1TEYA

Nmr structure of human histone chaperone, asf1a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
156
structure length
156
Chain Sequence
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords ASF1 anti-silencing function 1 homolog A
publication title Structural basis for the interaction of Asf1 with histone H3 and its functional implications.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 1teyA00
3AADB 4ZBJA 1WG3A 2DZEA 2IDCA 2Z3FA 2IO5A 4EO5A 2HUEA 2Z34A 2I32A 5BO0D 2CU9A 5BNXD 1TEYA 5EIIG 1ROCA 4RRPM 5C3IA 2IIJA 2YGVA
chains in the Genus database with same CATH superfamily
2DM7A 1G4MA 2FL5B 4QYOA 3FFDA 4WI4A 4WI8A 1E4KA 4DKFL 4PRHA 3O6KH 3X12B 4RGOH 5TPWL 5LG1A 5PCYA 4LCCB 4FZEH 1ZHLB 3T4YB 4ZFFA 3E8UL 2DYPA 5B38G 4FQJL 2W65A 4DEWA 2EDBA 5T33L 3HC4L 3TX4A 2HJFB 3VWJD 1HDMA 2OR9H 3QYNA 2JB6B 3QFGA 2J6EL 4HUKB 1UOWA 2WLLA 4G70B 1TT6A 3QFJE 2YXMA 4JL1A 4UOZA 2XN0A 1ZV9A 5FGBC 3EOTL 4XNQA 5D7IF 5AVXB 1SXCA 3O2VH 4HF5L 3NCCB 4XXDA 1R4XA 4U6YA 5EF0A 1BBDH 5H94A 1XO8A 3H2PA 1OP3H 2J1YA 2EUZA 2FR4B 2AABL 4IKLA 3SQOH 2VDLB 4JS7A 3VE0B 1IVLA 4I5BA 2XT1B 3H0TB 2HAZA 5IW6A 4HSCX 2NNFA 1CICD 1HL5A 3FQ1A 3JTTA 3KWXA 3S5YA 2QELA 4E9LA 3TWCH 4B7IA 1UJ3A 5JW3L 1XSKA 3P4NA 3FYEB 1A6WH 3BAEH 3UYPB 3CZEA 4H0HB 2GJ6D 2A74A 1KCUL 4FQHA 5J6HB 4LSUH 3PNWB 4HYTB 1EERB 1DJZA 3L3GA 4OCWH 1M6OB 3Q1EA 4NHUA 3BKJH 4X0NA 4AYGA 4ZODA 3TCXA 4EN3D 3TO4C 2ORBH 1B9KA 2V2XA 3LKPA 5HDBB 1J87A 1VFOA 3BSGA 2X12A 2JJUA 2R0LL 3W0WE 5F1IB 3RDTA 3NCWA 1FG2A 3RNKB 1A6AB 3L4VA 1H6FA 4WO4C 1VA9A 3RWCA 3QXWA 5D6DA 1PIFA 1GIGH 2RMNA 1F1GA 2ZKYA 3FTUA 4ZUUB 3KPOB 4CL7A 3GMLB 5GS0L 4Z7AA 2NSXA 3ABGA 3RY6C 2FZ3B 3UX9B 3LKOB 2A9DA 4KV5E 3T0EE 2J1KA 1KGWA 1UFGA 2GB2A 1WBZB 3D0LB 3MRNA 2PETA 3OKDB 4AYFB 1KGCD 4LSPL 5FO7B 4JFEB 2WY3B 3LRKA 4UU9A 3H9SE 1A7NH 2ADYA 3G6DL 4MCMA 2R0KL 2R1XA 1YDPB 2M26A 4HIIA 2VM3A 2AEPL 3T71A 4L0YA 5C2BH 3EYFB 3BO8B 4R8WH 2H26B 2F19H 4J4PA 3SZKC 3VWJB 5A2JH 5L7XL 3CCHA 1HN1A 3IDMA 4M3JA 3BGMA 4GQQA 1OM3L 2ZSVA 4CADA 4ZX3A 1A8ZA 5FPIA 3PWUB 3TA3A 3BQUA 3K0WA 5I1DB 3BDYL 4FMVA 1E6JH 5KYYB 2XSKA 5EC1A 1QSFE 4X2UA 4HMDA 2H5UA 4A2HA 3A5VA 3WFEL 3NUKA 4YHKL 4LKXB 5BO1H 1SJEA 2XA8L 2IH3A 4EIGB 2E59A 2BCMA 3GBDA 3NH7H 4U33A 2FVNA 4X7DC 2D31A 3IS1X 4M5YH 2A9NH 2H1PL 1AQMA 3QYCA 5K9OB 1H5BA 4MKTA 1JYVA 5DT1L 5B39G 4D7PA 3MLSL 1SHWA 3BH4A 3OWRA 1ZTMA 3E8VA 3DUUA 1S7WA 3MXWH 3TN0D 1KGIA 1SXSA 5J89A 1HHKA 3RNQA 3KYOA 1EFXA 1JF1A 1CICB 2BPBA 2D0GA 4KTYA 4RBPH 3WL9B 2XPYA 3MMEB 3SKMB 4XAKD 4A7QA 1N2RA 4MYPA 4AENA 3UO8B 3V0WH 1J8SA 1SNRA 2GJ6B 4OGYH 2Y5TA 3Q1SL 4UMGA 1QFWH 4KFMA 4N2EA 4G42A 4ODWB 4H8VA 3CVHB 4Z7VB 3VXOA 1F45A 1DBBH 4EN3B 1TZHA 3L2NA 4IHOA 3U46A 2YGNA 5KBNC 5IB2B 1JDDA 3F7KA 2Y36H 4X0KA 1IJ9A 3U6XA 1S3KL 2YD0A 4AK1A 2ED9A 3MO1B 4WEBL 3MV7E 1CD0A 2AEIT 2P5EE 4X4XA 1G0YR 1YN7A 4P5MB 3ARXA 4ZSOA 1KJ2L 5EEVA 1AFVH 3KPMB 4LEXH 1JNNL 3R4DA 4KXCA 2PO6C 3Q7JA 2ARWA 