2R1WA

Crystal structure of s25-2 fab in complex with kdo analogues
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
216
Chain Sequence
b'DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTITSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSEGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab, antibody fragment (IgG1k), light chain
molecule tags Immune system
publication title Exploration of specificity in germline monoclonal antibody recognition of a range of natural and synthetic epitopes.
pubmed doi rcsb
total genus 49
structure length 216
sequence length 219
ec nomenclature
pdb deposition date 2007-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r1wA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r1wA01
3HZVB 1UG9A 3K46A 2CKNA 3GSNH 4NWUH 4XRCA 1S9XB 3IDYB 4JG0H 3QRFM 1EUUA 1PSKH 5CGYC 4PGDA 3REVB 3SO3B 1U92A 4PJEA 1MUJB 4HAFA 1HINL 1OHQA 2ADJB 4X5XB 3UBXA 1GGIL 4IOFD 4KUZH 4N90D 3RZCC 2EEBA 1A6AA 4HXAH 3BKJH 2EIZA 4HUUA 3NPSB 5SWSD 2FYYA 2X41A 1FNLA 3O6KL 3BD5A 1V3LA 4Q6YA 4Q9QL 3BPOC 4DUXA 4X4XA 1BREA 4BYHA 1OP5K 3K1DA 1CFSB 4UV4L 5EWIH 4MQ7A 1N6UA 3BEWB 5E0QA 4P57B 5T1MB 4S1RL 4EVNA 2WWMC 5GGQL 1JGVL 1OQOA 3UPCA 3GSXB 2PO6C 3FQTB 1D5IL 5CGYD 5FA4A 5E5UB 4NSKA 4KK9C 3VI4E 4HIHB 4JFFA 1AHWB 2PUQT 4FQHB 4WO4B 3PWPD 1LE9B 2MFNA 4HW6A 4XWOD 3QUMH 5IMKA 3CNKA 2H9GB 1XIWA 3ZTJG 3U4EB 4P99A 1VFOA 3C87A 5B4MD 5DZOA 5BOPA 2Y6SD 5CCKL 1HSBB 1RU9L 1YQVH 1JGDB 1T1WA 2ZUYA 2D2OA 5L88H 4LU5L 1INQB 5AUMB 4MWFA 5JXEA 3ARFD 2H2PC 5I30H 2FNBA 1ZTXH 4KK5C 3TNNB 1QP1A 1M7XA 4MAYB 3DX6B 1WZMA 2B0SH 4JRXD 2XTJD 4U1KB 1ZLWH 5DI8A 5IVXE 1QACA 3RWCB 4JHAH 2JJSC 2ZOLB 4M1DL 4HPYL 3MRDA 2EKSB 3W0WE 3CX5K 5K9OB 4GKNA 2FX7H 4OQTL 1CDJA 1DL7L 2R2CA 3DXAB 4G9FD 2CJUL 4I4WB 2GHWB 3GIVA 3W0WB 4YHML 1A9EB 1DTUA 2DICA 3D85A 3QUKA 3M07A 3EJYC 1VEMA 1CU4L 4YFLI 4D8PB 1HIML 4PJXF 1D6EB 3VD9A 1ACZA 4ZYKA 1KEML 4IIQB 1JGUH 3ARFB 4B41A 3VA2C 3QEQE 4PJXB 1X6LA 3EW3B 4J3OC 4HCRA 1IAIL 2C1OB 5IW6B 3GSNL 1G7HA 3HNTH 1TIUA 4NWUL 3AREB 2UZIH 1ZS8B 3H9SB 1GIGH 1KPVA 2QQQA 3MACL 4MHHI 1UWGH 3SOBL 5GGSB 2ZOKB 4OT1L 1WWCA 1FLTX 2V9TA 3C9NB 2W9DL 4Z95L 1IQWH 5LXGL 4NKOB 4U31A 2YS4A 2EXYD 4HGMA 4D0CB 2MQ3A 3LRSB 4R2GC 4OGAD 2D7PA 5C0EB 2VLJB 3RP1A 1YNTA 4P3CL 1RULL 3MRCB 3GMQA 1QNZH 4P59H 3V6FA 4DCQB 3HAEB 1Q9KA 4CU7A 2ZUQB 3MXWH 4JFQB 4YC2C 1E4JA 4MNQE 4LSSL 4MA3A 2BVUA 4Q9BA 4OGYH 5DHXB 2OSLB 3L7FB 5EU7C 1UCBH 3BW9B 3FKUS 1MI5D 1S7SB 2D3VA 2OK0L 1T5XB 1NGQL 1D5BA 1YPZE 1DLHB 4I18B 5EO0B 1YY8B 3KLHC 1CICC 5GGUA 4MNHB 3CH8A 3UTTB 2NY5C 2PO6A 1MHEB 1IC1A 1AGDA 2DI7A 2DLFL 3K0WA 5J8OA 3DRQA 3DETD 5DQ9A 3V4VL 3OX8B 4EEEA 1E6OH 1UWEH 2I26N 1PX4A 2DIAA 2P8PB 3B9KB 1H8SA 5TDPB 3BVNB 1BOYA 3RY5A 4O4YH 2F54B 5AYUH 1AO7A 2GQHA 5HHMD 3TPKA 5HPMA 2VDRH 2DJ4A 4HKJA 4PJAB 4GUPB 4W6YB 4XXDA 1FFOB 2BNRB 4DFIA 5I75B 4U1MA 1YDPB 1TPXB 4UBDC 4NRXB 4P2OC 3ALWA 1J1OL 2OZ4H 3T4AB 2R29H 5DD1L 4D9LH 1DVFA 2EIBA 4BKLA 4MS8C 5EU6D 4OAWB 5IB2A 4WFFD 3MRNA 3KPLB 2P24A 3TCXA 4DVRH 4L8SC 2XZCH 4NO0D 1S78C 4ONFL 2VLKE 4LSUL 3T04D 1JUFB 3ZYOA 4DGIH 3Q6GH 3QNYA 1YEJL 1CN4A 1K9TA 1NANI 5A43C 1DVFC 2FDBP 1P4LB 2NY4D 1MWAL 2GUOB 2VZSA 2GT9A 4WUKH 4IRSA 4BZ1L 5HYQB 3N06B 2DBLH 4L3EB 3VXOA 1HHJB 15C8L 2CRZA 3Q3GB 4PRAB 3OAUL 1A6PA 2E6PA 2VLRE 5D1XC 5H2BB 3VXUE 1J0ZA 3CSPA 5B8CB 2EDDA 5DD3L 2ZUXA 3LVEA 2D7OA 3OAUH 4XMKH 4YPJA 1BZ9B 3S36X 3REWA 5MENB 1K4CA 3VXRD 5BZDA 5EB9A 5F6IC 2BY0A 2BJMH 4K9EC 4JFDD 5GQBA 1T21B 3IGAB 3S35H 3E2HB 2IFFL 3LN4B 4XTRC 5CJBA 3BSZH 1M05A 3LKPA 3NPSC 5ABDE 4FXLA 2P7TB 3G9VA 4ONFH 3LKQA 5BMFL 3U46B 3V9FA 3QI9D 4Y19B 4OZIB 1DUYA 5D70L 4PTTB 3UAJC 3W5NA 2FYYB 3S3PA 4OZIF 4HUMB 2KZWA 3RWGB 4AENA 5J11B 3RBGA 2DTMH 2HN7B 4PRDB 2XACC 2PYEE 1W0WA 3GO1H 3VE0B 1HZHL 2AK4D 1WFTA 2NTFA 4YR6B 1F3RB 1NBZA 4P57A 4IRJB 1D9KC 1MY7A 4GMTH 5K59E 3GNML 5I1HL 4KMTL 5H37H 5SWQB 1TTUA 4D8PA 4AEIL 3IB4A 1FVDA 2O5XL 3KNBA 5H94A 3O2WL 4E41E 3S37L 3F62A 1H15B 5TPWH 3NN8A 5ID1A 4OZHA 1YNKH 3WIIH 4MWFB 1RIVL 1V3JA 2QQNH 1OM3H 1JP5A 1OARL 1YJDL 4R96A 5LCVL 3IJYB 4RNRA 5D1QD 4ZPTB 5FYKL 4OCXL 3QDMD 1U41A 1N8ZA 3FQXA 3MRFB 4UT6H 3SE4C 1XF2A 4IOIA 1FFQA 4Z0BL 4GG6B 1IE5A 4G8IA 4E5XA 3KYKH 5FF6A 4LPWA 2BOBB 1SMOA 4P4RB 2FR4A 1P6AB 4MAYC 1TZIA 2QBWA 3SDCD 3VMNA 2E3VA 4EI5D 2DM3A 3IDGB 1WITA 2OJZH 5TGBA 5C9JA 2Q3ZA 3LEVL 1NAKL 4NRZA 1FNGA 5B22A 4BQ6A 4XCNB 3VRJA 1RZIA 3UZQA 5I1GL 5IQ7H 1P1ZA 4KROD 1VFAB 2CLZA 5GGTL 3BGMB 4AT6A 3OWEA 3RWCA 3L5XH 1SVCP 4JPIB 3IDUA 5DK3A 5FO8A 1I1RA 2YOCA 1R3LA 4JM2D 4PRHB 5HYSG 5DO2C 4R90L 4Y89A 3UO1H 2XTJC 4IDLA 1IM3B 1RK0B 2OJEA 4OF6A 5TE4L 5EZOH 5C0RL 3TIEA 1Q1JH 3CC5A 4QRUA 3UXFA 3SY0A 3OPZH 2H2PD 1H3XA 5CJQL 4Z7WE 3VFMA 5ACZB 4HIXH 1FBIH 3VWKA 4ZS7L 3T8XB 1HOCA 4Y19E 1A6TA 4OZIE 5IVXB 3MRIA 5FM5M 3OAZH 4N0CD 1F3JB 2FIKB 5L0QC 4MSWA 4P9MH 5HHXL 3F7VA 1U8IB 5C08D 5C0GB 3WNKA 3MNZB 2OI9C 4L5FL 4YE4L 2Z31B 3ARPA 3L5HA 4MD0B 3X13A 4UT7L 4JR9H 4I2XB 2IBZY 2EDTA 1JPTL 1WZKA 1DLFL 2R4SL 2YEZA 1JGDA 1DQDH 2VWEE 3GSOA 1Q72H 2UZYB 3QJHB 2Q1EA 4OD1H 3MUGB 3F65A 3W0WD 2ESVB 4NM4H 4ZFOB 