2R1WA

Crystal structure of s25-2 fab in complex with kdo analogues
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
216
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTITSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSEGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab, antibody fragment (IgG1k), light chain
publication title Exploration of specificity in germline monoclonal antibody recognition of a range of natural and synthetic epitopes.
pubmed doi rcsb
total genus 49
structure length 216
sequence length 219
ec nomenclature
pdb deposition date 2007-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r1wA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r1wA01
3E8UH 4QYOB 1A7OL 1HHHB 4X6DF 1MHHB 1OGTA 4OLUL 2DQDL 5HD8D 1RJLB 1BFOB 2CRIA 2MPAH 3CFJA 1QLRA 1J9CT 3VG9C 3F62A 4OZGB 1F3DJ 1JPTL 1KB5A 3SO5A 4MJIE 5JQ6L 1AXSB 2GJ6D 3KYNA 1HKLL 4HWUA 1BAFH 2ZSWB 3HG1B 3B5TA 1IM3A 3QNZA 1FIGL 3MV8A 4H1LG 4JB9L 3RAJL 3TH4T 3MLUH 5D96C 1FZOB 5FUOH 1F4YH 4P2QE 4OZIF 1BQHA 3KXFD 4XP1H 4PJBF 4QRSB 4QRPD 3LH2L 5H2BA 2A6KB 2OK0H 3X3GL 2VDML 5GS1C 4JN2A 4IOFC 2NY3D 4KK6C 3RWEB 1QYGL 5H94B 4I48A 4K8RL 2V2XA 1QRNB 3I6GA 3LSOB 4RGND 5EIVA 1BPVA 2FWOB 5I1CL 4P49A 4AIZA 2CLZA 1DQTA 1LVEA 2C1PA 2ICWJ 1WBXA 5TE7H 2NXYD 2NY0D 5E6IA 4FTVE 5GS2H 2DDQH 3TBTB 4PLKC 2JF1A 2YBRB 3U1SH 1SQ2N 5JDSA 3O6FD 4M1DL 5A2JH 3ZE1E 3ZTJH 5HY9B 5FO7A 2H32H 1FFNA 1TJHH 1XF1A 4LHUD 3DI3B 3SCMC 4BM7A 5TQ2H 1NC4B 1QFUL 2BNQE 3QZWA 1A2YB 4V1DE 4E42A 4Q9BA 1D5ZA 1H3PL 4KZDH 3HFMH 2C7UB 2QHRL 2AJVH 5D8JH 3V5DB 2HWZH 4AL8L 4IJ3C 4NUGL 5TH2A 1XGYH 4G6JH 1NAMH 4F2MB 3EUUA 3E0GA 3TBYB 2YWZA 1TZHA 1XEDA 1XZ0B 2Q3AA 1S9YA 1ZWIB 3IFLH 3GB7B 4KUCF 4KJYB 3VFWA 2MNUA 3VXTA 1F11A 1RIUH 4YPJA 1JWUA 5IKCA 5HHOD 2YPLD 1YC8A 2EDLA 4P2RA 2VYRE 5MEPA 5I1GL 1PVHA 4JJ5B 3OX8A 1DEDA 1ZGLM 4LNVA 1B4RA 1HINH 4X7SL 5INCB 1NUNB 4FQHA 5I8OH 1CDBA 1LO0H 5HYQB 4C55A 4GSDL 5GPRA 5SX5K 1VADB 5KG9A 4WI3A 5BV7H 3N85L 1KPRA 5SWZA 3FQNB 4G7VL 3HPJA 4UUJA 1S5IL 2NX5B 5SWSE 4HX1B 5FA3B 2ID5A 2FSEA 3PXJA 2YPKB 5TPWH 3TT1L 3OGOE 2X4OB 3AREC 4MXVE 3MLYH 5EO0A 4LEOB 3FONA 4G7YH 3VXNA 5J6HB 1NGPH 2Z93B 5DD1H 4OD1L 4TNVF 3TH3T 2JCCA 3QCUL 1A6WH 1CL7I 3DUSB 1NCBH 4LLQB 5HI5C 1ZS8A 5E8OB 3IXTB 2FR4A 3BOVA 3TVMD 4I8DA 3QQ9C 4XWOD 1OM3L 3UTZB 3ZYJA 4BFEA 1YECL 3WN5B 5E4EB 2YK1H 3SJVA 4BH7A 5CP7A 1AC0A 3ARBB 3BD5A 3HE7C 1GJIA 4MJ6B 4JPKL 2NY7L 1GGUA 3C6LD 1HQRB 1AI1H 3RA7L 3RWFA 4PGBA 4F15B 3FQTB 3M8OL 1S7XA 5ELIA 3ZHKA 2QTEA 1VGKA 3GBLA 4XB7A 3NZHH 2YD7A 3ILQC 3PGCA 5MEOB 3T1FA 5FF6B 1YNLH 4QHMB 4Q9RL 1YMMA 4HKXA 5F9DC 1KC5L 1CXHA 1SJEA 4OTXL 4ZFOA 3GBML 4DVRL 3DHMA 4PG9B 2FB4H 2I5YL 4BSVB 1BM3L 4ACPA 4NQDE 2AXGA 4Q0XL 2UWEB 3WDHA 1I8KA 5H37G 3W0WD 3L6FA 2ADIA 32C2B 2BVTA 4Z7QE 4I3RL 2CUHA 4XCFH 3TWCH 2OLDA 4HK0A 1T83A 4Z0XA 4GW5A 3OAYK 4FFWD 3IDGB 1SMAA 4Y7MA 4PRIE 3CH1A 3QQ4B 2G9HA 3QIUC 1A1OA 3QT2A 1GC1H 4P5KB 5L2KE 2X4RB 5DTFB 4HD9A 1IKFL 3O41B 5EZOH 3X12B 5D2LE 4KVNH 2A74A 5F93C 1UXWA 1VA9A 5IVNA 1R5WA 4GQPH 2QQNL 4S2SB 3LEVH 4P3CL 5LVEA 1DQLH 3NTCH 5LCVL 4HCRL 3WXVL 2PO6D 1HYSC 4MJ4A 5I1JH 1MQ8A 3P2TA 4FXKA 1UM4L 2XTLA 3HRZB 4U6XB 3H3BC 3UPAA 2I9TA 1H3GA 1YN6B 3MREB 4DCQA 4ZDHA 3FO0H 4EI6A 3C5SB 4NKMB 3QUXB 4PBXA 3LEYL 3EJZC 2IGFL 5DRZB 3ZKXB 3THML 1EFXA 1AKJA 4JM2B 4PLOB 1OGAD 3V4PH 2HFFA 3OJDB 4YDKL 1AC6A 2VO5A 1X5KA 3BP4A 15C8L 1NBZA 3JTTA 3JV6B 2QKIA 5FDWA 4JQXC 1A47A 4R90L 4UILH 2GCYB 4JAMA 1KIPB 2DL9A 1WFOA 1OAYL 4HS8L 1M05B 1WZKA 4HWZA 4IOFD 4CN4A 5CSGA 3TIDB 3FRUA 4I4WB 4KK6D 4KI5C 1AHWB 4GMTL 5D2LF 3RWGA 1GOFA 4BQBA 3MXVL 4Y4FB 1U95A 1J0ZA 2KL6A 3PL6D 6FABL 2XY2A 5J57B 4PLJC 3QIBA 2EKSA 1OHQA 3CXDH 1HEZA 4UAOB 1MIMH 2V2WA 2VZOA 4O51A 1SBBA 4L8CB 4IOIB 4PLKD 2IALB 4CW1B 1S9VA 1VEOA 3JWOH 4YHOL 3GGWA 2I60H 1FZKA 1P7HL 1V7MH 2MCG1 4RIRB 2FZ3B 1B88A 1YEIL 4TPRL 4WWKC 3SCMD 1N64H 1MRFH 1TVHB 1ZT4A 4WDIB 1RU9L 4UIMB 1UCBL 4JPWH 1NBQA 4U49A 4JZJA 3ROLB 1OW0A 1GPOL 5CSZA 2J6EH 3H7BA 3BEVA 4N0YL 3O8XB 5DGQA 4OIIH 3G6DL 2DQGH 3QEHB 1JGEA 2MQCA 2R56L 3TYFB 2HTKC 4PY8I 1XF4B 5KOMC 5DVOA 2GJ6A 4R0LB 3ULSA 3BDYH 1UQSB 3SY0A 3PJSB 2YXFA 4S1QL 1YZZA 1MFDH 4K94H 3T3ME 1LNUB 2V9RA 1YEKL 3VGGA 3G5XB 3TJHD 5JHLH 1HQ4B 2XTJE 2VLKE 4QXTB 1QPPA 2WINB 1Q1JL 3DX7A 4JFED 2YSSB 3A67L 3DURB 1NBVL 4WFED 2BNUA 2DQHH 3UYOD 3GO1L 3MV9B 4WFHD 2DWEA 4X7TB 4KPHL 1RVFH 3KXFA 5HI3C 1UXSB 3Q6GL 5DR5L 3QEQE 4NHUA 3NCJL 4K07A 4B50A 1QFOA 5F1KC 5AZ2L 2DTSA 4AJ0A 2A77H 5C0AA 4K2UH 1IKNC 4M5ZH 4YPGA 3DO7B 1LK3H 4NQSA 4I2XE 3K46A 3HZKA 3KPRE 4YUEH 4M6OH 5F1NB 1XCQB 5HVWA 3ARED 4DGIH 3MOAL 1UC6A 4IRZH 2HN7A 3O3EB 3UBXB 4RA3A 3TC9A 4G6ML 3FMGH 3LIZL 2ATPA 2J5LB 1CG9A 2JB5H 3O6FA 3GMOA 5HI5D 1REIA 4FZEL 2J8UE 1CDJA 2XWJB 1BVKA 3RKDD 2D4DA 3QQ9D 4LHUA 5BXFB 3FB5B 3S9DB 1OQXA 1LO5B 3EGSA 4XPFH 4O4YH 3QJFA 5IWLC 2ADGB 4P0DA 4WTZG 3RDTC 1FL5B 3HE7D 1ZVSB 4XH2B 1KCVL 3T3MF 4S0SD 1PKQB 2XI9A 1U92A 2P8MB 4FQ2L 5F7UA 3NPZB 5C0JB 4U2ZA 1WWWX 3CXHJ 3DTXA 3U36B 1T2JA 1XT5A 1KB5L 3DXAD 4Y5VA 1NKOA 4Y4HB 4C59B 3FO9B 1IAMA 1XGUA 2XZCH 1AIFA 1Z9OA 3ILQD 