1TEYA

Nmr structure of human histone chaperone, asf1a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
156
structure length
156
Chain Sequence
b'MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASF1 anti-silencing function 1 homolog A
publication title Structural basis for the interaction of Asf1 with histone H3 and its functional implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 28
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 1teyA00
2CU9A 2I32A 2Z34A 4RRPM 1TEYA 4EO5A 5C3IA 5BNXD 4ZBJA 5BO0D 1WG3A 2IIJA 2IDCA 1ROCA 5EIIG 2Z3FA 2DZEA 3AADB 2IO5A 2YGVA 2HUEA
chains in the Genus database with same CATH superfamily
1FL3B 1H6UA 1UCTA 5MERB 3T1FA 1IGJA 3DTUB 1S78D 4ZXBD 4UQ2B 5E8NB 4PV8B 3HPJA 1IEBB 1Y0LB 3ARUA 4NN7C 3M45A 4P04A 4UU9B 3HG1A 1LO5A 4B9PA 5EORH 3O45A 3N40F 1U8MB 3QRGH 1WFUA 5DVPA 1JV2A 3EF7A 3BAYA 5B7EA 1GVIA 3U9UB 2QVIA 3BIKB 3CFTA 2XYCA 3DMMD 2FZ3A 3EH4B 2VQ1A 1QFWH 3S96A 1CF1A 1J0HA 3MRLB 5JPMC 2JLPA 1B0GB 5FYKD 1MHHA 4G6ML 4AOFA 5EU6D 4KXZI 3BKYL 1CZ8L 1G6VK 1FYTB 3MJ8B 4X9IA 2YAHA 1QO3B 2PXYA 3GMOA 3BT2L 2I27N 5IHZB 4OT1H 4ZZFA 1DBMH 1URLA 5E2UH 5CILL 1NFIB 2ATPA 1PD6A 2NXZD 2X4NA 1ZA6A 2X3AA 3DJ9A 3NP4A 1PIFA 2LLGA 1MFAL 3O3AB 1HEZB 2OYLA 3L13A 3WEXA 1KEGH 4NKOA 4JKWA 1UM4L 2Z7UA 3GMLB 4P3CH 3K6DA 2Z35B 3A22A 4MMZC 2AK4B 4PJ7A 5E94B 3MRRA 1PG7W 5G4OA 4PWEA 3TBVB 1U95B 1RK1B 5I30H 2XYBA 2AFNA 1WIUA 3TYGH 4DKEL 2UXFA 5JMRA 4EI5C 1E28A 1GC1H 3BCDA 1YY9C 5IROA 3I75B 4OCRH 4PWFA 3K3QA 4KHTL 4TXVB 4Y89A 1HXKA 3QQ4B 4KJYB 2HLEB 4WFGD 2XG4B 1T04B 4Z76A 4BDVA 1TSHA 2FD6L 1S3RA 2VLKA 1UURA 5CS7A 2DQGH 2XXFA 3MRHB 4QJ3B 3TBTA 1Q0EA 1M2VA 3MODL 1DLHA 3F85A 4JO2L 3P1VA 4UNTA 4KKAD 5I8EA 2RALA 4N90D 1UJ3C 4DH2A 4U1NA 4TVPD 4UAOB 5DURB 3W39B 1URZA 3U1PA 3DETD 2PYEB 3S8FB 4LMQI 4HFUH 2B3IA 1HFUA 1O0VA 4FG6D 4UWQB 5C09A 2UY6B 3QWQB 5B38G 1OL0A 3KYMB 1HHGA 1VAHA 2YRBA 1MI5B 2Y7NA 5T1LA 4N0FB 4B5ZA 4F8OA 4CC4C 2VDOH 3T8MA 2WZPA 3AG3B 3FBKA 5K39B 3P2TA 2IQ9H 4HGKC 2FYVA 3A5VA 4IBWA 1ETZB 4L37B 4NO3A 2R0LH 4MMXB 3LZQA 4Y7MA 1IKFL 1OALA 5D96B 3VRLF 4XXCC 3O3BA 1OARH 4WWOA 2WOBA 1WT5A 1DUZB 2BIHA 2QVKA 3DROB 3HS8A 4MJIE 5KYUA 4QRPD 3X3FL 3APNA 1Q0YH 4B7LA 2J1ZA 3V10A 5IMLB 2NNCA 4F58H 2BY0A 2J8UF 3KPQB 5SX5H 2FR4B 4P05A 1ZLVH 4ZK8A 3RDJA 5HVHB 2MJWA 1KFAL 3TBSB 3U0PB 4PJEE 4IHOB 1JPSH 4BQ6A 1VRSA 3WJMA 5DQDH 3BZFA 1PBYA 5C97A 2VZ3A 1XR8B 4L8DB 3RPKA 4ZX4A 5BUAA 2FE0A 3FUJA 2ZP9A 4GSDL 2NDGA 1W8NA 1BAFH 3DX8B 3MACL 2A38A 1WAPA 5FW6A 4TUOA 3FB6A 5IFAL 3IETB 4KK9D 3H9ZA 2CHDA 3ZYZA 4RQQA 3BP6B 3HE6C 5EWIH 3PYCA 4PJ8C 5E51A 5IJKA 2N7SA 4KZEL 1FP5A 2FJUB 3UC0L 4NNXB 5F6IC 4WY7L 3NBNA 3BGMB 1FZJB 1WZAA 5AW0B 1T2QL 5DC4B 4ZW7A 5CEZH 3FU9A 5G5DB 4H0GA 5IVXB 4DP1X 1JAEA 2MKLC 3KLDA 1EJOH 3IDIB 3L5XL 3O4LA 1JUFB 4QHNB 5F3HA 2R15A 4R4NC 5J3HC 4BK4A 1GPOH 3HZKB 2XA3A 4KJQD 3NRQA 3ARED 5IHBA 5T5NG 1A6WH 4NLAA 3TC9A 3NTCH 3HUJE 4Z7UB 3ARDA 5D7LA 2DWEB 4U6YB 1YMMD 2DKSA 3I2CL 4NQDE 1WAAE 5HHVH 3CFJA 5EB9A 4P2RA 5T3XH 4PQXA 1MFCL 2XT1B 3F83A 4HXAH 3U0TA 4ZRGA 1DFXA 1EEUA 3QUXA 3QDJA 3VTMA 3JV5A 3MLVL 2P45B 1OM3H 3WE6A 2R2EB 3QC6X 1ZT7A 4MZIA 1KCVH 2Y1AA 4PGBB 2E27H 2IFFL 4OD3H 2OL3H 5SWQB 2NX5B 2BNQB 4PJAF 2B2XH 1YC7A 2CLVA 4DK3A 2FJGA 4NN7B 2YHGA 3T4AA 2AXGB 3IPBA 4RWHA 1ZJAA 2OI9C 1WBYB 4XAKD 1A1NB 1DQDL 3BAIA 4Y4HA 4LQ1A 3B9KA 4YDMA 5C0DB 1RZ7H 4Z78A 4OJAA 1IBZA 3INOA 2OSXA 3OHXA 4Z7WF 3APFA 4NT6B 5HD8D 3MV11 4K5MA 2YUXA 1T5WB 2UYLB 5JPMB 4OVUA 4XB7A 1CI3M 3JZYA 2XG5B 1HHJA 4XTRC 3CWGA 5C6TH 5ALBL 4Y2LA 3MJ6A 3NCYS 4LF3A 3LN4B 4CMMB 3Q0HA 4U2ZA 2YGQA 1NGPL 3D85A 4PYGA 2QVTA 3Q2LA 1PJWA 4ZO9A 4G2AA 3WNMA 3QWOB 1OKEA 5ICUA 1HXYA 5BZDA 3IK2A 4UTAA 4XN5A 1HEJC 5HYSB 1CT8A 2Y5QA 4GS7C 2WLIB 4NO2A 4JFFE 3RVWD 1T4WA 2AI0H 3OBAA 4BFJA 4P2OC 4MMZB 3RWHA 3WNLA 1Z5LA 3EO9H 4W9KC 3ILPB 2Y25A 1JZ7A 4PWGA 3ARGD 4UOW1 4HCIA 4LQFL 1CJYA 4V2BA 1U3ZA 5DR5L 5IB2A 2QQLH 1JNHA 3BMVA 2HA1A 1MNUH 4DEWA 2DKMA 1MHPL 4BQBA 5ANMB 5DUPH 2QQKH 1LD9A 1IM3A 2G4EA 1CTMA 5F93C 4MNQE 4OUUA 1JZ8A 1J9SA 4LLMA 2HPOA 4NC2B 4U05A 4MB3A 4RH4A 2CR6A 1AKJA 1AOZA 1I1AC 1T3FA 1H3TA 1WTGT 5D7JD 4PI2A 1NCBL 1IILE 3O2VH 1A22B 4KKQA 4MX7A 2ZOOA 2BNUA 1GSMA 1L7TH 4BXSV 2YZ1A 2C1PB 1YG9A 2X4TB 4H1LH 2LABA 3H2PA 3T2PA 5INDA 3B8SA 1CFQB 3GMPA 4OI9A 3IRPX 3T0XA 1ORSB 2ZUQC 4Y16D 2XN9A 4E41B 4L3FA 2BW4A 1NUGA 2R29L 3QA3B 3VG9C 4HV8A 1KDJA 3B5HA 5DQJA 2V7NA 1V8HA 3FMGL 5GPRA 1U30A 1R3KB 2Y5TB 3MV7B 3KPPA 1NDMA 4QKTA 1LK2A 1PSKL 4OAWB 3REWA 3MV8D 4YDVB 3OR7A 2MQ3A 1P6WA 3MYJA 4X6EB 1J48A 5IQOA 2D7OA 2XTJD 1N68A 2R23A 4G80A 1FGNL 3NIFE 4XMPL 4YE0A 3U0WL 3WE1A 3PLYA 5I1HL 3DVGB 1TYJA 3RVXC 4YZFF 1FN4B 5HDBE 2WIIB 3ECQA 5GGRA 1AGFB 1AQKH 5I6XC 5ID0A 2A83A 2F7IA 5CLWA 5D2LB 1C5DB 3GSRA 4IRJD 3UTTE 4YHNB 3ZBMA 3T0EC 4HIIA 3AMKA 1KTCA 1WWWX 4FTDA 1U8PA 4KY1H 1P4BL 4BQ9A 2XN0A 1P4UA 3OKEB 2GC4C 3SCMD 3G3LA 3VXUE 3P3RA 3HIZA 5CZKA 5E0QA 1SPDA 1KF9B 4N2IA 4XVTH 5KZCB 4KV5F 4OGAD 2DM2A 3BEVA 4YK4C 4UQ9A 3JV4A 4UCFA 3L4XA 1S3KL 1NOFA 4LARL 5L4MA 4V1DD 3PY9A 4HS8H 2BZCA 1G7QB 2DQDL 