1TEYA

Nmr structure of human histone chaperone, asf1a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
156
structure length
156
Chain Sequence
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the interaction of Asf1 with histone H3 and its functional implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords ASF1 anti-silencing function 1 homolog A
total genus 28
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 1teyA00
1TEYA 5EIIG 5BNXD 2IIJA 4ZBJA 2IO5A 2DZEA 2CU9A 2Z34A 4EO5A 2YGVA 1WG3A 4RRPM 5BO0D 1ROCA 2HUEA 2IDCA 5C3IA 2I32A 2Z3FA 3AADB
chains in the Genus database with same CATH superfamily
1IGCH 4G1MB 3V0EA 3K2IA 3VXPB 1U92B 3PV6A 4MA3A 3MRKB 1JZFA 2RCSL 1LEGB 3LJ3A 5IMOB 1OSZA 1DEEB 2DQHH 1UT1A 3H9ZA 4XWOC 4NDMA 4XP1H 5GJTH 2J7LA 2JIXD 3UTZB 4Y89A 4N9GB 3UMNA 3LH2H 3WN6A 5DLLA 5CP7A 4RFEB 4UU9B 4X7SH 4HC1H 4X7TB 1XBDA 1RULL 3GRWH 3ILDA 3D33A 3N0AA 3QNZA 3WJLC 2BNQD 4P06A 1N6QL 1XZ0B 3DC0A 3L54A 2NUTB 3TZVA 1N0LA 3G3LA 3S4SA 2A9DA 3OAYK 5C2BL 3TTYA 4I9WD 1QSVA 5GRXG 3KWWA 2HLEB 1U0QA 1XCXA 1SN5A 2OA9A 2EECA 5L0QB 4ZMLA 1ORQA 3TO2B 4YDVA 4ABUA 1SPDA 2PW2B 4P2QA 3E6FB 1FBIH 3QUYB 4C56B 4GQ9L 4MAYC 1VADA 3BD4A 4CU7A 3QORA 4JUTA 3UG4A 3BSZA 4MZIA 3SKUD 5KSUB 1BIIA 1R34A 2CK2A 2WXQA 4M7JL 3MV11 5ECGA 1JCVA 5ENWB 3QYNA 1KPVB 1FH2A 4PV9B 1JYWA 3RDTD 5JLZA 5C0JA 3HC3H 1YEJL 4PJ7F 3U9UA 1NBZB 3ZVVA 2YD8A 4P4KD 4X9GA 5C3LD 2P24B 5EMYA 3WIHL 3DV6A 3QUYA 4C56A 3UPAA 3MXVH 1DE4A 4LPCA 4EI6A 2A7BA 5FHAL 5IFJA 4KVCL 1ZANL 2NQCA 1OT1A 2VLLB 2A5UA 3LN4B 4RWYL 1T6WA 2JXMA 4Q74A 4M3JA 4OV5A 3OMZA 3HS9A 4WHYH 1B3IA 3OC8A 4GT7A 5JLZB 4UANA 5PCYA 3NH7H 3QS3A 4JG0H 5LNEA 1ZXKA 4FMVA 4PW9A 4W9GC 1NL0H 5DZLA 1TQUA 2P80A 4GXVL 5E6YA 2OXHB 2R0WL 4WEEA 1CYWA 2HYMA 2JB6A 3LS5L 4XPBH 5BS0B 1R0AL 3LH9A 1HOCB 3JT0A 2CDEB 3KJ4B 3QPQD 3RDJA 3FQ2A 4UUJA 5F3BB 1P7QA 4MASA 5GGRB 4ZYKA 3IKCA 1NKRA 2NW2B 2XICA 5I8OH 4RBPH 4O9HL 5T1KD 1I75A 4LEXH 3AY4A 2RD0A 2XBTA 3GGWA 1L9TA 3NABH 4RLDA 4K94H 1F8TH 3U4AA 4QHNA 4LPWA 1TTFA 3ESNA 4LHUB 1NH6A 4LSPH 2ZOOA 4ZX4A 3HS0C 1KNOB 3ETSA 4PBVC 4BFJA 3FBKA 4PJXA 4CADB 4TNWF 2CH8A 3OHXA 3OKOB 3LB6C 5D7KD 3ZTCC 5I75C 1CL7H 3M8OL 4QLWA 3JV5A 3O8XA 2FR4B 5TK2A 4O2CB 5DEFB 1U6AL 2VISB 4XXDB 1GXEA 5IMLB 2R0KL 4A2HA 5IB3B 4GYBA 1QWNA 5GIRB 3QC6X 3MA7B 2CRIA 4G9FE 4JRLA 1SF5A 1ML0A 1E2VA 4CN1A 2VIRA 1VACB 3QDMB 4K3JL 4FAAB 5MENE 4RGNC 5KJRH 2X40A 5MEQB 1PY4A 2JLLA 4JM2D 1W15A 4E36A 2EC9T 4HXAL 1XIWC 1Q90A 3L4VA 1UASA 3M88A 2X1OA 3FDWA 1RZIB 3QEUB 1YCSA 3QDHA 3ECBA 4YFDB 3PDOA 5HYJE 2NY6C 1NAMA 2VXQH 4YBLB 4L3CB 4MXWL 5DVKA 1VPOH 3BFOA 1GZQB 2BWDA 4GH7B 3SE3C 3TH3T 5JW3L 3AWEA 5IW1B 5INDA 5MENB 5E0QA 3QNXA 1R5WA 4DKTA 3DUSA 1OAUL 3ZYIA 2CLVA 2E27H 1IB5A 2EDYA 1U3NA 3APCA 4AM0A 4J3OF 2XX0A 1F4YH 3VD5A 3R19A 1MJ8L 3QO1B 3VM5A 1BPLB 1YRKA 3MN8A 2WPGA 5TH2B 3H42L 4CVZB 4DP4X 1I1AD 4DP8X 2P7TA 1S9VB 1PKQE 1UURA 5JDJA 5H8DA 3DJZA 4ETQA 1HHGA 4DGIL 5DA4A 4MD4B 2ED8A 4ZBJA 2FIKA 2W60A 1BM3L 3RKDC 4BQ8A 3TFKC 4HHGA 3F7RA 1RZKH 5D2LA 4NQSA 5DQDL 2UVEA 4W68A 3ZDYE 1U8CB 1JZ5A 1AZNA 1J9SA 4ELKB 4DWHA 4WFEE 3OAZK 4JDZB 5DQDH 3S37X 5MEOB 1T22B 3PE9A 5JHDE 4XTRD 3FB8A 2Q7YA 1U93A 5E6RB 4AJWA 1LO0H 4HAKA 1MCJA 4M3KB 3UL4A 3OMAB 4EMZA 5J57B 1AGFA 2Q6WB 4PYGA 3ZHFA 4PLKD 5TDNA 3Q6GL 4KX7A 5D1XD 2CMRH 5AL8A 2OMTA 3HIZA 2LU3A 1ONQB 2XPGA 2ZIDA 3D52A 4X4KA 1PKQA 2X70A 3RJOA 2GSGB 3PJSA 5DRZB 1DSWA 5LBSA 3X12A 3ZOAA 2EVIA 2Y06H 3LB6D 3GXMA 4Q58C 5EBMB 5JXED 5LQBH 3KPNB 1DZBA 4X5XA 3T1WA 3K6DA 1L5GB 2HMIC 2ZCKH 5I18L 3O3UN 1IC7L 2NXYD 2YPLB 3QDJB 3T1FA 4BZ2L 3ZGHA 2ZXEB 3IDIA 3V4VB 1A6TA 4KNSA 3PGCA 4W9DC 4OD1H 1IEAA 1U8OB 3GT6A 2J72A 3L4WA 1OTSC 2WMPA 4U2YA 1UKTA 2BOBA 4M8RA 4H1LG 5I17B 4EIBA 3AT9A 2FLBT 4XE0A 5C0AA 3SEPA 1YVLA 2QPEB 1FGVH 2YHGA 3BQUA 3MRQB 1BFVH 4HF5H 3D25B 2EVGA 2NNAA 4C4UA 1HYSC 2J71A 3KYNA 2Z1PA 2J3SA 4MMZA 4WO4B 3V4VA 1KXQE 1J9QA 1KGYE 3DIFB 5CLTA 5MEPA 2MNJB 4JQIL 4HKJA 4X42A 3GK8H 2WQSA 1GOHA 1YPZF 3MV7E 2XTJE 1QEXA 2OMZB 1D9KB 1W8NA 4L8CA 1GH7A 1KIRB 3UBFA 2AZUA 2RMNA 4QHMB 1NEPA 1EFXA 3DOSB 1AFVH 1JPGA 1RL1A 1EHLL 3RTQB 4JAMA 2GJRA 3X14A 3VH8G 3HPLB 4GKSA 3FF7A 5EO1B 4HPHA 2HTKD 2GHWB 2IOOA 3GNML 2YUWA 4JFEE 2G75B 2ZX5A 3MGTB 3U7YH 1WBZA 2ZKYA 3QZOA 2CKBH 1P4LA 5D7JC 3EGDA 2XA8H 2EDJA 2X3AA 4XNXH 1DJIA 1Q9OB 5LGJA 2I5YH 1KPUA 4Z18A 2G3XA 3J07A 1A4BA 2QKIB 3JWOL 1MW1A 1R17A 3MA9L 4L1BA 1T1WB 2VUKA 3P69A 2BY3A 2CA3A 1PCSA 4N8VB 1GOFA 3NTCH 1INDH 4Z7UA 5E99H 4XNYH 1ZIBA 3IBEA 4NI6A 4D9LH 4EZJA 3LZOA 2CK0L 3B9EA 3NACL 4MQ7A 1AOZA 3B4NA 4YHIA 1K2DA 1MIEH 5DJZB 1A6ZA 3D07A 3GMMB 4ODXA 5AVSB 5HJDA 4AYGA 2VKWA 1JJUA 3BX7C 3LHAA 4M61A 1RERA 3ETTA 3VFNB 3IF1B 4D7PA 4RA3A 1IM3A 2JIXB 5DVOA 3FPXA 3ZTEA 1OCOB 3GHPA 3TT1L 4GKNB 2EO1A 3TEWA 3BLBA 5I74B 3LKPB 3PDDA 2IGFH 5L9DL 1IC5L 3ECVA 4I9WE 2LQRA 1EGJL 2UXTA 2BVQA 1CXKA 5CM1A 5EO0B 2Y4SA 3N43B 2CIIB 4NKOB 3C5ZA 2W80C 2O6PA 1IBBA 1DL7L 4WGWB 3BKML 1NUFA 2AI0H 3NT0A 4PRHD 5T1JA 3IDNA 3GLDA 5FKAA 3T4AA 5J06A 3EOAB 3C9NA 2PCPB 1D5BA 1SEQH 4UZUA 2B8OT 2EE0A 5IM7B 3V4PL 