1NAKH

Igg1 fab fragment (83.1) complex with 16-residue peptide (residues 304-321 of hiv-1 gp120 (mn isolate))
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
214
structure length
214
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGVSITSGYWNWIRKFPGNKFEYMGYISKSGSAYYNPSLKSRISFTRDTSKNQFYLKLNSVTTEDTATYYCAIDDFDIWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 83.1 - light chain
publication title Recurring conformation of the human immunodeficiency virus type 1 gp120 V3 loop.
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 214
sequence length 214
chains with identical sequence I
ec nomenclature
pdb deposition date 2002-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nakH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nakH02
2AV7A 3T0EA 3BEVB 3S4SB 3HRZB 3QEGL 2ENYA 5HI3D 3QNXB 1OGTB 4JFPB 5FYJU 1Z9SA 5DD5H 3L7EA 4XI5C 1NFKA 1JWMB 3FO2B 2MFNA 3L5WA 3KPOA 4PJGB 4XCEB 1GRWA 1RJYA 4KMTL 5FA3A 4IMKA 4NHCL 5GGUB 5LGHL 3OAUL 4FQLH 1X5ZA 3TN0D 1S9WB 1SBSL 4Y5VB 1E4XI 4PLKD 3RWDA 1UEYA 3L3IA 4JFED 1XF5A 1C12A 3AS0A 3HG1D 2V7NB 3KLSA 5AYUH 5KVEL 4R97B 3SE8H 4MYWB 2PF6A 1H5BC 1KIPA 1DBKL 3GMLB 3X17A 1RVFH 1G7IA 1D5ZA 2NW3A 4EVNB 4OLEA 5CJXA 2XT1B 3D9AL 4DZ8B 4Y4KB 5T3ZH 4G80B 2AKRB 4U1JB 5T1DH 1G7PB 1OSZA 4ELME 5EOTB 1OY3B 5T3XE 1J5OL 1RUAL 3LRSA 1N5AB 5CEZD 4MAYC 5I71C 2GITB 4PR5B 4JO1L 3GMOB 1QG3A 1T1ZB 1TZGH 5KVFH 2PYFA 5ALCL 5DWUL 2EDFA 4KK6D 3C60D 4PGEB 4JO2H 1FVCA 3O4OB 3P0VL 4XTRD 1RJZB 4OZGF 5IWLC 5L8JB 3O45A 2BCKA 1QBML 4HIHB 2V2XB 2YEZB 4HS3A 4XXCA 4K3GA 3RY6A 4YHZL 1ED3B 4QRSA 4UTAH 2V9RA 3CFKA 4MSWB 2Z8SA 4RMTA 1E27A 4LSRL 4XPHL 1JGEB 3QULA 4LKCB 3L6FB 2ZUQB 3UEZA 5I76A 1G0YR 5HHVL 4RBPH 3TA3A 4WUUA 4YEFA 3O3UN 4OFKA 2GFBB 1OP5K 5C0IA 3PDOB 5JOEA 1ONQB 5GIRA 5EU4A 2CLVA 4K23L 3SGJC 5JORB 1KPRB 5FYKD 2V2TB 3UYPA 2Z4QB 3MLRH 4FOMA 4RGNB 4UAOB 3BX7C 1TCMA 3MROA 4G8EB 4OCRH 1BZ9B 1PLGH 5D1XA 1M05A 4KDTC 2XOTA 5FKAB 5ALBL 4HZAA 2YA0A 3QDGB 5CCKL 2A6IB 1N6QH 5DYOB 2BNRE 1NLBL 2ZNWA 1CDJA 2Z8RA 1I8IB 1KYOJ 4LHUG 4A6YL 4Q9CA 3WHXA 5F7DA 2XG4A 5E2UH 5AZEH 4QRTB 4R8WL 5E00B 2W9DL 3KNBA 3G5VB 3DX9A 4LSVH 3G04B 4PV8A 4ZO8A 4ZAKD 1RZ7H 5IV2A 2AW2A 4L3AA 1PQZB 3CXHK 4R3SB 4ONFL 2IG2H 2I9LB 2BHZA 4Z5RA 2UUDK 3TPUB 4EDXB 4X4ME 4MD0B 4JM4L 5I8CA 1P84J 3RTQB 2GT9B 1Y18A 5KVGH 2O5XL 4WNQB 5GRVL 1QSFE 3O3DA 4OF3A 4QRQA 3U1SH 1AFVL 1I9IH 5C08A 4NQDE 4CW1B 3RA7H 4UZGA 3VCLB 4Q9QL 3CK0L 3VFRB 4BZ2H 1QFWI 3H0TA 3CVHB 3RWCB 1QO3A 3U48A 3UJTL 4P57A 5C0CB 1JK8A 12E8L 1NEZB 3KJ4C 4L4TE 5CIPA 2YR3A 1JNLH 3LKOA 3JTTA 3KYNA 3QPXH 4XPFH 1AY1L 3B9KA 3EDJA 3LSOA 3VXUD 5J12C 2AGJL 1IKNA 1U2CA 2OTPA 2P8PA 1FORH 4IIQB 3VXTA 3KPRD 1NUDA 4I18A 4N8PA 2EZ0D 4P4KB 43C9A 4MJ2A 4OLWL 3S4SA 4XMLL 3VFTA 4DUWA 4MNQD 3GI9H 5A2KH 1ZGLB 5D1QC 3PQYA 1TETH 3AFLA 1OAXH 1ZLWK 1CLZH 5IGXH 1Q0YL 1JWMA 4OGXH 3NZHH 4HK0B 3WV0A 2QQNL 3V0VB 1TQCB 5FGBA 3S34L 4JFYA 3ZKMC 3GJFK 4KROD 4KKBD 4NWUL 1A7OH 1EO8H 5DJ8B 4XWGH 3QHTC 5DFTA 5DJDA 3MYJB 4NYLA 2F19L 3O2WH 4PGCB 2MQ0A 2J3SA 2WK2A 2XZAH 5KSBB 2HJFA 4PUBL 1U91B 2GSGB 2VDKH 2OK0H 5HGDB 1F4WH 4NOBA 2IQ9L 5F88B 4DZ8A 1E4XH 2DL2A 4Y4KA 4G80A 5BQ7B 2AKRA 3O11B 2ED9A 4U1JA 2XYCA 4G9FB 3VRIB 1MRCH 1CFTB 5IM7A 4F58H 3TH2T 1T03L 1M4KA 4AMKH 5EN2B 3BDBA 4K8RC 1U8PA 2GITA 3H9SB 1JF5A 1U0QA 1F11A 5TFSH 5CJOL 1TMCB 2Y25A 4KTEL 4DKFH 4GRLA 1AGFA 2V9QA 3QIUC 2IC2A 1A64A 2N4IA 3PV7A 3BP5A 3ARDB 3KPQB 4X6EB 5IW6B 1WVZA 2C1PB 4HIHA 2X1WL 4GG6F 3CLEH 1K85A 2YPVH 4WY7L 1IM9B 5CJQH 1M7IB 1ED3A 4Y1AB 2CXKA 2VERN 2DQFA 4MSWA 2FJHA 3LQZB 2FL5B 4BSJA 4YQXH 1QRNE 2YD8A 3OR6A 3D18A 3TNMA 3WS6A 4QRRB 2A74B 2GFBA 4KFZC 5FM5O 4RFNC 3QQ4B 3UAJD 1ONQA 2DQDH 1B2WL 3FFCA 2BP3A 3BKCH 3ZO0A 1VACA 1DZBA 4ODTL 4YO0A 3OB0K 2WSKA 2CK2A 4P0DA 3HZKB 3OL2A 4MJIA 5TGBA 4F9PC 3EYOA 4M1CC 5E8NB 4QNPF 5FKAA 1QR4A 4K3JH 4NC0B 2Z0BA 1OT1A 3WIHL 3QDGA 5C6TH 1MCOL 1OGAA 4GAYA 4JM2A 1OWWA 4XAWH 2UY7A 3TZVA 3GSQB 2FX8H 1I8IA 3L7FB 5IFJA 2DI8A 3NN8B 1ND0A 5C92A 1UB6B 3TYFA 1AGDB 4OD3H 1YEIH 4HPOH 3R06B 3LMJH 1H3XA 2FJFA 4HWEH 4IRSB 2VNCA 1F3DJ 2UZIL 3U4BL 1LO4L 3FO0L 3TV3L 1F4AA 3Q6FB 5J6HA 5D72L 1PQZA 3P9LB 4R3SA 5CEZH 2I9LA 1NANI 3TWCH 4JG0L 1OTSC 2VXTL 4QHKJ 3RTQA 3HPLB 3MGAA 1T4KA 3ILPA 4XNMB 2CUHA 3PWUB 2RB8A 1LDSA 4BSVB 3S3PA 5BO1L 4ZG1A 2BMKB 2CRMA 4PD4K 4FQCH 4GRWE 4LLDB 3VD7A 1NGPH 2VLJA 3RX8A 3JWDC 1MSPA 4EN3A 3MRJB 3QUZB 2DBLL 4PP1D 4XCNB 4D0CB 4HPYH 3VFRA 4X7DC 4PJ7B 5C0CA 3JV5A 4Q9RL 1MI5A 1JNHB 4YX2L 4ODVL 4N90E 1WCQA 1YEHH 1QBLL 4ZFOL 4YWGL 4UI2A 2ICWI 3HMWH 1D9KD 4NM4L 1XGUA 4IIQA 1NL0H 5ITFB 3U9UA 2F54B 3MV8A 1QFWH 3VGAC 5FYKH 1U8OB 5ECJE 4XP5H 3CX2A 1OM3L 4LCCA 2QSVA 4IJ3C 2XWJB 4HK0A 4YBLC 4CUCA 3NCFB 3FQUB 1E4WH 3BIAX 3PV6A 5JQHC 4G6ML 5E5MB 1JYXA 3MCLH 2NY1D 5AD0A 1IGYA 4PJIB 2EDTA 1FC2D 3BKJH 3IDGB 3TT3L 3LN4A 5TF1L 1N0XL 5GGVL 3MYJA 2Z31A 1YJDH 1R3IH 3BDYH 4WI2A 5IF0B 5HPOA 4Y4HD 1SMOA 4W4OA 1HOCB 2AQ3A 4P2OB 2I5YH 5HGDA 4TUKH 5F88A 1CQYA 3MX0A 4JFHD 3WD5L 4RDQF 1I1CA 5BQ7A 2IQAA 4WHYG 3O11A 2XY1A 2O61A 1IARB 2O26U 5FGCE 2PTTB 4M9OA 3KYKH 4UT7L 1C5CH 4OFYA 2AJUL 