1TEYA

Nmr structure of human histone chaperone, asf1a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
156
structure length
156
Chain Sequence
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASF1 anti-silencing function 1 homolog A
publication title Structural basis for the interaction of Asf1 with histone H3 and its functional implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 28
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 1teyA00
2Z34A 5BNXD 2I32A 2CU9A 1ROCA 2DZEA 3AADB 2YGVA 4EO5A 2Z3FA 4ZBJA 2IO5A 1WG3A 2HUEA 4RRPM 5EIIG 5BO0D 5C3IA 2IIJA 1TEYA 2IDCA
chains in the Genus database with same CATH superfamily
1I8AA 1KFAL 2JJUA 1BVNT 3MOBH 4X4ME 5E2UH 5JHDE 5C08E 1KCWA 3HC4H 1HHJB 3EDJA 5EEWA 3ZR6A 5BO1L 4PJ7B 2VXVL 4OIIH 4PB9H 2OL3B 4EDWL 3LEXB 1NEZB 2K9FB 2AJ3B 1SEQH 1OGAB 5FS5A 4NO2A 5E00A 1DVFC 3TOPA 3D2UA 3UYOD 5GHWH 1FVCB 4M02A 3S5LG 5EBGA 3TH4T 3EDEA 1ZVNA 5HY9A 5HYFA 5C8JB 1XGRB 2C8NA 3IJHB 1N5AB 4X9YA 3PIQB 5JPMB 4UQ2A 3TA3C 4MTMA 5D5ME 4ZW3A 4JJHA 3GRWH 5I30L 1UCBH 2Z7UA 2MHAB 1LEIB 5TPWH 3KYNB 1B4JL 3O11A 4HGMA 4KHXH 4KI5E 4ZPVA 4OGYL 3LYRA 3H42H 1S9KC 3GPEA 4LLMA 1YMMD 2UZYA 5ID0B 3X1GA 4BFGA 2GT9A 5IF0A 1H5BB 5C0GB 4R97B 3ARDD 4RGMC 1KY6A 1AVAA 3UAJA 1KNOB 1GGCL 1U30A 3GMMB 2HJKB 3I3BA 4E9LA 5F89A 3RTLA 1ZGLM 2OFQA 4OLXL 3VSVA 2WN2A 4ZFQA 4APXB 1BP3B 1QWUA 4M9OA 5CF3A 1K6QL 2ALAA 2OMXA 4CVZA 4TVUA 3H0TA 1AR1D 2ZWLT 4FQQA 3MLZL 4P59L 1AGFA 4QHUB 3B56A 2Q6WB 2HWZL 5D96C 2Q8BH 4WUUD 2D9CA 2VQUA 5EA0H 5B3JF 3MJ9H 4G8FB 4UM9A 1ZS2A 3HB3C 2D2CC 5IFAL 5C9JB 1TVBA 4R4ND 2CZNA 4U1LB 2VR7A 4AQEB 1RIHL 2P48B 2XETA 3FQRB 1GKEA 5ID1A 3KJ6L 1Q0YH 2CK2A 3KPNB 3VI4A 4CNIA 3LN5B 4KMTL 3H2WA 1I9RH 3KJ4C 4PRBA 4E42B 3W9DB 4QO1B 4YZWA 3QDGB 5CZVH 2W60A 4DP0X 2F53E 1YEIH 1FNEB 1OTUC 4LSVH 4GI8A 2XU9A 3TJHD 3TYFB 3WEOA 2WBKA 2XXGA 1WHPA 4OH2A 4DT2A 4KNQA 1EO5A 4FABL 1QBML 3WJLA 2WBJC 2VLLA 3SKUD 4LKXA 3VD5A 1BFOB 3D85A 1T1WB 5C2BL 1JGLL 4HUUB 5D1ZB 2GBVA 5TE6L 3ZDXE 1NIBA 2N0KA 1KIUA 4HZ1A 2HRLA 3C5SA 1BREA 5D7IE 3LRGA 1FVEA 2BOBA 3PP3K 1MY5A 1KWKA 4I2XA 4L37B 1IAKB 3I74A 3SBWC 2K8MA 2R1XA 3QCUH 2ZQKA 2X44D 1U95A 3HZKA 3KPLA 4GUOA 2W0FB 3CQPA 3KWWB 4QRPD 3OJVC 3GBMH 2CWRA 4OZGE 3T0AA 1OAKL 3EJUA 1ACCA 3VFMA 1T20B 1DLHA 3I75A 3Q6GL 2MH4A 4K3EL 1NL0L 4M3HA 4XWGL 4ZAKB 2DMCA 3BQVA 4O00A 4DPRA 4WRLA 5F0JB 1FP5A 1MOEA 1W16A 2IPTH 3GTNA 1IU1A 1NGYB 3SIKA 2E86A 4P5KA 2UXFA 4EAEA 1S9XA 5G4NA 1VGKB 2AQ2A 3IGAB 3GJFK 1DE4A 1J0HA 4NB7A 3SYQA 1N5YH 2QVFB 3QNZB 1MF2H 1BOYA 3T09A 4JN1H 4XBGB 2ZAIA 3MRCB 1KJ3L 4YO0B 3BZ4A 1GSMA 4CGUB 1D5BA 1ECZA 1UC6A 4MQTB 4C4KT 3D25A 4LE8A 1ZGLP 1R1CA 4LVOC 2OMNA 4XMKL 4AM0Q 2Y24A 3PGFH 4OUUB 5GS0D 4ORZC 2X70B 2P47B 1TLMA 4TLKA 3COOA 1I1YB 4RRPG 4I1NB 1UWEL 1YEEH 3UABA 1J9SA 2R0KH 2EDHA 2YK1H 2AK4B 2DQ6A 2ZOKB 4UZGA 5JW4R 1M7IB 2J1WA 2NY0B 5JQHC 1KIRA 4O9HH 1CDGA 1ETB1 1JWMB 3S2AA 4R7NA 3JTSA 3QZWA 1CGWA 2B3RA 2PXYB 5KVGE 1NC4A 3B8SA 5FYKH 4PS7A 2BSBA 5C71A 3LKSA 3BT2L 2K8QA 4HSCX 2LW3A 3UBGA 5BS0A 2DD8H 1F4YL 3QDMD 2YHGA 3RDTC 4I18B 4LLDA 3NSJA 3Q9PA 4WNJA 2DQHH 2E76C 5B21A 3BSHA 4L8BB 3VFWA 1Z2KA 1ZA6A 3BUTA 1FCGA 1MAMH 2JCCA 4LPTA 3X13B 2A83A 2CKBA 5AW7B 1G0YR 4Y2OA 2BSSB 2H0FA 2OMTA 2AXGA 3DWTA 5DMGD 3UCQA 1HEHC 4PRDB 3PDOA 1FVDA 4UQDA 3TZVD 5GRYA 1TFPA 2PTUA 3EJCA 3L1FA 3MJ8B 1ZSHA 4ZMTA 4I4WA 2X2JA 1LQSR 5FM4A 4FFZH 1NC2B 2WTOA 4IRSA 3UGEA 3NRPA 3BO8B 1RUQH 3GUFA 2P5WE 3L2NA 5KVEL 2VAAB 4AGNA 2XA8L 5D71H 5EU7E 2YEZA 3O8XC 2CXKA 4P2RE 3T04D 4B50A 1W72L 5L8KB 3LMJL 4LP8A 1BVKB 2R7EA 1NICA 4OVVA 1BMWA 1K4DB 4WV1C 4U1SB 4QT5B 4Y5YA 3SDDB 1NBCA 5CLZA 2Y1VA 4TQEL 2J88L 4OI7A 2XDHA 1YPZB 1GPOL 4U1NA 3WMPA 5DK3A 3SDXF 1EDYA 2AEOA 3AG4B 1BG9A 1HKFA 3C2AL 1DQVA 2ZKHH 3VNZA 4MJJA 4GKSA 4QYAA 4PJ8A 1LO0L 4EI5D 1QX1A 2DQFA 2DYPD 4IS6B 3BDYH 5JZ7D 3K4AA 2D4FA 2WZAA 3JTBA 3ROOB 2VSKB 5KYNA 1RZ8A 3RE0A 1O6SB 1YVLA 3PWUB 1IC7L 5MEOA 5MEPA 1DCEA 4U7KA 1NGWA 1WHOA 2WXIA 1YNTF 1IZJA 4JRYB 3GINA 4XO5A 5GGTL 5T3XL 3KLSA 3RWFA 2YXWA 2R2EA 4MRBA 3DRTA 5KBMA 2LVCA 4BFEA 5FO8A 1F41A 3MHZA 3KHQA 4M7LH 1MAJA 3DX2A 3UBHA 3ETTA 3I6LE 3EJYC 4DEPC 1PAMA 2OAAA 1ZANH 1D2PA 1T5KA 1S2EA 2HFFB 2R2HA 5C0IA 1KB5H 2XWTA 5HGHB 3FTVA 3CFIC 4G6AC 3TN0A 4IHBA 3Q8BA 2KYIA 3X11B 1AY1H 3LNEA 1BIIB 3MGAA 3VTTA 5GRJL 4W4OA 4PTUB 3VGAC 3MJ6A 3PHSA 1ZTXH 5KSBA 1KLGA 3CVHL 2XN9D 5IB1B 3ZIMA 4PRPD 2MKWA 5DC0A 2CO3A 3Q1SL 3H3PH 5EU5A 4WHCA 1TU2B 2EDDA 2ETWA 3SPHA 1I8IA 1QLEB 1TO4A 2A73B 4JM2F 2GCYB 2MIZA 5LKNA 1HFUA 2DICA 3D18B 3E6HA 1DJHA 3D39B 4JM2D 2W9DL 5KANI 4P5TB 4X6FB 3LCYA 4OGAC 4WWPA 5ABDE 1T0NA 4KAQL 4J6RH 2HUEA 3I50L 4H8HA 4LCIH 2W9EH 4LDLB 2XUWA 4E9XA 4O4YL 1M9SA 1X9UA 3JSSA 3LIZA 2JWYA 4DO6A 1KB9K 4FXKA 3CFJB 4YGVB 5D72H 4MJHA 4DN4L 2O5YH 2WY3B 3IDJB 1TZGL 4WI4A 5AZUA 1ZHNB 3D7PA 5DQJA 3N2JA 4QRRE 1E9PB 5CHNA 4DQOL 3CBJB 4JHBA 3TWCL 3O2DA 1I7TA 3U9WA 3V9CA 2Y5TA 3V0GA 2ZPKH 1E5ZA 4GRLA 1ZHLA 4WHYG 4X0NA 5DVPA 4Z76A 3FONA 3BD3A 4XNXL 4PG9B 1XCQB 1WQVT 1HXYB 5C0CB 3ISWA 2I27N 4HK3N 3VFGL 2CLVA 1PG7W 2G60L 2QQKH 2XQYA 