3MCYA 1MDAA 2WUBH 4HK0B 4LLYA 4MD4B 4LPXA 1TVHA 1H5BC 4NP9A 4OLZL 4WW2C 5F7YC 2CCWA 4HDIB 1RFDL 4HCRA 3V8CA 3ZK0A 1JK8A 2VMEA 2CLZB 2VXVL 4DOHB 2DMCA 2AJSL 3LN5B 4WFFE 2O6FA 3BXNB 3MROB 5CMAB 5GS1C 3GKWH 2IPUK 2NLJA 5HHNB 3KWXA 1EEYB 3U2SB 1I8AA 2IWKA 5D70H 1MCWM 2YJQA 5E6UB 5IVNA 4LSVH 1L9TA 1R19A 3WD5H 4J3BA 4MKTA 3W11C 2JNZA 2MFNA 3ZYJA 4MRCA 4OZ4A 4UT9L 2LLNA 1RV6X 2NW3B 2DQFB 1RUPH 3CDGB 4NQSB 3VU2A 5FO8A 1KN4H 3UPCA 2ZX5A 5GJSH 1LMKA 3GMMB 3L2MA 3QIWC 5FV1L 3JV6A 4JFOB 4KNUA 2X70A 3P9MB 4TVUA 2KMWA 3VFRB 1GGCL 3NSJA 4NZFA 4BRJA 4WUUA 4Z7QB 2Z1PA 4AKPA 1MJUH 2OI9B 1LO0H 4O2EB 3SY6A 2CJUH 2H32A 4BCZA 3PJNA 5JW3H 3HE7C 2DQTH 2NSQA 1C9SA 1UVQA 2K9UA 2HT3D 1MZZA 3EAKA 4XAWH 4PJBA 4YDJA 1E2VA 4L1SA 1HZLA 3L3GA 2NY6D 2IPTH 2AV7A 1R0AL 2V6HA 4PREA 3DUUB 3MBWB 1CICC 4F9LA 3TEWA 1AIFB 3R8BB 3PE9A 1YPZB 3DYPA 4FP8H 3SD5A 3A6CH 3JYCA 5C0RL 4MQ7B 1HH9A 4JFEE 3WNKA 1KB5B 1IE4A 3GHEH 1GOHA 4GRLA 4OCSH 3AM8A 1ZTMA 4UIKL 3LHPH 1IGCL 5JR1L 1HAUA 5BO1H 4KUCD 4GS7B 3ASNB 3ZE1F 3GI9L 4RDQF 3QP3A 1YNLL 3EGXB 4G7VL 3U4KA 3SYPA 4GIAA 4PTUB 4WV1B 3P73B 5GRUH 5CGYC 5AYUL 3MI6A 1EMTH 1DQVA 3UADA 1YEEL 1WSST 4ECNA 2GK2A 1CO1A 5LWYL 3FQTA 4YPGB 1NSNL 2VZSA 2CDGA 1DVFC 2VDNB 3FQYA 3GBDA 3VAEA 4E0RB 1P9MA 1DQLL 1QBLL 3BWZA 4BZ1L 2ZKHH 5J6SA 4PCKA 3MA7A 1CFTA 1EJ6A 3D5OF 4XMXA 1NL0L 3NJXA 3MAWA 4P57A 1KN2H 3AVEA 1GZHA 1UD3A 3K1DA 4WWKC 4YHIB 4X5QA 4LVOC 3ZMEA 4A7GF 2WAQA 2O93L 4TQEH 3EYQC 3L3HA 5I73C 2EXSA 2OTPA 1P69B 1ITBB 2YGNA 3VB8A 4E9XA 2YPVH 3PXLA 4D0DA 7FABL 4M5ZL 5D6CA 4MD0B 3B7SA 1EAPA 2QMKA 1QRNE 5FYKL 5A2JH 5DWUH 1S8DB 3VWKC 4HISA 4JRWA 3X1EA 1W9XA 1BVNT 2EIJB 3Q8CA 2ZUQB 5JHLL 1TO5A 4QRFA 2WMPB 4JFPA 3UL4A 1AGCB 3I02B 2VDRL 1BLNA 2DYPA 4L23A 2EEXA 1UXSB 2X6MA 1JF6A 2NY5L 2VL4A 3S4SB 5HHXL 2L04A 4JDVA 3TJHC 3PUCA 1DJSA 4OCWL 1YYMH 4JG5A 3TO2B 2W0FA 5ILTH 2CAKA 4MVBD 2OCFD 2GTWA 4FC3E 4OJCA 5I16A 2Z92B 4KQ3L 4LAQH 5GHWL 3F65A 2OR8A 4OW6A 4MFHA 4WI9A 1OSEA 4NRXA 3X14B 1FNAA 2RHEA 1OF0A 1XDTT 2DMKA 4GMTH 2XBTA 5I1KL 3FO2A 32C2A 3LKNA 4Y4KC 1W0VB 3NJFA 4FXTA 2FL5B 3BRGC 3GGWA 3QQDA 1JD7A 5I6XB 2K7QA 5JOPD 2F68X 3UP1A 2XWJA 4XXWC 4KAQH 1ACCA 2E4FA 3CLEH 1GY2A 3T0EB 1ZV9A 3K6IA 4Y5YC 5CBAB 3O0RH 1UB6B 3NK4A 4F9PC 3B6SB 1EEZA 1YDPB 3WFHB 3FU0A 4YHLL 1MLCB 3AXLB 4LLUA 3RWJB 3HS0B 5JXEC 1QQDA 3B7UX 5KSAD 1RMFL 2EDFA 3G7TA 4YDNA 2GUOA 3UTPE 1GJWA 2IMMA 4PJEA 4Z7VA 2HG0A 1RPQA 4YK4B 4FQLL 1P7KA 2XTLA 3EFFA 4LU5H 5F9JA 4JQXA 1EZVY 4GW1A 2QJDA 4TVPL 2VLJB 2D2OA 1CQYA 1I7ZB 3MU3A 2NYZA 2EADA 25C8H 2J6EA 1FLTX 4I3RH 4YNYB 5SV3A 3QQ9C 4IBUA 4TSCL 5T33L 1NAMA 4PJFF 3WUWB 1IARB 2DN7A 3JWOH 1A9BB 1H5BB 4KMTL 4L8SA 4ZQKA 4UM9B 4WW1A 3QDGA 3F01A 3WS6A 1XF4A 3QQNA 1Z5YD 3CLFH 1N0XH 3GBNL 1RZKL 1RZJH 3GTVA 3SDCD 5I8OH 4RBPK 3V4VB 4FADA 2HXAA 4KTDH 5IQ7L 2V5TA 2V33A 5L8KB 5IUSA 5GSRB 4OLXH 3K72B 3MRBB 2AMGA 3MUJA 4G3YL 1XSOA 4DFHA 5I2IA 4NWTL 4MTMA 1QABA 2G9KA 1N8ZA 4HKXB 5IFJB 4X4ME 1FVCB 4WI6A 5AZ2L 1G9ML 2DDQH 3E2HB 5ADOH 1HX0A 4FFYH 3QNXA 1WIPA 2XWRA 5DHXB 4EXPX 2DWTA 2XWBB 3RB7A 3C8HA 4EEEA 3INUL 1F3DH 5J4MA 4QRQB 4NX0A 3RWIB 4NQDA 1WAAA 3QJVB 4S2SA 1MJ7H 5HGHA 2Y2WA 2F6AA 1L5GA 1YEJL 2XQYG 1Q94B 1TCRB 5T5FA 5C8JA 1V05A 3EH1A 1T2XA 4ZOBA 3IJHA 2JJSC 2PPFA 3HR5B 1SDAB 4PM1A 5JHDE 3U6XS 5ABZA 1RK7A 3EBGA 4NQEB 4PJCF 5ERWA 5CCKL 5DQ9B 5DZNA 1KYUA 1DCLA 1FG2B 1CICB 4F15C 4RNRA 3QXVA 3D2UB 1ZANH 2P1YA 2N59A 3QI9C 3SE4C 5IGXL 3HNSL 2R56H 4FQQA 4DGVL 1WBZB 1Z9PA 4P3DB 2G3MA 2J3SA 2Q7YA 2YUWA 2RQ8A 3T77A 3WIHL 3IE9A 4RSVA 2O61B 4QHMA 4G11A 4GQRA 3X1BA 2XICA 1H3GA 4G6KH 3NCJH 1S9XB 4JFZL 3ZR6A 3ATAA 3NFNB 3ESVF 3QG6A 1BAGA 1JE6A 1TVBA 3F7LA 3WHXA 1I8KA 1OAZH 3K4DA 1KOAA 5CIPH 3LMJL 1RUAL 2NRDA 4MJJA 1KB5L 2EE0A 3O4OC 4FFZL 1QD0A 1AJ7L 1PLAA 1TKWB 2OR9L 3EOTL 2EVJA 4XNUL 4RFEB 1MNNA 1DVFB 2ZX6A 3G6DL 2LE9A 2Z0BA 4HZAA 5HYQA 3V0AC 4PJ9D 3FFDA 4JFFA 2WGNB 1K4CB 4FEMA 1E7VA 1OCRB 5GRWA 2QPSA 3AGWA 4OD2B 3SDAA 3TFBA 1RUML 4OM1L 2AXFB 4NOFA 4WWKB 4LVOB 4RA3A 4ELME 3EYVB 5E2VH 4PJ5E 5F1NA 3P11L 4OFIA 1S9VB 3V4PB 4LGSB 4X4ZA 2G5BB 5FB8B 2L7JA 2XOTA 3JTTA 4K55A 3RILA 4BFBD 1U8LB 2D03L 1F4XH 4IEFB 4HJ1A 1Z9SB 4JDZB 4TLKA 4MNQA 3RZCC 1DBKH 2UVEA 3FPYA 3OLGA 3PIQB 4NQXA 2HFEB 4AMXA 4EUPB 4Z95H 4U6HB 4TLTA 2VH5H 4U4IA 3VFMA 4J39A 3VNZA 3UBXI 2QKIA 3VWKB 5D1QE 1TIUA 2VDLB 5EC2A 3UG5A 5DXWA 5E4EB 5D2NC 1LE9B 1NAKL 4O4YH 4WI2A 3SO5A 1LM8V 2M1KA 3PQYA 4J3UA 3CMOH 4F5CA 2BNRB 1NCCL 2C4XA 2Y23A 3UROR 4DFIA 4IJ3C 1AO7A 2HMIC 3W37A 3ZDXE 3ROLA 4Y19B 1A7NH 4PRBB 3CJJA 3ZSTA 1TETH 2W60A 3M1BB 4R0LB 5BVJA 2G2PA 5F0JB 3BLPX 1WEJH 1WPCA 2VABB 1I8UA 2P42B 4JFDA 4NNPL 1YCSA 3GHBL 5IM7A 4XOEA 3ZPDA 4BELD 2H3KA 3MRMB 3F7VB 3QWRA 1PKQE 4Y5YB 5AVSB 3BQUC 3FYEB 4N4YB 3VFPA 3QNZA 4HWBL 1RULH 3LKRA 4A6YL 3P0VH 1BIIA 5BOJA 2AJYH 1AS8A 3FTGB 5ICYB 1S7VA 3VXRE 4JPQA 4LHUD 3C6LC 2CHXA 4WO4A 1PIGA 2W0KA 3M7FB 5AUMB 4YFEA 1MF2H 3PP4L 3UTTA 4TPRH 5JQ6H 3ULUC 1J5HA 4O2FB 2HVJB 2XXCB 2WLJA 2V5SA 2WD0A 2KPNA 3N41B 4IDJL 2XFXB 3BP5B 3RAJH 5I1LA 4JPIB 1Q8MA 2APFA 4WGWB 4ZMWA 4NO0B 1EZUA 1NJ9B 5JXAL 2B4CL 