5E4EB 3AG2B 1CG9B 4YWGH 3ZMRA 3RWIB 1I7TA 4OZHB 4KZ0A 2BVOB 4QTIH 2YD8A 1CXKA 2D03H 4JN2B 3TTYA 5BUPA 2BLFA 2OR7A 4KDVA 3LY6A 2L4OA 4K8RL 1JXFA 1KB5A 2ZWKA 1MN4A 3QUKB 4UB0H 4MJID 4YVNA 1XAKA 1ZPLA 5HGAA 1F1AA 4XC3L 4XBPA 1AKJD 4ZT1A 4F2EA 4WSGA 4KK9C 3VH8G 5DRNA 1XTMA 3H55A 4LSSL 4XZUB 4YHZL 3VXSE 1BOGA 5KOVC 3WNKA 4FJ6A 5A2CA 5TFSL 4UM9A 3QFJA 1IGYA 5DD5H 2PMZA 1HQRA 2I7SA 4HMCA 3D69A 3FN3A 2APSA 2EDEA 4JFED 2LVEA 4OF7A 4QHPA 3NG5A 3OTTA 4O58H 4QRUB 4YC2B 3U9UB 2YOAA 2FD6L 3WMPA 2J2ZB 4QCIA 5B8CB 1FFNB 1T0NB 1T20B 4MAZA 4XPBH 1J1OH 2WLNA 4OFKA 2JJWA 5AVWB 4R84A 2WC7A 4BXVA 1WUNT 4LPWA 2NY4C 3KNBA 1A6ZB 4FJYA 2FSEA 2C5DC 1V7ML 1XX9C 1WFOA 3TN0B 3FQXB 1JAEA 4TNWF 2E4FA 3FO1B 3SQBB 5DJDB 2NNXA 2Z7ZA 3Q2CA 4LSQL 4GS7B 4GXUN 3RX5A 4NEHB 3HLAA 1S7VA 2MEJB 4Y4KA 5D8JL 1NEUA 2NYZA 1G9MC 1WWAX 3LN9A 4K9EL 2C9PA 1YNKH 3O6MH 3HCVB 3P73B 1M4KA 5ID1B 3MBEC 5DVKA 1QSED 3IFPB 4O02H 2V5RA 3AG3B 1P1ZA 3IDYC 3MACL 3PL6A 2X4QB 2ZJSH 2FYYB 4L05A 3RVVC 3PWJB 3W0WA 1I9JL 4X5QA 5FW6A 3PABA 2CJUH 4X8XA 4TUKH 3QK0A 2HPTA 1K72A 3HZYA 4KFZC 3P4MA 2NPLX 1ZGLP 3EDDA 3GSVA 2FQEA 4AE1A 2Z93A 4HJGB 2HRGA 5H37A 3VCLA 3VQLA 1F58H 1HOCA 1PVHA 1WIPA 2FJGB 3MUZ1 4ECNA 5I9QC 2JV6A 4WU7A 1XH0A 4GQRA 3T0EA 2VO8A 4NO5B 3E9TA 4JFXB 2XQYG 1SMOA 2DQIL 3NT0A 5DVPA 4ZUVA 3RX8A 1GR7A 3ILPB 5BZZA 3D6GA 4OLWH 3PGDA 3GJEB 4KXBA 3H9SA 1KY7A 1YVLA 4LCCA 2AJSL 4YZWA 2VMCA 4MJIB 4N2LA 4YGVA 5L6YL 1BF2A 1OAKL 2YBRA 1J0HA 1FN4B 1AKJB 1GSMA 4Y1TA 5IK3A 2HJFA 3KDPB 1NCCH 2V8LA 5G2NA 4AOFA 1H3PH 1OTTD 2XTJC 4WEUD 3U1QA 5BXFB 1S7QB 5IIEB 4PWKA 3L6FB 2NOYA 4XBEL 5I74B 4IBZA 1QSFA 2ZCLL 3L3KA 4JR9L 4IS6B 2Q8AH 1OK0A 2QHRL 3OSKA 4OCNC 3WEXA 1RZ8B 1HINL 3BUYB 3IBOA 3O3AA 4MA1B 1HZLA 4R4ND 2EIBA 4RAVA 5GGQL 3KBFA 4Y9FA 4QHUA 5LUMA 4OCXH 3LQMA 4HJIA 3UG4A 3V95A 3UP6A 3E1F1 5JZ7C 4Q14A 2E8YA 4P07A 1BLNB 1IFGA 5FHBL 2BMKB 4XNAA 5EEXA 2Y7MA 2Z7YA 5F1NB 3IMUA 3UYPA 1ML0A 2ZX8A 3WHXB 5J6HA 1H8LA 1MJ8L 1I3RB 4N20A 4ZUSB 5JXAL 2CO2A 5FGCB 3QQDB 1EFQA 5FV1L 2VLLB 4UT9H 5D7EA 4QOKD 5SX4H 1M6OA 5SWZD 1S5HB 2JCCB 5GGUB 2OSXA 2WCGA 1SFDA 5I1KL 4B0MB 3HHRB 1QSEB 2X7LB 3BSZL 5IBTH 2ZF9A 4AQ8A 1E9PB 2GTWA 1K5WA 6CGTA 5F1IA 4KGJA 1U93B 1F6FB 2JF1A 3ME0A 2A9CA 1PPIA 1WZAA 4HJJH 4R26L 3RNKA 5M94B 4IJ3C 4HQQH 3LMJL 2HX8A 4J3UA 4CMHB 1KXQE 2XG4A 3MV7A 4MS8D 1OAXH 4WFGE 4M5TA 2P5EA 3FT3A 3S6CA 4K3DH 1UA7A 2XJLA 1PYWB 5D7IE 3DMMC 3IMVA 3UG3A 5L0QC 1RUPL 4RMRA 3NESA 1WBZA 3D0LA 4OFYA 3EYSH 5DJAA 2OK0H 1I4FB 3QO1B 2CBMA 2OXHB 2X4TB 2BVTA 5E8OA 2EVHA 3KGRA 4LAQH 5CZVL 1INDL 2FUQA 4JFFD 1J88A 2BY1A 4P9ML 4ODXB 5E9AA 1I7RB 4EDWL 2X1WL 2PNDA 3UAJC 2APWA 1YEDA 4P5TD 3BP6A 4XAWH 3QRBA 1CZ8H 2ZWSA 1U3HA 3KBPA 3PHAA 4CC1A 4DP4X 1IAMA 3HB3D 5GJSH 4OQTA 5FYLL 3IDUA 4LSVH 5SWSD 35C8H 5J12C 4F57H 3VXSA 4TF4A 4XN1A 2WUBH 4X98B 1DO6A 3C60D 4JBSA 5I1DA 5JDJA 4G9FE 5KYYA 2DIJA 4J3WA 1X7QB 3FN9A 2EEDA 3HAEA 5B21A 3NMEA 3JV4B 3GBNL 3VVWA 3IJHA 1XEUA 1Y6MR 