4I3RH 4AK2A 4F7EB 2V2TA 4OUOA 3NPSB 1CE1H 1IGJB 1T6WA 3O9WA 1B6DA 4BUGA 1UB5A 3TEXA 3N0PB 1CFQB 4O2FB 5TE4L 4X8CA 5HYIA 1T89C 2BPBA 2FUTA 3QO1B 4ZUUA 4KVNL 3LS4L 3TBYB 1XO8A 2AI0H 2WUCL 3L3OC 2CRZA 4PJIB 5IVNA 3T4YB 4LKCA 1QG3A 2QV4A 3OKLB 2D31B 2L7QA 3HZMB 3WE6A 5H4ZA 2QGBA 3SY0A 3GTVA 2OXGB 4KH2A 4BK5C 3UBXI 1CE6A 3U2JA 1D7DA 3FRPA 1ZLEA 2WJ7A 3VGGA 3CXHJ 2HXAA 3DI2B 3DIFA 2WQXA 1I4FA 4D0DA 4WKXA 5CJOL 5K9QI 1E7UA 3Q5TA 1HHGB 4GMTH 4PVNA 1Y0LA 4AV5A 3CUPA 1WTLA 4FQXB 2FB4H 3VD3A 1XL6A 3VTMA 4KZEL 1PSKL 1A6UL 3S37X 1J11A 3UO1L 1Q0XH 1CZ8L 4CVXA 4PLNC 2M8XA 3WCYA 4Y5XC 4N8VG 3HBZA 5JHDB 5C08B 1OCOB 1YMME 3UZEC 3ZJAA 3OWEA 2IPKA 2YRLA 3RB7A 2H1PL 4HF5L 3WXWH 5HYJA 1OHQA 1P69B 1YRKA 1Z9SB 4L4VE 3V6FB 4ZMQA 2H8PA 5D7SH 2IV9A 4KNSA 5DURD 4CC0A 3VWJB 2HP4A 3WI9A 2VDML 2QKIB 4JM4L 2PYFB 3QA3A 1TR7A 5D4JA 1TEGA 5I75B 3L3JB 3H9SB 1IV8A 4KKCD 3QH3B 5E6YA 1EEYB 2A6KB 3MRKB 1VFBB 5FM8A 1A1NB 12E8L 4FD0A 4QHKI 2WYZA 3WN5C 5C0AD 2A6JA 5EMYA 3L3IB 3BP5A 2YR3A 4XPBH 1HAWA 4WUUE 1Q72L 1NGPL 3HHSB 5EDXA 5I24A 2R56L 5KS9E 4H1LG 1U8OB 4NZJA 1EZVY 5D5MB 1O7SA 5EUOA 1PD1A 4D9LH 1TJGL 5B3JE 1XGUA 2ENSA 5D1XD 4LSSH 4PYGA 3BRDA 4F91B 1FL5A 4OJFL 2VKXA 3BIBX 4LMQI 1MJUL 4X9BA 2GIXA 3APNA 1MCOL 1WE5A 4Z77B 5CU5A 1S7UA 2ZUWA 1JGEA 1R3HA 1S7XA 3QS3A 4JO2L 3GO1L 1HOCA 2QFRA 4A39A 3F00A 2CK0L 1P7HL 2Y4SA 1GGBL 3QIBD 5GGVL 3C8KA 5AAMC 4CAGA 4LAQL 3VM5A 1BQHA 1JPTL 3IMBA 1UD5A 5DJYA 4WU7A 2AMGA 4YE4H 2B59B 3ATBA 5JHBA 5KVFE 5GZNC 3KXFD 4ZYKB 1KCRH 1BQKA 3HI6H 3WSQH 2M1KA 3WNOA 3UZVB 2QADB 4AC2A 1QW9A 1T1XA 4RAHA 2OJZH 4JDVA 3NAAL 3GSRA 1E8YA 2E27L 5D2LF 3DARA 4G6FB 3HG4A 5JPNC 1U3HA 4J3WA 2IVFC 3L4UA 4R2GB 4AXWA 1OT4A 5SX5H 3DRQB 4XZ4A 1MCEA 1OZUA 1BX2B 1G7MB 2F53B 2F1EA 4AT6B 3HC2A 2WO4A 5F3FA 1A8ZA 2ENQA 3NZSA 3C8DA 3UBXA 3U46A 4IHOA 1L7IL 1QQDA 4Q58C 3BWAA 3CH1A 2GK2A 4HIHA 2MCPH 43CAB 5JIDA 1IARB 4G42B 2X4SA 5IJKC 1UH4A 4JRWA 2I26N 3O6KL 3C08H 2VM9A 5AW9B 2CDFA 3WHXB 3LSOA 2ZUTA 4HVBA 3ESOA 4LCCB 5LBSL 5DS2A 5FECA 1YDPB 4WW2A 4Z5RA 3SO3C 3BQUB 1W6LA 3H3KA 3K3QA 3MRJB 5E4EC 4UQEA 4X6DA 1A7RH 3H7BA 1C7SA 5D7IB 4Y7MA 1NMBL 2XBTA 5ADPH 4HUVB 2J44A 4ODSL 5E2VH 1CTMA 4J2XA 4JE0A 3AACA 2YZ8A 3DPBA 3FN3A 4ZMZA 2Q76B 4RMTA 5DFVD 4H26B 1UD8A 3QIUA 4RAVA 1YLBB 5EOQL 4ZXBA 4OZGB 4ODTH 2VMCA 4FXTA 4LSUL 3GMOA 1KJ2B 5SX4I 2X4TA 3EFDH 4PJXF 2HB0A 4RESB 4ZS6D 5F1OB 1SZNA 1YYLL 5IHUH 4Q2ZB 5AEAA 5MEQB 2W94A 2WVUA 2G5BB 2JNZA 2VLRD 2Z8VC 3CX2A 4R7DA 1FFPA 1W8NA 1UH2A 3QIWA 4XXDA 2AW2A 5I1AA 2NNCA 3RFRA 3WNMA 4AUYA 3BP4B 3FMGH 4FDWA 2BP0B 3FT1A 2E8ZA 4QXUL 3DDGA 3CN3A 3VG0H 2BSEA 3DBXB 2LQRA 3QPQC 4B41A 2EIJB 4Z6AT 3DX7B 4F9PC 2NQDA 3REWB 1NQBA 3L54A 4QF1B 3P2BA 5FO7B 4ZW8A 3MV8E 1NCAL 3GD1C 5HGBB 3F7LA 3D9AH 1C5DA 4U1MB 3QORC 4UV4H 4DKFH 1MCWM 3MUZ1 4NQEA 2VXUL 3NJIA 4PS4H 3O3DA 5GGQH 4JS7A 1F3JA 5BRZA 1JGUH 4OKVA 5I8CB 3PHQA 5BQ7B 4JGJA 2XY2A 1CFTA 2DF3A 3Q8CA 2CKBH 2NYKA 2VUOA 4JFZH 3SDCA 3CFCL 5L7XL 5L9DL 4JDZB 1A21A 3QEQA 1X5JA 3C8HA 1PZ3A 3NJJA 1FNSL 2WXRA 1KEGH 5F1IA 1WPCA 2NLJB 1VERA 3V4PB 3ZZLA 4MJ2A 2EKSB 3ZZ1A 1TTBA 4W9HC 3L95B 2IAMA 1PZUB 4K07A 2A6DB 3S88H 1K5NB 2X4QB 4H8WL 4U1GC 4Y4FB 2EYTB 2A9NH 3WY4A 4KMQA 2UYLB 5AL8A 3CXDL 4OSUL 5EZPA 4MNQA 3TO4B 5B3NA 1F4XL 1MFDL 3TT1L 3MRGA 3WS3B 5HJDA 1YN7A 1GYVA 3UAFA 2EE3A 3QJOA 4WI9A 4BKLB 1F42A 1X5MA 3MGTA 2VR9A 3JV4B 4Z7UF 5I1GH 2PR9A 4OFIA 5E9DB 4PG2A 5EC1A 4S0TD 2GSGA 5EU6A 2OXHA 1JZEA 1ZY9A 4IJ3C 3FQWA 4F3FB 1IO4C 5F6IC 1BZ7A 4XAKE 4RWYH 4IKIA 1AI1L 5DJ6A 2YLHA 1OP5K 4XN8A 4PJDA 1Z5YD 4DSYA 1DBBL 2H5UA 3OHXB 3DMMD 2XZQL 4N6RB 4U1JA 5IKCA 3QBTB 3KNBB 4JCWA 1OSPH 2UX6A 3NCWA 4JLRA 5G55A 2LLGA 5IT2L 2X1QA 2E6QA 5KSUB 4E36A 2ESVE 1JSYA 1UQSB 3QE5A 4PJEF 5TF0A 4E2OA 3K2UH 3SPVB 4Y4KB 3SDXE 4PGJA 3T8XA 4J3OF 2Z9TA 2ZAHA 3AY4C 3BEVA 4J3OD 4FQHB 3VYNA 5B8CA 3F64A 4HKBA 1U41A 1ZK9A 5HDQH 2O5ZL 2AGJH 2P5WB 3DX1A 4UTAL 5ERWA 5FUCE 2W1NA 2A4ZA 4UAOB 4K73A 4P2RB 2AJYH 3MOAL 2UWEF 2ZUVA 1PCSA 4JAMA 4JL2A 5CJ8A 1B0GA 1KTBA 2PP8A 3BUYA 4TQIA 3ZXAC 1HQ4B 2FIRT 2XKNB 2Y6SC 4KZ0A 1OXYA 4LL1A 2CA4A 3E3QE 1D5RA 1CD8A 1ZAGA 4NCC2 1F86A 2OMWA 4HHWA 1ZPUA 1NCJA 1JOIA 2CALA 2Z35A 4Z3FA 1D9KC 1P7QA 3HUJF 1TZHA 2MOQA 4PRPE 1G6VK 4S0SD 4YDLC 1T80A 2OW7A 4TNVF 1JHKH 2J6EA 1G7PA 2WW8A 2ISDA 3ARFA 5GJSL 4KKPA 2MOVA 4WUKH 1ASOA 3BKJL 4UQCA 2P28B 2HG5A 4JPIA 4X7SL 5JIHA 4HD9A 1I53A 1S3KH 1XX9C 2DWDA 4GB9A 1P1ZA 3FOLB 3LIZH 5EBWA 2X4NA 1HSBA 2VDQL 3GLAA 4Q9CA 2CGYA 1V3MA 3WTYA 3EYFA 1XH2A 3O2VH 1EUUA 1CN4A 2CO7A 3D05A 4XPAL 4ZSOA 4LK4A 2ZICA 5B1CA 1V8HA 4G7RB 2KQNA 3RY6A 3O2DH 3AS0A 4R4FH 4XMVA 3MXVH 4J28A 3IJSB 3GIVA 2XQBL 1GZHC 1YNKH 3POCA 5I1LA 1FFNB 4GQ9L 4ODUB 1L3NA 1X7QA 1EXUA 1TQWA 3RUGA 2VE6B 3MV7A 4BWWA 4Y2DC 4XVUC 1RZFH 2RQEA 5HVGB 2X6MA 3SDYH 2J21A 1MCBA 4CJ0A 3OVUB 1DQDH 2BY0A 4Z3GA 2WXMA 1PL3A 2APSA 1CICC 1BFSA 4X4ZA 3DO3A 4Y1AD 1EUTA 4LHUD 1IEAB 4I88A 1RZKC 3V9EA 3QWOB 5E2JA 5AAWC 1NGZA 5HP5A 2P8PA 4APQB 5BW7A 1ZJBA 3QEGH 1X5YA 2BVQA 4WI8A 1QHOA 2GW5A 4PWIA 5KJRH 5LHDA 2EVJA 1QSVA 1NJ9A 3O3EA 1CVSC 3OXSB 4QRRB 3SQOL 4B7IA 2VDLL 