5C07E 4XGZB 4E9LA 1CK0L 3BH8A 3HHRB 5HDQH 3L5XH 2YN5A 4NBZB 4CVWA 3V6OE 4OCNC 4JKLA 4IMLA 3DUHA 4JQIH 4HXBH 5HHOA 1WZMA 2YPLA 1PSKH 3CDCA 1HIML 2OJZL 1LD9A 3KJ6L 2BVUA 1LILA 5IVZB 4UDUA 5EZLB 2ITDB 4NCC1 2X4PA 1NUDA 4MGXA 1EERB 3T09A 4QNPE 4HV8A 1DBAH 4LLWA 2J8UF 3CX5J 3KPOB 4HFWB 5GS0H 2GQHA 1IGJB 3QIUD 4AH2A 1Q9OA 4NQCD 2ARJQ 4IRSD 4NQED 5HGBB 5D9SA 3UZEA 4A2MA 2NLJB 4X83A 3VG0L 4JY4A 4GMSL 3SDXE 1IL1A 2E5EA 3BKYL 1RUPH 5ADPL 4OCSL 1ZGLA 2ENYA 3QFJB 4Y1AB 4ZOCA 1Z0NA 1BF8A 3WNPA 4U1HB 2BJML 4F7CA 4DUVA 3SPVB 5LAXA 4LLUB 4XI5C 4ZO6A 3CFEA 1TETH 3D3VD 4UOW0 5HYJB 2WZPD 1X7QA 1HYSD 1FNEA 3LQZA 1K4CA 5E9DB 3LKOA 3GMLA 3TVMA 4WI9A 5CBAA 1QLEL 1HHGA 3L3KB 3FT4A 2QLVB 1KJ2A 3O11A 1YNTA 4QHLA 1KIQA 1BP3B 4XBEH 5IESL 3P4MB 1J1XL 1K5NA 4YFLF 3UTTE 2FJGB 3RNQB 3EJZD 4H8WH 3LV3B 3C6LA 3MOQA 2AV1A 2A9ML 3BKCH 3KG5A 2QQLL 4YX2L 4AT6A 3KLHC 2OL3A 3NPSB 1DUYB 2UYLA 3LKNA 2WNGA 4HS3A 5D6DC 3PWUA 5I30L 3VI3F 2EDYA 3EFDH 3BQUC 4U6HB 4WVRA 1QRKA 2J6EA 1HSBA 1CN4A 5I9QC 4QNPF 4WHTB 3VXPA 2WP3T 1T4KA 1FFQA 5EO1B 2BNRB 3RJQB 2YWYA 4RFNB 2UVFA 3NGBB 4JHZA 3MBEC 1URLA 1MJUL 4KI5D 2QBWA 1CT8A 3CFJB 1QLRB 2DLFH 4M93B 3W0WA 4P9ML 4QXUL 5E4IA 2ZUQC 2WBWB 4BZ1L 1S9XA 3QI9C 5CEZD 1YEGL 3G6JF 4K3GA 2PR4L 5BQ7A 2W0KA 3CCHA 1WEJL 3LHPL 3PDGA 3DO3A 4OD3H 3KYNB 3FB8A 1CWVA 5DT1L 2LVCA 2AI0L 3EZ8A 1DBKL 4G3YL 1IM3B 1ZA3A 3MV8B 3QNZB 5FGCB 1IMHC 2AABH 4LVOB 1CXIA 3RHWF 2ZUSA 2GTWA 5ICZA 4YZFE 1BQHB 2VDOH 3V52H 5CINH 5H2BB 4J3UA 1E4XI 2PO6A 4JN2B 3K2UL 1L0QA 2QEJA 1GGCH 3MXWL 2D0GA 4I48B 5HHXL 2H6PA 4JRXD 4MA3A 3I6GB 5FYJD 3DECA 3WD5L 1C08A 3P0VH 4FZ8L 4YFDB 1B90A 4AIZB 25C8L 2CLZB 2BRRH 2C1PB 1BLNA 1WBXB 5E6IB 2NW3B 3KNBA 1JUFA 3RPIA 2FGWH 4PG2A 5T1DL 3N1MC 3RVUC 2ICWI 1OGAA 5JDSB 4GBXD 4OI8A 5FO7B 4AK1A 1FFNB 3RU8L 4P2OC 4M7JL 1RUQH 4ZFOL 5F3BA 1K6QH 4LHQB 4YHYC 3T0DA 5HI3D 4KK9C 3QZWB 4QGTA 4E42B 1KCSH 1KFAH 4HUUA 5L7XH 2CMRH 5EU7C 4K3DH 1KLUA 1I3RB 2CRYA 4HPOH 1ZSDB 2Z8RA 1EO8L 1WUNT 2GI7A 1ZANL 1AO7E 2FYYA 3QUZC 3PL6A 1QNZL 3GSOA 4YZFF 5AYUH 5B22A 4I9WE 1TZHB 5HHMB 5EWIH 1S9YB 2KZ1B 1Q72H 1CE1H 5HJ3A 1I9JL 4NO0D 3CZJA 2FRGP 3VFWB 1GOHA 3O81A 3VXTB 1F11B 3ZTNH 5IKCB 1JWUB 3L5JA 4GJTB 1OQOA 3FFCE 4P2RB 1D5XA 4FFVC 4ALAL 5MEPB 1I1RA 4PGDA 1I7ZA 2EYSA 3SCMA 3OX8B 4PTTB 4XPGH 4LKCA 2Y25A 1RULL 4U1SA 4WW2F 1DVFC 4ZXBC 4FQHB 5I19L 5D6CA 3MLXH 3MRFA 5KG9B 1XGPA 5F96L 1KPRB 3ALPA 43C9B 5SWZB 1MY7A 4XHQA 5C9JB 5TDPA 3L9RA 3BPOB 4R96A 1FFOA 2B2XH 2YUWA 3HPJB 4UUJB 4JFDD 3TZVC 5CLWA 1UWXK 1U36A 2FSEB 4ZNEA 1S7TA 3MLSH 3CVHH 1GRWA 5EO0B 3S3PA 3W11C 3FONB 3VXNB 3AS1A 1HE7A 3TCLA 2JCCB 2YD2A 3DYMA 2VDNL 1ZS8B 3NACH 3U7WH 4MXQC 1T5WA 4JFEA 4TVPE 2FR4B 4M62H 3ES6A 1JNNH 3FTGA 5DD3H 1CFSB 2K3TA 4MHHG 3SJVB 2YEZA 2IQ9L 5CP7B 4P2YA 2YC1A 3OF6D 1U6AH 1FIEA 4MLIA 2CGRL 1E6JL 1CXFA 1I9IH 1EEYA 2O5YH 3BKJL 4F7TA 4ELMF 1EXUA 4J6RL 3LS5L 3RWFB 4PGBB 1WK0A 2VR5A 1OAQH 2BERA 1S7XB 3SO3B 4JO3L 1VGKB 3MCLH 2ZUWA 3REVA 4R26L 2UUDK 4F8QA 5C7XH 3PGCB 4HIIA 5EFIA 3AREA 4HBCL 5DO2C 3T1FB 4ZMAT 5IW1A 1YMMB 4KRPD 4HKXB 3QEGL 4TNWF 1SJEB 4GKNA 3BZ4A 4NZTH 4HJGB 4J2XA 5IB3A 3U7YL 3F7QA 5DURB 2B1AH 1CGTA 1UB6A 3W81A 2AXGB 4PJEA 4MD5A 2EIZA 1RUKL 4IRJB 5DA4A 1I8KB 2ADIB 4XMLL 3HE7A 4DAGL 3F5WB 1GZQA 4F37K 4GQ9H 1DE4A 3LD8C 2I25N 2VDPH 1J8HD 4HK0B 4GW5B 4Z0XB 3V0AC 5BO1L 3QXTA 1WZ1L 3CH1B 3KLHD 1A1OB 2NW2A 3DXAA 3X3FH 2ZUTA 4ODTL 1PG7H 1QR1A 5CGMA 5ICYA 2A74B 3SOBL 3BQUD 1UXWB 4PJDA 3P11H 1R5WB 1DBJL 2CRMA 2DQJL 3BUTA 4HPYL 3VXME 2XN9D 2OR9L 1RHFA 4XC1H 3LN4A 1F4XL 3QHFL 4TUJA 3LQAC 5FA4A 4PJFA 1YY9C 1OSPL 2AXHA 3MODH 4EI5D 2WLYA 3MBED 1Q0YL 4FXKB 1ETZA 2I9TB 5B38A 1CQYA 1U42A 5L9DL 2QQKH 3ZMRA 4DCQB 4HXAH 4ZDHB 4EI6B 5J8OA 1ZHNB 2YN3A 2YA2A 4NKIH 2H32B 4R8WH 3FHAA 5IK3A 2KKQA 2X7LA 4ERSH 4OD2A 4XC3L 1E6OL 1EFXB 2FH6A 1AKJB 3QIUA 5J6GA 4NQCA 1EGJH 4IRSA 4NQEA 4OZFG 1TCRA 1BZ7A 2HFFB 2CUIA 4LVNB 4Y5YC 3BP4B 1GHFL 4FQJH 4MA1B 4G43A 3JTTB 2QKIB 5FDWB 4JAMB 2DRUA 5LWYL 4WO4C 4GS7B 3D3VA 4HWZB 2XKNA 4HW6A 3WDIA 1GYAA 5AAWA 3FHQA 2IBZX 1U95B 1MCCA 2IADA 1V3LA 2XQYK 2OR7A 1F4WH 4Q7DA 3ZSSA 1ZLUK 1NUGA 2EKSB 2GITB 4MMZC 5CGYC 1P1ZA 4BQ8A 2ZKHL 3T0AA 1HEZB 1MJ7L 4O51B 5DMGC 4KY1H 3RTQD 1G9ML 3VMPA 1S9VB 4ODSH 1QKZH 3GGWB 4NKDA 1HH6A 1U8QA 5GGQH 3GMNA 3LN5A 3INUL 2OQJA 3AS2A 2R0KL 4MWFA 1MWAH 3ARGD 4OZGF 1EBAA 4P2OD 4JQXA 3UTSE 2DM3A 1ZT4B 1UWEH 4KK9D 5SX5H 3W9DA 2DL2A 4MZ3A 1DL7H 2Z91A 4ZTPH 1DFBL 4X6CA 5C0RL 3CVHA 4JZJB 1EIBA 1AD0A 3QUMH 5CSZB 3H7BB 3QAZC 3WIIL 3BEVB 1JGEB 3QUZD 4M4PA 1IT9H 1IGML 3ZSTA 4UILL 1WICA 2P47B 1QHOA 3WHXA 2GJ6B 3ULSB 1OTUC 3S34L 2G2RA 3SY0B 3BGAA 1BQSA 1I7UA 4YAQA 4D0DA 1JPST 4QO1A 4YHIA 3H9ZA 4PJGA 5CJOH 1T66C 3DX7B 4JKMA 2BNUB 2F8OA 3KPSE 2DWEB 2HLAA 3KXFB 2D9QB 3O3AA 4QRPB 2IPKA 1DVFD 1FCCA 4ZXBD 5BVJA 4NHUB 4P57A 1ZTXH 3I50L 2EIEA 1CL7L 1KJ2L 5TQ0H 2NY3B 5IHUH 2N4IA 1DSFL 3A0OA 1U8MA 4JRXA 2NX5E 4YPGB 2K7PA 4LLAA 4NQSB 3EYOA 4RGNB 1B6DA 5D5MA 3TZVD 4AEFA 3ULUH 1BFVL 3OAZK 3HZKB 2OL3L 1EMTH 2HLFC 2NXYB 2NY0B 4PJ5E 2HN7B 2HRLA 5GZOC 3MLZH 5CEYA 3ULVH 3MUGA 2ATPB 1CG9B 4FQXD 4XRCA 2J6EL 3O6FB 