2R1WA

Crystal structure of s25-2 fab in complex with kdo analogues
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
216
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTITSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSEGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploration of specificity in germline monoclonal antibody recognition of a range of natural and synthetic epitopes.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab, antibody fragment (IgG1k), light chain
total genus 49
structure length 216
sequence length 219
ec nomenclature
pdb deposition date 2007-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r1wA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r1wA01
1VFBB 1IGMH 3JUYA 5E08L 3AROA 2F5BH 4KH2A 2SEBA 3WIIH 1HHGB 1PKQE 4PD4K 5J1SC 1EEYA 4NIKB 4KUZL 2F54B 4FQJH 5D4QA 4M9PA 4LRNL 3DX8A 1ZT7A 3NH7H 5TDOB 4UUJB 1HZHL 2GJ6B 5FM4A 4IRSB 3VXUD 2EXWC 2CLVB 2GY7B 4PLNC 3VW3L 1H3TA 1OM3H 2R2HB 1HSAA 3OKEB 1RK1A 2W9DH 1S7XA 3NMEA 1YEGH 3C5SA 3F5WA 3BW9A 4PJXF 5E9DE 4KHTL 1ZT7B 3TYGL 5EBMA 1KJMA 3HAEH 4KXZI 2VR4A 3HI1A 3O2DA 4RWHA 2AK4B 1QRKA 3TBVA 1R3IL 4ETQB 5FEBA 5IR1B 3GMMB 1ONQA 1A4KA 3VH8G 4HGWB 2X4RA 1RHHB 1AE6L 1A6VL 1IC7L 4NC1E 4NQEB 3IVKA 4XAKE 1T5WA 3LPWA 2YWYA 5FA3A 3WFEL 2IANE 4GKZB 5GS0L 3N9GL 2DYPD 2VITA 3IF1B 5AYQA 2ZOLA 3RX5A 3D3VA 5CD5C 1INQB 2I24N 2CUIA 3G5ZB 2J5LC 3EO9L 5GJTL 5C2BH 1IMHC 3VDAA 1NCUA 5T3ZE 4Z0BL 4NUJB 4HD9A 4ZUTB 4ERSH 3PGDA 4GKZA 5I8KL 3ARGC 5HYEA 2F54D 4XAWH 1S7UB 2BDNL 1MIML 4L4VB 4RWYL 1NGXA 3U1SH 2AJVL 1KN2L 3G6AB 1YN7A 4YDLC 2GJ6D 2HVKB 5IB3B 1WAAA 4ODVH 2R4SH 4YBQD 3UYRH 1FP5A 5CGYC 1CR9H 3PV7A 5FV1L 5L7XL 2AGJL 1RULL 2ESVB 4JB9H 4R97C 1GGTA 2VDPH 1L7TL 2VAJA 3LIZH 1VGEH 2AJXH 1CS6A 1XIWB 5HPMB 4XCNA 4YXHL 4K8RL 3MRNA 4C54A 3RWFA 3VMNA 1QSEA 2A9MH 4M62H 3AREB 4LLMA 4YPJA 3QFJE 1RMFH 1TJIH 1AJ7L 2E3VA 3KJ4C 3QI9B 2EKJA 4CW1A 1BLNA 1I8IA 1K4DB 1T1ZA 4JGJA 1EUTA 4WW2F 2HLAB 4LRIC 4K2UH 5DJZB 1KENL 2E27H 5FOJA 1MI5D 4FQLH 3MRBB 3LB6C 3K8MA 4O58L 1QRNB 2Q3AA 4WWKA 5J56B 2R69H 2NQCA 2FJGA 2V2WA 3QDMA 1JGDA 4M48L 2J8UE 3FQRB 4JREB 3KLSA 5HHVL 3V52L 2VDNH 1JHLH 1NANI 1BZ9A 3CLEH 1KJVA 4MA8H 4MA8L 2PYEB 4N68A 3UPRA 4L5FL 5DJDB 4HGKC 1Q9OA 4GMTL 4QHLB 2QQKH 3C09C 3HHRB 2P44B 5A3IC 1Q94B 3QZWG 3DO7B 1N4XL 5L2KE 5DZNA 5BMFH 4CGTA 3GI9H 1SMAA 4CJ1A 1RUPH 3VG0H 2KQMA 5DUML 1S5IH 1T7XA 1JHTB 5JOFA 2JJSA 5HYQA 5DGRA 5GGVL 5DI8B 1IM3A 4QY8A 1F13A 1KEMH 2EDLA 2GW5A 2QL1A 4ZSOE 4TRPL 1RK0B 2X89A 1UB6A 5FYJH 1A1OA 4OF3A 2J5LB 1V7MH 1QPPA 4BH7B 4OI9A 3ZDXF 4YXHH 2CK2A 7FABH 5TF0A 3WNKA 2DQUL 5SV4A 5L9DL 4PG9B 1P4IL 1RULH 2KBGA 5IVZA 4ALAH 2VLJD 3U0WH 4DUVA 3RA7H 5MI0C 2ADFL 2R56L 3MX0A 5EU5A 3TC9A 4M6NH 3QEUB 4XXDB 4ACPA 2WV3A 2NY0C 3BKMH 4JFXB 4LMQI 5BRZE 4PJ9D 1TVHA 4A6YB 2BHUA 3QEGH 3T4YA 1P4LB 1A6ZA 5GGRA 3MOQA 3NCBB 2CKNA 4NRYA 1H3WM 1J1XL 1RZKL 2GSGB 4AIOA 3V5DB 3GBNH 2BRQA 5IJVB 1VDGA 5D1QC 4XH2B 4PS4H 4X6CB 1DEDA 1HQRA 4Z7VB 3EZJB 1BEYH 5I1DA 1VCAA 4C83A 4OZFH 4GW4A 3T4YB 3ZKXC 3ULUL 3AAZB 3SJVE 3T8XB 1NUNB 4M5ZH 3HZVB 5BZWB 1U58B 3VXRA 3SDAA 1D7FA 1NUDA 2CJUH 2MQ3A 3BH8B 2CMRL 1HSBB 3GJFH 1REIA 4FRWA 4G6MH 1EAJA 5D7LB 3VXMB 2HFFB 5HI5C 3GSQA 1RSFA 3DHJA 1YMHB 1MY5A 3BSZL 4UMGA 1W0WB 2PXYC 1T6VN 5BOZG 2BNQB 1UM4H 4LLUB 4OD1L 3RWIA 1YNTB 3FQWA 3K2UL 1G7MB 5T3XH 1S5IL 4OZGE 3WD5L 3VFUB 3ROOA 3GI9L 1TPXC 2DLHA 4QTHA 2VLKB 3SDCA 4PJBB 4Y5XA 4C4KO 5I1AB 1FCCA 5DJXB 1Z6JT 2MTPA 3WUWA 1DQJB 3HI6H 2AP2A 1TJGH 3DUHA 1QLRA 1ZGLP 3PDGA 2R8SL 3CJJA 4P23A 5I73B 2WIMA 5JNYB 2J1KA 2AXGA 3OAYK 4O58H 2DMCA 4OFDA 1F58L 5FYJD 1A14L 3VWJD 2BY3A 4M7KL 4OGAD 4OUUB 3D6GA 4QT5B 5GS0C 1PVHA 4WTZA 1GZPA 3HTLX 4DCQB 1IGCH 3C8HA 4NSKB 5DQ9B 5KSAB 3KPMB 1F4XH 4WFFD 1MAMH 2R1XA 2GTWA 1RK0A 1XF3B 1HYSC 1JZ4A 3OF6A 5CILL 3FQNB 1T2JA 4RFOL 5HHMB 2VDKL 1XCTA 4FZEH 2AXFB 1FGNH 5BV7L 1ZK9A 3FOMB 2H1PH 1ZHBB 2ZKHH 4GXUN 1CDYA 4OZHB 4YXLL 4APQA 1P7HL 2FH8A 2X9XA 4PV8B 1PDKA 5AWNL 2FATH 1C1EL 4UT6H 3ET9F 5IMOA 3H9SE 1G9NH 3AU1A 1RZFL 4LLMB 3HZKB 3PWVA 4LSUH 3I50L 1FO0B 1ADQH 5BVJA 4I4WA 4PRIB 1QSVA 4DW2L 3AC0A 4JKPH 5ICZA 4UIMA 4LCWD 2EZ0C 4U2YA 4ZOCA 4G8GD 2C4FT 4PJBA 3MJ9H 1RIVH 5FO9A 1NGQL 2FWOA 3SDYH 3D0VB 3IDXL 5E4EB 3V7AG 3K3QA 4Z76A 3OB8A 5J11B 1M6OB 5GS0H 4KPHH 4JDZB 3E0GA 4U1HA 4X8JB 3K8LA 4P46A 1INEL 1OAUH 2VXQL 5BO1L 3H9HB 2N4IA 1N5AA 5FYLE 4FXKA 3RVXC 4X4ME 3EOTH 2EDJA 5K9QG 2ADIB 2BSSA 4HWBA 1QEWB 2R39A 1FNFA 1U93B 1T80A 3P30L 5ANMA 1BFVL 43C9B 4GRWH 4LP5A 2NY3C 5TFSH 3KXFB 3KPRA 4RBPH 1R5VA 3LY6A 5FOBA 1WISA 1MFNA 2AKRB 2YR3A 4NFDA 1MFAH 3MLTA 4KAQH 5AYUH 1B88A 3FZUD 3VFGH 4RSVA 4OCNC 43CAB 4JDVA 4P2CG 3ULUD 1U92B 4KRLB 3MJ7A 2PYEE 1QSED 4JFDD 1FGNL 2HVJA 2B20A 3NIGE 1UJTA 3KGRA 5DJYA 4ZTOH 3UTSA 4X6DA 2AJZB 3S6CA 4QXTB 3BJLA 3ZE1F 4U1LA 1ZWIA 3B83A 2YPKA 5D7KE 5ESVA 2X41A 2WW8A 1SJEB 3IDMB 5KAQF 1KCRL 4WY7L 4P5TC 3MRQB 1EFXA 2OTUA 3CVIH 5IESH 4I0CC 2IAND 4I8DA 5KTEL 3LZFL 1NC2A 2ATKA 4H1LA 2BVEA 2DLGA 2HKFL 4JG0H 2AAVA 1WZ1H 1YECL 6FABL 3IVKB 1FL6A 5J8OA 4FP8L 4JRWA 2ZUQC 4RDQG 3VGBA 1JL8A 5DT1H 