4TSAH 4I0PC 4X9FA 1TTAA 1SVZA 2V7NA 4AEHH 3VVWA 3PL6D 2BCMA 3CMOH 3ZE1F 3N9GH 5DHVB 4TQ8A 4JQIL 2DKUA 2J5LC 4ZOCA 3IMVA 3ULUC 2QVIA 2CIIA 3IJ8A 2NXYC 2PO6D 4FNPA 5CIPA 3NFSH 1OARH 1WIUA 1SJEA 3GMNB 1ZT4B 2PP7A 4M7ZB 4HDIB 4FXLA 4HIQA 1N2RA 3OAUH 3VRJA 2O6FA 2YD7A 3T1WA 3LHPH 1EHKB 3QHFL 3KGRA 2P5EE 4M43L 1RK1B 1FL6A 1G9NH 3HPJA 3F58H 5DD5H 1JNLH 5DYOB 1E6OH 4D8PB 4E9YA 1EBAA 3L08A 5IQ7H 3BZDA 3JZYA 5HYSA 3GBEA 2WWOA 4FNLH 2YXVA 4ODVH 4HCRL 5FCUL 8CGTA 5I66B 4JRXE 1JYWA 2A9MH 3AC0A 4JHVA 4HQQL 1J1PL 1YAIA 1FC2D 4P23C 5DS8A 3MSPA 4KRPC 5C0AE 3HR6A 1F6AB 1CG9A 4Y16B 2Q5BA 3THMH 4BBWA 2XYCA 1PCXA 3GBDA 4LLYB 5E8EB 2WO3B 4XOEA 1FQ9C 3MFFB 4M62H 3JT0A 4KDWA 1J5DA 4OCSH 4YS4A 3QJRB 1YC7A 1ZV5A 2NZ9D 4OJYA 2DOCA 5D1XE 1I8MA 4RDQF 4GBXC 1NCOA 2M83A 3INUH 25C8L 5TE7L 5LB1A 1A7PL 2VC2L 4IQHA 4QRAA 3GXUB 2DMBA 2EO1A 3N5AA 2N01B 4UV7H 1K8DB 4L4VB 1YJDC 2ZKMX 2X53A 5FGBC 1FGVH 1AR2A 3BLPX 1XSKA 4IIQA 4ZT1A 3V5KA 2VIRB 1T2QL 1IVLA 2XX0A 3DJZA 4IRSD 2IADB 4YQXH 2VZTA 2L3BA 3FN9A 3U6RA 4HS8H 4NUGH 1IC5H 3TWYA 3VGHA 2K6ZA 1S5IH 1RZGB 1KTCA 2PWHA 3LNHA 4PRNB 5CLWA 1GMIA 4KO9A 1AANA 1GMEA 2GKIA 2H1LM 5KS9B 4AQAA 3VD9A 1VPOH 4JDEB 3RZCC 2VNCA 3U4EB 2X4UB 5CEZD 4HH9B 3U7YL 4JR9H 1WIPA 2VLJD 5SWZA 1KCUH 1D3CA 1XHHA 4GQPH 3N85L 3OPUA 4ISVB 5ENWB 2APWA 3AXLB 3QUXA 1L6ZA 1QFOA 4MMXC 2EEFA 3VJ6B 1Z5LB 1CLVA 4V1DD 1A7OL 1GH7A 1OAJA 4KGLA 1Z66A 5T1KA 2JJSC 2VQTA 1GY2A 3AG2B 4TVPD 4ZRGA 4PJCA 2MPAL 2L7UA 3QAQA 1KEML 4XO9A 1XIWC 3VXUD 4NP4L 5KUMA 4OZFB 4F8NA 5IR1B 2NW2B 4FNUA 3TCTA 2WZ5A 3C60B 2FECI 3E1F1 3N6YA 3GSWB 4AJVA 3D12B 3CDFA 4F80A 1T21B 3RFZB 3DDFA 5LDUA 3D2TA 1XZWA 3A23A 1W8OA 1E9OA 1IM3D 4M7JH 3ZMNA 5TD4A 4GW4A 1KLUB 1BVNP 3L7FA 3LPOA 1RZKL 5JW5B 4KY1H 3SGEI 5SWSA 1K3IA 5EIQA 1HNGA 1N0LB 5AVVB 2B5IB 2YN3A 2L04A 3NCXA 3WIFA 1U8IB 2HRGA 4KXBA 1NIFA 2JKRM 4HAFA 4LT7A 1WZLA 4RDBA 2NQCA 4DP6X 4UT9H 3C6LA 2DI7A 2G30A 2FAUA 4JREB 4H8QA 3CLFL 2AABL 4WWKC 3BAJA 1GZPB 1U8CA 3GXNA 2FEDC 4PJXE 3WG7B 5CLTA 2VN4A 3L17A 1UOLA 2BC4B 4KKAD 1DQQB 5DWUL 4NN7B 1NBVL 2WP3T 2EH8H 4P2OD 1QBLH 5E9AA 1V10A 5A2IH 5JOEA 4EPSA 1AGDB 1HN1A 1LK2B 4X6CB 5BV7L 1T66D 3ULUL 1U0QA 1WA0X 1UZGA 3AWEA 2CLZA 5IEKB 1JS4A 1LO3L 1YN6A 2BVYA 2BFVH 4LVEA 5D1QA 4M4RB 4BWUA 5IJDC 4NRZB 3L3GB 2X4PA 1AQHA 1E42A 3O41B 4H88L 4M6OH 2RFXA 1MFBH 3I6KA 2A7BA 2GPZA 5KYWA 4S1DD 2FD6H 4NZDA 1K2DA 4QXTA 4MD5A 4QTIL 4XB8A 1A6ZA 1U8HB 1HVXA 2XPZA 4F27A 1DVFB 2GJZB 2QT6A 3WJMA 2VXQL 4GRMB 4OV5B 3O6LH 4JPKL 1MWAL 5E94B 3MROA 1VB9A 3O9WD 3DVFA 5B1AB 4G7YH 3FULA 4MCNA 2HPOA 3TBSA 1INEH 2P8MA 3D50A 4FTDA 5FO9B 3TBWB 4R84A 4F9LC 3GM0A 1E4XI 3UYRH 1TZOA 3CJJA 3FBKA 3LKQB 3MLRL 3TNMA 1G9EA 2JB6A 3MLWH 3WIIH 1QFWM 3MV8B 3G08A 1F0LA 5AW5B 4J39A 3OKKA 4P57B 4Z7UE 1IQWH 3D33A 4YZFE 5AW2B 1O9ZA 1J8SA 1RUKH 1T6BX 3QUML 2BNQA 4KVCH 4GQRA 1BYOA 1T7XA 2BNUB 3U0TA 1KCLA 1OCRB 4RGMB 4Y4HC 3W0WD 5B1JC 5JA8B 2BVUA 3VFSB 2RCSL 3D3VA 4MQ7B 3NACL 2GFBB 4J3BA 2I9TB 4ZTEA 4DPCX 1RSYA 2HN7B 3F5WA 1CDIA 4RZCB 3AITA 1NFDB 3GIZL 1AHWC 3NP4A 4M3KB 3B9KA 2LU5A 4KJQD 4OB5L 4OGQC 4PJEE 3HG0A 3KAAA 4QOKA 5DJCB 4Q9QH 4Y9EA 2AEPL 2AQ1A 3CLEL 1BA9A 2JK5B 1SMOA 2FO8A 4HUWA 2OSYA 4PWHA 5D96B 5FB8B 3IDMA 4HKZA 5ISZB 3Q1EA 2Z7ZA 3I2CH 3HB3B 3JXAA 5CR8A 3VMNA 3BPCB 3WYRA 3MMEA 4WW1B 5C09A 3C9NB 1ZCRA 3KJ4B 3BN3B 3RPIA 5FV1L 2UWEE 2E9JA 4Z7WA 2DJMA 1R0AL 4JHWH 2ATPA 4JY6B 3QS2A 1JPSL 3S2CA 3FDWA 1DO5A 5A6LA 3IKCB 1VJSA 1I1AA 4OVUA 1R46A 3UP6A 5ITFA 1AXTL 3IB4A 4PMFA 2ESVB 4TXVB 5C0BB 1MXDA 4HYTB 4GW5A 2J6EH 2H0JA 1RHHA 2Z31A 3HUJE 5IBLD 3BGMB 3SDXB 4OZ4A 3IGKA 2Y7QA 4L29B 3WFCH 3F84A 3V0AC 4G8GA 1MREL 4NZUL 2B7DT 4GSXA 3CD4A 3CPLA 1AOHA 2JKNA 1TUPA 4Q52A 7PAZA 1HSAB 3B4NA 5E6IC 1YNTB 1DUZB 2Z8RA 2BIPA 4F37K 3ME0A 2ZKWA 3OKDB 4QKTA 5I5JA 2BY3A 5FKAA 2XWJB 5GSRA 3RVWD 1N59A 3EYVA 2R69L 4JFEB 5CCKL 4N8PA 1LK3H 3SYPA 2FIKB 3CZEA 4CU6A 2VMFA 2ZSWB 4EZLA 1NFIA 3FB7B 4OI9A 4ORGA 2Z7YA 1JV2A 4Q4IA 2WLJA 1E8WA 2XQYG 3C12A 3L5XL 4NENB 4YC2C 2H32A 5H2BB 2IQ9H 1NFAA 1ASPA 1MCQA 2E9BA 2YD2A 5IB3A 4YIQB 3CVHB 1UA7A 4NJ9L 4IOIB 4A2MA 3RAJL 4XX1G 4FZ8H 5IMOA 4FQLH 1KT2B 3HZ3A 3B1TA 4JKMA 1XR9A 3KS0H 1UWXH 2HVJB 4Y1AE 5J6SA 3IDYC 3WY1A 4EN3B 5JDSB 2AJZA 3T2QA 3ZTJH 2BW4A 3A3YB 4N8CH 3HLAB 1TJXA 3FRPG 4AZ8A 5BZZA 2AQRA 3L3DB 3LV3B 4F24A 1WA2X 4EDXA 1CU4H 4IBVA 3ETBF 3WTSA 1NDGA 1G87A 3BAYA 3F7PC 4JM0A 1HL4A 4PV9A 4R5XA 4HA1A 2WUBH 1MQKL 4G8IA 3BX7C 5F7MC 4YSUA 4OU3A 4F7KA 2DQEH 2IH3A 3PXLA 3P9WB 2W8CA 4H20L 1UG9A 3WIHL 2VXTH 3V6OA 2OJEA 1RU9L 2PCPB 1E9QB 3B3IA 2F58H 5ETUA 5F3HB 1CGYA 1I1FA 5LAXA 4QXGH 4NO5B 4NM8L 3UYPB 4JVPA 3ZE1E 5CIPH 1X5GA 2SEBB 3JWDC 4ZXBD 1WAAA 3RNQB 2W65A 3S98A 4FFVD 4UDTA 4CU8A 1KTLB 1MAKA 3IFNH 2IALA 4N68A 5I9QC 1FZOB 4AX3A 3TNNA 3M6DA 3QIWD 3UMTA 1J88A 5DK2B 1TKWB 2C9PA 2GQHA 2ZCLL 1UHVA 1Z6JT 2YPKB 3VXMA 3UJTL 1IUZA 3EO0B 3IVKB 3KPPB 1HTYA 2UY6A 5KANG 4K3DL 4R90H 5CCHE 4TULH 2OCCB 2XN0A 4IKLA 1FLRL 4LRIC 3EIFA 4K5PA 4QGYA 1LLAA 4OD3H 1RFDH 4NWUL 1PY0A 2G75B 1D5MB 2FDBP 2JB5L 2Y1YA 3GSOB 1TNMA 3MCLL 4HBCH 4P46C 2R4SH 5DRXB 1T0PB 