1TEYA

Nmr structure of human histone chaperone, asf1a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
156
structure length
156
Chain Sequence
b'MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASF1 anti-silencing function 1 homolog A
publication title Structural basis for the interaction of Asf1 with histone H3 and its functional implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 28
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 1teyA00
2DZEA 2YGVA 5EIIG 3AADB 5BO0D 5C3IA 2I32A 2HUEA 2Z34A 2IO5A 1ROCA 4EO5A 4RRPM 5BNXD 2IDCA 2Z3FA 2IIJA 2CU9A 4ZBJA 1TEYA 1WG3A
chains in the Genus database with same CATH superfamily
4JFFD 1A4KB 2EDYA 5CILH 2VL5B 4U6VL 1TLKA 2VM9A 4A37A 2D3LA 4PJ8C 4FTVB 4P23D 4RSVA 5FYJU 3OZ9H 1N12A 4Y2DD 4KNUA 2ZUXA 2VN6A 3WXVH 4XMLL 4QNPE 1DUZA 2HTLD 3KZ8A 1PX8A 4L8CA 5HHXL 3HFMH 4F8OA 3LQAH 1MLBB 1AIFA 2NQ3A 4GJTB 4ZSOB 5CEYB 5C0FA 1HJCA 3T0ED 3LVTA 5IB5A 1BD2A 1IBGL 15C8L 3VVVA 4DK5A 5E2VL 2AQTA 4MA7L 4K5MA 4R6UA 1P84J 1PSKL 4LPWA 1XD0A 4P3CH 5JPMB 3REWB 3FO0L 4JFZL 4NGHL 5CCKL 3CIQA 1ZT7B 3KBFA 4BUQA 3N41B 2WW8A 2OJEA 1PZSA 4OIBA 4RMBA 3EBAA 5I1HL 4K23H 1JGVL 1GYVA 2C4FU 5E9AA 5D7JD 5IUCA 4H1LH 2G2RA 1DVSA 5BZDB 3KPNB 2BNRB 2WBKA 4OLWH 3MOAH 4EN2A 3GFUA 5DRWA 1B90A 2HT2D 1X5HA 3VFSB 4KZEL 3AG2B 3VXMD 4CILA 1MDTA 4KROC 2DM3A 2XKUA 3DJSA 1E6OL 1BHGA 2EE6A 4LNRA 3MA7B 2EH7L 2J8UE 4PRIA 3ARWA 5GGTL 5FYKD 2GTWA 1CT8B 2VDMH 5DZPA 1C7SA 1VFAA 4Z7VF 4Y5YB 4YHML 2JCWA 1KTDB 4CADA 5D4IA 2VDPL 2RTTA 2PCFB 1XB8A 3JUYA 5C0ND 1H3XA 1XCQA 2ZWNA 4RMUA 5TQ0H 3RVUC 3JTSB 4Y5VA 5IVZA 1OAUL 5FF6B 3GXFA 4R3SB 2B08A 4GBXD 2QSQA 1P7QD 3G6DL 4L4VE 4I0KA 1RK7A 1YUKB 1T5WA 4IQHA 1EDQA 4G6KL 1Z9NA 3BH9B 1CDGA 3FUEA 5DGRA 1TNNA 5HHVL 4M1CC 2XWBA 1P7KB 2E7MA 3T8VA 1OSPH 1U3NA 3C60A 3IDYC 3K2IA 1NANI 4QXWA 3UJIH 5KYXA 4O00A 1K8IA 1JIBA 2AKRB 2C26A 4LHQB 2VDLB 5GGVL 5F6HI 1IKNC 1IGTB 1R3KB 2XSKA 4NWUL 4TOYL 5HDLA 5DEGA 5E00A 1QFWI 3AT8A 3B9KD 5AVZB 4G6AC 4ZTPH 1F5WA 2JKTM 4NUGH 4HCGA 4RIRA 4A39A 3VWJA 1KTLA 3G5ZA 3MLPA 1LEKA 4BDVB 1CWVA 1NEZA 2X0UA 2PETA 3IJHB 4JREC 5IBUB 3SE9L 5I1AB 2AJZB 3C2SA 3KGUA 2AFNA 3CVCA 5EU6A 5IG7A 1A9VA 2HCZX 2GYSA 5E70A 3GSWB 1X7QA 1G7IA 1T2JA 4I3GA 2AJXL 4IU2B 3IBEA 1BQHA 4TS6A 3LXAA 3FO2A 1E67A 3LNIA 2Y5EA 1RK1B 2L7QA 3DTUB 2Q76B 1C08B 1Q72H 4ZFOB 3IGAA 4RZCB 3K2UH 2HRPH 3U0TB 4AYFA 3VU1A 1SOXA 2NXZC 1BIIA 2QLYA 4U31A 1U8IA 4HUUB 3S35L 4E41D 1PLCA 1X5AA 2AEPH 2R2EA 3QE5A 4R2GC 4W9EC 3OKKA 5GGSB 2FR4B 3PL6A 4X99B 1AP2A 4DW2H 2UWEA 3MRDA 3SOBH 5FW8A 4G6ML 5JUEL 3PABB 2BNQB 1F3JA 3QULA 3T0WA 2GUOA 3ULSB 1DJSA 3K71A 5F7KC 5EU7E 3TCXA 4XNMB 2OYMA 1CTOA 4P46B 2MNUA 5IHLB 4NZUL 2IANA 4OCMC 5C97A 5KOVC 4DKEL 1G7HB 1UXWB 1W80A 2BC4A 3GMOA 5E8PA 2PLTA 3S5ZA 5I6LA 1C1EH 4KTYA 3FUMA 3RILA 1I7TB 2EDJA 2EICA 1H8LA 5BCAA 2LV4A 2OK0L 5HJ3A 4ZUSB 1DQLH 4ZPTB 2HUHA 2Y36H 1EDYA 1JI2A 2XWRA 4MNQD 1GS7A 1BAFH 2ZSVA 5GGSY 3SY6A 2F53A 2VH5L 1ZY9A 1E4JA 3IDNA 1JGDB 4KKCC 1T2XA 1ZLWK 3HW7A 4BSJA 1JDCA 3GXTA 4XGZB 5JIKA 3B9EA 1CICB 2DQIL 1LEIB 2X5PA 5DD3H 3W5MA 4PHXA 2H1XA 3FUFA 3TO4C 3QZWB 5H2BB 3O4LD 3QJZA 1JPFB 1ID5I 3VXUE 1S78C 5CINH 5JW5A 1OB1A 5HJGA 3AVEA 5ITBL 2ARWA 2K7PA 2WIIB 3CU1A 5CGTA 2CDEB 5GS0C 5F3HB 5E6RB 4LL1A 4B95C 3B2XA 1TQWA 1OF2B 3CMGA 1A1NA 3MUZ1 1DEEA 3D2UB 1FO0B 1QLFA 2JB5H 2PO6A 1YDPB 3M1BA 1MI5E 1KXTB 4X9IA 4HFUL 4OZ4B 5CP7B 1MAML 4JHBA 4FQXB 3EDKA 4MNHA 1CLCA 1CGWA 4XC1H 5CAYB 1W8OA 3BHBA 4JUSA 2XVKA 2DQ6A 1DFBL 2GABA 1UATA 5EOCL 3CZKA 3IBOA 3RWHA 1SMOA 4U6TA 4ZPVB 2Y7SA 1ACCA 3VWKA 4NQEA 3W81A 1G7PA 3HE7C 2YPLA 4XCCL 4N5ED 4XB8A 5AVTB 4HJ0D 4JRYA 1ACYH 3UDWA 5H35A 4U6XB 3OB8A 2ZE0A 1XCTA 3ULUH 2VSDA 4X4XA 1HXYB 3EOBA 5MEPB 5PCYA 1XVSA 4A7GA 3HC0B 1KJ3H 4DFIA 2HKFH 4G11A 3MFFA 2ZXEB 1YNTB 3CVIL 4QGYA 5AWNL 3ZHDA 2R1XB 3QDMA 3V4PA 2PXYA 1HKFA 2OR7A 4P2RD 3MBXL 5BUGA 3N43B 4NQCA 4PVLA 2OMWA 4FZEH 3BVXA 1F42A 2V7NA 1PG7L 3C5ZA 1MQKH 3C5SA 1VGEH 2WBWB 4G3YL 1YSOA 2L8AA 4GIPD 4PJFE 2Z8WC 5F7EH 1YQVL 3LX9A 4U1IA 2R9HC 4YEEA 1SPDA 5IVNA 4MJIB 5IT2L 3OXRB 4MZ2A 3QHZH 2Y2WA 2VJXA 1VFBA 3NJFA 4R5XA 2QQKH 3V0VB 3AACA 3GSUA 5GIRB 3DSNA 1DN0A 4IBYA 4P2AA 2VLLB 5FYJD 3VNYA 5EG6C 5FM8A 3SKJH 2R15A 3M1CA 4NM8H 4L48A 2VLME 2NNAB 1IO4C 5MEOB 3ARGC 1MF2L 3UTTD 4AMKH 2OFQA 4IOFD 4LCIH 3OKEA 1R3IL 4YHIA 3LRSB 4KK9D 4J3WA 5EIIB 3SODB 1HYRC 3NMEA 3RWEB 1CYGA 3VRIA 2W0FA 2PPDA 5IBTH 3I50L 3MLWL 1YO4A 3B3IB 1NCAH 3BIKB 1MHPH 1OCWH 4JFYA 5J1AA 1HHJA 3SKUD 2G3XA 2W1NA 3UYPB 3T0XA 5F7DA 4K5LA 4OF8A 5MHSE 3BVWA 5BS0D 5EF2A 1KIPB 1ORSA 1G94A 3L2MA 5D1XC 1BVOA 4LSUL 4B0MM 5DK3A 1KJMB 4MDRA 5BQ7A 1BFSA 3EYUL 2RCSL 4WRLA 1I85C 3TGXA 1WWAX 4OZHE 1A5FL 3KCPB 5DZVA 1T66C 4YSAA 1OGSA 2XI9A 2GSIB 2XYBA 3LS4L 4Y19D 4FQ1L 4PJGF 1FZJA 4ZS7L 3VI3F 1A7OH 5CR8A 5HPMA 2FJFA 1MOEA 2X4NA 5LBGA 2APBA 2FCBA 4U4IA 4XXCC 3U4KA 3GSQA 4G1MB 3A5VA 4DZ8B 5DJDA 4QYOA 1BMZA 3RVXD 2IOOA 1FFTB 3DV6B 4ZAKB 3K74B 1MSPA 1S7SA 4PM1A 1NC2A 3C2AH 3RBGA 3DBSA 5IOKA 3KEHA 1USZA 1NDGA 35C8L 3GXNA 5TDOB 1K2DA 4Y4KD 1EEZA 1INQB 4U33A 4HUVA 4YDJB 