3QGVA 4WJG3 2BVQB 3MJ9L 2I85A 4PLJD 5K9OA 4PWIA 4QRPB 1WK0A 3W9EB 1JWUB 1QPPA 4HUUA 1MY7A 3DOIA 2XCMC 4NLAA 5DHYA 4ONFH 1QFUL 1A1MB 3AAZB 2R4SH 4UBDD 2Q1EA 2ATPA 3UADA 3GJFH 1A7QH 1IRAY 2EXSA 3TTSA 4P4KB 5KYNA 2DV6A 4GT0A 3WDJA 5TDOB 4B5EA 4AUUA 5CCKL 1AANA 2ZKHL 2HKFH 4FNUA 3X1GA 4XVJH 3U0TB 2CUHA 1NANI 2FCBA 2HFEA 2JCCE 3QH3B 4ODWA 2YUVA 4QOKB 3RWFA 5EF1A 5SWZB 5BRZD 2FHCA 2R1WB 3CVHA 1CU4H 1UGKA 1VERA 4X8JB 3WS3B 4EN3A 3KYKH 4NP4L 4DVRH 4JPSA 3VD9A 3U36B 5IB2A 3OAZH 3WAKA 3OQRA 3LNEA 1MUJB 3MO1A 2HRPL 4P2AA 5DU7A 2JI3A 2APTA 5IROC 2X38A 5ACZB 4FLRA 4OCMC 4P5MA 5F8QC 1UA6H 4IRZA 3KPMA 4F27A 2H0FA 1A2YA 1ZVYA 1PEWA 1CG9A 3MU3A 4W9EC 4GAGL 2P8LA 4NC0B 1SQMA 2OMYB 4P49A 4JN2A 4GMTH 3PPSA 3AMLA 3OPUA 4N2FA 5BCAA 1TQWA 2YMOA 3VXTB 3DIFA 2OKMA 4PY8I 1IGMH 2ALAA 4JFFB 3JUYA 4JRWA 1YMHA 3QULB 4K15A 2F58H 4K7PL 2OV0A 4ELMB 2EO1A 4P5TB 2J5LC 5I1AB 1EJOL 3P02A 1JGVL 3FB7A 4UAHA 1X5JA 4KBPA 3HB3B 3EDEA 5SWSB 1OARH 4G6AD 2DDQL 2Q6WA 3OMAB 3QUYA 1AZCA 3C60B 5DF0A 1WUZA 4AIOA 1JZ6A 1UXSB 1QR1B 1FL3B 4LVNB 3GSUA 5EBMB 5GISL 3U9UA 1N64H 3QIWA 4XCFL 2ZUXA 3UYRH 5BRQA 1AGEB 5B8CA 5TDNB 3C08H 3WFCL 5BMFH 4TL4A 3L1GA 3N42F 3KYNB 1T0NA 5KVFE 1AC6A 4JQXC 2H41A 1O7DC 3B2VH 1KJMB 3DX9B 1G7HA 3BAWA 4GRMB 4XMVA 1A6ZA 3E6FA 4XO3A 3QZWG 3PP4L 2BIIA 2CR3A 4LLWA 2ZPKH 4M5SA 2VN6A 2B7DT 3CIQA 4F37K 4YBQD 3HRZC 2EH8H 2O5YL 4JQIH 3I50H 3CZSA 4L37B 1G7MB 3WTXA 4F92B 3WTYA 4POUB 1UCTA 3P73A 4P4RA 4QOKE 5ID1A 4S1QL 4Q97A 5GRJL 1F4WL 2HH0H 2NY0C 3GXIA 3MRIB 4LSTH 5BRZB 1CO1A 3KM2A 4EIBA 2X4QA 5GGSY 4JL2A 4YFLI 2G30A 3FHAA 2YGOA 2FYYA 4FMKA 4L18A 4MDRA 3PWJA 4GT7A 3L4YA 4MAYD 1TUPA 4JY4A 3ES6A 4P0DA 1KXQA 3FB8B 4HJGA 1GGCL 2HCZX 4HCRL 3UBHA 1EAQA 2WLIB 2P49B 1WVZA 5D7IA 3C09B 4NHCH 2FSDA 5T8IA 4CC4C 1YY8B 4GG6B 4H40A 3FBKA 2B8OT 1CGYA 4PB9H 2WQ8A 3TIDB 4E5XG 4KY1L 5HVHC 2IV8A 2UX6A 3CFBB 1JGUL 2DLFH 5E8NB 4RISL 1QQDB 3T6XA 2FEDC 3S5LA 5F88A 1I7ZB 4ELME 5C0RL 5AL0A 1AKJA 1MNUL 3MLUH 2B2XL 3MRQA 3WLWD 4C57C 4UQBA 1ZOXA 4GKNB 3V9CA 4DWHA 3PP3H 1IFHL 3TEXA 5BXFA 1QI4A 3ULUD 4TTDD 3G6JB 4GXVH 1S7QA 4N2MA 2QTVA 3AS0A 3E7JA 3HG1B 5IIEA 3RPKA 3A4AA 4G9FA 1DJHA 2KQNA 3OM3B 4L1BA 5DUBB 3ZLQC 1QWUA 3R7QA 2VXQL 2B16A 5CJ5A 4FLQA 4HHAB 4UOW1 5LDUA 4OKVA 2O61A 2C34A 2FX9H 4BIKA 1RZ8A 1ET5A 2ZIDA 1J9SA 3RX9A 1OCZB 4Y2OA 4YLBA 3C12A 4Z76A 4OD2B 3O6FA 1WAPA 2VJXA 4UQEA 5I30L 1DVXA 1M1SA 2DKUA 2XV2A 4KI5D 3QZMA 4BCYA 2YSTA 4TUOB 4NN7C 4CSSA 2NDGA 1BLNA 1L9SA 5CGYC 1C7SA 1I1FB 2DLGA 2YMXH 5F1NA 5AKTA 1E5CA 1LO3H 1E8YA 2FIKA 3ABLB 4ZUSA 5DUML 1IB5A 1KV3A 3QQDA 4RMSA 2VLLA 3FTWA 3MZGB 1O7SA 1UWGH 2A99A 4PTTB 2JCCA 2QDVA 5GGUA 1XAUA 4ZG1A 3Q2LA 5BRZE 3T1WA 1QSEA 1WWWX 5GGVH 3KLAB 1E9PA 1XGZA 2WQVA 3TT3L 4NQTA 1MFVA 3FQUA 1TR7A 1TVBB 1MFAL 1MJUL 1Y18B 2BRQA 1QEWA 3FSAA 3GEFA 3P9LA 4K07A 4ONOA 3N43B 5GZNA 4MAYB 1P4BH 2Q8BH 3GS0A 4FRWA 2KZBA 3DDGA 4JFPB 3FU9A 3ZJAA 1WZLA 2P24A 3CLFH 3V55A 1HVXA 4RLDA 1UGNA 3VFSB 