5F88B 5A2CA 4H8UA 1N67A 4A2FA 3D0LA 2MQGA 3F58L 4XMPH 3AT8A 4UM8A 4NRZB 5FM4A 1NIAA 4YSAA 1M42A 2HFGH 5C0DB 4J3OC 3Q2CA 5F9OH 3C5ZC 4PGDA 5EOTB 4EI5D 4GSQA 1MCFA 2BVEA 3DROB 1CN4A 2FZ3B 5IHHA 3CPLA 3LEVL 4YBQC 3INUH 1A6WL 1YHPA 3ENEA 2XXFA 4U4IA 3VU2A 5FGBC 4BXVA 3ROLA 3KPPB 2ICWJ 3PY9A 1CYXA 3AUVA 2OMUA 2ZX7A 5I23A 3RFZC 5DWUH 5E5LA 3GI9L 5D5ME 4GUCA 5HHOA 4NKQB 2FJHB 1X6NA 4QYOA 2GSIA 1QI4A 2GT9A 4Z7OE 3TO4A 4JHAL 2CM5A 4H88H 3KR3L 3BZ4A 4YO0B 1LO4L 4U6HA 3JV6B 4DQAA 2AJYH 2CRZA 3D30A 3ALXA 4MJIE 1OT2A 3QUYD 4C56D 3P3SA 3G5YB 1XB3A 4AZUA 3QEQE 4KKRA 3HLKA 3VFGH 5I19H 2ZXAA 3VXNB 3SYOA 3RX5A 1KENL 1OTTD 5HHME 4ZFFB 1NGXA 3S3JA 5LAPA 3FH8A 5EOCH 4L1TA 3LRSA 3P30L 4FL4C 2XACC 3BZ4B 3NCBB 1NSNL 2D4DA 2DI7A 3O4OB 4XP6H 3LXCA 3CHSA 4MCYB 5BOPA 4G83A 2BMKB 1E4JA 5L4IA 3QDMD 4IKLA 2EIJB 4OFDA 5CINH 1VAHA 2XJKA 2ZJSH 2A6KB 4WTQA 1J05B 1ETA1 2C3HA 5I16A 5DZAA 2EKSB 4E9SA 2K70A 3M07A 2TSAA 2DV6A 1YNLH 2PTTB 1X44A 2A6JB 5F89B 1IFGA 1FSKC 3VXME 4ZFGL 3NEOA 5F70A 2DTSA 1JXFA 3F85A 1IM9A 3NABL 4HFWB 4K7FB 5DJXB 2B4CC 4W4OC 3UGXA 3BC9A 4HC1A 2PR4L 4F57H 1Z0MA 1TZIB 3VQ2C 5LJYH 2H3XC 5FAAA 1N59B 2ZAIA 4H26A 4NQDE 3RKDD 4AIZA 2O61B 4OR1A 3D9AH 2ITEA 1AIZA 2Z65C 4QTIL 3V5HA 3BRGC 4NUGL 4G8IB 2P5WE 2OCJA 2DQJL 1PBYA 4QXTB 4MDIB 3V0IA 1N26A 4DGWC 4J28A 4Z8FL 3TEYA 3S37H 2E47A 4FXKA 1HHHB 1MFNA 2X4TA 2QQQA 4R4NC 3MLSL 1JFQL 4HHWA 3ZE0E 1ASQA 5F7EL 2F7QA 4HJTA 5DHYA 1J5OL 1KCUL 4LLAA 5IJDC 2QHRL 4JPIA 2VN4A 2E9BA 3VU1A 4YDLB 3PWJA 2NSQA 4P23C 1VFOA 3KL0A 3EFFB 3BD3A 3MKGA 4YK4B 1KJ3H 4X98A 2APVA 4HXBL 3MDJA 5HGHA 3SD2A 3T3MB 1KEML 1HNFA 4GMSH 2DY2A 4NKIH 4PTTA 2AK4E 5CN1A 4E42A 1A4JB 2JNZA 1ZHLB 4WWKC 4IRSD 1GS8A 3BZEB 4K4KA 3A6OA 4GFTB 2R59A 3ATDA 2Z64C 3DIDA 3KPSD 4I88A 3EOTH 4GXUN 3W0WA 2WO4A 2WLNA 1NCOA 4WK2B 2H1PL 3UTZA 1HKLL 3LCYA 3BAWA 3SBWA 3BIKA 2Z8SA 3CSGA 4X7TA 1S9YA 3L9RA 3VGDA 4DZBB 5D1XE 1ZPUA 1QUNB 5INCB 4JZOA 5B4MD 2AANA 2WSPA 5GGVY 1MRCL 4DEUA 1D6VL 2C9VA 4YSQA 2HX9A 4ZD3L 3RX9A 3HJEA 4WKXA 2CSPA 4XNMA 5GS2H 3DGGB 4ZOCA 1MRCH 4HU8A 5E99L 4EN3C 4G8FA 4PTUA 1BMZA 2FHFA 3WUZA 4UQIM 3MJ9L 3MV9A 1OCWH 2BS9A 3HCVA 5KYXB 3L7EA 3EZ8A 2IXQB 2XBDA 3SY6A 4Q9QL 1QLEB 5IJCC 3BKYL 1E6JL 1I7UA 2ZUUA 5FW7A 2AXJA 4W9EC 4EUPG 5ISZD 2EE9A 1KB3A 3QEHB 4S0HA 5FK9B 4FQXB 4NO3B 3FRUB 5E2VH 3REWB 2ENYA 1U3YA 4QRRD 4OZGB 4F7EB 2GJ6A 2JKNA 3TO4C 4TF4A 4QT5A 5D7IF 1YY8B 5IIEA 1Z9SA 2ZYIA 4NO5A 3EYOA 4ANUA 5LG6A 2WO3B 4LCCB 2EDRA 3C5ZD 2WVVB 3D4CA 1BA9A 3IDXL 3IAGC 1QFHA 2GBUA 1D2OA 2ZOUA 5A40E 3HB3C 4G5ZH 2FNWA 1ZVNA 4MA8H 4FL4B 2BRRL 3RGVC 3SDCA 4AQOA 2GY5A 3GI8L 4ZAKC 3MZTA 4MNGE 2CUAA 1IVLA 4M93B 2JB6B 4OQTA 4GMTH 4XVJL 2NY1C 5FGCE 1MHCB 2W0LA 5HHPB 2O6DA 3QIBD 2CDEA 4LF3A 4MSWA 5DFVC 5F1IA 4LKCA 4N5UA 3UROR 2C3VA 2F5AL 2FX7L 3MRRA 3Q6FA 1HAWA 4J3WA 5F9JA 2D3JA 3BAKA 5TE7H 2DEYX 4Y0GA 4YNYB 3KLAB 1KCUH 3PWVA 2X1WL 1MWAB 1XQ4A 3ML8A 3W56A 4ELME 4FHBD 1CL7I 3SGEH 2HN7B 2YPVL 2FX9L 4EN3B 4WEBL 1ZGLM 3FMGL 4KI5E 4LF3B 2XN0A 3THMH 1H0DB 3LD8B 4KROB 1AO7B 1ZTXE 2BNRD 5CMAA 5DK0A 5T33H 3BFQG 4DP6X 1DBBH 2ICEB 4ERSL 2VXVH 4OFKA 4UT7H 5T5FH 5B1JA 4EIZC 5FEBA 4Z7WE 4UAOB 1E9QA 1FVDA 1JHTB 1ZK9A 1EV2E 4DQOH 1ZA6B 2NZIA 1N0XL 3ARTA 3O3DB 1M7XA 3DPBA 1ZDQA 1T3FB 2C4XA 3VD2A 2NY3D 3GMQB 4YPJA 5TGBA 4PRAA 2NZ1A 1Z7JA 5L2KB 4GKOA 5G4NA 4D0BB 5F1OB 1NFIB 4GNKB 4N2AA 4MCZA 3TIDA 1N3NA 1WG3A 1A14H 3MI6A 4R0LA 3VRJA 3ECBB 2X09A 4HLEA 1KB5H 6TAAA 1P1ZB 2ZXQA 3P30H 4N2KA 3DHPA 3TTSA 2IDCA 5CEZD 1PFCA 3GLEA 4MNQE 4R26L 2FO4A 2GSMB 4JFQB 4YUEL 1GZQA 4X5WB 4PU2A 1SVCP 3K2MC 3QJQB 4P2AA 4RMQA 1CFVH 3GMNB 4M1DL 1RULH 3VD7A 5GRWA 3MLXL 4UDTB 1WE5A 3WUWA 5BRZE 1U8QA 2UX6A 4FMFA 2X4NA 1FL6B 3HS0B 3G08B 3D39B 3HAEH 2E7BA 2YQGA 3HN3A 4JKMA 4JY6A 1GOGA 5GIRA 2A73B 3MA7A 3HC4L 3HUJE 2DQCH 1PZAA 2LLGA 4Y8DC 4QRTB 4APXB 2HUEA 4Y19A 4BRVA 3BH8B 3GPEA 5D9SB 4IHOB 4ZMYA 1WBYA 5E4EB 3MRHA 4URTB 2DDQL 3KYAA 5C08A 3VFRA 5GXBB 5K9JL 5T1LD 1Y6NR 4AWJC 3MRDA 3RWGB 4E0RB 4BSWB 2LE9A 4EUPA 4PJ5A 5DJAB 3RZWA 2X0VA 4H8WC 2VDPB 3T77B 3ESMA 1ASPA 2Q9OA 2NY1D 1FZOA 1KCRL 3GDCA 3HHSB 2DM2A 3GJFB 4AVIA 1JWUA 4PCSA 3F5WA 1BQSA 1VZHA 4ENZA 3T3PF 4HIXH 1SJVA 1JPTH 3HI5L 4YHLH 3KXFE 1ZPLA 1UEYA 4N0YL 4MKMA 3RZCD 4GRMA 5KSBA 5F8QC 4HUCA 4LVHB 2L7QA 1HHJB 4U1JA 2X70B 3UXFA 3QFGA 4H5SA 3TNMA 2AJUH 2W60B 3QFJE 4JQVA 4OQ1A 1PL3A 5T5FA 4WY7L 2X6AA 1IEHA 2F8OA 3JV0A 4X5XB 4Z7VB 5I30H 3CFKA 5D8JL 1UWGH 4FXTA 4O5LH 1NCDH 4S2SA 3NAAH 2HJFA 4D8PB 5EUKA 4MCNA 3MO1B 1S5IL 3PGCB 4QWWC 3LNIA 1EK3A 4S1DC 5BXFB 2HLAA 2MFNA 4RISL 3VGBA 2WLZA 3O6KL 2WMPB 2A9NL 4LXFA 1L9QA 4OLVL 2XG5B 1JNNL 1OQOA 3W82A 1A6PA 1K4DA 1I8KA 3ME0A 3K6SA 1QRNA 2G9HB 1PF3A 3RY4A 1N70A 1RZ8B 4JG1H 1GGBL 3VFWB 2ZF9A 5DD6A 1JNNH 2JJUA 5D7IA 1U3HD 2EYTA 1HTYA 5BCAA 1EO8L 3HAEA 2VAAB 4YEEA 2EZ0D 1T21A 1YEFL 4JM2B 4EAEA 1URZA 1MPAH 4DFIA 1AHWB 2XG5A 3WJMA 4P2OC 2H26A 1A8JH 1YYML 3WELA 1EO8H 4MMXA 2G9HA 4DUWA 4FNSA 4DKAA 1O6SA 1UWYA 4G6JL 3VJ6A 1YEFH 1IBZA 1BVNP 1H3WM 3HRZC 5BMFL 3CZUB 4K8RH 1MJ7L 5D1ZA 3EFDL 1YUHA 1N8OE 4BEIA 2Z4TA 2O30A 2F53B 1IIIA 