4Y4FD 3AGWA 3CBRA 3T2QA 2CO1A 3BPOB 3QIUB 6TAAA 3WYRA 1A14H 2DAVA 4D0CA 3KBPA 3RU8L 3HI5H 3N9GH 1TZGH 3HI6L 4MVBD 4ONHB 3KS0H 1DJGA 3B4NA 4XP6H 3UBXA 1DJWA 1G1CA 1R3LA 4IM8A 5J6HA 4MAUH 4F9LA 3VA2C 5HYQA 1VKXB 4RWHA 3VXQA 2QV2A 1T1YA 2FIKA 1BYOA 1TTFA 3WJMA 5I1DA 3BEVB 4FFVD 1WCBB 3H6AA 4N22A 1N5YL 3TJEL 2WZAA 1H5BC 2HG0A 5E0QA 2ZG2A 1XGUA 4GI8A 4U3SA 2R7EB 5T1DL 5AG9A 1KCVH 4FNSA 5D55A 1T03L 3BGFC 4BQCA 2YO3A 4XPTL 3OGOE 5KVDL 3WIAA 2GJ6D 2WXMA 2LLLA 3L4CA 4U05A 5IMMA 2AEQL 4MNGB 4XXWA 4XNZB 4WDIB 1THAA 1E2WA 2ZX7A 5C08B 2H26A 3IXAB 1IARB 1B0WA 2QZ5A 1OIOA 1IBHA 2Q3ZA 4R0LA 5DS1A 1PZ2A 2RD0A 4JKKA 2EUWA 3QNYB 2MKLC 1NDMB 2ZKHH 4OV5B 4FA7B 5EFIA 3U30C 1CFTB 3CUPB 1HK6A 2NX5B 3MNZA 2OMXA 4DVBB 1UD8A 1A0QH 1A6ZA 4XPGL 4AMWA 4ZRGA 2HT4D 1A65A 2IQ9H 4ATWA 5DYFA 3D9AL 4JFHD 1U8LA 1NH6A 2FHBA 4W4NA 5FO7A 5IB1A 4LNVA 1Y0LA 1S9XB 5E6YA 4M1DL 5LGHH 3U79A 3VRLE 1PY9A 1Q9OA 3BZEA 1WFTA 5EIQA 1FFPB 3MRPB 5C3TA 2J8UA 5F1KC 5F96L 1SJXA 3A6CH 4GS7B 3MLVL 4QXUL 5E4IA 2EE0A 3CDFA 1G7JA 4Z7UB 1EAPB 2CA4A 4X98A 4JNXA 2W60B 4JQIH 4NIKB 2DYPB 2HB0A 1ZTXH 4UAHA 2BXZA 2M1KA 3APFA 4OGAD 4BKLB 4HJUA 3H6JA 4YIQA 5HGHA 5GS1A 3I9AA 1IQDA 3NCXA 4AL8C 4UOZA 1A2YA 1K85A 1P5UA 2CHXA 3WBDA 4U6VH 4OFIA 1H8SA 3ZXAC 4L4VA 1TVDA 3D6GA 4BQ8A 1OE2A 2A6KA 5DO2C 4EUPA 3K6SB 4BWWA 1VADA 1BD2D 1DE4A 4HXBL 1VFMA 3H9YA 1KCWA 1AGFB 1BVNP 5I73B 3OLDA 4FG6D 4XN1A 3RNQB 2WUBL 1PIFA 5J6GA 1DUYA 1M1XA 4UM8B 5SX5K 1N0XL 4XMLH 5LAXA 3NGBC 2OYKA 5HHXH 2QVKA 4KH9A 4WO4B 2HX7A 3BFOA 5FW7A 1U8CB 1E5ZA 2MTAA 4XXDA 1RJCA 5BV7C 3GUTA 1IBGH 1MJJA 15C8H 4HJIA 5E2VH 2E7LA 3E6FA 1AXTL 2A9DA 4MA7H 1PSKH 1Z3GL 2ARJA 2NW2B 3FO0H 4JFZH 2A9AA 2GTQA 4FKEA 4NGHH 5CCKH 4MCYB 3BD4A 1ZLEA 2XVLA 4IRJB 4OCWL 5AKTA 5GZNC 1YEEL 3IS0X 1WZKA 5I1HH 1I7UA 1PIGA 1JGVH 1G1OA 3DWTA 4PRID 2HJKA 2HG5A 5L4FA 3REVB 3SGJA 5BRZB 4KK6D 2EE3A 4PWKA 2Z93A 1FSKB 2DQUL 4MQ7A 1NPNA 4ISVB 1MFCL 1QHQA 4PR5B 3VYPA 3D69A 1JPEA 5IWLC 2OSLA 2NY1D 2YWZA 4KZEH 1M7IB 1I7ZA 1E6OH 4GW1A 4Z7NF 4JKNA 2EH7H 4KVNL 2HH0L 1EUTA 5GGTH 3F7LA 4FL4B 3L5JA 5FYLE 3MUHL 2GITA 3WS3B 4Z76A 1QASA 4YHMH 2YGNA 2FRGP 1BDYA 2C7FA 1I1FB 2VDPH 4PGBB 5SWZE 1T22A 1X4YA 1I8LC 4HS8L 1YC7A 5DJZA 3QSKB 2AVGA 4JVUA 4GG6B 1OAUH 3C60D 3WJJA 3FU9A 1URIA 3ILQD 3RIAF 3OJDA 3WHXA 4M8QB 1M57B 3G6DH 2XQBL 1ZA6B 1VERA 1BLNB 2WQXA 2K3TA 4G6KH 3VD0A 2K7QA 3DHPA 2JB6B 2ZYIA 4OR1A 4PLKC 5HHVH 1Q9LB 1Q9KB 4NKDA 3VWJD 4EIZC 2X44D 4GSDL 5IB3A 1EXUB 4L2LA 5HGAA 1Z1WA 4HWNA 3EG9B 5GGVH 4DGIL 2KLSA 4L3FA 5ABAA 4N0CD 4TOYH 2GJRA 4NWUH 3S3PA 4XVOA 1NCDL 3EF7A 2OMYA 2L7JA 5EU6D 3I9GL 1SY6L 2W0LA 2FNBA 4DEUA 2WVUA 2YJLA 2FE0A 2GC4C 4F7PA 2J12B 2ITEA 1UB6B 3EJTA 4PGCA 4A2GA 3D3VA 4FQQB 3H56A 3EHBC 4XWOC 4ZJ9A 1NBVL 4H5SA 1MLCA 4TQPA 4WWKA 5I6OA 3SE9H 3VFVA 4OD2A 3C6LA 3LRKA 3VXUA 3WEOA 3D48R 4YBLB 5ADOL 4Q52A 2O6EA 5CFAA 2AJXH 3DGDA 4GYBA 2Z35B 1RK0B 3HAEA 3PL6D 2MPVA 5F9OL 3D8MA 1A7RL 1XXFC 1DP0A 4YDKL 5HVHC 2X41A 3GHPA 1CI3M 4NSKA 4PLOB 3HZ3A 2JWYA 3NIFB 4ICXA 3S35H 3HPJA 1MI5A 4NNYA 1ZVNA 3TU6A 2HRLA 4FULA 3RJOA 2DD8L 4PTUA 4GRLA 5B1AB 5KBLA 2NY0D 1B0RA 2IAND 2FO4A 4G6MH 1NAML 4E9SA 4AEIL 5JUEH 5EEUA 4NQXA 3GB7A 4ADIA 3QYMA 3GXIA 2JTYA 3MGTB 3SE3A 2AMGA 2IWGA 1VEOA 3HVNA 2DKUA 2X1OA 4F8LA 1NL0L 3KPOB 1P1ZB 4TMPA 3F3HA 4NZUH 1L6PA 2F53D 3QC5X 4DKEH 5E4OA 4BQBA 4JN1L 5EU3B 2AV1B 2XTSA 1QSFB 2VJ8A 3NIDE 2FVNA 4WI0A 2CDGA 3QYCA 2OK0H 3IMUA 2XVGA 1OP3H 5J3HD 1QYGL 2EDWA 2PWHA 5F3BA 2JCCB 2LABA 1ETZA 4OJAA 1A7NH 3X14B 2WVVA 5GRUL 1YNTF 2HJFA 2VH5H 5HJBA 5A2JH 5E2JA 3AUVA 5AW0B 3UMTA 2GVYA 2VW4A 5F21B 3EOYG 4OLYL 4QRQA 1J05A 5EWIL 3TEUA 4E5XG 4PJFA 2ATPB 4JY4B 3LB6D 2DQIH 3OR6A 4TUKL 4Z78B 3KLQA 3NUKA 4CL7A 4PP2B 1BOGB 3LHPL 2IDCA 3AM8C 2K4AA 1AGBA 2GI0A 2PO6D 1XIWB 4PV1C 4L0YA 2CE6A 1BSIA 1U58B 5E6IA 4JFQA 5ITBH 1TZIB 1KCUL 3C5XA 1R24A 3R06B 4M3JA 4JO3L 2EYTB 4NFCA 1UQSA 4HJJL 3LKSA 2VAJA 2F68X 4M3KB 2Y1VA 2IVFC 2KZKA 3UTQA 1IJ9A 4HS6B 4MGXA 3KYMA 5B8CC 1FCGA 1A4BA 3VGGA 1HVXA 1QPKA 3VWKD 4HFUH 5AOIA 3DARA 3QVAA 4NQED 1MAMH 5KVEL 2YPLD 1IC5L 4JRYD 2JF1A 2HKHL 1AHWB 1YYLL 1J87A 1PL3A 1N59A 1DFBH 1JN6A 3KLAA 2GIYA 5I71C 3PYCA 5EOCH 5MEND 1S5IL 2JKJA 4MJ5B 2WSPA 3CFJA 3NESA 4YSEA 4TF4A 3QDMD 3LNHA 3B5GA 1WC7A 3RGBA 4LLWA 4XCCH 1DHKA 1RL1A 5IQMA 4OZHA 2E7DA 3B3BA 3NA9L 4NQCD 4DO6A 3RUGF 5KYYA 3O9WB 1JZEA 1I8KB 1QMUA 3C5ZD 1U2CA 4ELMA 1E27A 1G9ML 1F41A 4PJAE 4TQHA 1G9NL 1OCRB 3IDJA 5AWNH 4JN2B 5MEQB 1QVOB 4WSGA 1LE5B 4AGMA 2K3HA 3BLKA 3D09A 3MBXH 4MFHA 2BVQB 3FK3A 1SDDB 4KKZA 3EJYD 2CKBL 3ZW3A 2NXYC 1NDTA 2R0WL 3U25A 5CD3B 5I1LB 1YEDA 2G4GA 3PXHA 1XH0A 1PG7H 3VD5A 1M71B 1KIUB 1MXGA 4G3YH 3ZE2E 4YGVB 1L9NA 1KLFA 1TIUA 1YQVH 2XWDA 3QXDA 3Q5OA 2QPEB 3A67L 4RQQB 4PB0L 4A7QA 4WU7A 5IT2H 1FG9C 2CJUL 4DOHE 2KPNA 1OWWA 5KSBB 1P4IL 1EHAA 4N3UA 3FB6A 4PV8A 1GPOL 4RETB 4CMHC 1DBAL 5C2BL 3JBG7 5I74B 1IL1B 2A6DA 2LVCA 5CEYA 2UY7B 2B4CC 2IG2L 2AQ2A 5D1QC 2VMJA 4CC4A 3ARFA 1R3IH 3MAWA 2YPKA 3WDIA 4NPYB 3ECQA 4FP8L 2FX7L 1E3XA 2A4CA 2YQ2A 4L8BA 4Y1AE 1BWWA 3MMEB 3KLHD 1N5AB 3I50H 3MLWH 5AVWB 4NZDA 