5AG9A 1I4FA 2YD2A 3QO1A 3IN0A 2AKRB 1ZXQA 2OXHA 3GRWL 2GHZA 2YKLL 2BP5M 4N8UA 3W3BA 4JPKH 1XZ0A 2A77L 1DJSA 1FVEB 2VCOA 3HPLB 4LOUD 1JYXA 3SYCA 1WC7B 1N9PA 3ZVVA 5KUKA 3IM1A 3PNRB 3N1MC 4LT7A 1WZMA 2VLKE 4L4VE 4LVOB 4WGVB 3D52A 2CMRL 3UZEC 3JT0A 3X1FA 4MMYB 1TZGL 3FCBA 3G6JE 1JD9A 2EDOA 5C0FB 3OZ9H 5KG9B 2AMUA 2G9KA 1X7QA 3DARA 3T6ZA 2ADJB 4JHVA 5E1GA 4W4OA 2WLYA 3BLPX 3UGXA 2R7EA 4YEFA 2OZNA 3OSVA 3CZLA 1TLMA 1R0AL 4XPGL 2K3TA 4XCEB 4DAGL 2BVQA 4P5KB 5ETUA 1W9XA 2GJJA 4H1LG 2WUCL 1TLKA 2XZCH 3DECA 3QDMD 2WYIA 4NFDA 4MDIA 5DSCA 1CURA 3BT2H 4NRXB 4YXHL 5DUPH 1MCDA 1BZ8A 3K6FA 3NK3A 2D7TL 3IMBA 4HS3B 4OM1L 1T2QH 2CA3A 1NEZB 1G9NC 4TVPH 4PV9B 4XP4L 4AQ1B 5AB9A 3SY0B 1UKQA 3H2QA 1WQVT 2MWCA 3KPLA 4LLUA 1L9PA 1T4KB 3GNML 3EYQC 2XDHA 4MLIA 4MJ2A 4KX7A 3PJNA 3VDCA 2R8SL 4QOKA 4H8UA 1LL1A 3LRMA 2E5EA 3G9AB 3D4GA 4I2XB 2ZYRA 3WTUA 1RZGA 2W88A 1KSRA 5AB1A 3JWOL 3WS3A 5CD3B 1XIWC 1X5LA 4X7SL 5CFHA 1GH7A 2IOIA 4FQ1L 4LAJH 2Z7UA 3SE4A 5I1CL 4JGJA 3D39B 4FXGB 3U36A 1XSJA 4KKCD 4M5ZH 4ILDA 1JI1A 4FNLH 4UF7C 1MUJA 2O5XH 2FQGA 2YC1A 2DI9A 3CDGB 3UMNA 5ID0B 2AC0A 2E56A 1VEPA 3NIFB 3U25A 3VMPA 3DURB 5CP3A 3B9VA 4G7VL 5D1XC 1T1YB 4OJFH 1UD6A 3HUJB 1I9IH 3ZZ1A 1KENL 3QJOA 5E0FA 4PTUB 2JXMB 1MXGA 1I8MB 4UIKH 1IZKA 4ABQA 1AQDA 5B1JA 1SVBA 5EG6C 2QVTA 1AZRA 4JGUA 1ZIAA 3VXTA 2I60L 2OXGA 1P6FA 2H8PA 4GJTB 1Z5HA 4ELMA 3KWVA 5D1ZI 3Q13A 5I1AA 5IGXH 3CH1B 2WBJC 4NI6A 4Y16D 4F37F 5DHXB 4N2DA 5DLLA 5TQ0H 3K91A 4PGCA 5SWSA 3ZTNH 4OI7A 1KTBA 1GC1H 4GI6A 2FWSA 3C60A 1WWCA 3ULVH 1MWAB 1UXSA 2WZPD 3KGSA 3QORB 1F4XH 5BW7C 1KIPA 2BHZA 1QR1A 5MP6H 4M43L 2HFGH 2A6JB 3QJHB 2KKQA 3BH9B 4PJFB 1FQ9C 1AGEA 5AW9B 3H6AA 2WXKA 3KYNA 1XL6A 4LO9A 3QDMB 3U0PA 4JKLA 1SLWA 4GUQA 1IC7H 1LMKA 2JCWA 1KJMA 3DX9A 4GRMA 1SXBA 1UJTA 2IFGA 1AIFA 2FH8A 2MQ0A 1QG3A 3B7TA 2YEZB 4KI5E 3EOAB 1SOQA 4DNLA 4GO9A 4MD0B 5JHMA 1NLBL 5IZ7A 4JHWL 1A6TB 1MCWM 2ADFH 1W8NA 5M7QA 4NCC2 3S35L 1RERA 1TNMA 2WXRA 4L37A 1G7MA 4GQ9H 4MA7L 3BPNB 1YEJL 3PCYA 4KAQH 3UG5A 3MFFB 4PH8A 1JGDA 1ZLWK 4Z95L 2E9IA 5BRZA 32C2B 3BEWA 3SPIA 1UD8A 3DSFH 1N68A 1M1XA 1G1OA 5ALBH 1UM4H 1F56A 2B08A 5E6IC 5EU4A 3ALXA 4YQXL 2GW5A 5FO8B 1A7OL 3SGDH 1NL0L 3Q8BA 1B88A 2VR7A 3N41B 1CPUA 3FB8A 3UAEA 2WB1A 3T4AB 2Z1PA 3V6ZB 5E5UB 5T5FH 4YSPA 3S37X 2ZXDA 4AW4A 1YY8A 5JTWA 4IOIA 3FQ4A 4D3CL 4JGNA 2AXWA 3LPGA 3RFRA 1RZIB 1Z66A 3TIDA 4QUOA 5DRXA 4K71B 4YHYC 1ETZB 4V33A 3RL1A 3D12B 5E8NA 1C8PA 1B0RA 1MHCB 4FQIL 1AH1A 1DLHA 4TQEL 3BPLB 3PUCA 3T8MA 3V0GA 4F15B 2NX5D 5KTEL 1ZVSB 15C8L 1L9MA 2R29H 4U6TA 3M8OH 4BJLA 2AQPA 4GKNA 4KO7A 4A2FA 4Y16B 2VLKA 4JKNA 4L4VA 3DPDA 1PTZA 4E41E 2YA2A 4GRLA 5D7LD 4B3VA 2C9UA 3G6JA 2XOTA 1CR9H 1KBKA 3AS3A 3FO0L 1E42A 4J7RA 4ZMYA 3S0PA 2NZIA 5B3SB 4AE0A 1UB5B 4JREB 1GJIA 1E3XA 2VDKL 4PJFE 1R3KB 3KJ4B 4R2GD 3AGWA 1JZEA 4A1RA 4L8BB 1KT2B 1ZHKA 5JQ6H 5K9KB 1XT5A 2CRMA 5AL8A 1TQSA 4MMXC 4EEEA 1ZLSH 3OQ3B 4D8PA 3HS0B 1O0VA 1C5CL 2PUQT 4B3EA 4Z8FL 