1NPJA 3CNKA 3VWJB 3WDJA 2XVGA 5DTFB 5FDYA 4YHPB 3FT3B 3FQTA 2WC7A 3ILEA 1P4UA 4NAJA 3V10A 3I3EA 2ADFH 1RIVH 3MRPB 4JO8A 2CCVA 3KPSB 1BV8A 2DJ4A 2G75A 4ZZKA 3QQXA 4KTDL 1W0WA 1GJIA 4PJHA 1RU9L 4GJTB 3CH1B 1JK8A 3X13B 3SBPA 2I25N 4L0PB 4N0CC 1TQSA 3L3KB 3RTQC 3CFJA 2QPSA 4L4TB 5HJBA 2AJZB 2QKIA 2J6WA 2CLRA 2J1YA 3CN3A 4XBGB 4N85A 4XBMA 2WJ7A 2L4OA 4IJTA 1ZHBA 5C0ND 5HDQH 2N01B 2Y0SA 3BE1L 4UMSA 3VFMA 1FG2A 2DBLH 3MBEC 3QJHB 5K39B 1JMXA 3FU5A 4WW2F 1G1CA 3V5DB 3P2TA 3GSXB 3T5WA 1EFXB 5F7EH 3MV9E 3QQ4B 5C0BA 3A4EA 2F5AH 3O4LE 4JY4B 1U8IA 5T1KA 3FFDB 4FLSA 5CJQL 1KFAL 3QWRA 4RSVA 1XIWA 3TA3D 3HTLX 3V6FA 3GSUA 3D7PA 1MFMA 3CDZB 2BSRB 3VXTA 3KW7A 5EC1B 3V5DA 4WI7A 1I1FB 1AD0A 4ENED 4DP0X 2BDNL 1BDYA 2BJMH 4RGND 1TQTA 5IEHA 2DL2A 2I85A 1T7YA 5DD3H 3CWGA 4AE1A 5C1MB 5E1AA 1DBBL 4WGVB 1JK9A 4Z0XA 3K1DA 4UT9H 2CO2A 1HQRB 2QFRA 2UY7A 4F27A 3AY2A 4N0UE 1BVOA 4XVUD 1TJHL 3BZFB 3IDNB 4OT1H 3KNBB 3HKFA 2EC8A 3B2DC 1E9PA 1T1XA 4A2EA 2PCPA 2ODIA 5EC1A 3PL6A 4JRYB 4DKDC 1FVCA 3M6DA 4HIJB 1QSFD 1DVFA 5J6GA 3O8XB 2FR4A 4FG4A 4WCYL 3H9SE 3NSCA 3OQ3B 3C2AH 1DQQB 5I8KH 4JANA 5C0DA 4IMKA 2YD6A 3GMMA 4ODXB 2I07A 3V6BR 4YHML 4YL9A 1D5ZA 3NK3A 1UTDA 2YXFA 1V54B 2X6BA 2IMNA 1DQDH 4URKA 2WNGA 4WDIA 4HT1H 4AT6A 4RH4A 4CMHB 2OMXB 4CUCA 5EPMB 3NCJH 2BVOA 3P4OA 5C07D 1IAOB 1ZA3B 4JZJC 2L7EA 1OW0C 1CGVA 5ECJE 4WTWA 2OMUB 5FUOH 5BV7L 1WWWX 2YZ8A 3GSNL 2NQDA 5KBDA 1FHNA 1F2XK 3C5ZB 3JYCA 3V6OE 5AVRB 1HIMH 1SUHA 3BESR 4HJGB 3FUEA 2ADGA 2BP0B 4JHUA 5F44A 3IMTA 1CI3M 5E6IC 5D96C 1SMDA 1BM3H 5B38G 3VI4B 1Q72H 4OSUH 3RVXC 4Z5RA 3BAEH 3IXTA 1K72A 1F4XL 1KJVB 4APQD 4UM8B 1JOIA 2CLVB 2DDQH 1KLGA 3ARBC 2VMDA 3UCRA 2ESVB 2VE6B 4F37K 4BM7A 4AG4H 2FH8A 2GK2A 4MFHA 3V5KB 1AGDA 4NGHH 3C6LB 2YFNA 5CJOL 4ETQB 2J5LC 4LVEA 1LGVA 3WFZA 3TJEH 3V0AC 4F37F 1CF8H 2FIKB 5FYKU 5F7YC 1EFQA 3QIBA 1FO0H 1UZGA 2W0FA 2GTQA 4UILL 1DQLH 4OZ4B 5J12B 2WOYA 1E40A 3K81A 4R90L 4X6CB 3TA3C 4D0CB 2XZCL 2A6JA 1MVUA 3RFZB 1O9VA 1U8HB 4KK6C 1O75A 2D31B 3MCKB 1NPNA 4YO0A 3D3VE 1WEJL 2GI0A 1NDMA 3DX6A 2YMXH 4Y19E 5IQMA 2AJVH 1G1YA 2EDXA 1ECYA 2G4EA 3C6SA 1I8AA 2X4RA 2M8XA 4E41B 2HH0H 2UY6B 1T6BX 4AMKH 2DWTA 3HZMB 3VG0H 1ET8A 1LP9A 5JOPD 3VXNA 1TKWA 3AWFA 4D9RD 1GMEA 4YC2B 2O5YH 4I0KA 5CUSL 5T5FL 3MOQA 5D1QA 1FFOA 4NO0B 1QBMH 1HINH 4RQQA 1DJXA 5I73B 5J9PA 2Y5QA 2WWKT 4JFXA 1R75A 3LQZA 1WSST 3EYSL 2DH2A 3ABGA 4FZ8H 3O6FA 5C0RH 2VSMB 4H0HB 2R23A 2YN3A 4HETA 5TE4L 1L5GA 4ZQKB 4TQHA 1PW3A 3C8DA 5LN8A 2ZONA 4K7PH 1KBKA 2NTFB 2WXNA 1QSED 3NG5A 4JQIH 3AS3A 3UAEA 1HWHB 1R3HB 2OL3B 3HA0A 5IUCA 2XWBA 4DETA 4EI0A 2JK5B 2EE2A 3F04A 3G5ZB 3STZA 4ZNEA 3KJ6H 5DHVH 2F74B 4LQ1A 2AK4B 2DD8H 1FFPB 4P5MA 4MRBA 1B90A 4HH9B 5DJ2B 4PJBE 4OCMC 4NQED 3ZT7A 12E8L 3PS6A 4M1DH 4K7PY 4YX2L 1DLHB 2IAMC 2V9UA 4ECNA 3TBVB 3ZDXB 5DMYA 4NN5B 3HZYB 1T5KA 1LQSR 3CFUA 2CE6A 4JFYB 1DYZA 5CLYA 4KQ3H 1F02I 2WWKO 5BQDA 2FWOB 3BW9A 4LIQE 1ZT7B 2ATAA 3VA2C 3HFML 4JFEA 2CIKB 3BVUA 3P0GB 2XWTA 4GLRI 5F6HI 2ZPKH 4NNXA 4AL8C 5GS0H 4NQXA 2CHWA 1R46A 3G04B 3QA3A 4F2MB 1BG9A 1JGLH 2EVHA 4JO4L 4YDIL 3DECA 1S7UB 4A7GA 2NOYA 2V17L 5GSRB 1A66A 4HKZA 3IMBA 2H9GA 1PG7L 3U7WL 4PJ8C 1CQKA 2X5PA 4P2OD 5D2NE 1XF4A 3BN9D 1P53A 1QLRB 4KI5C 3CLEL 3ATBA 2JMRA 3DJRA 2CKBB 3MRBB 1QASA 2IJ0C 4Y5VA 2ITDA 1CFSB 2GI7A 4D0DB 3B37A 1HFUA 1PZ5A 4TULL 4N8UA 1S7UA 5E5UB 4QRAA 4ZUVA 4Z7QE 4IDJL 1MQKL 4BFIA 5LLIC 4GG6B 4L8DA 4NPYB 4KK5C 3ZUNC 4APQA 4R96A 4ZW5A 5J1AA 5H35A 1WITA 1QEWB 4MB1A 9CGTA 2HVKA 3A0OA 3QIUC 2JB5H 3MV8A 5DRXB 4YHOL 4MAUL 5C08E 5DURB 1ZJAA 4MJ6A 4N2MA 4PJGF 1UZ8A 3TURA 1I7TB 3LKSA 3OMNB 4PBXA 3GMOB 1TZOA 3BXNB 4FI7A 1RJZA 1LEGA 1SEQL 5C0GB 4FTVA 1A7RL 4NKDB 4RAUA 1RFDL 1NLBL 4S1SL 4ZTPL 1NMCC 1KWKA 4NNYB 3AREB 3R7QA 3IDXH 1RMFH 1XGUA 4YQXH 1EZLA 2YSSB 1IGIH 3IDMA 2I9TB 5I0WA 4GSDH 4MA7H 4RFEA 4GRWB 1DR9A 1HINL 5C07A 4Q7DA 1ZLSL 1OAZH 3CFDB 4NM4L 5DRXA 5F71A 3PHSA 2VDRB 3BWZA 2RA1A 3DARA 1ZWIB 3FF8A 3M7OA 1JDDA 1MKFA 3OJVC 5E4AA 3SCMA 4AEFA 5EN2A 2DQEL 3FZUD 5FWQA 5HJ3A 4N5ED 3X1GA 1QATA 3L3DA 1MY7A 1GIGH 2X1XR 2ZSVA 1TYJA 2OJ1A 4DK5A 3IDMB 3A67H 3RA7H 2BZDA 3D0LB 1DCEA 4GSRA 4R9HA 1DBKH 2N0KA 3VD4A 2ICWB 1RZFL 1F5WA 1NCHA 2BERA 3H9SD 1AR2A 1AO7E 5I6NA 4L5FL 1ZWIA 4PGDB 5EOTA 1IIKA 3U9PL 4IW4C 1OTUD 1SJXA 3KXFA 5K59E 1MJ7H 2E7HA 4JCMA 3CPLB 3FULA 1VEPA 2D7NA 1FCGA 3CVDA 4G6MH 4C55A 1D7BA 1IAKA 1EDYA 3PCYA 3QRLA 2NX5B 4LCUA 4NFBA 4OZIF 3VWKB 5BZDA 5T3XD 5B1BB 4DSYA 5H37H 3DV6B 4YHKH 4BUQA 1V3JA 5FO8A 3TXAA 1T3FA 5DJDA 4MSWB 1JPST 2LGNA 1YUKB 3EOYG 5EWIH 5HHOB 4PVMA 4JM4H 4PRAB 4B5ZA 1NFAA 2GSIB 4LZKA 1SJEA 3ULUF 5CO1A 2F53D 3MQIA 4MD5A 4ZFOA 5ADPH 1A1MB 1JP5A 4HFUH 5DO2C 5K1VA 1VGEH 5JO5A 1NBCA 5KVGL 2YKKA 4YDKL 1QNZH 1L0PA 3WE6A 3FXIC 4BJLA 5D4QA 2AXGB 3VUAA 1XX9C 1YMME 1KYDA 2ZWNA 3AJ7A 3MAWA 2WQXA 3ARPA 4Y7OC 5GGSY 1BMWA 2DQTH 2CPUA 3QPXH 1NGPL 3P73B 3MLWL 1AO7A 1MCLA 2YGPA 4XNZC 3S36H 3LDBC 4HUMB 5CBAA 2WK2A 3GIVA 3HMWL 4JO1H 1Q9WA 3AM8C 3MOBL 1I1RA 4AL8H 1NFDA 2VQ1A 3QJZA 2P43B 3KLQA 3WE6B 5ERWB 1QWUA 3I6SA 1LMKA 2VW6A 1J10A 3CUPA 2A4CA 2VXSL 4MD0A 