1AIFA 3HLKA 5E2WH 3U7AA 2DBLH 2DQGL 3CQFA 3LQZA 2IFFL 4U33A 4DGIL 5BVJA 2CRMA 1A2YA 3EJTA 1CUOA 5DZOA 3T77B 1PY9A 2AJXH 3J8F7 4N6QA 5IVZA 3UC0L 1FH2A 4JFTA 3HG1E 4NFDA 1FBIH 3PWVA 4LPYA 1U2HA 2BVPB 1NBZA 1BQHG 1V3JA 4JFDE 4JZOA 2P5EB 1RURL 4G6JH 3GNML 4WV1B 3VXRD 5HJ3B 4MNQD 3EGSA 3IE9A 3BFOA 4XCFL 4F15C 1FE8L 1A5FL 4XPTL 3WLWD 1MCWW 1BZQK 4L9DA 3U1QA 4JRXB 4HIIA 2NSMA 4XNQA 2VMDA 3AQXA 3GLZA 7PCYA 3VI3A 5KVDH 3DYOA 2B39A 2CO6A 4XZUA 2E6JA 2HKHL 3APDA 1RK0B 3O4LD 1F6LL 3UMNA 5T1LA 5K39B 3DXAB 1AG0A 5CEZE 3NFPB 3OBAA 1UJ3B 3OKMA 2VLJE 3UBXG 1XEUA 4R3SA 1ZHBB 1X5ZA 4XVJH 4P4KC 4BDVB 3P0VL 4DEPB 4FJ6A 5IW6B 5HD8C 3MRQB 4QAMB 5C07E 3EBHA 1IBZA 3MRPB 4PP1C 3DVIA 4V1DE 2VITB 2C1PA 4JDTL 3TV3L 5JYMA 5K9QG 4AIZB 5HHNB 3EYSL 2BZCA 3GC3A 5IB4A 5BOJA 1WYJA 2W07A 2JJVA 3QIBB 2FBOJ 2DAVA 2V5RA 4TVPE 1A3RL 3PP3H 3ATDA 3FO0L 5FAAA 1G7LB 1KV3A 4FFWC 4XH2A 3VGAB 5HHQB 1EGJA 4ODWA 4PLJC 4XHJD 3O0RH 3D6GA 3VXUE 1Z5HA 2QHRL 1ODUA 3DROB 4FE9A 2BM3A 4PGDA 3TJEH 3ARRA 2N1KA 3NQKA 2ADJA 4GMSL 4FQPA 1UYWH 3BD5A 3FT4A 5DJ8B 3JWNE 4NQVA 4A6YB 1T5WA 3VAEA 5DJDB 1JYNA 3D09A 5ALCL 5IB5A 3LNDA 4KTYA 4LBEB 2C5DC 4NSKB 1AQKH 3WKPA 3I6GB 4NM4L 1S5HB 4HV8A 1UXLA 2DLTA 5ANMB 2B1HH 1QYGL 3LKNA 5DA4A 5JO5A 3FT2B 4KXDA 4JY5L 5I6NA 1D7FA 2D3VA 1T1ZB 3JVGC 3DK0A 4G9DA 5CS7A 1M9WA 3C5ZB 1BJ1J 2HKFL 3GJFH 3KBHE 1IGTB 4KQ3L 1A6WL 4JG0L 4HSQA 2PCXA 4QDGA 4ZK8A 3QYCA 5INCA 1ZV9A 3B2VL 5ALBL 2C3GA 4NFCA 3VXSA 2V5TA 2PTTB 4GO9A 3O2WH 1ZE3H 1D6VH 1AZBA 4XCEB 2Q2EB 2GITA 3P4OA 2ZJSH 3QZPA 3ULUE 2GBAA 2JTDA 3HVNA 3JWDL 3CDCA 1ZXQA 3PG2A 1CDCA 2J55A 2EINB 4WLCA 3KCPA 1WZKA 2WIIA 2A4EA 2H9GA 2VMEA 1O9VA 4YR6B 2A6IA 2QMKA 3DX9B 3AROA 2XZCH 1HKLL 2CAKA 5DUMH 3ABGA 3GZQA 1AO7A 1EZSA 3LRHA 1G6RL 4XWOD 3LZLA 2OR9H 3L3OB 4F8PA 2DH3A 1SEBA 1LDPL 1LMIA 2ICES 1QKZH 3MV7D 3VB8A 3OSVA 2BCKB 4JFOB 4A7GA 2WBXA 2QDVA 4JMNA 4U1IB 2YOAA 1F3RB 2DYSB 2F15A 3AUWB 5BZWA 4PJXB 1FO0L 4LOFA 1R24B 3QJFA 4LF3A 1UWFA 1YNLL 1HE7A 2ZF8A 3ZQWA 3M8OH 3UADA 4C4KO 1XD0A 4HFUH 4ILDA 1FH5H 1WLHA 1OIOA 2AJUH 1PQZB 3T2OA 2ZWKA 3B5HA 3HCVA 3MRRB 4G83A 2XYBA 4LU5L 3M45A 3E0GA 1HXMB 1KTKE 4AGMA 3ARQA 2BIOA 3QRGH 1CS6A 3OKNA 1MCHA 1WD9A 4YSDA 4XP5H 1OAZL 4LLUA 1OL0A 3SPCA 3W0WE 3WY2A 5JORA 2P8LB 1GSKA 3CMGA 3QISA 1JAEA 4MA7H 4B9FA 5E8OA 1DFBH 1TMCB 4AITA 1KWGA 3FTGA 4YAQB 1N9PA 5GS0L 4P2AA 4WFED 5DTFB 1AMYA 1F11A 2HJLB 1UD2A 2OQJB 3HE7A 3O45B 3C6SB 4NQDD 3JVFC 4LDCA 4ZO8A 2DM2A 4YVUA 1J05B 1CQKA 4OQTL 3WN5B 7FABH 5CSZA 1J5OH 3VRIB 1AQDB 3D8MA 3HC0A 4DGUA 4F20A 3SGEH 3QEHA 5EBMB 2B08A 2WKOA 3LVTA 4GLRI 2NNAB 4Y5VA 4W68A 5AW0B 4N2AA 4NQCA 4BZYA 2BNRD 4MFHA 3VFVB 2FO4B 4J1UB 4EIUA 5JOPE 1Y18B 2HFEB 1QPXA 2IMNA 3EFFA 1RUAL 4LRNH 5IP4A 3EOTL 4Z7NF 2N59A 5I1IL 1FAKT 3N04A 5E8DL 1AH1A 3CZSA 2FNBA 3HG3A 5HGAA 2RBLA 2PW1B 1SFDA 4TSCH 1LE5A 4LCWA 2QEJA 2VN7A 2B15A 3AJ7A 3UTSA 2IAND 3HFML 5J13C 3GPSA 3HPLB 3OM3B 4PJEB 2G2RA 2NYYD 2VH5L 1QEWA 2GVYA 3L4ZA 4JZNB 4GKLA 4Z7AA 3T9WA 5J4MA 2KLSA 4MQXC 5KG9B 5DRWA 1M3JA 3QJSB 5C7XH 5E2UL 6FABH 2EZ0C 4NPYB 3HC4L 2XZZA 2JSFA 5DJ2B 2P80A 4GP8B 1TYJA 2VJ0A 1CDHA 1MHCA 5JPNB 2E7CA 4PB9L 5K1VA 1OF2B 2Q3ZA 1F6FB 1SEQL 5IM7B 2YPVA 4I8DA 4KFMA 4WKZB 4A7TA 2O4EA 1IM9A 2UWEB 3G5VB 4A2GA 3UROR 3T6VA 5KOVC 3V0VA 3S36L 1A3QA 3LEVL 1YECH 2H32H 4UMGA 5I8EA 2YQ2A 1WK0A 4ZX6A 3MPCA 3L9RB 4ABVA 5DU7A 4NUPA 1E4XH 2F5BL 2ZYSA 3C2SA 2QPSA 4Z0XA 5JHLA 4ENEC 3GRWL 3HUJB 1UCBL 4PWFA 2FHFA 3BCFA 4XN2A 4ATWA 3SO3B 5I6XC 2QSQA 4JO1L 5TPWL 3ZTJG 4KHXL 2FTAA 2WMPB 1JGDA 5L2JA 4FJYA 4K23L 4IMLA 5AKTA 5DZJA 4M1CC 3VH8B 2V3DA 4LSPL 3T4AA 2N7SA 5KYXA 3S3SA 2VDQB 3GSXB 1MRDL 1CL7I 1ZDQA 2UZIH 4PGEB 5ESAA 2FHCA 2WZPA 3O3BB 2CR0A 3F7QA 2CHZA 4QTFA 1GS8A 4MD0B 4KK8D 2H3NB 1AE6L 2QHLA 4XBPA 1DN0B 2AK1L 4TNWK 4ETQB 3R1GH 4HALA 3BZ5A 2LAGB 1YYCA 5C0ND 2VDKH 5FM5M 1M1SA 3MTXA 3DUSB 3ZT6A 4BH8B 1PX4A 1KGCE 5HHOE 5EA0L 1QNIA 2B1OA 3MJ9L 5EFIB 5E4OA 3PABA 3FB8B 2HH0H 2Y3NA 4PLOB 4BD4A 2L0DA 4POUB 5D6CB 2EC9U 1P9MC 2GBUA 2IF7A 3C6LD 4K71C 5EU4A 3BE1H 2ZIDA 1I9RL 5HYSG 3QORB 4LHUB 3EZ8A 3E6FB 1RQ5A 1KENL 4HS6A 2OK0L 5BVPH 3RU8H 5LLIC 2Y06H 1FFOA 1YEIL 4LSVL 4N0UE 1COBA 4FXGC 1U8QB 1XWVA 3V5HA 2WXLA 4JPQA 3RILA 5HDLA 4HPYH 3MLUH 5INDA 4FP8H 2EDQA 3VE0A 4QTHA 3RVUD 4M03A 1RPKA 1C08A 5DRZB 1PZCA 2XY1A 5DRNA 3W81A 4HGWB 4HWBA 4A66A 5D1QD 2PUQT 4FFTA 3IM1A 1LP9F 4X4YA 3TONA 1SRDA 2QPEB 2YN5A 3NZHH 4HOXA 4PHXA 4MAYD 3MODH 1HIML 1U8LA 1QLRB 3KDPB 1PZ2A 1N26A 3LTVA 3KDMB 3QQXA 4Z78A 1UFGA 3QCUL 3QGVA 3P30H 3BMWA 5IREA 4DZBA 4PREA 2MPVA 3GBML 4GW1B 3K4ZA 2VW4A 4IJ3B 3ZDZB 3G5ZA 5GISH 3VXRE 5F6IB 1DJSA 2APFA 4HW6A 2NY2D 4ANXA 1BOGB 5E99H 3MBWB 1I9JL 2PWFA 3V8CA 2V9QA 5DFVC 4MD4A 1UEYA 4CN6A 1FZMB 3VB9A 2G4GA 2IPTL 4KJPD 4Q74A 1KBPA 3NCBB 1N70A 1TQBC 3V10A 1O6TA 4GAYB 2VR6A 3FCTB 3BEWA 3O6FD 4XRCB 4ZFFB 2AQQA 4LEOA 2Q8AL 3RGVC 2FATH 1N5YL 2VDNB 1ET8A 4ZW6A 1FYTA 3O4LE 4JW3A 1MF2L 3EOBA 4JN1L 3CX5K 3DTDA 4PIRF 3EO1B 4NQSA 4AVHA 1IAOB 3MNVA 5FA3A 5FF6B 4QRSB 1RUMH 1BMZA 2XZAH 2LAAA 2VC2B 3HG1B 2PLTA 5B7EA 4F93B 4XC3L 3X14B 5E5MB 2DQTH 3PGFL 