5GISH 5DGQA 5I75C 1UM5L 3FO9B 4DVRL 1MELA 4M1CD 5IFAL 4TVPE 4XP1H 4PRHE 4KKAC 1OCWH 3RNQA 5LWYL 3OKNA 2R2HA 1NCBL 1NCBH 2VXVL 4XCEA 1IQDB 4X7TA 4KKNA 4XCNB 5EULV 3JSSA 4QXUH 5I30H 4N9OB 4P2QD 5KZCB 2R1WB 4GG8B 3DX8B 3IS1X 3CPLB 5C86A 3BSZH 1UXWB 2YEZA 5DHVB 2OLDA 3JWDC 3HZKA 5HY9B 4DKEH 3ARGB 2DRUA 3S88H 5L88H 3QIBA 5FYLH 1QYGH 2XRAL 3HNVL 3QJFB 2W0KA 2BOCB 3ILPA 2PYFB 3O6ML 2FJGB 1RZGB 4OGYL 3DMMA 1N0XH 1OY3B 1N5YL 2YK1H 1WAAF 2AK4E 3K1DA 3LQZB 1XIWC 2IEPA 1I8IB 3BKYL 4QRRB 2D4FA 4Z7UE 3P0YL 3MRMA 4OM0H 2YC1B 4G8IB 3MRJB 4HZLA 3AXLB 3DO7A 1N59B 3OJVC 5IB5B 1RURL 2EDHA 4R3SB 3JTSB 4BKLA 3PWPE 4R2GD 3OZ9L 2APFA 4K55A 1JPFA 4JKMA 5IQ9A 1PY4A 2N56A 5D1ZC 2DD8H 4FXLA 4MVBC 4Z78A 4YDVB 4JVPA 4PJ5E 1J1PL 5TH2A 3KYOA 1P9MC 3SGJC 1PY9A 4ONGH 5C08E 5I73C 3SGEI 3CVHA 5ALCH 4A6YL 1YEHH 3ELAT 2J6EA 5C0AB 4IMKC 4D9LH 3VI3E 2QV2A 4R7DB 4ZSOB 2XQYK 3QYCA 2VXQH 5BO1H 2GSGA 5BZDB 2EDNA 3UZEA 1XGPB 5KSBB 3IDJA 5H8DA 2HTLD 2IG2L 2JIXB 4C58B 1JI1A 3ESVF 3U4EB 4R96A 4DEPB 5E6ID 3HUJB 3CFJB 3U2SA 3DUSA 1P1ZA 1YEIH 2E7LA 1Y6NR 1XGTA 4UV4L 2XWBA 3FFCD 4I4WB 2VN4A 3RUGB 1NMBL 3SY0B 1MCPL 1ZEAL 3RDTB 1TVBA 1JHLL 4C55A 2NX5E 4M1GH 2L0DA 5FO8A 1K3IA 1ZA3B 4UB0L 1OAUL 3D39E 2C1OB 1K6QH 4G8EB 1HXYB 1M6OA 5GSRA 2ZWLT 3V0WH 1BD2E 3HMXA 5JIKA 4NKIL 1XGYL 3RGVD 1DVFB 4GOSA 3UJIL 4QOKE 3VG9B 4JLRA 1LP9E 1BD2A 4PJ7E 4BFEA 5HI3C 4WHYH 1CFQB 1IGCL 4F9PA 4NO0A 5B39B 5BRZB 1GXEA 2AEPH 4DUWA 4NRZA 3C8KA 4J3VA 5JW3L 2IAMC 5T33L 4MNQE 1WAAE 3C6LC 1XGYH 2NLJA 4Z0XA 1VFUA 1BOGA 1F58H 3TBVB 2GJZA 4MAYB 3U4BL 2ED8A 4DKDC 5D2LE 5E6IB 3FQUB 5D1QB 2YD5A 5ENWA 4N1CA 2Q76B 3IDYB 1HILA 2IPUK 4M3KB 1MRFL 2R4RL 4NRZB 3U83A 4OZIB 3AS0A 5IVOA 3STZB 2IWGA 2IFFL 3VWKA 3DHMA 1F2QA 4NRXB 1NMBH 2F53E 5JW3H 1YZZA 4FN0A 1A1MB 4PGCB 3SDXF 3TO2A 4JRXB 2WUBH 3DURA 1BX2B 1G7PB 5DURD 5IQ7H 4RRPA 1GGCL 4D0DA 1XF4A 2GK0B 3KVQA 1YEIL 1CE6B 2XQBH 4NJAH 4CU8A 3V5KB 3FCTA 2EDYA 4LSSH 2PO6D 4ZUSB 4M93B 5JIIA 4Z7WE 4PJ5B 3BISA 3BH9B 3RGVB 1TFHA 2AQ1A 1IQWL 4X7EC 1KXVC 4JE4B 1FC2D 4M43L 3LVEA 4HKXB 3KDMA 1QLEL 3GSQB 3KLAA 1NAKH 1ZTXL 2XWJA 3OXSA 1U6AH 1CTNA 1C08A 2C26A 4WCYH 1R3IH 2AI0L 4JFQA 4OZIF 4HUXA 5K9KA 2F5AH 4HBCL 5GGRY 4U49A 2CH8A 4OZHF 4XP5L 2BVPA 3WJJA 3VFUA 3Q6FB 3TT3H 5C0JB 5GGUB 1U8HB 4PS4L 4X8JA 5D1QD 3VW3H 1EEQA 3K4DA 5D5MB 1GAFH 2W65B 2FSEA 4HUXB 3D9AH 2XXCB 2P5WD 3FO2B 5ACLA 1CGXA 3DXAB 4P23D 3QIUA 3C09B 4PJCE 1T89C 5E56A 5F1OB 5C0IA 2XPGB 4NM8L 4GAFB 2VXUL 4JRXD 4Y5VC 3RUGE 2C4XA 3BGFC 2C3WA 3IXTB 3ISWA 3BKJH 3W0WB 1G6RL 2QSTA 1OB1B 5HI5D 2A1WH 1U8OB 2F5BL 4KDVA 2VLLA 4IM8A 4N8VB 4KQ4H 1E4KC 2I26N 2VZ1A 2PO6B 2KUTA 5DLML 2GKIA 1Q72L 1QVOB 1R3KA 2EIEA 1RZIA 1FNGA 4JDVB 1IZKA 4NN5C 1UH4A 1ZMYA 4HULB 4NPYA 5I8CA 4PP1C 5IBUB 2J4WH 4QNPE 4RQQA 1MQKL 4UQ2A 4KZEH 1FIGL 3ARBA 4NM8H 4ZUTA 2BSED 3S5LB 1BAFH 5GRUL 3D2UA 4MXVE 3TPUB 4J1UA 4K71C 2XA8L 5ETUB 4GFTB 1GSMA 3BKYH 1MCRA 4HKXA 1KC5L 1SJHB 2H8PB 3U82B 5T1LD 3UEZA 2QHRL 4AL8H 3TWCL 3E6HB 4P4KB 4XMPL 4YHPB 4P57A 2WQ8A 1IC5L 1WCBB 1B6UA 4YFEA 1U42A 1KTLB 1LO2L 1WICA 5HYFA 4POUB 2VWEE 4A2MA 2P5EB 2ICCA 4XWOD 3WNNA 1KJ3L 4PREB 1D5XA 2ZUXA 2WQRA 5IM7A 3HAEG 2GI7A 5CIPH 3QG7L 3QEQD 5ISZB 4OCYH 4XNQB 1XAUA 1AHWC 4R6UA 2RCSH 1KENH 1MJJB 1R24A 4HEPG 4HKBA 1QOKA 4KJPD 4IRSC 3QQ9D 1A2YB 3QFDA 4MLSA 3O2DH 4KY1L 4MXVF 5IBLD 1J7VR 1PKQB 4DVRH 1JPSH 3HI5H 3CLEL 3UTPD 4EDXB 4WHTB 5FGBC 4K8RH 4F7CA 3F6LA 1RPQA 4MNGE 2R4RH 4XPBH 3TIEB 5FGSA 4RQQB 1FNSH 1P7KA 4WHCA 4P4KD 4I18A 3KYNB 5GRYA 3VD5A 5DXWA 1DVFC 2Z8SA 3GMNB 5A2LH 1WITA 1L7IH 1KFAH 1MWAB 4ZFGL 1E4XL 1WQVT 4HIHB 2A38A 3GIVB 5F9OL 3ROLA 3SQBA 5IHZA 1RZ8A 1P2CB 3JWDL 1CG9A 4YHOL 2J8HA 4JM2B 1A3LH 3SHSA 3NVQA 4HWUA 5DSCA 1B2WH 5DD5H 4OFYD 4OCXL 4PV9B 4HH9B 2GJ6A 3Q3GA 5F1NA 1FV1A 2AJ3A 3DMMB 3G5ZA 4O9HL 1F2XK 4TVPL 5HYJA 2XG5A 4PJFB 4KAQL 4M8VA 2ITDA 1VADB 3QWOA 4RAUB 1NGYB 2AEQL 4NPYB 5I8CB 4J8RB 1VESA 3MRMB 4F2MB 3JXAA 1YMMA 5ISZE 3JV6B 1BFVH 1VSCA 1HHHA 3IDGB 4RMQA 4ZXBA 4UTAL 4P46D 5J6GB 1O7VA 4QHMB 3RWGB 1MFBH 1G9NL 5F7MC 4KTEL 1T6WA 2P5EE 5B8CA 3BRGC 4LRIA 1I3GL 5E8EA 5KVDL 5T5FL 2I60L 1T20B 4WW2B 4E41D 3KG5A 3I9GH 3TO4D 2V9QA 3X14B 2GT9B 3EYQD 2AJSH 4O9HH 4BK5A 1CXLA 4JKWA 4X6CA 3MGOA 4TPRH 4ZPTA 1T0NB 4W70A 3SDDA 2O5XH 1ZS8A 4UBDC 3TN0D 2NY4C 3TYGH 1J5OH 3TIDB 3BZ4A 3I6GB 1S9VA 1RZFH 2W9DL 1YNKL 2GYSA 4WVRA 2APWA 1K8IA 1XGUB 3U7YL 3EO0A 3FZUC 5F96H 2EDFA 4PRNA 5JPMA 1DN0B 3VD4A 1NFIB 4HC1A 4JFFD 5D1ZB 4F8QA 1AGBB 2JELL 5KN5B 3BP6B 5TQ0H 5EUKA 1W0VB 4X8XA 4DN3L 5DUBB 4WI2A 1RHHA 2EO1A 4HIHA 1ZVSB 3SKUD 3CAFA 4F7TA 4N0UA 1UXWA 2YRZA 3WCYA 4KFZC 3FFDA 4S1DC 2VQUA 3QNYA 3VFRB 2PXYA 4CDGC 3F5WB 3WEXA 5C0RL 4ZFOL 2CKBA 5MEOA 4HZAA 4ZFOA 1SYSB 1JGDB 3U7YH 4EVNA 2NYYD 2WANA 4CVXA 4KKLC 1S7WA 1XIWD 1KCLA 3WDIA 1SVZA 3ZKXB 2H9GB 2CK0L 5EO1A 3LS5H 3JWOL 1B0GA 1G6VK 4HIXL 3LQZA 4Y2OA 1KBGH 2CJUL 2A74B 4ZUVA 3V5HB 3QI9D 4PG2A 4TPRL 4HQQH 1DZBA 3QRGL 32C2A 5ACZA 1I7RA 1ZT1B 2QADB 3X13A 3CMOH 4U1MA 5D1ZD 5GZND 3DLQR 1CICC 3RPKA 3O8XB 4MCZA 3MUJA 2EYTB 1BF2A 2DBLH 5EBLB 3O4LA 3IDJB 5BS0A 3UTZB 2ORBL 1E28B 2A6KB 3MLZL 4OLUL 5DQDH 