1T80A 4HWNA 4Q58C 2HTLD 2C1OB 3ZKSD 5EN2A 3WJJA 3NTCH 1LEGA 3H9SA 25C8H 4A6YA 4AYFA 5EZIL 5HHOE 4LARL 1U95B 3DYOA 1X5GA 1JNNL 1S9KC 2R4SL 2DOCA 4G3YL 3MJ9H 4R4NC 4EBQL 1BZ7B 4PJCF 3KPQA 4NQEB 5I18H 2C1PA 4FFWD 3SBWC 3LD8C 2Y5TA 3FAXA 4PRNB 4U3HA 3ZHDA 1IM9A 3HHRB 3O8XC 3O3AB 1M7IA 5DDHA 5IOPA 3T0XA 3OJDB 1TPXC 1BGXH 4L9DA 4PJXF 2FL5A 5IMMA 3UTZB 3T1WA 4ZO7A 3D69B 4QRRA 1YY8B 2A74A 2DIBA 3S5LB 1RZJH 3RU8L 2PXYB 4IRZL 2H8PB 4LU5L 4B7LA 1AKJB 1G6RB 2VE6A 1QSEE 5CZXC 5D7SH 3LQMA 2AVGA 2WQRA 3BGAA 4KKLD 3OGCB 1BLNA 1TTGA 4CNIA 3OAZK 4LSUL 4U0RB 1C16A 2MCPH 3FJTA 3GHEL 3V5KA 2NTSP 4HG4J 4I0PA 4M61B 5F97E 1NCDL 2PO6D 4TVPL 3QDAA 4IBLT 2VKWA 3MLPA 4APQB 3MUZ1 1KJ3H 3GMQB 3OPZL 4S0TD 3QXAB 3VFGH 3BAEH 5CGYD 1AC0A 3NVQA 5IB5B 5B3JE 1NGZA 1W2KT 1EZVY 1RUQH 3HC4L 2AERT 5JOFA 4XVUD 5I74B 3VMOA 2Y07H 4NKQB 2VDNL 2O5ZH 3BP4B 1QQDB 1PZ5A 3Q6FA 4N0YL 2A6KB 3P9LA 4OB5L 5TQ2H 3VXRD 4HT1L 4MA8H 1RZFH 1MCPL 1FCCA 1S7UB 3FN3A 3ZKXC 5ADPH 3HPLA 4XNMA 1D6EB 5TF0A 5GRVK 3IDXL 3ZYZA 3GGWA 3VI3E 3PWLB 1LGVA 1NCUA 4NNYB 4P4RA 5IQ9B 3ZE1E 4JFZH 1IGIH 3KYMB 1S3KL 5CP3H 5F9WB 2P45B 5D2NC 4LRIA 4O4YL 4OI9A 3MREB 1NAKL 1CG9B 1NANH 1BFVH 5K9OB 1A7PH 1IFHL 2DMBA 4P5TB 4X80H 2VLKB 5JXAL 4S1DC 4CMHC 5A2JH 1CTOA 4GMSL 3CH8A 3V7MA 5HYQA 2HH0H 1W72H 4J1UB 4DW2H 1LP9E 3DMMB 3FL7A 5DTFB 5ISZB 3MJGX 2VL5A 1F02I 2DMKA 2XWTB 4WU5A 5TDNB 5I8EA 2JB5L 1MFDL 1FH5H 2ZSWB 1B4JL 5EOCH 4Y2DB 3HI5L 5E8EA 3WUWB 3IDYB 4J4PD 1FPTL 3Q6GH 3LH2L 4XX1E 2N1KA 3DX6B 3NA9L 1DQML 4LEOB 2HWZL 5E5MA 4PBVC 4YZFF 1R6VA 3S4SG 1ZEAL 5KW9L 2G5BB 1KELH 2PUQT 4PJIA 4UUJB 2H9GA 4JFDA 4WFEE 5FYJD 1AQKH 3IDGA 2G2RA 3RQ3A 3ULVL 4XNQB 1FVEB 4XMKL 1R3HB 1TJHH 1HKLH 1X4YA 4YHYC 4NN6C 3N9GL 5FHBH 4C56B 4GAGH 4U49A 1VKXB 4U6VH 1Q0XH 2R2BB 4M03A 3C87A 2E9BA 4OZ4A 1OTUC 4X4XB 3P30H 4JRXE 5E8DL 1AGEB 2V17L 5IHZA 2PTTA 4N9GB 4FQ1H 1J8KA 1Q72H 4LCUB 3BPCA 1J8HD 1OQOA 3EUUA 3WIHA 3LQAH 3MRKA 2R2CA 5JA9A 2P8MA 2Y23A 1M71A 5HY9A 4OT1L 3VDCA 3EGSB 4D9LH 4FXKB 1U95A 1KENL 5E94A 4H0GA 3RPIB 4WRLA 3DVGB 3QEGH 4R2GD 3KR3H 5TDPB 2GIYA 2IMMA 4OJFH 2AK4E 3TVMC 5GXBB 4P48A 1FP5A 4HH9A 5TE7L 3IAQA 1TVDA 3FN0L 4RMRA 5SWSE 4FTVA 3OJDA 4HZLB 2I24N 4KMTH 4LVOB 3QUXA 1EAJA 3LPWA 4NP4H 3UTZA 1R5WB 1MCDA 4CADB 5LGHH 4FQHA 4LAJH 2BOBB 4ODSL 5FO7B 3BZ4B 4N0UE 2ADJB 3PWPA 3AB0C 4OUOA 2XZZA 3EZ8A 2H8PA 5C0AB 3OGCA 4CN4A 4BUHA 3GSWB 1MIEL 3EOYG 5KSUA 2NY0D 1FG2B 5TE4H 3CGTA 2ESVA 1RV6X 4M61A 3CSYB 3KPSD 2VC2H 1NKRA 2HKFH 4KWUA 2BSTB 4X83A 3PWVB 4APQA 4FP8L 3GMPB 3FCTB 5BJTB 4D9RD 4POZD 5I1LA 3EYSH 1IT9L 1UG9A 1DE4B 4UNVA 1ZVSB 4NHUB 4DTGL 5JXED 4LSSH 5E95B 5D7JC 2BRQA 4X8JA 5I1KL 3BP4A 2ADIA 1QQDA 1Y0LB 4LCWA 5DWUH 4YHPB 3TNNB 3C8DA 1J9CT 1H3GA 2OTUB 4TSCL 5B4MD 3DTXA 3TO4B 5GPRA 2J5LB 3V7AG 1QBMH 1RIHL 5KG9A 4NNYA 4YHIB 3QJFA 1UA6L 5IQ9A 3MRBA 3V79C 1UZ6E 3K2MC 1A22B 3QFJE 2AJ3A 2IADB 4LSRH 4P23C 4I9WE 4MNGE 4X9GA 5FOJA 1AHWC 1CG9A 3IETA 4O02L 4Q2ZB 5HHVH 5K9OA 5TDOB 4XHQA 1UH3A 3L3JB 3VI4E 2VLKA 3ECBA 3UC0L 2JIXA 3G9AB 5H37G 3RWHB 1ZHNA 1T1XA 4K23H 1ZLVH 1NGXA 3HZVA 1NGYB 3DMMA 4J6RL 1MF2L 5ISZA 2OMNA 4H25B 3TT1L 1X6NA 3D39D 4FMFA 3VFNB 1EHNA 5EUKA 4XNZB 1VFUA 4JDVB 3T3PF 2BSRA 1XGRB 2ZSWA 3VWKB 5ID1B 1DANU 4QTHB 2FECL 3O41B 1PEWA 4OLVL 2WANA 4F8QA 2W0FA 3QXDA 3DYPA 4XCCL 1I3RA 1NLBH 4PBWD 1BVKA 5FUCE 4OFVA 4LSQH 4YUEH 3DX6A 4MXWL 2VL4A 4NKIH 2P5ED 2R4RL 2DQJH 4UT6L 4KRLB 4HXAH 3DGCR 2F9BT 4J2XA 2X4SB 3HUJB 1GZPA 2W9DH 3MRQB 1PW3A 4TPRL 3LCYA 4HHAB 2G5BA 4F57L 4UUJA 2W0KA 4CN6A 5BV7L 2GUOB 5AZ2L 2P5WE 5FCUH 4NC1E 3ZKQD 1R3HA 4OI7A 5F96H 1KCLA 1T2JA 4RGMC 4F3FA 1YQVH 4EI5D 5JOPE 1I7UA 5DO2D 4MXVF 1AFVH 3MUY1 1CFQA 3ORJA 4Z0BL 3ZYOA 2FHFA 3AY4A 1UJ3C 1CYGA 3NBNA 1CCZA 3HE7D 2CIIA 3SJVB 2A6DA 4Q9QH 2FNBA 3CK0H 1YPZE 4N5UA 4JFEB 2FRGP 3NPSB 1RIUH 4Z0XA 3MOAL 3UJTH 4LCUA 2VISA 3HG1B 5HD8C 5E2VH 3CSBA 2DDQL 4Z6AT 1MELA 1OSPL 3SY0B 1QBAA 2YBRB 3ARGC 1PKQE 3EGSA 3FN9A 2WUCL 4FXKA 2OQJA 3BGMA 4FQXA 3DSFL 1CLYL 4R90H 2OXGA 1ZHBB 5E6ID 4PJDA 3BEWB 1JV5B 2MHAA 5A43C 2IGFL 4HJJH 2R8SH 3B9VA 3UYOD 1I1AC 1XF1A 3STBA 2HFGH 1Q0YH 2M26A 2FD6H 2RGSA 2R0KL 4NRXB 2E6QA 4MAUH 3QIWB 1FNEB 2HMID 5BZWB 2VDOL 4YDJB 4CADA 4K2UL 3BP6B 1TNMA 3S34H 2HRPL 4XC1H 2ADJA 5B8CB 4ODBD 4NWUH 5BOZG 4KHTL 5I1EL 4L4VE 3ZYIA 5FUZH 1MUJA 5L8KB 4X6CF 1MEXL 5FYJH 5EUOF 4K8RL 1WAAA 1FG2A 2MOVA 1XCQB 4PUBH 1TIUA 4S1RL 3D0VA 4QHUB 5TE6L 2ZUUA 2YOCA 2BY1A 2BY2A 5CGTA 2LVCA 2BSTA 3OZ9L 3PWVA 4L29A 2VR4A 3OXSB 1RZKL 3ROOB 2ZUXA 3W2DL 5D5MF 4YBHA 1T03H 4TSBH 32C2B 5IBUG 2R2HB 2NY5H 3KG5A 2XRAH 3SDDD 5KSAC 1MVFA 4H1LG 5CSZA 3BQUC 5CJOH 1Y0LA 2F74B 5CFHA 4KTEH 4F7TB 5D6CB 5MERA 3IKCA 3TNNA 5IR1A 2Q8BH 2OTUA 3WEXB 1VPOH 3TJEH 4EXPX 2MQCA 1QNZH 5F3HB 3QDJB 2ZOKA 1TENA 2Q20A 3LPGA 2GYSA 4I77H 4CU7A 4YXHL 3EOTL 1WJ3A 2IADA 5IEKB 1RPQA 1F8TL 1T1WA 2DYPA 1FG9C 2NX5A 5DD1L 1G7MA 1NCBL 2KBGA 2YXMA 4J3WA 3RL1B 4F7CB 2CDEB 1L9NA 2DQUL 3OGOE 4E41B 3QDHA 3QI9B 3V0AC 5GGTA 2FBOJ 1YEGL 4GJTB 3X14B 3IFLL 3OKOB 5HHPB 5F7KC 3MGTA 1T6VN 1JWUB 3U7AA 1DN2A 5MP6L 3VFNA 2V5MA 1RQ5A 2CIKB 5IMLB 3NIGF 4QRPD 3MV7E 3V6FB 5JW5A 3VXNB 1IAOB 