1DDHB 4Z7UE 4IMKC 5EBWB 2QQLL 1MNNA 4TUOA 3EH4B 1K6QL 4P23D 3HPJB 4KJWC 3SBWA 4F9LC 5CEZL 2GFBB 4PBXA 4Y9GA 2VERN 1UWEL 3UTTE 3LNDA 2E86A 4EPSA 4G5ZL 5DWUH 1UH4A 1WFIA 2YQGA 3I6KB 4JCMA 4N25A 4NO3A 2ZTBA 1P4UA 4UQDA 4WEMB 5SV3A 1KFAH 4PTTA 5F9JB 3MA7A 2DQGH 3KLAA 3P77A 3GIVB 1IU1A 3DRTA 1NPNA 3SYAA 3N5AA 4E9YA 3HN8A 3ZZLA 1J9RA 2V7HA 3BP4B 5CILH 3WD5H 3AY2A 4IRSC 2XQYK 4Y7OC 1MI5E 4Q2ZB 3DRQB 2V0AA 1U8CA 4OCYL 1DUYA 3L1EA 3ZRFC 3FU0A 4DK6A 4PAZA 2K70A 4JFPA 1E3ZA 4CN4A 5DRZA 1BQHG 1ADQA 1LXMA 1N6VA 1HEZB 3QAQA 4B6ZA 4LLYA 2VC2H 1PEZA 2ZAHA 5FUOL 4DO4A 5HI3D 4ZUTB 4OJCA 3H9HB 3KE0A 4KMLB 4A6YH 3QQ4A 5L4MA 3NTCH 1J0ZA 1FVEA 2PWFA 2XWRA 1JNHB 1HWHB 2BM3A 3WE1A 3G5YB 3HPLA 1EXHA 5DRWA 1OPGL 4ZS7L 2NX5B 4G59C 5C3TA 4L48A 1OLZA 3CLEL 2FECI 4JJ5B 1N5AA 3BGFC 3FQWA 4YAQB 3CX5J 3ULSB 3ZO9A 3ZL2A 4MMYA 4FXTA 3GKWH 1R1CA 3U7AA 5D7LB 3A4FA 2YPKA 3MLTA 4NQDD 4NM8L 4M6NL 5ANMB 2AQ3A 5DZNA 5JIKA 5KG9A 3S8GB 1M53A 1KEGL 1NBCA 4R97B 2ZCKH 2JJTC 5B3JF 4R0LC 4R2GB 3AM8A 3RWDA 4XPTH 2PO6D 4PJDB 4IBQA 1UOKA 4M6MH 4NRXA 4ODTL 5E2TH 2H4EA 1OSPH 1RURL 4XMKL 1NAKL 4PMEA 3QJRB 4Y2LA 2IMMA 3IDNA 2WTOA 3TCLB 4P23B 5D1QC 4PV9A 3UJJL 4AQ1A 3NPZB 4D94A 2Y2WA 2AJVH 3SY0A 3NIDF 1T5XB 3LAFA 3FB6B 1S7TB 2UZPA 3QR0A 2BY3A 1E6OH 3KYAA 1U0QA 2P3YA 1RXLA 2X0VA 3LHAA 1AE6L 5CD3A 4A04A 5DEZA 5KEZA 4LLDB 4FXGA 1R5VB 1BXUA 4YGAB 1OCRB 2GJZB 4NOFA 3X1NA 1T89A 1E28B 3TPUB 2KBGA 4FZ8L 3L5XL 2PPFA 3CDGA 3BKYL 5I15H 1XB3A 4JFOB 4N5UA 2BERA 1MCOL 3DURA 2X70A 4NKQB 2MSPA 4KU1A 4N8VA 3LEXB 4MJ6B 1T1YA 2BSED 4Z78B 4HISA 3Q5OA 4UZUA 4MJHA 2NY4D 4YBLC 1KC5H 1DQDH 1RCYA 2O5ZL 4PTUA 4JFYA 5FS5A 5AAMA 4LP4A 1AZNA 4JVUA 4R83A 5GJTL 1RMFL 2G3NA 2NSMA 1I8MA 4HBCH 1CFQB 2RALA 1MJJB 4FKKA 1HH9A 3NA9H 5CEYA 3MRRB 1Q9WB 2D7QA 2NX5E 4QJ5B 3CH1A 4HZLB 1ACZA 4H2AA 1ZVHA 1FJ1B 4NBZB 3QNXA 4XWOC 3VGDA 3VFVA 4E41A 5KVEH 4ZMAT 3EGDB 3RVVD 5ANME 1QHPA 5E2VH 4XCCL 4BM7A 4NQDB 5LLIC 4WSKA 5CZXC 3R4RA 2QQNL 2A6JA 3QJHA 1NAMH 1IBFA 3BH9A 4PJGB 2WINA 3IRZA 4H88L 4F91B 1CXLA 4PJFA 5INDB 3P40A 4NCC1 3TLRA 4XNUL 3L7EB 1FG9C 2DQJH 1A9BB 4HT1L 4ANXA 4F7TA 3T2OA 4AEEA 3V4VA 1QBML 5D4QA 3FU8A 3B9AA 3D51A 2PO6B 4OZFH 4P2OA 2YO3A 3MLXL 2WIMA 2ZXGA 3MC0A 2YEZA 4Z7UA 2H3NB 3LZFL 3EOAA 4XN4A 5CSBA 5DEFB 5ESVA 2UZYB 4MD0A 3VO0A 1QEXA 2DLHA 5C0EA 2V6HA 1ZA6A 5I8KH 2OTUA 1I85C 2QQKH 4AMKL 1QX1A 3UTTA 3SPCA 4URKA 1RUMH 1WV7T 3JBG7 5GRZA 5C70A 3D06A 2QL1A 3N50A 5CN1A 2VERA 4U1NB 2XTJD 4YO0B 4KQ4H 5DA0B 1YCSA 1ZHNB 32C2A 1TSHA 3R8QA 4P2CG 4IGBD 2KLTA 3VD4A 3DROA 1WF5A 4GRWH 4XXWA 2FJSA 3Q8EA 3V4PH 4YHLL 2EP6A 4YS4A 4XNYH 2FLBT 5FO8A 1MI5A 3TASA 2AK1H 1U8MB 2NUPB 3TV8A 4YBHA 4M9PA 1WIOA 2DIBA 4X8GA 1JNJA 1FORL 2ADGB 4HETA 5LAPA 7TAAA 1YEHL 2PR4H 2G4GA 2EDMA 3C8HA 2V5SA 3L54A 1I75A 2NY4B 3TEZA 3OXRB 5FA4B 4NSKB 2LFGA 3L3HA 1YHPA 5EZLA 5F72S 1ETZA 4L8CB 4WHDA 1HOEA 4WGKA 2FATH 4M48L 3HZKB 4B9KC 1DEDA 3PFQA 1NGXA 4PRIE 4Y19D 4ZK8A 3CX2A 3BOVA 3N2JA 