2XV6B 1DQLL 1KJ2H 4BYHA 1NMCC 2W9EH 2C1OA 4GS7B 5D7IA 2DQCH 4IRJD 1KV3A 4LK4A 4LDOB 3VFNB 1UH3A 4FQQB 4H1LH 1RQ5A 1IGYB 1W0VA 3MRIA 1UKSA 3BO8A 4LOUC 4R0LC 2FLRT 5FO9B 4LLVB 3BDYL 1E27B 3RVUC 3V0VB 4L9LA 2BNQE 2DJ4A 3UAJC 3OB0K 3ZT6A 5C07D 4K7PY 1UKQA 4JZOA 2FO4B 4H0HB 4EBQL 4GKNB 3WL9A 1QBLH 5TDNB 5LKNA 1T21A 3D2UD 1AD9B 25C8H 2OP4H 1NGWB 2X7LB 4HJJH 4UILH 4OAWB 5E2TH 4JZOB 1KFAL 3S3JA 5DDHA 1MLBB 3IAQA 4AQOA 3LAFA 4YEEA 4K9EL 4YX2L 4NRXA 3Q2CA 5DJCA 3VXQA 1T89A 2B0SL 2BOCA 3F8UB 3FB8A 5GZOC 3RBGA 2CKBB 1ZGLM 5EN2B 1FBIH 3WNMA 5KVGL 2H32H 2K9UA 4WFFE 4NZTH 3PABA 1CZ8L 3W0WE 4HH8A 3CCHA 1IBGL 1EXUB 1KCVL 1CI5A 3P9LA 3PUCA 3GK8H 3K74B 3WUZA 4N5EC 4GW5B 4JRYB 3VXTA 1KG0B 2OZ4L 4GBXC 4PD4J 4ZAKA 3WIHA 5H37H 3FTGA 1VA9A 3QXDA 1SEBB 2I9TB 1I3VA 2G5BA 2R23A 4RGND 4JQXA 3TA3D 1A7RH 3I2CL 4MS8D 1P9MA 4QLRA 3WUWB 4XP6L 5CEXB 3HR5A 5HYSG 3KPQB 3D2UB 1FZMB 3TPUA 2R9HC 3RVVD 2R29L 4NNPH 2BNRE 1KB5B 2FD6H 1FN4A 1LO2H 3VXMD 2K3TA 5IVXB 1O7SA 1NBVL 4M48H 4OIAA 4NKQB 4H0IA 4XMPH 4D9RE 1G9NC 1WC7A 2V5RA 3H9YA 1BGXL 1UYWH 4D0DB 3KS0J 4NQTA 1AQDA 4Q9CA 1R5IB 1H3GA 3CSYB 5T33H 4WUKH 1B4JH 1C5CH 5EZIH 2O5YL 5GS1B 1OB1A 5IVXE 4P9MH 1U95B 2VABA 3MUZ1 2GJJA 4MDIA 4Y2DA 4P57B 4JRYD 2J8UB 5DEGB 4Z7VA 4EBQH 2VKXA 3SQOL 4ORGB 4MD5A 1JP5A 2NR6C 2CRIA 4Q0XH 3VWKD 4Y19A 4PLKC 5DJ0B 3SKOB 3MUGA 4G7YL 1ZV5A 1W72H 5HYJD 3N9GH 3TA3B 4PJEE 5J1AA 1SVCP 4DZBA 3QRFM 35C8L 3HB3D 3RFZC 1U3JA 2AGJH 3K4AA 2D3VA 1RZJH 4KQ3L 2VDOL 1E6OH 3L5XL 1ACYL 1RUQH 4KMTH 3OX8A 2MHAA 4LCCC 5DD6A 5CLTA 4F7CB 1X5IA 5DRXA 1R3JA 4RIRB 4LCUA 4F7MA 3F7RA 1YC8A 4K8RD 4PYGA 4F9PC 3CH1A 1MCCA 1OP5H 3BHBB 1L9MA 1BP3B 1HCVA 1O5DT 3QB7C 1UJ3C 5HHMD 3VFPA 4NQEA 2ESVE 2H6PB 5J13C 1C8PA 2HVJB 3L7FA 4BSVA 5E2WH 1OTSC 4LGPB 2IMMA 1KTDB 1NGZB 5MEND 5I1JH 1J10A 2AI0H 3SE9L 4ISVB 4R4FH 4OCWL 3KLDA 1UWXK 3L3HB 1FL3A 1YEHL 1HYRC 4UU9B 1A6TA 4XVTL 1EDQA 4Z77B 4LIQE 4XGZB 3VWKB 3MO1A 4YHIB 4X6EB 3QIUD 1EV2E 1ZHNA 3MV11 1KN4H 2VE6B 4JM2C 3U79A 1T7VA 4W81A 4PJ7A 4H1LB 2DQDL 4LSSL 4JFYA 4LPVA 5J6HB 1AFVL 4QOKA 3D18A 3I02A 3GHEH 1MJUL 2H8PA 2ZOKB 2ZJSH 2J6EH 5GXBB 1ZLVK 3HRPA 5CKAA 1DCLA 4MYWB 4P2YA 3C2AL 5D7JB 4UI2A 1HH6A 2XN9E 4I2XA 3G04B 5C09A 1FO0H 2OTPA 4UAOB 1QTYT 3RNQB 1LHZA 2XNAA 2UYLB 5CEZD 5MENA 4NBZB 1NL0L 4JN2B 2DKMA 3ARPA 4LASL 3WLBA 3ZHKA 4S1RL 1EAPA 1LO5A 2H26B 3DMMC 1JNHA 3KXFD 3NTCH 1T1ZB 1ZT4A 3V5DA 4FTVE 4CL7A 1OQOA 1PX4A 2NXYB 2CXKA 2E9IA 4I77L 5DMKA 2NY0B 1HI6A 1QNZH 1X5LA 4CMHC 1QSEB 3DARA 1QHOA 4Y5YB 1F4WH 4TUOA 1F5WA 3QFJD 1BIIB 4OLYL 2D0HA 3QIUB 3CFEB 3I2CH 4OKDA 5IBUG 3O11A 1U41A 4F80A 2VZ3A 1VPOL 1DQTA 1Z9SA 3K81A 4LF3B 2GUOB 2Z92B 1VEPA 1ZOXA 2FEDC 1CLOL 1EEUA 3GSWA 2NLJB 1MCLA 3GSRB 1X3DA 4JPKH 4KGLA 1MPAH 4PJHB 3RKPA 5ALBL 4I0PA 1CD1B 4YBLC 3U4AA 1WFOA 1P5UA 4L5FH 5IR1A 2ARJQ 1H8SA 3PWJA 2GITA 4NM4H 3PABB 5F9WC 1YEDA 3BOVA 4XBPA 4P9HH 1HYSD 4FP8H 4OIIH 3PWPA 5CBEA 3W9DA 5L8JB 4MZ3A 2B0SH 3NFNB 2EC9U 1G6RA 5C08D 5EUOB 3P4MA 2B7DT 3B8SA 2DBJA 1SYSA 4RRPG 1MCOH 4R4ND 4FTVA 1Q0XL 5D1QA 5ENWB 1HOCA 4O2CB 2HJFB 4CMMB 3BPLC 1FQ9C 4GBXB 4NKMB 3S97C 4WY7H 4DQOL 4OGXH 4OCRH 5F1IB 2P8LB 4PRHB 1XFPA 4WFGD 1XZ0A 2HYMA 3RY6C 1NBQA 1B2WL 3PG2A 4PR5B 1G9MC 4OIBA 1RJZB 5ACZB 4XPTL 4OGXL 4UNTA 5JPMB 5DMIL 2IFGA 1OGAD 1E4XH 3V79C 1CU4H 2Y4SA 1XH3A 5EA0H 2DQFB 4PY8I 3UYRL 3MR9A 3VGFA 3ZSSA 3LN4A 4OI7A 4MB4A 2OBGA 1ZAGA 5I1DB 4XPTH 4XAWL 3GUTB 5I16A 3QUKA 1TTUA 2ARJB 5D96B 5MERB 4XZUA 1KPVB 5DJDA 3RBSA 3F62A 4WI6A 3S4SB 1EH9A 1EERB 3VXPB 3BZFB 4KUCF 2GITB 3OR7A 1WFUA 4Q7DA 1U3ZA 1AR2A 4L9LC 1CLOH 3GB7B 3OL2A 4XNMA 1FZKB 4X4YB 4OT1L 4N1EA 1YPZE 4PRHD 3VFNA 4JFOA 4TVPD 2ATPB 3HNSH 4XNXH 2IALA 3JZ7A 3N1MC 1KTRL 4Q97A 3OKDB 1ORQA 5LCVH 1K4DA 3IFOA 3MBED 1T4KA 3RY5A 4AIXA 5C09D 4RMRA 4DOHE 5C0AD 3BP4A 3MRDA 4BH7A 1OGAB 2XZQH 3G6JA 3MODH 3MV8D 4L4TA 3PGCA 3TO4C 4NWUH 3L5JA 3BMVA 3MJ9A 3U7WH 3T8XA 4OZHE 4O2EB 1UACL 4BQ8A 3O3UN 5I8EA 2A74A 3UTTE 3LMJL 1OSZA 1G1YA 3ZYOA 1CK0L 2HLFD 2MPAH 3BE1L 5IVNA 4YHLH 5JXED 1BQLL 2XA8H 5DJ6B 4FQQA 5DS8B 1KCSL 4DN3H 3LN5A 3O2WH 5IB4A 1GIGH 2GEEA 1FN4B 1X7QA 4LLUA 1QG3A 2FB4L 4NZDA 3RDTD 1T03H 3I6LE 4C56D 1DBJH 5SWQB 2F9BT 2NY1C 4PTTB 2Q76A 3MRRA 3OKKB 4MJID 1FDLH 4ZPVB 4ZTPL 4AEFA 2WIIB 1HNGA 5HD8D 1FZOA 4HUVA 2YOCA 4LVNC 1SM3H 1IC4H 4OF5A 4Y5VA 1IAOB 1MOEA 3ZDYF 3F12B 5ICYA 5HGBB 2VH5H 4GAGL 4OD3H 5H94A 1RI8A 4EEEA 5HSFA 2YZ1A 3E1F1 2FYYB 5IJVA 1I85A 2FX9L 5BRZD 3VFWA 3F7VB 4PBWD 2PCPB 4MA3B 4S1DD 3UBXB 3PQYB 2QSQA 4HIEA 3K2UH 5T3XL 1AHWA 1BJ8A 4TSBL 5T5FH 3RIAF 2PR4H 3GJFB 2ZNWA 3LH2L 4YFLI 3NABL 1KN4L 1LDSA 3IAPA 5KSAA 2CO6B 3S4SG 4E42B 2ICWJ 4UTAH 3P30H 4ZQKB 5I1AA 2VC2L 1DFBH 1JIBA 4J23A 4EUPH 2CMRH 2XACC 5E24E 1CFVL 3OPZL 5FK9B 3VI4E 3MA9L 2MQ0A 2P8PB 1NSNL 3WFDH 2VLKE 35C8H 2F8OA 2WLZA 4FNLH 1CIDA 3ZL4H 1MRCL 2V5TA 3G6JB 3GSNB 4UT9H 5D7IF 3KPTA 3VXMA 2UZIH 4FFVD 4Z8FH 5D9SA 4NQCD 4QRPE 3IFPB 3MV9A 4H1LG 5DJ8A 5JHLH 2Z31D 1I7UA 2YPLB 1HHJA 4AH2B 5J7CC 1ORQB 3U9PH 1IVLA 1RHFA 4P9ML 5F9OH 4NKDB 3BKML 1IGTA 3UJTH 3SBWA 3UTSB 4U3CA 2JB6B 3QA3A 3PQYD 4EIZC 1UJ3A 3O3EB 1GGYA 1KEGH 4RMSA 