4AEFA 4DF9A 5D1XD 1RZGB 5HGDB 2JWYA 4QRUA 1OIOA 4FTVA 4PP2A 5DD6B 3EYUH 3QEHA 3PHOB 5E6IA 1UXWB 4MQXD 3T2OA 2WXMA 4K23H 1HDMB 3N50A 2DYRB 3GSVA 3RTQC 4M48H 5LGJB 1RHHA 3UZVA 3QCVH 3Q7JA 3KWUA 1NCWL 2AAVA 3QUKA 2W92A 2FWOB 4PYHA 5BRZE 2EIZA 2FX7L 1JGLH 3VQLA 4PSPA 4OIBA 3MOAL 2E9WA 4IS6A 4YZWA 5I18L 3BH9A 1OSPL 1YN6A 4F1ZA 1XD1A 1P7QB 1SHMA 4H2AA 2CD0A 2QT6A 2ZJSL 3W2DL 4GKZA 1GYAA 1V7MH 4LPCA 2FVNA 1L6ZA 1SF5A 2CMRL 1U8CA 3C8KB 3SE9H 4ODUB 4KWUA 4DZ8A 3NSXA 2HJLA 3L5JA 1XX9C 1K3IA 1RZIA 3LDBB 4XNZC 5B3NA 5LAXA 4KKBC 4HSQA 3GS7A 3PU7A 5HHOB 5E08L 1P53A 1OT1A 3KCPA 4RISL 1MVFA 1BFVH 2WWNA 4P9HC 1EIBA 1ZTXE 2NR6D 3O81A 3V6ZA 2A6KB 5JW4M 1LP9B 3U9PL 1F18A 1EGJA 3QVAA 4ALAC 3DX7A 3HZMA 3IJYA 1BECA 2GEEA 1SM3L 1M1SA 1YYLH 2XKUA 4LSRL 1AOHA 1SDYA 3D0LB 4F15B 1Z7JA 2QSTA 1QSED 1VESA 4IOFD 5HXMA 1NGQL 1VB9A 3QI9B 4OQTH 5EPMA 3GHPA 4HIEA 4HKBA 4XNQA 4GAFB 4U1GC 1H9VA 1JPGB 2J73A 3IJ8A 2OJ1A 2YMXH 3RFZA 5KW9H 2HTKD 4PGCA 4Y1AE 3KHQA 2WQAA 2BSCA 3BAKA 5DZ9A 1NICA 1YNTA 1JCVA 5EO0A 1AZCA 1ZJBA 5EBMA 2VR8A 5DJCA 1HKLH 2C7UA 5H94B 4D8OA 4JFEA 1SN2A 2VDPB 1INQA 3PHSA 3O4OB 1K8IB 1T1YB 2OMTA 1EDHA 1BJ1J 2IDFA 4HPHA 4BZ2A 2VR7A 1BPVA 1FE8L 2IH3B 5ID1B 4S11A 3W81A 4D94A 3W5MA 1JD9A 2JK5B 3K74B 4C47A 4JM4L 5CSGA 5ELIA 5FECA 4EOWL 1PF3A 2VLME 4PB0L 2W94A 4H5SB 2WXLA 1PQZA 2JKRM 4PJGA 2ZXBA 2I69A 1JSYA 1FIGL 2RCSH 1R24B 2NNXA 5JOFA 2OTUA 3VXNB 2H2PD 3AT9A 1GTNA 4PBVC 4HIJA 4XOCA 5AG8A 3PAZA 3ZO0A 2I9LB 3RZCB 1E5ZA 1I9IH 3ATBA 3VI4A 4BH8B 1GRWA 1IBGH 3QJSB 4QXTA 3SQBA 1TFPA 4FFWD 1FYTE 5SX4I 1CDBA 5IHWA 4OFYA 4UMGA 5EFIB 5IFHL 3V4PL 3U4EA 3QZNA 3FT0A 2J8HA 4JBSA 1NFDB 2FNWA 5D2NB 5H35A 5HYJA 4L48A 4X5WA 4GFTB 2O1AA 4LSQH 3QNFA 3HMWL 4GIOA 4YR6B 4XNMB 1BQRA 1VGKB 4NI6A 1G7IB 2OSWA 3UZEC 4HBQA 2OK0L 1Q1PA 2C9XA 3EFDL 1YN7B 1U8HB 1CL7L 1AP2B 4LASL 4Y5XA 4LSUH 2VDLL 4B97A 2AK4E 3EH5B 2X6AA 3W0WD 3ZL4L 3MV01 2YPLA 5CP7A 3TWCH 3CFNA 4U1MA 1WP6A 3NA9L 3CFEB 4NQCA 4ZTPH 2H0EA 1FCCA 4L0ZA 3EJCA 4YO0A 4HWZB 1WUZA 3NACL 3CQPA 5EUOB 2BOCB 3MJ9H 5AEAA 1CURA 2EZ0C 1NMBH 1ET7A 3LZOA 5AG9A 2I85A 1Y1DA 4JW3A 4PHXA 3BQUB 1NIAA 3BUYA 1UM5H 1UD5A 1WH0A 3D08A 1Q1JL 4FMFA 5DEGB 3PWLB 5GGRY 1FAIL 1ET8A 4KROD 4BCYA 3BZEA 2IWFA 3C6LB 4J8QA 1TJHH 3JUYA 5IB3B 1YSOA 3KPTA 3DX0A 4JN1H 4V2CB 4Y4FB 2YQGA 1W80A 4G71B 1XGUB 1P4LA 4WIQA 4AYMC 5TH2B 5BZWB 3LD8C 2LFEA 1PLCA 2N01B 3K1KC 3N06B 4ODXA 5L2JB 2PYEE 5LN4A 2XVGA 4YSOA 5HHQA 4K3DH 1M3JA 5CJXA 5LCVH 4ZMXA 1N6QL 2P7TA 3J2PA 1ZSDA 1OHZA 1A7OH 3MJWA 1MI5E 4WTQA 1XIWB 4K71C 4NO5A 3P4LA 4YSAA 3KPLA 2A1WL 4XVOA 4AYDC 3RTQB 2QQNH 1S7XB 3OKLA 3LOWA 5INCB 3EYOB 2ZWKA 3KBHE 3BPCA 4EJ1C 4M6NH 5EMYA 1N64L 3DLQR 5B8CA 5B39G 3UBXG 3QDMA 5C2BH 3W56A 5IOKA 1JDCA 3TPKA 2W38A 4RDBA 3FB7A 1K4DB 5JLZB 3TZVD 2ADFH 4BFOA 3WTXA 3D3VD 5F7AA 5EN3A 3TGXA 5F9OH 3C08H 4QRRA 1E9PA 4AJWA 5C9JB 1NLDL 3MGOA 4FOMA 3IN0A 4M4PA 5KJ7E 1JXGA 3BWSA 4G7YH 3ES6B 3E80A 1OE2A 2R27A 4X4MA 1ZDQA 3GDCA 3OJDA 2ZUTA 4K4KA 3EH2A 2YD5A 3HB3C 3MRNB 2AEPL 3CFUA 3H1ZA 5I8CB 3LSOA 5CZXD 4KRMB 4Z3GA 4OZIA 1OTSD 1B0RB 3M17B 2PWEA 1YEKH 4B0MM 2Q9OA 3US1A 2WWMC 2EXWD 1HESA 1NH6A 3BSZL 1JRHL 2RQEA 2V2XB 1LNUA 2ZIDA 2Z8VC 3L3JB 2A5UA 5DJXB 1JHLH 2GY7B 2OJEA 3UTQA 3HHSA 3WEOA 3HNTL 5E00B 1RI8A 1YQVL 4G8GB 2D73A 4YE4L 5IVXE 4JY5L 3CZNA 4ENEC 4GQ9H 5JHDA 5DLML 1COBA 5TFSL 2YAOA 3O2DL 5GZND 3S5LG 1HN1A 4G6FB 4ZG1A 5E8EB 4N2AA 3QEQA 4OCYH 4P46D 4YHKH 5MHSE 3T3PF 3WDHA 3WY2A 4IIQC 4Z7UE 2OKMA 4BK5A 1CXKA 1IB5A 1BQ5A 4L3CB 1WC7B 3QUMA 3A21A 2ZCLL 1DO6A 4W9DC 2XA8H 5CGBA 3TN0D 3UYRH 1CFVL 2QPFA 3LIZA 1S7QA 3LS4L 3EBIA 4BFIB 3KYAA 5BCAA 3KJ6L 3UZQA 4RX4A 4NEHB 1L7IH 3B7YA 3US9A 3OF6D 4XP4H 4NZTL 4RGOL 3DXAA 5DGRA 1Q38A 1OPOA 2X1WL 4OFDA 4YXHL 4GAYB 5T1KD 3P40A 5CLTA 1SXAA 1FL6B 4CKQA 2GI0A 4X9GA 5DJ8B 5B1JA 1G1CA 4ERSL 1NWOA 2NX5E 2BNQE 2ICWJ 4PRIE 4OLUL 4KK5D 1XH2A 1D9KC 2VDPL 1AXTL 1MHEB 1NLBH 4FE9A 1HHKA 2F18A 3CPLB 3RGVA 2WVVB 3SBPA 4KJWD 2X89D 4HEME 1ORQA 1A25A 1MVYA 2Q8AH 3L2LA 2APXA 4KKCC 2K6ZA 4L5FH 3UX9B 4XCCH 2IAMD 2GHZA 2NNAB 3B5TA 4OJEH 1LEIA 2X0VA 1Q90A 3IKCA 2J6WA 4KXAA 5TDOB 3UTSB 1IIIA 4ELMA 4HJSA 2V5RA 3WNNA 3FOMA 4IOIB 1OLLA 2BFGA 3GXDA 2KZKA 1PKOA 2JVUA 3JBG7 2UXVA 3PHAA 2CIIA 4PJHF 1BVLA 4XN2A 3LHAA 1X5XA 2QFPA 1YA5A 1YEHL 2XBDA 1DSWA 3OSVA 1UB5B 2EDLA 2XZCH 5EEYA 3SYQA 1AQDB 5D1QA 3RVVC 2Y7LA 2WXOA 3F7KA 4XWGL 3BW9A 1QSZA 2ZG3A 1LWJA 3BH8A 4FLRA 3ZYIA 1UWEL 2WO3B 5FO9A 4Z23A 1L3WA 4M1GL 2WM0A 4WTZG 1D6VL 1ZWIB 2F19H 3MNMA 5AOMA 4NC0B 1VFUA 4QY8A 3N9GL 3V0FA 3UEZA 1XAUA 3SJVD 1DEEB 2DI9A 4QRBA 5ANME 5CJOH 3T0WA 2GB2A 3H9SB 4CRPA 5E9AA 3F7YB 2VUOA 4M8QA 1XGRB 4P2QD 3NJNA 3MLZH 2P8PA 1IGTA 1HOEA 3C6SA 3X1FA 1NPJA 1KCUL 4XBPB 1R9FA 4MS6A 4MJ6A 5ESAA 2EYRB 1XSKA 4QUOA 5I1AA 4QHPA 4O9HH 2J6EH 3H2WA 5ISZD 4XBGB 3RY6A 3QDAA 4YSRA 4FA7B 5FHAH 5B1CA 5EU5B 1YAZA 4R3SB 5J0BA 2NZ9D 2I26N 2B1AH 3EG9A 3MX0B 2UWEF 1OB1A 4E41E 3U46A 4FGMA 4HLZG 4FQPA 1EK3A 2LU3A 1HH6B 3SPVB 4Z3FA 2EXYC 3OLDA 3P02A 4I77L 5CJBA 5D1ZI 1ED3A 4K71B 3MV7E 3N44B 3RDTA 2ZX7A 4XPFH 4C4BA 3WXVH 3IWVA 2LAGB 1A2YA 