1ZVSA 3MSPA 1NC4A 1U4EA 2COQA 5B38B 3KS0H 3HFML 3JUZA 4U1MA 5KBMA 3U7WL 5CM1A 3LZNA 5E94B 3MRKA 2VL4A 4JG5A 1TVHB 3WJJC 1GOHA 4XVUC 3SBRA 4B0MM 4YSUA 3BWSA 1EO7A 2YUXA 1XF4B 3OXSB 1YEKH 1JF6A 1SMAA 1YY9D 2WLJA 1QNZL 4ERSL 1RLBA 2C3VB 4PW9A 5EWIL 3MREB 3HBZA 4EKJA 1MLCA 3ZDYF 1E9OA 3DMMD 4D9LH 4YH6A 2VUYA 1KCSL 1FCGA 3EO0A 2WHVA 5D2NC 2OP4L 2XWZA 2V3DA 3RY5A 3ZIYA 2VKWA 1SQ2N 4IDLA 2EUWA 1NCTA 3DGCR 3IB4A 1LLAA 1DDHA 1RUAL 3G3LA 3UBXB 3MJ8B 2N1TE 1QLFA 5HVWA 2MTPA 4I18B 1A02N 1ZLVH 4NQCD 1FNSL 2P5WD 3AQXA 1JGEA 2BK8A 4HPOH 4E9VA 1X6NA 2GBUA 4UTBH 4XX5A 2BIPA 1MRDH 1VJSA 1XSOA 2GCYB 2P1YA 2R0WL 3IJ9A 3MCYA 1UWXH 4NKOB 1QR4A 4UINH 4IGBB 4JRXB 2I5YL 4W9GC 5FGBA 4NENA 3GUFA 3BP4A 3UO1H 4Q2ZA 3PDDA 5DJ8A 1MRCH 3D2TA 1GMEA 4G2AA 5D7SL 3QEQB 4JGMA 4YJZL 3NFSH 4JVWA 4UOW0 2ZKXA 1CC3A 3QEGH 3DX4A 1OB1A 1PZAA 4S1DC 5CKAA 5JA9A 4JFUA 4KJYA 4GI9A 1TZ8A 1LVEA 1SHMA 4ZUTA 4PJ7F 3H9HA 4KK5D 5FCSH 3ZT7A 4ZMXA 4HPYH 2IF7A 4D9QD 1E43A 1JNHA 1KB5L 3G5YA 3FH5A 1F2QA 4Y19B 2BINA 2NX5A 3QDJE 1HT6A 3QWRD 4OY9A 3BXNB 3O2DH 1AD9B 5GS1C 4YAQA 1EGJA 2R4RH 1ZLUK 3TO4A 2VLRE 3VM5A 4TN9A 5CO1A 1SVZA 2MCPL 2VLMD 5HJ3B 4WTXA 3FW6A 2C3WA 5ANMA 5IVZA 3VFNB 2VXVH 3QNYB 5D7KD 1L9TA 3TJHC 4PBVC 5BS0B 3FUKA 3NIGB 4WO4A 4ZFZB 5AYUH 5CN2A 5MEND 1J48A 3ARDD 3PLYA 2MRYA 3RY6A 6PCYA 2WOYA 3N9GL 4NKIL 4LLQB 5TF1H 1AGDA 3CFMA 3ESUF 1F5WA 4G8EB 2I25N 1TZAA 1JHLL 4TLSA 3LN5B 3C5JA 5KAQG 4G43A 1RIVL 3ESPA 4O2CA 3KLLA 3KYMA 1CGSH 1XF3B 3G5VA 1JCVA 1NGPL 1VRSA 2X3BA 5JW4R 4NQCB 5EV7A 1T5XA 2FO8A 1P7BA 1QPXA 2P5WB 4KKLC 4JZJC 4HUNB 3FB6A 4DW2H 4HUVA 1S7TA 2E9GA 1MFBL 4RFEA 5J12B 2Y72A 1AQ8A 2WLMA 2XTJE 3MXVL 4N86A 4QO1B 4MX7A 2I24N 3OV6A 4HBQA 3P3TA 3RU8L 3STBA 1MPAL 3VWKD 1IC0A 3LDBC 5JOEA 4RRPA 4MJ5B 2GJZA 1DLFL 1JMZA 2GTQA 3PXHA 1S9XA 3MRHA 2L7UA 4Y4FC 2MQCA 3FQRA 1KB9K 1P5VA 3KXFE 1YJDH 3MODH 3NZHH 2PCPA 4JFOA 1P5UC 4CSTA 4OUOA 1MF2L 5JLZB 3LEXA 3FB5B 4H5SB 4MJ6A 1IGIL 1J8RA 1EHLL 4B5ZA 1C9SA 4ODVH 3CVDA 3IAPA 3SIKA 4BSVB 2ZP9A 4HS6A 5B3JE 5B3NA 3F62A 5AZ2L 3TF7C 5E2UL 1BVNT 1RU9L 4D0DB 1CFQA 4V1DD 1MJJA 2IBZY 3II2A 3A67L 3C2AL 1JOIA 3MRRA 5I6PA 3L1OH 2V5MA 1Q9WA 4Y19E 4PRIA 1DQVA 3WFDH 1AS8A 2XRAL 4BINA 3W9DA 2ICEC 1G1YA 4HZLA 2XV6B 4U6VL 2A2QT 3QIBC 1FVCB 2G5UA 3OR7A 4G8AC 3NIDE 3WEBA 1OKEA 3OHXC 3VH8B 4CGTA 2B20A 4UUJA 5LBVA 2M1KA 4HAKA 4TM9A 2DEWX 1YLBB 2EEBA 2BRRH 4Q9CA 3V0JA 4BZ1H 1EO8H 4XBEH 1KTKE 4OAWA 5T3ZD 3D18B 3NJGA 4M29A 3RILA 2CGRL 1F90L 4FX5A 3SD2A 5MENB 3ARDB 2DD8H 3FAWA 2V2WB 1JZ7A 3IU3A 2ZD0A 3L95A 4QLRA 2W0KA 4AKPA 4W9CC 2PO6A 4HC1A 2R2HB 4A7SA 2EE9A 2VDLL 4LSRL 4P9HL 3S36H 4NKMA 1MIEL 1KB3A 4EUPH 1HESA 1BWWA 1F11A 4NJAL 3LPFA 2UZYA 5F21B 5JPNC 1XH3B 1J8KA 3AS2A 1JFHA 1MRFL 2P5WE 4YHPB 4ZMNA 4ZUWB 1DCLA 3WFHA 5I76B 1FZOB 4AK2A 2EAEA 1G0XA 1MCPH 2J5LB 3HG5A 2Q7NA 4JM0A 2QGEA 5EU7C 3H3PH 4BHUA 1EIBA 4OLUH 3U0WL 4KTDL 4BGLA 4YO0A 2XQBH 3HR5A 3GFUA 4OLXL 1H19A 2IFFL 4HCIA 3VWKB 1DCEA 