1A7QH 1FNGB 2YA0A 3QXAA 4H25A 2Q8BH 4ETYA 4ELKA 5ICXA 3FQXB 5I9QB 4GXVH 3OXRA 3H2WA 5D5ME 3MLTB 4Q58C 1FORL 2D7NA 3VI3F 3L3GB 2DWDA 5E00B 3HC4H 5F7NC 5SWQA 1A1NA 3B5HA 1N3NA 1T1WB 2W9LA 1K2DA 4M7LL 1CXFA 4OD2A 5D7JA 3BIKB 5D6CB 4D3CH 43C9A 1UB5A 2CQVA 2R29H 3SKJL 5HJ3B 4X7SH 4G9DB 2HMID 3QO0A 3CFBA 2OQJB 1EO8H 1YEKL 3LSOA 2O5YH 5FV2A 1WK0A 3VI4F 1EZVY 2MCPH 3QUMH 4NKIH 2YD4A 2FL5A 2IPTL 4RAUA 1AH1A 4R4BB 1EFXD 4JDZA 4U1HB 2WZPD 4NQCB 3D3VB 1YNLH 3STLB 1JGUH 2R1XB 2Z31B 1FFNA 1CGVA 4N90D 2ICWA 3L3JA 2IAMD 4NHCH 1A7NH 1R3HA 3KLHD 3MRGB 5C6TL 3MV7A 1U2HA 1F3JA 1OW0C 5DHYA 3CX5J 4Q9QL 1G7LB 3FB6A 4LPXA 1LO4L 4TUJA 4WUUD 4NKOA 5SX5H 1BWWA 3AAZA 1WVZA 5IFHL 1MJ8L 2DWEB 2YWZA 3PWUB 4XI5C 4OZIE 2CIIB 1GOFA 1FZKA 4PUBH 1WBXA 3TNMB 5DA0B 1QKZL 5D1ZA 4QHLA 1BVKB 3TM6A 1JTOA 1FL3B 3NFPB 1TZIA 5GRUH 3WIFB 1EO8L 1QUNA 5FYKD 3EJYD 3FO9A 3IFLH 1SEQH 3TH3T 1BZQK 5F9JB 4QRUB 2J4WL 4IMLB 3VXSA 4N90E 3NACL 2W60B 3B3IB 4S0SD 1B90A 3ZTNL 1QPXA 3QUYB 1BQHB 1A9BB 2ZOKA 5I76A 3PWNB 2Q87A 5A2FA 4NNXB 5L7XH 5KSUA 3BVNA 4HUKB 4P3CH 1S7WB 2N1KA 4YPGA 4HBQA 3D39B 5KS9B 4L8SA 2F58L 3BFOA 5EIVA 1MIMH 4OCSH 4WV1C 3TVMB 2R23B 5D70L 5D2LF 4WUUB 2I25N 5IT2H 3FFDB 1BECA 2J7LA 4M6NL 4DN4L 1S9XA 3EZ8A 2P7TA 4ODSL 3QQ4A 3RGVC 3U0WL 5A2IH 4NKMA 3P3YA 1D6VL 4QHUB 3QHFH 4FABH 3BDYH 5DD1H 3T0WA 2AABH 3ZKMD 5JPNB 4JY5L 3L95A 3RWFB 5IGXH 4P2OB 1KB9K 4EZMA 5CWSA 2JB5L 1G9ML 3QNZA 3KPPB 4S2SA 5B4MC 5I74C 3SO3B 1JGLH 4HG4K 5GRWA 5B3JE 3RX7A 1ZT1A 5IWLA 3O8XC 4MX7B 3T09A 1DSFL 2HVKA 1A6PA 2APXA 1X5JA 4HMCA 3DMMD 4JPWL 3D0LA 1PBYA 1NGPH 5TDPA 5HBBA 1ED3A 3QRGH 3IJYA 1LO5B 1MWAH 1P6AB 4QRPA 3K7UA 3N06B 4N8CH 1I4FB 4K94H 4TUKL 3ZKQD 1S5HA 2MNUA 3RJQB 2X89D 3FFCA 4PPTA 4L3ED 4LSTL 1IT9H 4RMWA 4K3JH 3RZWA 1SM3L 4JPIA 4JFDE 1T5WB 3M8OH 1I4FA 4AZ8A 5E4EC 5KG9A 4GW5A 3NOIA 3LS4H 5E4IA 1E4XI 5EDXA 5IEHA 1I3RA 3CVIL 3OKMB 4QGYA 5C0RH 2R2BA 8FABA 4P2OD 4FMKA 1MJ7H 5I19L 4I18B 4OSUL 2AEPL 1KCRH 1AD9A 1CIUA 3C6SA 1JNNH 4XWOC 4ZO7A 5FUCC 5J12B 2HFEA 2Z4QA 4LEOA 3QIBC 4KU1A 4FOMA 3UJIH 4ZTOL 4TTGA 1OT1A 32C2B 5KS9A 4OFKA 2VDML 4KJPC 5I9QC 5JO5B 2WUCH 3O3BA 1ACZA 4MJ2A 1JV5B 3O3DA 3AB0B 2ZOLB 2IC2A 3IJSB 2G5BB 4PBXA 1P7QB 3TN0A 2VDRH 3EHBC 2FBOJ 4UV7L 3REWA 5KVFL 3FQTA 1IEBA 3QUKB 1AFVH 4D2NA 2X40A 5TE4L 1TCRA 4JO4H 4NO2B 2Y06L 1T66D 4NGHH 3ARZA 1LNUA 1D5BA 4X6BA 1F90L 2CDGB 4HS8H 5D7IE 4L3EE 4L3EB 2HG5B 4NO3A 2BSTA 4J7RA 1DQJA 3GM8A 2R0WH 3IXAA 5E9DD 4P59H 3OAZH 4PTTA 4HUUB 3NZ8A 1JTTA 4G8FA 3QZWA 1FCGA 5MP6H 4H5SA 1FFPA 3KYKH 1EMTL 1MVFA 4I2XB 4X6BB 1P4BL 1INEH 4OZIA 4ZMAT 1FNEB 2VLRD 2C9AA 5C0EB 3PE9A 3ARWA 5EUOE 1T7WA 3IDXH 5K59F 2FLBT 1SHMA 1FGVL 3SY0A 2XIDA 1B4RA 3RTQA 2FYYA 5C09E 2FX7H 2X7LA 3SKMA 1X6NA 3MV7E 4NO0D 4PP2A 4DW2H 4QRTB 2LU4A 1CE1H 2FHCA 2NTSP 2Y23A 3BQUA 1UENA 4RA3A 1E4WH 1AXTL 5HPMA 4GKSB 5EA0L 3S37X 4DZBB 1R5IA 1MHPH 2B4CL 3BUTA 5FYJE 1JPGB 1J87A 4I48A 5KOVC 2OK0H 5ITBL 1RURH 3B8YA 1ZVSA 8CGTA 1I8LA 2XWTB 4XP9L 1OSPH 1PJ9A 2WUCL 5E8PA 3ZDYE 3GSOB 5F7DA 3A6OA 4NCC2 3RWDA 1IC1A 4PLJD 4PRIE 1H5BA 2Q20A 4KMLB 4RFEB 4OCMC 2GAZB 4K7PL 3ALWA 1I9IH 2NY6D 3LKPA 4NKDA 3DSNA 3EJZC 1N64H 5HI4D 5MI0B 1U8KA 4S1QH 3ES6B 2EIZB 4MJ6A 5I19H 4U31A 1VFMA 5JIPA 3O8XA 4MCZB 3GSNA 3T0AA 4TULL 5E1AA 2YD2A 4NQDD 2LV4A 1R5VB 1S7QB 4OJFH 3VFOB 1MCEA 1RD6A 4IRJA 2PKDA 4WEBH 4IHOA 5H94B 1JNJA 1JN6A 2NY2C 1MCHA 4ZFFA 1C16B 2R0LL 4TNWF 4ZUVB 3V5HA 3CVHL 3QWOB 3I85A 3B9KD 4FXKB 3IAGC 3VU2A 1DQDL 4K7PX 5EB9A 3GSVA 4PRDB 3WFBH 1F8TL 1MFCL 2EKSB 1A7PL 2LU7A 2VNCA 1JGUL 2X4UA 2WP3T 5CZVH 3UROR 5E94B 5I2IA 3ARSA 1GHFL 3CK0L 3B2UD 4G8FB 5IFAH 5E1HB 1A6AA 1DQML 4I0PD 4NO5A 4WW1B 3Q5TA 5I1CH 5BCAA 4WUUE 1CE6A 4ELKB 4KJYB 5DEFB 3O6KL 1T0NA 5DHYB 1UQSB 2UUDH 3GHBH 3KPSB 2G9HB 4G6ML 1WZ1L 1YECH 4KK6D 1U3HD 1AGCB 2V5YA 3VGAB 1A6AB 1A5FH 3RAJL 1B6DA 4JJ5B 5CZXC 3E6HA 1J0YA 3V6OA 1B0WA 2CIKB 3T77B 3U7AA 2Y7QB 1J0ZA 3BXNB 4ONFL 3DX6B 5IG7A 4GXVL 4LASH 2OCFD 3EO0B 2LFGA 1S8DB 4AM0A 1FYTE 1BFTA 1LDPL 2ED9A 4Y89A 4M4RA 4ZO9A 4MA1C 3BO8B 4J3TA 1W8OA 5HVHB 4WTWA 4QHNA 1XF2B 1LEKB 1DBBL 4PRPD 4LSRH 1S9KC 4FQ2H 4Y1AB 25C8L 2E7CA 2OP4L 4JFOB 1VGKB 3ZE0E 2B1AH 3HE6C 1FLRL 3O4OC 2P24B 2WBJC 2YRLA 1CCZA 1IAIL 5FXCH 4LF3A 4ENED 5E70A 1F11B 4NUGH 3WV0A 4Y4HA 1G7HA 3T3ME 1INDL 4PJDF 4X6CE 3TZVD 3TO4A 4OTXH 5JW5A 5DA4A 3R1GH 1NCDH 4L4TB 1A47A 1CF8H 1S78C 4XP4H 3MXVL 3QXWA 4HWBH 1U3HB 1U8LB 1NC4A 1NH6A 4X9GA 5F9DC 1VKXA 1M71B 4NQUA 5CCKH 4RX4A 4LLQA 3CDGB 3RVTC 3RVUD 5D72L 12E8L 5C0NC 5IOPA 3UAJD 4UZGA 2APVA 2VL4A 2EDOA 3DXAE 2UWEA 3X12B 5HYJB 1ORSA 3PL6C 5CZVL 1S7QA 1I1CA 4P4RB 2VXSL 4MCYB 4BFBD 4NSKA 3EOYG 2E8ZA 3T0EB 4WO4C 2CUHA 4Y1AD 5SWZD 3EKCA 2RAMA 1RJLB 2OR8A 3T4AA 2P45B 3AS1A 3V9FA 2VZUA 4YFLF 5CUSL 5DR5L 4HDIB 3BH9A 3RGVA 1QLEH 1Q0YH 1UB5B 1XF2A 5SX4I 4YXLH 2EE2A 5KW9H 4P5TA 2ZKHL 3EIFA 3LN4B 4HFUL 3S3SA 4L3CB 1GZQA 1NCNA 4X5WA 5IHBA 4Z78B 3LKQB 3VFTB 1IZJA 2HTKD 3CXHK 4M5YH 5ESQB 3PQYA 5HVGB 3OGOE 3GMOB 3VRIA 2KKQA 4DKFL 1ZSDA 5HHQA 3TCXA 1I1YB 5AD0B 5KSBF 3G5XA 3N1QC 1YDPA 3TNMA 4YHNB 1Z2KA 3O2WL 5IIEA 3MPCA 5CSGA 3SKJH 4FFWD 1ZS8B 4LARH 