5HP5A 1XGRA 2YQGA 3H3KA 4RAVA 4YR6A 4F20A 5KZCB 3RY4A 3G5VB 1OWRM 2Z92A 1X6LA 1HSAB 2MQCA 3U2SB 1I1YA 4LAQL 1U3JA 4LSUH 1EANA 2XG5B 3T3PF 3EYUH 2RCSH 1W0WB 3QJTB 3MOBL 1A5FH 1CZ8L 4HWBA 4OM0L 1JZ7A 4EAEA 2ZAGA 1IEBB 2BVEA 3NH7L 3LS4H 2DV6A 3Q1EA 3OZLA 4JQVC 5HYJE 3V7AE 1JCVA 2IWEA 4FQ1H 4ZS7H 1NC2D 1UJTA 2OI9C 3ZHLA 3F7YB 3ME0B 3VFWA 3NBNA 2PCFA 2R0ZL 2LFEA 3TBTA 2BCKA 3QUZB 3EYQD 3JTSA 1PLGL 2RQ8A 4WUUA 1XAKA 2F8IA 2H3NA 3IFPB 1COBA 3AWGA 3O3AB 4A6YL 3ZMEA 2PCPA 3UTZA 5F71A 1NM9A 1IIKA 3D4GA 3PIQB 35C8H 4JM2A 5TK2A 3STLB 1CYWA 3EJQA 3WMSA 1FBIL 2VC2L 3O8XA 1HE7A 5SX4I 4MXWL 3IGLA 1P7KA 3NPSC 2DWDB 3VMNA 2C9PA 1MWOA 1QABA 2IAMB 2L3BA 4NO3B 4HJTA 3N1GC 4RDQG 3WKML 3RU8H 3HI6H 3AY4A 5JPNA 3KLDA 3ZL2A 5A3ID 1KTRL 2XXGA 2FWOA 4IKJA 4D94A 3OC8A 3P77A 3QJRB 3ULVC 3QQ4B 5ID1A 4LCVA 3LTVA 1OE1A 2CBTA 4HP5A 4J1UB 4ADGA 1JP5A 3TH2T 4X8GA 4KRNA 1N5YH 3TJEH 2HFFA 3QK0A 1JTTA 5E7FA 1HILB 5E8NA 2AJZA 2H7WA 1EBPA 3G5XB 2EDTA 5T1DH 1T03H 4I0PC 3WFDL 4EI5C 3FS9A 3OB0K 3BWUF 3WFBL 2FJHA 2WOYA 4TNGA 2B3RA 3HS0B 1JG9A 2XIBA 4XPTH 3APDA 5I8KL 1Q9WB 4E9WA 5KVDH 2Q76A 1CYXA 4PJDB 1FN4B 4U1HA 4BZ1L 1EGJA 2AEQH 1Z6JT 2XY2A 5JDJA 1NLBL 3LN4B 2MKWA 2NDFA 4Y5XA 4JK0D 4LLQA 2ZCLL 3V4LA 3VACA 4MA3A 5IKCB 3WNKA 4GAFB 5GGSA 1TJIL 3AU1A 4Y16A 3CXDL 1BEYL 2BS71 5EUKB 4HD9A 4WEBL 4X5XA 3ZKMC 1CURA 4MDIB 4X7CC 2V3DA 4KNQA 3TYFB 3ULSA 2XZAL 4XPGH 5CBAB 1GKEA 1JXFA 3D9AH 1SJVA 2BRRL 1IGIL 4FMFA 4EXPX 3V5HA 2J6EA 1OT2A 4I5BB 5F72S 1UXWA 5FB8A 4JHAL 2BSTA 3SQBB 1PCXA 3CFBA 2JKWA 3INOA 4M1DH 4DP2X 5F89A 3AG1B 5E5UB 3AXLB 3MYJA 2CQVA 3D87B 4Q0XL 1Z9OA 4ZPTA 1A4CA 4EIUA 5F96H 4QXUH 3MLVH 4E9LA 1SYSA 5DZOA 2NY4C 2D2OA 3MRNA 4L4VD 3US1A 2KDYA 1JGDA 1Z9MA 4JKPL 2Y69B 2Z64C 3GEFA 1TCRB 5SWZA 3KWTA 3WS6A 1PEZA 3I84A 5MI0B 1N10A 2P48B 1RI8A 4JB9L 5LLIC 5FIEA 1GOFA 2DIEA 3OAYH 4G9FA 3RL2B 4OAWB 4XH2A 1IGJA 2JI3A 4MZRA 3QZWA 1JMXA 1DQVA 1DVFA 3EOAB 2FH6A 5HGDB 3FJTA 3UPCA 4HXBH 3VCLA 2AV7B 4I1PA 1FNSL 1J7VR 4OH2A 1I1AC 4HHAA 4P3DA 5AOLA 2WUBH 2BNUA 2XN9B 4I48A 3QDGA 1N0XH 1AZVA 4PMEA 4F1SA 3KXFB 4FQ2L 4A1RA 1TYEB 5E5MA 2OV0A 4NO2A 2WLMA 5FKAB 5KSVB 4JLRB 2GQHA 2Y0SA 3TVMA 2X88A 5KYUA 5JA9A 3GSXB 3PWPA 1IAIL 3MODL 5AVXB 3CE1A 1AXTH 1WZ1L 3FRPA 3KLLA 1Z3GH 3FQWA 4BFIB 4OGYL 4ZO6A 1M42A 3QO1A 2X4UB 5CIPB 1ZSDA 2QLVB 3HE6A 3WTYA 4XBPA 2BSRA 1LDPL 4OCWH 1V27A 1WITA 1YEEH 2NTFB 2DI7A 3IVKB 3C8DA 2VYRE 3LMJL 1CPUA 1CN4A 5D5MB 5CGYC 3MLSL 1O6SA 3MNWB 2DMGA 2DQUH 2OTWB 1MFCH 3EKCA 2N1TE 4H2CA 3STZA 4NUMA 4XVUD 3JT2A 1XCXA 2BOBA 1A8ZA 3K3QA 4KVNH 2HH0H 3VFNB 4AH2B 3L2LA 4N8VB 1GGYA 4NKOB 3NIFF 4W9HC 3PRZA 4PRAB 5CSZA 5JR1H 2R56L 5J57B 1KJ2B 3FT1A 3B1UA 4HS8H 5EBLA 5HDWA 4ZFQA 5DVPA 1S9YA 2W80C 1D6EB 1CD1B 1Q0XL 3L3DB 5JIMA 5CJOL 1HNGA 4X6FB 2XQBH 1RULL 3GJFH 5BRQA 3WEAA 3TBWA 1UFGA 3MU3A 1P1VA 4XBGB 3CDCA 4OFYA 2ICES 5CJXC 2BXYA 3QBTB 1KB5B 4GSDH 2VQ1A 3D3VD 2AXGB 1WUNT 4IGBA 4DGIH 5HI5C 3HRZA 2NY3D 4WWKD 4AM0A 2JCCF 3ZE0F 1BZDA 3C6LD 3I9GH 3LXCA 1SY6H 4UQIM 3SBWA 2J7LA 3VXUD 1V7NL 2FEDC 3UZQA 3EYVA 2O4EA 1LILA 1H3WM 2QHRL 3HR5B 4MMZB 2UWEF 4BCZA 1JAEA 3EGXB 4B3EA 5TE7L 4H0HB 4P49A 4NRYA 1NBVH 4JW3A 4AKPA 2HVJB 1FNGA 5HYSG 2MMXA 43C9B 1J0KA 1F00I 2FT7A 4ZUUB 4FXKA 2OMNA 5ADOH 1MI5D 2DZEA 4WKZA 4ZDHB 1HZHL 4LPVA 4FADA 1GW0A 4GRLD 2AAAA 4JY5L 5D4HA 3EFDL 5F9OH 3T77B 1G84A 2QR0A 1A7RH 5BW7C 4K0OA 4YDKH 3OAWA 2GC7C 3EJRA 5FM5M 1HL4A 1IVLA 2XTLA 3L8QA 1J8HE 1GW6A 3EF4A 1BX2B 4OZIB 1ETB1 3PDGA 1QA9A 4EZMA 3B2DC 4GLRH 4B60A 2DD8H 1CG9B 4KRLB 1S7RB 3DVIA 4O9HL 3S36L 4PU2A 5KYWA 1TTBA 3MV8B 1NAMH 1JHLL 4AEIH 2D9QB 4ZXBC 3BSHA 4Z23A 2VLRB 2YOAA 2J8OA 4U1LA 2IALB 4HJ1A 1UHVA 1R5VA 1I4FA 3SPVA 2VITB 1NL0H 3MJ9L 5FKPB 2Y06L 4U0RC 4YDJA 3N40P 5D6DA 1FVEA 1JZ6A 2WZPA 3LD8C 4JN1H 1OKEA 1U3ZA 2FWLB 4K3EL 5AVSB 5CSBA 1SHMA 2PW2A 4PJAA 1WGOA 4P5KB 3BAJA 1QYGH 5JLZA 1Z66A 4EKJA 2XFGB 4ENZA 3DK2A 3QCVH 3W5NA 4YPGB 1MUJA 3L7EB 3MUGB 2OL3A 3EBIA 2EAEA 3HN3A 4OLYH 3T2LA 1CD8A 3ZKND 3A3YB 3BEVA 5EWIH 5E6ID 1QHPA 4HG4K 2LTQC 5E6SB 4TUOB 4JFEB 3UPRA 4KOCA 1JXDA 3S37L 4TUKH 1UASA 4X7FC 4XI5D 5IBLD 5JNYB 2ALWA 3LHPH 2IF7A 4HBQA 3IKCB 2IQAA 2QEJA 3L3OA 2FZ3B 3MGOB 3U2IA 4CC0A 1LK3L 1XBDA 3QNXA 5AAWC 4NI6A 2ZOLA 1KCUH 5CS7A 4NBZB 2DS4A 4JO3H 3AQYA 1FAIL 2LAAA 4HJJH 4TTDC 3CX5J 1AI1L 3KPLB 5MHSD 2QVMA 2YEZA 3EO0B 1A3QA 1A4JA 4K9EC 4LLDB 4P2OC 1M9WA 2V8LA 3HS8A 3R1GL 3DJZA 4UM9B 5KVEH 3FYIB 4PG2C 1IC5H 2HKHH 3TTYA 4P59L 4BK4A 1YYLH 4P2QE 3UAAA 4PBDA 3MJ7B 4JDZB 3KYNA 4DKTA 4BFKA 1S5IH 4XO3A 1CGVA 1HAWA 4K3DL 3KCWA 4B53A 4NN5C 2DM4A 5IGXL 1JI1A 1DQML 3QJQB 4WNQB 3MLXL 3PFUA 4MJ6B 5J9PB 4K71B 4J8RA 3NA9H 1FYHB 3POHA 1WICA 1XR9B 3WFHB 4PAZA 1JNNL 1G9MH 4PW4A 4Z7UA 2ALAA 2MSPA 4J2QA 1G9NH 4H26B 1DLHB 2W60A 1VDGA 4MJJA 4AYID 2J25A 1U3HB 1P84K 2V17L 1L9MA 2CKBH 2UYLB 1WBYA 1CVRA 2R0WH 3W57A 4JZOA 3PHQB 4HWBL 4P4RB 2GUYA 2IADA 1PX3A 4L3AA 1DSYA 5FA4B 5GSVA 1NPJA 5DRXA 2CUIA 7TAAA 4UT7L 4UQ2A 4RGNC 3ARFD 4PB0H 1O7VA 3W1ZA 2CJUH 3FTGA 4PRPB 1P4IH 2OYLA 2P3YA 4Z7WA 3ZJAA 2EEBA 1GPOH 5C0DA 1DBAH 3VTTA 1TFHA 5C2BH 2XN1A 3PCYA 