3U7WH 2X9XA 3QCUL 4KY1L 1EHLL 4F37F 2R69H 1NCCL 1I1FA 5ID1A 2GTZA 3LS5H 3RDTD 3O41A 5GS1B 2WBJC 4JVPA 2ICCA 4JPKL 5GRUL 3VXUB 1ZSDA 2VLRE 1SEQH 3LZFH 4WEMB 1E6OL 2ZKHH 3KPRB 4BQCA 3PABA 3LKQB 3EHBC 3HUJA 1T7XA 3MRQA 1MAML 1DL7L 3VU2A 4HHAA 2UZIH 3SCMC 3FO0H 3WXWL 1UXSB 2R9HC 2F5AL 5D2LE 5D72H 3DROA 3JBG7 2UWEA 3G6DL 1JHTA 2VXTH 1LO0L 3P11L 5F9JB 3T0EE 3QDMD 4M6OH 5BO1H 4DGIH 6FABH 5I1CL 2ITDB 4M5YL 1A7RH 4Z7VA 3AREB 3KHOA 2P46B 4NPYB 2DBLH 1V7ML 4KROB 3SJVA 4V1DD 5B21A 2B1HL 3HR5A 4JKLA 1BIHA 3BZFB 1REIA 4LPUA 4Q9RH 4PRIA 1DVFC 3LN5A 4X7EC 4Y16A 2G5RA 4YX2H 2JCCF 1RZ8B 4N9OB 3IT8D 4DOHE 4M6NL 2QQKL 1JYWA 5AWNH 2VXSL 2YC1A 8FABB 3VFWB 3MLSH 1T1YA 2ZCKL 1G9ML 3PL6C 1XGQA 1ZHBA 2XKNB 3BEWA 1WFNA 3H3BC 2ADGB 5C1MB 3WYRA 5JNYA 2J8UB 1W8OA 1IGCL 2DIJA 2HG5B 1YMHB 4PJBA 2GJ6D 4ZS6C 3QIWA 1QYGL 1FNEA 4HUVA 5FA4A 5BZWA 3KYOA 3IJSA 1KT2A 1ZANH 2YUZA 4BH8A 3IU4L 4R96B 4QXTA 2J4WH 5HTSA 1TJIL 5B8CA 3MRFA 3C2SA 1CD1B 2WINB 4R26L 3TT3H 4Q6IA 5TF1H 5GGVH 4RAVB 1JCKA 3HC3L 4MAYD 2KQNA 3DIFA 1VENA 4P2QD 3LY6A 3IXTB 4UT9H 2E27H 4PRID 1X6LA 4QHUA 2R15A 4XBEH 2APBA 3CFCH 4U6YA 3NH7L 5I66A 1W72B 1T0MB 3OXSA 5DJZB 1J05A 1BVLA 4HGWB 3ROOA 4UT7H 1LO3L 5HHXH 1G7QB 4R0LB 5AG8A 2KPNA 3HZYA 3QIBB 3LKRA 2VAAB 4FFVC 4ODHL 3V6ZB 4K94C 4PJ9C 2R2HA 2VLMD 3WKMH 4Y4FC 2IPTL 2YK1H 2F74A 5DD3L 3WO4C 4F7TA 2XN9E 2Y1VA 3KJ6L 1JNNH 1BBDL 1OF2B 2QTEA 4IS6B 3IDMA 1FJ1A 3BIKB 4EBQH 2X4QB 4GMTH 2AJSH 3T2NH 3I6KA 4FZ8L 2NQCA 3MZTA 3QDJA 1H3UA 4EUPH 5FUOL 1X4XA 2F53E 2ZOLB 4PRPE 3UJJL 5JW4N 3AVEA 3G6JE 2HT4C 4WFGD 4E0RA 3U46A 3SE4A 3RL1A 2CUIA 4F7CA 3HPJB 2R29L 5CMAB 4NZJA 4BH7B 2I60H 2J8OA 4IRZH 4E41A 4LU5H 3QI9A 4X6DB 2Q87A 1B9ZA 1WC7A 5CINH 3KXFB 3FRUB 2W60B 5HHPA 3PG2A 4LSUH 3F7QA 3B8YA 1BWWA 3GHEH 4XVJH 2CIKA 5IMLA 3V5DB 4OLZH 3V6FA 4OZIF 4AJ0A 4G6FD 1IAOA 2P49B 4ZMAT 1MCNA 2XPGB 1XF2A 5GS1A 3OPZH 3RVTC 4F9LA 1FZOA 3A6CL 4JO3L 4P2RD 3HC4H 1D9KB 1HINL 5ESVA 4NQVB 4RMVA 3LKQA 4DVRL 3ALXA 2L4OA 1U58B 2LAAA 1CGVA 2AJXL 4N0YH 4HAGA 2YN3A 5IJKA 1IC7H 3VGDA 2DS4A 5M7QA 4JB9L 4UOJA 5HYSB 1W0YT 2H2SC 3IDXH 4N1CA 4I2XA 4YHOL 4BK5A 4EUPG 5F8RC 4YHLL 2ITDA 5ICXA 1NCAH 2AS5M 1ES0B 2XNAA 3AREA 4YNYB 2NY1B 5D1QD 4O4YH 2BX5A 4YPGA 1NAKH 3D85A 3I02B 4Y8DC 4PJGE 4RFEA 2WWKT 5J06A 3D3VD 5T1KD 1LK2B 4M1GH 1NJ9A 1RZ8A 1XGYL 4Y4HB 2G9HB 1IC4H 3RUGB 8FABA 1LILA 3KLAB 5HGAB 3VFWA 3ZKMD 5IB2B 5DJ0A 4QOKA 3TGXA 5EZJB 3LOWA 3IFOB 4KXZI 1NFDA 2XKNA 3OJVC 4HD9A 4NQSB 5F7NC 5KZCB 2ADGA 3DX7A 4GKNB 3HI5H 3TH3T 1D5BA 4ZOBA 1FPTH 4QHLB 4ZTPL 2IPKB 5FHAL 3G5ZB 2HG5A 4KI5F 4Z7UA 3WDHA 2A6JB 4G8FA 3W9EB 3O2DA 3QXTA 3SDYL 4R96A 3HB3C 1ZEAH 1ZVHA 4UDTB 3W0WE 4DEPC 1U8MA 4NO3A 1YMMA 1DBMH 2QEJA 1CBVL 3UTTD 4K8RD 4RAVA 2N7BA 3GJEA 1A6ZA 2R0LL 4KU1A 1Z2KA 4OLXH 4WTXA 5FDWA 1J1OL 1UKSA 3RNQA 1BEYH 2HLFC 1BD2D 3N9GH 3WIFA 3VG0L 4YC2B 1TVHB 3B43A 1IBGL 3DGGB 3QIUD 5A2LH 2XXCB 3CFBB 4YXKL 3U36A 3LHPL 1ORSA 1VFMA 2OS7A 4LPVA 1RI8A 2YD3A 5DT1L 1T0MA 2W9LA 5E8DH 4BM7A 5CILL 1ZT1B 1JI1A 4HGWA 3SKJH 2BNQE 1MQKL 1G7QA 1EAPB 3GK8H 1E6JL 4P5MA 4ZO6A 3QIBA 4Z7WA 3NFNB 1CVRA 1AP2B 3WMSA 2ADFH 2C4FU 5AUMA 3JWOC 1MNUH 3E0GA 2Q7YA 1RURL 1WITA 3QQ3A 5DK2B 5EBLB 3MV9A 4OT1H 2PO6B 3MRIA 1KENH 4BZ1L 4FZEL 4Z7QF 1SY6H 3OR7B 2X4OB 2NY6C 3RNKA 3G08B 1OTTC 2QQLL 2P24A 5TE7H 5DXWA 3FN0H 2VB5A 3PGFL 5K9JL 4G6KH 3VMPA 1JPSL 1BHGA 3QDGE 4M1CD 3EO9L 3JXAA 5DVKA 1QVOA 3K8LA 4HKXA 4Z8FH 5C09D 1U92B 3HPJA 1RFDH 4TNVK 3VXRB 2APFA 4PJ8B 3REWA 5DQ9B 4X5XB 3K4DA 3T08A 1BAFH 4X6DA 5BXFB 5E2TL 1P5UA 6CGTA 5K59E 3IVKA 3KXFA 4LLMA 2QR0B 3FRUA 2MCG1 1CE6A 2W60A 3ABZA 3O9WC 5BS0D 1N0LA 2AJYL 3V5DA 4H26B 4I3SL 3NGBB 1OTSD 4N68A 3BDXA 1MFNA 5D7IB 2DQGH 5E24E 3MRMB 3PWJB 1QEWA 4FQJH 1GC1C 3ARUA 5DQJA 4KUCF 4PGDB 4DTGH 4KK5C 3DI2B 3MA9H 1FL3B 1DN0A 3LKPA 2HVJA 5I1KH 4WUKH 3IB4A 3QUMH 4RFOH 3I6GA 1MCEA 1C7SA 1ETZB 5DSCB 1IE5A 4HWBL 4X8XA 4JE4B 4PG9B 2Q6WB 1XFPA 2R2EB 3UZEA 5E9DE 3CZFB 5EWIH 4DQOH 3DUSB 2R56H 3S88H 4E42B 1UENA 1UA6H 3SO3C 4ETYA 5JW4M 1ES0A 3EDDA 5T3XL 4PP2B 1MJJA 3ARSA 1RHHA 3MXWL 2BVQB 2C3XA 2ZUWA 2DQIL 5IROC 1R5VB 3RIAK 1X7QA 5CKGA 3VDAA 1RZIA 3UC0H 3WNPA 4XPBL 2G9HA 4Z77A 1V3JA 4NQCA 1X3DA 3B5GA 2E7BA 4J6RH 1MF2H 1FYHB 1EBPA 2PTVA 4S1SL 5IB2A 4L8SC 4YFDB 1MHEB 1RUPL 4OZHA 4RIRB 4JZJC 5KSBE 5E8OB 1LEKB 4JAMA 2LABA 4GKNA 5B3NA 5D7KE 1J8HB 4BSWB 1QLRB 3CDFA 2IPKA 1Z6JT 3G5ZA 2ERJC 3F7YA 3WNNA 2WM0A 4OGYH 4R4BB 3SGKC 4G9FE 3ES6B 4F2MB 5GGRB 1NMCB 1PY9A 2DM2A 4UT6H 4ZSOB 2FATL 4ZXBB 3UBXI 1RJLA 5D1ZC 1T83C 4UNTA 1ERNA 1LEIB 4UDTA 3JVGC 2IAND 4R2GB 5E7BA 2XY2A 2WLYA 3STLA 3BZEB 3H9SE 4W81A 1WV7T 3KS0J 4OUUA 4PY8I 5EZLA 5FAAA 2CR3A 4K7PX 1QA9A 2UV3A 2PYEA 1R0AL 1TVHA 5GS0C 3CFBA 2E8ZA 2R23B 1DSFL 4R4ND 1KB5H 4U1GB 2LU3A 3AGVA 4GS7C 2EYSB 4Y1AE 3T0BA 5EU6A 4OLUH 1GZQB 3OKDA 3GNMH 1E28B 2YD4A 1TFHA 1EAPA 2O5YH 3MOAH 3O8XD 3MRDB 3FHQA 3NFNA 5A40E 5L2KD 3EAKA 2DDQH 5ITBH 3DXAA 5B38A 1T7WA 2VZ1A 5FK9A 4PRHD 1L0YA 5EBLA 5DVOA 3S3SA 1MWAB 3KPSB 2FWOB 3ARQA 2NZ9C 3DSFH 4JFOA 1CLYH 5F7EL 1I9RL 2JJVA 4O2FA 4LPWA 5CZXD 1YA5A 3K7UA 4WI6A 4XP4H 1EO5A 1BM3H 2YD1A 3UTSD 5B22A 4ZD3L 