3GMOB 4GBXA 4MXQD 4UNUA 4MJID 1BVKB 2C4FU 2JELH 4K3EH 4KUZH 4MDIA 4LHUB 1T20A 2UZIL 3EGSB 2ICWA 4LPUA 4Q2ZA 4QRRE 1MEXL 1EDQA 3OAYH 1R6VA 1YN7B 1OP3H 2R29L 5IQ9A 1U92B 1BREA 3RI5F 2D7QA 4P2QD 2BVOA 3PHSA 1D6VH 2VZ3A 5IF0B 1IKNA 3DTXB 5GRJL 4JGMA 4ZUTA 4Y5VB 1VENA 3SDYH 2EYRA 2R39A 1BOGA 1N7MH 4KUCD 5KANG 3U82B 5HYFA 1T1YA 5DO2D 3BH8B 1G1CA 2MCPL 3M17B 1ND0A 4Z95H 1ORQA 1INEH 4NO0A 4PPTA 4OLYH 3NCYP 3SGDH 1QOKA 2VUOA 4L3CA 1ADQA 1WC7A 4IMLB 1J0JA 3SKMA 2WV3A 3TJEH 5HHOB 4G8FB 2YPLB 5I17A 4FTVD 5KVDL 4L4JA 4DGVL 1LO3L 2UWEE 1LD9B 3DGCR 5CP3A 2Q7YA 4UDUB 1EGJA 2X4PB 3RDTA 5HPMB 4ELKA 4HMEA 1QP1A 1B3JA 4HV8B 1Z9LA 2D9CA 5KS9E 1I8LC 3QQ3A 4LLWB 3CK0H 4TSBH 1E28A 1IC1A 2BNQD 2AJSH 2R2HA 4O9HL 4AH2B 1Q9OB 5T33H 4V1DD 2FATL 1EEUA 3QWOA 3DBXA 2PUQT 3OKKA 4JFDA 4JY4B 1IL1B 5AZEH 1ZGLB 5D72L 4GG6E 4F7CB 5LAXB 3EYFA 3CFEB 3RVVC 3MUZ1 1N59A 1X7QB 1FNEB 1YY9D 1RIVH 3C8KA 3LQZB 3U0TA 1K4CB 3KYMA 3LKOB 2GK0A 3GMLB 3CDFA 4XNXL 3TVMB 5CBAB 2EDHA 4XZUA 1HHGB 3FT4B 5DK0A 3ET9F 1KJ2B 3S37H 3O11B 1G7LA 1YNTB 3H2WA 4QHLB 1KIQB 2XTJC 2GJZB 4Q58C 4UT9L 3OF6A 1K5NB 4N8PA 1YA5A 1MCHA 3GI9H 3P4OA 2CUMA 5E8PA 3C6LB 1UGNA 2AV1B 2Z8WC 3V5HA 3HAEH 3L1OH 5HSFA 4AT6B 2OL3B 2EYTA 4EDXA 5E2VH 2UWEF 2UYLB 3WJJC 3LKNB 4HS3B 3PWUB 3QXWA 4H20L 4L8DA 1FDLH 5T3ZL 4KHTL 4X9HA 1P9MC 1U8KA 2Q3ZA 3TCXA 1HSBB 4FQQA 3BGMA 2XA3A 1EO5A 3VXPB 5KS9F 3DYOA 1T4KB 3VU2A 1D5IL 1DEEB 4RMVA 5SWSD 4HUWA 2G5BA 4QOKE 4EOWH 1BBJA 1CT8B 1CIUA 1GZPA 1HHJA 3PNWA 4LDEB 3W0WB 3JV5A 4GG6F 5D2NE 1NMBH 4XCYA 1S9XB 4V2BA 1DQDL 5BQ7B 4IHOA 3CCHB 5CGYD 1J8HA 5K93A 3MA9H 3ZE0E 4YXKH 5GISL 3FB8B 4V2CB 2YOCA 4NNXA 5GGSY 1ZA3B 1PG7X 1XF3A 2AJUL 5D6DA 2OR8A 3WE6A 4MAUL 3BQUA 3WFEH 4UV7H 2GTWB 2OSLB 1R3IL 2XN9A 1A5FL 3B9KC 2RGSA 2BHZA 4KHXL 1WT5C 4JM2F 1JGUH 5BMFL 2PO6B 3RWDB 5FAAA 4PB9H 4LLVA 3MBEA 3VFNA 4NBYB 2CLRA 4Z7UB 5IBLC 5B39B 3RP1A 2H6PB 4MA3B 3V6OC 1N8ZA 1OL0A 5A2KH 4X6EA 5IM7A 3VG9B 4M7ZC 3H9SD 4NPYA 1C08B 1MI5E 4ODUA 3O6LH 5DWUH 5H8DA 3AMKA 3SDAC 2XZQL 4RFOL 1OTUD 4NQDD 1E4WH 2OX5A 1JUFB 2XXCB 3KNBB 3RPIB 4OIAA 3NZ8A 3TM6A 1MHPL 3WLBA 4YHPA 1OGAB 4QTIH 4ENED 3VFOA 1T1WA 4PJIA 1KLGA 1T66D 4HMCA 4KTYA 4WIQA 1NEZB 5MEQA 2VXVH 3RVXC 4PRID 5F3BB 2V9QA 5L2KD 3CDYA 4HUUB 3GMMA 4NRYA 1JZ4A 4QWWC 1T2XA 5JLZA 1KLUB 1W0YT 4CJ0A 3FZUC 2FYYB 5J9PB 4UT6L 3DX9A 1AP2A 3P4NB 3OKLA 3PL6B 4XCCL 3GSOB 3MUJA 4M6ML 4P3DA 5I1KL 5F8RC 4LAQL 1UWGL 5GZOD 1OAUL 2DLEA 5HJ3B 1RZJH 2ZJSL 3QRFM 3RTQA 3IDIA 3AVEA 3P3YA 1L0YA 3MJ6A 4OLVL 5IT2H 3F65A 3HTLX 3FAWA 3JVGC 3O2VH 1KTDA 2DAVA 4D9QD 1FFPA 2E9JA 5TDNA 3ARGA 1D5XB 4KQ3L 2CKBA 3OSKA 2MFNA 3BIBX 2R4SH 2XRAH 4PGDB 1I7ZB 2EYSB 4P2OA 3SCMB 5J11C 1JV5A 5DVMA 2OTPA 3TH2T 3NAAH 1B9ZA 4LKCB 4U1SB 3EW3B 4OBRA 5C0BA 5D6CB 3PWVA 3MRFB 4M8QB 1AFVH 2F5BL 2WBKA 1XGPB 3MX0A 1MAMH 2J8HA 5HYSA 3QRGL 3OAUL 3EO9L 5TDPB 3L9RB 4R96B 1FFOB 5E5UB 1S8DA 3QUZA 3L3JA 2BX5A 1RHHA 1YEHH 5C6TL 1U3JA 4NYLA 4DN3H 3AC0A 3GMPA 3ARUA 1K9TA 2EDKA 4F3FA 2Q8AL 4NHCH 2RR3A 4HPOL 4O5LH 3TCLB 1ZVYA 5I8CB 4OZIA 4Q6IC 1T5WB 2E6JA 5T3XD 4JFEB 3A6CH 4PJBA 5CUSH 3ES6B 3FTGB 4Y5XC 5D71H 3VFTA 1MPAL 2PNDA 2X70A 2I24N 2YEZB 2COQA 3UO1H 2YC1B 3VW3L 1E4KA 4YBLC 4JFHE 1DVFA 4ZXBA 3SEPA 1X4XA 1EEYB 5DUBA 4F7TB 1QQDA 1CDIA 3SKNA 1TXKA 1XR9A 2R1YA 1JP5A 4KV5F 4P59L 3TZVA 2CSPA 4EDWH 3REVB 3FRPA 3D0VA 1KXQE 5EFIB 1ZGLP 3AREB 4YWGH 5J0BA 5HYJE 4GKNB 1UCTA 3F7PC 3RVVD 1NGZA 3BZ4B 4F9PC 3R4DA 3F7VA 4LASH 2Y06H 5IB3B 1N6QH 1IAIM 4GAJL 4MJIA 2P45B 3CFKA 4NZRH 4JKPH 4XXCC 4GKZA 4WW2C 1UB6B 2W07A 3ZDXE 3OJVC 1NGXB 4PJEB 4MD5B 2EIZB 2VH5H 3CVHL 3QDAA 3KJ4C 3QUYC 2F8XC 1A7PL 2DLIA 1IAII 2VLKD 3HE7B 2X4SA 3X17A 3WL9A 5GRWA 1GZQB 3WXWH 4XBGA 1DE4B 4DN4H 1JWSA 5DJ2A 4P2QA 3F6LA 1OP5K 3JZ7A 2H26A 3VWKC 3PWLA 2F19L 2NW2B 1QACA 1NCDH 5CEZL 3QEQD 3DXAB 5FXCH 1RAMA 3NFPA 3WIHA 3PWPE 3TN0D 1QR1B 1JL8A 1RURH 5JW4Q 3QPXL 1GH7A 4MA7H 4PJDB 1CD0A 4YR6A 4HSQA 2WUBH 3VA6A 2QSTA 1W2KT 2EDXA 4OGYL 4TUJB 2ORBH 5FA4B 4ZUSA 4PJFB 4G6AC 3KPRD 4Q9CA 4HGMA 1AQKL 4LQFL 3FKUS 1YEDA 4FTVA 4P9HC 4PREA 1JPSH 4AEEA 1ETZB 5B38B 5TE4H 1OF2A 5E2WH 3AS3A 3TV3L 1IBGH 2BY0A 3EYVA 2UV3A 4KRLB 3MGOB 3BVNA 5FYJL 5IK3B 2X7LB 4N8CH 1E4XL 4QT5A 4OD2B 4EBQH 2BNQA 3CMOL 3QIUB 1VESA 1F6AA 5J6GB 4V1DA 4NQCB 5D7IB 5FGCE 4IRSB 4NQEB 2DMBA 1TCRB 1BZ7B 3ZDXF 4PTUA 3CLEH 1DUZA 4G43B 2QSCH 1F2QA 4YFLI 3T77A 3PG2A 5DHXB 4JO2H 3D3VB 1JI1A 4TSCH 3G5VA 2P5EE 1ZLVK 2XKNB 4YFEA 2EDEA 3QNXB 5IBLD 3S37X 5TDOA 2IADB 1RSFA 2JK5A 2Q20A 2C3HA 4GUPA 3NA4A 3U30C 4HUNB 1MLBA 1P1ZB 4JG0H 4NWUH 5T3XH 3E3QE 1KJ3L 3QCVL 2QL1A 4XP5H 3GHEL 1R5VA 3O6ML 4KMTH 4RGMC 4NKDB 4OLZL 1HH6B 1U8QB 2EEAA 2ICES 2JJSA 3LN5B 3G5ZA 2WIMA 2OQJB 4Y5YA 4MWFB 3HS0B 3DUUA 3UJIH 2MQ3A 2B8OT 1ADQL 3B4NA 2HT4C 3RGHA 3W9DB 2AXJA 2LU7A 2VXTH 2Z91B 4G8GD 4HT1H 5SWSA 1I8MA 3BIKB 4AEHL 4QWWD 4X6CB 2IQAA 3JV4A 3CVHB 1A7RH 1MQKH 5JW3L 5C86A 2X6MA 3QDGE 1AD0B 3TBSA 1UWXH 1NLDH 3FZUD 5TE6H 5F88A 5I73C 2P5WD 4WI4A 5FO8A 3S35L 5HHME 2V6HA 3NCBB 3N9GH 3JSSA 3WHXB 1L7TL 3D5OF 4KTEH 2G2RB 4LIQH 3MPCA 3PV6A 3VFRB 1PEWA 5F7DA 1I7UB 4YAQB 5GGTH 4D0DB 3UTTD 