1NGYA 5F7KC 4HZLA 3W82A 4ZTEA 3IMVA 3B2XA 3EYSL 4LP5A 2VW4A 2H1XA 4GAJH 4LDEB 1EWHA 1X9QA 2VT0A 4ZUTA 1BZ7B 2HKFL 4J6RH 5CSBA 3FO0L 2NMSA 2EDRA 3EOBB 3OPZH 4S1DC 3ZL1A 2CKNA 2BSBA 4YQXH 5JPNA 5IW6A 3ZHKA 2CBTA 1XF5B 4X6BB 2HVKA 3JQOB 1SHSA 5D2LE 1QATA 3BN9D 1Q4NX 4L8BA 4ZUWA 2GT9A 1P1ZB 1NBQA 4ANKA 2UVFA 2D9CA 3S37X 1K5NA 1RP9A 3ECWA 3V6FB 3BUPA 3HB3B 2DM4A 3TVMB 2CKBB 1MRCL 2CUAA 3KH4A 4AKQA 1UA3A 4BGLA 3QJOA 3WFBL 5C92A 2EICA 2DEYX 2WNWA 3J27A 3O11A 5CCGE 2PTTB 4Q6YA 1I3RB 2OMXA 4O2CB 3BJLA 3VGBA 1PFOA 4MMYA 1FZKA 1B4JH 3RLSA 2AABL 5DTFB 1NCDL 1XGPB 1RIHH 5D7SL 2FLMA 4Z7WB 2Q76A 3OKNB 3EOAB 2V2TA 3V4VH 1VFBB 5I1CL 4CADA 4RBPH 3PL6A 3VFVA 2WZ0A 5ESVB 2DQ6A 2VQUA 3KS0J 3G5YB 4LL1A 1U4EA 2E75C 1OF2B 1WBXA 2DJMA 2PWGA 5CF3A 2R9HD 4DOHE 2BSRB 4N2DA 4WUKL 3U2JA 4F33A 2DW5A 3MHZA 3E6HA 2X4RB 1WFMA 4G8EB 4FNRA 2OYKA 4AUYA 4IIQB 3F84A 5E8OB 1JK9A 3L1OH 4M1CD 4Z18A 4Y1TA 1FC2D 1FLRL 3OAYH 4AY0A 3AGVA 4OV5B 2O5XH 2CM5A 2NY2D 3DSFH 1E8WA 3LRGA 3V6OC 1FNLA 4QXUL 1LXMA 5I1IH 4RGND 3V9EA 1OOAA 3FAWA 1BSIA 1NOLA 1HSBB 4XP6L 5EEWA 1W6WA 1IKOP 3NCEB 2XSKA 5FHBH 4NKMA 1D7FA 1YJDC 2EYTA 4Z7QE 1MCCA 2FIKA 2RD0A 2VZOA 3FN9A 1QR4A 1QUPA 1XBDA 4R3SA 4AVKA 1FL3A 1B4TA 5MERA 2VZUA 3DMMC 4WCYH 3NQIA 4HC1H 5HDWA 2XQBH 2R59A 5CD5D 4UU9A 4B41A 1YPZE 1U8MA 2Q7NA 1K8DB 1BPLB 3U9UA 3BIKA 3BSGA 3STZB 1U92B 5F70A 5HPMB 2VXUH 1BGXL 1KXVC 1ZE3H 2NXZC 5BOZG 4BFFA 2DLFL 1E4HA 3G5XB 3SOBH 3QIUC 2DQEH 1FYTA 4L0YA 3CZJA 2DQMA 4WHYG 2QVFB 4QT5B 1QO3A 2CGZA 2X4OB 1RPUA 1H6EA 5K59F 5GGVH 2Z8WC 3STLB 4YX2H 5C0AB 1NPNA 2D3JA 3O6FC 5BQDA 5AZEL 3O3AA 4F91B 2ITFA 5E8PB 2GI7A 3VI3F 1FZMB 3GMLA 3MREB 5F1IB 3NZHL 4Z9KB 2WKLA 5K9OB 2Z35A 4N0RA 2J2ZB 5IJVA 2AK4A 5E94A 4TL5A 5BMFH 2ZUVA 3SKMB 4TN9A 3TBVA 4PWHA 1U95A 2A4EA 1RK1A 1AZNA 2J1YA 3SGKC 4B3EA 2GBTA 4P8QA 3FW6A 1BQLH 3RPBA 2P46B 3BWUF 2AJVL 3WJLA 1CGSL 1NQBA 4K5LA 4CVWA 3M46A 4KJYA 3ASOB 3NN8B 3PFQA 2F54B 5EUKB 5KBLA 1CGXA 1F3DJ 1T04A 2P8LA 3X3GL 1IEAB 1PPIA 3GXTA 3IFLL 1LO2H 2R29A 3LPFA 4ZD3L 5IJCC 3QH3B 4XOBA 4HD5A 1T2JA 1QWNA 4U7KA 4PSRA 4HPOH 1PNDA 5KJRL 2IDSA 1U8IA 4YDKH 2VAAB 1FRGL 1N59B 2EO1A 3W39A 1BYPA 3BP7A 3HI6H 2A6IA 3NABH 4UTBH 1L9SA 2EIEA 4LCWB 3WJJA 1M53A 1PEZA 3KDMB 2UY6A 4HHGA 4JVUA 5K1JA 3KYMA 4CSSA 3L4VA 2NY0D 3ATDA 4OZFH 4N0FA 1T1XB 2JJTC 1OAQH 3JWNE 1TMCB 4OJDH 2J5LC 2IFGA 4QOKD 4RRPM 4QHUB 1JF1B 2DQCL 3QHFL 4K8RD 5K39A 3VA6A 5MEND 1X44A 4W9IC 2IDQA 1TTAA 1ETZA 1H0DB 1REIA 3T0EE 3VTAA 3FU6A 4BRVA 5BRQA 4JVWA 3TA3D 2Y0SA 2CRZA 1Q0XL 3RTLA 5LGYA 3DROA 3S35L 4EIGB 4M5TA 1N4XH 1GGIH 1UCBH 5BV7L 3C5ZD 3WS3B 4J1UB 1RIVL 2AJZB 5B7MA 2WWKO 4Q9CA 3KPQA 2FR4A 4J28A 4KK9C 1KBPA 5FYKU 4DK6A 3TBSA 1FFTB 3U0PA 4J4PD 3L5HA 5GGSB 2E86A 4PGEB 4AVJA 1U3HC 5E2WH 3JWDL 4FCHA 3K6OA 4NWUL 2VLJE 1XR8A 4L8DA 4EBQH 1JHKL 1KLGA 3UYPB 4Y8AA 5AW4B 2JKTM 3DX8A 4AYID 4AIXA 1O9VA 2K45A 2J8OA 3N1GC 1U3YA 2GTQA 1Y1UA 1F86A 3BP6A 2WV3A 3DGGA 4XPHH 4YAQB 2VYRE 4MA7L 3NCYP 1J5CA 4JM2D 4NNXA 2ESVE 1RIUH 1YEIH 4AYEC 2QADD 1KJ2B 4KJQC 3BHBA 3AREC 1RVFL 2BVPA 3T6ZA 1OSYA 1MKFA 2AQNA 1KY6A 3MPCA 4XC1H 3ZLQC 1KULA 3WAKA 3CFIC 5IVXA 4KKZA 2FSEB 2GQHA 4JKPH 5MI0B 1F1AA 3UAFA 4BFGA 3HFMH 1XF2A 3IDIA 3NOIA 1B6UA 1JUFA 4MBRA 4ZX6A 4PGDB 4PLJD 3HZKA 4I3SL 4HJ0C 4PRHD 4UT9A 5DI8B 4PPTA 4K94H 4D3CH 1CD1A 1II4E 4FXGC 3ETTA 3O6MH 3B3BA 2ZAIA 2YD2A 1SFDA 1SJHB 4Z7UA 3CXFA 2DWEA 4LBEB 3IFOB 4PIRF 1KB9J 1FAKT 4U6YA 2IQAB 2VDMB 3B2PA 3L9YA 1QI4A 4RIRB 2RFXB 3CVHB 3GM8A 2JTYA 4K0OA 1J05B 4WU7A 5DUML 1KTDB 2YEZB 3O3DA 3DUSA 5DK3A 3MXVL 2D9QB 1RJZB 2ZXAA 3ZY7A 4PGBA 3PJSA 3I9GH 3DMMB 2PNDA 4MXQD 2D7TH 2NX5A 4JRYD 2MCPL 5HD8C 3FQRA 2PCXA 5DYOB 2Y1VA 2ZXWB 1WBYA 5TK4A 3NVQA 1A1NA 9PCYA 1NBYB 3ARFB 3K91A 3IGFA 5C0DA 3ABLB 4JE4B 3VWJD 3BJ91 4FA6A 4M43H 3S5ZA 2IAND 4ETYA 2NXZB 1JVLA 3A6OA 1T5WA 2UYLA 3BKCH 3UJJH 3S88L 5JPMA 2NW2A 3QIUB 2MPAL 2XG5A 3RWCB 3DNKA 2Z7YA 1OW0C 4K7PY 4A2GA 3C5SB 3DBXB 4GG8B 1TLKA 4YJZL 5KS9F 3LN4A 2CA4A 2MCAA 4ZNCD 4FMKA 4CMMA 3MLYL 5C07B 5E2TH 2G0LA 3U6XA 3RIFK 2ED7A 2Y2TA 4NHUB 3UIYA 3VXMD 3UO1L 3DV6A 1DQKA 1IGIL 3ARGC 4HAKA 1XCWA 5EZLA 3QWOA 3BRDA 4GRWH 1MPAL 1AQMA 4WI0A 1MFUA 3O6FB 3V7MA 5B7FA 3WV0A 1PX3A 2DBLH 4JZJA 3RL1B 3U48A 5HYSA 4BZ1A 4KTEH 4KVNH 2VWEC 3BUQA 3OLEA 3BYTA 5GISH 2ISDA 3L48A 4QXWA 4H8WC 5CWSB 3APMA 5EULV 5I8KL 1N18A 4ZXBA 2FGWL 1X5IA 3ILPA 3AQYA 3FFCB 2H0JA 4O58H 4X42A 2ICWI 5DJ6B 3V0EA 5D7JC 3CXDH 1E0OB 2X42A 4ZUUA 4KNQA 5L8JB 2XVKA 4GPVA 5ANMA 3VGHA 5I28A 43C9B 1FHGA 4YDIH 4RESB 3QFGA 5AOJA 4AG4H 4JGNA 2V37A 3EKCA 4ZFOB 2H0FA 5EU6A 3GM0A 1E65A 4KRPD 3RQ3A 1MCNA 1MFNA 2YUVA 1K2DB 3BWAB 1ICTA 2OAAA 5JHLA 4S1QH 2QGDA 1ZA3A 4NZRL 3V5HB 3HZYB 3L4TA 3ESMA 2VR9A 1ONQB 2Y6SC 3LQAC 4DW2H 2DH2A 3EADA 2E3VA 3F3HA 5E5MB 5EEXA 4HIXH 2X4TA 1XH3B 2BNRE 3ARVA 3WIIH 3V0JA 3KLSA 4Y2DC 5A2FA 3HLKA 5IR1A 1CFQA 2WQXA 2OMZB 3OR6A 2BVQB 3HG1D 1F1GA 1ORSA 1KFGA 4E41A 5HHMD 1HK6A 1A6ZB 1HQRB 2E0PA 2VSCA 5FO7B 4FQ1H 4X8XA 1DR9A 1JNLL 1JWUB 1R3KA 1FJ1A 2WZ6A 4HT1L 4XCNB 2O26U 4N6RB 4Y1SA 4YDVA 3SGEH 4Z8FL 1I8MB 3LV3B 4EAEA 3RJDA 2EE9A 