2V2WB 3QCTL 5HHMD 5CD5C 3ARFA 1BQLH 1AJ7L 4K2UH 2GEEA 1U9KA 4DGYL 2LTQB 4ZFFB 4PJ8A 5DQ9A 1K5NB 5CLWA 2RFXB 4AIOA 1MCIA 2VQTA 2FBJL 5BXFA 5JQ6L 3V8CA 2JJUA 1D5XB 5MEND 1CT8A 5HYJE 2QR0A 2X4UA 4HUUA 4KV5F 4K8RH 4K07A 4MXQC 3HS0B 5HBBA 3ZHLA 1UCBL 4UINH 3FQWB 2J88L 4RA0C 5TE6H 1T3FB 4JZNA 3SKNB 2Y9RT 4OLYH 3L3OA 3T4AA 5IFAH 1I3VA 1KB9J 3RPKA 1P4LA 4M1DL 3ALWA 4LVHB 3AU1A 3PDGA 4PGDA 4PJ7E 5IW3A 3D39B 3BPOB 1FL3A 4KAQL 3G5XB 2VZUA 1IEAA 4KHXH 1KYOK 3GSRB 4YIQB 2APVA 1FSKC 1V7NL 1Z0MA 4MD5B 4S1DD 5DSCA 2IBZX 5TJWK 1LVEA 2UYLB 1T7ZA 4WTZA 4QHNB 4HX1B 5GISH 4BK4A 2F54E 4OD1L 3O6MH 4WIQA 5I15L 1FFPA 1B88A 2R2EA 4JM2F 3DUSA 4GG8B 3C5JA 3M1BB 3SE9L 1AD0B 2P5EB 3CX5J 1ZA3A 1P84K 4IHOA 2VMFA 4U1LB 2D7MA 3RWGB 1JGVL 5EC1B 3FT4A 4ISVB 2BVQA 2EDQA 2BNRB 5IEHB 1ZHLB 1R5VA 4OKDA 2JTDA 2DQUH 3R8QA 2KKQA 2X10A 3ROLA 1K4DB 3BHBB 3WFBH 4EI5B 5INDA 1YEGH 3IFLH 3MTRA 5HHQB 3D25B 4XMPH 5MP6H 4GUPA 3CH1B 4XRCB 3V0WL 1MHEA 4CVXB 3HE7B 3WDJA 5EC2A 1LEKA 4G43A 2HLAB 2MNUA 2DQTH 2OSLB 1EHLH 1NCCH 3RZWA 3RP1A 4JN1H 4NQDB 5J11B 4M93B 2FJGB 4N0CC 2XWBB 2YZ1A 3T0AA 4OD2A 3BRFA 1OTUD 4RNRA 1SVCP 4XNYL 4H20L 4UV7H 4AT6A 1O7SA 4ZXBA 5E08L 5ETUA 2QJDA 4F8TA 5E6YA 4N8CL 4L4TB 1DL7H 1LEIA 2X05A 3JWDH 1SBBA 3VFMA 1D5IL 2F5AH 2DI9A 2M1KA 4GBXC 5GQBA 4KVCL 4RQQA 4P2CG 3G6DH 4QO1A 2YPLA 1BQHB 1LO0H 2LFGA 4N8VB 5BRZB 2D0HA 1J88A 1INQA 4G8IB 2BSSB 3EFDH 5LWYL 1LHZA 5HGGS 2W91A 4NQEE 4NT6B 4G8GE 1KJVA 4RWYL 1J0YA 4FXLA 3EO0A 1S7WB 4LASL 1V7MH 3MRRB 4J3OC 3TVMD 2B1HH 3IDJB 1W0WB 1JGLH 2IFGA 1E28A 1WWWX 5KANG 3NACH 4NZRL 1FNGB 2P44B 1A6WH 2QKIB 5IBLC 3HNSH 4M6NH 1DFBL 2QQKH 5DC4B 3TBWA 4L8DB 2VXSH 3CPLA 3MACH 3JUYA 4LLQA 4G5ZL 1MWAA 1YN7A 5F7LB 4NRZB 2AJZB 4KK9C 4GKOA 4JKPL 1P7QD 1AGCB 5D7LD 3HCVA 4HDIB 4KI5C 1KLUB 1YYLH 4V2BA 4L9LB 4XWOC 4U1NA 1A1MB 4HWBA 3C2AL 1IGCH 2MWCA 3SDDB 4HUWA 5DJ2B 1KXQE 5F7MC 2L0DA 3ZT6A 1KEML 1QYGH 2QHLA 3QWRA 3T0EC 5FV2A 3U30C 4ELMA 3K3QA 4G42B 4NCC2 3GB7B 5J1SC 3PXJA 1K8IB 4O5LL 2QV2A 2W59A 2X89D 4YGVA 4TUJB 4ZUSA 4IMKC 5D7JD 5C0BD 5I6XC 3SGEI 1QHOA 1A7QH 1KXTB 3QUYA 4ZPTB 2XQYK 3V6BR 1QUNA 4X6FB 2WAHA 5F72S 1FBIL 1GSMA 5T1LD 3MZGB 4WFFE 3SKNA 1Y6NR 1A7NL 1GOHA 2XZCH 1J0ZA 3JV0A 1LO3H 1QRNB 1B0GA 4N0FB 5JHDD 1IGFH 1UCTA 4ODHH 3VRLE 4P23D 4Z7OF 2R1XB 5CJXC 3O0RH 2DWEB 5EO1A 3G5XA 2V7HB 4WI7A 1S7RB 3GSNL 2FX9L 1C5BH 3GSRA 4YIQA 5T3ZE 1KTKE 5IG7A 1QBBA 3U4EB 4GLRI 3KJ6H 4RZCB 3RDTB 1BBDH 2UYLA 5C0EA 1T5XB 4HX1A 2CDFA 1VCAA 4BZYA 5MI0B 3L3HB 1MHHB 4J8RA 4FZ8H 5T3XD 3RZCB 5C7XL 4YHML 3P0GB 1KJMA 5C86A 5LGKA 1VB9A 4KRMB 5FUOH 1HHHB 4QRUA 2EKSB 3GZKA 1X5KA 3UJJH 4KZDH 1K8DB 5J89A 3RWGA 5EC1A 1BIIA 3QG6A 3WO3B 2PW2A 5L9DL 2BNRA 1ZHKB 5I1AB 4PV9B 3A6BH 2YUVA 3BPNB 4ONGL 1H0DA 1K4DA 1JYNA 4JREC 4XXCC 3RY6C 1XAUA 4M6ML 3GIVA 3QDMB 5HI5C 2DM4A 1KNOB 4D8PB 1KPUA 3MYZA 2H32A 4LKXB 3TA3C 1G7LB 4DFIA 3BKML 2RCSH 4TVSa 4X4MA 5T33H 2NW2B 4V1DB 4L3EE 2HLAA 4C56E 4YDIH 3R8BB 4NQDA 1S7TA 5CS7A 2DQEL 1CXEA 4OFIA 3FQNB 5IJVB 3A6CH 4JO3H 4L4JA 1PZUB 2XWBA 4NOFA 1EFXD 3V4UL 4LCIL 2YSSB 1I8MB 3V52H 5D1XC 5CHNB 5F7FA 3BMWA 3U7YH 1BQSA 4L4TA 1NPUA 5FCSH 4DVRH 2I27N 3OKKB 2A9NL 3DV6B 3GBML 2RIKA 4NCDA 5DEZA 5HD8D 4X98B 2Q8AL 4I0CC 2XTJB 1SJXA 3ETBF 1UVQB 3RWEB 4JB9H 1H5BB 1EEZB 5BRZA 3ARGD 2BSSA 5JO5B 1YEJL 1U3HB 3WXVL 3T4YB 4BQBA 4M7LH 4X9IA 3MV01 2YUWA 1S7WA 5B39G 3FQRA 1OAUH 3MRRA 4HCRL 1I1AD 4PJIF 1TTFA 2V6HA 4MDJB 4MAYB 1FNGA 5I71B 4PG2A 5DC0A 1XIWA 3HMXA 8CGTA 3BISA 5HDBE 1QSFD 4L8DA 5C6PB 1HK6A 5L6YH 2UVEA 2AJZA 5C0AE 2DLTA 4I4WA 3F12B 1P53A 3C08H 4NDMB 3D0LA 4HDIA 4QCIB 4XC3L 2Z9TA 4LLYB 1U8HA 3BN3B 1KTDB 2DWDA 3B9KC 3E3QC 4L9LA 4HBCL 5LCVH 2HJLB 1IKNC 2IF7A 1BP3B 3QUMB 5DJ2A 5FHAH 5B38G 2EE6A 5FECA 2IFFL 2CXGA 4I18C 3SDYH 3DOSA 3QA3A 1H3TA 3MLTB 2EDRA 1FV1B 2Q3AA 1J1XH 5D93B 3VWJA 1DUZB 1JMXA 2ZPKH 2J6EH 3ULUF 3U83A 1PYWA 4GKZB 4ZQKB 4QXWA 5KSAD 1J1OH 4TUJA 5FFLA 3UTQB 4HS6A 5FGBC 3BQUD 4X0KA 3VG0H 4EZMA 4ZPTA 4OIIL 4YXKH 4X6FA 5J13B 3JWOL 5DHVA 3LHPH 2EXWC 2AABL 4HMDA 5CILH 1A7BA 3CU7A 5JDJA 4LP5A 1QRNA 1E6JH 4HWZB 2ZP0T 3SGEH 1IGJB 3PP4L 1JUFB 1SJEB 2DMCA 4FFZH 2DWEA 4Y4KC 5EU5B 1LK3L 1HSBB 5F7UA 2HTKC 4HW6A 1RURH 4X7TB 4AK1A 3RVXC 1PFCA 4HFWB 3C09B 4JY6B 3U4EA 1KG0B 4C54A 3VFUA 4JGUA 4OCMC 1T5XA 2Z8VC 4FS0A 1YEDA 4XP6L 1S5IH 1MLBA 3QQNA 1MHHA 3RZCA 3DJ9A 5ILTH 3MXVL 5LQBH 1ZS8A 3REVA 2QSQA 2EKSA 2IEPA 3PGFH 4GRLC 1NC2D 3PP3H 2B8OT 1JPSH 3EO9H 1SYVB 3RI5K 4GLRH 3B6SB 2HN7A 4JQXA 1DTUA 1ZHKA 5I1AA 3KJ4B 4WTZG 4JPVL 1KIQB 2WBJD 1FFOA 3FOLA 1JWSA 3KDMB 4PJHB 3TM6A 3HUJE 4JKMA 5EORL 1KB5B 3EHBD 2IPUK 3WS6C 1CTNA 5DS8A 3ZHKA 4LKXA 4HC1L 3SCMD 2R9HD 1N8ZA 2ZSVB 5DGQA 2NW2A 5D1QB 2AJYH 5F1IA 5J1AB 5T5FH 3QXWA 3ZDYE 1MY7A 1CL7L 3MJ7B 4EDWH 2D7TH 3D3VB 2Z35B 5T1KB 5JZ7C 1BOGA 4AENA 1NSNL 4XCYA 3IJHA 4GXVL 1U36A 1XF3B 4RGNC 3SJVE 4UAOC 1KTLA 1G9EA 2AP2A 3MRHB 4F7EA 2YSSA 4JFEE 1I8MA 5F3BA 1IKFL 3HG1E 3TO2A 2IH1B 3QP3A 4HJ0C 5KS9E 1MCWW 2W38A 2BDNL 5C3TA 3QT2A 3AS2A 2WLZA 2FEDC 4JM2C 1DVFD 3GSVA 3TZVC 1XR9B 4X98A 3ILQC 1UXWA 1LP9B 3QZWB 4NBZB 5SX4I 3WLWD 1F3DH 3NCJL 3DLQR 1U3HA 4S1QH 4PBXA 3PL6D 