1XZ0B 2IPTH 5D5ME 3FFCD 2C1PB 2EEDA 4I18C 4LLVB 1MJ8L 2W0FB 2F19H 4RA3A 2AXFA 2ZPKH 3EZJB 3V7MA 4P4KA 1OAXH 4HT1H 3FQRB 2Y5TA 1T7VA 5CMAA 3TBWB 5HD8C 1MEXL 3IFPA 3O4LE 3O4OC 4HIEB 1CFQA 3BYTA 1G7IA 2CIKA 2I9TA 1UJ3B 1K3ZA 5C8JA 3L9RA 1ZANL 3PWLB 3DUHA 2HRLA 3RHWF 4M4PA 4D94A 3N85L 1T0NA 1NFDB 2CMRL 3GGWB 4X9BA 1CXHA 1KEGL 1VGEH 2ICWA 3RHWK 3CVHA 1IJ9A 5F1NA 2XZCL 1DSFL 5JW4Q 1G7PA 3QFDB 2ADGB 3GB7A 4XC3H 1P4BH 2XFXA 2W65B 1NMBL 4HK3J 1IGYA 4UV4H 3FOLB 2WIIB 1K8DB 3MNWA 4L4JA 4ZTPH 1DQQB 4JFZL 3FMGH 4G43B 1HWHB 1MI5E 3F7VB 3ULUF 1J05A 5D7KE 1ZGLM 3RRQA 3EYOA 2V2WB 4RFOH 2WW8A 5I6XC 2BNQB 4WVRA 4DVBA 3N1PC 2GTWA 4YNYB 3BEVB 5D6CB 4KGJA 5E8DH 1KCUH 2P8LA 4LLQB 4ZO7A 5CP7B 3MCKB 4L8CA 2E7LC 2P5EB 1BOGA 2IG2H 5I17B 2OXHA 4KKBD 3RKPA 4FQXC 1KCVL 3VFUA 4HIIA 3SDXE 3GSNA 5MEQA 1ACYH 3CSBA 1CZ8L 1F4XH 1QLRB 3QPXH 4DK6A 1SJHA 3BDYH 5FO8B 3CFDB 4GJTB 5FHAH 3NCMA 4NN5C 1L9NA 3D5OF 3UTTD 3VE0A 5ERWB 5IEHB 4DAGL 3O8XA 3DECA 2YBRB 4GXUM 4KJYA 2P45B 5HD8D 5B21A 2GYSA 1J1XL 2FZ3A 1ZHNA 2OR7A 2GK0A 1UEMA 3CCHA 2E8ZA 3M45A 3CDGA 2WAHA 2PTTB 5CBAA 3VXSB 2B5IC 3T0DA 3OKMA 2YPVL 3GMOB 4P46A 3W5MA 2X6MA 1ULVA 4JREC 5E9DE 4POZC 2AJZA 5KW9H 3RWHA 1NSNL 4O2CA 3MRCA 1G1YA 1ZTXL 2XY2A 1RUKH 1JVKA 2AV1B 3VMPA 2P24B 1DLFH 3OGCA 3WV0A 3E3QE 1V05A 3AROA 1QFUL 3AS2A 4C55A 3GHEH 3DI3B 4KQ3L 1ZOXA 3H7LA 4OIBA 4CMMB 1QSEA 1WIOA 2BVPA 2XWTB 4FZEL 3W2DL 4LKXB 1JMZA 4LQFL 1ZGLP 1RIUH 1T1ZB 2AI0L 3IJYA 4RNRB 5IK3A 3P0VL 4JQXC 1P1ZB 1WUNT 3O6LH 1ED3A 4CMMA 4F8QA 1G6RA 1I7TA 1SY6H 2L7JA 3IFOA 1CR9H 1BM3H 5DVKA 5C0CA 2R2BA 1FCGA 3Q2CA 1V7NH 3IKCA 3BW9A 3WHE1 3SBWA 1SJVA 3DRQB 4JY4B 4DEPB 3Q5YA 3KS0J 4E42A 4LCWD 4JPWH 3OKKB 1MAKA 3QDJD 1AJ7H 5EPMB 3SDYH 2EKSA 4OZGE 4QWWC 3LEYL 2NW3B 3UDWC 2BSTA 1EHLH 1OP3K 4ZXBD 2CGRH 4PBVC 3MLYH 4AIZB 2NY6B 4KY1L 3OKKA 1EXUA 1ZA3B 4PFEA 3WFEL 1A2YA 4V1DD 1SEBB 3EJZD 4FQLH 1AR2A 2OLDA 3O9WA 3HRPA 4PRHE 4YDKL 4KRPB 2ZG2A 4GW4B 3MV7E 1AH1A 1DBJL 1CVSC 1NC4B 1TLKA 4LF3A 2HTLD 2LU3A 4FQXA 4JG0L 4PGCB 3TBYA 4OCXH 1JUFA 4ODSL 3I84A 3MUJA 4LCUA 4YFDB 5IMLB 3M8OL 1EO7A 1I4FB 4HWUA 1KC5H 1EEYB 4MQXD 5CHNA 1ES0A 4R6UA 1NCAH 1EEZB 3W9DA 4YEFA 5IFHH 1YN6A 4GKSB 4M4RA 3QWRA 3KPSE 4NGHH 4G7YL 1CFVL 3SKOB 3BMWA 4QEGA 43C9A 4HFWB 2D31B 2F53D 2NZIA 3ZDZF 3NZHL 3MGOB 5D1ZA 3SQBA 5C0DB 1TDQA 1D9KD 2VZOA 43C9B 3RWIA 4MYWB 3ZKMC 4AIOA 4K3DH 2VKXA 5TQ0H 1NGPH 4DKAA 1A1MA 4KJWC 1FV1A 4HBCH 4J7RA 2A9ML 1KCLA 1A7RL 4GRLA 1INDH 2R1XA 1MRDH 4HCRL 5ITFB 2AW2A 1MUJA 1AGDB 1NAMB 1SEQL 2IAMD 3ZDXF 1IBGH 5JDJA 3EFFB 1RVFL 2OZ4A 1WF5A 3CLFL 4BH7A 1RUAL 1RZJL 4R3SA 3JVGA 4RX4A 3I6KA 2D03H 3V5HA 2VC2H 4R0LA 4NQVB 4NSKB 5BOZG 2BVQB 3FB7A 1U8PA 4QCIA 2EDXA 5GRXG 3ULVL 4KMQA 3OL2A 3HPJB 3OR7A 4JO1H 3ZE0E 4U1NA 4NNXB 4YIQB 4LLUB 4XNUH 1XF4B 5IBUB 3T0EC 1NMAL 4MJ4A 3FO1B 5E70A 3GK8L 4IIQA 4IM8A 4L9LB 4OQTH 1DQTA 2WQRA 3KPQA 2XG4A 3QQ9D 4APQD 1IC7H 1OP5H 3E2HC 1LEIA 2XTLA 5HVGB 4Z7VA 5I1JH 4K8RD 5BV7H 4JY5L 4L4TE 1MFNA 1A3QA 2GKIA 1Z3GH 3BE1H 4BELD 4DGVL 5I6XB 3U0PA 4YLQT 3WEXB 1IAOA 2OSLA 3FRPG 3L7FA 5D7IE 5GGTH 4XCCL 4C56A 4JRYE 3D25B 3C09C 1ROWA 3LKSB 4ZO8A 2R1WB 4TUJA 2AJ3A 1ZGLA 4XGZB 4F7TB 5I1GH 5ALBL 1UZ6E 4K7PX 1LQSR 1X5LA 4GG8B 2D0HA 3V6FB 1F58H 3S3SA 4BQCA 2ENYA 4E42B 4AMKH 4X98B 4L4VD 1I3RB 1YEHH 5IGXH 3VH8G 4U1HA 1HXMB 2ZZUT 2EO9A 5D2NB 2HA1A 3HG1A 2CDFB 4NN5B 2AJVL 1RD6A 3OSKA 1BFSA 4Z7WA 2NY6D 1JWSA 5DMKA 1CGXA 1Q8MA 1EXUB 1JBJA 3VGGA 2LVEA 5C07E 3IXAB 1JNHA 3QZWG 3A0OA 1NUGA 1OW0A 1A6UL 2R4RL 2BHYA 5I8KL 4OLUL 1CTOA 2E6JA 1AQKH 3EOAB 5KAQG 3OTTA 3IU3B 3QH3B 3WHXA 3UBXG 4OLXL 4FXKB 4FQ1L 4Y4FD 1INEL 4R8WL 3ZYIA 1F4YL 3D18A 1IFHH 1NGQH 3OGCB 3SGDH 4HUUB 2A9MH 3HZKB 3EOBA 5DVLA 5E00A 5AZEH 4XB8A 4NQTA 3RTQB 3M17B 1OAYH 4WWKA 2EEAA 4HHAB 4UOW0 3QSKB 2A77L 32C2A 4WW2F 3KPNB 4HJGA 3D2UB 3QUMA 1RJZA 1I9EA 4P5KB 3DXAD 1XIWB 1PG7H 4OLYL 2YD9A 1J0IA 1KJVB 35C8H 3FT4B 4JKKA 4S0SD 5HJ3B 5GZOD 3Q1SH 4P3CH 3WS3B 4PJ5E 4YBQC 4TTDC 2XIDA 4N0UB 1XZ0A 1PZ5A 1OGAB 1I1CA 3LIZH 4DGYH 1HILB 4PV9A 3INUL 3H3KA 3JWOL 4OCSL 3MJ9H 5IOPB 5D71L 2Y5TB 5CMAB 3P4NB 3I3BA 4L8BA 3DSNA 5DD3H 1IC5H 2H6PB 3H3PL 5INDA 3K2UH 1JRHH 3P40A 4XMKL 3A6CL 4X98A 5F3HB 1CD9B 5E99L 5HSFA 3MYJA 5ESVB 1A9BB 4P2CG 1B2WH 2MSPA 4WUUA 2PXYB 2PYEA 1N5YH 4JQIH 4KZDL 5DC4B 1ZSDB 1MJ8H 1RUAH 4RAHA 1FSKB 4NC2B 4QY8A 1XR9B 2Z31C 1CLZL 3VD4A 4O00A 2ED9A 4DGIL 4Y16A 3D69A 3SJVD 2JJSA 4HPOL 4M5YH 1KJMB 2BSRB 3BISA 4EZMA 1JFQH 1T66C 1WZ1L 3CC5B 3RVWC 4M5YL 1IAMA 3G5ZB 2VL4A 1K8IB 4HS8H 2ORBH 4J3VA 3ARZA 2XZAH 3GJFB 2EZ0C 3SDXB 2HT3C 4M43L 4MNGB 1DBKH 1MCOL 1U3HD 5F7FA 4A6YL 2A9NH 4R0LC 1J1OH 4H1LB 1I85A 1N64L 3P4OA 4PBXA 3VXSD 3LRGA 3QXDA 4X4MA 4OGXH 3D0VA 1S8DB 2FSEB 2VXQL 3VFSB 3MA7B 4D9QE 4H1LG 3LHPH 3UJJL 1WAAE 4FXGA 4X8JA 5DYOB 3V4VH 4YDLC 2X7LA 4MJ6B 5IJVB 3FRUB 3RWDB 2D7QA 1EFXD 4MDIB 2VN4A 2CPCA 3KNBB 5D7IA 4Z7QF 5H94B 4K71B 4ESKA 3IU4H 4NQXB 1DE4B 4QXGH 3S37X 2WM0A 3VGBA 5MI0C 2PO6D 1FO0L 4KVNH 5GGRA 4J3XA 4F57L 2PXYD 5SWSE 3DO7A 5K33A 2VUOA 1FZMB 2EDRA 3LS4H 1EGJL 5J1TC 3ET9F 3MCLL 5DQJA 3BOVA 1ZHBB 5EN2A 4EDWL 2RIKA 2YD3A 3KDMA 2AABL 