4IRJC 1SOKA 5L4JA 4X6EA 4JKKA 2AKRB 1WZMA 5ADPH 4ONGL 2PXYD 1I1RA 1BXXA 3M8OH 3CHQA 3VD5A 1FDLL 1DN0B 1TYEB 5AVZB 3U4BH 2D2CC 3ULUH 3TCLB 3DVGA 1BZ8A 1JPFB 2B9AA 2NSXA 5AB0A 1T20B 2AQ1A 2J21A 2WIIA 1AGFA 1OP3K 1DEDA 2WXHA 1C5DA 2CO4A 5CJQH 4RFNC 3MLXH 3VG0L 2IBBA 4HXBL 4OJFH 3T0VA 3VSTA 3K2UL 1U3HB 4XN9A 4B50A 4DN3L 3TH2T 4OSUH 3VRJA 4K3JL 4Z3HA 4D7PA 3OKEA 3LPGA 3FRPG 1H3PL 5JW4R 4J6IA 3P4NB 4G7SB 3VUAA 2NUPA 1MW3A 1IM9B 1IGMH 5EOQH 3DGCR 2P24A 4MSWA 1M7DA 1ES0B 3H53A 3VQMA 1E5CA 3DVIA 4XMKL 3CXHJ 3VW3H 5C3TA 5J6GB 5IROD 3P3TA 1UC6A 3JSSA 4W68A 2A74C 2GJ6D 3RX8A 5FUZL 5FIEA 1G7QA 4LRNL 4HK0A 1AZBA 3NSDA 4MD4A 1NIDA 2VLKD 3VXOB 4BKLB 2PKDA 4H13C 3DRTB 3BKMH 2H3NB 3CMGA 3OKOB 4HDIA 5EO1B 4IRZH 4N1CA 2ED6A 5D7IF 3LRMA 1FA4A 2CLZA 1U2CA 1IFGA 3GLAA 3BXNA 3MROA 1P4IL 3QS2A 3BDXA 4G43A 5CKGA 5HHNA 3A3YB 5I82A 4FXGB 3BKJL 4MAYC 3DX9A 1MDTA 1DVQA 1EFXD 3DHJA 4JL2A 3DKHA 1DQJB 1T80A 3WKNA 1HU8A 2CO6A 2V7HA 5C09D 3ISYA 4G1MA 4PY8I 4X7TA 3FF7A 3K71B 1HINL 5IV2B 2SODB 3BUDA 5T1LD 4XI5D 2WC7A 4P9HH 3FCGA 1QA9B 5HHOE 4QNPE 2F8XC 3BEWB 4UZGA 2DQFA 3BVDB 2NW3A 2WZPD 1KPUA 5CJ8A 4M7KL 2AP2A 3GBEA 2DQIH 4H44C 2HT3C 3TF4A 2VXTL 3GMMA 4YSSA 3UTZA 4ZQTA 1CR9H 1LP9E 1QI5A 2PR9A 3VFRA 4U1JA 3EBAA 4DO5A 3P3UA 5CILH 2GTZB 1YECH 3FTSA 1VPOL 2IIJA 4ZMPA 3G5VB 5E9DD 3DTXB 2ENPA 2IGFL 2KZWA 1X4YA 1QHQA 2Y7OA 1DUYB 2NT0A 1QACA 5IKCB 3RIKA 3JT0A 4Z5RB 2AEQH 3HN3A 5D71L 3WIHA 2L7UA 1S9WB 5GRZA 2QHLA 3L95B 5BZXA 1FI8C 2UZIH 4GIPD 3DUUA 3DJTA 1AIFA 1T03H 4AMWA 1W72B 2TSAA 2WTOA 3EZJB 2ZKMX 1VSCA 1LDPH 2PABA 3OG4B 4R4FL 2DICA 4MQ7A 1KB5A 1RZQA 4FFZA 4NRZB 3Q2CA 5GS0C 3HI1B 1WITA 4Q0XL 5I15H 1ZK9A 2MEJB 3QJHA 4JVPA 3EJZC 1BVNP 4GRWE 1AD9A 2YAPA 4ATWA 5DMKB 4HWEL 2FD6H 4WV1A 5BXFA 3P73A 2JB6B 2X4SA 1WD8A 3WSQH 3FOLA 3LZRA 1OWWA 2IXQB 2A77L 2VAJA 5MP6H 4DTGH 2IV8A 3EHBC 1FORL 2X1XR 4A2HA 5FYLD 3L45A 4E0RA 1BEYL 4ZUVB 2Y69B 2WN3A 1F42A 4X8JB 2ITCB 3O9WC 1OANA 4WFEE 5D7LD 1NC4B 2AJUL 2I7OA 1H3XA 4YGAB 4IMKA 4YHIA 1JG9A 2FGZA 1EJ8A 2H9GB 4F37F 3QUZB 3VFGL 4JFXA 4WKXA 3T6VA 1DL7L 2X1QA 4U0RB 1FFPB 1SY6H 3NCXA 2FDBP 4JPKH 4JR9H 2YKLL 3QDJD 3QUXD 4IKNA 3SZ6A 4JJ5B 5FOBB 3S2CA 5L6YH 1NFDE 2XXMB 3HVNA 2BRQA 4PRPE 5D2NE 1JYNA 4Q58C 4YHML 3PWJB 3G6JF 3MLUL 4MD0A 2EDJA 1NPUA 3ASWA 5TE6H 1U91B 2ARWA 1Z2KA 3KLAB 3MNZB 3BSHA 4Y2DB 1KCLA 4ZFOL 2H26B 2IWEA 3MV8B 4N2KA 3TJEL 2QGCA 4HALA 1I1FB 4NOBA 4X9YA 3EJJX 4EIBA 2WMPA 4N5ED 2GAZB 1J9TA 4Y4HD 3TO4B 3B9KD 3I02A 3MJGX 2VJXA 1UXSA 4H88L 4YBQD 5LBVA 4HSAC 3S4SA 1E43A 3RI5K 4X80L 5AW3B 2B1HH 2ZSVB 5C6PB 3TO2A 2IAAC 1X9UA 2VB5A 2A7BA 4O5LH 5K9JH 3D9AL 5EUOE 2AF2A 4CC1A 2Z92A 2HJFB 3DPDA 3FQUA 3RWFB 3HC4L 4UQ3B 4R2GB 4EVNB 2Z34A 2AZUA 4UANA 1JGIA 2UXGA 4IU2B 3HPLA 3X14A 1CFSB 3MRDA 3R1GL 3HCVB 5FGSA 2HB0A 4HWBA 1MUJA 3D85D 4A6YA 2CALA 1W0VA 3PRZA 12E8L 2FL5A 4KMQA 4PG2C 4RAHA 3EFOB 4C57C 3C09C 1EHAA 1H15B 3DDFA 3UAJD 4KBPA 4ADJA 4FDWA 1T2QH 3T0EA 3HN8A 2BVUA 2P80A 3MC0A 2BFVL 1UB6A 4N2NA 1YDPA 3R8QA 3WFHA 5KVFL 3MCLL 1MLCA 3AXLA 1BBDL 4XZ4A 3RWJA 3VRIB 3HS0A 1JZHA 3MOQA 3CHOA 4XPGL 5E4AA 4AL8C 4XE0A 4AV5A 2DLHA 5IT2L 1OK8A 3E8UL 1GKEA 4TRPH 1IM3D 4QTFA 4GBXC 5T8IA 1IC7L 3VQ2C 2VLJA 2I9TB 1I7ZA 4OF8A 1PZAA 3EJQA 3DI3B 3OQ3B 4LB8A 3HMXH 4OTXL 1BQSA 3I2CH 4QWWC 1AKJD 5DHEA 5C7XH 5K1NA 4YN3A 1GW0A 1KGCD 3OWRA 4P23D 3DO3A 1FHNA 2A9BA 3AS1A 4UM9A 1H5BA 4JL1A 2BIIA 5A16B 5SWSB 1A4BA 4ODWB 3S3BB 1VDGA 3MLVH 2F5AH 2RMNA 2R1WB 2XPZA 3DX4A 1BZDA 4HBCL 4OF3A 3L16A 5GSRA 3OJVC 3K72A 3MRBA 4XP1H 4MAYB 2CKBH 1Q9LB 2OA9A 3DBSA 3NJHA 3ROOB 2PWFA 2XN9D 5IFJA 4QAWA 4MAUL 3SODB 5MEPB 3RHWK 4ZS7L 4GO9A 2ZCHH 4PJDF 5KVDE 3SCMA 1FG9C 4HJIA 1VA9A 2AQRA 4RZKA 4MDRA 4M7ZC 4QYAA 3N42B 3HRZB 1JHTB 3PS6A 2A4CA 2YRZA 5IZ7A 1PZ5B 2XWBA 3NT0A 3D09A 2WP3O 2HWZH 3D52A 1F8TL 4MA8L 4B3VA 2EDMA 4EZJA 1EH9A 2GC7C 4Z1PA 3VVVA 3V0WL 1JVKA 1X5GA 5TPWL 1NGPH 4G8GE 1Q94A 1TCRA 4FNLH 3OJMB 4K5NA 2EKSA 4X9BA 1H6FA 5BJTB 4DPRA 3HR5A 4HFWB 5GRXG 1X9RA 2XX1A 2LFGA 3LPOA 2IDUA 4KH2A 2HG5A 5F8QC 4P06A 2O30A 2W65B 3AACA 4NQEA 1VJSA 2WTRB 4X99A 5DQ9A 3MFFB 2EH8H 4H20L 4M56A 4WNSA 2ADYA 1MCPL 1RERA 1QLFB 3D2UA 2VC2L 4MLIA 4DVRL 4ZNEE 1VERA 2CJSA 2YPKB 4XVUC 1NANI 4P3DA 3LKQA 1A65A 1J7VR 2WQVA 4WWID 3ZE2B 1MHCA 3ABMB 4P5TC 2HLFC 4YL9A 4BSVB 2ZNXA 5MEOB 1WHPA 1ND0B 4L9LB 3VH8G 4EDWH 5AYTA 1QMUA 3AY2A 4H2CA 2E7MA 1OGSA 1FO0L 2K8MA 1S9XA 3CFCH 3CC5B 2APWA 4QO1B 1M7IB 1SJEB 1SN5A 1NC2B 3FZUC 3NFNA 4NJAH 1ZHKB 2O5YL 4P49A 1A4CA 1DBJL 2VSMB 1UD6A 5DO2D 5L88L 1X7TA 3L6FB 2ORBH 3ZHLA 4J7RA 1TKWA 1KDIA 1FNHA 5J1TC 3EHBB 2FEEI 2VNCA 3ARZA 3QPXL 3HC0A 1CPUA 3VD2A 4YL4A 3LZPA 4ZBJA 1WF5A 3O9WB 1KCKA 2E6QA 4J3WA 4NDMB 3CE1A 2IF7A 4OD2A 4A63A 4P59L 1N0LB 2AXFA 4WHDA 3UJIL 4WWKA 1UT2A 1V10A 5EZIL 3UTSE 3EYVA 1ZLDA 1UZGA 3IDNB 1S9VA 4GY4A 3WY3A 3V4PA 3BZ5A 2UZXB 2G5BA 3IT8D 4CNIA 3IEAA 3S5LB 4UZSA 1PSKH 1U8LA 5AVWB 4HU8A 4I2XA 1OAXH 4IEFA 2GITB 1ZLSH 3TEUA 4JDZA 1E4KA 3PIQA 2HFEA 2H1PH 3IXTB 4EUPA 3A4DA 5HYEA 1WE5A 1U2YA 4PJIF 3QZLA 5DK0B 3VWKA 3AS0A 4RRPG 1EFQA 3KPSD 4QCIA 4WUUD 5I1GH 3ZTJH 1XCTB 