3MXWH 3G6AB 3NZ8A 4KJYB 1T04B 3PJSB 1KJ2B 5CEZE 3BE1L 3RTQC 2AEPL 3CDGA 3UTTB 2ARWA 4JPIB 2ATKA 3C6LB 3W5NA 1DBJL 1IGML 4ZS6D 2D03L 5FGSA 5J6GB 4H88L 1YNKH 1BD2B 2MSPA 2X42A 4EN3C 2YKLH 4WW2A 3B5HA 2E9IA 3THML 4U7SA 3U2SB 4XXDB 4YHKH 3NIFE 5E1AB 1L6ZA 2XQYG 2HFTA 3MRGB 1WBZA 4K71C 4NDMA 1HN1A 3L9RB 4LLYA 2DLFL 3LKSB 1T2XA 2MJWA 2C3HA 2HJLA 5CSBA 1JPTL 3HTLX 4IIQC 1R3LB 5ACZB 1HHKB 3J8F7 4MJ6A 1BX2A 1AR1C 5GS0L 3ZTNH 5FYKE 4LCCC 3MLTA 3S97C 1FV1A 4RGOL 1SM3H 3RJQB 1UB5B 1G9NL 4JKKA 4J3VA 4PJDF 2AJVL 4FFVD 3IU3A 3NCYP 1U42A 2CQVA 1OB1A 4PJ9D 1YYML 5MHSD 1TQCC 4Y4FD 3IDNB 3PHQA 5ESQB 4OCSL 3FZUC 2KZWA 4HKBB 1YEEL 2UY6A 1R0AH 2ZWLT 5AG9A 4Y5XB 5C09B 2ZJSL 3MGOB 1GGYA 2AK4B 3STZB 1DSFH 1FL6B 4LMQI 1AXTH 2Z31C 3P4NB 4NN7C 1KIUA 2GK2A 3KLHC 1QLEH 2EIDA 4EXKA 4ZOCA 4W4OC 4D3CH 1S5HA 3OF6D 4JY4A 4HWZA 2D31B 3VE0B 3FT2A 5ESAB 1JUFA 2HT4D 3VXSD 5EU5A 5BS0B 1A9EA 5KJRH 3UPRB 1WAAF 3HE6A 3ULSB 4E41E 5JIPA 1A6TB 1VFAA 3FO1A 1RK1B 1UYWL 4JY6A 3BXNB 3K8KA 3O4LD 5AAMA 1XMWA 1FNSH 3QEUB 3BPLC 1CICA 1EIBA 3VFSB 3PWNB 3R0NA 3E8UH 3WJJC 3T09A 5IHUH 3QEQD 2AEWA 1DEEB 4W6YB 4LQ1A 1HKFA 5EA0L 1FVDA 1LNUA 3RVVC 3QCTH 3ARZA 5C0RL 1SYVA 2AAVA 4TNWK 5DVNA 1P6FA 4DN4L 1V3KA 5BW7A 5HHOD 1B6DA 1QPXA 3GKWL 3VXUE 3JWNC 4DGYH 4FN0A 3OQ3B 1ZT7B 4XPGL 1ZLSL 4LPCA 3RVTD 3UBXB 3KPRE 4HCRA 5ERWB 5FO8B 3KDMA 1HHJA 3O6KH 2FBJH 3ARBA 2LVEA 5LAXA 1BPVA 3B3IB 5KOMC 4MNQE 3N1PC 3ULVF 3TBSB 2BJML 4PTUA 3M17B 1VGEL 3ZDXE 35C8L 5GSVB 1UCBH 1S7SA 1PG7X 4AEIH 3GRWH 1N3NA 3TF7C 4ZS7L 1A9BA 2H2SD 3MNWB 4IJ3B 1FZMB 4YBLB 3I75A 4P46A 3QO0A 2A77L 1EBAA 1WZ1L 3N1QC 5MEPB 1QSED 3U9PL 1A1NB 4MNGB 5IVZB 3MRHA 1QKZH 1CICD 3IJYA 4I0PC 3MBXH 5DMKB 4KAQH 3HLAA 4O58L 4M7ZC 2EO1A 3GSXA 5FKPB 5EO0A 5GSRB 4AIZB 1XR9A 1LP9A 2H2PC 3MNVB 1EHXA 1BBJA 3N1MC 3SE9H 2DI7A 1FAIH 1QPPA 3VXMD 1H8OA 1I4FB 4LIQH 2J8UE 1JGVH 1NFIB 1T04A 3PJSA 1KJ2A 3WL9A 4GXUM 4NGHL 1OP3H 1T66C 4P5KB 2X09A 5SX4H 1EX0A 1NH6A 3FB6B 3T3ME 2UWEF 2EXYC 1PX3A 2V5TA 3RRQA 4JPIA 3C6LA 3ZE2E 2F5BH 5IVOA 4PLNC 1JRHL 1OAKH 4JQVA 5EIIB 3D2UB 4LRIC 4G9DB 1FNLA 2AXFB 3HB3D 3U2SA 4KVNH 4XVSL 4Z7VF 3BN9C 3GMNA 3IF1A 2VOTA 5E1AA 4MHHG 4WW1A 5DZOA 4JR9L 5IP4A 4NNXB 3LD8B 4CU8A 3IFPA 3L9RA 1JF1A 1QTYT 1IL1B 2HLFD 3JSSA 2VO5A 5L2KB 4IM8A 5HDQL 1R3LA 1CGSH 3TCLA 4YBQC 4JRXA 1NCTA 5E0QA 3ZE0F 3MBEB 5LXGL 1VGKA 1DDHA 4TULH 1AD9A 4MCYB 4PRDA 3V4PL 1DLFH 1D5IH 1WBXA 2Y7QB 2DKMA 3P9WB 7FABL 3UTSB 3UZVB 4HFUL 1PEZA 3OTTA 4HKJB 1KIRB 3IDNA 2CKBH 1NBQA 4PJBF 2I25N 4Y5XA 2AK4A 3STZA 2NY6D 2PKDA 4ETQB 1LE9B 2CK0L 4Z76B 4MNHB 4F7PA 5FOBB 4PREA 1OTTD 4TUOB 3R1GH 4ZUWA 1INDL 5MENB 3ZSSA 2D31A 5JR1H 5DD0L 4WDIA 5LBSL 5ESAA 1KEGH 1KFAH 4N0UA 1CDGA 4OZGB 3V5HA 1HH6A 4LK4A 1EFQA 5MEOB 2P7TB 1A6TA 1LO2L 1RK1A 1TXKA 4GAFB 4K7PL 4L4VB 3ZKXB 5I8KL 2ZG1A 2NY0C 4V2CB 4PS4L 3KXFE 4O2CB 5TQ0H 4JKPH 1ROWA 1UM5H 4R7DB 2NTFB 3H3PL 1P1ZB 1AO7B 4W68A 1IVLA 3C2AH 5D2NB 3O9WD 1P69B 1KEMH 4I5BB 3NPZB 3ULUC 4CMHB 1VADB 3K74B 1IQDA 1ZT7A 2ICEB 3UBXA 4F33A 4QTIH 4L1HA 1RAMA 1IM3A 1UACH 5DFVC 1TCRA 2OTWB 5DEFB 1K6QH 1MAJA 2OR9H 5GRJL 5EIVA 5F1NB 3B3IA 1MFEL 4KK5D 4BFIB 2Z8WC 3QUXC 4UU9B 3TBSA 5SWSD 4HUMB 2FIKB 3RX7A 2ARJA 1A2YA 4K94H 2OXHA 3IGAB 4W4NA 5GGSY 4AL8L 1FBIH 2IH3A 1I8KB 1Q9KA 3DETC 1P2CB 3HNTH 4Y19D 3GHBH 4XAKD 1NDGB 4M43L 3MNWA 4WGWB 4LCYA 3C8KA 3VH8B 3QFJA 4L8BB 5JIHA 5E4EC 3CXDH 4MNGA 5D6DA 3F5WB 1CXFA 3OKLA 4WU7A 1R3KA 2B7DT 2EDDA 3MRCA 3GBLA 4PJAE 3QCVL 3SEPA 1NDMA 3GSNH 4IRJB 4APQC 2FX9H 3GM0A 3U0TA 5FKPA 4UQ2B 3RUGE 5GSRA 1DQLL 4YHYB 1LD9B 2BERA 4JFHE 4OSUH 3BO8B 2F8VA 4JN2A 1L0QA 2X70A 1A3RL 1V8HA 4YHMH 4M7JH 1G84A 1XGTA 1CE1H 2DJUA 1TVBB 3DBXA 4PYGA 4DKDC 3U0WH 1I4FA 4LBEA 3WNLA 1NFIA 4NO0D 2A1WL 5I1JL 1B0RA 5FYLD 2VLRB 3FB6A 4LHUD 2FEEI 1CFVL 4OZFA 2FR4B 3WUZA 1KN4L 1F13A 2YA2A 3D2UA 4PJ5D 4NZUL 5F9WC 3VD5A 4DKEL 5IKCA 1RU9L 5D1ZD 2AI0H 2W9EH 1HEZB 1Q94B 3U6RA 2P5WA 4QGYA 3WBDA 2VQ1A 1UM6H 2ZCHL 3S37X 3W9DB 1R3JB 3DMMC 5BMFL 2DQEH 5GS0D 2DM7A 3IRPX 4YHNB 1MIML 1PY4A 2EH8H 4JANA 3SE3A 3S35X 4XZUA 1YPZA 3V4UH 4LCIH 3MBEA 3VXQA 1XZ0A 5FDYA 5FM4A 1T7YA 5L88L 4MCYA 3MLXL 4ENEC 1WFTA 3IDYC 3MUJA 3AS1A 2A73B 1NFDF 1RIVH 2I07B 1YZZA 2Y7QA 1FNAA 1GGCL 4UIKH 3CCHB 4WO4B 1PKQA 5KOVC 1K2DB 4HKJA 3LS4L 1YEKH 3V8OA 2VITB 2E9WA 5GGRY 5ADOH 1YEJH 4Z7UF 2NZ9D 1FO0L 4MQ7A 5F7WC 3BD5A 4U7MA 4ERSL 5CZKA 1LE9A 3AC0A 4Z76A 1AH1A 1B4RA 3I50H 2BNUB 1C5DB 3AM8A 4TUOA 4PGJA 1CU4H 3O6FA 1IC5L 4TOYH 1E4JA 5CD5D 2Y4SA 4XCFL 4DK3A 5D7JB 3VXRE 4TNVF 4Y5YB 1TZHA 1FAKT 3WN5A 1NUNB 3AY4C 4X5WB 2OJEB 1J10A 1SYSB 4JPWL 2P7TA 4GG6B 1A4JB 4L4VA 1DQQB 5E99L 4ZFGH 3VXPB 3KHQA 4R7DA 2NLJA 4XC3H 1AO7A 4HBCH 2M8XA 4HWUA 4HULB 1FLRL 4Z7WF 1T22A 5A1AA 1A6UL 1QRKA 3MCKB 1FGNL 4MXQD 3BI9X 4CGTA 4FQXC 5D7IE 1HILB 1BQUA 2BHYA 2OL3H 4MMXC 4I5BA 4OCXH 1ZA6B 4PB0L 3ZTJH 2C3VB 1JE6A 1CDIA 2ICEA 4D0DB 2P8LB 4AEEA 2Y06H 1PKOA 1YEFH 5C07D 5L7XL 1OLZA 5EFIB 5TH2B 2OTWA 2LU7A 5DEFA 4LNRB 1JGDB 3BYYA 5JLZB 4BFIA 5C0FB 3L95B 5LGJA 1OD7A 4ZO9A 2FIKA 4JDTL 4KTDL 4LP4A 1IILE 3I2CL 3JWOH 3BD4A 1PSKH 1DLHB 4TTDC 3B2VL 1I8KA 4NRYB 3SDXF 3TFKC 5EOCJ 