2P24B 3MBEB 3X2QB 4F92B 3T8XB 4S1DD 4YO0A 2E56A 1JZDC 2A74A 2IG2H 4MB3A 5BOPA 2OZ4A 1IAMA 4N26A 5D93B 2LFGA 1ZVSB 2IOIA 5JW4Q 5KBDA 4PBWD 1JWMA 1H3GA 4FP8H 2FX7H 1R3JB 5IFJB 1AMYA 2H32H 3KPSE 1UT1A 3V5KA 2MJWA 3GIVA 1D6VL 3R4RA 2TRHA 4W1TA 2CR3A 3PNWA 4GW5B 4OW6A 2WAHA 5F7FA 3C6EA 4N2OA 1ZHNB 2HFEB 3CVDA 3D50A 4ZMWA 1V3JA 1HHGA 4LAQH 4XX1G 2BH0A 4AQ8A 1KWGA 2EDLA 3MTXA 4CN4A 4ABVA 2IPKB 3MOBH 3VXRA 1CZ8H 2YJQA 5CU9A 5H37H 4HULB 3UTPE 4OM0H 3K0WA 3BKJL 3NH7H 3PGCA 4WUUD 4YAQB 4PJDF 5H37G 3VQ2C 4PREA 1WAAE 3O4OB 2BIOA 3ATBA 5L0QB 3GLZA 5L7XL 1BQSA 4QHNB 1EHLL 1RERA 4NPJA 1DJHA 5AKRA 2R0ZH 1RMFL 3LNGA 1O75A 1D9KA 1WPCA 3O8XD 4G8EB 5DJ6B 1GIGL 1PLGH 3MRJA 4XPBL 1KGJA 5A6MA 4ZFOL 4EDXB 1WAEA 4ANXA 4GG6A 4LEXL 1FNLA 1KACB 3L2NA 1YRKA 1O7DC 4A6YH 4AC2A 3ILPB 2CR6A 3BN3B 1U2HA 1SHWA 1ZA6A 4KU1A 3MLUL 2XPYA 5HY9B 2Y1ZA 3TZVA 1LK2A 4Y9CA 2JB6A 4D3CL 4PRBB 1FBIH 1GVIA 2VC2H 3HLAA 3M86A 2APSA 4MXWH 4R7DA 3VXSE 4GPVA 4F2EA 2AEIT 4QNPF 3P3RA 4J3OF 6PCYA 2DIJA 4CSTA 4FFZA 1DN2A 3P3TA 1QW8A 2FUQA 3WKMH 1O6TA 5I1GL 3VW3L 4QRUB 3FCUB 2XY1A 1XZ0B 4OGXL 2AS5M 4C4UA 1XAUA 4JRXE 3SE8L 2J6EL 4YVNA 4RRPG 1ETA1 1QAWA 2Y7NA 1LWRA 3QO0A 4FQQA 3II3A 4PJ9A 2YAHA 2C9XA 3FUJA 5I5MA 2WXJA 4OFVA 4QYAA 5IVXA 4XP4L 1SLWA 1MFDL 1RKRA 4Z5RA 4JFWA 1F4AA 1TVBB 4PV9B 2QT6A 4GKSB 3WFDH 5IQ9B 1BV8A 4Y16D 2YAPA 3WFBH 2YUWA 2X7LA 2R39A 2VWEE 2WUCL 5I8KH 4Z3IA 4GQ9L 4AYEC 4M56A 4BZ1H 5ACZA 4UI2A 2EDKA 5KVFE 5D8JL 1AH1A 5I82A 1NLBH 2RJMA 2H1PL 1KF9B 2OPCA 3MKKA 1XWVA 2J8UF 3PHOB 4GI9A 1XB3A 2ZCLH 4HAKA 4N4YB 4DPRA 4Q7DA 1TJIH 4P5TB 3AROA 1NC4B 3CXDH 3HCVB 4H0LC 3LV3A 1BEYH 3OWEA 2BJML 3IJYB 4WEBH 4RMRA 1KB9J 3DJ9A 1X5GA 3RX9A 3BN9D 4MAYA 4EN3C 1XDTT 3V95A 3NCEB 2A5UA 4H40A 1KGUA 2BSBA 1XF2B 1PDKB 2XZAH 1LL1A 1PNDA 1FO0L 4OZFA 4S10A 2BRRH 1IGIH 2OS7A 3KVDD 4J3BA 1OVZA 2C3VB 4R96B 4JHAH 2ODHA 4LQFL 5SWZD 2AV1A 3KWWB 3VFMA 4ZBJA 4OJEH 3OGCB 1IX2A 1SN5A 3QI9A 1N0LA 4M6AA 1E5UI 1AC6A 1QACA 4Q0XH 3TH3T 2DEYX 5AVUB 4G9FD 4YX2L 4NQVB 3TF7C 3A6BL 1IILE 1PJ9A 3PWJA 1CLZL 3BQUC 2B7DT 1L0XA 1DVFD 3N6YA 5J12C 1S7TB 1G7QA 4RMVA 4JKPH 4G6JL 3OAYK 2H6PA 4WLCA 5CLXA 1INDL 4P5MA 3SYAA 2ATPA 4NI3A 1CGSL 4JB9H 3RTLA 4F3FA 4Z78A 3FBKA 3QDGD 1FZOA 1FVCA 1YMHA 3CHQA 3P0VL 4JPVL 3E6HA 5J6SA 1G0XA 1OK0A 3CSBA 3TVMD 5C0BA 4YHZL 4G80A 1FNSH 1NKRA 2DIBA 2LE9A 4PJCB 1FNFA 1GOHA 3L4XA 3PWPD 5C09E 1RZKL 5ECGA 3RGHA 5I18L 2AQQA 4LVHC 1D2PA 1OW0C 2OJ1A 2GJZB 1ANUA 1UM4L 1KTBA 2X4PA 1SEQH 3H3BC 3AREA 3FONB 1UEYA 3HE6D 4FQ2H 3RP1A 4JY6B 4PWJA 5EUOB 2F61A 2VZOA 4HCRA 3WTUA 5BZXA 3UTSE 4MWFB 1IAIH 3MODH 1C8QA 2JKLA 1WZ1H 1S7QA 6FABL 4H8WL 1IM9B 3F65A 4OGYH 4GUCA 4U1NA 5HHOA 1I8IB 3PXLA 1ZLUH 1LDPH 3L9YA 2Q8AL 4K3GA 2YPVL 4K7PX 3RB5A 3RKDC 1IC4L 1T3FB 5A7EA 4NKMB 4JCMA 3HJ0A 1WZAA 4P48A 4W68A 3G6JE 3QFGA 2CLZA 4GSUA 3MLSH 5BMFL 2TSBA 3O2WL 5HI3D 1T1WB 4KROB 5C07A 3Q13A 2GJPA 2OX5A 1M56B 5JDSA 4JL2A 4J2XA 2G0LA 5DJXA 2H4EA 1MXDA 1QRNA 2IH8A 4DGWC 1CFNA 4FNLL 3GF8A 4I9WE 4MLIA 3V6ZA 3BJ91 3S34L 4PLJD 1UH4A 1QR4A 3FB7A 1SDYA 2R56H 4QJ5B 3QP3A 3PP3K 2W81C 4LASL 3VSTA 2HRHA 3FHQA 3HFFA 4YGVA 4OQTA 4JPWL 4OFYD 4JJ5B 2OULB 1B4JL 2YD2A 3MROA 4IGBD 1OCOB 3E8UL 3C8HA 3JWDL 4JFVA 5ESQB 3VAEA 1Q0XH 3CXHK 3F83A 3CHOA 5D72L 5CJOH 1VPOL 3FTSA 1RULH 1LEGA 3F7VB 3SSGA 4EO5A 1KCLA 3HTLX 4BD4A 3IDYB 4WU5A 2DKSA 3NN8A 3WL9B 3ZGIA 5K9KA 3HUJE 3FO1A 3VFUB 3ZHFA 4DGYL 4X6BA 2E86A 3RWIA 1JZ4A 1VGKB 2Q1EA 2Y4SA 4BCYA 1IMHC 2UV3A 1WBXB 1Q8MA 2DJMA 4XPAL 3BESR 1FJ1B 2GT9A 3F84A 1V7NH 2DM7A 5EN2A 2OMBA 2QHRH 3IFOB 2APTA 4JREB 2A9NL 3U0PB 5TE7H 2C9QA 5AB1A 2JI1A 2K9UA 3EJJX 1RZJL 4XNXL 1GOGA 2NNXA 2ITCB 5EZLA 1A6UL 2ZKWA 1BLIA 1QPPA 3FT9A 4DQOL 4Z3HA 3NIDB 1HZHH 3TT1L 3E9TA 4PI2A 4Y2OA 2EIKB 4DZBB 2YLHA 4XBEL 1R5IA 2BWDA 3EFDH 2V5MA 1J0HA 1S7UA 1Y07A 2NXZB 1RJYB 1CFMA 4FYTA 2NCMA 2YXMA 3DX3A 4R2GB 4XCYA 2JXMB 4NUJB 2YUVA 1QX1A 2YA0A 2CKNA 4R7LA 3O41A 2KYIA 5TE4L 3SDDC 4ODSL 1PBYA 1KPVB 7FABL 2V5SA 1RH8A 2WLIA 3D07A 4P2QA 4EI6A 4O9HH 3S36H 2WZPD 3QIUD 1JHLH 4PJIB 1RY7B 4AQEA 4KY1L 4PJFF 4QEGA 4FABL 2WLLA 2XG4A 3ESOA 3FTUA 3QUXB 5CUSL 5IB2B 1TFPA 2GBUA 3LZFL 2F8VA 1AGDA 3MJ9H 5C0CE 2Y06H 3MTRA 3FBQA 2Y7MA 3FUIA 3T4AC 2DWDA 1KLUB 2NNCA 5HHME 3TV8A 3IDMB 3PF2A 5GGRB 4CGTA 3SD2A 4K3EH 3V0IA 1BXAA 1UZ8A 1DZ0A 2ZCZA 3NCMA 3EDFA 3LQZB 5G4OA 2K8MA 2VW7A 3FCSA 4JCWA 2X6UA 1QEWB 1UD5A 2ZOKA 4HW6A 4L37B 2W91A 4KJQD 4IOIB 3ZT5A 2K6WA 1OARL 5M94B 3U83A 3EZJB 3DX7B 3DX6A 3GMPB 3S37H 3RWGA 2F7OA 3TO4B 3UABA 5DJAA 2CLRB 4NERA 3MLTB 4HUXA 1KC5L 4LU5L 1W0VA 3UXFA 3N40F 1LK3H 2BERA 2N0KA 1HHHA 4QIRA 4DFHA 5GGRY 4NCC1 1P6WA 2H41A 4OZHF 4XVJL 5DD0L 2E74C 2NY6D 1CVSC 5CFHA 1JV5A 1FAIH 4J7RA 2IV8A 1PZAA 1AI1H 5E8OA 3TCLB 2FT6A 4DIXA 1DQJA 2WWMC 2CDFB 3VFRB 4YSOA 2GCYB 3B5HA 2Z4QA 3TA3A 3SEPA 4WGVB 3R1GH 1EZLA 2AXFB 5KSAB 1TTRA 2FATL 3ECUA 4N0RA 3ZE2B 2NY2C 4P59H 5F97E 2ATKB 4ORGB 3EJSA 3V4VA 2DQGL 3OX8A 4EQ2A 5AD0A 3K2KA 4PH8A 3G3LA 4G72B 4LEOA 4F9PC 1N3NB 4ELKB 4ZX6A 4KTEH 3HE7B 3PWVA 1XF4A 5DO8A 4K3DH 3H7BA 2EXWD 1PS3A 1SYVA 4Y89A 5IGXH 2P52A 1DQMH 3FQ1A 