1EHLL 3MUY1 4WEMB 3T8XB 3IFPB 5F9WC 3SE3C 3AU1B 1F3RB 1J9RA 1L6PA 4NJ9H 4KX9A 4WEBL 1LE9A 3B5GA 3SPHA 1J88A 2IGLA 2VITA 3VRLE 4B27A 4D9QE 4GAGL 1UD2A 1AYOA 1XR9B 2K1MA 3IDUA 4Y9GA 2J7LA 2J8UE 4Y19A 1N67A 4PRBA 2E6PA 4TSAL 2JI3A 4R0LA 1VF5C 1IC5L 2Y7SA 5E24E 4GRLD 1Y7VA 2D0HA 2VABA 2YLKA 3IDMA 5FF6A 3C09B 4PRDB 4I0PD 4MXWH 4R96B 5K9KB 4HQQH 3T1WA 3HAEH 3MBED 3ZUNC 5ITBL 2CIKB 1UGKA 5A7BA 2JCWA 1OCWL 2J1KA 4YSEA 4Y5YA 3FUNA 5D8JH 1TYRA 1NBVL 1QKZL 1UENA 4ZMZA 2XKSA 1GXEA 1UZ6F 3NCMA 3IBOA 1OTTD 3Q2WA 5H37A 3VA2C 1SMDA 3NJKA 5A2BA 4KNTA 1BFTA 2IWGA 5ICYA 2I32A 2O6EA 3KLQA 4QGYA 5LG1A 2EH7L 5AUMA 2BOLA 4XH2B 2R2HB 1AY1L 2QMJA 3MLRH 2HP4A 1SOSA 2GY5A 4GBXB 4MQXC 4N2BA 4XRCA 4N2CA 3BP5A 1CFNB 3WG7B 1KIQB 1G4MA 5HDLA 2VLLB 1AHKA 4NPJA 2AERT 1JNNL 2GUYA 2RR3A 1NJ9A 2BRRL 4NO0A 4W1TA 2KLSA 3RE0A 4X6FB 5B3JE 1OGTB 3DSNB 1KPRB 3T3PB 5E6ZA 4X7CC 3H2QA 4GO8A 2ILLA 1IIKA 1FCGA 1HDMA 2RGSA 2C4FT 2YFOA 2PW1B 3LZLA 3MXWH 5A2LH 5A2IH 5DUBB 4XMLL 4F27A 3QW9A 1S46A 3GQFA 1A4JB 1KJMA 4G59C 2FWOA 3CDYA 1MG3C 4TVSa 5FYJE 3TT1L 3VD0A 2N7BA 4R26L 1JGVH 3H3PL 4AZUA 3MLWL 4ZUSB 1YEFL 4M3KB 4XX1E 1LLAA 4D2NA 1VFAA 4UV4L 4D0CB 5AWNL 1P7QA 2YOCA 4PJAE 3KLHD 3JUZA 5G4MA 3KAAA 1AFVH 1WV7T 4NGHH 2YZ8A 1CE1L 4JLRB 1FNFA 3BSZA 1AS6A 4ODUA 1R0AH 1EUUA 5I1EH 4PJ7F 3CN1A 2V8MA 4XVJH 1ODAA 5DMIH 1JFQL 4Z7WE 4W81A 4KZDL 4F7PB 2YO3A 5C0RH 2M2DA 1MCBA 2EDEA 4I9XA 1RZ8B 3F6JA 3KW8A 3U9WA 3UG3A 5GZOD 4UIKH 1IGCH 2Y7QB 4Y0GA 3SDCA 3UEQA 4LRIC 1DVXA 2ARJQ 3SKOB 5KTEH 2BCKB 2A9ML 5LNGA 3O2DA 2XV0A 1G87A 2A6KA 1I7RB 1LP9A 3EJYD 5AZUA 2Q8BL 3NFSL 4MJID 4TKWA 4G7VH 2GSMB 3Q9QA 4NIYE 4ONFH 3D0LA 1E50A 3OXRB 4UB0L 4W9FC 1MG2C 3QI9A 1F58L 3FUFA 1M05A 4WK4B 2ZUWA 5FOJA 4PLNC 5F96L 1BCIA 1UD8A 4N5UA 4BUGA 1JPGA 3BE1L 4ODHH 4P5TB 4N24A 3PP3K 5I6NA 3CVHH 4N0YL 1YJDH 5DF0A 4JG0L 1RSFA 2ALWA 2X2JA 4FFVD 4RGMC 3O6LL 3ML9A 1KCRL 2COQA 5DD1L 2B0SH 4R9HA 3QFJB 3UMNA 5KBNC 1K8IA 2L4OA 4N0UA 3IS0X 7FABH 2H2PC 1I9RH 2JK5A 4TYUA 2V17H 4JX0A 5FYKH 1UGNA 3BO8B 3CZFA 3SPCA 4W9JC 3BWUC 2HRPL 2X6CA 4H5SA 3KZ8A 3EGSB 5DDHB 4N8CH 4TSBL 4FFWC 1CMOA 3B2VH 2OULB 4JEGB 4LZKA 4PRAB 5HHXH 4OCWH 3BAEL 4TMPA 3VXNA 2Z3FA 4NUGL 2WB1A 2UWEB 2WN2A 4NSKB 4RZCB 3V95A 4CGTA 4P48A 1A3RL 4KQ3H 4BH8A 3BDYL 1SHWA 1YRKA 3AG2B 4NQDD 3MRIB 4N2HA 1FFOB 4I9WD 4XMWA 5A40E 5HY9A 4LMQE 4FAAB 5I1KH 3OJ2C 4IBSA 1L0YA 2FHFA 3TBWB 1RD6A 3OKDB 4Z3IA 1KEML 1JZ6A 4N1EA 1URIA 1NFDA 1S5IH 4W6XB 5D2NA 5F9WB 3IPFA 1AGEB 4GKSB 3CBRA 5C0AE 3S8WA 5GGTH 1NEZG 3SE8L 1Q9WB 1YEDB 2G60L 2WLKA 1MCDA 4YR6A 4WI5A 3ZHFA 1VGKA 4C55A 4DKDC 1G7IA 3WYRA 2Q5BA 4YZFE 4UIMB 1CLYL 1ADQH 4LOEA 1YN7A 4YHLH 1U8HA 5EZJA 1AP2A 1KPVB 3ECBA 4JRLA 5LAPA 1AE6L 2YK1L 3V52L 1ILUA 5AL0A 4X5XB 1L0QA 5TE4L 2ARJB 3CFEA 3Q44A 3GSWA 4FKEA 2ED9A 3B37A 3GNML 2VXQL 1J8RA 2D7QA 1RJYB 4HWZA 4KROC 1TOXA 4TVPH 5FYLL 5EUOA 2BINA 2BOCA 2DM3A 2K0RA 2V8LA 3D1MC 4OV6F 2EAEA 1R34A 4KV5E 4J2QA 4KRLB 1EEQA 1AVAA 1QVOB 2F54E 5JW4Q 1RJCA 1H3VA 3PWLA 5DEGA 1TZAA 2X5PA 1U8JA 1EZVX 3GSNB 4BKSC 4JCWA 3EJRA 2VQ4A 4I4WA 4ORZC 5IB3A 2JB5H 1U8OB 3SDXF 4Y4FA 5EBLA 4JFFD 3APCA 2MNJB 3MLSL 4DP7X 5DZJA 4NWTH 4HG4K 1R6VA 4F57H 5TH2A 5BZWA 3U2IA 2HZHA 4LCWE 5F72S 3PGDB 1AYRA 1A3LL 1LHZA 1UG9A 1F02I 1XIWA 3TZVC 4MNQD 1NUFA 4JRXB 4POZD 3NJLA 1U2HA 4GMSH 1S7XA 5INCA 1PZ2A 3EYOA 5DHMC 4UNIA 1R3IH 4B9YA 2QL1A 4Y5VC 4XO9A 3U7YH 2ZX9A 4HWNA 1OP3H 2HKHL 3T6WA 5I1JH 1K4DA 1LO4L 2NY7H 5JLZA 5AW1B 4AQ1C 3H6AA 1UATA 1WJ3A 2X3BA 3SY0B 5CZXC 4YBLC 5DS1A 1OV8A 4KO9A 5C9JA 2AS5M 2NQ3A 4FLSA 2Q3XA 1AO7D 1HWHB 1A5FL 3ES6A 2V2WB 4OH2A 4U3CA 3TLRA 5KAQG 4DP9X 3ABGA 1C08B 35C8L 4ZO8A 1U58B 2ADGB 1E2WA 2TRHA 2DWYA 4HJJH 5KSBF 2FB4L 5I5MA 5D1XA 4DGVH 2XWZA 3M17A 4FG0A 2X1OA 3H3BC 1C1EH 1ZLWH 3ZDZF 4ADIA 2PR4H 4YEFA 2GEQA 2W80C 1GZPB 2BWDA 1ETA1 3QHZL 2V2XA 5EEUA 2XDHA 3KPNB 3L3JA 3QWRD 4S1RH 3QJFB 3P2BA 1R5IB 4JFZH 3GUFA 1GC1C 2W9EL 3HNVL 4PAZA 4PGZA 4P46C 4G8GA 1GHFH 3UAEA 5BUGA 2PYFB 4WO4D 2OYPA 2OR9H 3EOTH 4Z3JA 2VO8A 1U9KA 1RU9L 5B4MD 3UTTD 2GW5A 5I9QC 3G6DH 4EI0A 4ZFGL 1OO2A 4MQTB 1OHQA 1UTDA 2QSCL 3B3IB 5E5UB 3I6KB 2C9PA 4KUZL 3VD3A 2ICEC 1KYDA 1UH3A 3V6OE 3VXUD 1RUMH 3VTTA 1HL5A 4PWIA 4X0NA 4L3CA 3NSCA 1WC7A 4RGMB 3KYNB 3GJFK 3GB7B 3TYFB 2HN7B 5FGBA 3L81A 4BFIA 4FTVD 4JQVC 4O02B 5E6ID 4IBQA 3X13B 2OJZL 4GSXA 4BH7B 2Y36L 3WLWC 5IESH 4GAYA 3FXIC 1XGYL 2FYYA 1FL6A 1NCOA 2VKXA 2NR6A 3MZTA 3A24A 3O6KL 1A14L 5TQ0H 2ITDA 1VEMA 2AV1A 3BAXA 3Q1SL 1IC4H 3DHPA 3L7EB 5E1AB 3JTSB 1SVCP 2DBJA 1KGXA 3GSQB 4YH6A 5D93C 4WFFD 1MHEA 4ZTOL 1I9JL 2QSQA 1SOQA 1J8HB 1G7HB 2WVVA 2GCYA 1C12A 3CPLA 1GYCA 3ECUA 3FHEA 1A7QH 3LY6A 5I19H 1W2KT 5E4IA 2GBUA 3NRFA 2O72A 1DJZA 1T7XA 5JHAA 2NNAA 4PN6A 3ESUF 2K4AA 4ZYKB 5TDOA 3QIBC 2K3HA 3L3OC 4UUJB 2OM5A 3CZSA 4IOIA 1OPGL 1BVKA 2WZAA 5C07E 2FX9H 3D39B 3QISA 5D1ZB 1SNRA 4S0SD 3MA9L 1G7PA 3GHBH 2B5IB 3LCYA 5EU7C 3SQOH 4H8WH 3OG6B 5TDPA 5L8LB 3KPMB 5L2KB 3N2JA 2AJXH 1DBBL 4B9FA 2X9ZA 3N0AA 1L0PA 3V0IA 2BHUA 4HWBH 3CFBB 4A55A 1CU4H 3KM1A 3HG5A 4FERA 4Q6IB 3VSQA 1XF3B 2M8XA 1E27B 1LO3L 1WGVA 1Z3GH 