5I1GL 2BP8B 2CBMA 2RQEA 2BIQA 3NZHH 1ROCA 3GLAA 5JIPA 4OQTL 2YEVB 2NLJB 1ZAGA 5AB0A 4P9HH 5D1ZD 5I1GH 2IGFL 5L9DH 4M93C 4HWEH 2ATKA 4LLVA 5LCVA 1JGDA 4LSVH 3T6QC 3EDJA 3OKKA 5E2VL 1J5OH 1WA0X 2QV4A 4UQ3A 5JQIB 5E4EC 2QL1A 3F5WB 5GRJL 3QUXC 1A65A 2NY4B 4UDUA 1JUFA 3KVQA 1NEZA 4GB9A 5BZWA 1T0OA 1MWAH 2CHXA 4NN6C 1A9EA 2WIIB 4X4MA 2KBGA 4ZPVA 4Y4HB 4L3CA 2KI6A 1KCLA 1WC7A 3HE7A 3AM8A 4J3BA 1XGYL 2OFQA 5DJCA 4BWWA 4ELMA 4UB0H 3LH2L 1VPOL 2WP3O 5F9OL 1I1CA 1Z3GH 1XB6A 4ZO9A 2JJTA 5GS3A 2VUOA 4V1DA 3OR7A 2B08A 5FKPA 5BNXD 1F4HA 2AQ1A 3B2VH 1JNHB 3L08A 4CW1B 2A77L 2FSEA 3KPTA 4L37B 3EO1B 4OZIE 4I0CC 2EEBA 1MZYA 1JNLL 5BRZD 4PJAF 5DR5L 2MOVA 1BMGA 5KYWB 1HDMB 1NFDE 1NZRA 3WS3B 5EOQL 1UOKA 2VDML 2HWZH 4M7LT 2NNRA 3T77A 3ZZSA 5HYQA 4G43B 3HZ3A 3KDMA 1QO3B 1YNTA 3T09A 3WKMH 3I75B 4MZ3A 2ZZUT 1LMIA 3OR7B 1WICA 5KSVB 1V7MH 3RBSA 4XT1C 1D7CA 4JRWA 3CGTA 3FTGB 2FSEB 2IDUA 1RUAH 3S5LG 4LT7A 4PRIB 3CE1A 3RI5F 3CDGB 5K33A 1VKXB 2EYTB 4E9YA 5E08L 1H5BB 1HEZB 3E8UL 4CC1A 2ZUWA 1FLRL 1MQ8A 3BZDA 2DQFB 3H9YA 3BIKB 4WSJA 4JPSA 2KT6A 2X42A 4HIHA 1CD1A 1TJGL 2P3YA 1QRNE 4TVUA 2OBGA 3ZKND 1KTLB 4MMXB 3SPGA 3L48A 3L6FB 2L3BA 3WIIL 3MBXL 1ET7A 1K6QH 2Q6WA 4M29A 1UB5A 1TJGH 3L95A 4JQXA 4G70B 2NY4C 5DC4B 2WVSA 4NHCL 4YHZL 4NLHA 3QRGH 2OXGA 3MXWH 4YHPA 2VLRE 3BUQA 2RHEA 3ZHNA 1EVUA 2YAOA 4N1HB 4KTGA 1ADQH 2VERA 3DV4B 4WFED 2H0PA 5I8CA 1NC2D 1QRNB 2B4CH 3H7BB 3L5XH 1KTJA 4UT6H 5D71H 2KMWA 4AGLA 3GIZL 2OSLA 4PD4J 1JK8B 4F8NA 5C0NC 2ZXGA 43CAB 4XZUB 5I1JL 5D4HA 2D7OA 1H15B 2FAUA 4CBPA 3DSNA 4X6FA 1ES0B 2OQJB 2Q86B 2E7CA 3TIEA 4OI8A 5TJWK 1F97A 5EORH 3E1ZA 4AMWA 3FT2B 1U8KA 5KVDL 2B1AH 2OP4H 3QUML 3VFVB 3O0LA 3V0WH 4XPAL 1KN4H 2NPLX 15C8L 4QOKD 4XI5D 5JHAA 5EG6C 5IHUH 1FQ9C 4OJEH 3H0TA 2NR6D 5I1IH 4P3CL 3HI6H 3K2UL 1JNJA 1IKNA 2J5WA 1SLUA 1F11A 3FFDA 4XPTL 2YD0A 5TE6H 3LY6A 5CHNA 4NS0A 5DQJB 4ZX3A 5IHUL 1RK0B 2XQYK 1AANA 1WS7A 2C1PA 2F54A 2XPZA 1A9BA 2G2RA 2WV3A 3GK8L 3GSOA 2A0LC 4OFVA 4TNGA 1P5VB 1H3PL 1UWEH 1KT2B 1DE4B 3KPSE 3R18A 1DJSA 2ZUTA 2EUXA 1T5XA 1OK0A 1YY9D 3MRGB 3VXRE 4OI7A 1FNEA 3WTTA 1BSIA 3IGFA 2AJZA 4KXCA 5M7QA 4Y7MA 2E4TA 1T7ZA 4F5CA 1BM7A 3RVTC 1A9VA 5EU7C 2UUDK 2A77H 5AVQB 3ARZA 3G6AA 2CO7B 3F7VB 1RJCA 1M57B 5FUCE 2CDFA 4OLWL 2X0WA 4H40A 4RMSA 5K9KA 3CXHK 2X4OB 3DDFA 2OI9B 1AIFA 5H94B 1Q9OA 4OCXH 3C5SB 5EB9A 4ZMZA 3BHBA 5DRWB 1N2RA 1DJHA 3EJRA 4LASL 4K3JH 1NLDL 3CQQA 3EJPA 4I0PD 3ULSB 1XIWB 4R26H 1RPQA 3ARFA 5F6IC 2NQ3A 4PRPE 1ORSB 1IGCL 3G6AB 1IT9H 4Y8AA 3KG5A 4FJYA 1TCRB 4O58L 1DVTA 3HRZB 1MNUL 1FRGH 2VXQL 3RGVD 1O5PA 5D6DC 2EZ0C 5KYNA 5AUMA 1GJWA 1N2RB 1G7IA 4EPSA 2WXJA 3LEYL 4P46A 3MTXA 1BFTA 4RBPK 1Z32X 5GZND 3IF1A 1RZKC 3MBXH 4UBDD 5DT1L 4HLZH 5FDWB 3B5TA 4OCRH 4XMXA 1XL4A 3PQYE 1TCRA 3FTXA 5SWSA 3ECUA 3RQ3A 4EDXB 2ICWI 3FAWA 1IGMH 3ISRA 4I3RL 4IKIA 3GTVA 3NQKA 4JVPA 5GHWL 5JNYA 1BEYH 4X5RA 3UTTE 2L7JA 4Y2OA 4KOBA 3GSRA 3HS0A 4BELD 2WXOA 1NAMH 2VXQA 3F3HA 4QXGL 4TYUA 3TN0D 3GSQA 4NKOA 4FFVD 2BVPB 4KX8A 3RGHA 1I8IB 3EFDH 1IBYA 1WO2A 2EIZB 3QG6B 3UPRB 3A22A 2XRAL 1O6VA 3HUJA 2PXYB 3TA4D 4LVOC 4B5EA 1IEBA 5D1QC 5J4MA 4IIZA 1A7OL 3IU4H 1HH6A 1SHSA 4Z7AA 4OLZH 5EZJA 1BW8A 3QUXA 2ZNWA 4G6KH 1YMMD 2WWMD 3GSVA 3K91A 1Q0XH 5GZOC 4TNVF 4FEMA 3HI5H 2OCCB 4WK4B 4KHTL 4NZTH 1WIOA 1KENH 2Z0BA 1R3JA 3M46A 4K3EL 4U1LB 3UTSA 4NPJA 3WSQH 3SGDI 3RFZA 5IBUG 5DLMH 3WTSA 3EKCA 3QSKB 1DZ0A 4CU8A 3VQMA 1RP8A 2KDYA 3E80A 4F7MA 1F13A 4J2QA 4KUCD 5I30L 4OCWH 4YPGB 5TE7L 1ETZB 4J1UA 3T65A 3CVIH 3VMPA 2YJLA 4FJ6A 4NWUH 5LXVA 4L4TE 1S5IH 5E24E 1BD2E 1WUNT 2YUZA 5F96L 3F6IA 3O6KH 2PYFB 4GUPB 5HHXL 2PP9A 1QABA 2XKSA 4K9EH 1HHJA 4U1JB 2HWZL 3ZE2B 2WJ5A 2O5YL 3BRFA 4IBYA 3BDBA 3TWYA 1WQVT 1U93B 3IJ9A 1DFBH 3WIFA 4D94A 5EIIA 5E0FA 2WYTA 1AQDB 4DVBB 2C9PA 1OD7A 2YGQA 4PLOB 4XNQA 5L6YH 4MVBD 4R4BB 2FEEL 1ETZA 2ZCZA 4J1UB 3X1NA 4XHJC 2ESVE 1G9MC 3BH9A 2D3NA 3HNSL 4K71C 1EHKB 4MNQD 1OCRB 1G7PA 3RWFB 4MS8D 3O6ML 4PJEE 3AU0A 4JZJB 3RPBA 1J1XL 4DT2A 5G5DB 1JBJA 3T0VA 2B0SL 3IN0A 2RALA 1XAUA 3QCVL 4IMLB 4CNIA 4QJ4B 4J3OH 2H6OA 3BAJA 4PJBB 6FABH 3B6SB 3T0AA 3WKNA 4JZNA 2FE0A 3PYCA 2MCMA 3CHXA 2A74B 1LP9B 2B7DT 3S88H 1T7XA 2BNQB 4JL1A 4Y2DD 1AR1C 2HUHA 1HSAA 1NWPA 3FT9A 2JI3A 3HMWH 1WFJA 2WQUA 5I5IA 2CO3A 3PJLA 4RQQB 2BOBB 2DS4A 5HHMD 4OGAD 3B2UC 3VQLA 3EO9H 4ONFL 2XSKA 1YZZA 4NERA 4S0SD 4XCYA 4QRQB 2ZG1A 2X0UA 3KPMB 1Z66A 4YXHL 5IUSA 4M6ML 4Z7IA 1LK2A 2ZT9C 4PJ7B 2PO6C 4AC4A 1DSFH 3LIZL 4WJ5B 2ZPKL 3SPVA 3MSPA 2AQPA 4PS8A 1GA2A 4TSBH 3RY5A 3PWLA 5F3HB 1F3JB 1FJ1B 1SDYA 3RG1C 1MAMH 3BEVB 1UFGA 4L8CB 4BV1A 2H9GB 4LSQH 4NENA 2V2TB 1OZTG 5KUMA 3BP7B 4NHUB 4BDVA 2FDBP 4OF3A 4KO6A 4Y4FC 4K5NA 1ECZA 4NEHB 5CJQH 2Y7QB 5E1GA 5ABAA 2AVGA 2EDQA 4CKVX 2CKBA 3POHA 3TONA 4R83A 1MCDA 5HHQA 4PJIF 1NGZA 3SN6N 4B3VA 5B3JF 4PB0L 4CSZA 4QO1B 2VLRD 2XG4A 1MIEL 4FI6A 1AH1A 1H3PH 1XCWA 4JHZA 4Z3GA 4FI8A 4LCWD 4XOBA 4HXBH 4W1TA 1PVHA 4ONOA 3OX8A 3PWPE 1NC4D 3HG3A 1QEWA 2HXAA 1IBDA 1XGQA 4WTZG 5T5NF 3HNTL 3DUHA 1A0QH 3MNVA 4MCMA 1Q9KB 4PRDB 3OAYH 1D7DA 1HK6A 3LRGA 4PREB 3RWDB 3KM2A 4OTXH 4MYWB 4H44C 