3ZT7A 4OI8A 5SWQB 1F2XK 5F1OB 2VDLH 3EYUL 3HAEA 3EO1B 1MHCB 2XKSA 3S36L 3FB7A 4ZUVB 4L8BA 2P1YA 4OQTH 1FRGL 4X6DF 3KPPA 1YNLL 3DVNB 2OP4L 3MO1B 5FYJE 4OTXH 3RIAF 3PP4H 3VMNA 5IB1B 1EHAA 4ZUTB 4KQ4L 3T2PA 3BH9A 3EIFA 5HGBB 4IRJA 3UO1L 4LRNL 3MLVH 3OXRB 4S11A 2X1XR 3S9DB 4UQ2A 1MCKA 1HNGA 1W0VB 2VYRE 4UILH 4P49A 1S9VB 2ATPA 3TBVB 2CLRB 4RRPG 4MCZB 3MXVH 1EFXB 3MV7A 2Q7NA 3GSUA 3LIZH 1J8HE 4M7KL 5HHNB 4JFFD 2J5LC 1FYTB 3VFOB 2ED7A 1A6VL 5JUEL 4JPVH 2X1OA 2VLRA 2FYYB 5DEGB 5E1HB 4ZSOE 3ULVC 4N0CD 2YWYA 2EYTA 4M48H 5F89B 4X4YB 5J57B 2FR4A 5C8JA 3TBYA 1MCSA 3TC9A 4AEHL 2NY3C 1GC1H 2PETA 4ODXB 4JRYB 5D2LA 4MX7B 1N2RA 1L7IL 4HC1H 2XQBL 5GGVY 3X3GL 5JPMB 1Q94A 5CZVL 4GBXD 4LHQB 1FFNB 2F8XC 1I1AB 4XX1G 1R5IB 4NJAL 2YUXA 4ZTOL 4EQ3A 1GIGL 4G6AC 1NSNH 1R3JA 5IVXE 4JHZA 5F21B 4YH6A 2GAZB 4OV5A 1P9MA 4G7YH 4Z7NE 3OKEA 3QHFL 3QJHB 4PB9H 5C9KA 5SWZD 3BUTA 3MNZA 2C4XA 2VZOA 4XNXL 4OZHF 1AGBB 1CFNB 2P48B 4PJEE 3SDAA 5IBLD 4YDVA 3KPSE 1MJ7L 1WWCA 4WO4A 3QH3A 4RISL 3PDDA 2BVOB 1ZLUH 2VITA 3NCJH 2VAJA 2ZG3A 3JTSB 1UT9A 3F7PC 2V5YA 4LQFL 5DJAA 1UZ8B 4KK9D 5DD6B 3IDIA 5J9PA 1BREA 2CDGB 1IAKA 1UWGL 4KI5D 3FQXA 2BNUA 3CVHL 4X9BA 4XWOD 2L7JA 1C5DA 3NFPB 5CEXB 3B2UC 2NR6C 1M6OB 3OV6A 5KSAB 1P4BL 3NCMA 1CD9B 4XNUL 2OR8A 4DGVL 4KRPC 3T0ED 4Y5YA 1T21B 5FYLH 2N56A 3W0WB 3P9MA 4PJCB 4X5WA 3H7BA 2OJEA 3OAYK 3GIZH 1OQXA 4U0QB 4GG6A 4WEBL 2X4TA 4B53A 3OKMB 3BUYB 2QHRL 1V3LA 4PJXB 3VXPA 4GW4B 4Y16C 4YAQB 2R0WL 2DLFH 2EEAA 2A83A 5ACMA 3MCKA 4KPHH 4FFYL 4EOWL 5CGMA 5DJ6B 3WNKA 1K4CB 1SJHA 4H8WH 4XP1L 1F6AB 2BNQB 1FIGL 3PP3K 5GS0H 1ZA6A 5SV4A 2H6PA 5KVMC 3DUUA 3BH8B 3BVNA 2P8LA 3RHWK 4DN3H 3D39E 1EJOL 3ARPA 5EFIA 2AJVH 4WWKA 5TH2A 3WKNA 4LNRA 3QIWC 1N5YL 1CXHA 1I7ZB 2XN9A 1UQSA 4GFTB 1NC2B 3EJYC 1U8IB 3DHMA 5D8JH 1YEEH 3VDBA 2KZ1B 2H45A 5B8CC 1QFOA 4U2YA 1DLHA 3T77A 2EDLA 5C0DB 5SWQA 1LE5B 3EKCA 2ZUSA 4M62L 2P5EE 4Q6IC 3EO1A 2CMRL 2BK8A 1MHCA 1CLOH 2W0PA 2F53A 5DUBB 4PRPA 3G6JA 4ZUVA 3Q5YA 2IBBA 5E8PB 5CBEB 3MJ8A 2AQ2A 1D5MA 1MHPL 3SDCA 1EEUA 2LU4A 4ZUTA 3SCMB 3SKOA 4CAGA 4NWTL 3T0VA 4BJLA 1OWRM 2WUBL 5I17B 3WLBA 4YE4H 4M8VA 1UYWH 3NAAL 4I3RL 5EU7E 4RAUB 1HI6A 3K2UH 4CKVX 1S9VA 4TQEL 5HI5D 2BC4A 1NAMH 3FQTA 1NBZA 3P4MA 3TA3D 3GJFA 4WUUD 1DUYB 4U1MA 3X11B 1L4IA 1P5VA 4NUGL 1V3MA 3RWIB 2DTSA 5CP7B 1F4YL 1X5JA 1FO0A 5DRNB 2YWZA 1FYTA 4AQOA 3VFOA 3BT2L 3GKWH 3EOAA 4KUCD 5KVDL 5BV7C 1DVFB 5L0QC 2CKBB 1CVSC 4E5XB 2E9JA 2FYYA 4XPGH 2UZXB 3O2VH 3TBTA 4NJ9H 1KCSL 3F62A 4X4YA 1F3JA 3D5OF 1A1OA 5D1XD 1MFAH 3PL6B 2Z91A 2FHBA 2PTUA 3SE4C 4DWHA 3FB8B 5DUPH 4WHDA 5DJCB 1CDHA 5BRZE 1KUMA 4FRWA 5E9DB 1R5IA 3BEVA 3PNWB 3HRZA 3QI9C 4N5EC 3QNXA 4OZFG 1OGTA 4MLSA 4JFPA 4YDLB 2GAZA 5INCB 1I9JH 1GYAA 2A77H 2ORBH 3VW3L 1PBYA 1N4XL 5DI8B 3FO2A 1FGVL 4XCEA 3QJHA 4PJGA 3RWJB 1FCGA 1MY5A 1RULL 5GGUA 4Q0XH 4O58H 1S9WA 4Y5VA 5GS1C 2CGRL 4F9LC 1DJSA 2EH7H 2RBLA 5C08D 1SMAA 3TLRA 1U6AL 2BVOA 2NYYC 2V7NA 4JY5L 3JTSA 2IAMB 4R4FH 3GMLA 4A2MA 2WBWB 4XT1C 4EVNA 2CDGA 5GRYA 2GHWB 3B9KD 1BJ8A 3UYRL 2E7LA 1B3JA 5I73C 4PJ9B 1G7PA 1EVTC 5EOTA 4Y4FB 4CMMB 3AREC 4YXLL 3W0WA 3WO4B 1J18A 4PJFE 1N5AA 2DQCH 4RMUA 1CF8H 4PR5A 3PQYD 3GMOA 3TJHC 4XVSH 1T1ZA 1VEPA 4KTYA 1JMZA 4RAHA 3IS0X 1T89A 4GW4A 4D9QD 1RZKC 4PGEA 1J0KA 2R1WB 3T1FB 2VXVL 3EYFB 4ODUB 3UPAA 1RJZA 4OIBA 1KPVB 2NY4B 4KJPC 3TH4T 1I75A 3G5YB 1JPGB 2V2XA 2EIEA 2YEZA 3SQOH 3VXSB 4F15C 1JL8A 1QSZA 1MCLA 2EXWD 4BUGA 3LB6C 5DJ6A 2OX5A 1K4CA 5LXGH 2BNQA 5JW4Q 1JGEA 1H9VA 4LKCA 4LHJB 3L6FA 2CLZB 3FO9B 4AZ8A 1DBBL 3O4LB 3WNMA 3BH8A 1H3PL 2RR3A 1Z9LA 2WIMA 3FRPA 3PDOA 7FABH 1WSST 3QEQB 2WV3A 4QRPE 3S3JA 2FO1A 4QGTA 5CUSL 4Y4KD 1G0DA 1UWEH 2HTKD 4M02A 1EK3A 3BGFC 5JORA 1KPRA 1I7RB 2X4RB 4HJGB 3RVXD 2V2TA 1N64L 5GHWL 2Z4QA 4GAJL 5C0DA 5EO9B 2QSCL 4ELMF 1LE5A 4G8EA 1BZ9A 1GXEA 1A5FH 2YD9A 4WJ5B 5FM8A 4CJ1A 3SPVB 4DAGL 1IMHC 3RGVB 3P4OB 2A6IA 5DYOA 5ICZB 4GRLD 5CBEA 4NSKB 1T5WB 1DQDL 4QT5B 4S2SB 4HIXL 3HI6L 1KB9K 4U05A 4CN1A 2P47B 3QDME 4QRTA 5E00A 2OZ4A 3ZDZE 4OCWL 1LO2H 3GM8A 1SHMA 4K7PH 3G5VA 3HAEG 4ODWB 1MREL 3G04A 1BFOB 1ITBB 2P43B 5I8KH 3ULUL 1L0XA 1WCBB 3QIBC 5HYJB 3MRPB 1OAYL 4DKAA 3TPUA 1EGJA 4FQQB 4EDXA 4MD0A 2NY2C 2YS4A 4V1DE 3OG4B 2GT9A 3KWWB 4OM1L 1LMKA 5EPMB 4OAWB 4WNQA 3W11C 2VDPL 1JHLH 4HMCA 1Z3GL 4NZTL 4CW1A 4KKNA 3T04D 4PRAB 5DRNA 4CJ0A 3FFCD 5JZ7D 3VCLA 4JGMA 3CX5K 4E5XA 4WHYH 4KI1A 3D48R 4ELKB 5I8OL 1GGUA 1OP3K 3WIIL 4BQ8A 3BRGC 3CVHA 3RWCA 3BSZL 4RGND 4XBGB 1G6RL 4KH2A 4MJID 1NEZA 4ZNCD 5GRJH 1JFQH 1MFBL 1OP5H 2M2DA 1MFEH 4LSDA 2FO4B 1ZT4B 2WNGA 4HJ0D 3VXMB 3QDGD 2HT2C 2XTJE 3CVIL 5DJCA 1OGAD 2YRZA 9CGTA 2FEDD 2JELH 3GMMB 4JM2D 3TZVD 1NBVH 2VDRL 3ILQD 4P4KA 4AL8H 5E9DA 2GJ6E 1OAQH 3BP7B 5I16B 3EJZC 1ZGLA 4PLOB 1N6VA 3JV6B 4WCYL 4HKZB 1GGIH 3WFEH 3C9NB 2OI9B 5LG1A 1MCWM 3NABH 3V0VA 2EDHA 2X44D 1GJIA 5DRXB 3RTQD 1G9MC 1M7DB 4P2QE 5DJXB 3CMOL 1QLFB 1QFUL 2B2XL 1MVUB 4WV1B 1DQLH 1DANT 1KN2L 5DJ8A 2VLJD 4FQLL 2C9AA 2UZYB 2OL3B 4EN3D 1PG7L 1JJUA 1E0OB 1HQ4B 4PGCA 4LDEB 2IAMA 5KSBA 4ZOEA 5C0CD 1MI5D 1U91A 2GSGA 5DA0B 4MD4B 1UADC 3SE8L 2K3TA 1OPGH 2VLME 4LSTH 4OM0L 4JO4L 3F58H 