3CZFA 3MRPB 2IQAA 4JQVA 4XI5C 2V7NA 3KWWA 1A22B 3NIFF 4QYOA 3IYLW 1I75A 3AMLA 3EOAA 2C3VB 1CD8A 1PKQB 1UJ3A 2MPAL 3C5ZB 1XMWA 3V79C 4GMSL 5CINL 1ZK9A 4GQ9L 5C6TH 3PXJA 1AE6L 3FTGB 4R8WH 2DLEA 3HZKA 5CFHA 5ACMA 4LLDB 3W81A 4ZAKC 1JZ4A 2JJTA 1FO0H 3MRMB 5L9DL 2DLHA 1IM9D 4M61B 3AY4A 3T0EB 5TPWL 4U0QB 3CFKB 5CEZL 1YPZA 4EI6A 1BBDH 1GGBL 1MAMH 4Q74A 3DSFH 3QG7H 3TJHC 1A0QH 4QRPB 4LPTA 4TUJB 5HPMB 3NA4A 3VWKB 1WTGT 2HFTA 1G0DA 2DJSA 3U7WH 1CU4H 1JRHI 3WFBH 1PZ5B 1D5MB 1Q9OB 5BW7A 3I50H 1DBBH 5AAWA 3VGAC 1IEAB 3C09B 2ZUTA 3JUYA 3SKNB 5HYJA 3NOIA 3VXRA 3P2TA 5ESAA 1YEGH 1U2CA 3V7AG 3KPPB 4DUVA 5A16A 1N8ZB 1S3KL 4JHZA 3O6FA 2B5IB 2X4RB 1HSAB 3DARA 3BAEH 4YK4B 4IRJC 4GRLB 1E4KA 3LB6C 4EIGB 1OGAE 5EFIB 4WEBL 4LHUA 2C3XA 5JIKA 3T2NL 5D7LD 3SGJC 5FCUH 1JHLL 5D6DA 1DUZB 1Y6KR 2FLRT 3JV4B 3V0WL 1QSEE 4FQCL 1BD2E 3L3GB 5CS7A 1FDLH 1RZGA 3OXSB 1JNNL 1X7QA 3BIKB 4EI5B 4OKDA 2NX5A 2VLLA 1ZT7A 3LOWA 1NCBL 4JDVB 2H45A 2AJYL 1X5IA 4YX2L 4WW2A 4HKBA 2YD1A 2R1XB 4ZTOH 1DBML 4NRYB 3LS5L 4ZPVA 5TDNA 4PGJA 4YXKH 4U6VH 2HH0L 2X4PB 1SYVB 3FQNA 3HC4L 2NY1C 2FJGB 5HHQB 4ELKA 4XPBL 1P7QB 4WW2B 2ZNWA 4JZNA 2VNCA 3BZEA 3MLUH 1KJ3H 2IG2L 5HYJE 5I66A 1IGIH 1KENL 3VFRA 3S88H 1AR1D 3VFNB 2BNRA 5GS1A 4RFEA 1AGFA 4JM2C 3L3IA 2XA3A 5T3ZH 2YZ1A 4HULB 3O2DL 3FT3B 4PJ8D 1HWGB 3DLQR 4OCNC 3MLZH 4JKMA 4NPYA 1A8JH 4FZ8L 5B3NA 4TVPE 3FT3A 5MP6L 3ZHDA 1JRHL 3O2VH 4M6OH 5AD0B 5IFAL 3HB3C 2RHEA 3N1GC 2HVJB 4F37F 1BVLA 1MFEH 3VU2A 1KB5L 1LK2B 2W92A 3TWCL 3VFWB 4G80B 5D1QC 1FORH 4JB9H 5I1IH 3INUH 2X4SA 4LP4A 2K9UA 3QEHB 4PJIB 1VACA 4P23D 4XPTL 3QDGE 2HTKC 3G08B 2F58H 4UB0L 5FK9B 4GKOA 4PJGA 3TN0A 4G8FB 1EHNA 1FRGL 3VFGH 4LKCA 2ZOLA 2E8YA 3GZKA 4QOKB 4I0PC 1CE1L 1E6JH 4OLWH 1OWWA 3GMOA 1S5IH 3QUXB 3SE8L 1JPSL 3L3JB 3V2AR 3IXTB 3MLYL 3S8WA 3O11A 3LEVH 1MJUL 3MXWL 4R0LB 3R06A 2BP3A 1H9VA 1L7TH 3ZTNL 3MRGB 2VH5H 5HGHA 5FUOL 1BZ7A 3ARBB 5IB3A 2BFVH 3C2AH 1KTLB 5LGJA 4DCQA 3MOAH 1DE4A 5C0FB 1T04B 2OP4L 4NN6C 3LQAH 4QXGL 5JR1H 2UZIL 3VJ6B 4RMTA 2VLRD 2VITB 5KJRL 3ARUA 3JTSB 1N59A 4P9HH 5E4IA 1KTDB 3SOBH 1J05B 3MV11 5T1LB 3VW3L 3LRSA 4MJ6A 2V17H 1F42A 3CSGA 1BIIB 1FZMA 3VXRE 3O3DA 2HFFB 4F33A 1CGTA 2AJXL 4U1IB 1KELL 3TBSA 3GSWB 5MI0B 1DP0A 2Z8RA 4LRIA 4OUOA 1PJ9A 1WJ3A 1E4WL 4G42A 4S1SH 2O5XH 4G8EB 4XBPB 1NEUA 2UYLB 4JFQA 3WXWL 2YPLB 5C2BH 3P4LA 2X1WL 1CFTB 1KLFA 4LKXA 3GEWB 3IRZA 3O6ML 1FZKB 3TO4B 3NIGF 5ALBH 3WYRA 5J1SC 1MF2L 3V4PL 3AUVA 3L5JA 1LE5B 1NFKA 1VKXA 4NN7C 5KS9B 3CXDH 3ZDZE 4JFXA 3FZUC 5T3ZL 3QXUA 5IMOA 2B0SL 1NGZA 3DGGB 3NABH 4W6WB 4Y4HA 3L9RB 1WBXA 4HXBL 5IHZB 4PD4K 1KACB 2VISA 4ENED 4LLWB 5J57B 4MXVF 2W59A 1N6VA 1MHEA 5DJCB 4QRTB 4L8DA 1CL7I 5LWYH 3CFKA 3D87B 3S5LB 5A3ID 3SGEI 3S35L 1RZKH 2E6QA 3MBED 5FYKU 3C5SA 3HZYA 5F7KC 3DRTA 3PE9A 4MVBD 2H8PB 1Q9OA 4WI3A 1U91B 3GMMA 4V1DB 3TH4T 4XP1L 5JQ6L 3U2SB 3ULVH 3HNSL 4YDIL 4HKBB 4RGNE 1ZLUH 1X4ZA 1T3FA 1KPVB 3D39D 2PKDA 4A2MA 5CBEA 3HCVB 1QHPA 1KIQA 4DUWA 1OTTD 4P5TB 1NBVL 4XNQA 1DZBA 4QHMB 4APQA 2EDEA 1MCJA 1MIMH 1IC4H 4S2SA 5JXAH 5L8KB 1M71B 5F89A 2G9HA 3BAEL 1FP5A 3ILQD 5HJ3A 3ZT6A 4KK6C 4NNPL 5BRZA 2WSKA 3CH1A 5EZJA 4QRPD 3E8UL 4NQCD 3UTZA 4DZBB 2I9LA 5CKGA 4JFOA 4U6HB 4NO3B 3WO4B 2ADJA 4X5XA 3ZSSA 4OM0H 1TQCB 3OMZA 4YAQA 3BT2H 3FOMA 3GI8H 1Z9OA 4PJ9A 3ILPB 2HLFD 2HG5B 4WV1A 3RTQC 3ARQA 2IANA 2VR5A 3G6DL 2X10A 4FFWC 3IJHA 4JREB 5JOFB 4XZUB 4KGLA 4U6XA 4RWHA 3P0YH 2NLJB 2C9AA 2DQHH 2YA0A 4KTYA 4KVCH 4WTZA 3TZVC 1EHLL 5ACLA 3ARRA 25C8L 1GGCL 4ZFZB 5DSCA 5FGRA 3GGWA 1VPOH 2A0LC 5I1EH 4I4WA 4NNYA 1UZ6F 4U6XB 2X4UB 1BGXL 5T3XD 1NMCC 3MRRB 1EJOL 1XGTB 4Y19D 5I8KH 3QFDA 3QFJA 3ARYA 3LEXB 4H1LA 4G6MH 4QHUA 2X4UA 1SY6L 3EOTH 5CD5D 1WWWX 5E2VL 3STBA 4PUBL 2F74B 3DYPA 3FB8A 3HZYB 3GKZA 4KUCF 5FECA 4OZFH 2UUDH 4RMUA 1T7XA 4OGZA 4X8JB 3E3QC 5IBTL 1M6OB 1KNOB 4JHWL 3MRKA 4OJFL 3D2UA 4DEPC 1HHKA 1S7QB 2XFXB 4D0BA 3X3FH 4OD2B 1RJLB 2P8LB 4LLQA 1KBGL 3TLRA 4Y0GA 3VFPB 5CEYA 2P1YA 2RB8A 1WK0A 4YHLL 5KSVA 4KI5C 4I2XA 3O3DB 1ORSA 3OJMB 3P9WB 3BH8B 4P59L 5KSAD 4L29B 1IKNC 1Z3GL 3BE1L 3IVKB 2HFGL 1L6XA 3H7BB 3FRUA 4F3FB 2Z9TA 2FGWH 3IDNA 1TCRA 2Y23A 3RDTC 4KRLB 1XCQA 5E4EC 3VXQB 4KJPD 5BS0D 3EO0A 4NQSA 4PJDF 1OD9A 3AU1B 5CLWA 2VLMD 4CRPA 1Y18B 4NHUA 4PJ9B 2PYFA 4F9PC 4ELMB 4Y2DB 1U3HB 2QR0B 3LKSA 1ZGLB 4ZFGH 2WBKA 1O7VA 2Y6SC 3FL7A 5F97E 1JJUA 2AJYH 3GFUA 4NQED 3IDXL 4Y5YB 5FUZL 4NQEA 1P4IH 4IRSC 6FABL 4CNIA 4DJMA 3IDMB 1RIUL 2OJEB 4WU5B 5CEZH 1MH5A 5ILTH 5J6GB 1LEKB 4XVJL 5GSRA 3GKWL 1GJIA 1T4KA 2A74B 1NUDA 4Y16B 1U8MA 2VLRA 2BRRL 4LLUA 4DOHE 1XGUB 4K71C 3V0VA 1T03L 3QIBD 4DN3H 4TYUA 5A40E 3DTXB 1FL5A 3MRJA 4H26B 4QTHA 1ZLWK 2WMPA 4E0RA 1U91A 1WZ1H 3GMMB 1ORQB 3ZKSD 2HWZL 1X44A 5SX5H 4NCC2 1UCTA 1JPFA 4KJQC 3JTSA 4YHZL 3BFOA 1YNLH 1EA9C 5T1LD 3MQIA 4G5ZL 5DK0A 1OAUH 4KQ4H 4ODHL 4WCYH 2HJLB 3BZ4B 4ODXA 3OJ2C 3KPSB 1NGXB 2NY0D 4OD2A 4IOFC 2AGJH 3GSOB 1BD2B 2VO5A 3MZGB 2ZKHL 1Z5LB 4PJFE 5D1ZD 1KTRL 3T0BA 1I3VA 1I9JH 4I5BA 3L1OL 5AZ2L 4EN3D 5IB2B 3MREA 4ZUSB 3IVKA 1LE5A 1XIWD 5HHOD 5DJXA 4XPTH 2H6PA 3MGAA 2OXGA 2PF6A 4G8IB 4JO4H 3IJHB 4E5XB 1D5IH 3VXTB 3NACL 2FCBA 