4CGTA 4GOSA 2YPVL 4PJGB 2IH3A 4XVUD 2CK0L 1G7JA 2D7PA 5E5MA 1PFCA 3TF7C 5EOCH 3HMWH 2N7BA 3GNML 4EVNB 3MFFA 4TNVK 3ARDC 4R4FH 3O3AB 5HHVH 3T2PA 2IPKB 5BVJB 4MB3A 4U1JA 2AJXL 3MLRH 1B4JL 1F13A 4M03A 1JNLL 2ADFH 1U8MB 1IGCH 2UUDH 3EYOB 4A6YH 3BP7A 5D5MB 1P53A 5FUZL 4NKQB 1T0PB 1ZT7A 4NQDA 5HTSA 3L3OA 5CEYB 3I3BA 5GJTH 3MUGB 1RIHL 4TSAH 1EA9C 4XRCB 1UYWL 3LY6A 2R1XA 4GBXB 5JPMA 4ZFGL 4MDIB 1T20B 3SE9H 4WI5A 3KLAA 1RZKH 2FX9H 2X9YA 4PRIA 4TUKL 3SJVE 5M94B 4Q2ZB 1UENA 5L2KA 5J56B 3AU1A 5DJ0A 3L5IA 3MRBA 5D2LA 5H37H 4H1LA 3LEXA 4K23L 1XGQB 1OT1A 5IQ9B 4O2FA 2BVOB 3VXOA 4J3SA 5DQDL 2CD0A 3C60D 3BMWA 1NUFA 2VZ1A 2G75A 5I15L 4ZUTB 4CKVX 1I7TA 4JFPA 4WU7A 2D7NA 5DF0A 4BUHA 2EYRB 3GSRA 1D3CA 1T1YB 3X11A 2DBLH 1ND0B 4H0IA 1ORQB 4NO0B 4L3CB 5KJRH 3G9VA 1UEYA 1WC7B 1DP0A 1ES0B 1UM5L 3UJJL 5MP6H 5LQBH 4FQ1L 4M5YH 5I17B 1EHLH 1AQDA 2Q7YB 2WWKT 1PEZA 5J89A 4HAFA 5FV1L 3QUYD 4YQXH 5E94A 5GJSH 4LDLB 4NRXA 3HC4L 3IDJA 4ELKB 1SBSL 3V4VL 3QQ3B 3GBNL 3BP5B 1E28B 3VWKD 2JELL 2R2HB 3P30L 4X98A 4HQQH 1JGVL 3I9GL 3DBXB 1X3DA 3QWOB 5TJWK 2ILLA 4JFDB 5JTWA 2BXZA 4YHZH 1OAXL 1LEKA 1RJZA 5LG1A 1AJ7H 4LKXA 2HKFL 4W6YB 4Y2OA 1AO7D 3TESA 2D7TL 3P9MA 1A7NL 1IILE 4X7DC 2BOBA 4ZQKB 3EYFB 3ORJA 3UEZA 4NFBA 4G6AD 1N59B 3U0TB 3KYMB 2GK0B 4XZUB 1JRHI 5DK0B 4OCMC 1G7LB 3C5JA 4DEPB 4MSWA 3UC0H 1ITBB 4GLRH 3FFCD 5SX4H 1MWAB 3IDYC 4RWYH 5AG8A 1A7QH 1MHEA 5E8PB 3P4OB 3V5HB 1I8LA 3IU3A 3SQBA 4AYFA 4N0UE 2X89D 4TRPL 4KZEL 2EYTB 4EDXB 2DQTL 3BSZH 4RISL 4L8DB 3I2CH 1U8KB 2J3SA 1MCPL 4FQQB 1CLZL 3BGMB 4KRPB 4LSPL 4OCRH 1I4FA 5FYKH 4TSBL 4JY6A 2CKBL 3D39B 1ROWA 2BXYA 1ZEAL 3DWTA 4HUWB 2G5BB 1BBJB 1F90L 3LZFH 3RX7A 3PQYD 4JRWA 1X5IA 1GZPB 1HHJB 3PNWB 3EYQD 4EN3C 2VC2L 4K7PY 2VLKA 4XCYB 1BHGA 1CTNA 4HGWA 3FJTA 5I1IL 3WN5C 3VE0A 4M7KL 3JTSB 3S4SG 4IHOB 1J8HB 4EUPH 3ARBC 2D03H 1MFBL 2V17L 2VXQL 4NNXB 3QEQA 1S3KL 1Q9WB 4N5EC 3TN0A 1XF3B 5EG6C 3WJJA 1LHZA 3PDOA 3WS3A 2PW1A 4F15C 3WE6B 2HFGH 3BQUB 3N1QC 4B5EA 1P9MA 4CMHB 3TGXA 2F58L 4AEIH 3QXVA 2XN9B 5I9QB 1QBMH 4A6YA 3NH7H 4KI1A 2FEDD 2K1MA 3KPRA 3MRJA 4DK3A 5IROA 4EI5B 4LLVB 3MBEB 4LLMA 1KGCE 3VFNB 2CLRB 3QDJE 4JANA 4BK5A 5DK2A 3OAZH 4YBHA 1N8ZB 4GXVL 4X6EB 5IM7B 1T2QH 2J8UA 4NPYB 5IB2A 2ZUQB 4ODUB 1P84K 2R0ZH 1WBZA 1WCQA 5I16A 2YMXH 3K8MA 1I1AC 1QFHA 3NZ8B 3WLBB 4YHPB 1KLFA 3V0WH 2NNAA 1T1WB 1KLGB 4GKSA 4DKFH 2BVEA 5MEQB 4NJAL 1RUAH 5FYJU 1FVCA 1EJOH 3S6CA 2Y07L 5JIHA 5BCAA 4QRPE 4PUBL 5F7HA 2OZ4H 1DLFL 5IFJA 2DKSA 2E9WA 1J1OL 4ONGL 5FKPA 3GMMB 4NRYB 3TA3D 1WT5A 2EEDA 5JLZB 1MNUL 4I0PB 2AEQH 2NZ9C 3R1GL 2WMPA 1BBDH 5DEGA 3VXMD 1HK6A 4FMKA 1N0XH 1JZ5A 3CZFA 4MVBC 4ODVL 4RGNE 4LCCC 3BRGC 3V6OA 2XQBL 3B8YA 1JHKH 3DX9B 1AP2B 3NMEA 1O5DT 3OKLB 1ZT1A 1UACL 3AAZA 4LEXL 4P3DB 1JF5A 2L7JA 5GGVY 4JGUA 5F7NC 3WIHL 5C0EA 4DKEH 3IF1A 4AM0A 3RTQB 4NC2B 2J2ZA 4GAGH 2W38A 2HFTA 5AYQA 4I77H 3ZKXC 5ITBL 1FFPB 3T08A 5TDNB 3ARGB 5GRVL 2CKBB 1PQZA 4P2OB 4W6WB 1JV5B 1R3KA 4OF7A 4YHYB 4XAKE 3KPNA 3SDXA 2DWDB 3PE9A 4G8GA 3UTPE 2VWEE 3PWVB 1I9RH 4H88H 4K71C 3VI4E 5HYSB 4KAQL 4XHJC 1MIEL 5JXEC 3T2NL 1S8DB 3QUZB 3OWEA 4ZOAA 3L3JB 2D2OA 1RHHB 3SDCC 3C6SA 2P5WA 4G5ZL 1HXYA 5IVXB 2NY2C 5FCSH 4NYLB 4Y4FC 3GMPB 4Z7WA 2X10A 3A6BH 4F57L 4F3FB 4LP4A 4OLEA 4WHDA 1HHKA 2VAJA 2MOVA 4GT7A 5D2NC 3ARZA 3IRPX 3UTTA 4XVTL 4OZIB 3JVGA 4Q74A 4UAOC 1LDPH 1I3GH 4PJBB 4RSVA 2OI9C 3SGKA 5AWNH 3VFTB 2ZWLT 5JOPE 2X70B 2YXMA 3LQAL 4BQ6A 1AXIB 3MMEA 3P73A 3IU4H 3FQXA 5A1AA 3S88H 1YEEL 1DVFB 4ZXBB 4DTGH 5DJYA 4CADA 4H5SA 4OV6F 4L1DA 1WZLA 2VB5A 3UTSD 1FBIH 1FGNL 3C9NA 4FFZH 3SKNB 4NBXB 1XR9B 2R1YB 1NANI 3TZVB 3GRWA 4BYHA 1AXTL 1C7TA 1A14L 4LPCA 2DQEH 3RL2A 5FHBH 2QR0A 5EORL 2GY5A 2R1WA 1VACA 4HZLA 3VI4F 1A0QH 4KKBC 2DKMA 4FQXB 1NGZB 3TYGL 3F7VB 1LO4H 3VDCA 4MJIB 5E0QA 3CFKB 1U8JA 4GKZB 3JWNC 1J05A 2ZPKL 4YE4H 4D3CL 3OKDA 1CBVL 4L5FH 4XNMA 3BGFC 4LSVL 4MHHI 2X4SB 3WL9B 1A4KA 3LKRA 1QVOA 1M6OA 4XBGB 4Z7NE 1JWSB 2AERT 2YUZA 5DJ2B 4P2QB 3KPSD 2H26B 3I85A 3VA2C 3C60A 1CVSC 5F9JA 3ZO0A 5EOTB 3NFPB 3W82A 1V3JA 5CZXD 3QP3A 1NCAH 1VHPA 2BRQA 1OTSC 4XPHL 1WLHA 3ZDZF 3IVKA 4PRPE 4IMKC 4YR6B 4UNVA 1YJDC 3P40A 4ZUSB 4F9PA 1ZLWK 1GCFA 4N8VB 1FL3A 4K55A 1A3QA 1YEDB 4PJ5D 4FTVB 4XXCA 4PREB 4OQTH 2JIXD 5DUPL 1BFSA 3CNKA 3UAJD 2GJJA 2JJVA 4A2LA 1OF2B 4EN3D 3QUYA 3EYVB 3IJYA 5GHWH 3C2AH 5DUML 2Z8VC 5IFAL 3O45A 4HBQA 2DLGA 3WSQL 3BVNB 2IEPA 2P7TA 1H8SA 4QT5B 1VDGA 3J7HA 4IOSD 2BNQB 3VWKA 4QRRD 3NVQA 1F6AB 4V1DB 3P0YH 4UT7L 4J3VA 2DQFA 4N5ED 2AGJH 4PTUB 3MUHL 4Z0BH 1DUZB 5I1AA 2Z31C 2F74A 1AO7A 4Z7NF 2KZWA 3T77B 4ZG1A 4LPVA 4D8PA 4ONFH 1TZIA 2WBJC 3G5VB 3PF2A 4JEGB 4Z7UE 4WEBL 3SE8L 3QA3A 1ORSA 4WFFE 3IDMA 5JO5A 1HNFA 2G60L 5B4MD 5TDOB 2R15A 4MNQE 5ALCL 4ZUVA 2JK5B 3FFCA 4GUPB 5BZWA 5CZVH 1K8IB 1MLBB 3DV6A 2W9EH 4GG8A 1LEGA 2FBJH 1DN0A 2F5AL 1I1AD 3BKML 4LARL 3MRQA 4W6XB 1R5VB 2X89A 3CU7A 2Q8BH 5HVFB 1IQDA 1WV7T 4Z5RA 4XCEA 3NA9H 4F7EB 3DUUB 2CH8A 4PRDA 4PP2A 3T0VA 1QSFE 5D7SH 5DVNA 4OT1H 1I8MB 4K9EC 2SEBA 4XXDA 2IQAB 3JV4B 2YUXA 3MRNB 1CI5A 1OD7A 1A3RH 4KKLC 2O5XH 1WISA 3VCLB 3TBSB 2IJ0C 2C4XA 5EC2A 5CGTA 3K2MC 2OCFD 