1LDPL 4G9FA 3VRIA 1CFTA 2BFVL 5T3ZL 3MV8D 1PVHA 4MB5A 1QFWM 5JPNB 1AR1D 1RU9H 3VD9A 1XF4B 3H7LA 2IALB 1CD0A 2R1YB 5BZDB 5JMOC 1EA9C 4BKLB 4OQ1A 2FB4H 1K3ZA 4WFGE 1HHGB 1ZE3C 3ARDA 4X6EA 5IW6A 3FZUD 5BMFH 3FAWA 4NN5C 4G8GB 1JPGA 1YNTB 3ET9F 4JO2L 1MIMH 4U7KA 4B5EA 4Y1AA 4TSAL 1ZLWH 4OBSA 3LQZA 4K3DL 2NNAB 2D4FA 3DO3A 2Z31D 4X6CB 3KLHD 2HYMA 4JQIH 1YDPB 2FX7L 5EUOB 3QQ4A 2EYRB 3WFHB 2NY7L 1GGCH 3FTGB 1Q9WB 2VN4A 2MQ3A 1BFTA 4KZEH 1GCFA 5D9SB 4CDGC 1X9QA 3K1DA 4LL9A 4U6TA 3O81A 3LS4H 1IGTB 4BFBD 3V6OC 1I7RA 4O2EB 5D5MB 1P7KB 3HZKA 4OFYD 4L1DA 3T8XB 5T1MB 4P2RE 5EO9A 4GSDH 1RMFH 1WGOA 5I19H 4YJZL 1ZVYA 1HYSC 4AH2B 2DTML 1KCUL 3MLRL 2AXGB 5E8NA 5FM5M 3F8UB 3H9SD 3GSOB 2YA1A 3CFJB 4KDWA 3SPVA 4DCQB 3RGVA 3RI5F 3DRTB 3P4OA 5CIPH 3RVVD 3C5ZB 4YC2C 4OCRL 1PLGL 4NSKA 2WW8A 1T5WA 3GSQA 4XCFH 2EDWA 1ZTXL 3L7FA 4XH2B 4AM0B 3NN8A 4S2SA 1UB6A 1AGDA 3LKNB 4PJHE 3R06A 3H2WA 3WHE0 4IRSA 43CAB 2R0ZL 1IM9D 1S9XB 3QRGL 5HYJA 2YRLA 1WICA 5AZEL 5E2UL 4JZOB 3IXAB 2ED8A 4F7MB 3K0WA 4LSVL 3SO3B 2WIIB 4QRRD 1RZ7L 3PWUA 5ELIA 4BSVA 5EPMA 4UTBH 2BMKA 3ZKNC 3D3VE 1NGWB 5FF6B 4LLDA 2D9QB 1HXMB 3GBNH 2ICES 1O0VA 3QBTB 3MRJA 3QUZA 4PB0H 1S7XB 4MS8C 4XCNA 4D0CA 3U1SL 2VDQL 1I9IL 2G60H 4PJ7A 4XBGA 3RGHA 1JNHA 2J1KA 4I0PD 4LLAA 2BOCB 3ARFC 4KUZH 4L8SB 1TJGL 2FO4A 1ZT4A 2HFFB 3UJIL 1WTLA 5A16B 4JDTH 2WBKA 4KTDH 1JNLL 5JW3L 5ITFA 4PJ8C 3GMMA 4XPFL 5IIEB 2F54A 3QG7L 3OB0H 1EH9A 2H2PD 1U8OA 1FORL 4P59H 3DI3B 3BP7A 4LHUB 4IDJH 4CVZB 3BWAB 4NM8L 4HKZA 4HQQL 4PJ5B 1FRGH 3C9NA 2ID5A 2W65B 4AG4H 2XWJA 1TETL 4XVTL 2DLEA 3UTTE 3FQUA 3NGBC 1OAXL 3DSNA 1CLZL 5IGXL 1M7DA 1T66D 1A3LH 4OGXL 1IAIM 3NIDE 1BD2E 2EXYD 2LV4A 4POYA 4WV1A 4LVNB 1MVUA 5IHLB 1N26A 1VERA 3RWFB 5I0DA 3M8OH 4X99B 4GRWF 1OHQA 4LLWB 3CFEB 4D2NA 1JTOA 3IDUA 4QF1B 4M7LT 5IF0A 1NMAL 4L3EB 1EO8L 3BN9D 3QPQC 5GS3A 2YRPA 1HOCA 4FG6C 4GS7B 4XB8A 1N59B 3RIFK 4P2OA 3O2WL 3I6LD 2JCCB 5K9KB 2ARJQ 1HHIB 4PTTB 4LFHG 2ITCB 1ACYL 5JUEH 2VDKL 4XBPB 3ALPA 4DZBB 2OK0L 3S96B 1F4WL 5I9QC 5JIKA 4YBQD 2C26A 5GGTL 2CJUH 1VFBB 3QNZB 2C1OA 1MRCL 3PIQB 2J7LA 5H8DA 4F58L 1U8QB 4GQ9H 2DLGA 2XQBH 4HV8B 4JDZB 5CZVH 4AMKL 2JB6B 2R1YA 3INUH 4WWID 3PGCB 3MUHL 4NJAH 2X6MA 4ZTOH 5TFSL 1QFHA 4QY8B 3ESUF 4DKFL 1BZ7A 5C09E 3GFUA 4NQEA 4NQUA 4RMSA 2J8HA 2QL1A 4G8GA 1YNTA 4PRNA 3O3AA 4JFDD 3QHFH 4WW2F 1I85A 2NNAA 1NAMB 1ZXQA 5E4IA 3D69A 1QR1B 4NHCH 3P3YA 1YY8A 3OAUH 4KKCC 1SBSH 3S5LA 4WHTB 3U0PB 2EYRA 4YPJA 5F6HI 3WFHA 5C0GB 5BS0E 1ZAGA 2PXYA 1S9YB 3X3FL 1ADQA 5H37H 5D9SA 1AKJA 1G6RA 4O00A 1WFUA 1IRAY 2JF1A 4OV6F 4ZXBC 2D2OA 2BVPB 2W07A 3S37L 5KVEH 4O2EA 1P7KA 4LQFH 2Z92B 1DBKH 5DHXB 2NXZC 3BKCL 3S35L 3D9AH 1OARL 5C07B 2AXGA 3CFJA 5HPMB 3GMQA 1N6UA 4TNWF 3EFFB 3C5ZA 3QUKB 3MFFB 1P4BH 3QXAA 5I2IB 4XNUH 2FLRT 4DVBB 4IMLB 5DJYB 4C57C 4XH2A 5IB5A 3MJ6A 1J5OH 3KLDA 4JJ5B 2LQRA 2W1NA 4U3CA 5KSVB 4Z78B 5C6TL 1RUAH 3ULUD 4U1GC 1FSKB 2DAVA 4XAWL 4JO1H 2BHUA 2FX8L 2X1PA 1OAZL 1DBAL 3UX9B 2QHRH 3PF2A 5ALCH 4HLZG 5DFVD 4OD3L 2A6KA 1YEIL 4HPOL 4FTVD 3LMJL 1M7XA 4HWEL 4JZOA 3P0VH 3QUXD 1SJVA 5FEBA 1S7UA 2WIIA 1D6EA 3FFDB 5CEZL 3PWLA 2CSPA 5FIEA 1NGWA 1RJCA 3O3BB 3PWPD 4EOWH 1HXMA 4YHZH 4D0BB 3DETD 3KYMA 5H2BB 1FIGH 4XPHH 1S7XA 3MREA 5C0JB 1RZGB 2BVTA 1NGPL 4P5TA 4OZIB 2ESVD 3RX5A 2C5DC 1N5YH 3L5XL 4NO2B 4J1UA 4APQD 3QR2A 5DTFA 1NC4B 2LTQC 4JFFB 5IIEA 5KN5B 1YEHL 1MPAL 3OAZH 4OKVB 4MJ5B 1NUGA 2XWTA 1AXSB 4IOSD 5TDNA 3HMWL 5KTEL 1NL0L 5B3JF 2CMRH 4CVZA 1NEZG 3GI8L 4Y2DA 5ALBH 1QFWL 2A2QT 5FYKL 3WUWA 4FQ2L 5CCKH 4XP5L 3QUYC 4LCWD 2W65A 5BVPL 5CWSB 1MHPH 1IQWL 4A6YH 4LEOA 4CU6A 4GBXB 2GTWB 1ODAA 3IAGC 1CGTA 4HAFA 5ID0B 4R8WH 3VJ6B 1E4WL 2GCYB 4I3RH 1JPFB 3RWFA 3VI3F 4X99A 4ONFH 3MCLL 1URLA 4HUXB 1G7HB 4HF5L 3ZE1F 4XNQA 1FVEA 4JM4H 3BPOC 4QF1A 4L3EA 4O9HL 2O5XH 4Y2OA 4YFLI 4C56A 1N59A 2VLKD 1YJDL 1VKXA 1R3IL 2JIXD 4LPYA 5SWZB 1F4YH 1HHIA 5L2KE 2R2BA 3DV4B 5HVGB 3TN0B 5CEYB 3BT2H 4X4XA 3VGBA 1F45A 2I5YL 4ZYKB 1AGEA 3DMMD 3E6FB 4PRHE 4XBPA 4DZBA 1YQ2A 5ISZD 4N9GA 4TUKL 5H94B 3GUTB 4YEEA 1KCSH 4ONHB 12E8H 1VFBA 3BD3A 5ICYB 5KS9B 2VWEE 4LGSB 3KPLB 3KAAA 5HJ3B 1AY1H 3KYKL 1N7ML 5EB9A 4M9PA 1U8QA 3M45A 4FMKA 2AGJH 3UTSE 4ENED 5FB8B 3K8MA 4HV8A 4JDZA 3F6LA 2VXUL 4H1LH 1JZ8A 4LF3B 5HHME 3RPIA 1D3CA 3DVGA 25C8L 4OLWH 5I1IL 4XMLH 5TDPA 3WJLA 3OX8B 1ZOXA 3V4VL 4AIXA 4IOIB 3RL2B 4X9FA 3OG6B 5FXCH 1MCQA 2WQ8A 3VW3H 2ZG2A 3MJ9L 1N4XH 3U30B 4Q9BA 4HZLA 2QQNH 5MENE 5BCAA 1R5WA 1QR1A 1RULH 3C60B 2BOBA 3L5WB 5FO7A 1BGXL 3BZ4A 4OZGE 3U0PA 4RBPK 5FA3B 1S9YA 4DFHA 5IMKB 2EDYA 1WLHA 1U6AH 2F19H 5C0AA 4KQ3L 3RWDB 2FSEB 3GSWA 3L3IB 4TVPD 1XF5B 3WCYA 5D7SL 1AO7E 4LVEA 1CD8A 2C3GA 2IQ9H 3CSYA 5D2NE 1FL5B 3T0WA 4RX4A 2MCPL 1MCJA 3UYRH 5HPMA 1G7IB 1L7TL 1D5ZB 2NW3B 3GMPA 3QUKA 3FCTA 5BJTA 3MFFA 5I2IA 4FQXD 4IMLA 5DK0B 5DJYA 1WZLA 1KJ3L 4JJ5A 4YXLH 1DE4A 1V05A 1ZVSA 4NHUA 3VFGL 3BAEL 4AQ1B 3Q0HA 3LRSB 4YHPA 2Y07L 4PG2C 3TO4A 5D71L 1XIWC 1QD0A 1QOKA 2VZVA 2O5ZL 3FFDA 1JHKL 5TQ2L 1FVCB 4MA8L 4YHIA 3OSKA 1YC7A 4LSPL 3O2DL 4MLIA 4WY7H 3VFVB 3L1OL 4TTDD 5ADPL 3MCG1 4D0BA 3TFKD 1IAIL 3O45B 2BCKB 5F7YC 4JG1L 5C0AD 4HS3B 1RZGA 