4NM8L 1CE6A 3PV7A 1QEWA 1MPAH 2VISB 5FYLE 3QXAB 5HI4C 1A1NA 1LD9B 5E08H 3PHOA 3DO3A 2Z93A 4PJDE 2R2EB 4XP5L 3U7YH 1A6ZA 3VWKC 5H2BA 3MO1A 3OZ9L 1DUYB 3GSVB 5TJWK 2J3SA 1RPQA 3LN5A 3QBTB 1HHHA 4OFVA 5E9DD 3DBXB 1RI8A 2HMIC 3ARDC 3L3DA 3VXMA 2EDYA 5F1SA 4XAKD 3WFHA 1BVKA 4GXVL 1G1CA 2YRLA 4MA7L 3CFEB 3CU1A 4HK3N 4LIQL 3RIAK 3QJFB 2YPLE 3R4DA 1NC2B 5BJTA 3JVGC 3LMJL 4ZNEE 3F7PC 3RVXD 3DRTB 1NDMA 5GHWH 2JJWA 3I6KB 3ZKXB 2FJFB 1NFIB 1B2WL 1KLGA 4OQ1A 5ALCL 1YQVL 1DQLL 3LQZA 5KVDL 3P0VH 1OWRM 3QUMB 5CJ5A 4KKCD 4XHQA 1PYWA 4C56D 4LQFH 2FJFA 3HNSH 4YDIH 3HPLB 1F00I 5DA4A 1FC2D 1PW3A 3U0TB 3MTRA 3JWOH 1JMXA 2J6EH 5F7MC 3LDBB 4ONHB 2EH8H 1A1MB 3U6RA 3MV9D 1YEIL 4NKIL 1AI1L 3NFSH 3QXTA 1P69B 2CQVA 4M43H 5DLMH 5IB4B 5IKCB 4X0KA 3NCEB 4OCYH 3LKPB 1HEZB 3QQ3A 2GY5A 1G6VK 3WS6C 1A1OA 1CTNA 4MNHA 5ADOL 2Z8WC 4J6RL 1F90H 1B88A 4MCZA 3REWB 4JM2B 3R1GH 4JKPL 4PRHD 4Y4HB 3QCUH 5ICYA 5JNYB 5GZNC 1FV1B 2R2EA 1C7SA 3B5HA 4JM4H 4KRMB 4YDJA 1G7QB 2DQJH 4MCZB 4E41B 4OIIH 1QPPA 2OTUA 1OT1A 5DGQA 1IFHL 4LPUA 4XP9L 4YXHH 1XF4A 5SX4I 3VXPB 4LKCB 2ED7A 2DQCH 1IGTA 4OD3H 1L9MA 2FL5B 3NAAL 4JZJB 3VW3H 2AEPH 1IC5L 3HUJF 3UBXI 1FBIL 1BX2B 2FJGA 5D96C 5HHQA 1RMFH 2Q87A 3N9GL 5E8OA 1ZHNB 5KSUB 1UJTA 4Z7OE 4UNUA 3RVUC 3KPSD 3DHJA 3TIDA 3DIFB 3FT2A 1FPTL 1S9KC 3LH2H 1WICA 1ND0A 1VA9A 3BIBX 4X7TA 4OFKA 5J0BA 5CILL 4ZUUB 5E8PB 3TA3D 5JIIA 3HR5B 3MOQA 2O26U 4LPVA 4PRPE 2NZ9D 1NLDL 3F5WB 2A6JB 1B0RB 4J4PC 3BKCL 5EU4B 5LGJB 4ZUUA 1HKFA 1KUMA 1KPUB 1T7ZA 2IGFH 1WT5C 1FGNL 3EJJX 1R3IH 2Z91B 1XGPA 3B2UC 4Z7QE 5JPMA 4MXQD 1E4XH 4OF0A 3NZ8A 4KI5E 4NFCA 1YNLL 5JZ7C 1M7DB 1WBYA 3MC0A 2EYRA 4OV5B 1XF3A 3FCTA 4GQPH 4RBPH 5KANG 4QRSB 5T3XE 3TH2T 4PB0H 1T83A 4NGHL 1T1ZA 3AU1A 1E27A 3MJ9A 4OCWL 3RGVA 1VB9A 3QIBA 3NA9L 3ISWA 3L3GA 4M7JL 4P0DA 3ZMRA 3HE6A 3MLPA 4N8PA 1QLEH 5I74B 4MGXA 4BQ9A 3KDMB 1KT2B 5J9PA 1GHFH 1OARH 3MRMA 3MV8A 5DURB 5HGDA 2OMNA 4X99B 3STLA 1KJMA 2XI9A 2NY3D 4F7PA 3HG1D 3QXAA 5E1HB 4XP1H 3RNKB 2QQNL 3T0EE 5IEHA 5IUSA 3QHZH 4LCCB 1BVKB 1R6VA 43CAB 5ICXB 4Y4FA 4RMVA 3IFPB 5HI3C 1JHTB 4K7FA 3WL9A 4ODXB 3MLZL 1N64H 5MP6H 4MNGA 3FO9A 3QUYD 5I1LB 5FO9B 3LAFA 4L9DA 3VXSA 4YDVB 4KMTH 5DFTA 1UC6A 3AS3A 5IBUG 5GGTA 4BFEA 4WEUD 5IIEA 1YEDA 4PJGF 4M6AA 1ZE3C 4FQ2L 3S34H 4LSUH 4HS6B 4HJ0D 4HWBH 4OUUA 1RHHA 1A4JA 3BQUD 3VFPA 3H9SE 1F4AA 4JPWL 3SCMB 4XMPH 4HKZA 4NDMB 4PJCA 5D8JL 2WUBH 5DR5L 4L8SB 1B6UA 1UB5B 1VEPA 3GMQB 1FNHA 5LG1A 4FMKA 4ZNEA 2OZ4L 3ROOA 4L4VE 2QHLA 2KH2B 2Y1VA 5C0CD 4FQHA 4PRNA 5A2JH 2R1YA 3S5LG 4XCFL 1QSZA 2KKQA 3HHRB 4MB4A 1R5IA 3ZYJA 1U6AH 5C07D 4LCWB 4LSPL 1I7TB 3MLXH 3JWOC 4ISVA 5F72S 2CDGB 4NO3A 1CVRA 5ANME 2H32H 2CR3A 3L3HA 3ORJA 5FXCH 5CGMA 4OZFB 3Q6GL 5DMJB 3RU8L 4PGZA 5D7SL 2NX5E 3QYCA 4JRWA 5D8JH 3RUGF 2X4PA 4XX1E 4I3RL 5ENWB 5JDSB 1A6VL 4D2NA 3BPLC 3ES6A 2XN9D 3MRJB 4H26A 1I1AA 3C8KB 4GKNB 4Z7WF 5L7XL 2OCFD 4ZFOL 3O6KH 5L6YH 3S6CA 3EOBB 1JN6B 3UTSE 4NQDD 2QJDA 4QGYA 5C2BL 1QNZL 1BBJB 3T4YA 4KMLB 2AEQH 3KLSA 1MFAH 1JN6A 3GJEA 3K8MA 1LP9E 1RK1A 4NQDA 5MERB 3FOLA 1W72B 1I9RL 4OF3A 3D3VB 4PLJD 3OHXA 2N1KA 3H9YA 5FYLD 5DK0B 1A3LL 5LQBL 4M03A 5HHVL 4YWGH 3JUZA 5KVMC 5IG7A 5EN2B 3PP4H 2ZKHH 1MCPH 4LOUC 5FA3A 2R15A 4M7KL 2DD8H 3RKDD 1EZVY 3QUYB 2VH5L 2Y7QA 2WWKT 4O02H 4JM4L 3BGMA 4AT6B 5ERWA 3T1WA 3GSRA 5F9OH 2DQJL 2NYYC 2ZUSA 1T4KB 1SM3L 3O2DH 4FG6C 1T0MA 4YHZH 5IVOA 1QLRA 3SE3C 3WD5H 3P77B 2XKNA 2YPLD 3S96A 3CZFB 1RV6X 2HWZH 4ETYA 4MX7A 2X1XR 5ADOH 4HXBH 5I1JL 5EUKB 3BKML 1IC7L 3C5JA 1FPTH 4PYGA 3SDDD 3WJLA 1MJ7H 4LDLB 1CT8B 1NCWH 3QR2A 1T89A 5E4EB 1FAIL 1J8HA 3U4BL 2XWBB 4F7PB 5SV4A 1T2XA 3JV0A 4K8RH 2QADD 4F15C 1QBAA 2ZCLL 5EU6A 2CDEB 1XCTB 3L95B 2VERN 1U8KB 3PGDB 4I48A 3HI6H 3WS3A 5FHAL 2IMNA 3HMXH 3OF6A 2R9HC 5E5MA 5MEPA 3OF6D 3VDCA 2O5YL 3ZHLA 1K2DA 1F4XL 4Y5YC 3RNQA 4QRRA 5EG6C 1JGLH 1FN4A 1MHPL 1U8JA 3SKJH 3BP4A 1P4LA 3MR9B 4FQIH 2EC9U 3DX7A 3KXFA 5C0IB 1TTGA 4A6YH 3O0RH 2I07B 4K94C 1BFOB 3UTZB 4DZBA 1W0VB 2VLJE 3K8KA 1IAOB 1R5IB 4J6RH 5F96L 1QD0A 1VADA 2FX7L 3X13B 4FFZL 3IDNB 1CGSH 3H42L 5B8CA 4OLVH 3FHQA 3RJDA 2P8MB 2R23A 4MJ2A 4PY8I 4FFZH 2Q6WA 3VWJC 1MELA 5DURD 1T1XB 2BOBA 1J86A 2DLGA 1KJ3L 4X6BB 3DV4A 5TF1L 4TNWF 1JPTH 3HR6A 5TQ0L 1IT9H 1SY6A 4WFGE 4D9RD 1L0YA 1FVEB 4PJHB 5IBLD 1B0WA 2XT1B 4Z78A 2J4WL 2ICWJ 1I3GH 2BC4A 1LGVA 1N3NA 5CUSH 2Q86B 3TV3L 3NIGE 4LVNC 3UC0L 5IBTH 2B8OT 3PDOB 3P11H 2VDMH 1C8PA 1DQLH 3LPWA 2OM5A 4LPYA 4MMXC 1M05B 4W4NA 4X8XA 3HI5H 3VFTB 1NLBH 4HUKB 3TGXA 1OOAA 3KR3H 4TVPL 1Q0XH 4YGVB 1RURH 5E00B 4ZS6C 4R90H 3PWUA 1X3DA 3B9VA 4K9EH 5KVGL 3ZE2F 3KPRA 25C8H 3NN8B 5CINH 3TO4C 4M8VA 1B4RA 1I3GL 5J3HC 2F8OA 3U0TA 1Y6NR 5L8JB 1QVOB 4RFOL 2IC2A 3VXOB 3KPMA 2AQ2A 5BW7C 4XAWH 2FH6A 3UTPD 4QHMA 3HAEA 1NAKH 2HVJA 4CUCA 2ADIA 3NVQA 4X0KB 4ISVB 4U3HA 2W60B 1K5NA 2C3WA 1OGAD 2WINB 4M9OA 5D7LE 4XC3L 2D0GA 3CVHL 5FGSA 4PJIA 5DK2A 1BQSA 3WLBB 5FGBA 2KUTA 1T03H 1BM3L 1OAZH 2VZ1A 4ONOA 3G5XB 2WQ8A 4Z7NE 1YJDH 4G6FB 4LSVH 3EFFA 1G84A 4DTGH 3ARSA 4WHCA 5D6DC 1IAII 4GAJL 3IDXH 5FUZH 4G42B 3NAAH 3QNXB 1G9MC 3JV4A 2X4NA 3QEGH 5F7YC 5I2IA 2NY5L 5H35A 2Q7NA 3QEQB 