5F88B 1BGXL 4LRNL 1OCWH 5FO8B 3I75B 1Q0XL 3MLVH 4K3JL 1JJUA 1T03L 4N0CC 4HWEL 5T1KD 5DMIL 3PV6B 4Z7UF 2IPUK 5F7DB 5F1OB 2XA8L 2EO9A 4OIBA 1YEJH 1FNFA 2IH3B 4YHLL 1MRCL 1Y0LA 2NZIA 3LB6C 1G7JB 5E5MB 1P4BH 4KJQC 5I1HL 4JDVA 5EA0H 2JB6A 3QWRD 3F7YA 4U1JB 4TTGA 1KN2L 1OARL 4RFNC 2A83A 1C12A 1PDKA 4XHJD 3CX2A 5JXED 3S36H 1LP9B 2LE9A 3BP7B 5K9KA 1CS6A 5HDOA 3H9SB 3SDCD 4NM8H 4QOKD 2VABA 2VQTA 5L8JB 2NY2D 3JUZA 2O26U 1KV3A 1PLGL 1ZT7B 1D9KC 1INDH 4NQDB 2Z35A 3L3OB 1CD9B 1A7RL 5ERWA 2OTUB 3S96A 1VPOH 2EE6A 5F6HJ 2R1XB 5JPMB 4JG1H 2ED9A 1KG0A 3O6KH 2UZYB 4OLXH 3KLAB 4PRIB 1AY1L 3HB3C 3VH8G 2FIRT 1YNKL 5L2KB 4TNWK 4U1KA 3AU1B 4O02L 4GW1A 4XNUL 3TA3A 5DJ0B 3MRBB 1MFAH 2BSED 4H1LB 3LEXB 3UXFA 1DQQA 1T6VN 1A1NA 3VXMA 3EJYD 3IFNH 4AMKH 4O2FB 4D0CB 3MRRA 2BCKA 3VXOB 4DVBA 4RCAA 3QSKB 5ACZA 1I7TB 4JFPB 2X4TB 4WU7B 1A6UH 1BFOA 1Y6NR 1IAIL 3GSRB 4R4FL 4OQTA 5E8DL 1J18A 3X11B 5KSBE 2Y5EA 5BS0E 1CICC 5E1HB 4KKBD 1MI5D 4M6AA 3VD5A 1RZFL 4S1RL 3IDXL 3E3QC 1CDCA 1R0AH 4N9OB 1AQDB 3GK8L 2W0PA 1UH2A 1N5YH 2G5RA 3MJ9H 3NABH 5E94B 4MA8L 4TOYH 4NRXB 5K59E 3IDJB 3C09C 3GKWL 2E7CA 3ARPA 4C83A 4Y8AA 3NFNA 2A6KA 2E27H 2V9TA 4FFYH 4FQCL 1CXEA 1SY6A 1LEKB 1WWAX 3QO1A 1TITA 3UYRL 1CGSL 1A6VH 1RJZB 2VLJD 1A6AA 4LKXB 4WRLA 5E8NB 4LMQE 5T1MA 2VN7A 3P9MB 1DANU 5CJXC 1ZLVH 2BOBB 4HC1A 4JFYA 5ITFA 1FGVH 3B9EA 3RY6A 5IHLB 2R0WL 4Z8FH 4HULB 12E8H 4PS4L 2A6JA 1FE8L 2VOTA 3C5JB 1F4HA 3T8XA 5HY9A 1X5YA 4XNYH 3GSVA 1G0DA 4ZUWA 5D7IE 1JHLH 2VERN 3UTSA 3CU1A 3IU3B 4HG4J 1J8KA 2C7UA 3MNWA 2ZZUT 3C08L 3K4DA 2DICA 1SM3L 1G7IB 3BPOC 5FYLH 4RNRA 4EXPX 5K59F 2YHGA 2Z31D 4X4ME 3QG6A 1CLOH 1I4FB 3SGEI 5DD5L 4JY6B 4Z9KB 3T0WA 4HK3J 3SDDC 5C2BL 2E6PA 2WBJD 1DBBL 2JLLA 4NWTH 5KTEL 3GB7A 4GRLB 3STLA 4X8XA 4OCWL 2EDNA 1NSNH 1KENH 4HH8A 3D87B 7FABH 2VLKB 4OGAC 1VFMA 4HGWB 4CRPA 4JPVL 3HC3L 3VE0B 1VSCA 1K3IA 1YYMH 4HMDA 2BY3A 3KPSA 1P69B 1IGIL 4NJ9H 5INCA 3EKCA 4HJ0C 3ZZ1A 2DTML 2QSQA 3QEQB 4JFHD 1EUTA 3TN0B 2FHBA 1U8PA 3PDOB 3WS3B 3SO3C 3D18A 4A6YB 1A7QL 3KLDA 1G6RH 5D7IF 1W8OA 3MRJB 3UZQA 2DM4A 4TQEH 4KKLD 4LLMB 4P4KD 2Z93A 4PJ5A 4KQ4H 4JANB 5DC0A 4OSUL 2JIXA 3CPLA 3DUSA 5FGBC 5DK2B 5E8OA 4EN3A 4MS8D 3RZCC 4K7PH 2J8UB 5IB2B 4J3XA 4R9HA 5LXGL 1JVKA 2QSVA 3WN5A 2AEIT 4X80L 2A9NL 4IRJC 1WBZB 4JO1L 2AK1H 5I16B 3ME0A 5T5NF 5J4MA 2EDJA 4QRRA 3GRWL 5IB5A 5CILH 4NM4L 2NNAB 1HQRA 1OWRM 2BFVH 4GKSB 5FCUL 1ONQB 1AGDA 3L5WA 3IJSA 1FVCB 2ZCLL 1I7RA 4O2EA 3WFCH 3PWPD 1JE6A 5FKPB 3MRLB 3RPKA 5DEGB 4JFFE 3O2DA 4TTDD 1MCIA 3CZFB 5FOJA 4DQOL 5C0DA 1KBGL 5LGHL 4M7ZB 1GGBH 1QBLL 2PYED 1ZT1B 4OB5L 2Q86A 2AJYL 4X6CF 3AAZB 1HXMA 3RI5K 1D9KD 3TPUA 4L3AA 1TNNA 2W65B 3S97C 32C2A 2YZ8A 2YD1A 3G6AA 4XP6L 5C0EB 4KI5F 3IF1B 4AM0B 1I1AA 1B2WH 5I8EB 3TFKC 3WS6A 4B0MM 3K7UA 3QDME 3CH8A 1MCNA 5D93C 4OI7A 4NNPH 5KS9A 3QG7H 3KAAA 3QQ4A 3V6BR 4FNLH 5C1MB 1PQZB 1MFCH 2DN7A 4HLJA 3SKJL 4BFIB 1OT2A 3HB3D 2D0FA 1R3KB 4EJ1C 2YKLH 2GW5A 1H8NA 1FVDB 1PJ9A 1HI6A 3SDXB 4G8GB 4J4PC 4OZFA 4PD4K 1BMGA 4D9LL 1KEGH 1O7SA 2DBJA 3ARFC 3FQRA 4PJGF 2ZNXA 3W39A 1QSVA 4C4KT 4GG6A 1EZVY 3MBXH 4Z7VB 4G9FE 2VLRE 3KPQA 4LCCA 3RX8A 1RUAL 5CBEA 2P5ED 2P5WB 3C6SB 1HXYB 3HRZA 5ICXA 3JWDH 4PRNB 4Z7WB 1F8TL 1X5FA 5GGVH 1HHKB 1CGYA 5T1KA 3BHBA 1CICD 3UTTB 4N90E 2FX8H 2WLZA 5D5MF 1FRGL 3BWAA 4OM1H 1WIUA 1JZ7A 1FL6A 5J11B 3RY4A 4M6NH 4OKVA 3V6FA 4HIEA 3MMEB 3P73B 5BV7C 3FQXB 2CPCA 1KCUL 3BD3A 4P9HL 3QWRA 4H5SB 4KKNA 4FQPA 3DSFL 5F9OL 3WDJA 2AQ1A 2EE3A 3S36X 4LCYA 1O0VA 2VL4A 5JXEA 1JRHL 3SDCA 2IMNA 4B7IA 4QOKA 1FLRH 4JZOA 1MCOH 3F58L 3QDGD 1BWWA 5EU5A 1FN4A 3RL2B 4FA8A 1L7IL 4HWNA 2QR0B 1J10A 1ACYH 1FORL 1VACB 5D2NA 1FPTL 4HZLB 5GGRA 3HAEG 1BIHA 2J1KA 2YD8A 1U8JB 4NUJA 1U8NA 1WTLA 4M7LH 3OKDB 4XNMB 1QSEE 4LCIL 5EOQH 5EIIA 1F6LL 4YBLB 1MF2H 1A4KB 4XCNA 1QVOB 5INDA 3VXUE 4LL9A 1IC4H 3N50A 3S8WA 1F58H 2B39A 2VZUA 1JFQL 2F53E 4PRHE 1S7RA 5DQ9A 3C60B 2BVYA 4TVPL 5T1LD 2HRPH 2Y6SD 5F9JB 4NN6C 4KXZH 1WBYA 5EBMA 4ZOBA 1H0DA 3IVKB 4RGNC 2FJHA 1NGQL 2MJWA 4JJHA 2BDNH 1ZOXA 1V3KA 4WTXA 3HE6C 4JN1L 3D39E 3E2HC 4UTAL 1J0IA 1MLCB 1MI5A 3SDDD 2NY0C 3RVWC 4OZ4A 1FL3B 3V8CA 4NO2A 5D70H 5A40E 3P4LA 3QUYB 3KJ4B 4DJMA 2V5MA 5I2IA 3IJYB 4OQ1A 4OGAD 2XZAL 1X6LA 1J1PH 3O45B 1GC1C 2FHCA 2PCPA 2W60A 5I8KH 2P7TB 4NZDA 3H42H 3MACL 4HJ0D 3T0EB 3WNNA 1KB9J 4M02A 1UA6L 2VWEC 2DQFB 1W72H 2AQ2A 3LAFA 3MRMB 1G0XA 5I1AB 3ULUE 2F74B 4LSSH 4IMKA 4M1GH 1R24A 4WY7L 3DMMD 4YDIH 4D8PB 1TZIB 1BQLL 3OPZH 4CBPA 1A3LH 1C1EH 3HRPA 4ODWA 4U1GB 5SWQA 5DA0B 3ULVE 5IIEA 3QA3B 4JY5L 1TQBB 2B4CH 3BPNB 1ORSB 5EBGA 3IDMB 3CAFA 4NGHL 1FNSH 1A8JH 3PIQA 4ZUVB 5KN5A 3RZCD 2AQ3A 2HYMA 3BESR 3KYKL 3FFCB 4F58H 2NY5H 3O2WH 1OOAA 4DGYH 4JKKA 3DV6B 5F71A 4BK4A 3UJTH 1LEGB 3WFDL 1DN0B 3U9PH 1P5UA 3MRQB 4LOUC 5HGAA 1IQDB 4KJWC 4Z5RB 4OJFL 2J88H 5D1XD 4XCEB 1XF2A 3HI6H 3PABA 2PW2A 3V4UL 4BSJA 2Z31A 3ARXA 4PRDB 2HA1A 4PP2B 5GRUH 1ZHLA 2Y1VA 4LU5H 5KW9L 4HF5L 5A16A 4U2YA 4XVSH 4ZTOH 2SEBB 2WBJA 4XXDB 4WUKH 4Y88A 1G7MA 3PQYB 4TN9A 3LS4H 5DLMH 2AGJL 1JZ6A 4XWGH 5EC2B 1RZGA 1BX2A 2IFFH 1QR4A 3ULUF 4P5MA 3FN0L 4ZO8A 3U30B 1IAKA 1YYLH 5CIPA 