCYA 2YBRB 1MEXH