3MUUA 1XFPA 5ENWA 3MLXH 5C86A 4F27A 4UNVA 3D39E 3L4ZA 2B9BA 3CZFB 5T3ZE 2EKSA 3WFEL 1FZKA 1PYWA 1ND0B 1M53A 1T5XA 3L9RA 4AGOA 1JNNH 3C8KA 4WWOA 5GGUA 5I16A 5ACMA 2Z31A 4NQSB 5KS9E 4U6HB 4DF9A 4Y1AB 4XO5A 2MOVA 3Q5TA 4QWWD 3LKNB 3WLWD 5DMKA 4E9RA 2V17H 4GXFA 5FXCH 1XGTA 2WVTA 3Q8BA 1N26A 4ZMNA 1WT5C 3VSUA 2X4SB 2IWKA 4HWBH 3CSPA 3FQYA 5DD5L 3TV3L 5JXEC 3VGFA 4NQTA 3MRLB 4M02A 2BP0A 4UT7H 1XGQB 4GFXA 4WFHD 1JBJA 2WPGA 3VXSA 3N1FC 2D31A 2XPGB 1MCDA 4ABQA 5IHZB 3IWVA 3K4DA 4LHUA 4HH8A 1S6NA 3CN4A 4PSPA 43CAA 3ARGB 3TIDB 1U8JB 1EX0A 1CXEA 1O5DT 2XDHA 4WI4A 3MX0A 1HL5A 5HYJB 5B39A 2MCG1 5HDBE 3GSRA 3BAIA 3LVEA 5ISZA 3SJVA 1AXSB 4JRXA 3OSKA 3SDAC 4E68A 2UVFA 3KYKL 3TONA 2PMZA 3ZKSD 4NFBA 5EC1A 1DVUA 3MV7E 2X4UA 1F11A 3PFQA 5CIPA 3FFCB 2C4XA 1KIRB 3GMLA 4URTB 2CCLA 3QT2A 5AALA 4W9LC 1D6VH 1EJ6A 5FV1L 4FFZL 3FFDB 2NTFA 2QBWA 3VXRD 3TT3L 3PU7A 5D1XB 5IROC 3QG7L 1W2KT 1VB9A 1HCZA 1WA1X 3Q8CA 2K0RA 4HDIB 1F4YL 1I8AA 3DGGB 4JM2F 5KVGE 3RWJA 4K55A 3VRLF 5FAAA 4K94L 4PY7B 5ANMB 1D9KD 1OAZL 5IJDC 5IREA 1BZEA 3HBGA 3BKJH 2ZYHA 1QFHA 1MCQA 1SVBA 3MR9B 1LQSR 4JPSA 4FQHB 4N8VA 3PHAA 5IBUG 5L7XH 2ZIDA 3VXPB 1EHLH 3OKDB 4NKOA 3VXTB 1FHGA 3ARDA 3EDDA 8FABA 2QADC 2QGEA 3TZVD 1RMFH 2J21A 2E3VA 4JFOA 2YD7A 4V1DE 3HZKB 3W11C 1GIGH 4XPBH 4JRWA 1TQBC 4LEXH 3RFZC 4XO4A 1IU1A 4OLUL 3EYSL 2WMPA 4R4BA 1RZ7L 5DJCB 4W81A 3K5RA 5FGBC 4A2HA 3K0YA 2KH2B 4IIQC 3MLUH 3LJ3A 5DA4A 3US9A 4D3CH 5CMAB 4CNIA 1D5MB 4HGKC 1NKGA 3SGDH 2BS9A 4L9LC 4EJ1C 2XTJC 4X6DE 2KKQA 3CHSA 1QP1A 1OAYL 4PJ9D 4LE8A 1S7XA 1JPTL 5I1GH 2G3MA 3GEWB 4Z1PA 5IEKA 4XMTA 1V3MA 2XQ0A 1J8RA 3VW3H 2YZ1A 3HZYB 2A6JA 4JDVB 4OGXH 5ES4B 3SE8H 4EDWL 2J6EH 1BG9A 4U1JB 3L3IB 4B9JA 5DJ8A 3W0WB 1B6DA 1BREA 2NZ9D 1H5BB 3QORA 3JV6A 4LDEB 3WI9A 1MZZA 5CZVL 4OJYA 2J2ZB 3EUDA 3JUZA 3ILEA 3L7FB 4UNTA 3DYPA 4RH4A 5GZOA 3EDEA 4A2EA 4XP4H 43C9A 3BGFB 1MFDH 1EMTL 5CZXD 3IRZA 1L9QA 3PWUB 3SGKC 5C09A 4GMSL 5CZKA 5KAQF 4E0RB 3BH8B 1GC1L 1VZGA 4LF3A 2WUCH 4WAFA 1DBML 3B7TA 5DVNA 3BXNB 2X09A 4GQ9H 3VE0A 1NGWB 4U6YB 2CO4A 3EJCA 5F1NA 4MAYD 4X0NA 5D8JH 4LCCA 2H1PH 5I1KL 1F86A 2BWQA 5C0GB 4EKXA 1KYFA 1G0DA 2D7QA 4KKRA 2NSXA 3E3QC 3U30B 4P23C 1RZIA 2BJMH 5EBMA 4JO4L 4PG9A 4PGEA 1QUNA 1HKLL 5ABDE 5J56B 2GPZA 4ZNEE 3P4MA 1JXGA 1OP9A 3QI9D 1UXSB 2HTLC 2N4IA 1GZHC 5CF3A 1BBDL 3B7SA 4WUKL 2KMWA 1FO0H 1RPKA 3T0EC 3G6JA 5DMGC 3IE4A 2Q5BA 2ITDB 5IM7A 1BBJB 3CTTA 4G8FA 5K5YA 2X1QA 3Q7JA 4LQFH 2YC1B 4L5FL 5C92A 1JNHA 2HVKB 4HIHA 1XX9C 1OPGL 2V6HA 4HK3J 4RZKA 3ES6B 4KPHL 4ANVA 4YX2H 3DX9A 2NRDA 3FNKA 4JFXB 3AQXA 2Q86B 3A6BH 4KFMA 5FOBB 2G75B 5D7JC 1CLZH 2BHFA 3BZ4A 3LKRB 4QKTA 2ZP0T 5C0BD 4G6JH 2UZPA 4DVRL 2XPZA 2EDQA 1INDH 1E4XL 4C57C 5FA3B 4ZMVA 2XBDA 4FDWA 4XN5A 1TQSA 1CGSH 3H9HB 1T0PB 4PB9L 3P0VH 3ARED 1J9RA 1TO5A 2V5TA 3LXUX 2FZ3A 3GSNB 4JUTA 5HHQB 2GTZA 1CDUA 4ZUTB 4YHZH 2Q8BL 4O2EB 2VCOA 2IJ0C 4LCYB 5EOQL 1CXFA 1EXGA 3NGBB 5KVMC 1RZKH 5I18H 1MCJA 5DHVA 2DQJL 1UM4H 3B2MA 3MRHA 3ZTCC 1HQ4B 5C0IB 1XH2A 1NFIA 4Y4HC 5HHOD 3LIZA 4U2ZA 4F15C 5BV7B 5C0NC 2FUTA 4TKWA 5ESAB 2J1WA 2XICA 3B9VA 2LLNA 1NIEA 2OMZA 4L29A 4O4YL 5E9DB 4HIIB 2ODIA 1FNHA 2NLJA 5I19L 1CQYA 4BRJA 4KDVA 1RUKL 4MS6A 4H8WH 1ZLUK 6FABH 3OSVA 5C07D 1EZUA 4U1MB 5DJYB 4XC3L 5FO9B 4ORZC 1C5DA 2Q8AH 4BH7B 4GG8B 1ZT4B 2V7HB 2X70B 1S5HB 1VACA 2YPVH 3IAQA 2X4TB 1IC4H 5DQJB 3Q06A 4GW4B 2WYIA 3GZPA 3K4ZA 3UAJC 3UJTL 1QRND 1BJ1J 4FKKA 1J9TA 4HK0B 4M8RA 5LG1A 4OI9A 2W9DL 5BMFH 3GGWB 3O2WH 3B9KC 1E50A 2ADIB 2RA1A 2YKKA 4MD0B 4WHYG 3DJRA 4G6FB 5ICXB 3NIDF 3ZE1B 3ELQA 5A40E 1XF3A 3GPEA 3L6FB 1F3DJ 3EYFA 3ISWA 5FM4A 4YOKA 2WBJA 1KMGA 1X9LA 4UB0L 1UD3A 4FNLH 4NENA 3HG1A 3S34H 3Q0HA 4BSVB 4BYHA 4N0FB 2WKOA 2X40A 4PWEA 1HOCA 2LGNA 1JGUL 1RD6A 3ATFA 3BD5A 1H9DA 5ERWA 4P4RA 2VDOL 2H9GA 3FQNA 2BY0A 3ENEA 4JPWH 4ZS6C 1B4JH 5F1IB 1U21A 1FP5A 3E8UH 3JWDH 3P4OB 4FNUA 4FYRA 5E6UB 3TNMA 4O02B 1MREL 5D72H 1P4LB 3LPOA 3QPXL 2F0CA 5IP4A 4NHUB 4CBZA 1N9PA 4HH9A 2BK8A 2C3XA 2PKDA 1RJLB 2OMVB 1OGAE 3CZGA 3V2AR 1J8HB 4LCUB 1AE6L 4DGYH 2P5EB 3VQ1C 5KZCD 3L5WB 2GEQA 2HXAA 3OKLB 3EJZD 3WG7B 4XPAH 3TO2A 3UIZA 4NOFA 3MNVB 2YGOA 3BZFB 3BP5B 3EHBB 3VGEA 1UKTA 2HN7B 3I6KB 4TNFA 3NSXA 2L7UA 1TG8A 3GM8A 2A9NH 4JR9L 2EE9A 2EXSA 2F54E 4J3UA 1TVHB 3U1SH 2ZAIA 3KM2A 1JVLA 1YCSA 2FO8A 2I69A 2N3JA 3CFTA 1RZJH 3MVSA 4XNXH 2OBGA 3ARBA 2GIXA 1KDJA 1T83C 3CZUB 3Q6FA 4XO9A 3TBYA 1JF5A 1A6UH 4X7SL 4DQOH 4FF9A 1Z9LA 5HVHB 1G5AA 3KDMA 5CKGA 3TT1H 2HMID 1LHZA 4O5LH 4XBEH 4JPQA 3Q2VA 1ORQB 3DPBB 3EYOB 4XCEB 2UZXB 2B39A 3BISA 3MCG1 4X5WB 3AAZB 1KCSL 2A7BA 3K2MC 4PJAF 4XTRC 2BSSB 4QHNA 2WWKO 1BP3B 1HI6A 3QUMA 2GSGB 2K6YA 1F45A 2AXJA 4HF5L 5TE4H 1UFUA 5EO9B 3DMMC 2DLHA 4FLRA 4KI1A 7FABH 5CD5C 5IK3A 2VMCA 3DX4A 2J1XA 3FSVA 3ZE2F 4KY1H 2CGYA 1S9VA 3RTQB 4L3EE 4FABH 2BMKA 1TEFA 3VQLA 1HYSD 3L13A 4RISL 3LZFH 3HMXA 3IJ9A 1ADQL 4G7RB 5FK9A 1UC6A 3CCHA 2NDGA 4PJ7A 2JLLA 2G9HA 1YEHL 2P7TB 5HDRA 1GH7A 2FLMA 1GYUA 3OC5A 4WK0B 1IGFL 2HLFD 4N25A 4AQOA 1A1MB 4IS6A 5KS9A 1W72B 4MD5A 1WIOA 4LEEA 4LRIC 4NT6A 5C6TL 4H88L 1SBBA 1OARH 1FL3B 1S8DA 4XOAA 