3JWOC 2ITDA 1FH5H 2AEPH 2P42B 3WIFA 1TTGA 5E99H 2L4OA 1SY6L 1CZ8H 4WTWA 5EN2A 1SYSA 2H3NA 3ULVF 1BJ1J 1J0KA 2DQCL 4LDOB 2FH8A 2FEEI 1I1YA 1XF5A 4RGMB 3C6LC 1IQWH 1N4XH 2O5ZL 3NOIA 4Z6AT 1CFNA 1Y0LB 3MRHB 5JORA 1WWBX 3GSNH 4NKOA 4HC1L 3G08A 2Z8SA 1RMFL 1P4IH 3BT2L 1NAKH 1WTGT 3CFBA 2JJWA 4KDVA 2V5YA 4J4PD 2VZSA 4BUGA 2JB6B 2DI7A 2HJKA 3F7YB 1K3ZA 4HIXL 3ARFD 2EDTA 5GS3A 4DK6A 5L88L 1EVUA 3LMJH 4OF6A 4XX1G 4P4KA 5IFHH 5E5RB 2A83B 1C12B 4JLRA 4KWUA 1IZJA 4S1SL 5D7KD 3PP4L 4HWBH 4K7PX 4XMKH 5IVXE 1I3UA 2OMNA 5DVLA 1U58B 2IG2H 4RBPK 4ZD3H 2B0SL 5K9KB 5I73B 1U3HC 2R69H 4K94C 3L3KA 2VABB 1N5AA 4NC0B 5IQ7L 2Y36L 3O4LD 3CFCL 2Z35B 3K4ZA 4X7FC 5L6YH 1NMAH 1A3RL 1XMWA 3LRHA 2FJGA 5J13C 3EOBA 2B1HL 3S96B 2LU3A 4AY0A 1JZ2A 4NRZA 4X0KA 1KG0B 5F89A 3FO2B 5L0QB 1QBBA 5F6HI 3O4OC 4U3HA 4DOHE 2AKRB 3D2UB 4U1KB 4GW1B 3PWPA 4YIQA 2EH7H 3TA3B 5GRZA 1KEML 1DQQB 4FXGA 3RVTC 1A1NB 1N2RA 1AE6H 4WHTA 3VXMB 4S0TD 3CFDA 2NXZC 3MRRB 2BCKB 4DVBB 5ACZB 1ZLSL 2PO6C 3SKOB 2NMSA 2ZUXA 3OKNA 5IMKA 3BH9A 1GVIA 3Q5TA 2PYEA 4KTDL 5DSCA 4DW2H 2Z0BA 4BQCA 1EHNA 5IB4A 1KGCD 3UTQA 1NDGB 2V7HA 3QDJD 1CLYH 1D9KA 4JHAL 5FKAA 5HVHC 1DBMH 1MJ8H 5JUEL 3ESUF 1ZLWH 2R0LL 2X5PA 5JXAL 2NTFA 2OXHA 5T5FH 2FNBA 3WUZA 4JO4H 1FAIH 5IVXF 4PG2C 3WHE1 4G42A 5LBSH 1KF9B 1F00I 4PYHA 3BX7C 3AXLA 5IGXL 4H0GA 2P44B 1RFDL 4OCYL 3FOLA 3D1MC 4C83B 2IPTH 1FNLA 3NFNB 4LSUH 5EU3B 3I6LE 3O6KL 3BJLA 4JDTH 5MENE 2ICEA 2P5EA 5E2UH 3QO1B 1CFTA 1V7NL 1A6AB 1TENA 5T1MB 4XPAL 2VDKH 3TT3L 3HE6D 3PL6C 2XKSA 4Q97A 1AGBA 1CICA 3B43A 4F9LC 1YEFH 4JFYB 5ITFB 5BVPH 5F7MC 5E1AA 2NW3A 2W1NA 3RVWD 3EYUL 5C09E 1IFHL 1MRDL 2QV2A 4OGXH 1A6UL 5I66A 1WAAE 2A6JB 1XCTA 1MVFA 5EPMA 3M45A 4LRIC 1NLBL 3T8XB 3O2DL 3ISWA 2P8PA 4HUVA 5GS0C 4D9RE 1NCCL 3GSVB 1DLHA 3CDGA 5CCKH 1OAKH 1FNAA 2FD6H 4ZUWB 2VKXA 6CGTA 3UTSB 3DLQR 2ZP0T 4XAKD 4YDJA 3MNWB 3UTPD 5FIEA 1I3RA 3R0MA 2OP4L 1ZSDA 1OD9A 3C87A 3DGGA 3BE1H 3QDGA 1T5XA 3HMXH 3B9AA 4RNRB 5E2TL 3ZL4H 3QG6B 4APQD 1VFAA 3RWHA 5CJXA 1EBPA 2VIRA 1QUNA 2R2EA 5KVGL 3DNKA 5BZDA 3STLB 1IGFL 5I18H 2HH0H 5HI4D 3TJHC 1DTUA 5B3NA 4HS6A 1A6VL 4KJPC 4XPTH 5CJ5A 3W2DL 5AD0A 4H8WC 3ABZA 4LCUA 1TJGH 1L6XA 4HJJL 3KPLB 4HKZA 4CU6A 4EXKA 3IDYB 3GJFH 2DQUH 4PTTA 3B83A 3MJGX 4YXHL 1VEPA 4JKWA 2PN5A 3GZKA 5JOPD 5E08L 3KPSB 4AG4H 5ACMA 3RNKA 4LOUD 5T1LA 1DQML 1FO0A 4BA8A 3RUGE 3KPMA 4KJWD 1U8PB 3ZE1F 43C9A 4KVCH 5C9JA 2APVA 4RMSA 1KYOK 3D18B 1G7PA 5C3LD 3PHQA 4NZUH 1BZQK 3L3IB 3WNMA 1RUML 4KH2A 4QHUB 4G6KH 4PR5B 3SDDA 1LO2L 1NPUA 1RZ7L 4L8SC 1WIOA 2GFBB 3U83A 1G0YR 4UB0H 5I74B 2R8SH 1PY9A 1G7HB 4PJ5B 3LN9A 4XX1E 2ARWA 3ZT5A 2JIXB 3CPLB 4HFUH 1S78C 4JR9H 1RPQA 1CXKA 4EN3B 1JTTA 1X44A 2XICA 3HZVB 1IC7H 3RKDC 1IEBA 4TULL 1CFSA 4M8VA 4FQLH 1DQJA 1T1ZA 3T0BA 4K7FA 3EYSL 5K9JL 2HFEA 3BISA 5C3TA 4QRRB 5IB5B 1SEQH 1YPZB 2X4UA 3OR7A 7FABL 1FZMA 1NCWH 3QIWC 1OWWA 1AGDB 3L5WB 5ETUA 3IJSB 4Y19E 3GIZL 1I7RB 1KN4L 3B2UC 1OAZH 3NFSL 4O2EB 4XVJH 4UV4H 4OM0H 1MREH 1YC7A 2VL5A 4LSQL 4ODHL 2DLTA 2R2BA 4OUUA 4WCYL 4RGOL 2H1PL 4PRPD 4ZS7H 3RUGF 4BZ2L 2ED7A 1LP9E 4HKJA 5C0DB 1EEQA 4R6UA 5FGBA 3PGFH 4HJGA 3H9SE 1NL0L 1K2DA 2APFA 3RZCA 5AG9A 5FHAL 1U3HD 3KS0H 2Q86B 5ECJE 4OLWH 3MR9A 1CR9H 1HXMB 2E6QA 4IRJA 4MXVF 3TPUB 2APXA 3G6AB 2VXSH 2PTUA 1I1AB 3F5WA 3MLWL 4NN5C 4K3HA 1XH3B 3CVIL 1BIIA 1C8PA 4U6VL 5KS9B 5D1XA 2W9DH 1HHIA 4IRSC 1VEMA 1MSPA 1A22B 2ZOLA 3ZHLA 1F5WA 3QXDB 1EH9A 1HI6B 4IIQC 2HT3C 2OBGA 4OZFB 4QXGL 1PW3A 4O58L 5CD3B 3U0WH 4XP9H 3FQRB 4XAWL 3EOAA 2DD8H 3RVTD 3W39B 3IB4A 4YHKL 5ILTL 4GG6B 1DN2A 1JHTA 2NXZD 1C16A 3KPQB 4LCCB 4GRWH 3HNVH 3Q1SL 5CBEB 1OPGH 2FX7L 5ICXB 3STBA 1J12A 5DJAB 4WFFD 4PIRF 4NP4L 5T1KB 1ZHNA 3BHBB 2CR6A 5F7KC 4MNQD 4D9QE 2H32A 2EIBA 3NN8A 3WFBL 2ZCHH 1LP9F 1HZHH 1YQVH 4M43H 3BWAB 1RZ8A 3CLFH 1A6ZB 3T4YA 2O93L 1GGBL 2DKUA 2IBGA 1YJDL 4JE4B 3SQOH 1FL6B 4N0UA 1RI8A 1BQUA 5KVFH 4OKVB 3V6FB 4HIEB 4J4PA 3B2VL 4Z7QF 1B0GA 2J4WL 5EZIH 3VD4A 1QG3A 3ARFA 4M48L 4IDJH 1X4ZA 4K71B 4YHMH 5E95B 1X5LA 3HNSL 4MNHA 1FAKT 4L4VE 1NAMA 1GAFH 1QSFD 1CE6A 4LCYB 3QJHA 3BZFA 4Q6YA 3LDBB 2XQYG 3MV11 3SDCB 4LSRH 4QOKB 2ZCKH 4Z77A 4JZOB 2NY2B 4ZPVA 5ESQA 5EU5B 1FN4B 2WIIA 5FM4A 5D2NB 5GGRB 2BSTA 3O0RL 5T3XE 2GITA 3GJFA 3KVQA 4NUJB 4ETYA 2GAZB 4M3KB 2OI9B 1U8NB 4CVZA 1JGLL 1JYVA 1G9NH 1M1SA 1ODAA 2Y5TA 4BKLA 2BP3A 5TF1L 1PX4A 3BAEL 5EIIB 5GS0D 3AB0B 4XCNB 1EK3A 5INDB 3H3PL 2A1WH 2PTVA 1LE9A 4MXWH 5EBWA 3PGDA 4M1CC 1S7RB 4UINH 1J5OL 5DQ9B 4KKCD 2RCSL 1G6RB 5IJKC 2CDEA 5JNYA 5JZ7D 4GRMB 5GSRA 3BP6A 1GIGH 2EH8L 1WBYB 5EBMB 5ADOH 4HKBA 3QDJA 1H0DB 5IBTL 2R4RH 2CJUL 4RDQG 2AJ3A 2FJHB 1ZAGA 3VFSA 3RIAK 4MJ2A 4LCWE 2ICCA 4EUPG 1MI5B 4I3SH 4UQ3A 4C56E 2Y23A 4LIQE 4OZ4B 4LVHB 1A9EA 4HUXA 1RD6A 4NO2B 4R2GC 4LSTL 3LKPA 4GBXC 4JVWA 2EC9U 4K9EL 4KK5C 3KHQA 4KJPD 1FYTE 3BGFB 5I2IB 4PB0H 2Q6WA 1FFRA 3EOTL 5HGDA 4UTBL 4POUB 3LKSA 1T0NB 3QCTL 1FYHB 2PCPB 2W60B 4UIKL 4L1HA 4QRPA 2MSPA 4X99A 4L9LA 3HNTH 1HILA 2DJUA 3DRQB 3DX8A 5CJQH 3BWUC 1KCRH 3MGTA 1N6UA 5DHYA 4RQQA 3U48A 1GGIL 2VLJB 2Q87A 4JM4L 2P49B 1IEAA 1JPFB 3HE6A 1N3NA 35C8L 1R24B 2VDLH 3VFGH 4NN7C 