2QQQA 4P2RE 3SE3C 5IKCA 1AC0A 1T21B 3VFPB 1PG7X 3IJHB 4W6YB 1O0VA 1JNLL 1ZLWH 4NNXA 3RZCA 4PG2C 4XPFL 1BD2B 4N5UA 1UACH 1IM9A 4I3RH 4XRCB 2X1XR 4HWZB 2BZDA 4IOIA 3DX9B 4NDMA 3WLWD 5DJCB 5KOMC 1YNKH 3NFNA 4X6DE 5K9OA 1XGQB 4CU6A 4QYOB 4X6DB 4YQXL 4TNWK 3M07A 1QFWH 4QHMA 5ESAA 5JUEH 5LCVL 4ONOA 1RV6X 2VLKA 2C4FU 3ARYA 5JHLL 4NJ9L 4QXGH 2WAHA 1QSFB 1MHHA 4XB8A 2G75A 1PYWB 3VE0B 3U30B 5EUKB 1CGYA 3AY4A 4QNPF 3VXUE 2ERJB 1NCTA 3GBLA 4LGRB 3I75A 2NXYD 2OL3H 2NNAB 2NR6D 2NY0D 5C0AE 3G6DH 1HHKA 1SJEA 1S7RA 4R7DA 4ZSOA 1OGTB 3EDJA 5JPNA 5GGTL 4NYLA 1YEGL 1CTOA 3JWOC 5TGBA 2HWZL 2IH3B 2A73A 4HJ0C 4QCIB 5FM8A 1S7RB 3CNKA 1CU4L 3NH7L 4QTIH 4NUJA 1IAIH 4M6OL 3MLYH 4LLDB 1ZLWK 3E6FB 3EYOB 1NKRA 4XCYA 4OCXH 1I1AA 3LKSB 1T1YB 2L7JA 5J9PB 1KYOJ 2LVEA 3QEUA 4YHOH 1Q1JL 1IGML 3SDCD 3FMGL 5GS1C 3GJEB 3ECBB 3UX9B 3RWJB 1DBKL 3VD7A 1MJ7L 2AEIT 3EOAB 2P42B 4YDKH 1UFUA 3MCLH 1WIOA 1NLBH 3MRKA 4XB7A 5KVEL 5FYJL 4NHUA 3M8OL 5CBAA 3HPLB 1ZGLA 3L5WA 3HFMH 3MJ8A 5DRNA 3QDGE 2W9EL 3BEWA 2FHFA 3O0RL 4LHUD 3EYUH 3BQUC 1JTPA 1OWWA 3BEVB 4Z7UB 2W91A 4L4TE 1AR1D 5C07E 3I75B 3FN0H 4O5LH 3G9AB 1JF1A 2YS4A 1BOGB 5DWUH 5DUMH 5ID1A 4Z7OE 3RPIB 1NBYB 1NQBA 3QDJE 3LKOB 1LE9A 2CR3A 3RWDB 4NWUL 1YEFL 4R8WH 2CUMA 1B0RB 1WWWX 5BW7A 3KJ6L 1FC1A 5FGCB 4W68A 5IROA 4E41A 1A1NB 3VCLB 4IDJH 4OLZL 1PG7W 1I75A 1WBYA 4YUEL 3TCLB 4OLYH 5C1MB 5A16A 2D0FA 3MRHA 2VRAA 1KGCE 5HDQL 4HMDA 2KH2B 1CXKA 4I77H 4LEOB 1AKJA 3RZCC 4R9HA 1MRDL 1OTUD 4MJIE 4R8WL 2DM2A 4AG4H 3MMEA 5E6IA 3QIWD 4PB9H 1UADC 3BPLB 1JWSA 1C5DA 3L5IA 5SWSB 2DQTH 4YNYB 5GIRA 1PEZA 1UG9A 3VRJB 1H9VA 1CDJA 4CNIB 3PHSA 1HOCB 4O2CA 5CP7A 1CLYH 4DAGH 3DO3A 4G9DA 1FO0L 3QUYC 2X4TB 2FCBA 3SE8L 4JJHA 4I3SL 4P2QA 4X99B 4MD4A 5TH2B 1FH5H 4E9LA 2LTQC 4JB9L 1N26A 5F21B 4P3CL 4X5WB 4HPOL 5KTEH 3MUGB 4V1DE 1PZUB 2W65A 1JNHB 4N0CD 1G7QA 3ECBA 3LD8B 3VFVA 1RFDH 4HX1A 2P47B 5CINL 5DD3L 3BT2L 1G7MA 3MZTA 1CFNB 2DJUA 4GKSA 4LQFH 1BBJB 4GW1B 3RPIA 5DJAA 5BQ7A 2PTTA 1UVQB 1X5YA 4IS6B 3KHOA 4F58H 1G6RH 2FJFA 3BESR 2A0LD 3UTTB 1ZLUK 1P1ZB 1RUKH 4G80A 2ADGA 4JM2A 1UVQA 5AYUL 1WBZA 3ROOB 1PQZA 3SDYL 2DI7A 4LHUG 1RIVL 5HYSA 4P59L 3KPNA 1J86A 2R0WL 2VISA 4K07A 2V7HA 4U6XB 4XP5H 4FG6C 2F5AL 2CGRL 3HE6A 5FCUL 3H9HA 4RISH 1BX2A 5E2UL 2E9WA 3OG4B 3MLSH 3U6RA 3P0VH 4M9OA 2OZ4A 4ELMF 1ZTXH 5E94A 5I2IB 1ACYH 2AJYH 2BNUA 2QEJA 1YC7A 3MFGB 4EXPX 4PJ5A 1T3FB 4U7KA 2H6PA 2EDQA 5KSVA 4N0RA 4UBDD 3TN0C 3L9RA 2NY4D 4XPFH 4ZDHB 4AYFA 4APQB 3IJSA 4JZJA 2P46B 3WIIL 3MMEB 2J88L 2FGWL 3GMPA 4WFGE 1EUUA 4TTDD 3S5LA 1F4WL 5TPWH 3W9EB 2ATKB 3HCVA 1RFDL 4XGZA 5CINH 4IIQA 5GHWL 4OGAC 3UYPA 3CIQA 2Y06H 3SN6N 4LBEB 4M5YL 1ZHBA 1S8DA 4AM0B 1KF9B 2D7PA 3RWCA 3UPCA 1T83C 4FQXB 4RFNB 5J1AB 3LKQA 1TETL 1A9EB 2RBLA 4H26B 3VMOA 2DN7A 3L3KB 4EOWH 1Q0YL 3HCVB 2QQNH 3QG6B 3MV9E 5CUSH 4KROC 2X4SA 3CUPA 5DJYB 3MXWH 1MAML 4YDJB 2D4DA 2YKLL 3QO1A 4LU5H 4YIQB 2YPVH 5E8DH 4PGZA 5EOTB 1JNNL 4YHZL 1DDHB 1OP9A 4YLQT 5KVMC 4XP6H 1ITCA 4HK3N 5C08A 1T0MB 2J6EL 4BZYA 5EG6C 3CFEA 2BVOB 4O2FB 2DYPB 1RUAH 3HLAA 4HHAA 3VJ6A 3FQRA 3X14A 2NY4B 3KXFA 3F58H 2VL5B 2VZVA 3QO1B 3MJGX 4HWZA 4YIQA 4APQD 15C8L 3P40A 4L8SC 4S0TD 5HHPB 4IRSA 3W11C 2AV7B 2X09A 3LEYH 5IOPB 5IBTL 5DUPH 1MCPH 1MCJA 4EI5A 3QUYA 3O4LE 4JY5H 2KZ1B 3NPSC 2NW3A 5KVGH 4F33A 1TNMA 2ZCHH 3NCJL 1YNTA 4TQEL 4QHKI 4GRWB 4WFHD 2Z92A 3TWCH 4J3UA 5FA3B 4X0KB 4GRMB 1EFXB 4IRJC 5BVPL 2Y07H 1D3CA 1GGIL 4FZ8H 1WGOA 1F4YL 1BIIA 4XHJC 5EZLA 1B3JA 5JHDE 1W72A 4O02H 1FE8L 1XGRA 1JHTA 1I1AD 2Q1EA 4KZDH 2P7TB 2NW2B 4LOUD 4RAHA 1B9ZA 1WT5A 5K33A 5CCKL 1CBVH 5DD0L 3SPVA 5C07A 5J0BA 3QG6A 4KMTL 3RA7L 1NAMA 1UXSB 2HJKB 3L5XH 1E6OL 2DB8A 4U2ZA 2JJVA 5D5MF 1RJLA 2C1PA 2H26A 5CGYD 2CDFA 4X80L 2CDEB 2G2RA 4YPGB 5AUMA 4OTXL 1NFKA 1K8DB 4HCRA 3KPLB 1DDHA 3HC3H 4P48A 5ICXB 1V7ML 2P5EA 2D31B 5K9QI 3HZYA 2X4TA 4TRPH 2FX8H 3HE6D 3QCUH 5DMGD 1KCSH 3QDMD 5EC1B 4GH7B 4YHMH 4HS3A 4XX1G 3MNVB 4LPTA 3G08B 3T08A 3RJDA 3PDDA 1NEZG 4YXKL 3RWCB 4ALAL 1RUPL 3IDIB 4LNVA 5GRJL 3MLPA 5L2KB 1AQKL 5IFHH 3T3PF 3WFZA 4TUOB 2EH7L 3NCMA 1H0DB 4NQSA 1NBZA 2ZCHL 3L5WB 3OWEA 2MKLC 4GW1A 5HHXH 4N5ED 4R0LB 1DJSA 5MEPA 5FDWA 3BZEB 3IXAB 4JZJC 4OCLC 2PNDA 2CRZA 5IMMA 3FN9A 3RVTD 3SDDC 4DFHA 2VLME 4DKEL 1QR1A 1BFOB 4M43H 1EK3A 3TA3C 3T0EE 5F7HA 3GIZH 1X4ZA 1D5MB 1A7RL 4XBGB 1JE6A 3MRCA 3DRTB 2VLJB 3QIWA 3RVVC 1RUAL 3GMRA 3REVB 4ELMA 4NN5B 4QRSA 1BF8A 3CH1B 1BFSA 4QRTA 3ZTJG 3TFKC 2ADIA 2BSSB 5JQ6H 2WUBL 3EFDH 3DI3B 2CDFB 3HE6B 1JI2A 1H15A 3KJ4B 4OZ4B 1UA6H 2H9GA 3QDMB 2I9LB 2ZPKH 5IW6A 4L4JA 3ZDZE 4QTHB 1U58A 3VXRB 2BK8A 3BP5A 1CDUA 1LEIB 3HPJA 4DWHA 5IB4B 4PJHA 3RKDC 4U3XA 2AJXL 3BD5A 2Q8AH 3F65A 2NW2A 4X4YA 1TQCB 3X11B 1X5AA 1I3RB 3OKMA 5DHVH 4LSDA 1U3YA 4RGOL 3VFOA 4AY0A 1YEJL 4LPWA 5IK3A 1KIRB 3W39B 2W59A 2EYTA 3BW9B 4YBHA 3JV4A 3QNZB 3SEPA 1WBYB 2NCMA 4LARL 4CBPA 4DVBA 4K3EL 1U2CA 3U4EA 3QCVH 2NX5B 3PHOB 3DOSA 4L8DA 2YPKB 1NLDL 3CH8A 2O5XL 3TZVC 2FX8L 3R0NA 4FFWC 1VENA 4ORZC 4KRMB 4PRBB 4W4OA 4XCCL 4M62L 3QWQB 2ZUQB 5BZDA 4DK3A 2BSRA 3B2VH 1X44A 1MI5A 3QUMB 3U48A 5KW9L 4ZFZB 2VDPL 3OR6A 2OK0L 1WIUA 3V6BR 