2EVFA 4XI5C 3TEWA 3NABH 3D2UA 2BOBB 4YDKL 3FPYA 3MOQA 1ESOA 3HIZA 3CZFA 1TMCB 4YSTA 1S4IA 5DHEA 2ADGA 1L7TH 5AOLA 4QJ4B 5IESL 5H4YA 5C0IB 2BSEA 2G4EA 2IAMC 4KQ3L 1INEL 3OXRA 5HI5C 1FZMA 4L5FE 5E4OA 4RCAA 1W0VA 2VSCA 3B2PA 4OVVA 4W93A 4AIZA 4AQEB 5C0DA 3DETC 2X9WA 5A2BA 4C59B 2XWTA 4V1DB 2EDFA 2DQFA 4HJSA 4U6HB 1U41A 3WG7B 3VU2A 3QDJA 1G94A 3KS0J 1CIUA 5B38A 1EHNA 3QXAB 4U3SB 1OF2A 3MBEA 3L3DB 3LTVA 4XP1L 3AWFA 5E94A 3MYZA 4AL8L 2VLRA 1PU0A 1YEGH 1NWPA 3WIHH 1T3FB 4P46D 2G75B 3ZDZF 3BT0A 1NTDA 3DV6B 3BAXA 5AKSA 4DZ8A 1JZ3A 4WUUD 3L17A 5CCGE 1AQKL 5FECA 1GKOA 1MREH 2C3VA 1DBML 1VFBB 4JPQA 1DTUA 3GUTA 1LE9B 3BE1L 4LPXA 3BD4A 1GRWA 4IBTA 1JF5A 3DUSA 3TESA 3MGTA 1SF5A 3D9AL 4KRPC 2FLMA 1KELL 2NY2C 1HIML 1Z6JT 4F7MA 2DH2A 3LSOB 1SYVB 4DGVH 5LDSA 1HEHC 4AQAB 1MY5A 1VADB 1XGTB 4L29A 3VFOA 2XZAH 3QIUD 4MNQE 5I28A 2IALA 2VLJE 4BZ2A 2AXFA 3GMMB 3IFLH 3W37A 4AGQA 4AYSA 4PJ5D 4B41A 4KMTL 1PAZA 5D96C 5CJBA 5KVGL 1IAOB 3QHTC 3BPCB 4ZRGA 1K2DB 3CVHL 43CAA 3TYGL 3SDXB 5ADOL 3KL0A 3MROA 5E5RB 4B50A 3RJOA 2EUVA 2ZAGA 4WUKH 4FFTA 5J9PB 4NIKB 3KXFA 3EJTA 4ZBJA 3VFTA 3FTYA 4PP1D 5EU6D 2IANE 2ICWB 1QSVA 4JO2H 1O7DE 4DN4L 4YE4L 1RH8A 4PS4L 3GMNA 5L4IA 1JCKA 2VDOB 4U7MA 2JVUA 1NBZB 2APBA 4U6XB 4ESKA 1FF5A 4NN7B 4KI1A 1BAWA 2ZG1A 4I3RL 4K3GA 3QUZD 1UKTA 4GRWF 5EULV 3SO3C 3V6OC 3F3HA 2ED8A 5FKAA 3VD7A 3RVWC 3EFDL 4MYWB 2XKSA 4KROC 4OJEH 3MZTA 4P2QD 4Y19A 4Q7DA 4ES8A 4PGDB 4U1HB 1NDTA 4OF3A 3BXNA 4RDQG 5D4JA 1AD9A 3RKDD 1LK2A 4EOWH 5TE7H 4YHMH 1J05A 4AZUA 3PWVA 5IB4B 3H3BC 4PD4J 4P46B 4RWYH 3RRQA 3VFNA 1NGWB 3VW3L 1LEKA 5IFJA 5T3ZE 5ESQB 2YWYA 2OW7A 3LEYH 1UVQA 3W2DH 4WUUB 4PLKC 5EIIG 4JM2C 1FUNA 1E27B 1CWVA 3HR6A 4X6DF 5J13B 2ZNXA 4HWBH 5FOBA 1RIHH 5D1XD 3VB9A 2PTTB 3FULA 4YDMA 3DMMA 4DFHA 2UZIL 1JZIA 1NMBL 3SGJC 5HDQL 4Y9BA 5JPMB 4TSCH 4OLVL 3LN5A 1TTCA 3OKKA 2VSKB 1QFHA 2ZXWB 5B39A 1XF3A 3I9AA 3ZKND 5I82A 4ZW5A 2CRIA 4AZ8B 3QIUB 1IVTA 1JV5A 2VDMH 2IBBA 3UAJA 2P5WA 2CM5A 2WVUA 5TF0A 4BV1A 2CXGA 4CSPA 4GAJL 2WBJD 1KWGA 3CHXA 1DVQA 2XPGA 1FH5H 4PJ5B 4HSAC 4XVTL 2BWDA 5HD8C 5KN5A 3OR6A 3ARPA 2Y4SA 5IVXB 1ITCA 3BUTA 3OG4B 4QO1A 4BKLA 1OW0C 4G6JH 4OD3H 2W9EL 3SDXE 2JB5H 2X2IA 1NFIB 1LHZA 4NZDA 4Z7OB 1A1OB 2OJZL 4JKWA 1WZ1H 2X2UA 1JNLL 1FFQA 1LYQA 5EUOF 1QA9A 1CT8A 2KLSA 4BHUI 1U2HA 3I02B 5KJ7E 5JLZA 5EU6B 3ZU8A 4GBXC 3ZTJH 1H15B 1JXGA 2VXSL 3N85H 3SBPA 3NQIA 5LNDA 1L3NA 2SEBA 4WFHE 5DZAA 1HE7A 2JMRA 1AG0A 5E6RB 3T65A 4EF3A 2MPAH 1YQ2A 5B1CA 3D0VB 4IDJH 4BK4A 1YECH 3MLYH 3QUZB 1B0IA 1Q0YL 4XPAL 3BWAB 3P2DA 3ULAB 3ZR6A 4P2QB 5HHNA 2NNCA 1OGAD 1OE2A 1X4YA 3QWRA 5DD6B 3CSGA 4IMLB 3BKCL 1FVCA 4PREA 1BLIA 3FTZA 1JXJA 5AWNH 1N18A 4ZX4A 3DK0A 3VDAA 5IVNA 2ITCB 5E6ID 4MB3A 2CGZA 3EHBD 5DD1L 3ZYJA 5FA3A 9CGTA 4KJPC 2VXQH 2UYLB 4D9RE 4UQAA 1AOHA 5IROA 2CBQA 4XP9H 1ZT7B 2N0KA 3QJTB 3RWGA 1T7XA 1P7QB 5LCVH 2PKDA 4TSAL 2IDFA 5HYQA 4A7GA 1FZKB 2H32H 3EJJX 4I0KA 5AW0B 4JPIB 3JT2A 4HFUL 4MNQA 3BJLA 