4OT1L 1B9KA 4KJYB 1BJ8A 2Z34A 4TQPA 2PPEA 3OSVA 2ZKHL 4ZTOH 3AGWA 4WHYG 3MFFB 3OXRB 4QO1A 3W0WB 4FHKA 4MAYD 5BW7C 2FJFB 2YPKB 1AXSA 4EOWL 2JTYA 4OU3A 3TFKD 5I9QC 1YSOA 5LGKA 3VMNA 1XF4B 5HGBB 2ZP0T 3KYKL 3NIGB 3X11B 3OKNA 5AQ0A 4Y5VB 1HQRA 3SPCA 1SYSA 3JWNH 4LASH 3T2NH 2RCSH 2WBKA 2DYPA 3VFNA 3DX9A 5L7XH 2X3CA 3MV7B 3WXVH 3GS7A 4I77L 1TNNA 4WGKA 4F8LA 4ZUUB 1NCNA 3X1BA 1PZBA 1O7DC 1J0KA 2BVQB 1QZ1A 1U42A 2YXWA 1SXAA 5I76A 1LO2H 3SDYH 5HI3C 4JANB 2CIIA 2O1AA 3QXUA 3EOBA 2CD0A 3QZWB 4Z3JA 4EBQH 1I9JL 2B2XL 4Y5XC 3AXLA 4DEPB 4ELDA 2Q8AH 3CMOL 4KMTH 4R7XA 3WD5L 2WB1A 4F8OA 3REWA 4NP4L 3PWPA 1ZV9A 4C4KO 5EU4B 2M2DA 4QT5B 5IQ9A 3DJSA 4OCSL 1U3ZA 2X4SB 4XNUL 4R0LC 1F3RB 1GJUA 3CC5A 5T3XL 4LCCA 2GC7C 4BK5A 1G7JB 3S3PA 4HOMA 3APFA 5E5MB 1K9TA 2A2QT 1QW9A 2BSEA 3ARED 4TNWK 5CZXD 5E2JA 1HSBB 1DO6A 2R4SL 3IDGB 1O9WA 4NRYB 3WOVA 4DKFL 2IVFC 3K6FA 4G5ZL 1JPFB 3TBTB 2DMCA 4N90D 4B9IA 2JELL 5ISZE 2AXGA 2LVCA 3RPKA 3A6CL 3KPRA 3QEQB 4HBCL 1INQA 4Q52A 5EBGA 1JZ8A 2ESVA 4TUJA 4Z95L 3ILQC 1XBRA 1U92A 3PV6B 4YFLI 4U1IA 1KZQA 3ARDC 2LV4A 1J48A 1EXUB 2EIMB 3NN8A 1CDUA 3CFIC 2K6WA 5B39G 2ERJB 4TS6A 3FOLB 4W9ZA 3S35X 1UEMA 1Z9PA 1M2VA 2OZNA 2F1AA 4PAZA 1P7KA 5CR8A 3OJ2C 1RZQA 4AQZA 1I9RH 1B3JA 1SN2A 2X7LA 4MD0B 2BSCA 2Z31B 3UTTD 4PMEA 4GG6F 5DDHB 2NYYD 1TTBA 1QRKA 3R0NA 3FT1A 1U8HA 2J8UB 3LZPA 1A6VL 3CDYA 5FYJD 1NDMB 2JTDA 3VW3L 2WBJA 3NIGF 4YHYB 3EGSB 4OLYL 3O81A 2L8AA 3TYFB 1OEZW 4JGJA 2QT6A 1QVOB 2X4QA 2ZKHH 5ANME 1EEUA 3WJLA 3V7AE 1C08B 3PPEA 4XPFL 5EFIA 3QWOB 5DZJA 5D5MA 3VW3H 3VDBA 4LLDB 2VABB 4ZS7H 2ZP9A 4HSAC 4KJQD 2W65B 1UQSA 5ALBH 3GTNA 1CLZH 3IGUA 5ESVA 3HW7A 4KI1A 5D1QE 3U9UB 2UZIL 4M9PA 2PPDA 3QULA 2P24A 1JZIA 3MLZH 1A14L 1G7LA 1V8HA 4R7LA 4PUBH 3DMMC 4GAAA 4A7SA 2FWUA 1L7IH 4PJ9C 4H26B 4AIZB 3D2UD 5E23A 5I6OA 2APBA 5D5MB 1MY5A 3DNKA 2HTLC 5LBGA 5DUMH 3SDDD 5A16A 1BGXL 3II1A 1RUQH 1UQSB 3TVMC 1NJ9A 4LPTA 1WP6A 4XN9A 5DUPL 3B2VL 3H3BC 4GBXA 4PJ6A 4N6QA 3WIHA 4EIGB 2OYMA 1BFOA 2GY7B 3NCMA 1VZIA 1FIGL 4XXCA 3B7YA 1FVEB 2C1OB 3MNZB 5L8JB 1EMTH 2ERJC 1GC1C 1WPCA 4IU2A 3RNKB 3T3MF 4DN4H 1ZVYA 1LO5A 3FTUA 3BVNB 2VJ0A 4R8WL 2QQNL 1IUZA 1X5IA 1XR8B 4LRNL 4LGPB 5IVZA 3V4PA 5IBLD 5KVFL 4KRPB 3IAQA 3FHEA 4Y1AD 5M94B 2KZ1B 1M71A 3QJTB 1A7OH 5JPMA 3TYGL 5T3XH 1FC2D 2DKUA 5CD3B 4XNZB 1RZ7L 4CU6A 1I8MB 3HI1B 1FYTB 3AROA 1RJLA 1LQBC 2W9EH 4V1DB 1T0MA 4U0QB 3JWNE 1E3ZA 2WTOA 1NKOA 4KU1A 4BKLA 4NQCA 3SDAA 2IWKA 3D5OF 1Q1JL 3TV3H 1P1VA 3O6LL 1MHPL 5C86A 3VACA 4Y19D 5DEJA 3U2IA 2UZYB 5I19L 4R2GC 5DLML 2YD7A 3Q43A 5C0IA 3L3OB 3MJ8B 1TSRA 1G9ML 1NM4A 5C0EA 4I5BA 1PNCA 2JF1A 3G9AB 4NRXB 1BVKB 2IH9A 2WXPA 2AJXL 4XWOD 1I1AA 5F7DB 1DQTA 1KCWA 2Z8VC 4U49A 2XPYA 4Z3EA 1Z2KA 2MKWA 2AAVA 3DGGA 1YQVH 3FUDA 5C9JA 5HYSG 4P23D 1VFAB 3SYCA 3FAXA 4X7FC 3VD0A 4G72B 1OB1A 4WW1A 1RIVL 1RK1A 3MJ8A 4N6RB 1XCTB 5LBSL 4UV4H 3FFCE 2KC0A 3SGJC 1P4BL 4G8GB 4KTEL 2ITCB 1BP3B 4HGKC 1JD7A 1N9PA 1H5BC 2YR3A 1CFTB 3A6BH 3GHBH 4QF1A 3VXSA 4DIXA 2PN5A 3VNYA 1SOQA 3FOMA 4BH8A 4K55A 1RZ8A 2PYEB 3QFJD 5I74C 5AFAA 2YD9A 1BBJA 1TQBB 4X8JB 1KIUA 1XCQA 4WUUB 4B0MM 1E65A 4OJFH 2DM3A 3C09B 1K8DA 5HHNB 4LOVA 3IE4A 3QQ3B 4HKXB 4IRSB 4U1GB 1L4IA 2F54B 4JM2A 4M5TA 3MCYA 1P5UC 3H53A 4PJAE 4NQTA 3OF6A 4BBWA 3E3QE 3HZVB 3H7LA 4FN0A 4YBHA 1AS6A 3FTWA 4N3UA 3V0DA 3SCMB 4HZLB 4GI8A 1YMHA 2N1KA 3BZ5A 5DMGD 1G9NH 3ARBD 4BZYA 4X6FB 1QA9B 3U30B 2X53A 1KSRA 4FXGC 3L4UA 1JD9A 1OLLA 2HJKB 2JQAA 1U8KB 3GBMH 2AKRB 1X7TA 2BCKA 3GBEA 3QDGD 4OGXH 4XX1G 5JOEA 5TK4A 1C5CL 1Z6JT 4DQOL 2OV0A 4W6XB 1BBDH 5E5RB 5H4YA 3S34H 3T0WA 5J56B 2OMTB 3EH2A 4HFUL 4IS6B 1PDKB 1KCVL 3PU7A 4JK0D 1DJGA 3GDBA 1S7VB 2QKIC 3QPQC 1RK0A 1P7QD 5AYUH 3TF4A 4TMPA 3QZNA 3Q7JA 3IKKA 3CLFH 2P49B 4APQC 4G1EA 4PJHE 4JLRB 2ZCHL 1KB5L 3DPDA 4GW4B 3PHOA 4J8RB 1H6TA 2HVBA 2JSFA 3G6JA 4N2CA 5KSAA 1SGKA 2ICEA 1JZ2A 4MJHA 3HC0B 1SUJA 1WFIA 3VXUD 1KYAA 3W39A 3D08A 4IKNA 4KJWD 1A1MA 4QWWD 5EN3A 4WWID 3RVWD 4QRRA 5ILTL 3K7UA 3DHJA 4X8CA 3ABMB 1TFHA 2V7NA 4BGDA 2YS4A 5DK2A 2L0DA 3OHXB 2OTUA 3OKOA 3QHTC 4F7CB 4GFXA 1XD0A 1PD6A 4B0MB 4WO0A 4ZMWA 4Y2OB 4HQQL 1T6VN 3CFTA 3WIIH 1SBBA 3MV9D 3WN5B 2WXFA 3UEZA 1XGRB 2O26U 1NM9A 3ZSTA 5DUJA 2CR0A 1NOLA 2Z35A 1ZCRA 4H25B 3FFOA 3REVA 1EA9C 4A2MA 2JQMA 3ZYZA 4UV7L 1S7TB 3B1TA 4O2FB 1MF2H 4LDCA 3QAZB 4LP4A 1AKJA 1E4WL 5GRUL 5K1JA 5MEQA 3WTUA 4JFFE 1JPGB 2XYBA 5A7BA 2DKSA 3H9HA 3IU4L 2HCZX 4DK3A 1QACA 3KL5A 3OD3A 1VERA 4QRUB 5AUMB 3L5XL 4UT6L 1FL6A 3UZVA 4GKSB 3RAJH 1CGSL 1IAMA 1NAMB 4HZAA 4JY6B 3N44F 5JDSB 3IWVA 1T0PB 4L29B 3WENA 5LNDA 4L2YA 2A9AA 3AMKA 1SVBA 2R2EA 3S48A 4O2FA 3W0WD 4R84A 2AW2A 4BFGA 1PZ2A 5SX4H 3BPCB 5CEYA 5I6KA 3HBGA 3WTXA 3TBSA 1HCYA 4IHOA 4L3EA 3UYPB 1KPUB 1DVXA 5TDPA 3TVMA 1W8EA 1YAZA 3NP3A 4FYRA 4TUKH 4BSVB 1U8LA 1KJMB 3O3AA 4ZPVB 3ZHKA 3C08H 3FRPG 2WXIA 3VH8A 4OCNC 3VTMA 1SVZA 3ARWA 1RLWA 5FYJE 2JKRM 1NUGA 4CA4A 3D51A 4L4VA 2VMFA 1F8TL 3BO8B 4N0RA 2XQBH 3VI4A 4YN3A 4F3FA 4DVBA 4M43H 4GEIA 4DO4A 3EYUH 4I2XE 4KH9A 1UVQA 1PZ3A 4JR9L 4NC2B 4W4NA 5IB1A 2OK0H 2FJGA 4M61B 4AW4A 3SE4C 3CBKB 3WXWL 3HZKB 