1X5GA 1JF5A 5TGBB 3ZYZA 4MNQD 1OAQH 3Q5OA 3LQMA 1KN2H 1MFBL 3O4LD 4I1NB 1FZMA 2G5RA 2OL3B 3EYFB 4BQ9A 1GJIA 4A2LA 1DQLH 5CKGA 5F8RC 4WI9A 3QDAA 1GOHA 3SBWC 5GIRB 3NABH 2D9CA 5IMLB 2PXYD 3QR2A 5DMKB 4UT9L 1IGFL 5DEZA 1W2KT 3GSOA 4Y4KC 4Y16B 5DYOB 5EORH 2CRYA 5KN5A 1P7QD 2JK5A 1YQ2A 2FWOB 2NX5D 2FX9H 3ARDD 3MRHB 2OR7A 4MAYC 3SDAC 5KSAD 4UDUB 1WZLA 1TZIB 4LVHC 1FJ1A 4D9QD 1K8IB 4FQHA 3AUVA 5JZ7C 1V3JA 3O6LH 3PGCB 2K7QA 1AXSB 3ZDXE 3I50H 3LEYL 4UQ2B 5I1IL 1CD1A 3H7BA 5E9DB 3G5VA 5DD3H 5MEQA 4N8PA 5CGTA 2I27N 3P0GB 3LH2H 1MLBA 3ZE1E 2Z35B 4YBQC 2DMKA 1D9KA 1ES0B 3G9VA 4NUGL 1FZOB 1BBDL 4NC0B 3V0AC 4LQ1A 3O4LB 1FLRH 4OB5L 3UTTA 3M1BA 3HR5B 5GS3A 4UQ3A 2H3NA 3IDMA 4BM7A 3A6BH 1KB5H 4MQTB 3DYPA 3HMWL 3MXWL 1F6AB 4H5SB 4LCWB 3VFMA 1F4XL 1EJ6A 1NDMB 3CZJA 4NN7C 5C6PB 5EIIA 2P43B 4YR6A 1TZHA 2ZJSL 1ZLSL 1OTUC 4ZAKC 1T04A 1OAKH 4JY4A 3QIWC 4XVSH 1MIEH 4N8VG 5GGUA 3ULVF 2A83A 1DSFH 3O9WA 1UCBL 5F8QC 1W0YT 3OJMB 4HK0B 3PDOA 3MBXH 3DV6B 4K3JL 4XXDA 2UV3A 2WBJA 4YUEH 2W1NA 5I71B 4J1UB 2Y1VA 4RAVB 1CGUA 1K3ZA 4ODWA 1I7TA 3KWWA 5DDHB 1ORSB 3TT1L 5DJAB 3K8KA 3MBEA 3BYYA 3WD5H 4LDEB 1SYVA 5IMKA 2V17H 4XNQA 3E8UL 4JO2L 1D6EB 1FIEA 1KLUB 2WP3O 3FN0L 1R3KB 4XNZC 3ULSB 2V5MA 1I1YA 1I1FB 4ODWB 1AKJD 3QCTL 4YZFF 1T22B 3PL6B 5I1EL 3D85D 5IHLB 3HRZB 2AXHA 3NFSL 4JG1H 2XTJD 3ARTA 4X4ZA 3UTOA 3S98A 3TH4T 5K9OB 1JYWA 3E3QC 5LGJB 3GJFA 5F7UA 5IW1A 3NN8A 4PJHE 4MQSB 3RL1A 1I8KA 4Z7UF 4EDXA 2W0FA 3PL6A 1EFQA 3WN5A 4F7TB 5EOTA 1J05B 2J12B 3UPRB 3FL7A 5EIIB 5EZJB 4I0PB 1CDIA 5DRZA 3SQOH 5E03A 1N6UA 3GO1L 4K7FB 4P2RA 5HYIA 5CD3B 4HIIB 2NTFA 2VAAA 3FB5A 4KKCD 3H9SB 4BZ2H 4PJIF 1ZXQA 2H3NB 2BVQB 3VGEA 4QRQB 1XZ0B 1WZMA 2G2RB 4U1JA 1PAMA 3MLRH 4E41E 3UZVB 3HS0B 1GGUA 1X7QB 3DRQB 1MJJA 1IEHA 1FVDB 1Q8MA 1LK2B 3ZT7A 3ARFD 4Y2DD 3WJLA 4NM4L 3QFJA 5EU3B 3U0TA 4EUPB 5C6TH 2DYPA 5EBLA 4JO2H 3EFDL 4GRWF 1JGVL 1QQDB 1UZ6E 3VFMB 4Y0GA 5GS0D 5DMYA 4OCRL 2CDEA 5AUMB 3FQNA 3ULUE 1KCUH 3QUZD 2ZSWA 3HUJA 1U8QA 4OLXL 5JHDB 5EOCL 2DJSA 1JFQH 2IPTH 3D39A 5HDOA 1MRDH 4U33A 5DJ2A 4WTXA 4L4TD 3VFWB 3GFUA 2IBGA 5IF0B 3IJHA 4V2BA 2WM0A 1AO7E 2P8MB 1DN0A 3UO1L 4JHAL 3VXNB 1F90H 1K4CB 2XN9B 5KS9F 5L2JB 1FRGH 5GGQL 1IL1A 1A8JH 4R2GB 3QQ9C 4U7SA 2X10A 1T1XB 1HWHB 5F70A 3T1FB 4F57L 5JW4R 2Z31A 2HLFC 2BMKA 5KVFH 2VUYA 4H8WL 4LKCB 4OGZA 5F9WB 2EH7H 2FJHB 3BZFA 3GMOA 3MROB 3Q3GB 4LLDA 4JHWL 4PY7B 5J1TC 3CXDL 3MZGB 2VTFA 3PWLA 1PEWA 3MTRA 1VPOH 1D6EA 1KLUA 1TTFA 3CDGA 1OAZH 2YD6A 5GSRB 5CFHA 2XYCA 3HA0A 1P2CA 1IKFL 2VOTA 3LDBC 2R0KL 4OLVH 1OP3H 3X3FL 3C5SB 1U8OA 5K9JH 5FF6B 1MHEA 3FB8B 4YDIH 1UWXH 4ODXB 5JHDD 5KS9E 4PJBE 1U9KA 2YN3A 1RVFL 2XZCH 3IFPA 3MV9B 1OLLA 4CMHB 2PW1A 3ULVH 2AKRA 5SX4H 3MRLB 1YJDC 1BMGA 1TZGH 2BVUA 3KNBB 1BZ7A 3FO1A 4NP4H 1YYLH 5ECJE 3QULA 4IOSD 4KVNH 1FG9C 2E6PA 2AV1B 3QDGB 4R4FL 4WU5A 3MO1B 5EOQH 4B53A 4FQPA 4JLRB 2UZYB 2X44D 1E0OB 4HCRH 4XPAL 5IB2B 3RHWF 3PGFH 3JBG7 2VDLL 3VFTA 1GGIH 4FZ8L 2B2XL 2PR4L 5BVPH 4LLYA 2GT9A 3WHXA 3C9NB 4JFXA 2X4UB 1HNFA 1JPTL 5E6IC 3KPMA 4N0YL 1IGYA 2FNBA 3VRLE 4UAOC 4FXGB 3ARDA 2Y36H 1J8KA 2D2OA 1IC7H 4HX1B 4NN6C 4LLWA 2DL9A 3FHAA 4AMKL 1JK8A 4W4OC 3NPSB 5CD5D 2CK0H 5FGBA 3PJSB 2XWBB 3AVEA 1I85C 3MV9D 5C9KA 4FXGA 5GRVK 4ONGL 1OAYL 3WL9B 1TZGL 1HDMB 1QSFD 5FKPB 2DI8A 2DQFA 2B5IB 1HCFX 3F7YA 4HIEB 2JKXA 3LHPL 3VXSD 3C5ZA 2BX5A 1DLHA 3O6FB 5JA8B 1HZHH 1L0XA 4CN4A 4NBYB 2E7LC 4L1DA 3OKYA 3LKRA 5D5MA 4FQJL 4WHDA 3TIDA 2CIIA 3D0LB 5EZIL 3F6IA 3FQWB 5AG8A 1YYLL 3DIFA 1OPGH 1VACA 4UOW0 4HXAL 4JFQB 5MEOB 4WJ5A 2X05A 4AT6B 1MEXL 5SX5K 4LCCB 3C5JA 2Q8AL 1UC6A 3U4BH 4RZCA 2Z91B 2F19L 3HMXH 4V1DB 2LAGB 3VXRE 1A3RH 5BS0D 1QLRB 1IAII 3WLWC 2KPNA 1X5ZA 4GW4B 2A6JA 1CXHA 5TPWL 1H8NA 1CFSB 5D1XC 3DXAA 4B0MM 3O6KH 2LU3A 5CZKA 1CDGA 4EQ3A 2R0KH 3BRDA 5ID1B 4LLQB 4DKFH 1KPRA 5DRWB 5B8CC 4YHLL 2AV1A 2VLJE 5C70A 3ME0A 5HYSB 3OKLB 3CMGA 4JO1L 2DIJA 2HTKC 2P5WB 4PJGB 4G9FE 2QQKL 2AJYL 5A3ID 1A7OL 4KV5E 4F57H 4M1GL 1NEZB 2DMBA 1HINL 5ADOH 4BSWB 2EIZA 3DSFH 1KPVA 1FPTH 3UO1H 5DEFA 3VD9A 2C7UA 1EGJH 2WMPA 1KTLA 2Z8RA 6FABH 1BIHA 5KAQG 4NQCE 4QRPD 4P2QE 1U8IB 4JY4B 4YE4H 3FAWA 4GAYB 3EFFA 4V1DD 2QLVB 1N2RA 3WHXB 2M26A 3HB3C 5GPRA 3CU7A 3HLAB 3VJ6B 5BS0B 5C0CD 5F6IB 3BAEL 4JN2A 4JPVL 1T2QH 2WBKA 4NZUH 4AIZB 4IBLT 1T22A 5I74B 1AJ7H 4HWEL 1Q9KA 2WWMD 1U36A 1OLZA 3S35L 1QBLL 2VR5A 1D5IH 5DD5L 3B9AA 3P77A 4HWBL 1AI1H 4PJDB 4MXQD 1DEEB 4PJBF 2UY7A 3EDEA 4LIQL 1QFPA 5T1LB 3MRKB 1RU9L 1PQZB 1V7NH 3R1GL 3DETC 5CJXC 5D2LB 1QR1B 3AS2A 1N5AB 3JWNC 3WSQH 1KJ2B 2EDTA 2EEBA 1SY6H 2ATPA 2XKUA 3QJHA 2W60A 1XGTB 3B3IA 2EIBA 4KK5D 3H7BB 4WTZG 4EI6A 5TFSL 1LEGA 1TMCB 2P5ED 4M7JH 4U6YA 3SKNB 2ICWB 3IETB 3OTTA 1MNUH 2MFNA 3D0VA 3DJ9A 3SDAB 3TGXA 4CAGA 1FE8H 4JJ5A 4LIQH 4YC2B 2GSIB 2XZAH 5TDOA 3U0PB 3HI5L 1YYML 2DBLL 1M7IB 1J8HA 4MZ2A 2OSLA 1U92A 4HT1L 2Y5TB 4ZDHA 4JM4H 4MDJA 3MSPA 5EH1A 1I9RH 4Z7NF 4GRMA 4H20L 5JW4Q 4LFHD 1I8LC 3FO1B 4MMXC 3HG1E 5GJSH 3HE7A 1G84A 1K2DB 3NCYS 5GS2H 1YPZA 3STZA 4P5MA 5L88L 3U6RB 4Q9RH 3GHBL 3TVMC 3VMPA 3W39A 2NNAA 5DF0A 3PNWA 4LBEA 5IQ9B 4B41A 3SE4C 1QFWM 1C12B 1LD9A 1UZ6F 2HJKA 