2AXFB 4JFDB 1IAII 5I8OH 1UZ8A 1QWHA 1EVUA 3T0EC 4CADA 2PABA 2E56A 5EIIB 1MJ7H 2R0KL 3SYCA 1H6TA 4LCUB 2R0WH 1EGJH 1KCBA 4YXHH 2X3BA 2JIXA 5I0ZA 4BIKA 3DV4B 5EEXA 3VX0A 1D9KB 4XBEL 3A67H 5ECJE 2KDGA 3N0AA 5C09D 3BLBA 4YDLB 4PY8I 5FIEA 4FKHA 5FYKL 1A6AA 4GQZA 4OFKA 5JTWA 3UTTD 1L0PA 5FYJH 2AJVL 3ARGD 3MLXH 1AKJB 4FERA 2FX9L 4XNBA 4PR5B 4M5ZL 2BY2A 4RFEB 2D2OA 1D6EA 2VLJB 3S0PA 2XCMC 1H6UA 4GFXA 1ZLDA 1KGUA 4HUXB 1MAML 4K9EH 5C07B 3VGBA 4FGMA 5JMOC 3VD7A 1PD6A 1TO5A 1P4IL 1XXFC 1B4JH 4OGYH 1N7ML 2PWEA 3RLSA 3IETA 3F85A 4P3DB 4JANA 3DNKA 1NIAA 4QD2E 5LCVL 5GZOD 2K78A 3V9FA 3RX7A 2NUPA 2OTUB 3VXUB 3EJZD 1HHJA 1GGCH 1SVBA 4FFZL 1XB6A 1JF5A 4WK4B 4TLTA 3WLBB 2BXYA 4Y2DB 3S8WA 4OLXH 3T3PB 5D71L 4Z0BL 3LEXA 4W9IC 1F18A 1HWWA 1OGAA 4J3XA 4GKOA 2V9RA 1IEBB 3R8BB 4MDJA 1IM3B 2DIEA 4LIQE 1FVCA 1CICB 3P4NB 4YWGH 3MZTA 3TH2T 3L16A 1OAUH 2DJ4A 2CJSA 2HWZH 5C8JA 1XGRA 3IBOA 3UAJC 1G7HB 3PIQA 2ZUQC 3ALWA 1Q9KB 4HIPA 3VXPB 4NBXB 3QUZA 1JJUA 1T5XB 3NDZE 1FCCA 1MNNA 2FJFB 4JQXA 4MYWB 3BKYH 2VZSA 4ZUWB 1LEIA 3H4FA 4I0PB 2VR3A 4P2OB 1ZGLB 1P5UA 2FGWH 3BDYL 3FU7A 3IN2A 4N1HB 3RPKA 2F2HA 1TMQA 2KHAA 1B0RB 1CD0A 1JPGA 4HCFA 2VISB 2J5LB 5I1KH 4GH7B 4FABH 1RIVH 1H5BA 3S3BB 2C9QA 2ZKXA 4ZUVB 4M7LL 1ED3B 4GP4B 3EHBC 4JX0A 5C2BH 1JGLH 4F33B 2HJKA 3FBQA 1ZANL 1M6OA 4N2DA 5EZJB 3ULVH 2XWBA 4PW9A 5TE6H 4APXA 4DUVA 1KB5L 3VACA 2ATKB 4LLQA 3KPQB 1E7VA 1AY1L 4XGZB 2Z1KA 4QLWA 4QHUA 2Q6WA 4JFXB 4X6EB 1ZTXL 1TPXB 4IOFD 4Q6KA 4AYEC 4F7TB 3X3FH 4G8FA 1MWAB 1HE8A 1XTLA 4Y9GA 4ESKA 5C9JA 4NQDE 4NQXB 3NBNA 3H3PL 4XB7A 1Q8MA 5LBGA 1WAPA 3FQRA 3EJSA 4KRPB 5JW4M 2LU4A 3KPNA 1MG3C 3BISA 3ILPB 3STBA 4UUJA 4L0PB 1I7ZB 2BVOB 3Q6GH 1MCPH 4K3EH 4W9LC 4E42A 2GY5A 1OLZA 2G4EA 2MOGA 3NDYE 3NYKA 4WFGD 3QDGA 1S4IA 2Y6TE 1A9BB 4GNKB 4XWGH 1OP5H 4AVIA 4WI6A 3FW6A 4J6RL 5DEFA 1MVUB 3CNKA 4LCIL 4MA3B 2W9EL 3VXMD 2BNRE 2DIJA 2EDWA 2J8UF 3TYFA 1SOKA 4YXKH 4ABUA 5F7HA 1GTFA 3QQNA 4MVBD 2BMKA 3ECBA 1U36A 2OMUB 4HKXA 1JZ6A 4NKOA 1EAPA 5LBSA 4WEBH 2GEEA 4ZMYA 4X6BA 3BAIA 2YO3A 2DTSA 3PGDA 1T1WA 4BSWB 4E9WA 1GS6X 1MIMH 4Z7NE 4B96A 1JFHA 2XOTA 3EAKA 4GRWF 4WGVB 1UXMA 3IF1B 3VFNB 4C56D 3SPJA 1ZIAA 4LHJB 5T3ZD 4ACTA 1WUNT 1RPUA 5CFAA 1MDTA 2VR8A 4L37A 3SE3A 2IANE 3FQXB 1IAKA 1F4WH 3KBEA 1P84K 3SKMA 1IC1A 4DCQA 1PG7L 2QQKL 4I3RL 1JXFA 1CE1L 3KWWA 4RMBA 3IMRA 1VSCA 4Q7DA 4PRHD 2JI2A 2R29A 3OGCB 3B7UX 4A7VA 4E41D 1AS6A 1T20A 1B0IA 5AW1B 4KDVA 1GHFH 1OB1A 4PRIA 2YPVH 4ZAKA 2AI0L 3KYMB 1TYRA 3AQZA 4R7XA 1SOSA 1OANA 5DC9B 1XZ0B 1FG9C 3BW9A 4MMXB 1FYHB 1NGYA 2NQ3A 1SPDA 2ZCZA 3MR9B 3CQQA 4JFPB 3BUQA 4X7TB 1F4YH 3KPRB 4A68A 4AMKH 2DQIL 3QNZA 5FFGA 3EGXA 1OW0A 4XBGA 3JWOL 3MRCA 5BZXA 1XIWB 2ADIA 4KFZC 1KDJA 4OLYL 4IJTA 3HG5A 3FT3A 3TBTB 4M4PA 3N41B 2OM5A 1Q0XL 5T33H 1CLZL 2NSXA 5LXGL 4YMPA 4U6HA 3TYGH 1NBQA 3ZKSD 3ROLB 4OUUA 4DEWA 1YUHB 3FQNB 3WXWL 1JCKA 1I1YA 1OQOA 4XMPH 5D7SL 2HVKA 2ZOKA 3QQ4B 2HAZA 4JRLA 2C9RA 3LRSB 4GG8B 4I77H 2H47C 5FUOL 3MJGX 4Z3JA 3FB6B 1JWMA 2D4DA 1W72H 5CZKA 5HGGS 5HI4D 2PXYA 1E67A 2X0VA 4PV8A 3ZKXC 2O26U 4BHUI 5I19H 3VWKC 4K8RD 1LEGB 3O3AB 5FYJD 3NA9L 2X1XR 3PQYB 3DGDA 5CBAB 4XPBL 1CIUA 1MQ8A 4IRSC 2N56A 4KY2A 2WWNA 5F7BA 1WWAX 3GZKA 3K5SA 3MBEA 4I18A 4D9LL 5CGMA 4L8BA 4PMEA 2J88H 2LGNA 3BSZL 1WFNA 1GPOH 4L8DB 4LSSL 1BF8A 3KPTA 3K72B 3C2AH 3BAWA 4IW4C 5FM5O 2VUKA 2BSSA 1TLKA 3QFJA 5TQ2L 5HGDB 3TF4A 4Y5YC 4PRDA 3QQDA 3B2UD 2DWEB 3MRNB 2Y5EA 3MZGB 3QFGA 2BXZA 5I0VA 5HI5C 2CO1A 1XT5A 2OTWB 3PWPE 4Q4EA 1CVRA 5LGKA 1HILB 3E9UA 1Q90A 1NC2A 2LLNA 4PJ8C 5TFSL 4YE4L 3TIDA 3BO8A 3TO2B 5T1MB 5SWQA 1VLXA 1ROWA 3HI6L 4HZLA 3WSQL 3FQYA 4ZMPA 1LP9E 1WFJA 2E8YA 1AO7D 2OJZL 5C0DB 5HHOB 3WEAA 4B3EA 4HJEA 4ERSL 3ILQD 4BH7B 2ZAGA 4JO3H 3MCKB 3RWHB 2DBJA 2EC9T 5KSAB 4U1SA 3ARBD 3SODB 5DHYB 4KK6C 4LSRL 2F8IA 1N3NA 4KKRA 2XIBA 1CXIA 4IGBD 4RA3A 3TN0C 2A74A 1XGPA 1L7TH 1SYSA 5DWPA 4ZFGL 4LGPB 4HEPA 1DTUA 1EEZB 4G1EB 1XF5A 4W4OC 3JTTB 4BFBD 1E4HA 1NOFA 4Y4HB 3WNLA 2O6PA 2XV6B 4R5VA 4FI7A 4ES9A 5F70A 1IGYB 1O6SA 3PWUA 4LL4A 3MRLB 2JFCA 5CD5C 1PZ5B 3U0PB 4JRYA 1J0IA 1AHWB 4RIRB 1A8JH 4DGVL 4YEFA 3EXJA 4BFFA 1VGEL 1MHHB 4DQOH 3TWCH 2HFFA 2K4AA 4X8XA 4L4TE 3S35H 2Z64C 5ADPL 2XIDA 4M6ML 1CL7H 1UCTA 1YCSA 5HGHA 5E2VL 5EZOH 3ZVVA 4ONFH 4XNXH 3L6FB 1OALA 5FA4B 2ZXDA 4FXKC 3ZGIA 2E7DA 3OR7B 3VFGH 2YA1A 4PTUA 2G60H 2JJWA 2BX5A 3NH7L 3X3GH 4ODTL 2XN1A 3PWLB 3EFDL 3AREC 5IB1A 4K15A 3KYOB 4XNUL 4Q97A 7CGTA 4POYA 4BHUA 2NUTB 1GYUA 4CMHC 5ADOH 4GRLC 5DQ9B 2Z91B 3D39A 2XHNA 1MLCA 2JKSA 5FW8A 5MENB 3VG0L 4GAFB 4U6YA 5CNHA 3DX4A 4RSVA 4JUTA 2DV6A 1KGYE 3O9WC 1HT6A 3UTTE 3U7WH 3OG4B 4R8WH 5EU3B 4YGVA 3CFJA 5CBEB 4Q9RL 1VZGA 2V6HA 3O4LB 3D9AL 2IO5A 4AK1A 4PW3A 4UV4L 5KSVB 4NNPH 2XVLA 1ZHNA 4JZJA 1JGUL 2KLRA 5E6IB 1KACB 4JJOA 2AS5M 4JEGB 1P4UA 3NIDF 4JFZL 1B4RA 3ABMB 2CKBL 3D0VA 4LCWD 4KWUA 3CFUA 1GYWA 1M4KA 4QWWC 1A6UH 3UTSD 3UO1H 3KLLA 1CZ8H 1HXYA 5C0CA 4JFUA 1KEGL 3UJJL 1J0KA 1DVSA 2ZSVB 2ZWZA 3MA9H 2CLRB 2IXQA 2QVKA 4YC2B 1PX8A 1ZPLA 2H1PH 2XG4B 4NRXB 3U0WL 1KXQA 3S88L 2K3HA 1CYGA 4W9DC 4R7VA 5C2UB 3WS6A 3FCUB 2VDMH 