3UMTA 4JZNB 1MFEH 3B5HA 3CJJA 2X42A 4ODWB 5KSAD 5SWQB 3D69A 5IIEB 5BS0D 4P23D 1S78D 2MHAA 4Z7OE 3TEUA 3PIQB 1JNHA 4FP8L 5KN5B 5KVEL 2PTTA 1A7OH 4NT6A 2RB8A 1CDUA 2XWBA 4OLUH 4XPBL 2DQDH 4FQIL 1YN7A 5HGAB 1H3WM 5HDLA 3GHBL 3JXAA 1XF2B 4UDTA 3HI5L 3QIWD 1Y18A 3PABB 5IF0A 1JPTH 2PW2B 5ALBL 2VXUL 5JQ6H 3VDBA 2Z31B 3P9WB 4LMQI 3GI8L 4APQA 3B2UD 3KR3L 1ZHLB 1HKLH 5A16B 2HKHL 1AGCA 2WBJB 3R8QA 1FIGH 2CXGA 3M17A 3PWJA 4JB9H 1G7MB 3MV7E 1HH9A 3RAJH 1JCKA 1RZGB 1BX2B 4G8FA 4G80A 4P5MB 5CAYB 4URTB 2XZZA 3X3GH 1JYXA 1IAKB 1KULA 2VDMH 5CIPB 3WIFB 4DEPC 2WM0A 3BN9C 1QYGH 5HPMA 4OFKA 5EN2B 1CXLA 1SYSB 2H3NB 5J1SC 4K8RH 1I1YB 1XF5B 3P0GB 2XPGA 3BFOA 3HZYA 2I26N 5E24E 1CFNB 3CSBA 5JORB 3L7EA 5I1CH 1IC5L 1MUJA 3NCMA 4NKOB 5IBUG 3G08B 3LRSA 5L8LB 3BJ91 4RFEA 4G8GE 4DGYL 3AMLA 3CFBB 4OZHE 2HT3D 1TQCC 1X5ZA 1X5XA 2HJKB 4KRPC 4M1DH 4Z7VE 3Q6FA 4P4KB 1J88A 5F7EL 4S11A 1C5CL 2Y72A 4JLRB 2ZUVA 2P5WE 4WWID 1QFUH 4FABL 5F1IA 4Z7WE 5FUCE 1H3PH 1N5AB 5DRWA 3WKML 2QHRH 1N26A 4ZTOL 4JHWL 1KELL 5IMLA 2GJZA 2B5IC 1NJ9A 4X9GA 1X5GA 2H8PA 4AL8H 2WUCL 1CIDA 3EOBB 4NUGH 2M8XA 3ILPA 3QHTC 3K8KA 4NRZB 1QFWH 2IFFL 4X0KB 5F89B 4CVXA 4OAWA 5D1QD 3RBSA 3TNMB 5DD0L 1D5BA 5JIKA 3PWPB 4YIQB 4CMHC 5K33A 1HWGB 3NIFE 3OL2A 1NDMA 3H9HA 4FXGB 1N2RB 4PJ9C 2DOCA 3CFDB 5FYKE 3ULUC 3K80A 1DEEA 4PRPA 2VDRL 5I1GH 4MZ2A 3IYLW 4CDGC 4EI5C 1UM6L 3MCKA 2W92A 3OKNB 4CVUA 3BH9B 5IMKB 4X7SH 2PYEB 5DSCB 3SDXF 1U3HA 3ULVC 3UTQB 5IB4B 1HDMA 4OZHF 2V7HB 4GSDH 1D9KB 1FO0L 2A6IA 5FKAB 1V8HA 3IDNA 3N85H 4KROC 4Z7VF 3A6OA 4G7VH 2NTFB 5C9KA 1S5IH 3D9AL 3TT1H 5IB1A 4G42B 3V7AG 1Q94A 4Z7WF 4ESKA 1II4E 1NCNA 2DQIL 2NQCA 3AXLB 5L8KB 1L0XA 4OD1H 3QCUH 4XMPL 1BEYL 5C08E 2OSLA 3FOLB 3OZ9L 1JWMA 1Y6MR 1FSKC 4M1CD 2BOCA 3VGAB 1OM3H 2IAMD 2V7NA 2C4FT 3E6FA 1YECH 4I0PC 3RWDA 2ICEB 5I1EL 2P5EB 3LPFA 4Z7UA 2KQMA 1CFTB 2D31A 4JFFD 5B39A 3GJEA 2WQRA 3MOBL 5JIIA 5DI8A 4JPKH 2EDFA 2NY7H 3AY4C 1C5BL 5GRYA 3RA7H 1AGBB 1CICB 4MNQA 3M8OH 2DYPD 2KDGA 3WLWC 2CR3A 3E8UL 4M00A 4NFCA 5E1AB 4JFZH 5EO9A 3QDHA 4PRBA 3RTQC 4QLRA 2MPAL 4R2GD 5I66B 4G9DA 4Q9RH 1XCTB 4KK5D 1NGWA 3QDMD 3OG6B 5EPMB 1KC5H 1NEZA 3ARGC 2P8PB 4HUMB 4HUVB 2P8LA 4OTXH 3C09B 1DLHB 3CDGB 3GBMH 2BK8A 2Q1EA 5JPNA 4DVRH 5BRZE 3T0EE 2I5YH 3RWIA 4DUXA 4UQ2A 4P5TB 3DPBA 4YDJB 1QSFA 1BM3H 1BAFL 4Q0XH 1R3HA 4LHJB 1CDYA 5IW3A 4UOW1 4PRAA 4I3RH 3SHSA 4QEGA 1F02I 3DGGB 1BJ1H 2XY1A 3QDGB 5J9PA 1T5XB 3MLUL 4G9FD 2VLRD 5FUOL 1F4YL 1KPUA 3P4NA 4UZGA 4S10A 1VFAB 4YK4C 3RWHB 3PP3K 4XP1L 5JW4R 2VIRB 4F9LA 3MA7B 2R2EB 3PUCA 3T2QA 2OK0L 5BZDB 1IKFH 5BW7A 4KKAC 2QQNH 4HS6B 4JRYE 4P3CH 5AD0B 4N90D 4LRIA 2FO4B 2YD5A 4LCUB 3AUVA 5LCVH 1CFVH 4HKZB 4HCRH 2XYCA 3WXVH 5EUOB 3HUJE 5TE7L 1E4KC 1UM4H 2DDQL 3OGCA 3RNKB 5T1LB 1NFDE 4PP1C 5EBLA 1FO0B 4YLQT 4M8QA 3U1SL 3KPMB 2ATKA 2N1KA 1NC2D 1QZ1A 4QRTA 4U0QB 3LEYH 1TJHL 2IGFH 1G7PB 4HEPG 4L9DA 3PHQB 5TQ2L 1OAKL 3THMH 5LGJA 3U79A 3SDDB 1TPXC 4KZDL 3HFML 3PQYE 3R0NA 2FEEL 4YDKH 2AJVL 5D8JL 15C8H 4RBPH 2HWZL 4FQXC 2VAAA 5I8CA 3JBG7 4R90H 3EDJA 5GSVA 1XGYL 4G6JL 2IF7A 1BD2D 1IEBB 1NAML 1OAYH 4HS8H 1NEUA 2X1WL 4HEME 1DQJB 1M71A 1T1ZB 2NTSP 4LNRA 4K7FB 2HFEB 3BN9D 2BVPA 2IBBA 3IFLL 5EH1A 4GMTH 1CLCA 1QSED 4U1LA 3RWCA 4NO3A 4W70A 3MXVH 5B21A 1RIUL 3FO1A 3VXSD 3VXUD 3AGVA 2I9LB 2X4UB 3OR7B 1FZMB 6FABH 2CDFA 5ETUB 2F53D 4PRHD 5J7CC 2K9UA 1HINL 3HUJF 3DMMB 4QY8B 1GGYA 4L8SA 2VL5B 5I8OL 2WK2A 4YHOH 1LO0L 1NFDF 3HC0A 5KSAA 4UBDC 2R2BB 4OUUB 5KSBA 2AXFA 5BV7L 5BS0A 1YEIH 4HKJB 4P23A 4TPRH 4Y4KC 3D39D 5EOCJ 2QADC 4GAFB 1NKRA 1K2DB 5CHNA 3RZCB 5DS8A 1RU9H 4RX4D 1UCBH 1IM9D 1P7KA 1ACZA 5TPWL 2GYSA 1JMZA 1NGXA 3MR9B 3MLYL 2FDBP 5A2FA 1GPOH 4G7YL 1NGPL 5DD1L 4N0YH 1A6WL 1I9EA 3G6DH 1NCBL 2EKJA 4JR9L 1BIIB 1UEMA 1E27A 5D1XB 2R56H 1BVLA 3QIWA 1HHIB 4IEFB 3E6HA 2ZOLB 2Q7NA 2W59A 2YK1L 1WFUA 4S1QH 3GSUA 2M2DA 1YEKH 3K0WA 5EU6E 3V2AR 3EOAB 4PJ9D 3RZWA 1Q1JH 1JHTB 1A9BA 3A67H 3ULUD 2A0LC 1AI1L 1ED3A 1C16B 1NBVH 4X6FA 3U9UB 3GO1H 4MNGE 5IP4A 3L7FA 4KPHH 1XIWD 5F6IC 1UJ3C 3Q6GH 5DR5H 3NZHL 4X5XA 1RZJC 3ULVD 3NCJH 3W5NA 1M7DA 5CJ8A 5AZ2H 1YNLL 4MDJA 1FG9C 3EHBC 3UPRA 4KROD 2YD9A 3NN8B 3MGOA 4KFZC 5J1AA 5D93B 2EO1A 3W5MA 1RZ8B 3T4YB 3MROA 2FB4L 5F7LB 5DRXA 5D7IA 3B9VA 3MOAH 3IFPA 2JJSC 4N0UB 4UMGA 3TNNA 4G6MH 1LDSA 3LIZH 4IIQA 4LLDA 4J7RA 1B0GB 1XGTA 5HHNA 3ARFB 4XCFL 4FZEH 3TWCL 4NFDA 4MNHB 4X4MA 1SVCP 3SGDI 1NAMB 4YHNA 1KB9K 2DJSA 1CE6B 4I0PD 3QJHB 4HK3N 3BZFB 1GC1L 3BEWA 5H35A 3QNXA 5EZOL 4Z77B 2ADJA 4KVNL 4ZPVB 3ZT7A 3O4LB 5ESQB 4Y16C 2WIIB 4FQ2H 3LEVL 5HGHA 5HHQA 1DQLL 5F9WC 3NTCL 2BSTB 4RMUA 4HCRA 3WLWD 1KB5H 3GJFB 2HJFA 2ZUYA 1SVZA 5ANME 5I1JL 4CUCA 4OF5A 4CVZB 1CK0H 2XOTA 1YQ2A 2Y5TB 4BKLB 5BV7B 3CMGA 3EJJX 3FO0L 5ISZE 3HS0A 5FM5M 3RWJA 1S9KC 1LE9B 3EZJB 1KSRA 2HMIC 3IFOA 5I75B 5EBWB 1QSZA 3PGDB 1HIMH 2OJZH 3BIKA 2EDWA 3KJ6H 1W8NA 1D7FA 2CDEB 5JNYB 5TGBA 3V4PL 4PJCE 4OGZA 4LF3B 5GSRB 4EIGB 3BP6B 4C54A 2ARJA 4CU8A 2E7LC 1T80A 4HKBB 3F6IA 3QDJB 3UX9B 2AJ3B 2ZG2A 3VFSB 5JMRA 3QXUA 4CN1A 3F8UB 2RQ8A 3MZTA 1LEIA 2EECA 4UQ3B 1NFKA 3VG0H 5FB8B 1I1CA 1A9EB 3VFRA 4OCSH 4HUXB 5ADPH 4YJZL 