1AQDA 1OAKH 1U8PB 4NKDB 2PR4L 4OGXL 1I3RA 1SEBA 3PNWA 5E2TH 4NCC1 3LY6A 3L6FA 3T2NH 4F37K 1MCKA 3FO0H 4WRLA 4QOKA 4Y4KA 1NSNH 1W72H 1KN2L 3ULVE 1F8TH 1BHGA 2AV7B 2GI7A 4HS3A 3T3PF 2DQUL 1CI5A 1UB6A 1TENA 3VWJA 4JZNB 3E0GA 2E5EA 4ZOCA 4EBQH 1AGCB 1G0YR 5GS0H 3I6LE 4J12A 4HS6A 5F9JA 2VXSH 4XT1C 3ZO0A 1FCCA 3P3YA 4PJ5B 3QPQC 5CHNB 3CPLA 1Z5LA 1FVDB 1MCBA 3B8SA 1N5YL 1Z6JT 3W11C 3B2VL 1P7KA 3DVNB 1JE6A 3RPKA 4EQ2A 1QBMH 2ATKA 5SV3A 2UYLA 4YBHA 3V52H 4ODVH 3ARVA 5EUOE 1NGYA 4ZOEA 3ULVC 1N26A 1I3UA 4A2LA 2BX5A 2QSVA 2G60H 5C6PB 2W1NA 3MRNB 1NH6A 2IAND 2NX5D 3QFJD 5EFIA 4KDWA 4MQTB 4BSVB 5FM4A 4ZG1A 5I19L 3QUXD 4DTGL 5JR1L 1AXSA 2BNQE 2AJSH 4LSQL 4J8RA 3EYQD 4RMSA 5EC1B 3EHBC 3WN5C 4XNZB 1X7QB 3BIKA 5C09D 4EI5A 3VXTA 1RUML 3NTCH 3B83A 4QHNB 1HHHB 2ITCB 3OB0K 1Q38A 1Y0LA 3UTSD 2X9YA 4YDJB 2L7UA 1M7IA 1CDHA 4LHUB 5HHOB 2AVGA 3MUZ1 1WTLA 3HE7A 5GRZA 4KKLC 3T4AA 3FQUA 4M00A 3QIWD 1CLOL 4LAQL 3RDTB 1J10A 3F7RA 3PHSA 2MQCA 5AYUL 4H1LH 2NX5B 4PJHE 1RURL 1FNAA 2ADFL 2VZUA 4GKZA 3QHZL 4P46B 3SQOL 4FNLH 5FAAA 2F5BH 2EYSB 3KYKL 3RUGB 1KLUB 2JK5B 2Q3AA 1UQSA 3DIFA 1LILA 4GKSA 3KYOB 3ARXA 1QFWL 4IRZL 5EU6B 3EYUL 2YWZA 3S3JA 1LVEA 1SBSL 1QFWH 4WDIB 4G3YH 2J8UE 5GJSH 5DS8B 5M94B 1KCRL 3QXVA 1TITA 4KV5F 4LEOA 1CS6A 3BP4B 1HYRC 3MR9A 1Q9KB 3SKMA 5I16A 3MRKB 3J8F7 3PUCA 1XCQB 4PJFF 5DJ0B 3FFDB 3QIUD 1UCBL 3TN0D 4X9FA 3DX6A 4WUKL 1U8NA 2Z92B 5CGTA 2AK4A 3KYMB 1BECA 3RWDA 3VH8A 1KYOK 4F7MA 1WQVT 5HYSB 3BH8A 5D4QA 2GJZB 3IDIB 3MROB 1CF8L 2ORBL 3UJTH 3ARED 1VSCA 5JHDE 1J7VR 2DJUA 2PETA 3BKYH 4GBXC 5F1IA 5D9SA 4YBLC 3VXMB 1E28B 1EIBA 4N0YL 5DMIL 5HVHC 2PXYA 2PYEB 3QUKB 1FG2A 2J88H 3DYOA 1VDGA 4HUXB 3LD8C 4TPRH 3CCHB 3VD7A 1QPXA 4RGND 5GISL 2XWJA 4V2CB 3GMPA 2FD6L 5H35B 5DEGB 4WFHD 5C70A 1NCDL 2VQ1A 1JYNA 4O2CB 5IF0A 1RK1B 4NQDB 3EYSL 3U4EA 4NKMB 3CVHB 1GOGA 3QQ4B 3RWEB 4Y4HD 1EJ6A 4EDXB 2VLJD 1C7TA 2JLLA 4N0RA 5E95B 2VLJA 4Z7OF 3B2VH 2DM4A 1IL1A 1S5HA 3CDGB 3FQWA 4G9FA 3ARGD 3H2WA 3AB0C 5MHSD 3R1GL 2FX8L 2NY7H 5FUOH 3HS0B 4IOIB 3OKOA 3PHQA 3C2AL 3TBTB 1H3TA 2P4AB 3JWDC 4HEME 3IETA 1V8HA 4D9RE 4NHUB 4KKAC 4PYHA 1F13A 5A16B 4RX4D 3WS6A 3SGDI 1FIGL 2IBBA 3DX8B 3D9AH 5T1DL 1ZA6B 1P84J 1TXKA 3SE4A 3FRPA 2ED8A 4N5ED 2JKXA 1YMMD 4CNIB 2NW2B 1XF1A 1IGFL 1C1EL 1CE1H 1FFRA 2P5ED 4GLRI 4PJCF 4X9GA 4XZUA 1URLA 4JPIA 2CUIA 4CJ0A 4ONGH 3UBXB 1A4KA 2HKHL 2HT4D 4J1UB 3PP4L 5F1IB 4Z8FL 1S7TB 1AKJA 4N8VG 5E2VH 2ZSWB 4P2RB 1A6WL 2O5ZH 2P49B 1T83C 4Z18A 1YUHB 1I7ZA 2V7NB 3KWWB 4NQCA 1RUPH 4N9OB 2IQ9H 2VDNL 3V7AE 5KG9A 5F93C 1XGRB 4LIQH 2XZZA 5FO9A 4H88H 3MLTB 5DMYA 4K07A 1MREH 4M02A 4FZ8H 4A6YB 1J1PL 1TCMA 4ODTH 3V6OA 4HJGB 3QB7C 2PCPB 5IEKB 5BV7C 2DQFA 4FFYL 2JJTC 5C0BB 3CFCL 1RJCA 4XBGA 5JIHA 5ESQB 1T22A 5KS9E 1RHHB 3B2UD 1XGQA 4G6AD 3WFEH 4K94H 1KNOA 4GW1B 3N1QC 4JKPH 3F7QA 4PJ7B 3RVVC 5C0AE 1BFVL 1JPFB 7FABL 1F4WH 1R0AL 1F11B 4HD9A 1M1SA 4U7MA 5IB1B 1F6AA 4LHJB 4JFYB 3TYFB 4J4PD 4OCMC 4QHKI 4L3ED 4NZTL 2F58L 1RJZB 4HWEL 5KN5A 4G8GD 4N9GA 4MD5A 2AJSL 4LSQH 4XPAH 3IU4L 3UP1A 4HH9B 3KPTA 4PGDB 1T2QL 5GRWA 3M8OH 4U1IA 3TBSB 1KJ2B 5HI5C 1A3RH 4HIJA 1U95B 1D5ZA 1C5CH 2IF7A 2OL3L 4LSRL 5ESVA 2ERJB 2J8UB 5DUPL 4JN1H 3GUTA 5CP3H 1CG9B 5E56A 1DEDA 1OTUD 5D96B 5IFAH 2E27H 3LHPL 5T3ZE 4QRRE 3G04B 4CVWA 1QBML 2I5YH 1FE8H 3OAYK 4Z7UE 3ILPA 4Q0XL 5EOTB 1ZVSA 3KYAA 2QSTA 4W6XB 2YKLL 5DMKB 2DB8A 2Q8AL 3OJDB 5JXED 3VG0H 5MENA 1RUKL 3QNZB 2ICWB 2F54D 5IESH 4WHTA 5EUKA 4WHYH 3L3JA 1H3GA 1X5KA 5I1AA 3BUTA 5C07A 3MSPA 4PV8A 4JAMA 4JKLA 1HH9A 1ZAGA 1VENA 4KHTL 5E2TL 1N4XL 4TUOB 1MCNA 3GKWH 2ID5A 1FIEA 5MERA 4XNXL 3MLRL 3QIUA 4NO0B 2BMKA 3V5KA 4X4YA 4YHIB 5HHOE 2JF1A 2IANE 1E6OL 3PDDA 1PG7X 3Q3GA 4HAGA 5EDXA 2ZJSH 5IMLA 1PQZA 4GAJH 5MEOB 3MJ9L 1BQHB 1U8HB 2VDNH 4JRXE 5L9DH 3QQ3B 1T2QH 1UM5L 5GSVA 3EYUH 1WBZA 3QNYB 5KJRH 5F9WC 4MXWH 3O8XD 1W72A 4FHBD 4GRWH 1HILA 2EXWC 2WP3T 1HYSC 4FP8H 3OKOB 5GJTH 3JTTB 3CH1B 5EZJB 3C6LC 5DVOA 2A1WL 4UIMB 5HDQH 1QSFE 5GGVY 3RGVD 2V7HA 1HXMA 2VR9A 5T3XH 3IFNL 2EDOA 3L5IA 1VKXB 5GS1C 4Z77B 2H1PL 1H5BA 2NXZB 3NCJH 3HE6B 4GBXB 2HYMA 3Q5OA 12E8L 3PIQB 4XH2B 5JPNA 4JN2B 3RY6C 4O2EB 3BXNB 4EKXA 5FOBB 2X09A 4XBPA 3GM0A 5AG8A 5D9SB 1T21A 1OGTA 1DBBL 3QEQD 1Z9MA 4M93C 4PRDA 4BZ2L 1K85A 4XVTH 2EE6A 3RGVC 3G08A 1PY4A 1J1PH 4ODTL 2YUVA 4H88L 1RUMH 4BK4A 1LMKA 4ZODA 3QEQA 5ANMA 3O8XC 4K3HA 3C5SB 1IL1B 1S5HB 4G9FB 2R2HA 3OBAA 5HHVH 2DYPA 5GJTL 2EIEA 1R3LB 4PRHA 5BQ7B 2D4DA 4GKZB 1AD9A 1I8LA 2CK2A 1AY1H 1I9IL 2MQ0A 4C56E 1CR9L 3KPOB 4J23A 4JB9L 4ZXBB 4KROB 1YNKL 1ACYL 3WIIL 2M8XA 3CSYB 3OKMB 4AH2A 1A4JB 3QWOA 3SO5A 1RFDH 5EC2A 3W9DB 2R39A 4YXHL 5F9JB 3PXHA 4H8WC 4ZOAA 1EAJA 1QR1B 4IDJH 3DMMA 4W4OA 4HUNB 3TZVA 4DZ8B 5JHDD 5EU4A 5I8OL 5L7XH 1HZHH 5DUBB 1JF1B 4M6NL 5C3TA 5HY9A 1BQUA 4PJ8A 2VUYA 3DMMB 1XT5A 4Z5RB 1PFCA 4XCEB 3WSQH 4WDIA 2GJZA 4LVHB 1IM9B 1NGZB 4JY5H 3QI9A 4YXLH 2MWCA 4HX1B 1GGYA 4HPOH 3MV8B 3G5YA 2JCCE 2A6IB 3RU8H 2RR3A 2X4SB 3LV3B 1IGML 4XCEA 3IFOB 1EAPB 5L88L 2BVYA 1HQRA 3VG0L 1UZ8B 1A7PL 3MRDB 2R0LL 3HLAB 2EH7H 2WANA 2NR6D 1JYWA 3BXNA 2C3HA 3UTTA 1MCEA 4TTGA 1GZQB 1HQRB 1BAFH 4PJHF 