4HWEL 1B0WA 3HS8A 2DMHA 3TBYA 2IOMA 3P3SA 3QEUA 4Q8BA 3TFKC 3IDXH 3I3DA 5AG9A 5I1GL 3T4YA 1L6PA 1IBYA 4PUBH 1MN4A 4LLWB 5TGBB 2DEWX 1NGXB 1VACB 3IDYB 4KXZH 2OXGA 5CU9A 3ZHLA 1IGMH 3DO4A 5FV2A 4EKJA 1CLCA 3F7YB 1G9NC 1NGPH 1NKOA 5DZVA 3VUAA 2O6DA 1TJGH 1R3LB 2DDQH 3GHPA 2O61B 3FTYA 5A6IA 4L0YA 2NX5A 1ZWIB 1N12A 2F68X 4OQ1A 1OSPL 3BJLA 4O02B 4OJFH 3N40P 3QUYA 1E2WA 4RFNB 3WMQA 3VFPA 1OP4A 1P0SE 5HPOA 3K2UL 4AE0A 3GO1H 4PJ9B 3OJDB 2OULB 1T3FB 3RTQA 2FZ3B 1MPAH 2CK0H 4X4MA 3CHQA 5JHDA 5C08A 5GGVH 2Q86B 5ECGA 2BHYA 4L3EB 1O5DT 1Q4NX 1UXWB 1WITA 1Z9SA 2R9HD 2WZPD 2AGJL 3V6FA 3IXAB 5HDQL 3WU1A 2K7PA 2WWMC 4F7MB 4YHPB 4BYHA 1WAEA 2YA2A 4HIXH 2AJYL 3KW8A 4P0DA 3VWJA 4H40A 3EGDB 3HI1B 2QKIA 5ILTL 1H9DA 5I9QB 2KS0A 1ZT7A 4ZTPL 5ABAA 3WGVB 3MRHB 3QH3A 2R0ZL 5DZNA 1EEYA 4MWFA 2A6KA 2FCBA 3MRKA 1YY8B 2YD6A 1A1NA 1G5AA 2EEXA 1G6RB 2A9BA 2WQVA 3CN2A 2Y25A 3DSNA 1FWXA 3AU1B 1XF2B 1JF1A 1BXVA 2NNRA 5FFLA 3OZKA 1OPGH 1MW3A 1U8OA 2BS8A 1CC3A 1FO0B 3BXNB 4P5RA 2A0LD 4POZD 1DJWA 1JHKL 3OV6A 1BPLB 3P77B 3WAJA 2E7HA 3NCJL 3TV8A 3DUUB 1L7IH 3LY6A 4WUKL 4WFGE 4YN3A 3SD5A 4CJ1A 3SN6N 3FTXA 2YRBA 4Z77A 4JO4H 3W37A 2GC7C 1S3KL 1U3HC 4G2AA 4JFFE 5IHHA 4P3WA 3QHTC 2J8UE 4HX1A 5LBSH 2RHEA 2VQ1B 3OQRA 3PF2A 3O2VL 2IDSA 3PWJA 2D7MA 3UPAA 3FFCD 1H8LA 3T0EE 3O2DL 1NMBH 5DC4B 2WLLB 2F19H 5HJGA 3TC9A 4DOHB 4F15B 4ODSH 2CJTA 4C56E 4MS8C 5T3ZE 4PJHF 5EEUA 2NY6D 5GGSB 1YNKL 1P4LB 3CFNA 4K5LA 4NNYB 1J0ZA 5J06A 1FF5A 4WW2C 5EOQH 3ZQ9A 3DTXB 3TIEB 4MXWH 5IMLB 3SDYL 3GHBL 4XMWA 2CU9A 2R29H 2YC1B 3DRQA 4PRHE 1DQDL 4ZG1A 4OLZH 1BX2A 1RUPL 4E41E 2F53A 4MA8L 4AT6A 3TURA 4IM8A 3PAYA 1U8JB 2BNRB 4QXUH 1ZHKA 2YARA 3M1BB 2YD5A 5DEZA 43CAA 1X7SA 3QIUC 4G42A 4NXKA 4OM1H 3BZEB 1S8DA 4P4KB 4WNSA 2C7UA 2HRPL 5H37A 1HEZB 3EFOA 1UGNA 4YHKH 4YHZL 1INQA 4M7KH 5J5EA 3WHXA 3GKWH 4OJDH 4Y8AA 3GSNB 4NBYB 4LCCA 4HFWA 4MJ4A 2IFGA 4P9MH 2XWRA 1CXEA 3MRJA 4AEHL 3V0WH 2C4FU 5L4FA 3D51A 2DIBA 3N9GL 3H8NA 5D7IA 5KVMC 1LWJA 3CFCH 4J4PD 5IHZB 3TVMA 5L7XH 4D9RD 2IANB 4PJ6A 5L9DH 3JUZA 3IU3A 2WN3A 2VDPB 1O9WA 3P2TA 5LGHL 1FFRA 1OARL 2Q76A 3WEXB 4K5NA 2QPUA 4JCLA 1PVHA 2ICWI 2OMVA 2X6UA 3RWDA 5MEQA 4H8WH 3LHPL 4Q2ZA 2E5EA 4RGNC 3SDCC 3ZO0A 5CM1A 2G5BA 3CXDH 1G4RA 4YBQD 1BD2E 1WIOA 3SE4A 3F58L 1UB6B 1F4XH 4CW1B 3LPWA 2JIXD 1E6OL 4IOSA 5IQ7L 3EOAB 5TQ0H 5KYUA 3BP4A 3K1DA 3HZVB 3M86A 5FCSH 2LTQC 2XPGA 4R9HA 3FO1A 3I6SA 3OZ9L 4UT7H 2A9ML 3DX7A 2CHWA 2IAMC 4FHBD 5DVNA 3REWA 5IROA 2X4OA 4PTTA 1HHIB 1CIDA 4FRWA 5HVFB 3NJXA 3THML 4IRJD 4W6YB 3U9UB 2VZVA 2XTJD 3QXWA 5GGRA 3CTTA 2GSMB 4M62L 5BQ7A 3OKOA 3G5YB 1OF0A 4GJTB 1DQKA 1NCUA 4PG2C 2Q87A 1BW8A 3INUL 3FQ2A 4WCYH 1KY7A 1TFHA 3B6SB 4L48A 3N1GC 4JDZA 3CV5A 2NCEA 1PDKB 3HC3H 5FFOA 4GS7B 2NLJA 3FQ4A 2EDFA 4UV7L 2WTRB 1LYQA 3G3LA 1SM3H 1FGVL 4WI2A 5IV2A 5J6HB 2P3YA 4PJ7F 2A6DA 4Y4FA 2EYTA 2PTVA 2JQMA 4YK4C 4UTAH 2UYLA 1DBML 3G5XA 4HS3A 5G5DB 3TO4A 3VXNB 4HS8L 4NUGL 1TVHB 1ZSDB 3T65B 1IC5L 2Z0UA 3WS3A 4UTCA 1GYCA 1OGAD 3VSTA 1C5CH 4QPEA 4BKLA 4IBUA 2YGVA 3F2LA 3KH3A 2C3XA 1OY3B 3GXFA 4Z23A 2DH2A 5B8CC 5IFJB 5A40E 1VPOL 4F3FA 2CDEB 1XGQA 4QJ5B 5I28A 4AYBA 3U25A 3BKMH 3HOGA 1KCUL 3OHXA 3G9AB 5B38B 3KNBA 3V6ZA 5JW4Q 5GJSH 3N1FC 1UQSA 2JKWA 1JXKA 4IBZA 1WEJL 3EUDA 1CXLA 3WKQA 1J9QA 1ZT1B 2NW3B 1PLGL 4P5SA 3PWPB 2LFGA 3FH5A 2Y2TA 5DHEA 1OSZB 2WZ0A 2P5WA 3ARFC 3FFDB 1GIGH 4QCIB 1XGYL 4BV1A 3O4OB 4UIMA 1MCFA 2ICWA 4ZPTA 1CMOA 1A65A 3QXDB 3WFHB 4AJYV 1SOXA 1RI8A 2XQBH 1B3JA 1HQ4A 3GMLB 1BF2A 3S96B 4GQ9H 3S5LA 5KUKA 2X6BA 4XOCA 3RIAF 2ARJB 2HLFC 1ML0A 2Y7SA 1QHQA 3JV6B 4XNMA 4IEFB 1JGVH 3RY6C 3BVTA 4U2ZA 4G8AC 1SXSA 3ALXA 1JK8B 2R2BA 3AG3B 5DUBB 1OP3K 3NJLA 3VFRB 2ZKYA 3OF6A 4UOZA 1I8KB 1AZZC 3QDGD 2EH8L 4RQQB 2YGQA 1QBLL 4DUXA 3V52H 1GC1H 3M17B 3SZ6A 1GXEA 3FOLA 2AEWA 1Q9LB 2EDRA 4RMUA 4RMVA 3QG6B 3O6FB 1UADC 2XV0A 5J13B 4FG6C 1AAJA 2CUAA 5JNYB 3RVVD 3SQOH 5BS0E 4JFWA 3GS0A 4TNVK 2VDLH 4JJ5B 4UQ9A 1QI4A 2ADFH 2PYED 5D1ZD 2NTFA 4L4TB 3R7QA 3VFTB 4M6OL 5CKAA 2PCFB 1MFBL 5FHAL 2FD6L 3LN4B 2ERJC 3NIDE 4AIOA 5CKGA 2X2IA 4IU3A 3O6LL 3IJYB 2XA3A 1PW3A 1H0DA 4TL5A 5LGJA 4BZ2A 1T22B 3FO2A 3IPBA 4JFYA 2B1AH 4G7YL 5FOBB 1EMTL 3E38A 3GLDA 2BVEA 4NHCL 2ZYRA 1QR1B 3IEAA 1PMYA 4JCMA 3DIDA 4YHNA 1INEL 4N2EA 1A47A 1OZTG 2KZKA 3DKHA 4G9FB 2DTMH 2W92A 1IEAA 2VL5B 3IPFA 4ZAKD 2IJ0C 3SQBA 1RV6X 3VGFA 3CBKB 5FCUH 4QYOA 2JE8A 5I6XB 3HBGA 3ARGB 3WIIL 3MLWL 3KR3H 1JV5A 4HQQH 1J1PH 2VWEC 4HWZB 2WXGA 3UEZA 2GJ6B 1KSRA 4PJDF 2H0EA 4LCYB 3Q44A 2H2PD 5J6GB 3FUJA 2V8MA 3BWZA 4PVMA 2EUZA 1C8PA 3MUHL 3CSFA 3CC5B 1A7QH 3F83A 4N5UA 2EXWC 4CVUA 5D7KD 1JPST 4YUEH 4OD1L 5I1EH 1H3PH 1CLOH 2HT2C 2MMXA 1XFPA 1GL4B 4HKJB 3CSGA 2FR4B 3ZKND 2EEBA 3GMNA 4L1SA 4W93A 2CRYA 4HG4K 4FJZA 4HDIA 1YSOA 5DK0B 4N24A 1KYOJ 4PPTA 4JKNA 2O30A 1WSST 3QC6X 2AK4D 3V4LA 4I85A 1RK1A 3H2PA 4G71B 1ETZA 3RKDC 2NY0D 4P5MA 3LPPA 5DYOA 3WJJA 4D8PA 1ETJA 4K71B 1W2KT 5EPMB 2PXYD 5EBLA 3S36X 2VMJA 3CFDA 5I66A 4IIQC 2J43A 4A2LA 4JHWL 5JMRA 1XR8A 4G59C 4HUNB 4FXGB 4X7FC 1F6AA 1G7QA 3IMUA 4Y16A 3M46A 4OZIB 4CMMB 4L2YA 3MLYL 4LLYA 1L6XA 