1OP5H 3FBQA 1S7RB 4WWKB 5E9DE 4OIIL 3C6LA 1T22A 2Y6SC 1J8HD 3RWIB 2AFNA 4Y4KD 3DX4A 1RZGA 2UZXA 5DS1A 4U6YA 4F7MB 4UIMA 1GVIA 2UVFA 2VL4A 1RU9H 1S6NA 4B50A 4ZMQA 4TV3A 1BZOA 2N3JA 2CKNA 1C5DB 2HTKC 4OUOA 3MO1A 1MHPH 3S96A 1ONQA 5K9OA 3ZE1E 3RWIA 5GJTL 2DMHA 5A43C 4TL5A 4ZMAT 3FUJA 3BCFA 4HV8A 4LEEA 3L2LA 1UD5A 3ZR6A 5JMOC 1I8KB 5E8PB 3EO0A 4FS0A 4LGSB 4XO5A 5F72S 5KWYC 4JO1L 1DANT 1WGVA 1MFDH 5ETUB 4QXWA 3WNIA 3LZNA 4NSKA 3LX9A 1YYCA 2OZ4A 3IJ7A 2BVYA 3BEWA 2OXGB 4OKVB 5TTRA 4L4TD 4JKNA 4PV1C 3QB7C 3BT2H 2Y22A 4AE0A 4DZ8A 4LRIA 2GJZA 4GAJH 1YN6B 3WFCL 1J5IA 1H9DA 3WFDL 5IWLA 4NENB 1NFDF 3LRHA 3ZW3A 2DKMA 3NSJA 4P46C 3IRZA 4NHUA 5EZPA 2XTLA 3NJFA 3VB9A 3FU3A 5AW8B 5I15H 5EZOL 2ENPA 2H4EA 4LPXA 1HU8A 2I27N 3TO4B 4B9KC 4XAWL 1HKFA 1T83C 2H7WA 3FQTB 5DZPA 1WBXA 4ICWA 1K8IB 1DJZA 1OW0A 3MLSH 2EICA 3ASOB 5DYOB 1XGPB 4XVTL 5AW0B 5I66B 2IDFA 4GI9A 35C8L 3KPMA 3KWTA 2Y5TA 3KPRE 1L9MA 1LK2B 1D5RA 3WKPA 2E6JA 3PHQA 5F1SA 1SXBA 5CN2A 5AVUB 2AABH 3RVWC 1SN0A 1ZANH 4WJ5A 3PGFL 4L4TA 3X14B 1DHKA 3L5WB 1MUJB 4M7ZC 4PCTA 1A0QL 1R5VB 5FYLE 2FJUB 3QUXD 3II3A 2HKHH 4YXLH 2HT4C 2Y6TE 3WSQL 3CVHA 4DJMA 2BNUA 5D55A 4HAGA 4KDVA 4RZCA 3AQZA 1E90A 2Y07L 3ULVC 4MX7B 4Z7NB 5C0BB 3LS4L 2OYPA 3ZZ1A 2BP3A 3SJVD 4DN4L 2F1BA 4MNHB 4DTGH 4ZFZB 3ZDXE 2QVIA 4PY7A 7PCYA 1MUJA 4PRNB 1IGFL 1OE1A 1TYRA 4Z3TA 3ZKMD 4ZMNA 5I6XC 3GJEA 4DKEH 3LD8C 3K74B 1CLYL 3IJHA 1DBAH 4B9PA 1CWVA 1Y18B 4QEGA 3E38A 3AS1A 4YQXL 1MCKA 2CA4A 3HNVL 1MH5B 1BLIA 4YHNA 3O2WL 3ABKB 3P9WB 1E8WA 3BAYA 1QLEL 1RUAL 1JZEA 1PTZA 4ZJ9A 1MFBL 3FONA 1KWGA 4F2ME 4QXUL 3U2SB 3QZWG 4MDIA 1AG6A 2M1KA 6CGTA 4HK3N 4KJYA 1PZ5B 4HC1L 5GS2D 1XH1A 3EJYC 2FT7A 1P6AB 5A2JH 4LPUA 3CIQA 2GKIA 4BFOA 2IGLA 2WWOA 3IJYB 4HWBA 1ZHKB 3EDKA 3LKPA 2C9SA 5ACZA 1BEYL 2KH2B 4QOKB 5CCJA 3GXFA 4ZO8A 2P4AB 4U3SB 2FRGP 4JPIB 4TNEA 2EIBA 2GIYA 4TSCL 4W9LC 1T0NA 4K0OA 3ISWA 3N6YA 1E5YA 1TENA 2QELA 4FQHA 4AENA 3K72A 1H3XA 1KMGA 2NRDA 3MV7A 1IC0A 1BIHA 1JDCA 2HG0A 1FPTL 4G6KL 2PR4H 4NNYA 1IAOA 2NY2C 4F57L 1G9EA 2J44A 4X9FA 1FL5B 5DD1H 4LP5A 2AJVL 4F33A 1OY3B 3DRTB 1KYOJ 2ID5A 2X05A 1FPTH 3T9WA 3VI4F 2VJ8A 5L88H 2BOCA 4JFTA 4PG9A 3T08A 2CALA 2P5WB 2Z4QA 3VXUE 3QIUA 3WEMA 5JW5B 4Z7OB 4QHKJ 3Q9QA 1X5MA 1NMBL 2OW6A 4HKBA 4H7VA 3QUMH 3N9GH 1UD3A 1H8OA 4YDJA 1AVAA 2BH0A 3IMUA 1L6ZA 4GG8B 5JPNB 3QQDA 4Y5XB 4JDVA 2FHBA 2IG2L 3FO0H 4OF0A 4GIPD 1IAII 2YN5A 3P9LB 5DHEA 3TBYB 4AVHA 2IANB 1U91B 5CP3A 4WV1A 3LQAH 1HVXA 1TXKA 2ARJA 4N9GA 5C0CD 4PRHB 2NY7H 1A7NL 4U6HB 3KJ6L 4EZMA 3UJTH 1IKFL 3F12B 3QQDB 5C71A 3GSWA 1A3RH 3DETC 4JUSA 1E6OH 5DJDB 3DVNA 1X5XA 2MQ3A 1BQ5A 1QMUA 4JCLA 2D8KA 2VQUA 2Q3AA 2OPCA 4Y5YA 4U1IB 2NY0C 2WD0A 1TTAA 5SWSD 4AQ1B 3KPOB 1WAEA 4HJJH 1AZVA 3P2DA 3UDWA 5TE4H 1RVFH 2C9AA 5CLXA 4HWEL 5C0AD 5ADOL 5AB2A 5JORB 4PRHA 3DX6B 3MRCB 1RD6A 3QUKA 1F56A 4PGEA 4P46D 2J56A 3F12A 2UUDH 1HNYA 3CLFL 5IV2B 2V8MA 1JI1A 3RVUC 4HSCX 1MCOH 5IK3A 3JTSA 5D7HA 4KXBA 4HU2A 5FA4A 2YRLA 5IQNA 3OJDA 2Z31A 2ENSA 1NCUA 2XQ0A 3LPGA 3KLHC 1XMEB 2GHZA 3JTTA 1NUDA 3KPOA 4J2XA 1AY1H 3Q8EA 4NO0A 5ITBL 5JXEA 4Y4FD 3EDDA 3GMRA 3QXDB 5G5DA 4XNAA 2XDHA 2GK0A 3B3IA 1REIA 3MLRH 5B39A 1CIDA 2V5MA 1URLA 3R8QA 4KOCA 5BVJB 2V2XB 5ITBH 5KN5B 1YEHH 3DO7A 3BSHA 1OP9A 3BPNB 4OGYH 5AAMC 3T6VA 4CVWA 2K3HA 1IO4C 1T7VA 5DD0H 1KELH 3JVFC 2K78A 2XLLA 3B56A 2AJ3B 4O4YH 3K71B 2Q20A 1FFRA 3K6IA 2Y1VA 1BREA 2NLJA 4B96A 4FTVE 4DN3H 1EJ8A 1CICB 1KYUA 4ENEC 3BGMA 5BS0A 2UXGA 1YDPB 4JHAH 1JGDB 3G6DH 4MJIA 4ZW8A 4A66A 4YFEA 2R1WA 2GPZA 1PSKH 1SXNA 3BP6B 1T0MB 3BUDA 1AFVL 1BQHG 2E59A 4FD0A 4MAUH 4N2DA 3F83A 5C0JB 5B3SB 5IOKA 3ULUL 2W59A 1HQ4B 4PLKC 4ZNCD 1JHTA 1YY9C 4KRPC 3UTSE 1A5FL 4BCXA 1CICA 4Y4HA 1NEUA 2BXZA 4RESB 3SKOB 4CGUB 3GNMH 4E5XA 3MLTA 3SDDB 4Z3HA 2CKBL 4XP6L 4UOQA 1A25A 3L3IA 1UATA 1ZY9A 3JUYA 1EFXD 3BP6A 1LO5B 1VJSA 1CTOA 5CINL 3MBEB 3VGEA 2EXSA 5CKGA 3GQFA 4BIKA 4CGTA 1V05A 3CLWA 1R47A 1RURL 4EXPX 1PLBA 3SKOA 2VLRB 4AUYA 1J1OH 3WY4A 4N6RA 4M8VA 1A7PL 4YLQT 3KDMB 2ZXWB 3W11C 4E5XB 1RJYA 2VITB 4ZW6A 1W72A 3DX8A 2YXVA 1TEFA 5FYJH 1NCBL 3M1OA 1QUNA 4FNPA 5INCA 3GEFA 1RZIA 3JVGC 1NLBH 1NTDA 3RURA 1S7QA 2Z9TA 4AGOA 1IZKA 2J73A 1IKFH 3PDOB 4KRPD 2PYEA 4A63A 2DI9A 4GSUA 1HC1A 3WXWH 5E2TH 1DVFC 2UZYA 1CD8A 4NQCD 3SDAD 4M03A 1YNKH 2H3KA 3FCTA 4MAYB 4WFHE 4HKXA 5FYKD 3L3OA 4Y1AE 4K8RC 3IRCA 1ANUA 1DUZB 3IFOA 4HIHB 3OR6B 2HFGL 4H8HA 1BHGA 3QORC 4GOSA 5KYXA 3BI9X 5C9KA 2AXWA 3QO1A 1DBMH 2AEQH 4PJHF 4ALAC 4LQFL 2YAMA 4KXZH 5B3NA 2AS5M 4IRZA 3ZPDA 4WZ9A 2B0SH 4I18B 4RFNC 2YKLL 1AHKA 3MJ6A 4BGLA 5HPOA 1OB1B 4WW1B 2YSSA 1WHPA 5D2NA 3WGUB 3L16A 3ASNB 4JFHD 5C07B 1KB9J 5AZUA 3ULVD 1DVSA 4OAWB 5CU9A 2QTEA 1CFTA 4UT6A 3IS1X 3SKNA 3SJVE 1P84J 1KB5B 3D18B 3NCWA 4KKCC 1WFMA 3VXRB 5LAXA 2X1PA 1ID5I 3U7YL 2HT2D 2P80D 2X6MA 4RFOH 1H8SA 4XCEB 3U2JA 2UX7A 4YR6A 3QWNA 1M05B 1MFAL 3PWPB 4DFHA 5BUPA 1WAPA 1A6AB 1SDDA 4PHXA 1QW8A 2J25A 5DZOA 4WTXA 3VO0A 1F90H 1E3XA 3IETB 4IBUA 1QNZL 5KSAB 2JKIS 2LFGA 3NZHL 4JKPH 1N4XL 3GEWB 2C7UA 3KLAA 1OWRM 3HE7D 2VRAA 3R4DA 3LDBB 1TVBB 2CK0H 2LOEA 3HG4A 3QIWB 