4N5EC 3O3BA 4HJ0C 1ITBB 4LK4A 2F7IA 1AYOA 3QQDB 4RFEB 1UD2A 4YS4A 5I1JL 1MIML 4WEUD 1KC5H 2BY3A 3TWYA 3ARUA 1IFRA 4LU5H 4WHDA 4UTBA 1E28A 4NQDA 3CXFA 4TVUA 3TA3D 1MFBL 1OGTB 4MMYB 2FBOJ 1X7TA 4G71B 4XVJH 2RQEA 5DD0H 4DPCX 4M5ZH 1AD0B 1LD9B 4BH8A 4UQ9A 5TDPB 3ZIMA 1KXHA 3GXPA 3SN6N 4HHGA 5B8CB 1OSEA 4NBXB 3HI1B 4CVWA 1KJVB 2FEEL 4ZX4A 2YD0A 1SM3L 9PCYA 5AZ2L 2VW6A 7PAZA 1MZYA 5G2NA 3O3DB 4QO1A 3T71A 1AGEA 2FATH 5HJDA 1CR9L 1NCJA 5I71B 2A6IA 4YBHA 3R4DA 3UTPD 1T1XA 2DQGH 4IMLB 1U8OA 5C0AB 5BOJA 4KVPA 1HX0A 4WEMB 2DJ4A 4PJHE 3V5DB 3UTOA 1U8NA 1WWCA 4IOFC 4L4JA 5EU4B 2Z31D 5CCGE 4UDUA 4R96A 4KK9C 3TWCL 4IBZA 1ACZA 1U8QB 4XNUL 3X13A 3SOTA 3UH8A 4HV8A 1XCWA 1R4XA 3WFEH 5FGSA 1KPUA 1ZCRA 5DR5L 1CFVL 2D7TL 4NWTL 1JD9A 3LZNA 3IT8D 2DYRB 2NXYB 1S7TA 1HH6A 3KPSB 1RJZB 4QHUA 3BPLC 2J88L 5D1ZB 5IMKA 1FLRL 4JDEB 3WAKA 3VXSD 4BE6A 3LEXA 4LHUD 3PAUA 1BW8A 3MO1B 4N2BA 4PJ8A 5AUMB 2CRMA 3ULUE 2ZUUA 3LXBA 4UV7L 5DD5H 3TV3H 3O11B 4UNUA 5ICZA 3L1OL 1JS4A 3MREA 4K7PY 4CMHB 4ZFGL 2PNDA 3SJVD 5ISZD 4JRXD 5IOPA 4JPIB 1TTUA 5IQLA 1NFDB 2IV9A 2ZUSA 4OF6A 4X8JA 1WS8A 1GZQB 3FONA 4QF1B 5D1QB 1RHFA 4LDLB 4EEEA 3NFPB 2ZSWA 2A2QT 3S48A 3NFNA 4XNZC 1ZV9A 3WD5L 3I3BA 4ZFFB 4IKKA 3KYKH 3KPPA 4BRVA 1M3JA 4UQBA 4Y4KC 4HBCL 2K45A 1SJEA 3BC9A 5HGBB 4Y4FC 5JOFB 1KB5L 1UWEL 3IETA 4FFZH 3FQUA 4Y2NA 3TT3H 3AADB 4X6CE 4CVZB 4MVBC 1JHKL 3QG7H 3RX7A 1PD6A 3WO4C 2EO1A 2FYYA 3WNNA 2XFXA 3RWCA 1F4YH 3ABLB 1UENA 3BVNB 4GY4A 5DJ0A 4C55A 2I9LB 5DHYA 3QXAB 3L5HA 3N91A 4E5XB 3DSFL 4K94H 2RFXB 1OAZH 3DV4B 1IEHA 4ODVL 1I3RA 5CHNB 4FFVC 2Z3FA 2Z0UA 3HG5A 2F74B 2OI9B 4RDBA 3GSVB 4Q9RL 3L5XL 3FUKA 1XEDA 4WZ9A 4QJ3B 2XA3A 2BHZA 4GS7C 1G7MB 2DLEA 1DSWA 1LWJA 5DD6A 5EN3A 4ZNEA 1WDAA 3IYLW 2Z9TA 3GUFA 5GQBA 5LBVA 4M61A 5AENA 4OLUH 2EACA 5T5FA 1RZ7H 1RHHB 1TPXB 2A0LD 2K6ZA 4HC1L 3NPSB 1K4DB 2EUZA 2CZNA 5C1MB 3BWUC 3UYRL 1FQ9C 1BVKA 3TBSA 5BVPL 2KLRA 2YD9A 3QORD 5D7IE 3MXWH 3RB7A 4MCZA 1Z5LA 2ORBL 1OAYH 2G2NA 4W9ZA 1NEZG 4KTGA 1JPTH 4M6OL 2ZUVA 2VR5A 4N87A 4NJAL 5GZOD 2VIRB 1VJSA 2HT4C 4PGJA 2DQCL 4EDWH 4E9VA 3FB5B 5FUCC 4PVMA 2D3VA 3NVQA 5C09D 3UG4A 1BQHG 3GJEA 1PD1A 1T89C 1WZLA 1YMME 3AXIA 3ZY7A 2L04A 1JK8B 1LMIA 2A1WL 2ZOTA 3QDJA 4I13B 4R90L 4RFNC 3ABGA 3VFOA 4HD5A 1N64L 5CZVH 3SKMA 5GSRB 1FL5B 3MBWA 3QAZC 3HB3D 4Q89A 1MG2C 4I0PB 5JHMA 3HC4L 4EI5B 4BWTA 3DIFB 1EMTH 4XNQA 5TH2B 3QJHB 3BAEL 4GMSH 1QTPA 1GC1H 4K5OA 3QYNA 4TNWF 1DBMH 4OGAC 4QDGA 4DKFL 2CLVA 2OQJB 3ESUF 2PYEE 4GKZB 4HISA 4FN0A 3BWAA 4P3WA 5EDXA 5TDNB 5I1KH 5AAPA 4FLSA 5K1NA 3AUWB 5E5RB 5TJWK 1EO8L 4ZUVB 4HKJA 4JO4H 4YXKL 3L3JA 4FG6C 2FO1A 2H1LM 3N42B 5HHPB 3DO4A 1HKLH 3MV9A 1EFXA 5DZLA 5L6YL 3QJFB 4N0UA 4UYPA 4ZQKB 5JIHA 4GP4B 4JANB 1BBDH 3FUHA 1I53A 4WUKH 3H0TA 1SF3A 4WFED 5JW3L 1QUPA 5EBWB 3SYPA 4I9WD 3D33A 2XXMB 3PPSA 2PWFA 3MRCB 4W9IC 3FQ2A 3IWUA 3KWUA 4NX0A 1KLUA 5AKSA 4L5FH 4X42A 4DP0X 1WS7A 3AFLA 3ZVVA 2PPAA 1OPGH 2YEVB 4JFED 4YDVB 2NY4B 3MLRL 5ESVB 2VDNL 4R4NC 3VFPB 4KPHH 3LZLA 3O3EB 3WENA 1QEWA 2DJUA 4AXWA 1DYZA 3EH5B 1JK9B 3O81A 1T0OA 4WI7A 4AITA 3K91A 4F24A 4C54A 1WH0A 4DVRH 2IH3A 1E4XH 5D2NC 3L3GB 3GMPA 2OXGA 2RR3A 2NY1C 1S7VB 1W6LA 2DH3A 4PB9H 4ETQB 4ES9A 4YK4C 1G6RB 1HXMA 4DJMA 4Y5VC 4XMUA 3CDGA 3GS7A 4XB3A 2X38A 3H9SE 5EH1A 4HKXB 5EOQH 2Q8BH 2DL9A 1OGAA 1T7XA 1WD9A 4UM9D 3SCMA 4CMMA 5JO5A 3ETSA 4AQAA 3ZGHA 2DQJH 1FORL 1G0YR 3WY4A 4P57A 1SLUA 2CDFA 1Q90A 1Q0YL 5CKAA 5I75C 3C60C 2IGLA 2VRQA 2OCJA 3ILQC 2NT0A 4I3RL 5L9DL 4O4YH 2VRAA 5FFOA 3GYRA 1PJWA 4FHJA 5I19H 3STBA 1KNOB 5K9JL 1RUKH 1R0AL 2GFBB 2F54A 2ZUTA 1CGTA 5I2IB 2X4RA 4XC3H 5T1KB 3BGMB 2QMKA 5ILTL 3S4SA 3V6OE 1UZGA 2ZX6A 3M8OL 3VWJC 3VXME 1SLVA 1CL7L 5GJTL 1W8EA 4CU7A 1XO8A 3LRMA 3IJSA 2WBJD 2WLKA 3KLKA 3UJTH 4N0CC 1HQRB 2DQFB 3WGUB 5JHAA 3SPIA 1MNNA 4G8GA 3S3JA 2W9DH 3HUJB 3HG1D 2HKAA 3ZTJH 4BGLA 4DO5A 1U8HB 1T4KA 3PDOA 1N7ML 3ZTJG 5FM5O 4Z7OB 2YARA 2WXGA 3WNOA 2EVGA 3VNZA 1LNUB 5LHDA 4JVPA 3EIFA 1HN1A 2ZWLT 2R29L 4UB0H 5I76B 4OM1L 2DI8A 2W95A 3KEDA 2VDQB 3D08A 3OV6A 3UERA 3TEWA 2BSDA 3QQ9D 1U2YA 4JAMB 1JGUH 3PL6C 4JHWL 4M4RA 5EC2A 2PABA 3M17B 1MVUB 2ZWSA 4FRWA 4L3EA 4CN1A 1G6VK 3DUSA 1L9OA 4PS7A 4PVBA 3SB3A 5CR1A 3CNKA 1IKOP 1MREH 1MJ8L 1CD0A 2EKJA 4KGLA 4M03A 2WZ6A 3QPXH 4M7ZC 4XN9A 4O58L 1JERA 4Q14A 1MEXL 4HUWA 4I2XE 1QEXA 3UBXI 5JHDA 3QIWC 1AE6H 1ED3A 1QSVA 3IKKA 2EIJB 1HHIA 1NUGA 1ZXKA 3ARBD 4LESA 1XTMA 2WXRA 3HMXL 2CRYA 2BWIA 3V0GA 1U0QA 2QV4A 4YPJA 2R4SL 4JR9H 2EYSA 2KERA 2ZXDA 4NRZB 4Z0BL 1MY7A 3TBVA 2M26A 3IPBA 1FVDB 5F9WC 5J3HC 5C0CB 5DI8B 2YAFA 1GXEA 4PJBE 1I85A 4XZUB 1ZGLP 4E41E 3RZCA 1MCEA 4WQOA 4X7SH 5HHMB 3THML 1ONQA 4PWHA 4OUOA 3KLSA 3FUNA 2VABB 1UXLA 2BVOB 5ANMA 3ZKXB 3LN9A 1AKJB 1D5BB 3BEWA 5SWQA 5FC9A 3LB6C 4N1EA 2G60L 4AYMC 1PCSA 1KCSH 3CFKA 1YPZB 4LL4A 5DC2A 5E03A 3VXPA 3OJ2C 2YKLL 5GRWA 4R7NA 4HF5H 5F9AC 4ZXBB 4AQ1A 3GZQA 4LLMA 4LLUB 4GH7B 2UUDH 4WW1B 3GSOA 3RPIB 4LBEA 5KJ4A 1UM5L 4J3SA 3QQ3B 1U8KA 2FEEI 3U4EB 3UBXG 1YEKL 4U0RB 2E9JA 4MNQE 3BP7A 4RISH 3FO9A 3LD8B 1TJHL 1V55B 4JO1L 4D0DB 1D5MA 1L7TL 3RDTA 1ADQH 2I7OA 2LLGA 