9CGTA 1C5BH 1RP8A 3ZMEA 2DWXA 2EXTA 3FB5B 1FNHA 2J6EL 3RKPA 3KGSA 1I3RB 4WI7A 1BZ9B 1DYZA 3WFCL 4IU2B 5EZLB 3FUDA 2YSSB 5F3BB 1PKOA 4LLAA 1V55B 2QVTA 1YMMA 4YDIH 4U1HB 3EF7A 4UF7C 1DN2A 1K8DA 3MGOB 4NC2B 3ARDA 5H8DA 1ET5A 1KEMH 2OR7A 4HK3J 5GS2H 4NP4H 2VIRA 3QUXC 1J0JA 2IADA 1U93B 5DCCA 3UG4A 1KJVA 4DP7X 4DVRH 1DQTA 5IG7B 1LK3L 1KB5B 1QRNE 3AB0C 3ZR5A 3MCG1 5IUCA 1X5KA 4LSTL 1G1CA 1RIUH 4NUJB 1FHGA 1S7QB 3OTTA 4WUUA 1YO4A 1EEQA 2RAMA 1AD9A 4DAGH 1QR4A 4PJHE 2DLEA 3SDDD 1YPZF 2X4UA 5B4MD 1TJHL 3ETBJ 4HH9A 1SHSA 5IGXH 4FZ8L 2PWGA 4YJZL 2WINB 1L9SA 2AABH 2VW6A 2HTKD 3CLFH 4FQLL 4G3YH 4FCAA 2KZWA 4HXAL 1E50A 4N87A 4O2CB 5HTSA 4FEMA 4EN2A 3BOVA 2OMZB 5IVOA 2V9TA 1Z5LA 1NBVH 4D0BB 2KZBA 5DO2D 5K9KB 1A6VL 4JFFB 1KUMA 1KYFA 4N8CL 1I85A 2Z8SA 4DH2A 2IDUA 3T1FA 3QULB 5T1DH 4MJ6B 2J8UB 4UU9B 5BV7H 2R15A 4HXBH 2B0SH 3IAQA 3N43B 5F71A 3DURB 2WUBL 4PJAF 3R8QA 4OZFA 5FEBA 1XCTA 1LNUB 3Q2LA 2NW2A 3T0EB 2D3LA 2DQEL 1ICTA 5IR1A 5JIMA 1PZBA 3GSWA 4KJYB 2VXTL 5A1AA 5B1BB 1QSFD 1ERNA 1T21A 3GT6A 3RFZA 4KX7A 2F58L 1ZE3C 2PKDA 4D9RE 1YMHA 4QXGL 3OZLA 3WL9B 2V5SA 4ADGA 4AV4A 5JW5A 2VXQH 4CBPA 4JPKH 1LGVA 1KCVH 1N0LA 1F1GA 4QRPA 2XICA 4X83A 2K3TA 3M07A 5A7EA 3IFNL 3OKYA 4LASL 4E41B 2UXVA 1FHNA 1Y7VA 2D7TH 4XMLH 3K71A 4YOKA 4LDEB 1PKQE 2HT3C 2EABA 1SYVA 2YOCA 4XXWC 1CI3M 1GZPA 2QQQA 1CGXA 4N90E 3D39D 1S7TA 1DQQA 4P5TD 1JTPA 3D2UB 4FMKA 1TJMA 2IH9A 4EO5A 1JI1A 3A6CL 4FAAB 4NS0A 4TULL 3P73A 1JZIA 1U91B 3B1UA 3EYQD 4XN7A 2A1WL 3OX8B 4OD3L 1RFDL 5IEKA 3VD4A 2X6CA 2X3CA 3QUMH 4UQ2B 4YGAB 2C4FT 1KJMA 4QJ3B 5FYKU 4NRZA 5EUOE 2R4SL 4L3FA 1Z9PA 2HPTA 4MNGE 2DBLL 3PXHA 2XRAL 3CSYA 1S7VA 1UATA 3O11B 2X0WA 3SB3A 2AJXL 5C0CD 1DVFA 2GJZA 4LLMB 4R6UA 5CMAB 4XXCA 4BM7A 4GRMA 1IC0A 3BGAA 2GT9B 1RP9A 5IF0B 4JVWA 3GTTA 2IQAA 3CLEH 3FTUA 1BD2B 1HHKA 4G6JL 1IGCH 2HX7A 3QJXA 2ZUQB 3TGXA 4MB1A 3F6IA 3BP6A 4FNSA 5FO9A 3BYYA 4PJ7E 4PJIF 5HHMB 1HH9A 3TBWA 5KVGH 4LBAA 4HP5A 1I8UA 4HMDA 3B9KC 4GXFA 3RQ3A 3KL0A 3FO9A 3AQYA 1F97A 4LVNC 4CVZB 3H0TB 3LKQA 1DVZA 2JKXA 1E8ZA 1AGFB 4TUJA 5J3HC 4WO4C 4UM9B 4WQOA 5C0JB 3PGCB 1TVBB 3LZFL 5JIQA 4OJEH 5IK3A 4K4KA 1ZIBA 2RACA 4HEPG 2F5AL 2BNUA 4MASA 4WTXA 3VI4B 4XVJL 4CNIB 4U3SB 3EHBB 1E8XA 1QPKA 4MQ7A 1N64H 3SGKA 3KPSD 3PV6B 5E9NA 4FQXD 3UTPD 2I9TA 4DK5A 2HN7A 5TDPA 4IBLT 5KJ4A 3TZVA 3WO4C 1NPNA 3MREA 2DL9A 3ZDWA 1HINH 3PY9A 5J11C 1I1AC 3IPEA 5DJCA 2EDNA 5C08D 1QTSA 4AQOA 4F1ZA 2CIKA 2JK5A 2VLLB 3E9TA 4LKXB 5I76A 3D85B 5FB8A 4H44C 1IT9H 3O0RL 4JKWA 5C0EA 2Z31C 1FNLA 1BHGA 2FEEI 1NWOA 2ALWA 5T8IA 2ZG1A 3QXUA 3TJEL 3TPUA 4L5FE 3BPCA 4NC1C 4UT6A 1KIUB 1WFUA 5A2JH 3C5SB 3C9NA 3H9SD 4QRUA 2PF6A 1FVEB 3FZUD 1AKPA 2PETA 2L7EA 5C6TH 3VA6A 4IBTA 2RTTA 1HS6A 2R1XB 5C3LD 3HZKB 1U95B 4DTGH 2VR5A 3B43A 2B1HL 3QSKB 1UM5L 1DR9A 2P9RA 4NJ9H 3UO8B 3FQTA 2IG2H 4IGBB 4XI5D 1TTUA 3D5OF 2YZ1A 1ND0A 3I75B 3SOTA 2ESVA 3L5HA 4EI5A 5H35B 4AV0A 1DVQA 3BGMA 2JKLA 3SDXA 4L29A 4AKQA 1JXGA 2WB7A 3KM2A 1DJIA 4J2QA 3V4UH 4BELD 1P5VB 1RLBA 2D03H 4NUMA 1Q9WB 2G3ZA 4P9HL 3O2WL 2LE9A 2EDBA 2ITDA 2NR6C 3L5IA 3WNPA 1XAUA 3FQUB 2V2WB 3I9GL 1CF1A 1HSAA 4N8VA 2ZJSL 3CGTA 5IOKA 3AUVA 3SKJL 1YNTA 1DUZA 3SBWA 3ZTDC 4HD5A 1DE4B 3QARA 2CDGB 1ORQA 3ZX1A 5IW1A 5DUPH 5I6KA 5I23A 4NQEE 1L9QA 1GGYA 2PYEE 3S3PA 4MMYB 1J10A 3MA7A 5BRZE 1D5BB 3PFQA 4H25A 3D25B 4CSPA 4RGNE 2FIKA 5DUML 2QADD 1G9MH 3BH9B 3STZB 5KYYA 3FB7A 4AEFA 4GY4A 4NENA 1M6UA 5H2BA 2OR9L 5AZEL 4PD4K 1ET7A 4K7PH 2G3MA 2J25A 1MVYA 3SY6A 1QKZL 2XN9A 4YIQA 4BZ2H 4G6FD 4PRPA 3V7AG 1E65A 4EI0A 2NT0A 4R2GD 4ICWA 4IOIA 4H1LA 1AIZA 3EBIA 4RBPK 2MFNA 2F53D 1KT2A 4JM2A 3FUFA 3MACH 4WU5B 5FUZH 5FYLD 2HVJA 3M8OL 3QZWB 2HUHA 4EN3A 1NC4B 5JDSA 2AAVA 4HFUL 1BM7A 1FH5L 1DBJH 3F7VA 4JUSA 5IJCC 3LV3A 3RNKB 3Q01A 5BS0B 1FLRH 4N5ED 3SKOB 3IFOA 4LLDB 1T83A 4KBPA 3Q43A 3QRGL 3BQUD 3P40A 3HE6C 3RIFF 5JDJA 2NXZC 4PJDE 4O58H 2J20A 4H0IA 1W15A 2A83B 5I71B 4BQ9A 2YQGA 2DKMA 4Y2OB 2PCPA 2BERA 2OTPA 2C26A 2AXGB 5F3HA 2ODHA 4YL9A 2EE9A 1DCLA 1F90H 4OZGF 1PG7X 3UC0H 3UXFA 1EJ6A 3ZKXB 4I4WB 3VWKB 4B9YA 3FXIC 4OFDA 1SJMA 2FX7L 3QJVB 1KTLA 2AJSH 2EICA 3LNIA 4L9LB 4B97A 5BXFB 7FABL 3N40F 1J5OL 4FOMA 1FZOA 1H3UA 2A4CA 4GOSA 4XCFH 1OK0A 4MCZA 4NZFA 5CGTA 4IOSD 4HJGA 3NN8A 4X5WA 2R1WA 1P2CA 1PZAA 1TKWA 1K9TA 1HK6A 2YPKA 4FFYA 3HN3A 4H5SB 2VZ1A 3AQDA 3LKRB 3OXRA 2D7OA 3IVKA 4X4XB 1ZDSA 4NKQB 43C9B 4GUPA 1W0VB 3DK2A 5L4JA 1CFVL 4F8TA 4DGYL 4KK5D 4X7EC 1BXAA 4NPKA 3LZRA 5IHBA 5K1NA 4U1NB 1BCIA 2RJMA 1T0OA 2X40A 4YHLL 1M2OA 4IIZA 3MU3A 1J8RA 1MCRA 4TSCL 5DRXA 4YHOL 4AG4H 5DMKB 3C75A 4UMSA 4GKSB 3VMPA 4HHAA 2DQFB 2Y07H 3GLEA 3T77A 1BBJB 3DBSA 3OLIA 1BZOA 1JL8A 4AKOA 5MEOB 4UCFA 4WTQA 2PCYA 1NGWB 3D4CA 4DGWC 6PAZA 3OG6B 5C7XL 1ES0B 4UBDD 2R2EB 3RWFB 3DRTB 6FABL 2VW7A 3OAZK 2P5EA 3QC5X 4L8SC 4ZDHB 5FO8B 3ORJA 4A2EA 3A24A 5HJ3A 5F7DA 4GG6A 2GK0A 1BLNB 1MWOA 4HH8A 2R2HB 5C0IB 2QSVA 3UTQA 3JZ7A 2WKGA 2XWTB 4GMSH 2YBGA 4KJWD 4WNQB 3QR1A 2I9LB 3SQRA 3TN0B 5E5RB 4PRAA 1HZHL 2O93L 1AYRA 5E9DD 4AGQA 1YECL 1YY9D 5C0AA 4X42A 2LU7A 5KSBB 2XACC 5KEZA 1QWNA 2G0KA 3BPLC 2OZ4A 1QYGH 