4F8TA 5DUPH 1UM4L 5EOQH 3H3PH 4L3CB 3QUML 1A9EA 4MB5A 4BQ8A 1OSZB 3X11A 4V2BA 1C5BL 5BS0B 4DQOL 4Q9RH 1AGEA 4Z0XB 4HIXL 3CMGA 3GSXA 1FYHB 5T5FH 4KU1A 4NFDA 1SBSH 4HUVA 1IGYB 3U0WH 3LKQB 1HHIB 1G7HB 1I85C 2VLKD 2CO6B 1UYWH 5I8CA 4WW2C 1N6QL 4MQ7B 3RDTA 2EICA 4GUPA 1JGVH 5DJ8A 2CK0H 3RWJB 2O93L 5C0BE 5HBBA 1AHWC 5E2UH 2VRAA 4GSDH 4HBCL 1DN2A 3QUZC 1KCSH 4KI5D 4KPHL 3PWPA 4R4FH 1U95A 2BSSA 4U6YB 3VXUD 3PWUB 1QKZH 3FQTA 1NL0L 2R29L 2W38A 4PRAA 1WISA 4XAWL 4L8CB 1NJ9B 4F7EA 5J06A 4PJHA 3QUZA 3BGAA 2DD8L 3RVTD 3LKOA 4JANA 2QADB 1F2QA 1S7XB 1NMBH 1TQBB 2HJFB 5DJXB 1KCRH 1P53A 5F7NC 3FB5B 4LASH 5DTFB 1INQA 4OSUH 5ISZB 1DQJB 1K4DB 2LTQB 2ESVD 5C9KA 4PB9L 2BHZA 1LK2A 4JLRB 4P49A 3K3QA 4DOHB 2NW3A 1ZANH 2A74A 5F1NB 2A0LD 2QV2A 4U1KA 3QG6B 2MTPA 4M3JA 1HHGB 1PG7L 3EUUA 3MRHA 1O7SA 2PTTA 1Z9SA 3UCRA 2R8SH 3WDJA 4I0PB 4UILL 1G7MA 4LBEB 2VN7A 1CICA 1T0MB 3EO9H 1AQDB 4U1JA 1EH9A 1G9NC 2NQCA 3PG2A 2FHCA 2XQYK 1FIGH 4LGPB 4ALAL 1JI1A 4G8GE 2XZQH 5L8LB 3JWDH 1OTSD 4OB5L 3WHE0 1GXEA 4PRIE 5CZVL 2VABA 1BQHA 5KZCD 3RI5K 3TT1L 4GO6B 3VFRB 1F4HA 3RNQB 2ITDA 4J3WA 5C0CE 4U3XA 1NCCH 4Q2ZA 5F3BB 1QR1A 2VIRA 3H7BA 3SDAC 1LDPH 4C58B 5DK2B 3S4SB 2JIXB 5C0NC 1MCWM 1UADC 4UIMA 3CMOH 5LGHL 2BRQA 5I15L 1JF5A 5ILTL 1I8IA 4M1GL 5IWLA 1XH3B 4X5LA 5CEYB 1ED3B 4JFEA 5CWSB 3A6OA 2VDLL 2ADIB 5EO1B 1OVZA 3IF1B 4YHMH 2IADA 2X1QA 4P2QB 3FAWA 5FFLA 4J3SA 1TCRB 2IH1B 3OR6B 1MH5B 2F54E 1C08A 4JY6A 4NHCL 5CJQH 2V7HB 2P48B 2DDQL 3LQAL 1MNUL 5KOMC 5JO5A 1YUHA 3MLSH 3GO1L 1TNNA 5C0RH 1NUFA 3ULUD 2ARWA 5HHPB 4WTZG 3WNOA 3AB0B 1F3DH 4R7DB 1A4KB 4D9LL 2DI8A 3FFCA 1JL8A 2EE2A 5JDSA 4M7ZB 1N0XL 4LEXH 4M61A 3G04A 4P4KB 5I1AB 5EORH 2XQYG 3B3IA 3G5ZA 3H9HA 5E9DA 1TVHB 5C86A 5CEXA 4Y8AA 2F74A 5D2LB 3WFDH 3BZFB 3MJGX 1SBBA 1SVZA 1DDHA 1VFUA 5GRJH 2NNAB 1WC7B 4OBSA 5EBMB 3RTQA 1U3YA 2NY2D 4IRZH 4MLIA 1RZJC 5B3JE 4Z7VF 5ALCH 1X5FA 2K3TA 3DUUA 3EGSB 1T7YA 5DJDB 1X5GA 4Z7VB 3SCMD 1QSFA 3A6BH 5F6HJ 4POYA 4YXLL 1A64A 4ELMF 3O45B 2W0LA 5FKAB 3AGVA 1I1YB 4U7KA 3VI3F 1CLOH 3EO0B 4NQSB 3HC0B 4X6CF 1CWVA 4RGOH 4RDQG 2NXYB 1U93A 4X6CB 1NDGB 4K3EH 1GL4B 2FWOA 3G6JB 5IFJA 3LKNA 5HDLA 1DEEB 3HC3H 2B1HH 2NY3B 4GRMA 2CRIA 3EYQC 2IANB 1P4BL 1UVQB 4OV6F 2ZSWA 2V6HA 3F58H 3RZCB 2DQTH 3WUWB 5JHLH 2BERA 1HDMB 3AVEA 3QT2A 1DANU 4JE4B 4M62L 3ZL4L 4OF8A 5J1AA 5L2JB 3STLB 3T65B 4U1JB 4MZ2A 2MKWA 4NNYB 4B53A 1NC4D 4OTXH 1FG2B 3ME0A 5IHUL 1D9KB 4N8VA 2H41A 1CQYA 1U6AL 1T22B 1HOCB 2X70A 4GRLC 4DKEH 3KPRD 3RUGE 1CK0H 4XCFH 3DVIA 3O3BA 7CGTA 4KQ4L 4QLRA 3TBTA 5HHNA 1KN4H 1ZEAH 4X6EA 4XNZC 3WEXA 2F19L 5C08B 2AABH 4DKDC 5HVFB 1F6AB 2JB6B 12E8H 3I02A 3ZSTA 1UGNA 2QQKH 3TO2A 1NGYB 5KW9L 2YD6A 1AR1C 3JXAA 2IADB 4P2QA 4KI5F 4KUCD 1GYAA 5C0FA 4ETQA 3MUGA 3EDFA 3NABL 4RDQF 2CIIA 1YEIH 1SJEA 1HI6B 4NKIH 4R96B 2GTZB 4XXCC 5DVNA 4U6HA 1AXSB 3VRJB 4C56B 3RA7H 3UPRB 3OJVC 2A6IA 2DDQH 3SKJL 1BIIA 4JFHE 4Y2DC 2GAZB 2NY5H 5IG7B 5FCSH 4XNYL 4PJCE 1DBAH 1OAKL 1EFQA 3DSFL 3QG7L 5J4MA 1I7ZB 4XNYH 1MCPL 1CQKA 4ZD3H 4P2QE 5ITBL 4HBQA 5E1AB 4QRTA 3U4BH 5A2IH 1MQKL 1YY8A 5CIPB 4CJ1A 3PP3H 1YYLH 1B0GA 4IIQC 4MZ3A 4JJ5A 4I9WE 4GW5A 1AO7E 5IIEB 1MRDL 3RX5A 2ITCA 1H3PH 4KWUA 4Z7UA 2EYSA 3RUGA 5ID0B 5KZCB 1IQDB 4YHPB 5E8DL 3FN3A 4AIZA 3IU3A 3MLVL 3BKYL 4FOMA 1PD6A 3VXMD 1YYMH 2DWEB 4PJXA 5IF0B 5GS1B 4WJ5A 4P5TA 4XNQB 2N7AA 1KN4L 1ZEAL 4O51B 4TRPH 4YHKH 3HE6C 1KLGB 1KB9J 3SE8H 2R1WA 2HLAA 1EO8L 3VWKD 3OZ9H 2R8SL 4HK0A 2OJZL 4U1LB 4GFTB 1FE8L 2QL1A 2OI9B 2G2RA 3NZ8B 5ID1B 5JA8B 2QHRL 1Q0XL 2R0KL 2YUWA 3JWNC 1MHCB 2Z4QB 4YC2B 4TSCL 2MHAB 4NUGL 1LO5B 4PREB 4LCWE 5C0DA 1PEWA 4NZUH 3L3IB 3DUSA 4YO0A 1WT5A 2HJKA 2ICES 4OT1H 4BUHA 4NDMA 1FVCB 5DMGC 4CW1A 2ICEA 1JPST 1K4CB 5HDBF 5BZDB 2H32B 1WAAF 3UYRH 4IJ3C 1FGVL 5CSZB 5D1ZC 4X80L 3HC3L 4NO5A 3O2WH 3DROA 3CAFA 5IVZA 5C0CB 4LSPH 4N8CH 3F58L 4J4PA 1PLGL 2DS4A 3C2SA 3V6BR 5EWIL 1R0AH 2F8VA 4XC1H 1OGTB 3BN9D 3S35X 4M8QA 4Q6IB 3I3DA 5TF1H 5E1AA 4M7ZC 4XXDB 1R24A 4MJIA 2BCKA 5ADPL 1I8MB 4U1GB 1HHIA 3B9KC 3RVTC 5DHYB 1CBVH 3L6FB 2HN7A 4FFYH 2GFBB 1K4DA 3UYOD 3SDAA 3GSVA 2COQA 4UOW1 4NWTH 3UTSA 4MNGE 1LEGB 1B0GB 3MZTA 4KK8C 4CADB 4OAWA 1DQDL 4MA1C 1CGSL 3H42H 1BX2A 3E6FB 1TZHA 2G5BB 1ITBB 1J8HD 3QUZD 4UU9B 3FO9B 3O81A 3BJ91 1OL0A 1D5XA 3A6BL 1A6UH 2R4RH 4XPBH 1K6QL 5T1MA 4LEOB 4WFEE 3SO3C 3EYOB 1J0YA 4NP4L 1PX3A 1YNTB 3MMEB 3TO2B 3B6SA 5GPRA 3W9EA 3PL6A 5B38A 1YEEH 3NCFB 2CLRB 2X4OA 3E6HA 5D71H 1MEXH 4BSWB 2BNQD 1A7BA 3KJ4C 4WNQA 2J8HA 5IBLC 1JZ8A 2GTZA 5I73C 2EYTA 1Q1JL 1A1OB 4QHLA 2HJKB 5GHWL 5B8CC 1HH6B 2QTEA 4ZDHB 5BV7B 4F9LA 1DN0A 2XNAA 3QEUB 4G9FE 4B0MM 1G7LA 3SN6N 4JO2H 5F6IB 3U30C 2QQKL 4S1DC 4ZSOB 3QWQB 5F44A 1W72L 3PHOB 3MRQB 3OXRA 1AFVH 3WNNA 5T33L 4JR9L 5ADPH 4Y2DA 1ZVSB 4L5FH 4YE4H 3H9ZA 1XGUA 3VXPA 1FFPB 3CUPB 4X5WB 3NCBB 4XPFL 2J2ZA 3ARFA 4JN2A 1GGIH 3RWFA 3DBXA 4IDJL 3DYMA 5BQ7A 5K9KA 1HINH 4PJGB 4X4XB 2Z35A 2M1KA 2J5LC 4G8GA 4WU5A 2F8XC 1A3LH 3C6SB 4YHIA 3S96B 3GIVB 3W0WA 1KELH 3V6ZA 4ZS7H 2VDLH 4QHKJ 5EIIB 5FHBL 4U1SB 4O58H 4JGJA 4TUKL 1LHZA 5JIPA 2J88L 2BVTA 1NGXA 5AWNL 1AGFB 3GM8A 1MFAL 2ZUUA 3K81A 1UH3A 5KTEL 1T7WA 