4KKAD 1OLZA 4RMTA 4ENEC 3LKPB 2BJMH 1VCAA 1PYWA 2Q6WB 5HGDB 1K4DA 4D2NA 3LKSB 4FXLA 5C2UB 4WI6A 5IMOA 2XFXB 4EVNA 5IEKA 4AQOA 3CXDL 4U4BA 1MIML 2IAMA 1QLEH 4X99B 4L9LB 3VH8A 4PP1D 1HILB 3DX8B 5IJKA 4NN6B 5IESH 3MRDA 1QLFA 3JWOL 3MGTB 5DHYB 4RQQB 2I60L 1J1XH 5F21B 4JFFA 5A2IH 1V7ML 3VD3A 1IEAB 3GMRB 1N64L 4OBSA 2A9MH 1MRFL 3HE6B 1N3NB 2QQLH 4YX2H 3WNKA 2EDBA 2YRPA 3E2HB 3IKCA 4JHBA 2DYPA 1F97A 4JPWL 3D69B 5I30H 2IBZY 4GAYA 4PJCF 4R4ND 4WUUD 4DKAA 2MHAB 2CO7B 4OIIL 2DQGL 3QDMA 1IJ9A 1JNHB 3VGBA 2PTTB 3GKZA 4NT6B 4YO0A 2XV6B 1H9VA 2XWBB 1MJUH 3BDYL 4K94L 1MFDL 3M07A 2EDRA 1YPZE 1XGQA 3GMQA 5JHLL 4P9MH 3QNYA 4QXUH 2W0LA 1Z9MA 4UDTB 1MHCA 1Y18B 4BZ1H 3G5YB 1YEGH 2PR4H 2DQHL 4G9FA 4XNQA 2VLRA 3I6LD 4GRWB 4APQB 4U1NA 1WEJH 3LHPH 1RVFL 5MEND 3MRIA 5DT1H 2IANE 3ZDYE 2AI0H 1AGCB 1DBKH 1RJYA 4G3YH 4RMQA 5K9QG 3PWJB 4UBDD 5CJQL 5B8CC 1MCQA 2BC4A 1HH9B 2H2SC 2A77L 4JCMA 4Y4KD 2CLVA 4OI9A 1ES0A 1KT2A 4K2UL 2QADD 2VNCA 3K4AA 4M5ZL 1LK3L 4J1UB 4G80B 4JFOA 5C09D 4MLSA 4YUEL 4M6OL 4DGIL 3WCYA 3K2UH 2RAMA 3OJMB 4IRZL 3MXWH 2CO6B 1HN1A 3FMGL 5HHXH 4U3CA 1NMCB 3ARWA 2MQ0A 2H41A 4D9RD 2JB5L 2XPGB 1RK0A 4WJ5A 3HZYB 1NC2A 3BP5A 3WD5H 3L7EB 4FZ8H 1MUJB 25C8H 1Q9KA 3LRSB 3QQNA 4RFEB 1DDHA 4O4YL 4XPFL 3T04D 3RBGA 2NY4D 5F7WC 5T1DH 3KYAA 3QFDB 1YPZF 2ERJC 3Q6FB 4ZQKA 2A0LD 2XKUA 3RU8H 4M7JH 3HR5B 4GRLC 3QR2A 4EEEA 5F1IB 1BD2A 4OFDA 3VGFA 5DRWB 1KNOA 2XZCL 3ZDYF 4XP4H 4MD4A 5IMLB 5HDQL 3L5XL 2NY1D 1NJ9B 1EO8H 5DHVH 2H8PB 4POYA 5M95B 1QSEA 3EHBD 1MWAA 1Z9SA 1ZANH 5SV4A 2KBGA 3OTTA 3VXSA 3VXUA 3ILPB 3LOWA 5ACLA 4PV9A 5BJTA 4JQIL 1QNZH 4HXBL 4CVXB 4N9GA 3MC0A 1PSKL 2F53A 4OAWB 4PRHA 2FCBA 2X4QA 3MQIA 3S4SB 3TN0C 1DZBA 3IETA 1D5BB 1L6ZA 1I9JH 3BPLB 5FYLE 1S9WA 3OJ2C 3QUMA 2WQ8A 5C0AD 1NDMB 3H9HB 4ZOEA 3D85D 1DBAL 2ZOKA 3ARVA 4PRPB 5FO9A 4ALAH 5GS0L 4MQTB 3D39A 2NYYC 5IROC 5MI0B 3MCKB 2QQQA 1RULH 3ETBF 4RX4A 1U3HB 1IM9A 1RUPL 1HDMB 3BZDA 5I19H 2ED8A 2A6IB 4Y16D 3V6ZA 3IDNB 5F96H 1U8OA 1VERA 5J13B 1ZKAA 3JTSA 1RZKC 1TETL 5IB1B 3ALWA 1PY4A 1Q94B 5C0ND 3O4OB 1Q9WA 4X4YA 1BJMA 4XBEL 4X9FA 2VDNH 4Y19D 3AFLA 1JK8A 1JWMB 4LPYA 4PJ9A 3VRLE 2HMID 4H8WL 2NXZB 4TUOA 2BOCB 3BKCL 1QFWL 2V7NB 3E6FB 5CD5C 3GSQA 1XIWA 5DDHA 4EI5A 3HLAA 2IQ9H 5EZJA 4MCYA 2D31B 3EFDL 4W4OC 2CGRH 1E6JH 3GJEB 4DZ8A 3BKJH 5DI8B 3RIFK 5HVHB 4J6RH 3LS5H 4MNQB 4X8JA 4PJHA 4JO3H 5DEZA 5EO9B 2A73A 2CXKA 3VD9A 4G8EA 4PRBB 4R26H 3BZEA 4J8RA 3GUTA 4G9DB 4HBCH 1WCBA 3AM8A 1G84A 3DVGA 2DLFL 1NGWB 1TCMA 3QEGH 1QPXA 2P8LB 3U7YH 5JPNB 1NFIA 3RWIB 3EAKA 4UQ2B 4YGVA 4OD3L 3ZE0F 5C0CE 1QSFB 4I0PA 1R3HB 1RUKH 2X1OA 5DYOA 3FAXA 4PRAB 2VLJE 3QXAA 4XMLH 1TDQA 4ISVA 4DAGH 2AABL 4WV1C 5LJYH 2EXWD 4ZNCD 1KPUB 3AY4A 5BO1H 4WU5A 1WZ1H 2VDOL 3VRLF 1OLLA 4XTRC 3V52L 5FUCC 4PYGA 2YZ1A 5CINL 4I18C 3DIFA 4ODTH 3U4AA 3IDUA 3SOBH 1GGCL 5E7FA 1DBJH 2DQJH 4HPYH 4WHYH 4XVUC 1HSAA 2VMFA 4ONHA 2OR9H 3P0VL 2XG4A 3SGKC 1MCDA 1F4XH 1VFUA 3QHFH 2LAGB 2F54B 5C0GA 2BRRL 1OSPH 1Q0YH 4OFIA 4JFZL 2DWDA 4YEFA 3OGCB 2FGWL 3ZYIA 5EBLB 5L9DH 2ATKB 4QRTB 4DKDC 1U3YA 3MLPA 4KMLB 1CU4H 3OB0K 1J87A 5JOEA 4L4VD 4HZAA 8CGTA 4JFQA 1RUQL 1K6QL 4QRQA 5IVXA 4XC3H 1E6OH 1INQA 1KCSL 1KFAL 5LGJB 2C3GA 1OTTD 1W0VB 5L7XL 2CMRL 4K3DL 4R4BA 1GHFH 5DHVA 4E41E 1CFQB 2H2SD 2X9XA 2VAAB 3P77B 1MELA 2RJMA 4LK4A 5GSVB 3HAEA 5LWYH 1A21A 4WFGD 4DFIA 5DJDA 5AYUL 1OP3K 4CDHA 1M71B 4LNRB 5L2JA 1EEZA 5EWIL 3EDDA 1Q72L 1CE1L 2BVPB 4U1LB 3RWCB 4NO3B 2FLBT 1KJVA 1RY7B 3ZTNL 3S5LG 1K8DA 3FO1B 5A3ID 5F7FA 1KCLA 3T1WA 3C60C 2CDFB 3J8F7 3SKUD 4AENA 1CFVL 2IMMA 5SV3A 2ZKHH 1MJ7H 3MRKA 4XPGL 3B6SA 2P4AB 1G9MH 3D48R 3UYPA 4L8SB 4CMMA 3HC0B 3MLXL 5KSAB 3INUH 5KSBB 2AXFB 2R0KH 4HAGA 3CUPA 5BS0B 4LCWD 4FQXA 4P23B 4WUUA 1A02N 4KGJA 2B2XL 3WUWG 4GRLD 5CHNB 1H5BB 2GEEA 5DS8B 4C56D 3BRDA 1H3UA 1U9KA 2P43B 1DFBH 1P7KB 1MJJA 2ESVE 5C0RH 3QULA 3MLSL 2BY2A 4ZAKC 1FYTD 4MCZA 3WIIH 5MHSE 3L3DA 3NACL 3U7WL 1E27B 1IGMH 1BVLB 3QIWB 4HLZH 4M62L 1JNNL 3T0EC 1P2CA 3E6HB 5EOTA 4PJAE 5DD3L 1ZK9A 1OB1A 3CIQA 3S34H 3GSUB 5MENA 3L95A 1U6AL 1CDHA 1I9IL 2O5YL 3WFHA 3VFUA 5TFSH 2HG5A 1A9BB 1EAJA 1ED3B 4X6FB 1XGRA 4Y4KA 2YA0A 1JTOA 1OAQL 2NYYD 3U4EA 2PYEE 3L7FB 4N8VA 4BELD 4U1GC 1U0QA 1TQBC 3BPNC 3MCLL 4X5XB 5C09A 5T3ZD 4ZSOE 1U2HA 5C6PB 5C7XL 3I50H 4YXLH 1CL7H 3EFFA 1KJ2H 4Y2DC 1M7DB 1WAAA 4MDJB 5A2LH 4QKXB 1KCKA 4U1IA 3UPRB 1DSFH 4NN5B 5B3JE 4BH8A 3MNZA 5J1AB 4NZTL 1ZV5A 2B1AL 1BFVH 3MROB 5DRXB 2OL3H 3IFPB 2DI9A 3TNNB 5JW5B 4IIQB 4LLDB 5JW4M 1XGTB 2B20A 5HHNB 4GQ9L 3WO3B 2VDPL 4UI2A 4G6FD 4J12A 1F6FB 4YHNB 2UZIH 3QO0A 5CD5D 3RL1A 3BEWB 3OXRA 3X3FL 4I3GA 4PJAF 1GSMA 5H35B 1MEXH 1UJ3A 3BO8A 1PG7L 2ADJB 3MV7D 3EYQC 3PP3H 2R29H 3P11L 4WEMB 3N1PC 5HHQB 1KIUA 5HGHB 3MFGB 1K8IA 5GRJH 5DJXB 4XC1L 1GGTA 4P46C 2HJFB 4AZ8A 3MODL 4QRUA 5EU4A 5D1QB 5JMOC 1OP9A 2EC8A 3H0TA 3IXAA 5DMKA 2MCPH 1GOGA 2QQKL 3RUGA 3FOMB 4HXAL 2PKDA 4F7EA 3RWJB 4NKIL 4R8WL 5B3JF 2K7QA 3D85A 3IFOB 5KVDH 4ERSL 4DGVH 2FEDC 1LO3H 5D7LD 3LCYA 1T7ZA 3MRNA 2DI8A 3S98A 1EGJL 5TGBB 2P24A 5GRVK 4E0RA 4FHBD 3VCLA 4B53A 4PJXE 2DM2A 1FQ9C 2ARJB 2GIYA 3CXHK 1LQSR 4FOMA 4FQJL