4PRBA 2CGRH 3ARSA 1WHOA 5IESL 1WFUA 2HN7A 4EN3A 4Z7WF 1RZ7H 3SCMD 5BQ7B 1WZKA 5DD6B 4PW4A 1BZDA 2AEOA 2E56A 2XVLA 3L3HA 4YSPA 4OFQA 1IEAB 3M17A 3S5LA 1PDKA 1UM4H 5D1XC 3QBTB 2O5XH 2C5DC 2V9TA 1L9OA 4J3VA 1OHZA 4N2GA 5CEZH 2PP8A 3HC2A 3W5NA 1JVLA 5E6ZA 3BSZH 3ZRCC 1RY7B 4QTIH 5CNHA 3UCQA 2PTVA 5K9KB 3P73A 3GMQA 2X6CA 3Q3GA 3UBXA 1YEIL 4N1CA 1NFIA 2XJLA 4WI0A 2OMWA 4NXKA 3V4VH 1IGFH 43C9A 4F9PC 3GRGA 3AITA 1DN0B 1JDAA 1NIBA 3MRPA 2A9NH 5CZVL 3II2A 4FA8A 3O0RH 1RHHA 1G7MA 2FB4L 1EEZA 1BYNA 4PSRA 3TBSB 4WCYH 4AKOA 3GHEH 1KTRL 1XV8A 4NZTL 2ZXCA 2AF2A 1J88A 5HHVH 4Z78B 2VMEA 1U4EA 1S78C 1ZT1B 3BYYA 1X5HA 1DSYA 5BVPH 5IP4A 4P2OA 4N87A 2WUCL 2K45A 1NBVH 1N6VA 2P48B 2JV6A 1AQKL 3MUJA 2J8UF 1W6LA 3WU1A 3P77A 1CLOH 3GSNH 1JWMA 1WT5A 1ZV2A 4OZIB 3DUUA 3NIFF 4AKPA 3RP1A 3MLPA 3KR3H 3V6FB 2OMZA 4WUKH 3WMPA 1BJ1J 1YJDC 1J86A 1PX8A 2R2EB 1IEBB 5FV2A 4IRZH 1XEDA 4JHBA 1NCWL 3ZE0B 5AAPA 4FYQA 5D7JB 3IVKA 4FERA 3BAEL 4XN8A 2OSWA 2J5LB 4X0NA 3BKJH 3JWNC 4TSAL 1THAA 1M4KA 5KEZA 4RSYA 4G6AD 1AAJA 4CW1A 1IILE 2C3GA 1I7RA 2W9LA 4HCIA 3CD4A 1PG7W 3SDXA 3SB3A 4ODWA 5KBLA 4PJBF 3OKEA 5EIVA 4AMXA 5F1KC 4XO4A 3WS3A 4BFKA 3G6JF 3QIBC 4PI2A 3RL2B 1V55B 3A6CH 3JUZA 2ROYA 3VMOA 5IWLC 3BIBX 2YEZB 5MEOA 3FQWA 2ZX8A 3SE8L 3NIDB 2UXVA 5AYUL 1FYTA 4XC1H 3FN0H 2GTWB 2ORBH 4IK6A 2JFCA 1OF0A 3I6GB 3KL3A 4KJPC 3BQVA 4BKLB 4R2GD 5EO0A 1VCBC 1QQDB 3WN5C 4XPAH 4ZFGH 2DWXA 4UWQB 4B7IA 4GP8B 3FN0L 4XXWA 5LUMA 1AI1L 1QKZH 3D87B 3GS4A 3QXTA 4XMWA 4D9LL 4N8VA 3BRDA 3EO9L 3CSYA 2AK1L 3PL6C 4RNRB 2F7OA 2B3IA 5FO7B 5I1JH 1J8HB 3BD5A 5EIIB 2AEPL 4X6EB 1K4DB 3ME0B 4YZWA 4BINA 4YEFA 5D1QD 3WFBH 4XN2A 1GYWA 2F19L 2H0JA 3F62A 3LN5A 4NZUH 2WQWA 4JW3A 5B8CB 4DVRH 1CL7L 3M8OH 3IDIB 5D7IB 2GTZB 4KKLC 4C83B 4Z8FH 4PLJD 2JIXA 3BPLB 3WTVA 1QUPA 2B1AL 3HAEB 3U36B 4JN1L 1IJ9A 4OBSA 3UABA 4GKNA 2BS8A 1EGJH 4A2DA 2P28B 2NCEA 4HA1A 3D50A 2B15A 3BUIA 2VN6A 5JUEL 1MIMH 4JRYE 3EYFB 4PH8A 1A1OA 2NYZA 1IGYB 2OS7A 4OFPA 4OW6A 1MCPH 3PNWA 1LDPL 4XZUA 4DNLA 3KPQB 4YWGL 3LPOA 3P54A 1ZHNB 2YKLH 5B4MC 2OKMA 3I02B 4CVXB 1YEEL 3BN9C 3QAQA 4WW2C 5AD0A 2FBJH 5E4OA 4L4VD 4AITA 1FYTE 1KYOK 3GC3A 3NZSA 5L8KB 4ONFH 1AD9B 2F58H 2CR6A 4GXFA 3ROOB 4MX7A 3VQ1C 4KZEH 1ZK5A 3MTRA 4XP9H 5BOJA 3MLUH 1QFUL 3DX2A 4OTXL 1SRDA 1F11B 4LBAA 2FK9A 4L1LA 5DS8B 1R3IL 3WFEH 3VI3E 4A68A 5FM5M 4O2EA 2PWHA 2W0PA 4D9QD 2GAZB 5GS0C 2X9YA 1NDGA 4R7DB 3NRQA 1JNLH 2R2BB 2VLJE 5FYKE 3VI4E 2AMGA 2VXTH 3C5XA 1S7SA 4OV6F 1W16A 5DVLA 5H2BA 4F7PB 5IVXB 1YEGH 1A3QA 2MNWA 4D9RE 5D7KE 4QYOB 3G6JE 4UTAA 2X44D 4L8BA 4YAQA 5I1CH 1U8IB 1CK0L 5F89A 1ZLUK 3MJ9A 3CZNA 2FGZA 3L5WA 4M1GL 4NAQA 4DPBX 3WXVL 4HFWA 3MRLB 1F1GA 3NJNA 1NGZB 3GSUB 1N6QH 3CN1A 2BO0A 4G8GE 4EQ3A 4EO5A 2OMVA 2R2BA 2BNUB 2IBZY 1GTFA 1OCWL 3C60B 2NTFA 1QFWI 3OLEA 5DRWA 5F9WC 4OD2B 1Q0YL 4IJ3C 2P5EA 4WFHD 4ODTL 3ARDD 1E5AA 1D5MA 2OJZL 3WHXB 2BSSB 2LLLA 4JPKL 4Q9CA 3O6FD 3T4YB 2P8LA 1ORSA 3BZFA 3ZTNH 4BWUA 2NY3B 3GUTA 1N64H 1B2YA 1TFPA 1I8UA 3NH7L 4JG0L 5GGTH 3B8YA 5DK2B 1H6UA 4PJAB 3RNQB 1UM5L 3MV01 5G4OA 2XV0A 1I1YA 1F1AA 1D5IL 4HG4J 2ZOKA 4UQCA 1EZSA 1MREH 5FCUH 1CFVL 5JTWA 1BZ9A 3PXHA 3L4YA 2AERT 1G43A 3KBEA 4AIOA 1JHLH 1SJHA 1BXVA 1R3LB 4H25A 3NJLA 4G9FB 1S9KC 1S7TA 4HUWB 5B38A 1MXGA 5ICZB 4FG0A 5C0RL 4OLXL 2Z7WA 3E9UA 1CI5A 2EEAA 3U46A 5HDQL 3EYQD 4NJ9L 1ICTA 3U6XS 3AB0C 5LGYA 4Y5XA 3SBQA 3CX5K 5KYYB 2J43A 3F7YB 1UZ6E 1OTTC 4P07A 1XVSA 5J13C 3HNSH 4U1HA 5A3ID 4GS7B 3A4FA 4G9FA 3HUJB 4GMTL 4KPHL 3V4UL 5C6WH 2FT8A 2WUCH 3MPCA 2GFBA 2X4PA 1J1XH 5B1CA 2LVEA 5E8OA 2AEWA 2J12B 4JFZL 2R9HD 4KPHH 4N8CL 1T89A 4K9EL 3NRPA 5EIQA 3JQOB 3GYRA 4NI3A 3UP6A 3ARRA 3KD4A 3RDTC 2VW7A 3H2PA 1H9VA 3L2NA 4M56A 2VE6A 2Q76A 3I9GL 3LKOB 2OAAA 4N3TA 1O7VA 4MQXD 3IEAA 1RI8A 3AFLA 1IAIL 3TL5A 3QUZA 5L6YL 4J5VA 3U0WH 4L3FA 1AKPA 5DHDA 3ES6B 5KAQF 3JTBA 4GQZA 1KGUA 1ZGLB 1MJJA 4WWOA 3UMTA 4F3FB 1HYSD 2CJUH 1TTCA 5FYLH 4Y4KB 4C8XA 1KC5H 4YPGA 4LLMA 4ERSH 4YXHH 3GMLB 5LG1A 4YSSA 4S10A 3LMJL 3OJDB 3SO5A 1TMCB 5IJVB 1IU1A 4I0PA 4HISA 5FGRA 1S7RA 4WWKA 3AG3B 4I1PA 1AZUA 3MX0B 4OVUA 1UJ3A 4WKZB 1W2KT 1LD9B 4Q0XH 4YDKH 2APXA 1DO5A 1CK0H 5C09E 1IQWL 1MJJB 4U6YB 5HTSA 3WY3A 1X5JA 4JBSA 3JWDL 3TPKA 1OIOA 1M2VB 3NTCL 3Q48A 1YY8A 1PAMA 2DWDA 4E9QA 2FQFA 4JRFA 4P23A 5AYTA 1P7KB 1DQJA 3UBHA 3A21A 3FQXA 1BLNA 4JPWL 3VD9A 1KLFA 4FQCH 1MFCL 3LPFA 4PV9A 3RVTD 5CGBA 2ZYRA 2BWQA 5FO9A 1FFOB 4KFMA 2J6EA 3WFHA 4PPTA 5FXCH 2WNXA 5J13B 1J1PL 4OJCA 4CILA 2ICCA 1WA2X 5C2BH 2HRLA 1AGCB 3S35H 4FXKC 1K5WA 1XD1A 2R0ZH 4MXVF 1CGWA 2VDOL 3NSXA 7TAAA 2QLYA 3HCVB 3SYPA 3ETBJ 2YA2A 3N04A 2C3VB 5F9JB 1MAML 3V5HB 1G6RA 2EDHA 2VDRH 4OB5H 1JTPA 1EDHA 3HG0A 3QUMB 4MS8C 4XC3H 1H3VA 4QXVA 4PVBA 5EF1A 3FCUB 3LPPA 1UUNA 3LZFH 5GHWH 5H4ZA 1XTLA 1MCCA 3T0EC 1R4XA 1VA9A 1RP9A 5A2FA 4N0CD 1AGCA 1OALA 1RMFL 3QVAA 4X6CF 4FQ1L 5DJYA 3O0RL 4HEPG 2WKOF 3JVGA 1NGWB 2XIIA 5KSUA 2E8YA 2F7RA 2EDDA 2FYYB 2V9QA 4NO5B 2IQAA 1F42A 3KLDA 4Y4KC 4ZYKB 4OLZL 1QYGH 2WBXA 5MHSE 4ONGL 1IX2A 3DJTA 2F53E 3U6RA 4H13C 2C3WA 5KW9L 1T03L 3D06A 4NJ9H 2BFVH 4IOFD 5IW6B 3BPNC 5I1KL 