2VAAA 2XETA 3VWKC 4UTAL 3GMRA 4UBDC 5F7BA 4WWID 1YEHH 3BSGA 4N2EA 3UDWC 3VI4E 1DFXA 3NK4A 1IGFH 1BJMA 2OXHB 4HEME 3G7TA 5J89A 3IXTA 2WHVA 1CCZA 1U8MB 2Z0BA 4JDVA 4PP1D 4M1GL 1KBBA 3R0NA 5C6TH 2LTQB 4H88H 4J3OH 2PXYC 3QUKA 4NQDD 4J3OG 1KB9K 4JRFA 1J88A 1BVZA 1IBBA 1T20B 3CFMA 4A55A 3MCKA 1H15A 3T0BA 4I85A 5EORL 5I1JH 2XNAB 1MIMH 3V0DA 1GJUA 3BI9X 2YXWA 1IC7L 2O5YL 2BZDA 1H3TA 4JMNA 4M9PA 2Q6WA 1KYOK 3RGVA 1NC4D 3C75A 3D39B 4PPTA 4ZO9A 4I89A 4JMXA 4QRPB 1MFBH 5F2FA 1RIUL 2YSSA 1VHPA 3EJYC 2Y23A 1LO2L 3FB8B 3ZQ9A 1OE3A 1FV1B 3QEUA 2XV3A 4RESB 2VNCA 1NFDF 1WAAF 4P2OB 2Z7ZA 2NCEA 5J13C 2K9FB 4PMFA 1SM3H 1D5XA 5AZ2H 1ITCA 1UURA 3SQOL 4APQA 1RP9A 4FAAB 5FHBL 1XTLA 2V2XA 3MLYL 2MOGA 3F04A 4MDJA 4QOKA 5DEFB 3S5YA 1CR9H 2BW4A 3GWJA 4BUGA 3EZ8A 3PGDB 4X6CA 2JH2A 3ARPA 4NN5B 5KSUA 1P9MA 3QUZC 1ZGLB 4HJEA 1GYCA 4PGDA 4QRSA 3V7MA 1UOVA 2VXSH 3AT9A 4XHJD 1U9KA 4Q8BA 3APMA 3TWCH 1MHEB 1I7RB 2LU4A 3BUIA 4JFSA 4XNUH 4Z7QB 5KG9B 3NJJA 2WLNA 5CIPH 3QUYA 4JZJA 3H1ZA 3SKOB 4OCXL 3KLHC 4FX5A 4WJ5A 1M05A 1A9BA 2WTRA 5F9JB 2QTVA 4PJ8D 4GRWB 1D5RA 4Z7AA 1KCBA 1CFVH 5DR5H 5FWQA 2D7TH 5HYSB 3L1GA 4NWTH 4EUPG 1F1GA 1AO7B 2X87A 1E2ZA 3H3PL 3MV7B 4FQJL 1X3DA 4UQDA 2SEBB 2A83A 2J88H 3GHEL 2WJ7A 4AWJC 3FOLB 1A6WL 3H9HA 1KOAA 1YUHB 5FYJE 3VGBA 2MNWA 4F2MB 2G4EA 3KPRA 2X6AA 3SYCA 3KPQB 4RGNB 4UV7H 1MCSA 3RE0A 3UTTE 1F6AB 2UX6A 3L1OH 4ZFGH 3VRJB 1K5NA 1ZV5A 4HGWB 4LCYA 1LDSA 3A6OA 1FIGL 3Q3GB 4WV1A 3S5LB 2C1PB 1M6OB 1BJ1H 2OJZL 4KJWC 5D7IA 3PWNB 4ACPA 2FJGA 5EO0A 1OT1A 4FKHA 3TBCA 1E90A 4GUPB 5IIEB 3P0GB 5T5FL 2X53A 3LEVL 1F3DH 3PV6A 3DXAE 3EFFA 3WD5H 3ZDXE 3VH8A 3ULVF 1IGYB 4V1DB 2MQ0A 1NGXA 4HJGA 5GZNA 3IGKA 4D2NA 5BZWA 4HBCH 4F9LC 1L0QA 1CFBA 4PWGA 2AANA 4XCNB 4R9HA 4DQAA 1GMEA 3MNMA 2MQ3A 2AABL 1KB5H 1ZT4A 2ZYSA 4HX1A 1WGVA 4AEFA 3D18B 4I4WA 1UOKA 2CNZA 4AX3A 4QT5B 1OAXL 3P4NA 1JHKH 1A1OB 4LCWB 4WWNA 3O6FA 5IWLA 1BVLA 4RA0C 3EDJA 4AE0A 2YLKA 4G9DB 4X6DB 1U92B 2C9SA 5AOJA 4ZX3A 3OKMA 2PYEA 1A6VL 4XRCA 3DSFH 5BJTA 2JTDA 4J3OC 4ODVH 4WENB 1JMZA 1GMIA 4Q9RH 4OIFA 4HMDA 5LB1A 3L5XH 3SD5A 4K5NA 4GRMB 2R23A 4N8CL 2CU9A 2CUMA 3X12B 5HPOA 2V37A 3B56A 1MCCA 2DLGA 4I3SL 5I16B 4HU8A 4B7LA 2G3NA 5B4MD 4N90D 3P40A 3FU3A 5DURD 4D7PA 2VN5A 2I5YL 3GI9L 4X5RA 1LLAA 2VR8A 2X2JA 3MCYA 5F1IA 3LSOA 1X44A 2QZQA 2WAQA 4F1ZA 4HC1H 1OTSC 4MS8D 3TURA 1WUZA 4NHUA 2KUTA 1SBSL 1NPUA 4U1SA 4J4PA 3A4AA 4JM0A 3T65B 3UYRH 4BHUA 5HBBA 4F37F 3S96B 4KH2A 5BVPH 1H9VA 3QDJD 3NZ8B 2P5EA 1JHTA 3UPAA 2Q3XA 5IQOA 1QBAA 2ORBH 2J5LC 2YSTA 3K80A 4M6OH 4NJAH 2VZ3A 3RIKA 2FBRA 3FT2B 3FCGA 4L3CB 5TGBA 4X7DC 4KUCF 1KBGL 3QQXA 3BUYA 2DQCH 5ID0A 4Z0XB 4FEIA 4KHXL 4RBPH 4Y2DA 1LMKA 1FNAA 4RA3A 3V6FB 3HAEG 2ILLA 2ZONA 3ML9A 3ROOA 4R90H 2A1WH 2XWTB 3FHAA 4X7EC 1JPST 4NDMA 1N64H 4IMKA 3S35X 2NXZD 3N50A 5GS1C 4B9GA 4MJ4A 3CDZA 2QL1A 3ZK0A 4X9FA 3PJSA 3HC4H 4LMQE 3H9SA 1CK0L 4WY7L 1QTYT 2IH9A 3BAEH 4JQIA 4X4YB 2NY5C 4JQXA 4NAMA 1EJFA 3MOAL 2VISB 4YNYB 5L2JA 2OMUB 4DKFH 1CJYA 4GSXA 3CFQA 3W39A 3DKHA 3FQTB 3MV9D 1EFXD 2J1ZA 5C0RL 3DOHA 2CALA 5A2LH 2QQQA 4JFHE 4ZODA 4B9PA 1EO8H 3ORJA 5GS0L 5DTFB 4EN3B 1U30A 4NAJA 2V5YA 4L8DB 4TL5A 4OSUL 1M7DA 4YXKH 3VXMA 4FXTA 3HZVA 2CMRL 4MA1C 3V6OA 1EO5A 5A7BA 5I5IA 3KW7A 4KJPD 2Q7AA 1JGEA 3WY2A 5KVDE 1IE5A 3BT2L 1ZS8A 4QTIL 5SWSB 1AHKA 3I9PA 3TA4D 4P99A 4KWUA 5JW3H 1VAHA 2P5WA 5K39A 5A43C 3F6LA 4G42A 3C09C 1TXKA 1FH2A 3AG3B 4KJYA 1IE4A 4OBSA 3SGJC 4PRHA 1RP8A 3HUJF 5I8EA 3MLRH 3BE1L 1OSYA 2VDNH 4OFDA 4C4KO 1N8ZA 3PGFL 25C8L 1ROCA 2UZYA 4AE1A 5J12B 3VXOA 3RPBA 5H94B 4YFLF 4V2BA 1G43A 1QSEA 2P43B 4QAWA 3PQYB 4NNXA 1HFUA 4WGKA 4ZTPL 1NUFA 2A73B 5GS0D 5D9SB 2BOCB 1OGAD 3G04B 3SCMD 2H0JA 3ZTEA 2JLPA 3JQOB 3Q5YA 1CFQB 4RFEA 1EHXA 1A7QL 2MHAA 4O51A 3QCUL 1C9SA 1Z5YD 3WEXB 3RHWF 1CTMA 3QB7C 5GGTA 4KVCL 1LVEA 2MTPA 5E4EC 4J6IA 5EU7C 5BXFB 4LVHB 2XU9A 1FCCA 3QH3B 3QZPA 3M07A 4Q4EA 1OY3B 5B1KA 2B59A 4I2XA 5DF0A 3U4BL 1FORH 4ZYKB 2F54D 3LKQA 5T1MB 4HKZB 1A6TA 3FQ4A 5EPMA 1Q0YH 2HRPL 2FSEB 4Z7VB 4TV3A 5JORB 4B3VA 4HIQA 4H1LB 1PFOA 2DKMA 4I3RH 5L9DH 4WNSA 2EVHA 2NUPB 4A7VA 4I7ZC 2HJLA 2XZQL 5K9JH 3BRDA 5HDQL 4G8GD 4LB8A 4WHCA 2XOTA 2YXVA 3A4FA 2ZWKA 1R0AH 1FFNB 1NCOA 3QJVB 4DWHA 5ILTH 3M8OH 1P2CB 1J11A 2K1MA 1P5VB 3G5YB 4GXUN 4PJBA 4I9XA 5GJTH 3RBSA 4P9HC 4LPYA 2NY3C 2R51A 1JDAA 1QWHA 1RZFL 1RURL 1QFWL 2A9ML 3C6LC 3DVFA 1TJXA 3DO7B 2JKSA 1N7MH 4CU6A 3FN3A 3RYMA 1J1PL 2FIRT 3DIVA 2X6MA 3GBML 5ABZA 4L3ED 2EDNA 2AAVA 3DPDA 3DURB 3G08A 4P4KA 2R29H 5IW6A 3PUUA 4OM1H 2YK1L 5INCA 4CVXA 2G0KA 3NABL 2B9AA 1MRFL 3ARGD 4GRLC 4JHWH 3B37A 1HS6A 4AV5A 3V0JA 3IDGB 4H25A 5JHDD 3D7PA 5D2LE 3TCTA 5A1AA 2XXCB 4D9QD 5JOPD 1MN4A 3SE3C 2CIIB 1LE9A 1MJ8H 4HETA 2AITA 3ZT7A 3TPUA 4H4NA 4O58H 3VI4A 1E8YA 1ASQA 2R1WB 3EFOB 4QF1A 3X1GA 1MEXH 4HEMA 4YXHL 4BEIA 4NZTL 3QIBA 4R7VA 1TYRA 1GJWA 2VSMB 3IDUA 3CFDB 5IMLB 3VD2A 4G7QB 1ICTA 4HWZA 3OKNA 1SXNA 3WKNA 4Z77A 1HH9A 3QEGL 2JJVA 5C9JA 2X4OA 1UH3A 3K72B 2VLKB 4R5TA 3RZCD 5G5DA 1T66D 2IEPA 3V8OA 1CLOL 32C2B 2WSDA 4OJFL 3FUDA 5EHFA 4GQZA 2R4SH 3MN8A 3H54A 3WELA 4Z0BH 3F05A 