4Q2ZA 4ZAKB 4L9LC 4QRSB 4I13B 5TDOA 1F6FB 3L3JA 1E27B 4I8DA 3S8WA 3QQ9C 5I76B 1T0NB 3RWHA 3P40A 4WUUB 3CUPB 1B2WH 4G6JL 1A7PL 5C0IB 4X80L 1NGYA 1B6UA 1NC4A 4ODTH 4H25A 1N64H 5GIRB 5GHWH 5KN5A 2CLVB 2HH0L 3VWJC 1W72L 4MJ5A 4JDVA 2KH2B 1XGRA 1AIFB 3VWKA 2AV1B 4QTHA 4DAGH 3WIHH 5IB3B 1MCOH 1UFUA 5D1XB 1M05B 1FH5L 4WFHD 5CWSA 5EOCL 5BVJB 1NMBL 2DQHL 5HVWA 3EDKA 4LLVB 5ID0A 1S78C 2X4SA 3Q6GL 3ULVD 3U4BH 1LO4H 3TV3H 1JPFA 3ULUH 4MNQB 2XI9A 1ULVA 5F7DB 3WHXB 3IKKA 2GUOA 1G7HA 1OAYH 4JG0H 4JJHA 1UZ6F 2NY3D 3KNBB 2DYPD 3DX9B 4PV8B 1KELL 2NX5D 5IV2B 4W70A 1AQKL 4Z5RB 1Z3GH 2CO7B 4LGPB 4NZTH 3FONB 1HKLL 3VI4F 3DV4A 3TN0A 3P4LA 5CEYA 4PY8J 4R7NB 1HH9B 4G6AD 1Z0NA 4GAGL 3O3DB 3RZCC 5C08B 4JFEA 3GKZA 3AS3A 4PYHA 4HLJA 3BSZH 4ONHA 4QLRA 1HZHL 2BRRL 2VABB 3HG1A 5ICYA 5KS9A 1MFBH 4ODVH 3H0TB 4H0HB 4FQ1L 2HAZA 5JIIA 5D7LE 5K9QG 2NXYC 1QBLH 1QO3B 3DURB 1JK8B 4JQXC 4YWGH 3SY0A 5FB8A 2YBRA 4NM4H 3WLWC 3CVIH 3LKOB 2FGZA 3JTTB 1CI5A 3B9KB 4LF3A 3LSOB 3TPKA 1U8KB 2RQ8A 4GW1B 1OM3H 3VXTB 1JV5A 4D9LL 4I18B 4WCYH 5E7FA 1H15B 3VFTB 1VDGA 3KR3L 3RY4A 1W8NA 3PHSA 1Q9LB 4OJFL 4NRXA 3PQYB 2OYPA 4HEME 3F7VB 4G6MH 4YDJA 2I9TB 3BP6A 3CMOH 5C0BE 3C60A 1AXIB 3B2UD 2NR6D 4H5SB 1QFUH 2B2XH 4NP4L 4KRPD 1KN2H 2OM5A 3A6OA 5IMKA 4GG6E 4ZPVB 4JFYB 1PG7H 1N0XH 1H3WM 3SJVD 5F7HA 2FSEA 2K1MA 4GOSA 1YPZF 3VD3A 5DJDB 4NYLB 1XCQA 4BFEA 5JHDE 5L8LB 4Y16D 4HXBL 2EDXA 2JLLA 3S5LG 1FL5A 3WD5H 2HJFB 2AXJA 1WUNT 2XTJC 4OM0H 4JO4H 5TE4L 4WI8A 1LDPH 5EOQL 3N1GC 3TIDB 1GPOL 2BFVH 1U3HC 2AJUH 2VC2L 2HKFL 5DK0A 5EIQA 32C2A 1OD9A 3RFZC 5C70A 5IM7B 5SX5H 3EYSL 4QNPE 5EZIH 2XV6B 1I8LA 4LARH 5D6CA 1U8PB 1BJ1H 4LSSL 2DN7A 2ICWB 3WEXA 3QIWD 1EZVX 5TPWL 1F42A 2R4SH 1F11B 2XA8L 4G3YH 4GRLB 4WW2C 1AGFB 3EJYD 5F3HA 3QO1B 3UTPD 4PFEA 5DR5L 3VFVA 3BP5B 3B5TA 4TSAH 3QAZC 2E7MA 4K3DH 5IEKA 4IOFC 1JVKA 4MA3B 4ZAKA 4RWHA 2FX7H 2DQFB 2FJHB 2CDEA 1HNFA 2NY7H 4OF0A 3OR6B 3D18B 3TNMB 3RU8H 1T0NA 3CUPA 1EV2E 3C5SB 4OGAC 1L6XA 3X14A 3OKOA 1JWUA 5D93C 3FFCB 5C2BL 1VACB 4YO0B 3VXNA 1NCDH 2DTMH 1KCUH 1AIFA 4TVPH 4K3EL 1HWGB 2AV1A 4MJIB 5TGBB 5IB3A 1FYTE 1YUHB 3EYOB 4MGXA 1AR2A 3EW3B 5J13C 1BMGA 1ZTXH 3VXUA 5I1HL 5BVJA 1F4XL 3MJ9A 4BYHA 1OGAB 4GAYB 3KPRA 4JM2B 4LLVA 3TZVB 3QDJD 5IFJB 4LSQL 2VDNH 4YUEL 2HT3C 1ND0B 3RBSA 4NKIL 2R0ZH 1UXSA 3QRGH 2DQJL 4JRYE 1TQBC 4MNQA 4HXAL 1E4KA 3TYFB 4OB5H 2DIAA 2FJFB 3WUWG 4HT1H 5F70A 1MCPH 3P73B 5F9JA 5J6HB 5ANMB 3HE6C 4UNUA 5FCUL 3C09C 4ORZC 3FONA 1T4KB 3ILPB 5F96L 1KGCD 4E41D 1S3KH 1YQVL 1YY9C 3QI9D 4N5ED 4R7NA 1CICC 1HH9A 4NPYA 2VDQH 4X4ZA 2VLJB 1IFHH 3BZFA 4EN3B 4O51B 2VABA 4PJAB 5JXAH 5F1KC 4LOUC 3VG9C 3WE6B 4IEFB 4GMSH 2FECI 2Q76B 1TJGH 3UJIH 1RIUL 3DURA 5BW7C 1MI5B 2DKSA 4K71B 5E2VL 5JW3H 1XT5A 4EI6B 3QG7H 5FO9B 2EEDA 3ARBC 1XGUB 1U8KA 2JB5H 4GW1A 1MFDH 1IZJA 2NYYD 3U9UB 1B4JH 3G9VA 3MV8B 4NM8H 4R90L 1H15A 2J8UA 1GGBL 4HQQH 3D6GA 3LDBB 1CGYA 4HJJL 2R8SL 1Q9LA 1YMHA 3LH2H 5HYFA 4LCCB 4XVTH 5D2LF 3ZZ1A 3F7VA 5J1TC 3NA9H 1DQMH 2HFGL 4HIJB 2HWZH 3W39B 1QFPA 2I9TA 2FD6L 4EIZC 4MAUL 4H5SA 4P46C 5KW9H 2O93L 4PJCE 3PV6B 1CD1A 2WINA 3ARED 4ZPVA 4XC1L 5CP3A 1G1YA 3C6SB 3ULVH 2E8YA 5AD0B 4XMKH 5DMYA 1IGYB 2A0LC 3D85D 3IXTA 3TJHD 4PJXE 1NMAH 1VESA 3LN4B 3ZMRA 2Z31B 4NN7B 5DRWB 5FUZL 4UQ3B 4NCC1 5FYJL 1EERB 1ACYH 1J0HA 1W72A 4UB0L 4KJPD 2L7UA 2V17H 3TIDA 2APTA 5DJZA 4TN9A 3MRNB 3ARRA 4QOKD 4R0LA 3LB6D 5GGTH 2IQAB 2VAAA 2O61B 3V6ZA 3RHWF 1ORQB 1FDLL 4LIQE 2CPCA 3BPLB 4TSBL 2NY5L 2XRAL 1LEGB 3H9ZA 2ICWA 3C6LC 1HDMB 4JQVC 1OF2A 4IS6A 4A6YB 3BIKA 4S0SD 3IAPA 2X4QA 1WQVT 2Q8BL 1VPOL 2EIZB 3QO1A 1A4KB 3TJEL 2MPAL 1F5WA 4Q97A 4NQXB 1YMMD 2ZOLA 1QNZL 3ELAT 4WGVB 2EIBA 2Y5TB 4MA3A 5CSGA 5J8OA 3AMKA 3EBAA 5DDHB 4I77L 5IOPB 5GGSB 2VR9A 4ODSH 1QACA 5CMAA 4BH7A 5IMMB 4HIEB 1A8JH 4OBRA 3X3FH 2ZUTA 1OL0A 3C5SA 5F6IC 3PUCA 1FFQA 3S37H 3H6JA 1MIEH 1Q1JL 2DLHA 2VE6B 5CAYB 3QIBD 1UWXH 3S35H 5HSFA 1BLNB 1OARH 3JUZA 4CNIB 2NY2D 5IBUB 1C16B 2XPGA 1VA9A 4FP8H 3V5KB 1EEQA 4I0PB 2EDNA 1YUHA 3MV9D 3W11D 4H1LB 1I1YB 3U7WL 3CJJA 1JIBA 2R69L 4Y5XC 3LS5L 1IT9H 1FNFA 1D9KA 4M7ZB 4NQVA 1MWAL 4Y89A 4P9ML 4BELD 1IAII 1NGZB 1OAZH 1SEQL 3LZFL 1DBAH 1U58A 5JOFB 2ZKHL 2MMXA 4WI5A 4TSCH 1HSAB 1SVZA 3G6JF 1NBYB 5K93A 1PZ5B 3P73A 5HYSA 4ZNEA 5ANMA 5KANI 15C8L 4DJMA 2HT2D 1RIHH 4FQIL 4YZFE 1A47A 5I0ZA 4M8QB 4YNYA 1EO7A 4M6OL 4LMQE 3GGWB 4DGIL 6FABL 4IDLA 3EJZD 4P4RB 1O7VA 2BVYA 3KXFD 4O02H 1A7RL 3I02A 1DQTA 1GOGA 1KCRL 4O51A 4PJAA 3W5MA 1LK2A 5I30L 2EC9U 3WE6A 2Q76A 2DICA 4Y4HA 3L5XH 3UDWA 1Z9MA 3RUGA 4Z18A 3KLAA 5HGAA 1JN6B 3TT1H 4P3WA 5HYQB 5IESL 3AAZB 4EI6A 5EZJA 1MPAH 5FO9A 3IFOA 5AWNL 3ZSTA 5EDXA 4NQSA 1NCWL 3MLSL 5I75C 5KTEH 2VL5B 4W6WB 1J11A 3GI8H 3QISA 4U6XB 2I26N 4WU5B 4FQ2H 5I8EB 4OLVH 4QHLA 5BVPH 1PD6A 4XCCH 1U2HA 2D0FA 2A6JA 1FN4B 1IQWH 2BY0A 5E8EB 4MXWH 2R4RH 3W9EA 5MHSE 4HIJA 3W39A 3WHE1 1I9EA 1U3ZA 4TPRH 2WWMC 1P7HL 1ZANL 4F57H 5BV7H 4NQTA 5D6DC 2J4WL 4HF5H 5AZ2H 3C6SA 4I48B 3S6CA 1H8NA 3SKMB 2H9GB 4JFDB 4O9HH 2G2RB 2X4NB 5HGHB 4PJGF 3DGGA 5DRWA 2NPLX 4UQ3A 3RVUC 5IVXB 4Z0BH 3HRPA 3NMEA 4UT9L 1BVZA 2E27L 3VXSE 4NQCD 1G9NC 4DUXA 1ZT1A 4X