5IEKA 5T3ZL 2DQGL 1YMMB 5IB3A 1NMCB 3O81A 3KPRE 5HVHC 4Y19D 1PZ5A 1J9CT 2ZG2A 5DRZB 4BELD 2FL5B 5JOPE 4M02A 5L8KB 4WDIB 2H2SC 4NQDE 1M05A 4XNUH 4JPKL 4PJDA 5CLWA 1S3KH 1V5JA 2X6MA 3FONB 5T1KB 3FT4B 4IRSD 2UY6A 5EZLB 3IKCB 4IRZL 3WNPA 4HPYH 5FB8A 3V2AR 2QHRH 3RNKB 4XP1L 1JVKA 3SDAD 5E8DL 4KUZH 4OM1L 3UTQB 1KC5H 4JRXA 4GAGH 1DQDH 3KDMB 5I15L 5HDBE 2PO6C 4WEUD 3A6BL 1DUZA 4GUPA 2M8XA 3EYSH 2IANA 1HI6B 4U3HA 4P2OC 3GUTA 1FVDA 5DZOA 1UGNA 2PETA 4Q9BA 4U6TA 5F7EH 6CGTA 4NFBA 2HN7A 4KK8C 1WEJH 2IMNA 3BP6A 4NQED 3L3KA 2BRRL 3DV4B 4R7NA 4XWGH 5DHVA 1ZLSH 4V2CB 3WLBB 1M7IA 3OAYH 5I1LA 4S1RH 5EU6D 4DGVH 5T5NG 2LVCA 3QEQE 3BGFB 4LSTH 5FOBB 5C0BD 1P84K 1OF2A 4LAQH 5AD0A 1EA9C 3MJ8B 4QRRE 3BKJL 3MV7D 1H15B 3CFCL 5DO2C 4GQPH 1MVUB 5D7LA 3T0VA 3ZKNC 2NZIA 3LMJH 2ADJA 2JELH 4L4VD 2ZCLH 2ARWA 1ZHKA 3QH3A 2VUOA 4MNHA 1BWMA 5ANME 3ILQC 4XNUL 5EU7E 1DQQB 2DI9A 3MYJA 5T1KD 4H88L 4QO1A 4JANB 1LK2A 2VJXA 3QBTB 3UBXG 1D9KC 3ZTJH 1Q9LA 2YN5A 1IILE 4CVUA 4D0BA 4NQXB 5IUSA 3IXTA 1QLFA 3CCHB 2W07A 3K2MC 3MCG1 4XVTH 5F7WC 5CJBA 2GFBB 1EHLL 5EPMA 3VXOA 4Y4HC 3RNKA 1RUQL 2AVGA 2E9JA 5FYKE 2C5DC 5F3HA 4M5ZL 5HYQB 2VDOH 4X98B 3NGBC 4WFEE 1U8JA 1RJYB 4AEHL 3HZMB 3TP4A 5FYKH 3VGGA 4IDLA 5JOPD 4JM4L 4JFFB 3MNZB 1MI5B 4KXZH 4GT7A 3KYKL 2F53A 1QRND 3MJ9L 4HUNB 1AR1C 1XF5B 4HXBL 1JWSB 4C59B 2V2TB 4WU5B 4NJ9H 2KL6A 2EEDA 2NY5C 1DE4A 5KSVB 3MV7B 5JUEL 4DGYH 4PRBA 1HHIA 4YHIA 1S7SA 2PYED 4HK0A 4U4BA 3IU3A 4CN6A 1HDMA 3WFHA 3WMSA 4FFYH 2HRPH 4UIKL 4HPOH 2G60L 4PLJC 2IBZX 1MRFH 1K4CA 2XN9A 4I2XE 1BVKA 4P46C 3EJZD 1MY7A 5BV7H 1NAMH 2VO5A 1MF2H 3BN9D 3G6AA 2PW2A 2EDRA 1P4LA 4HV8A 5HHOB 3TLRA 2IJ0C 2VSDA 5FO8B 4MDIB 4QYOA 5F1KC 2BVPB 3MFFB 4KKCC 1SEQL 3WNOA 1EGJA 1I1AB 3ARVA 5IP4A 4WHTA 5EZOL 3N85H 1OHQA 4JPVH 4F7EB 1KPUA 4K3DH 1CLCA 5I8OH 3KR3L 1KNOA 1NFDB 3PV6A 5D2NE 2F74A 2VDQL 4AG4L 4PJ8C 2QADD 2DTSA 4XMKH 4XVUC 3UDWA 2Z8VC 3LS4L 3FAXA 3PWNA 3BH8A 1OTTD 1T1XA 2Z35A 1MREL 4JHWH 1KB9J 3TBWB 1AGDA 5EO9B 3QG7H 3W11D 5I1LB 4F33B 2RHEA 5D7LE 3BP5B 5L8LB 5T1DL 4Y2DC 5F9JA 4Q9QH 1PW3A 2EDEA 4NT6B 5DR5H 3HUJF 2FEDD 4IRJB 5ADOL 2YEZB 3P4NB 1FRGL 4LSPH 2EH8H 3GJEA 4PJ9B 3EGSA 5D9SB 5A16B 1DLHB 3O6FA 4PJFF 4HJGB 2O93L 5EN2A 4KY1H 3E3QE 5HVFB 3ES6A 1MREH 1ETZB 4K9EH 4BSVB 1MHEB 2YUVA 2ZUSA 1MFEH 1CXEA 1D5ZB 1U8MB 3WXWL 2RFXA 4KK6C 5L2KD 4RMVA 4PJAF 5HHOD 4OI8A 4LSQL 4DK6A 3NA9H 5E8PB 3ARED 2D7QA 3IU4H 1N6QH 2MWCA 3MGOB 3AM8A 2XQYG 5EBMB 4LDLB 4D3CL 3ALXA 2Y72A 3TNNB 1G0DA 5IGXL 5JR1H 3BKCL 4HLJA 5D7LD 4Z9KB 1KELH 1BOYA 1MF2L 3RQ3A 3TBSB 4LNRA 5TJWK 4AEIL 2IBBA 5B39G 1L7TH 5J06A 4UOW1 2EXYD 2YD9A 1D6VH 3DYMA 4APQC 3KLAB 1MI5E 3OXSB 5H37G 5IB2A 4TSCL 2PCPA 3MLRL 2GJZB 4MAYA 4P9HC 4Z7NE 1AC6A 2A6DA 1ZVHA 3OZ9H 3EOBA 2IGFH 4G8EA 4NZJA 5CS7A 1NJ9B 4HKJB 4ODTH 4NN6B 3LN5B 5DK0A 3T2QA 1CN4A 5DFTA 4X9BA 4U1NB 5JXAL 3VXRD 3MRNB 3SDXE 3NIFE 2BXZA 2ADFH 2R56H 3ZDZF 2F8VA 3DURB 3RWEB 3V6OC 4M8QA 4CVZB 4R0LA 3MRRB 4XT1C 2P1YA 2BNRA 2XI9A 4GJTB 3MRIB 4TTDC 3WFEH 4P49A 3O6MH 4HBCH 3O2VH 2BCKA 3NACH 3PWUA 4ZOEA 1J0KA 3OPZH 5JR1L 3Q6FA 1QYGL 2XRAH 5CHNA 5F89A 5DUPL 5F7LB 1LP9B 5EBWB 3V7MA 1KPRB 3CSBA 2YBRA 3IFLL 2Q3ZA 4O02L 2QQLL 5I1EH 3QI9A 2APTA 1C08B 1UEMA 5E2WL 1NPUA 3CFDB 2H32A 5GGVH 1JPTH 3QPQC 2BVTA 4LPCA 1RIHH 2RJMA 4KVCH 3VA2C 3N50A 3EJJX 4GQ9H 3ILPB 1QSFE 4DVBB 2EDXA 3MREB 4ZFOB 1D5MA 1YUHB 2ZCLL 4TQEH 2AK1L 3L3DA 4MNQB 3MV8E 4KI1A 3FRPG 2FJFB 1QSFA 3S34H 4F37K 2X4OA 5JORB 3RY6A 2BNRD 3X11A 4OBSA 1J8HB 3JWOH 3R06A 2VH5L 4LVEA 1U3HA 1U8LA 3QAZC 4PJ7B 3MRJA 4G8IA 2W0FB 4PRID 5TQ0L 1GGBL 3CX2A 1NFDF 2R2EB 5GZOD 3BIKA 5D6CA 1U8JB 2I9LA 5IW6B 2HKFH 4JG0L 2JTDA 4Y88A 2X4OB 3JUZA 1CLZH 1JBJA 1QBBA 1R5WB 1A6UL 2QTEA 3GGWB 5KSBE 3V4UH 3INUH 5J6GA 4L4VE 4P4RA 5F71A 1FNLA 4QY8B 1TJHH 3U46B 3BPNB 4QGTA 3TESA 1CYGA 1G0YR 3LEXB 5EFIB 1HXMA 1M7XA 4GS7C 5D71L 3VDCA 2EYRA 3SE4A 1CDBA 5EOCJ 5CJOL 1AGCA 4OBRA 1OAZL 4M7LH 1N7ML 2MPAL 4OM1H 1M7DA 1KLGA 4LLWB 3BDBA 2NY2B 2DQIH 4EOWL 5E7BA 3L9RB 3DROB 2R9HD 1WCQA 3GBML 4JFZH 5ETUA 3WNLA 5INDA 2DL2A 2W38A 3H42H 4NOFA 1PX3A 4ZS7H 2VLKD 3DV6A 2VL5A 3C5ZC 5B38A 3DX7B 4UT7H 5TQ2L 2DQGH 4WWID 2BNRB 3R8BB 3MFFA 2GAZA 2EECA 1JGEA 2OI9B 3ARGA 5I8KH 4K8RC 2N7AA 4MJ4A 1NCAH 1MCSA 1NGWA 2FEEI 4WU7A 1IFHH 1S7VB 3DETD 4JVWA 4MHHI 3ZL4L 1EX0A 4F8TA 5FYKL 1RUKL 1EBAA 1KCUL 1W0WA 1HK6A 2HH0H 3BQUB 2X4PA 3KPRD 3MRLA 1EJOH 4PJXB 3PWPB 5CBEB 3PNWB 3UJJH 3VWKC 4JZNB 1R3HB 1TXKA 1FG2A 1EHLH 5TE6H 2QR0B 5JW4N 1FBIL 1U8KB 4PJDE 4X6CF 3QDGA 4CVWA 3BT2H 4KDTC 1J1PH 2A6JB 5ID0B 3GIVA 3HZMA 2D0GA 1QSZA 3R06B 1G7JA 5F1IA 1GH7A 5D1XB 4ZS7L 3QEHB 3A67H 2D7TL 3CDCA 4TVPH 1QFOA 3OJ2C 4NO5B 4HJJL 1FH5L 2AXGB 3CDYA 1RU9H 4U0QB 5KZCD 4OD3L 1YPZF 1DP0A 4XCCH 3HC0A 4LFHG 4L8SB 2VN7A 4A6YH 4UQ3B 2MJWA 1OTSD 2QJDA 3HUJE 4XVJL 4EJ1C 1IAKB 4PP1D 5BXFA 3QCVL 1R0AH 5C0BA 5J13B 1SJVA 3IFNH 2YD3A 4PG9A 1LVEA 2V7NA 4M03A 2VQ1A 3I6KA 4W6XB 1MCWM 3BQUD 5JZ7D 4JAMA 5HHPA 5EO0A 1YEJH 3MLUH 1HH9B 5KSAC 1M4KA 3CDFA 4RFNC 1H0DA 4NQSB 5LGHL 1KB5A 3UBXI 1I7TB 3KWWB 5A43C 1FVEB 1IT9L 4P9HL 5E5UB 4EDWH 4UNVA 5DQ9A 4B7LA 1EZVX 5C0FB 