2VN5A 4LNVA 5EV7A 1W15A 3PP4H 1R5VB 4DEUA 1X7SA 4BEIA 2R0WH 3FU3A 3Q5TA 1TMQA 2ZCKH 2X4UA 4IDJH 1T6WA 1F6AB 3DHUA 1QSFB 3HUJB 1S7TB 1DEEA 4UDTB 3OXSB 3H9SA 3VXTB 4MGXA 3F7YA 3J07A 4LCYB 3X1NA 1Z9OA 2DY2A 3LQAH 1XGRA 4KQ0A 4P5SA 4ESKA 5SWZB 4JFED 1EERB 4NFDA 3QC5X 1KLFA 1FBIL 1WYJA 4L8CB 2EYRA 2ZOKB 3OKKA 1E5YA 4FULA 5DZOA 3WFEL 4PR5B 1MCHA 2FECI 4P9ML 4HAGA 1P5UC 2X4PB 3HKZA 5IMOB 1AXSB 4ZFQA 1SBSH 1B4LA 3MX0A 2R2BB 4WKZB 4X4XB 4I18B 5I1DB 2BIQA 2ZJSH 3HHMA 4MCYB 4PJBF 1E3FA 4XB8A 1HH6A 3SPVA 3OZ9H 3QXAB 4LLDA 2X87A 3QUYB 2H7WA 2F8OA 5CUSL 4OI7A 1BF2A 4PW9A 4HX1A 2VN6A 5KVGH 3PDGA 2O6DA 3BN9C 3V4UH 1TQVA 3HC2A 3GZKA 4OGYH 4OFYD 3E9TA 1QFUH 3H42L 1JGEB 1BZ7A 1NGWB 2CDEB 3D18A 6FABL 5AB9A 3EOBA 2ZOLB 5HYJD 3EBHA 2A9DA 5C0IB 2WLLB 4JO3L 5E99H 4TM9A 3WHE0 3VDCA 3HOGA 4TUJB 5IW3A 4HETA 1P1ZA 2A2QT 3PWVB 1BZQK 1IAKB 5IEKB 2N0KA 4LSRH 2XIBA 3L9RB 1R5WA 4WVRA 1EBAA 3GRWL 3V6FA 1C16B 4AJYV 5K33A 3TVMA 3ZVVA 1NGQH 3FAXA 2NYYD 4F7MB 2MOQA 2FLBT 2H8PB 4L2YA 4O2CA 4LEXH 2R9HC 3KYKL 2ZYRA 2EACA 4PS8A 5DTFA 4AGPA 4Z7WA 2BSSB 3OKNA 1MCOL 3EOAA 5FCSH 4DSYA 3OB0K 2MSPA 1ZVHA 3CHRA 3CX5K 5ESVA 1ZS8A 1TZIA 4M1CC 3G5YA 3WKML 1OF2A 1O6SB 4D8PB 5I9QB 1UKSA 2CA3A 4W9HC 1UM6H 4KQ4L 2DB8A 4WFHE 1CCZA 1BX2A 4B0MB 2BSRA 3BZ4B 3NCCB 2V4LA 2NY2C 4ILDA 3QCTH 4X4YB 3H0TB 4MZ2A 4M6OL 4ZOAA 1VZGA 4G8EA 3GMNB 3MUHL 4ICXA 4ODBD 2DQJL 2DTMH 1OM9A 4GOSA 5E8OA 1TZ8A 1OSZB 2WLMA 3UTPD 1MWAH 4AEEA 4OKVB 3GUTB 5B21A 2NXYD 5LG6A 4M7JH 4FG4A 3A6BH 3A23A 5C0CB 3WKQA 1WTLA 1OVZA 2Z31A 2DZEA 1C5BL 3MSPA 4WSJA 2UUDK 1U8QB 1E6OH 5C86A 5HP5A 2J20A 2R69L 3FRPB 1BZ9B 2VR4A 2R0ZL 2E7LC 4I13B 3NIFB 4X7EC 4XXDB 1IC0A 5DRNB 2W07B 1Z9MA 1CWVA 1D6EB 3ME0B 4XCFL 4HKZB 5FA3B 5CD5C 3CVBA 5D93B 1N5YL 2YS4A 5F97E 3FB5B 2AEIT 1N2RA 5FWRA 2V3EA 4N22A 2R51A 2DMBA 2ZUUA 2OS7A 4LBAA 2OK0H 1GGBL 5GZNA 4OCXH 4DZBB 5BW7C 2LVCA 2CK2A 1P6AB 4XPBL 4KHXH 4JY4B 3QIBB 3H56A 3L3OB 3ZL4H 4WGKA 2WXFA 3WFCL 3H8NA 2F8IA 5GS0H 4Z7VF 3KE0A 3LNHA 2Y5EA 1K8DA 3AUWB 2YXWA 1U92A 4G7QB 3HZVB 4HIPA 1N6VA 3VB9A 1U8NB 3VXQB 5HPMA 3ZTNL 4B9JA 1CQKA 3FUDA 1MFEH 3KVDD 3DYMA 5C7ZA 2BP8B 2F5BL 5CD3B 5JYMA 1UHVA 2P26A 3QHTC 3SJVB 1Q1JH 2Q6WB 3IDJA 4QT5A 4PD4K 4ACTA 1SGKA 1YZZA 3S37H 2E9GA 1BYOA 1IAMA 2C26A 4TNVF 5JHDD 4YVNA 5JNYB 1ASOA 5C0AA 1KELL 4JQIH 5F3BB 2BJML 3UCQA 5KSVB 2EEAA 2K3TA 3UGEA 3LEXB 3WDJA 1MIML 4H25B 1FZMA 5F1IA 1XD0A 3W9DB 5KJ4A 4F1SA 4F7CB 2OZ4H 2J2ZA 4LSSL 5DMJB 4FZEH 3SKMA 4L1LA 3ATFA 1AMXA 1R47A 3NCWA 4RX4D 3AQZA 4QYOB 3VFTB 1T21B 4OGZA 1JWMA 4YLCA 2DLTA 2P5WB 5DD0H 3CZEA 1XTMA 2CUMA 2CHNA 1WAAF 1MJJB 4EZMA 1PG7L 2CO3A 2QDVA 3BIBX 5TE7H 5DRXB 3CIQA 1P5UB 2F54A 1AGBA 3MV8E 4FXLA 5EU4B 1KC5L 1IEAA 1E42A 2GABA 2LU4A 3RGVD 1HOCB 3QH3A 3OMAB 1AQHA 2YBGA 2NY0C 1OAKH 3W5NA 5LQBL 2VAAA 1KBKA 5D7IB 3X12A 1EVUA 3HI5L 3AQDA 2UX7A 1XAKA 3KL5A 3OHMB 4K8RC 4XWOC 2WZ5A 1J5DA 2AEPH 2YSTA 4YUEH 5BQ7A 2ZAHA 2HT2D 3KDMA 2QTEA 3TA3C 3IJ9A 1M7XA 2ADJB 4FL4C 1IAIM 4NP4H 3C5ZC 5EORL 1JRHH 4IKJA 4QHUA 4Z77B 1JF1A 3GIZH 4AM0Q 4PY7A 3C9NB 1H0DA 5D1QD 4UNVA 5C0BB 1RJLB 3LH9A 4AL8H 1GTFA 2VKWA 4R5VA 4YE4H 4JY5H 3SDDB 1A47A 2EVGA 3WS3A 2BO0A 2OYMA 5AOLA 2YN5A 1EPFA 1HL4A 4UQAA 4A7VA 1JFHA 5FX3A 1DBML 5E2UL 2K78A 3T09A 2X28A 3QORB 5GGSA 1TTCA 1FSKC 4B53A 3P2DA 3V9FA 3CZKA 2F58H 3S98A 5EU3B 4U6VH 4K15A 3MBXH 3U6RB 5ECJE 1CFVH 3IJEB 3QO1B 3I85A 3PXHA 4E42B 3IDGB 4N8VB 5SWSE 2NZIA 5DO8A 4ZFZB 4LGRB 4KJPD 4NZTH 2FEDC 2G2RA 3H7BB 4QPEA 3UCRA 4YAQA 4ZFFA 1TUPA 3PGFL 1KG0A 4TULH 5JZ7C 3CDCA 3ILQD 5H4ZA 5I30L 5HVFB 1KJ2A 3HJEA 3DECA 1QRNB 4JO4H 3TYGL 5M7QA 5JQIB 4FJYA 4OCRL 4H1LB 3VXRD 1CLOL 4U33A 5FM5O 5TF0A 2PO6C 3FTZA 4N85A 4UT6H 1R33A 2X2IA 5AAWC 3WUWG 4DKFH 3FHQA 5HI4D 4PGDA 3FFOA 2EVIA 4R4BB 3RDTD 5DI8A 1SDDB 2PPAA 1PU0A 4J5VA 2NY4B 1QTYT 1B2YA 3WMSA 3PWPA 1SJHA 3RPIA 2YKKA 2WO2B 3IFOA 1DVUA 1NUDA 2IQAA 4MXQC 4R7NB 4WNQA 4L4TB 4FQXD 3FTVA 4J27A 4RIRA 2RFXA 3GI8L 2XIIA 3ETBJ 1XZ0B 4HFUL 4CJ0A 3LRSB 5EC1B 1JYWA 3VWJC 4OLYH 5F1OB 1GL4B 1RJZA 5KN5A 1U6AH 3BD5A 2B08A 5DMGD 3ZZQA 3S36L 2VDOL 4G8AC 5E1GA 3DOSB 5GGQH 5HDBF 2IQ9L 1LILA 4JG1H 4PG9B 4W70A 1F90H 5DYOA 2PMZA 2OXGB 2R0LL 2ZPKH 3ARFA 4AUUA 1OARL 2H47C 5LBSH 4E36A 4HKJB 3N9GH 4AM0B 1CK0H 1PNCA 1Q0YL 2OMYB 2LT9A 3PP3H 4LKXB 2CDFB 4RMTA 4P5KB 5DD3L 4F58L 2WYHA 1KXVA 1MY5A 4U3SB 4JFVA 1IQDA 1JVOA 3FT1A 3QIUA 1B88A 1EO8H 3FCSB 1JPSL 4QRTB 4G9DB 4PBXA 3C5SA 3DBXA 4GG8A 5JQHC 1AZZC 1TQBC 3PL6D 1VKXB 4NHUA 1UYWH 5KSUB 2QR0B 1W0WB 3B2UC 5F0PB 3M7OA 1BAFL 5IWLC 3WEBA 4EZLA 3O6FA 3JWOC 4QXGH 4AITA 2KKQA 4IHBA 5G55A 1DQIA 3RL1A 4I85A 5CN2A 1VZHA 3JVGC 3FSOA 1SXZA 4RFOH 1H6TA 3HS9A 5KANI 2XQYA 3GS0A 2D31B 1PEWA 4Y9CA 1XTLA 3MNVA 3FFCA 3VSVA 3SGEI 1HNYA 1CBVH 1CI5A 2DD8H 1RZFH 3LIUA 3TL5A 2IPKB 5CEZL 3DURB 5F7LB 3DPBB 3N1PC 5DVKA 3SGJA 1EJOL 1RSYA 2V9TA 4Y1AD 3LB6C 3NIGF 43C9A 1GY1A 1GPOL 2QPUA 3ESPA 4ODVL 2OMVB 1KLUB 2AGJH 3EYSH 2P47B 5KOMC 4ZFOA 1A6WL 4IU3B 3NTCL 4FG2A 2HKFH 3IMUA 1K2DA 5HGAA 3BWAA 3FO0H 2O5ZH 1M9WA 2C4FU 2A9AA 3QR1A 5E4OA 3V5HA 1B4RA 1ONQA 5HHVL 5BO0D 1E4WH 2PETA 2UY7B 