2X87A 4Y9CA 3UAJA 3FUHA 1ZT7A 1XT5A 5I66A 5DUPH 3O11A 4HEMA 2IH3A 3BWUF 3ULVL 2X4UA 1KGCD 1G6VK 3BVWA 3D4YA 3L7FA 4W9CC 5SWZD 4EI6B 1HJCA 3AG2B 2EH7H 2NY0B 1OWWA 1V3MA 5KVEH 1N3NB 2IG2H 3VVWA 3MJ7B 2R1YA 2G60L 3ZIYA 1Y7VA 3KYOB 1QSEB 4ISVA 4POUB 1UA3A 3EXLA 4HKZB 5K9JH 3DXAB 4LEOA 4PJFE 5TF1H 4HWUA 5ID0A 3UC2A 4P3WA 3GBNH 5GZOD 2J88L 3L7FB 4B9JA 1OL0A 4LOUC 2B1HL 5JQ6H 3ZRFC 4P4KB 4NQDB 4R5XA 1QBAA 5DK0B 3QCTH 3V52H 4AC2A 1LP9E 3PP4L 4JZOB 3EXJA 4TVPL 4ADIA 4OCSH 2IV9A 4B7LA 5C8JB 1DQDL 3QJOA 4B41A 2VKXA 2BOLA 1E9QB 1F45A 3SDDC 1CQYA 2N56A 5E94A 2DMGA 2HLFC 2LTQC 3ZT5A 2FATL 3F05A 1D3CA 5I1LA 1RVFL 1MH5A 1T7WA 2FJFA 4NPYA 2EINB 3NCYP 4Y9BA 2A6DA 1BQRA 4PVNA 2DICA 4GRWE 4HPOH 2YUXA 2XUWA 1TOXA 1PX4A 2DQTL 3QPXL 4R4FH 2JQZA 3BUYB 4FNUA 2C9UA 4GKZA 2IGTA 4POZC 4TUOB 4HUVA 3FB5B 4Z7VE 4CC4A 4BSWA 3NIDF 1BZ7A 1CDHA 2HKFH 2OMNA 4GIAA 4YSRA 3FKUS 4HCRH 4L23A 3ARXA 4BFBD 3IMRA 3MRJB 4ATTA 2YO3A 5F7NC 1C8PA 4PGZA 4LCIH 3Q0HA 4PJDE 4HCRL 3ZHDA 4B53A 1A4KB 3EJQA 2OL3L 4R7NA 2XN9E 5LBSH 3PWNA 4GUQA 5JHBA 4QF1B 1BAWA 1SDAB 1YEHL 4I48B 1JN6B 4KTEH 3IETA 3B2PA 1DANU 2BY0A 2YRZA 4DKFH 5IHBA 4FQJL 3GUFA 2A73A 2Z92B 3N9GL 4JMXA 3CZKA 2VQ4A 2C7UB 3Q06A 1P0SE 5CF3A 5INDB 5FM5O 5IW1A 1JL8A 5D2NB 2CRMA 1KN4L 1OHQA 4P2RA 5C7XL 2DQ6A 3HN5A 4Q2ZA 2CGRL 1XF5B 5DI8B 4JHVA 1FL3A 4UAOC 4J3UA 5KVDE 3FTVA 4PW3A 5KSAC 2FD6L 1QR1A 3LPWA 2K6YA 3L3HB 4KXDA 4EXKA 5BO1H 5E5MA 3B9KC 3PABA 5IJBC 1NAKH 4V33A 3SKJL 3N0PB 5GRYA 2R4RH 1CFQA 1IKNC 4XB3A 5H37G 1G6RH 3GINA 4PB9H 4G80A 2Y3NA 4Q97A 1DLFH 4IEFB 4NKMA 1UM4L 5EU6A 4PJ5D 3MNWB 4F9LC 3OMIB 2Y6SD 3HFFA 4P2RB 4NKIL 4FABH 4PB0H 1KJ2A 2Y7SA 3IPEA 4RGOL 1WDAA 1GY2A 2D7TL 4LSTL 2CQVA 1JXKA 4YXKH 2WLLA 5DMJB 4KNQA 1F6AB 5HVGB 1EIBA 2J4WH 3T6ZA 4ALAH 4J4PC 1MF2L 3DGCR 2Z6FA 3FUKA 2XWDA 3TS8A 4XB8A 4DAGH 1FIGH 2XETA 3H7BA 2C3XA 3CVBA 1WCBB 4S1QH 4JLRA 4S1RH 2XV2A 2Y06L 3EDFA 4NQDD 4TN9A 1LEKB 3LMJH 2WXGA 2W9DH 4ZDHA 1SXSA 3C2SA 3GI9H 3FSZA 3GD1C 1OAZL 2VO8A 3OKLA 1QSEE 2F53A 4JFDD 4DEWA 1MCBA 3RHWK 3VRJB 2Q86A 3BMVA 3MGAA 4M9OA 3U7AA 4JM2C 4H88L 2WUBL 1AQHA 1ZSHA 5FECA 2Y7LA 1IFRA 3IRPX 4ZUSB 4PJHB 4X6DA 1NC2B 4M6AA 1PS3A 3IU3A 5CZRA 5HXMA 5DRNB 5JA9A 1D9KD 3ETBF 3I3DA 4LMQI 4MS6A 3QDJA 1HE8A 1NC4B 1JZ7A 4P3DA 4X9BA 4ES8A 1OAQL 1JWMB 1MFEH 1BFVL 2H5UA 1CLOL 4XBGA 1TO4A 2WAHA 1DN0A 2E0PA 2DOCA 3QULB 1XDTT 1CDYA 2QQLL 5EOCL 4EF3A 4P5TC 4F9LA 1BVLB 5AOIA 3UJIH 5FUOL 2QVFB 3STLB 4X6DB 1JRHI 3IU3B 3L8QA 4TLKA 4IBWA 1HIML 2BNRA 1MREL 2AQ3A 2ZQKA 1JZDC 2D9QB 4PJEF 1FNEB 5FCUL 1E5CA 5DMIL 4KO7A 4CRPA 3NCCB 1NJ9B 2EXYC 1P4IH 4UF7C 4Y16D 4BHUI 5DJAA 1JRHH 2YPLD 3KZ8A 3TJEL 4AH2B 1PG7H 2ZKMX 1JPSL 1E3FA 1TZHB 5I0YA 1AZZC 1TIUA 3LVEA 3MR9A 1SM3L 4I1RA 4FFWC 1OGAB 1TZGH 5C09D 2X4OA 4UQDA 1OD9A 2JJTC 3OC5A 4HMDA 2IADB 4F93B 3I6GA 4GP4B 1N7MH 3L3OC 1T5WA 3TBWB 1X4ZA 1NMAL 3L9BA 4EQ2A 4OCYH 5EO1A 5EUOB 1HDMA 1RHFA 3TF7C 1KJ2H 3CK0H 2GYSA 2Y1YA 3GJFH 2AJXH 2ZXDA 1BOYA 2O5ZL 4YGVA 1TEYA 4X6EA 3F7PC 3O4LA 4RWHA 5CS7A 4N8CH 3ABZA 5T3ZD 3QHFH 4XE5B 3LN5B 1FNFA 1NICA 2GJ6D 3Q44A 4G71B 5HYSA 4G3YH 4MGXA 2BIOA 4MHHI 4HJ0C 1X5FA 4M62L 1VKXA 4E68A 3I50L 4FA6A 1DVUA 4IIQB 5EUOE 1KOAA 3KJ4C 3U0WL 1V5JA 4GAJL 1LE5B 4PJGA 4JFFD 2R2HA 1J0HA 3AZUA 5LN4A 1G84A 1X7QB 3HPJB 1KGCE 1OANA 4GRLD 1IM9D 4IBSA 2HT2C 2V5TA 1P2CA 2XY1A 1K3ZA 5I1EL 4D3CL 2WYZA 3V0GA 4BFNA 1SLWA 4MQXC 3WHE0 4K3DL 3BIAX 2D73A 5CBEA 2R0KH 3WIAA 1JTTA 3GXDA 3W0WE 3MC0A 4N0FA 5HDBB 1EXGA 4P5RA 3ARBB 2ZOLA 3UAAA 1DBKL 2DI8A 1T21B 3D3VB 4M48H 4NAMA 4W9HC 5DQ9A 3JWDH 2C34A 2IMMA 1JVOA 3JYBA 1OP4A 2H26B 2QVKA 3UBXG 2BY2A 4M8UA 1JGUH 4JFED 2GUOB 4LEBA 4UQBA 3VJ6B 2AABL 3SQBA 2WUBH 1CF1A 4HW6A 3CCHA 1CIUA 5ESAA 1DEDA 1USZA 4H1LA 1WFOA 8FABB 3WI9A 1CPUA 1SF3A 3C9NB 1MFAH 1J1PH 1U9KA 12E8H 3EYQC 4NBXB 1ZA3A 5MHSD 3WFEL 1UACH 3FT2A 2VDMH 3KPSA 3BPLC 2COVD 1A6WH 3KCPA 3UPCA 4C4BA 4CBZA 1F4YL 2MEJB 1MCIA 2A9ML 2CHNA 4X6BB 4D0CA 5E9DD 3BMWA 3CCHB 1EJOL 3C6LC 4GRWH 5SWZE 1CLYH 4N2LA 3FRPA 5CGYD 5DEGB 2FSDA 3OL2A 4B9FA 2VZSA 4Z5RB 4QY8B 4MCYA 2W1NA 3LKNA 3L4TA 4ZX5A 2ZCLH 4WI3A 4AG4L 3JZYA 3ESUF 1EXHA 3NA9L 1FAIL 5DJ8B 5IR1B 2CCLA 1KXVA 1ND0B 2F8VA 4B9ZA 4WSGA 4UNIA 3MCLH 1VFMA 3OSKA 1PEWA 3B5HA 2NX5E 2PETA 3J8F7 4JDTL 2P8LB 1NL0L 2WWMC 4X4YB 3NGBB 4PRBB 2PMZA 2P44B 3C5JB 4U6VL 1CVRA 3RIFF 3QNFA 3EBAA 1NMAH 1LO0L 2V3DA 1N59A 3G5YA 2CGYA 5HGAB 4CSTA 1JPEA 2XN9D 3HG1B 1HHKB 3B7RL 4HS3A 4XB7A 3VYNA 1OP5K 2WTRB 1U36A 1R3HA 5HDWA 4CMHC 1A7RH 2UY7B 1V3LA 4ZXBC 1SJHB 1R3LA 4EVNA 4J3OG 2AK4A 2Z31C 1Y18A 5JIKA 1UUSA 3D09A 2D7PA 1FDLH 1IM3D 4N4YB 5LQBL 4XX1E 1RK7A 2ARJQ 3STBA 1KXTA 1DDHA 1BJ1H 1QHQA 3O2WH 3SPVB 1BPVA 4TLUA 5FLUA 3T2NL 1FDLL 3FONB 3WN5A 5D96B 5FFGA 2MH4A 3TWCL 1EO7A 2FL5B 1VIWA 2Z35B 3FJTA 1J87A 4Y5YC 4Y16A 3O6FB 3CU1A 4PJ9D 5AAWA 1QSZA 2VDKL 2JWYA 4HIIB 3OM3B 4K3GA 4U7KA 3TWCH 4JEGB 4RIRA 2E8ZA 1TPXB 4ES9A 3WKYA 1BWMA 2KDGA 1YEDA 1QBLL 1ILUA 1GIGL 3D39E 3O3EB 3SDCC 1HESA 2XQBL 1I9JH 2B2XH 2JJSA 5L2JB 2HAZA 2X1QA 1QFWL 2IWFA 3N1PC 3P4MB 3TO4D 4L9LB 5DSCB 5CFHA 2CM6A 4OJAA 3NCXA 3M1CA