2FJHA 3SJVB 5K9JH 3RVVD 3H3BC 4KVCL 3TNMA 1F58L 4ZUSA 4HUWB 4MJ5A 5E6IB 1NMCB 2CDEA 4WI9A 1HE7A 3HTLX 3PQYE 4UI2A 1OSPL 1D6VH 1A14H 3T3PE 1S5IL 3OHXB 3JV6B 4R4FL 3MCLH 3OAZK 4OI7A 4J1UA 2DYPD 1N2RA 4NNPH 2Z8SA 3LS4L 3MJ8A 4JO2L 5DJYA 4RRPA 5IFJB 3BDBA 2ATPA 4PRBB 2JELL 2GCYB 4EXKA 4ZFZA 5H37G 3OR6A 4OSUL 1MCDA 5AYQA 1UM6H 2WUCH 4MCYA 1AI1H 4PJIF 4P2RE 4FABL 4GRWF 4QTHB 2H32A 1HSAA 2X4NB 2ZP0T 5I2IB 1MCSA 4ERSL 4KRPD 5IEKA 4ZXBA 2YA2A 1MJJB 2FHBA 1MVUB 5GRYA 2LU7A 1WCBB 5GSRB 2IJ0C 3FONB 2MCG1 3DXAE 4U49A 1VCAA 1QA9B 1VFBB 3RIFK 3ZLQC 4NZJA 2DWDA 2LQRA 3IAPA 1K6QH 1P5VA 1UWXK 1JWMB 4E0RB 3QQ4A 5CSBA 4X7CC 4ENEC 3GRWA 4GAYA 5EZLA 3VFSA 1YN7B 1QFOA 4ZMAT 1FJ1A 2FO4A 3C08L 3MUHL 1JFQL 4U0RC 3HUJE 4WJ5B 4WO4D 2V2WA 2DL2A 1JWUA 3UJTL 1AXIB 5E5MB 3VI3E 1YMME 2AERT 2GITB 1F11A 4G6KL 5C0GA 4JFHD 4APQC 3O0RL 3GUTB 1GCFA 1KXVC 4JQIL 4WI5A 4Y7MA 1ZVHA 4Y88A 2HH0H 3DX8A 2KL6A 4P2QD 3QWRD 4LNRA 2I5YL 4PV9B 1JZ2A 1Z0MA 3L5WA 4DVBB 3BIAX 4FQCH 2IFGA 4OTXL 4WI8A 1HXYB 2Q76A 3U4AA 4HWZB 3BP6B 1EEQA 4UQ3A 1NFDA 5D72H 2PW1A 1PDKA 3FB5A 4I9WD 1OTUC 3NPZB 3JV5A 1G9MH 3RWFB 2VL5B 2PYED 3O41B 1ZT1A 3FTGA 4TVSa 2GSIB 2W91A 3IGAA 4LLWA 3V0VB 2VQ1B 1W0WB 4YQXL 4MAUH 2B1HL 3OG4B 3CX2A 3GIZL 5DD1H 2DQEH 2HKFH 4D9QD 3ULSA 3D18B 4FFVC 3TN0C 4LSSH 3EFDH 3FQWB 3RI5F 4X6FB 5D7JA 4Q2ZB 4FXGB 1UACL 5DYOA 5K9KB 3ULSB 1CXIA 3KVQA 3MRIB 1IILE 3F12A 3HZMA 2AKRA 4UINH 1AJ7L 1IGJA 3D3VA 2ARJQ 4UIKH 4PTUB 1KIQB 3O3AA 5IT2H 3QAZC 2R56L 3OR7B 3P4OB 5ELIA 3SPVB 3CXHJ 3GBNL 5LQBH 5D5MA 2XICA 1RMFL 5DD6B 1XGPB 2WNGA 3O9WD 4BH8B 1J0JA 1P5UA 4QRRD 5I73B 5ISZE 1EHXA 5IJVA 1MFCH 3C5ZD 5FHBH 4AEHH 3QDAA 2HFEA 2HTLC 1ORSB 4MA8H 3ZDYE 4ZFOA 4XPGH 5FGCB 1JV5B 4PP2B 3RPIA 4ZD3L 3DHMA 4ODVL 5IV2A 4RGMC 5B3JF 1MOEA 2PNDA 2E7LA 1CDYA 1KGCE 1MLCB 3CFBB 3WCYA 5B39G 1U36A 3HI1A 3WNLA 4QXTA 1RZ8B 4OGYL 1MFBL 2KPNA 1TJIH 1XGYL 3MROA 3ELAT 3U30B 4PJ8C 1QRNB 1LNUA 2AXGB 4H5SA 4JHAL 4KRNA 5DSCB 1LO2L 1IM3A 1RK0A 4U2ZA 1YYML 4Y5VB 2D7NA 3DPBA 2H2SD 4WY7H 4OFYA 3WHXB 4DKFH 5DJYB 1FZKA 4F2MB 1J8HE 1F90L 1JI2A 4OZGF 1T2JA 1BP3B 1FZJA 2A1WH 1YQ2A 4LLMB 4LFHD 3MLUL 3RFZC 4WUUE 1VFAA 5T3XL 1WFNA 3FQUB 2DQFB 3IT8D 2J5LB 4BM7A 5HHPA 4LU5H 1DDHB 4WWKB 2NY7L 2BRRH 2OBGA 5C3LD 2DTSA 4XCYB 1CDBA 1R3JB 4RZCA 4TSBH 1MQKH 3S4SA 1M7IB 3C6SA 1Q9WA 4FQPA 3VA6A 1OPGH 2KBGA 4FXKA 3G9AB 5DRXB 4J3UA 3RWEA 4AIXA 3KPOA 3W11D 3U9PH 3IS1X 4Y4HC 5DDHA 3IF1A 5TF0A 4LSRH 2JB5H 1WVZA 1MCOH 3CDFA 1JZ3A 3IS0X 3DJ9A 4NOFA 1WAAA 1PVHA 3PWNB 4Y4KC 1LO4H 1II4E 4H8WH 3RWIB 1A7NH 1T20A 3QZWB 5FYJH 4TOYL 1WV7T 3C60A 2F5AH 3I75A 4U33A 5HYFA 1QFPA 2YK1L 2K1MA 3K4AA 4IEFB 3DGCR 3P0YL 1XF3B 2W9EL 3FCTB 4GBXD 5EU7E 4LPXA 4XMLH 3DX9A 1CLYH 2YD7A 4OJFH 5TDPA 5C71A 1CK0L 2B7DT 4ACPA 1E6JL 2JB5L 3KYMA 4HUXA 5BVPL 3SDAB 2AJUL 5EZIH 3MRHB 2L4OA 5I71B 4HF5L 3X3GH 4QHNA 1FYTB 4PPTA 4HMCA 2V5MA 4BUGA 3N0PB 5DI8B 5E03A 1RZGB 3KJ6L 2K7PA 1X9QA 4UU9A 5I66B 5CBEB 3RVXC 3LN5B 5LJYH 4LCCA 4KRPC 3KYNA 1KPRB 4GW5B 5FO7A 4U1SA 5E24E 4HWEH 4ORGA 4X9HA 3OB8A 1QOKA 3CLEL 4F7CA 3P9LA 2F5BL 1VPOL 3BQUB 4YDVA 2UWEF 3IDJA 1IKFL 4LMQI 3QUXA 4PJGE 4U0RB 2ICCA 3B4NA 3U1SH 4AG4H 4KZEH 4XVUC 1NBZB 5IQ7L 2DQGH 3EBAA 5SWZD 1BJ8A 3ALXA 4WWKD 2IEPA 2YD5A 5EORL 1WFOA 2VDOL 4UNTA 4XWGH 3WLBA 4QXUH 5HI4D 3W9EB 2OR8A 1S7VA 1G6RL 1MRCH 1RQ5A 3OB0H 1T0PB 1OB1B 3QDGD 4Z5RA 3SDYL 1S7UA 3D6GA 2IPKA 1FVCA 5DD0L 3QCTH 4MA1B 1FFNB 4KFZC 5I19H 2XXCB 4JVUA 4O2EA 4PJAF 1C12A 1R3HA 3DV4B 1KJ2H 2GJ6A 1NBVH 4G8FA 2JTDA 4MQSB 2VSCA 5LAXA 1AIFB 3GSWA 2HKHH 9CGTA 3WNPA 3W2DH 5HGDB 4JZOB 2AI0H 5E94B 4KDVA 2V5TA 2VXQH 3SDDC 5AG9A 1W8OA 5DJAB 3N1MC 1EERB 5IW6A 1GOFA 4HC1A 1UM6L 3F12B 3HZMB 4RISL 4IOSD 4RMQA 2DMBA 2Q8BL 5J6GA 2OTUB 2V2TA 4GW4A 2OP4H 2WZPD 1FNSH 1CDIA 1J5OL 3I02B 2FZ3B 4JQXA 3OX8A 4PR5B 3R0NA 3DV6B 1FO0A 1CF8H 4RCAA 2LVCA 3AREA 2FHFA 3GBLA 2PCPA 4W81A 2AJZB 4QF1A 3MXVH 3VXQA 3QISA 1EMTH 4WI7A 1LO5A 3L3OA 1XEDA 2YUZA 3P4MB 3PWJB 3V8CA 3WFBL 3BN9C 4HC1L 3BPOB 5I1CH 2ZNXA 3WDHA 2NCMA 4U7SA 5IHUH 3PABA 3QDJE 1A3RL 4OFYD 5IMMB 2AP2A 2CIIB 3BWAB 3LSOB 1S9WB 1IBGL 3V5DA 5E7FA 1UKTA 4O9HH 5SWZA 4ZUVB 3QUYA 4HFUL 4GXUN 1LO3L 2ZG1A 3QDGA 5D93C 1DLHA 1MFEL 1TFHA 3EIFA 1I8LC 3IKCB 4BFIB 4G6AC 4XHJD 4Q58C 2MCPL 2HLFC 3DXAA 3V6OC 3IFLH 3L7EB 5I1DA 2VDOH 1QBLH 3RAJH 4JFZH 2I60H 4PRID 1WZLA 3D39E 4X6DA 4JVPA 4PRIA 4WWKC 3BH9A 4AM0A 2BSTB 5AZEL 1HH9B 2B4CC 5E2UL 2HJLA 3BZ4A 4GRMB 4OCRH 3OXSA 5DA0B 5IQ9B 3RIFF 3MV8E 4RWYL 1SJXA 1KCSL 2DYPB 1FRGH 5CBAB 4GG6F 2FX9H 1KG0B 2IAMA 4X80H 4G3YL 3MBEA 4YPGB 2BMKB 1I7RB 1OTTC 1EO5A 5T5FL 5EO9B 1U2HA 1DFBL 4AH2B 5L2KE 5DZNA 1YC7A 1QLEL 1S9YA 4WI4A 2EXWD 1V7ML 3DVGA 3KPSA 3D85D 4EJ1C 2GTWB 1J0KA 3GMNA 4YNYA 2ADFH 2P5WE 5I1CL 5F7LB 1BEYH 3FO2B 1A5FH 4JRYB 1IEAA 2OQJB 2EH7L 1CGWA 5A3IC 4FFWD 1ZA6A 1ZLSH 4HIIB 1HXYA 2NLJA 4XMLL 5C08A 4YUEL 3Q6FA 4QKXB 3P73B 2E7HA 2B4CL 4X9IA 1RZ8A 3TCLA 1E28A 5GRUL 2H3NB 1HSBA 4AEEA 3ULUC 3KLAA 3GSRB 3M1BB 4LCYA 4KY1H 3BHBA 1RZIB 2BXYA 3O41A 5IB5B 2HAZA 2CDFA 3B5GA 2V2XA 2F5AL 4NQUA 2VDPL 5HYSA 1E4KC 2J7LA 3I2CH 4Y5VA 5LVEA 2CLVA 1F8TL 4D0DB 1B3JA 