2VSKB 3Q8BA 4WHCA 5E5MA 1NIFA 4NZDA 4HXAL 4V11A 5AOZA 1EGJL 4DK5A 5J89A 2CRYA 1S9KC 2YC1B 1S5HB 1JGUH 2BVQA 1A7RL 1OM3L 2JXMB 1KCVL 5IBLD 1A1MB 2E27L 4OD3L 1A6ZA 2OL3L 5ETUB 5J1AA 2D0FA 2PXYC 4E9VA 3FRUB 1BW8A 4R97C 5ALCH 3QG7H 1MZYA 1RLWA 2BP0B 2JJTA 4RMUA 2NUTB 3WHE1 4NKDB 4XCNA 1KCSH 1HWGB 4N6RA 3TT3H 1I8MA 2HJKB 3LV3A 2KLTA 1AHWB 1FYTD 1YNTF 2AKRA 5G4NA 1JPTH 3DI2B 3QFDB 4PCYA 1SBBA 4U1HA 3ZHNA 4BFKA 2F61A 2F7RA 3MOBH 3TCLA 1JPFA 3CSPA 3FT2B 3JZ7A 5C6TL 1YMHA 1DVSA 2YFNA 4PCTA 4BZ2L 4WK2B 1TF4A 4DPCX 4PVBA 1L9QA 2JFCA 2E74C 2CSPA 2R4SL 4HS3B 4A7UA 1U3HA 4GG6B 1YNKL 5ESQB 2OMWA 4N2GA 2AK4D 5IROC 3TU6A 3MO1B 2Z8RA 2E7DA 1UA6L 1U33A 2ZTBA 4PJGF 4X2UA 3WCYA 5IB4B 4PJ5B 3E8VA 5ITFA 3P4NA 3GXUB 3AAZB 2AI0L 4BUQA 1SJVA 4MCMA 3E1F1 3AC0A 3EO9L 4ENZA 4LXFA 1ES0A 3T3PE 3VXSB 2OZNA 3LVTA 1A6VH 1CS6A 2P3YA 1TQTA 1EHXA 3L4WA 4JPVL 1ET5A 1O5PA 1R3JB 3IDYC 3VI4F 4L18A 2IH9A 5TQ2H 1BM3H 3WN5A 5MENA 4OZGA 5GRVL 3QNYB 2QQKL 4K7PL 3QRFM 3VXOA 2VSDA 3N6YA 4BKLA 2H3NA 3GO1H 5EO1A 2PO6B 3NEEA 2CBQA 5DEFB 5FGRA 2QZQA 5DYFA 5FWQA 3UXFA 3O2VL 3C8DA 5DURD 1OWRM 3FO1A 3AWEA 4J4PA 1L7TL 2PYED 4JGJA 3S0PA 1HILB 1DQJA 3QZBA 2WYTA 4MA1C 2CPUA 5FLVA 4P2YA 5EOCJ 1J1XL 1NA8A 1WT5C 5FA4B 4DUXA 3R0NA 1MI5D 3K71A 1AI1L 4EO5A 1VLXA 5DVLA 3N1QC 2WUCH 2DLFH 4JM2A 1I3GH 4NPKA 1L4IA 4UQCA 4XVSL 4EN3B 4BFNA 5DCCA 1WCBA 4OIFA 3PABA 3ZYOA 3H6JA 3S3PA 3NH7H 2GTZA 4G9FA 3DHMA 1A64A 4MS8D 4XZUA 3G5VA 3F62A 1NZRA 3LJ3A 3DTXA 4PV1C 1HI6A 4HK3J 4KDVA 2N7AA 4KX8A 1DUYA 5J9PA 3D30A 4G72B 1D7CA 1S9WA 4LAJH 2WQ8A 3L95A 1M71A 1SXSA 3GJFH 4E5XB 3F58L 1ZIAA 2YAQA 4O02H 4NENA 1W72A 5JDSB 2WWKT 3RWDA 1QUNB 2AANA 4KY1L 1TQBB 5BVPH 3WTWA 2P4AB 4OU3A 5L9DH 3DC0A 3QFJE 4GXUN 2P48B 3V4LA 4NRZA 2K70A 1RH8A 2QFRA 3N5AA 4XVTL 4PUBH 4HUVB 1LEGB 3GDBA 1T5XB 5DHVA 5BRZB 4ONHA 2QELA 3ARDC 5DMKA 4JRYA 3U83A 3IFLH 4IW4C 4ZD3H 1S7RA 4HS8L 3I3EA 1H3UA 3WLBB 2AC0A 1N6UA 2WUBL 2DI7A 5DJDB 3T5WA 3S36X 4CVZB 1RURH 4AQAB 3RKPA 4Q56A 1FRGH 4ZUVA 5LHDA 2UWEE 5MHSD 2ITCA 1A9EB 2IANA 2P5EB 4X98B 4FABH 3GKWL 2KT6A 1R75A 3G08B 3HLAB 5D6DA 1IGJB 3C60C 4AK2A 1YY8B 1ZVSB 3QUZA 4OZIF 5DJ0A 1FFPA 3T4AC 3HG1B 5EOTA 2CHZA 5D70L 2XBZA 5FOBA 4N5EC 4NQVB 4JJ5A 1MAKA 3QPKA 4LSVL 3WD5L 3AB0B 5AW5B 3TTSA 3QHFH 3KXFB 4GI6A 4YBQC 2VL5B 3PWJA 4A2MA 4M93C 2R1XB 5F88B 4Y2DA 2NX5D 3S96B 2BNQD 1KN4L 1HCYA 4J3SA 1E4XI 2DPKA 2YMOA 5F44A 5GJSL 5BV7H 4KK8C 3SGDH 3ULSB 4P99A 3IM1A 1GA2A 3TO4A 4YSDA 3QCUH 3N43B 4YC2C 4R97B 2F0CA 3MTRA 1I82A 5I0VA 5TD4A 1VFMA 3ULVF 2ZSVA 1MJUL 1LO0L 1V3LA 1ZA6B 2CJUL 2UZPA 2X12A 2X4NB 3I6LD 4ZJ9A 5JW3L 4FLHA 3Q6GH 2DQTL 3MTXA 1TPXC 1JGDB 4TNFA 3RWFA 3TONA 3OAUH 4UQ3A 4EVNA 1NM9A 4IU2A 1HZHH 1IC1A 3HCVA 3SYOA 2FATH 2L7EA 3TNMB 4JFSA 3MRRB 2YBRA 3BPNB 4LDOB 1FQ9C 3T65B 4FP8L 2ZKXA 1H15A 4OLWH 4A66A 3A6CL 3WU1A 2PUQT 3H9HA 4GXFA 3T9WA 5CIPB 3SYCA 3J8F7 3KEDA 4OCSL 5I66B 5JA9A 3GXNA 1JYVA 3QB7C 3ULAB 4NIKB 5BO1L 2ZWSA 3EYFA 5KANG 3VRIA 3LN9A 4UINH 1BFSA 1EZLA 4CBPA 1TTGA 1NEZB 3LKOB 3L1FA 4BDVB 4Z76B 5DK2B 3LNEA 3O3EA 1M2VB 1DLHB 5GJTH 1EMTL 1U8KB 4KXZH 4EDXB 4JRXE 4N1HB 3AG4B 3RVUC 4BQCA 2I9TA 2FH8A 4ELMF 4MNGB 2AK1L 2ZKHL 3L8QA 1X5MA 4NHCH 4NM8H 5L7XH 4U1SA 5GSVA 4CSPA 4WEEA 3RFRA 5A6LA 3QUHA 1KN2L 3D0AA 2WBKA 4MWFA 4C56B 5DJ2A 4TQEL 1HHGB 3MXVH 4FEIA 2R1WA 3WMQA 5J6HB 4KTGA 3KGRA 5EA0L 5K69A 1HYSC 3M1CA 1I31A 4AW7A 5CCJA 5J13B 3W38A 1E8XA 1TLMA 2E4TA 2ENYA 2YPVL 2HKAA 7CGTA 3ROOA 4E41D 5MEPA 1INEH 5IBUB 4MA1B 4NM4H 2K6YA 1WK0A 4LOVA 4GQQA 3MV7D 1E5UI 4NXKA 1AZUA 3HRZA 1JHTA 5DJAB 3VD4A 3CN4A 4DCQA 3I9PA 4I1NB 3W57A 2AEWA 1PZ5A 3GSUA 4ZAKA 4APQB 2VERA 2R1YB 1I85A 2FT6A 1TZGH 4HVBA 3OB0H 3FU7B 2GJ6A 5ILTL 4DNLA 3DARA 2BMKA 1KBVA 3BZFB 3MLYH 1XB6A 4IBYA 3ZKXC 4FX5A 2C34A 1DJIA 1C7TA 1X7QB 2IH1A 3TH4T 4GMTL 3FB6B 5BJTA 4HFWA 4PLKD 5KYYB 4K7PX 1T7YA 2QSVA 2W65A 4Q2ZA 5K59E 5B39A 3UBXA 1EANA 3MFFA 2HSIA 2IGTA 2Z7ZA 4KAQL 1U21A 1EFXA 3QDHA 3CLEL 2ZKWA 1MRDH 4LVHC 1RK0B 4LIQE 3O0RL 3MRQB 1QLFA 2C9RA 2L8AA 3F7QA 5KZCD 3Q06A 2UUDH 2YPKA 3O4LB 5DO2C 2GHWB 4JJOA 1I1YB 4BSVA 1OCCB 4FQIH 5C08B 5MEOA 2IO5A 4KDWA 1ND0A 3UP6A 4L9LA 2EE3A 4R90H 3ZU8A 4AEHH 1IAOB 3TEZA 3ZDYB 1SJEA 3ARDB 1F4YH 1NC2A 2GK0B 2W81C 1ZHKA 4I3RL 2WLZA 4UILH 1TJIH 4R4ND 5J3HD 3L6FA 4P2RB 3G04A 2NY3B 2LLLA 1YVLA 1OAYH 5E9DA 1J8HE 1I3UA 1ZSHA 3NGBC 3U0TB 3WFDH 3T0DA 1KGYE 3CLFL 1N0XL 1RZJL 2IALA 1G6RH 4GEIA 4JGUA 3T08A 5I8OL 3WE6B 4U1LB 3O8XC 4KTDL 2C1OB 3SDXB 5HSFA 2P8MA 3C60B 4N25A 2I07B 3QAZC 4NBXB 2CLVB 1R4XA 3IDNA 2FJGB 1LDSA 2AAAA 2UZXA 5DEJA 3VYPA 3S5LA 4HT1H 3D39E 3WNPA 4Z8FH 2DDQL 2GITA 2JH2A 3GBMH 5DZLA 5ADOL 1XWVA 3KPOB 4FFYL 4DGIH 3IXTA 5L2KE 1JBJA 3V2AR 3LXBA 4EKJA 5DK0A 4E68A 1FDLH 3WFZA 1EZSA 3ARTA 4F9LC 2XTSA 3RU8H 2CBPA 1SXCA 2EUXA 4NAQA 3T8XA 2CHWA 3IFPA 1HWWA 3RL2B 3AU1A 3K8MA 4YC2B 2QKSA 4MDJB 1AACA 2HTLC 2ZWYA 3GLEA 1ZTXL 3PJLA 4HXBH 1G9NC 4GRLC 2VXQA 2CU9A 1D5RA 3AM8C 4BE5A 1XR9A 1QSFE 2BP3A 1U0QA 1CT8B 4KFZC 4AE0A 4NO2B 2AVFA 3STBA 1HQ4B 3D8MA 3RWHB 4J3OF 3NK3A 1Z5LB 3SHSA 5SWZE 5IB2B 1OTTC 4OGXH 4XMKH 3IVKB 5KSBB 1F2XK