1RUMH 2O61A 4XNZB 1BM3L 9CGTA 4EQ2A 3WXVH 4QXUL 5I30L 3RI5K 2X4PB 4PJXA 3H9SD 1FNHA 2V2TA 1GHFH 4HS3B 5C0CE 4LVOB 3ZO0A 4MSWB 1EVTC 1HHGA 2X4SB 4GBXD 1LK3H 1BJ1H 3PP4H 5TDNA 1RIUH 3HZYB 2ZUYA 3OAUH 1OD9A 2XZQL 5LGJA 2DM4A 2AK4A 3QH3B 3BGAA 4OCYL 3GIZL 1NUFA 4PLKD 1JWMA 1V3KA 2L4OA 3MQIA 4PJ9A 3SO3C 2V2XB 5DRXB 5C0BE 3D48R 1IAMA 5BVJB 3PWJB 3HFML 5DO2D 5DK2A 3AS3A 4ESKA 2M2DA 5KVEH 1OF2B 1NAMB 1UXSA 3HNSL 5JXEA 2XKSA 4F2MA 3S37H 4PBVC 3HMXL 4TSAL 2D03L 5IESL 3ULUH 3TBWA 3P9MA 4Y4FA 1KXQE 2JE8A 1BEYL 1XGRB 1AGEA 4LKXB 3V6ZB 1ZHKB 4XXCA 5KG9B 4CMMA 1KJVB 2WK2A 1JHKL 2QHLA 4RGMB 4QRQA 2Q7YB 1I9IL 1C7SA 3TH2T 2XICA 4LHJB 3EO1B 1QA9A 5DT1L 3QEGL 3ARBB 3EYUL 3FFCB 4HWNA 4OB5H 3LQAC 2CRMA 5MHSE 1CVRA 2EE6A 3C5JB 3RWGA 3MGAA 3L5HA 4WENB 2BSTB 2E7MA 5BOPA 4FQ1L 4YR6B 2PF6A 4J4PD 5I1GH 4GAYA 2LQRA 3IFNL 4JO3L 5T1MB 3TT3L 1N59A 4X80H 5L9DH 4YHPA 1R0AL 5E2JA 5GGTH 3ZTNH 2E7HA 3O6LL 4B50A 3PHOA 3BKCH 4YO0B 1AI1L 3L3IA 4HS6A 1QACA 3G6DL 2E7BA 1HE7A 1NAKL 1S5HB 5FUCE 3MV8B 1FNAA 2VXUH 5I1JL 3RU8H 3F7YB 2DM3A 1JJUA 1N8ZB 2VR9A 5LAXB 5KANI 2AJSL 5IVZB 4Z7QE 2BJML 2VZOA 3D18B 4IS6A 3D9AL 3F7PC 1D9KD 4C83B 4JQIL 4QXGL 1MJ8H 3H9ZA 1A6WL 4JKPL 4G5ZH 5L0QB 3MACH 4HCRL 4XPAH 3IDNA 1XR8B 4ORGA 1PSKL 4LCIL 1JPGA 4I48B 5EBGA 3X3GL 5GGRB 3U9UB 3EOTL 5FFLA 1EPFA 3FKUS 2EC9T 3RIFK 4C56B 3GRWH 3TV3H 1E4KA 5ITFA 1S9VB 4LPYA 2Z91A 3LV3B 5CSBA 4FTVD 4HW6A 3GNML 2X4NB 5F7FA 4XNYL 4JO1H 3LKOA 1LE9B 1YMME 1DBAH 2IPKB 1W72L 4HUWA 3RDTA 1NUGA 1JRHL 2FGZA 5CILH 3P4OB 4Z0XB 4Y4FB 4NCC1 3B9KC 5C0JA 5EZOH 5K9JL 3U0PA 5D71H 5DUBA 3MC0A 4EKXA 3X3FH 4UDTA 4HEME 4PRAA 1AIFA 5JLZB 4G6KH 5D7SH 1H3PL 1SQ2N 2ICES 3FB5B 4LEXH 3C9NA 3VXQB 2YPLA 1I7UB 2JIXD 1SMOA 2JCCF 1FAIL 1CICB 4X7FC 1JRHH 4Z7VE 3BX7C 1TCMA 2NY1D 4X6FB 5H2BA 1NAML 1F4HA 3QUMA 3EGSB 4OZGB 4KJWC 4YH6A 4Z18A 4PTUA 3B6SB 4H0GA 3B2UC 4IIQB 1GGBH 4I0PC 2OMNA 4UB0H 1CR9L 3V6OE 1LNUB 2VDKH 5I75B 1XT5A 2A83B 1FAIH 4U1SB 2HP4A 3HI6L 1CDHA 2DQJH 3FCTB 4RWYH 4Y5VB 2EDKA 1T1YA 2BDNH 3D25A 3OV6A 3EHBD 1E28A 4UV4H 3NIGF 2YD7A 3IRZA 3MACL 1KCKA 4YHYC 1A6WH 4AENA 4FTVB 5CGMA 2B1HH 4RNRA 3C60A 3LEVL 5GSVA 2BY2A 5J4MA 5T1KA 1I7RB 2Y25A 1XF1A 2QSVA 4HFUH 1DVFD 5HHME 2HT3D 3ARUA 4HUMB 1QFUL 4PFEA 2JIXA 2YPLD 1C7TA 1JGVH 2FBJL 2MOVA 1G9MH 4O4YH 4D9LL 3P11H 1C12A 1F02I 3S36X 4OCWH 4AMKH 3OKDA 1J88A 5C0AA 5HHXL 1CICD 4Y5YC 2SEBB 4LCIH 1S9WB 4GRLC 1CD8A 1P7KB 3OGCA 1WF5A 3AREA 4G5ZL 4XCYB 3OR7B 4R4NC 1OARH 4FFZL 4XPGL 4K9EC 4KI5F 1KNOB 1NFDA 3PV6B 1AO7A 4FFVC 1YQVH 2VLRA 3L6FB 3ULUF 3H3PL 4LRNH 3QEQA 3UZQA 1ZLUH 1YA5A 2CO7B 3P0YH 4O00A 5E6YA 3TJHD 5FUOL 5DJ6A 1CT8B 4QHNB 1U95A 4NFCA 4ZOAA 4TSCH 3TEUA 1NCDL 2RGSA 3WYRA 1DBML 1N0XL 3M1BB 3VFRA 3RP1A 1V8HA 4PJIA 3DX6A 5IG7B 2ZCKL 2DD8L 3W5NA 2DOCA 4D9RD 1LQSR 1CICA 5HI4C 2IAMB 5L6YL 3IF1A 1UCTA 4NQXA 2I9TA 5C0CB 1A9BA 1A5FL 3RAJH 5DD0H 4PJIE 3Q48A 4ZUSA 2HT4C 3AM8C 4FQ2L 5B22A 4HAGA 4EI5B 4Q74A 1YN6A 4L8BA 3S8WA 1T2XA 4RMUA 1FAKT 1HHJB 2D31A 4AH2A 2IAMA 4QOKB 2Y07L 5I1KL 2F8XC 1JHKH 3G5YB 1CFSA 1U91B 2CKBL 2OTUB 2AS5M 3TO2B 4FQXA 4WI5A 3DPBA 3LB6D 1LO0H 1HSAB 3IYLW 3OKEA 1N4XH 2AXJA 3TBSA 1BJ1J 2C3VA 4H8WH 4HQQL 1T5XB 5ISZA 4Z77A 4AEIH 4FS0A 4U6VL 2R0ZL 1HILB 1F8TH 3RDTC 2X1PA 2AJZA 2EH8L 3WXVL 1U91A 3DROA 1RUML 1U6AL 1A4KB 1UQSA 2C3HA 3W0WD 1A7NL 3D25B 3IU4L 1N6QL 4RGNC 3MBXL 43CAA 1G1CA 3C8DA 1CXIA 1QP1A 5HGDB 3RVWD 5MEPB 2IADA 3QPQD 1VHPA 2XZZA 4XI5D 5GQBA 1YDPB 4YHNA 3HS0A 3OAUL 1MIEL 4Y16C 5F93C 4ZUUA 5J9PA 2BMKB 2NY7H 1HH6B 3O9WC 1A9EA 3V8OA 2OZ4H 5EOCH 4Z5RB 3D39D 3MRBA 4L9LB 4X9IA 3OMZA 4HG4J 5CSZB 1GZQB 2FIKA 4Z7WA 4OV5A 1NCWL 4LSPL 1UM5H 1TTGA 1WUNT 1UWGL 3QAZB 2IFFH 4MNGB 4MXQC 2CLRA 5LBSL 1JYXA 1ULVA 2R0LH 5FK9A 1TPXB 2ZUUA 3VFVB 5F72S 3QI9C 2ICEA 1OQXA 1J05A 1LO3H 1G7LA 3FB6B 4TUJB 4PJXE 4Y19B 5DJ0A 3SKOA 4YZFE 4OFIA 4HHAB 4PGBA 5JW5B 2Q8BL 4U1GB 3VFSA 4MQXD 1II4E 4FFYL 4JFEA 4XMKL 2AJVH 3OXRB 4QXWA 4YDKL 5D7SL 3TIEA 4R2GC 1DBKH 4Z95H 3TF7C 4JFHE 5IW1B 5C7XL 2Z8WC 5SWZA 5JQHC 5ESVB 4QF1A 1F00I 2Q6WB 5CEZH 3N1GC 1TJIL 4HZLB 2N7BA 5TE6L 1MLCB 3A6CL 1MWAA 3TN0B 4NC2B 1Z5LA 4NZUL 3BHBA 3HN3A 1OSZB 4Y4FC 3IDUA 2YXMA 2GCYA 3BAEH 3OKOB 4QTIL 2C3GA 4LPUA 3A67L 4GKOA 5F1SA 4YWGL 1SBSH 4QRSB 3C5ZD 1NGQH 1H5BC 1A4JB 3H9SA 4P5KA 4YGVB 3ZKMC 3BRFA 1RJZA 2OR9H 3MLXL 4IOIB 5E5MB 2I07A 1NCAL 3BWAB 4PIRF 1F4AA 2DQCL 4RISL 5LG1A 1QQDA 5EU5B 2HKHH 4ISVA 2UWEF 1EGJL 5L2JA 3SGDI 1OOAA 1MQ8A 5HGHB 2DLFL 4OUUA 5CP3H 4D9QE 2ORBH 3LOWA 1JZ3A 1L6XA 4H25B 1A2YA 3TBYA 5M95B 5I17B 4TSBH 5JA9A 3BUYB 2HH0L 5DFVD 4R26L 1MPAL 4OLWL 5GRVL 4JFZL 3MOBL 3P4MB 3VXUB 2LTQB 2OI9C 4TVSa 5CP3A 1CGWA 4MAUL 1IEAA 3MYZA 2Z93B 1N7MH 3MA7B 3ZT5A 3S4SA 4JM2D 4P3DA 2OTWB 2AERT 1Y6MR 5E08H 4M93C 4U0RB 4U1NA 4YFDB 5B38B 3V8CA 4MJ5B 2FR4A 1EHAA 1K5NA 4OSUH 3ZSTA 3WUWG 4HFWB 1EO5A 2D7OA 3T0XA 4UT6L 5T3XD 4PJCB 3MCKB 4KK8D 2OMBA 4HUWB 4I3RL 4HGMA 4Y4KA 1BQHA 1LO3L 1IGIL 3GBMH 4ODHL 3MV8A 3MRGA 2ILLA 3C6LD 2R8SH 1GYAA 1FVCA 3O8XD 2CXGA 3RL1B 4XCEB 5E0QA 5I18H 4NQDA 5E95B 3NZHH 1I7ZB 1NCWH 5AZEH 4PGJA 5FHAL 1FJ1B 4HKZA 5LGKA 3Q6GL 2BFVH 3ROLB 1N5YH