5DC9B 3EDKA 2E9BA 3TNNA 1BPVA 1MWAA 5GRVK 1NANH 4LRIC 3CXDL 2FR4B 3FO0L 1FNFA 3GMLB 2MOVA 4JDTH 1QTYT 1A6AB 2RCSH 3OKLA 4X83A 1JGLL 1FL5B 1X4YA 4UT7H 2XTJE 4TULL 1UXSA 1HDMA 4OLZL 5JXEC 2HRPL 3UX9B 1ZXQA 2JCCA 6FABH 2C3VA 3QEGL 4KAQH 2V17L 3BZFA 4ZQKA 4GRLD 5D1XD 5C07B 1FAKT 3G5VA 3P0GB 1H15A 4L4TD 3PGDA 4I48B 2CJUH 5D7LA 4M1GH 5CAYB 1NCWL 1XFPA 1FZOA 4WU7A 1JHLH 1RVFH 1QRNE 1AP2B 3D0LB 1AFVL 4Y2DD 4UQ2B 3AM8A 5J89A 4NNXA 1S8DA 2FSEA 2I27N 4UUJA 1IGJB 4Q6IC 4MNQB 4AEFA 4OZHB 5GGVH 3CVIH 6CGTA 1BZQK 2VDKL 1ZKAA 2OQJA 5DJ6A 2P8MA 3BRGC 4JY6B 5ICZB 1ZHBA 4BJLA 4XNMB 2DQGL 2C1PA 1CLCA 2PR4H 5D7JC 4L8BB 4ZUVA 4YHNA 3FQXB 3C6LA 3MRFA 4P2OB 2XOTA 4HGWB 5C09B 4X5WA 4B5EA 2ZCHH 3G6AB 4HJJH 4I77L 2H1PH 5KSBF 4QOKE 3NIDF 1A0QL 3NH7H 3TH3T 5IHZA 2Y7QB 4OLXH 4MNQD 1DEEA 2DBJA 1U58B 3QIWA 3IDGA 1NAML 5HHOA 1XGRA 4I3SH 2VOTA 5KBNC 4OM1H 4LOUD 5FYKH 3C5ZC 2ATPB 4PRBA 2AK1L 4NQEB 3IKKA 1UM5H 2C4FU 5B39B 4R3SB 1TJHL 3O9WC 1XF5A 2XWBA 3KPRE 1ERNA 2CR6A 3QIWC 3I9GH 4LRNL 1NEZB 2VDML 2AJVH 3B9DA 3LEXA 4HWBA 2E7CA 3DI2B 5I1EL 2AJUH 3K8LA 5EZIL 3MV01 4Y5XB 4YDKH 5SWZE 2DKSA 3W39A 4RGMB 3BDXA 3B9KA 3MLRH 4IMKC 4PJ5D 4PLKC 5IB1A 1P7HL 5D7JD 5F7EL 1OSZA 3X11B 1A7OL 4JQVC 2RAMA 5DJDA 1PEZA 3ZKQD 3IFLL 1VFBA 4N0FA 3BT2L 3GI8L 4H20L 3T2QA 4TOYH 4LGRB 5EOCH 3SKMB 5I16B 3KPNA 4Y5VC 2AQ1A 3HR5A 5T5NG 4F57H 3DNKA 1PSKL 1YN7A 3KAAA 1H8NA 1MPAL 1S7VB 4UTBH 5K59F 2Z31A 4MD0A 5CSZA 3BO8A 3BYYA 5EU6E 1ES0B 3BSZL 5EUOF 3TYGL 5F3HA 4QTIL 3VGDA 4G80A 5EUOB 3NGBC 3SGJA 4M7LT 5C0JA 4K7PL 2NR6C 4P48A 3L1OH 1MSPA 4JFFD 5DJ2A 1S9WA 4LL9A 5LBSH 2VXTH 4BSJA 4BZ1H 2RBLA 3B9EA 1EBPA 3Q6FB 1JZ5A 2P46B 4UT9H 5DEZA 2RCSL 4G6KH 4RQQA 2XZAL 1KT2A 3LMJH 3V5HB 4B7IA 1SMAA 4KH2A 3KXFE 4LVEA 2YPKB 2P44B 1AXTH 2XG5A 3SDAD 2IPTL 3MFFA 5F96H 4L8DB 2N7BA 4Y4KB 1L6ZA 4Y4FB 1Q94B 4MJID 4CU8A 4DN3L 1OTSC 7FABH 3MRGA 5F7EH 2VQUA 3F8UB 4JGUA 4FQ2H 3ZT7A 4I0KA 4GG6E 4CADA 3U7AA 5JW4M 4NQVA 1ADQH 1KLUA 1MHPH 1LP9B 4Z76A 5DJ8B 3MOBH 4OKVA 3W82A 1Y6MR 3O3UN 1OPGL 2BK8A 2ATKB 5FM8A 3SCMA 2BVPB 4XGZA 4F7TA 1LP9A 1QVOA 1TJHH 2Z4QA 4MAYA 4ZAKD 4FA8A 5C6WH 4EQ3A 5DTFA 4PJ5A 4IRJD 4HQQL 4RRPG 2UY6A 1J87A 1S7SA 1A6WH 5TH2B 5EU5B 2VAJA 2NY0C 1JTTA 4I1NB 3P4MA 3L3OB 2QHRH 3NFPA 1S7XA 3L5XL 3NCYS 5F7DA 1YECH 1IVLA 5SWSB 3TT3L 4GQ9H 2X5PA 4WTWA 4ALAH 1SM3H 4IHOB 4ODBD 1LO0H 4WV1C 4IMKA 4ZSOE 4PG2C 3D9AL 1UENA 1LO0L 2VDKH 1WBYB 2FATH 1DQJA 5DQDH 4G9DB 5GGVL 1OY3B 2FGZA 1JCKA 5ANMB 3ROLA 4PLOB 2GAZA 1RUQH 2VYRE 3QHFL 2X4TA 2DQEL 2HKFL 4LLDA 3IXTA 1A14L 3QHTC 4M93B 5ICYB 4ODWA 1EGJH 4XHJC 1UB6B 3EAKA 3AY4C 3BKCH 5L2KD 3C8DA 4WFED 3C5ZA 3HI5L 3B43A 2DWEA 1YPZB 1MF2H 3V4PH 5T1KD 4JAMB 2AXJA 3DVFA 4E9LA 3OAYH 4Y1AB 2P5WD 2EIDA 2O5ZL 4HH8A 1QR4A 2NZ9C 4C4KO 4K7PY 5LCVH 2JE8A 4OI8A 4F7CB 3SE9H 5B38G 3KPRB 5T1LA 5HVWA 3MNWB 1EEYA 1RY7B 1YEHL 4NN6B 4P3WA 2J6EA 2I07A 1J88A 1PYWB 1YDPA 5DRWA 1CLYL 1N5AA 3BX7C 3CMOL 3KPPA 4YHNB 3THML 1T20B 3QZWA 3P30L 4G7VH 4URTB 3CLFH 5DXWA 1T66D 1IKNA 3D3VE 4BH8A 2Y72A 5FYJL 1U93B 4CAGA 1QSED 4S1DD 1LD9A 4OB5H 4P5MB 2P5WB 1W0VA 2BC4B 3S36L 2DIBA 1WSST 2R4SH 3O4LB 5IVNA 3HUJA 3O45A 3O6FB 1ZT4A 3WUWA 1R5VA 4BFBD 5DLML 5KVFH 5C0JB 4XRCB 3GI9H 5FK9A 3QAZB 1AO7B 2E9IA 3EYSH 3K2MC 2IALB 3IJSA 5HPOA 4Q9RL 5F88A 4JG1H 2LABA 2BVOA 4K7PH 4AY0A 2CRYA 2E27L 1WIPA 5E2WH 3U83A 5H8DA 2QQLH 5KANI 1KPRA 4JG1L 4FTVB 5EBWB 5HYJD 5DRZA 1NFDE 4LAJH 1IGTB 3LIZL 4KTEH 3VFNA 4TTDD 4YGAB 5JMOC 4HLJA 3CIQA 3OQ3B 1NFIA 5D2LA 4AK1A 4XPAL 4Z7UB 4J3TA 3MPCA 1I1AC 3UO1L 2GITA 2CRMA 4NWTL 4RWYH 3TJEH 1VADB 1GC1L 4Q97A 1FYTD 4C54A 4OLYH 3T0VA 5CD3B 4TUOA 2W65A 1FJ1B 3VDBA 1YMMB 4TSAH 5BVJB 4K3JH 3HE6D 4EI5C 3QDJB 4M1CC 2HMID 3PGCB 3SKNA 3RJQB 1PZUB 1MVFA 3CJJA 3WO4C 5KVGH 3CLEH 5J3HD 2V2XB 5D5MB 1NPUA 2AK1H 2VXUL 4KHXH 4ZS6D 4Y2OA 1HYSD 3MRRA 3SDCA 3WIHL 5DMGD 4ZTOL 1JV5A 4B7LA 4ONGL 1C5BH 4MCYB 4F2MA 1LEKA 5FDWB 3LKNB 3P11L 3UYPA 1ADQA 3D85B 2AEQL 5AZ2H 1L7TL 2VXVL 2I24N 4XVSH 1OAQL 3V0WH 3QRGL 4NKMA 4EN3C 1OAXL 3D69B 5J1AB 5FGBC 2X40A 3O3BB 1S7TA 2CLZB 3MUY1 4J2XA 1GGTA 5C0BA 1IT9L 3OKDA 3RWHB 1S7QA 3WUZA 5GS0L 2EE3A 3LEYH 5MEOA 1J5OH 4YPGA 4N0FB 4MDIA 5D7IB 4CDGC 1MCRA 1GH7A 5D1QB 1H3PL 2NMSA 3TNMB 5CJOH 1CXLA 2JJVA 3DUUB 4ELME 4KJQD 4Y4KD 1TNMA 3S9DB 1XF2B 4RA0C 4PLNC 5GGRB 3L3KA 2YN3A 2NY6C 1YMMA 3FAXA 3I50L 5I71C 5AEAA 3SGEH 3TWCH 3UEZA 4P5TD 4RGNC 3U7WL 2O61B 4KTDH 3HS0A 2BNQA 3UTOA 3HMXL 2FD6H 3WKMH 1T1XA 5DHVH 4K2UH 2AQ3A 5TFSH 2NY0B 1U8NB 2X9WA 2V9QA 3BESR 4XP9H 4FQJH 5IW1A 1H0DB 2C4XA 5F70A 3WBDA 5JOFA 3KXFD 5TE7H 1JTOA 1N3NB 2Q86A 3SDXF 4M1DH 3BQUC 1RZFL 4N0YH 1MFDL 2EDBA 1ZV5A 4HGWA 1ZSDA 4MJIE 2HVKA 3F7YB 4WW1A 2IBGA 2FGWL 2VDPH 1CDGA 5JO5B 4XWGL 3VXUB 1MJUH 2MPAH 3OKEB 3RDTD 3T2PA 1NGPL 3QDGB 5J56B 2J12B 4K3DL 1KB5B 1NCUA 2Z0BA 4PJIE 4PLKD 3ZE0F 1XGQB 5E5RB 5GIRA 4UTAL 2A83B 2JCCB 1DBMH 2C3GA 2FEEI 1BEYL 2ADGA 3GB7B 3HCVA 5IJKC 4N90E 5DJZB 3SBWC 1U8JB 1BWMA 1M6OA 1TPXC 4PJDA 4V1DE 1AGEB 4MQXC 4Z0XA 5TE6H 2IH3A 2FB4H 4NZDA 1BBJA 2X89A 3T4YB 2E9WA 3UYRL 4FP8L 5HGAA 5ISZD 1PKQE 3X12A 4AEHL 1GZPA 5D1QA 1DSFH 2FBOJ 5F3BA 3SCMC