3OMAB 2FSDA 3LKOA 3EUUA 3NP3A 4GIAA 1MDAA 1YN6A 1QR1B 4U2YA 1AS7A 3TBBA 2EIEA 5AAMC 3TNNB 1BQKA 2GBAA 3QUHA 4OI8A 4IKIA 3THMH 2I9LA 5BUAA 3QXAA 5AYTA 4FERA 3WTXA 1BZ7A 2IANE 1OTTC 4BM7A 4O2FA 4NO5B 3ZKNC 1RZQA 5E6IC 2ESVA 1MRCL 2I07B 3H4FA 4K71C 5CLZA 2G60H 5IBLC 3I02B 2F18A 3C9NB 3SDDB 5KS9F 4LOVA 5CBEB 4JGNA 2R69A 2YKLH 4LLVB 4YDLB 1QWNA 1AQKL 2GK0B 2F53E 1NCTA 4G7SB 3RDTD 5B21A 1MQKL 1ZT1B 4EVNB 1UM5H 3DVGB 2DIAA 2Y22A 4L4TE 4XNDA 5MERB 1J1XL 3WFCL 4ABUA 1YEKH 3MRKB 4Z9KB 3WUWG 4ODXB 3T4AB 4YN3A 3MRGA 2AK4B 2WQUA 1TJHH 4C4BA 1A6AA 4JO1H 1T0MA 1L7TH 4UCFA 1UVQA 2Y7QB 4MB1A 4PBXA 1ZE3H 1N70A 3W0WD 4UTAH 1J86A 4OGQC 3K8LA 3MRBA 2P8LB 1QFOA 3DLQR 1A22B 3SDCA 5HDBF 1TU2A 5SV3A 2I9TA 1QZ1A 4XMPL 2KHAA 1FHNA 1QBML 5IV2A 2AEOA 4X8CA 4M1GH 1NCUA 1NAKL 3KPTA 5D93C 3H55A 3RGVD 4FLHA 5B1JC 4UDTA 4AT6B 3W9DA 1X5IA 2ZXQA 2W07A 3MRIB 1FL5A 4JKLA 3FSAA 4PJHB 4UZGA 2FWSA 4X6EB 2NY7L 4I0PA 4MMXA 4EI5A 4O2CB 3OG6B 1OANA 5EO1B 5EORH 4ERSL 3GIZH 3L3HA 2EDMA 3PS6A 2AJ3B 4MQSB 4AL8L 4OT1L 1IC7H 2O5YH 2OCFD 2QVTA 3NCFB 3QA3B 4APQD 4NQEE 1RIUH 5FECA 2YPLE 2G5BA 5DUML 3TEXA 3UCRA 4ANUA 4JRYE 3IK2A 4WHTA 1LO2H 4QOKD 2WCPA 4C56E 1J5DA 1XH3A 5TDNA 1XGYL 1IM3A 1FF5A 1DBJL 4G83A 3MRRB 3DXAA 1HJBC 1AQMA 3GSNL 5KAQG 2EIZA 2V2WA 3QNZA 3TIEB 2VERA 4L0PB 3SQOH 3ARFC 4CC4C 5FHBH 2NY2B 5AW6B 3DUUB 1HXKA 4PJXA 1RUQL 3MLYH 3UMNA 1JPGA 1UUSA 2C3WA 3DDFA 2AW2A 2BDNL 4XMXA 4ZOEA 4NO0A 1FL6B 3CSFA 3QUYD 2CJSA 2ZZUT 4NQCE 5DVKA 5BV7L 2C3GA 2P8PA 1O9WA 1BZOA 3FZUC 1LO4L 3RL1B 1S9WA 3IAPA 1E4WL 3F12B 1U95B 2EYRB 3ZDZE 4QTHA 3ZL1A 4OV6F 4MCMA 1BYPA 3N85L 2E7CA 1H6UA 4WTZA 2Y5TA 1SFHA 4KKBC 1JZ3A 2O61B 5KVEE 4X6DF 2Q7YA 4QHKJ 1W6WA 4OCXH 3OAZH 5JZ7D 4JFPB 3WN5B 1TZGL 3KPRD 4HIEB 3P73A 1NGYA 4FFYA 4AEHL 4AG4L 3H3PH 3JV4B 3BGAA 4KK8D 4FQJH 1F58L 1ZHBB 3ERXA 3GHEH 3SDXA 1WBZB 4TN9A 1D7BA 3L3GA 2AC0A 1A6WH 5T1LA 3D4YA 5J11C 4YXLL 1MHCB 3OL2A 1MH5A 4X4ZA 1UOLA 2X4QA 2XACC 2D3NA 3BQVA 4FA6A 3CFUA 4H8QA 1JZ8A 1I1AA 4LIQL 1JF1A 3D0VA 3KVQA 5FR3A 5E9DD 4AGLA 3INUH 5IW1B 1HNYA 1CGYA 1FIGH 3MJ8A 1T1ZA 1P6FA 1BZQK 2OJZH 4JM2C 4PRDA 5GZND 4J23A 1FE8L 1R5WA 2WY3B 1Q94A 3O8XC 4F7TA 1T04B 3SDAB 2Z4TA 4PJGB 4F7CB 4ELDA 1DEDA 1TMCB 3TFKD 3VI3B 5K69A 5T5FH 4O02L 3U9WA 2C1OA 5IEHB 1TQTA 3DOSA 3LEVH 1WO2A 3AY4C 5JPNC 2XZCL 3O6FD 4N9GB 3GZOA 3OHXB 1IIIA 1WFJA 1KV7A 4JL1A 3T04D 1TJMA 4PJEE 4AUJA 2PYED 1M2VB 3MYZA 2AABH 4QY8B 2X2UA 4PWIA 1XGPB 3F8UB 3K81A 3O2DL 4WI8A 5FS5A 5CLYA 3ZYOA 4XP9L 5DUJA 1OAXH 1WFOA 1NINA 3F85A 1OQOA 2AQRA 3HHSA 3LNDA 4OFPA 4Y9BA 3LRHA 3GTVA 1ODUA 1N4XL 2ZPKL 4ZUWA 3QHFL 4X80L 4XPHL 3RVWD 1BFOB 5A2IH 5ICYB 1A6VH 1BPLB 1EXHA 2WQRA 5IHHA 1AOHA 1HWGB 2IPTL 4ENED 3C6SB 1AQ8A 3DJTA 1ULVA 2QADB 3B83A 1BZ8A 4Y5XC 4F37K 4N8CH 1YMMB 4YSPA 4I3SH 3GMNA 4GINA 4FI8A 5D7HA 4LOUD 1TQBB 4J4PD 4W6YB 4Y16C 3VB9A 3RFZB 5C8JB 4P0DA 2I5YH 3GI9H 4DP7X 3CH1B 2VO5A 3KE0A 3Q6GL 1B0GB 2P5ED 4IIQB 4POUB 3UGUA 1HESA 3D12B 4RMSA 2O26U 2DL2A 4YDMA 4L9LB 2JKNA 1XXDC 1SBSH 2XTJB 2WP3O 3P69A 2ETWA 2PYFA 1EWHA 2R4RL 5JHBA 5LKNA 3QFJE 3DX2A 4FQCL 1SN2A 3UC0H 2JJTA 2OR9L 4AMXA 3T1FA 1TKWA 4ODWB 2X9ZA 3BN9C 3FYEB 3NCBB 1LP9A 4LLYB 2CGZA 1I8MB 1U6AL 3JTTA 5CEZL 1KBGH 3ASNB 3H9SD 3IS1X 4KHXH 3U46B 3NZUA 1QKZL 1W8NA 1KY7A 3CHXA 3OWRA 3WS6C 4AZ8B 2V9RA 3DVNA 4IEFB 3I6SA 4PBVC 3KYOA 2YQ3A 1KG0A 1W72L 2HLAB 3DRQB 3F5WA 4UQ3B 1MWAB 2MFNA 1UM6L 2JK5B 1CK0H 2XWCA 4WY7H 4BSWA 4KDTA 4U1KB 1DVFC 2EDBA 1D5ZB 2FL5B 2W65A 3ESPA 3CC5A 4JFFB 3FCTB 1YN7B 3CPLA 4FFTA 3F6JA 4XR8C 5DSCB 5DVOA 5IW3A 4F7EA 3U7WL 2GI7A 2YBRB 5C0RH 5IJVB 3S8FB 2WZ5A 3FTXA 4LSQL 4F7MA 5LGKA 4W6WB 2RMNA 2WN2A 4IRZL 4P23B 5BZZA 1P7HL 2ZWZA 2EIMB 5C9KA 5CEZD 4YZFE 1HTYA 2P5WD 3TVMC 4LPUA 5GS0H 1KWKA 3ESVF 3LPGA 3HBZA 4OD1L 4RX4D 4OSUH 2CMRH 2BRQA 4PRHD 1U41A 1E6JL 2BFVL 3T0EB 3CDYA 3BT2H 2AK1L 4QTIH 5AG8A 3DX1A 3MLZL 4HFWB 4MAZA 1C7TA 1EEYB 4KI5D 4LKXB 3BD3A 3QS3A 1JUFB 3EO1A 3GBEA 1T0NB 3GHBL 2BP8A 3HA0A 1QSED 5GS2D 3WNJA 2I24N 3RHWK 3KNBB 1R3HB 4C83B 4JZNA 4HZLA 2OXHA 4Q9BA 3BE1H 1N8OE 3N1PC 4M5SA 2ENQA 5D7JB 5D7LA 3PGFH 25C8H 4JS7A 1T5KA 3X11A 5AZUA 1RZPA 2WLHA 5F6IB 3JZ7A 4OB5L 2WTOA 1JWUB 3DTXB 2FAUA 3B5TA 1UZ6E 2J3SA 4CU8A 2UXFA 4ZFZB 4NRXB 2NR6C 5HI3C 4HOMA 2QFPA 1BG1A 1RZGB 5D96B 3EBHA 5D2LA 1A7QH 4N28A 3QCUH 3ZO9A 5FGCE 5AAWA 4KVCH 1PQZA 1JWSB 4AVIA 3TASA 2E76C 5K93A 4OUUA 2JELL 3UOAB 5JHLL 3I6GB 4F15B 1JGIA 3FH5A 1ZWIB 4Y4HB 3NZSA 3RWDA 1QATA 3SHSA 4Z7NB 3U4BH 2Z91B 5C0AD 3B6SB 3DK0A 3FQXB 3D25A 2O6DA 4AIZB 4UQCA 1P7QB 3CFEA 4DEPC 2ADJA 4MKTA 3HRZC 3GJFA 4QHLB 3WN6A 1J5HA 1AGCB 1DO6A 2XKNA 4UIMA 4XOBA 2XZQH 1JVOA 5HDQH 4QRTB 2B4CL 5DJ2B 3SBWC 5KJ7E 2C9VA 2OTUB 3W9EA 3WE6A 4OZGA 1NANH 1TZHB 4OTXH 3B9KB 4P4KD 1N6QL 2NXYD 2C8NA 1RZFH 1RURH 3FT4B 1KPRA 1SY6A 1OT4A 3QUXC 5DYOB 3VUAA 1QFWH 2A9MH 5IFAL 2O6PA 3QEQE 5DS2A 2EIDA 3G9VA 3BPCB 3P9WB 3QRBA 2LT9A 3DBXA 1J1PH 3GBMH 5E8DL 4CAGA 2DY2A 5K9OA 1U93B 3IMVA 5DS8A 2B14A 1U8PA 2MWCA 1HSBB 1A7NL 1L0PA 2YK1H 3KDPB 1IGCL 1GY2A 1ES0A 3NABH 5T3XL 2GAZB 3BP6A 1FLTX 1MRFH 4WFFE 2X89A 5B1CA 3SKNA 4B41A