2X9WA 1E4XL 4LB8A 1X5HA 3RL2B 4X50A 5IQMA 3G04B 3BRFA 4G80A 4JY5H 1I8IB 4W6WB 1UJ3A 1DQLL 3SE8H 3T8MA 3L8QA 5D1XA 3DVNB 3V0EA 1YPZE 2HRHA 2HKFH 4V2CB 5DJZA 4FLSA 1A6WH 5H37G 4EUPA 1T0NB 5F7AA 3S3DB 3MRPA 3B2VH 1DANU 1U8KB 3AADB 3D69A 4Y4KD 4OCWL 5ALBH 1MCIA 4AIZA 5HHNA 4ZMLA 1TJIL 1TNNA 1J5CA 3QIBA 4LOUC 5LCVA 4MJ5A 2YD9A 2UZIL 4Z95L 1FA4A 1OT2A 1G7LA 2WQSA 4K9EC 3KEDA 2P5WD 4KDTA 2RIKA 4OZFH 5KVFH 3L4WA 1GGTA 3AREB 1T1YB 5DQJB 3WFDH 3DROA 3O6ML 4P2RD 1QRNB 5DJXA 4PJAE 4KROC 3VG9C 2JXMB 3MUGB 4P4RA 2WLIA 3T6ZA 1QSFE 4CMHB 4GRLB 1ZHLB 1D5XB 2IH8A 2VDKL 4NKIL 5DJ8A 4Z76B 1ASQA 4A6YA 1IKNA 5DJDA 5I73C 2WNXA 4D2NA 1I82A 2CLVB 4LBEA 2NRDA 2VZ3A 1LDPH 4NSKA 4AM0A 1A4AA 2CUHA 3I6GA 5AVQB 1KB3A 2V2TB 3U4KA 2HH0L 4BKTC 2WOBA 3EBAA 4NOBA 5F96H 4ADIA 5IFHL 2DW5A 1JTTA 5D2LA 4OFQA 2E0PA 4XX5A 4XCCH 3BE1L 1T1ZA 3KLQA 2BSTA 4ZUUB 3C5ZA 1YNLH 5BVPL 3RU8L 1CYXA 2Y06L 4X8JA 2ED6A 3IDIB 4U7MA 5DVOA 4LKCB 2IDCA 4JB9L 5F7WC 1QSED 4AW7A 1SJXA 4P2QD 3WE6B 3FAWA 4HPYL 3MLUL 1MEXL 3SY0B 3BUBA 3UPRB 3ARSA 4L4JA 1XEDA 2DQCL 1XVSA 4FTVD 4ZNCD 3DIFB 3BN9D 1R5WB 3KE0A 3LDBC 5HDBF 4D0DB 5FK9B 1Y0LB 4QHMA 3CUPB 4YR6A 3DX9A 4Y8DC 3TP4A 5DXWA 2BHFA 4WI5A 5GJTL 3B7YA 3MODL 3ZHDA 1NM4A 1MCKA 5IUSA 4IRZA 4UOJA 3AXIA 5GS0H 2OYMA 3P30L 3ESNA 2J71A 4OFVA 1M2VB 2G3XA 3GSQA 4A63A 5HYJB 2YAEA 1KIQA 3LB6D 3E8UH 2BCKA 1CFSA 3ULVC 1MHPH 4KK9D 4BSJA 4OQTH 1RHFA 1SUHA 3NESA 1NIEA 3S97C 2VLRA 4PJXA 5GISL 3BAEH 4BFJA 2WSDA 4N2FA 3BPOC 1OPOA 3CSPA 4TPRH 4DHLA 3ESUF 1MZYA 5K9JL 2AF2A 3DHUA 1WG3A 5E99L 5E8PA 1IZKA 1NWPA 2TSBA 1YYMH 2OP4H 1EIBA 3WKYA 5F9JB 2UXGA 3AU0A 3HE7C 1NDTA 4TRPH 4YLCA 1CFNB 4APQD 1ZVSB 4U3CA 2A6JB 3BP5B 5HI3D 5KVDE 2ATAA 3EOTH 3MRRA 2CRIA 2ZOLA 2YD8A 5I1IH 2FATL 4PSRA 4XNYL 1J87A 1HXMA 3CDZA 4KUZH 4MJIE 4QRRD 2XIIA 4XNAA 5EUOB 3ZSSA 1XGUB 4MNGB 4Y5VC 1IBDA 4LARH 1U8PA 4R0LA 1KV7A 4N2HA 4FYRA 2YAMA 1FL5B 2I24N 1E90A 1RUML 4HK0A 1SMDA 2V7HB 4H8PA 3QWQB 3U30C 3KPSE 4TTDC 1X5XA 3UTPE 1S7UB 4CRPA 1R3HB 1S7XB 2MCMA 2WYIA 2VH5H 2DQTL 2I85A 5IJBC 2B20A 3C5JA 1JNNH 2PW2A 1MG2C 1NUNB 2HJLA 3O45A 5DTFA 2HTLD 3C6SA 5AVUB 1MJ7L 1XF4B 1J05A 2R0WL 2QQNL 1EGJL 2BP8B 1GOGA 1AQDA 1BQHB 1REIA 4YXHL 4ZX4A 4WU7B 1UTDA 2NY1D 4WI0B 3VO0A 1C9SA 1NLDL 5D70H 5EBMA 1HYRC 3A67L 1HESA 3IKKA 2V17H 1WA1X 4ONGL 3VFVA 3D1MC 1RZIA 3H9SE 4JDVB 3S36H 3LEVH 1PZDA 5FYJL 3QWRA 3MLXL 1Y18A 4X0KB 4Z7UA 3U82B 4FG2A 4JKLA 1ZV2A 2YKKA 3K46A 2Z7WA 1U3HB 4Y16D 8FABA 3ZGHA 1XL4A 1GOHA 2F5BH 3BZFB 3WD5L 5JW4N 1RZQA 3S6CA 3UBFA 4KZCA 5CGYC 3MBXL 3DMMA 4YSSA 1QASA 4K9EL 3VRLF 3MC0A 3EDKA 2XQ0A 4JO1H 5F7YC 1QQDB 1OGPA 1PTZA 1QABA 3KVPA 3BWAB 3CH1B 4HIHB 4YX2H 5HPMA 5M94B 4DZ8A 2X4SB 5I18H 4PJEA 1WO2A 4JZNA 4K23H 4LSPH 2YLKA 5IMKA 5KN5B 5KG9A 2FT6A 2PPDA 3CVIL 3LSOB 4L4VD 5CWSB 3ZYZA 5AVXB 4KPHL 1MRDH 3CVCA 3VQ1C 4KKQA 3QR0A 2QGCA 4NPYA 5FECB 2J1ZA 5B22A 4WW2B 1HL9A 2J3SA 3CDGB 5CZXC 1JZ2A 2FWUA 2J57A 1J8KA 2I69A 5JPNA 1AE6H 1R3JB 2AK1H 4CN1A 2VSCA 2HX8A 3GBLA 4ANKA 5IM7A 4M7LT 2EVIA 4KHTH 1B4LA 1EERB 2UWEA 4FKKA 3T4AC 4WK0B 3LKPB 4YWGL 5KS9F 4KKLD 4H2AA 2C7FA 3L1OH 1OAUL 5CO1A 1NMCC 1YEDB 4YDJB 3FSOA 1SBSL 5KOMC 3NSDA 2R9HC 1KG0B 4AL8L 4FLRA 5K33A 3GMOB 3L9RA 3VCLB 5BRPA 2AXWA 3FRUB 3BSZA 4H1LH 4R7DB 2B4CH 4E9RA 1RJZA 3HUJA 1FFPB 3BKYL 4XXDB 1JXDA 2W38A 4J8RA 5I1AB 1KENH 4ODXA 2OK0H 2WVVB 4RISH 2FGWL 3AWFA 5FYLE 5EH1A 3TS8A 4DN3L 1UD4A 5I1KL 1RIVL 5ACLA 4JBSA 2C3HA 3DJTA 1AFVH 1C5DB 5J9PA 2FO1A 4B60A 3RWIA 3T2NL 4NQEB 2PYEB 3O3DB 4MD0A 4DP2X 5BRZB 4B5EA 4OKVB 3ULVL 3C60D 3PHQB 2BNQE 1DN0A 5A16A 1CFTB 4RGNB 3SDCB 2EE0A 4MBOA 4ETQA 5E6RB 2GTWB 3I02A 2E59A 2DB8A 2WNGA 1MH5A 1E4KA 1HIMH 3MNMA 3QEQB 4G5ZH 3NJVA 3W9EB 3DUSA 4HJSA 5F1IB 4PM1A 2LTQB 5H4YA 3X3FL 4G6KH 5EFIA 1JD9A 3FB8A 4QOKE 4ZUSB 2IAMB 2UZXB 5D6CA 4BK4A 3CHPA 2FJGA 1I31A 4S1RH 3CZFA 3ZN6A 2YD4A 1MCPL 4GPVA 4QGTA 1GJIA 3QORA 4Y1AA 4LHUA 2CKNA 1N6VA 1I9JH 1OT1A 3GRBA 4PLKC 4WJ5B 2CMRH 5EN2A 3F6LA 1GZQB 3MGTB 4D8OA 4X6CF 5EC1B 1U8QA 4YXKL 5EU6B 1AZUA 4GEJA 2IDQA 5C97A 5I0DA 3MV11 3VDBA 5GSVB 4S1QL 3TPKA 2WXHA 4WEBL 2Q8AH 4KTGA 5DJ6B 1JNHA 3R19A 4PJDB 2WQRA 1WC7A 3PL6A 3SCMC 1MIML 4C55A 3LXUX 1WCBA 3ES6A 1K4CB 1DHKA 1YEFL 2WXJA 4LNVA 4YK4B 4KI1A 3II2A 3V4VB 5A2AA 5D93C 5CJXA 4OI8A 1CBVH 4NKMA 1KPUB 4XC3H 2PO6A 1EO8L 1QLRA 1F4WL 2WLHA 1DVFD 2JQZA 4K3GA 1WZ1H 3KLHC 2YPLD 3IXTB 3BEVB 4GW1A 4AOFA 5B8CB 5CD3B 3FTSA 4HKBB 3GUTB 1RJLA 1UACL 4E5XA 5IBUG 1USQA 2FQDA 3IDGB 5ERWB 1HYSC 3I85A 2BP3A 1GHFL 4YLBA 4XBEH 3B2MA 5DMYA 2YPVL 4JAMB 5DT1L 1CD1B 2HG0A 3KYKH 4YBLC 1FZMA 4OLUH 2AJVH 2DM3A 2EDLA 5E9DE 3VGEA 3MV8D 4BINA 2FX9H 1WRFA 4M5ZH 4QRBA 1G0XA 2V4LA 4XRCA 2OMWB 4G43A 4L2LA 3JYCA 4AMKL 5JHLL 3K6DA 3EO1A 4KV5F 3LH8A 1IAOA 4YDNA 5FF6A 1NEPA 5K5YA 1G7PB 1GGUA 3ARFB 4QRSA 3VSUA 1NFDF 1NMAL 1KTRL 1P4IH 4EUPH 3CVBA 4NYLA 5T33L 4HLZH 2Q2LA 1N7MH 35C8L 4LGRB 3TYGL 5BOPA 1NSNH 4HBQA 5DJAA 5EBWB 4JFDA 2R59A 2X4NB 2XXCB 3FCSA 1HSBB 3OKEB 5LCVH 4OZFG 1WT5C 2J4WH 3EYFB 3LD8C 4OBSA 4FNRA 2P42B 4XMPL 3X2QB 3QCVH 4KH9A 5ISZD 2CO7B 3N1PC 1KYUA 3HB3D 4ZSOB 4M93C 1EZUA