4B9YA 3VXMD 3QZWB 2AJUL 1OAQH 2VLJA 4Q58C 4YHPA 4A39A 4ZUWA 2BNUA 4DQOH 5J6SA 8PAZA 2LOEA 2WBJB 4PJ5E 5D5MB 4D0BA 1T2JA 4F2ME 2B0SH 2P5PA 2DOCA 4NT6A 5IVXE 1T6BX 4LSDA 1QBAA 2C4FT 2V9TA 4KZCA 5DQ9B 4X6FB 2PWGA 2OM5A 5T1LA 4NZTL 3P0VH 4Z7OE 2ZOUA 3GM0A 5JYLA 1S9YA 3ZW3A 4CU7A 2IG2L 3LRLA 2NY5H 3EJSA 3TT1L 4EKXA 2BOBA 1FZJA 3VGAB 1UTDA 3RVTC 4R96B 5GGTA 3VQ1C 5KBLA 2B1AH 3BZEB 4XGZA 2IANA 4PG9B 4LZKA 4JQXA 3DV4B 2R0ZH 2O1AA 5FDWA 5ECJE 4ZMTA 1U42A 5J1TC 3ZHLA 2F8IA 3LYRA 2FGZA 4GKSB 1GY2A 5LQBL 1MCLA 4ZS6C 2YOCA 3EZJB 3IMRA 4KJWD 3G9VA 3SPHA 1Z0MA 4W9DC 4XPHH 2YKLH 1V7NH 2JLPA 2WYHA 2AI0H 1OTUC 2XQYA 3PJLA 4HOXA 1I8IB 3HRZA 5CINL 4E5XB 1CL7I 1CI5A 4U6HA 5J6GA 4ZQKA 1EVTC 2PCFB 2YAQA 4W4NA 5E2JA 2DQTH 1NMCC 2J1ZA 3QJXA 1AO7D 3S4SA 3QXAA 4U3SA 2YARA 3VQ2C 1ZSDA 1GC1C 3CHPA 3FHQA 2JKIS 3MRCB 5I0ZA 1C08B 1V54B 2VAAB 3SDYL 2CHWA 3PV6A 1QWHA 3KLKA 3EHBB 3VI4B 4GP8B 3VFRB 1KXHA 2LU7A 1VFBA 3MLZL 5FB8A 3D48R 1U3YA 3WN6A 2Z7WA 4JX0A 2F5BL 5D1XE 3LRSA 1U8IB 4J3XA 2ZCHL 4JANB 2AXGA 4CC4A 2A73A 3QYMA 3S37L 5DVNA 1N4XH 5IMMB 3HMXH 3LSOA 2UX7A 4JG0H 3L08A 2X1XR 4AQAA 1FC2D 1VADA 3T6QC 1KMGA 1KPRB 4BWWA 3T3MF 4LPVA 5ICZA 2WWMC 3AJ7A 3GMMA 3VXMB 3VXRE 2RJMA 3IU4H 3OHMB 3RZCC 4B9JA 2Z31C 5D5ME 1CXEA 4AYID 4M7KL 3GSNB 4G6FD 4BXSV 1IAOA 3BPCA 4PJAF 2JELL 2IEPA 2ID5A 4OT1L 1N59A 2EVIA 1UXWA 3L3IA 3SDXA 3IYLW 1UASA 2KERA 4KXZH 4ZMZA 5I1CH 2QGCA 5IB1B 3NACH 4NGHH 3TNMA 1OGTB 3RPIA 4GIAA 4ZMOA 4GQPH 4OZFG 5J9PA 4XR8C 3GXTA 3NCYP 4RGMB 4X83A 5F0JB 4RETB 4ZOCA 4LIQE 4AGOA 2VJ8A 2MQ3A 2ADIA 2Y1VA 4ONHB 1L5GB 3MA9L 5GHWL 1YYLH 2XWCA 4HIPA 4I3SL 1OE1A 1NBZA 1S7UB 3ML8A 4PBDA 4U6XA 5DZOA 1Y7VA 1CGWA 3CXHK 4DGIL 1ZK5A 3QPXH 5JOPE 1JPFA 4UV4L 3MRMB 1CFSA 5TE6H 4O5LH 2F1EA 4Z7WF 2Y25A 4XO4A 4ADJA 4AQZA 3DO7B 4K3EL 5BQDA 4PGDA 1Q1PA 2ODIA 4U1HA 2ESVD 1FV1A 3P30L 1OGAE 2I07A 2QGBA 1CFVL 2IDQA 2WWNA 1S3RA 5D2LF 1IAIL 3BAYA 2EINB 5IB4A 3CVIL 4XOEA 3QE5A 4RWHA 3P9MA 4GLRI 5C0AE 3EH5B 3H9ZA 3VRIA 2UZXB 4NZ8A 1Y1DA 5ACMA 1S78C 4RRPM 2X1OA 1DVYA 1JXKA 1JG9A 1V3JA 2CKBB 4HMEA 5I17B 2OI9C 3FSWA 5FC9A 3RAJH 3DKHA 3TBBA 1QLEB 2BC4A 1RUKH 1EMTL 2OL3B 1Q4NX 4H1LB 2RB8A 5JHAA 4M1GL 3UYOD 3S8WA 4PJEF 3UC2A 2DMBA 2YFNA 4TPRL 2DN7A 5AW1B 2BNRD 4JG9A 3IWVA 4IJTA 3C8KA 4ICXA 3K4AA 4Q9QH 1KNOA 1PQZA 1KBBA 4AIEA 1AR1C 3SDAC 5F3HB 4Q56A 4MJ4A 3S35H 4FFZA 1FDLH 5TQ2L 3EJUA 1RL1A 2WM0A 4PJ5A 4F2MA 3KR3H 1RY7B 3P0GB 1W72H 4WFFD 3L4XA 4G6FB 4J27A 4KHXL 4P59L 3UZEA 5IVXA 3JQOB 1KCWA 1P53A 2IGFH 4DCQB 1NFIA 1JJUA 1B2WH 1PLGL 4KKNA 4ANKA 3DVNA 3CFCH 2EKSA 1CS6A 4IRJD 3CSBA 4URTB 4LARH 1FL6A 4ODUB 3D3VD 3I02A 1GZPB 2A6DB 3GGWB 5IEKB 2DEXX 4ENEC 4M03A 2BNQD 1SM3H 3WJLC 4M61B 1NH6A 2BZ7A 3CZNA 4X6DE 1M2VB 4YZFF 4AV0A 5IUSA 1EJFA 1A3RL 4FLOA 1OM9A 1YAZA 3LNFA 3TS8A 2YIHA 5C3LD 2BOLA 1LGVA 2IAAC 2Y1ZA 3CHRA 5IOPB 3AUVA 5CN3A 5CNHA 2NW3A 2RHEA 3RUGF 3DYMA 3HS8A 4ZO8A 1RJLA 2AJ3B 2AITA 2F74B 5L2JB 3O3DB 3JWDL 5DD6A 2ESVB 4IMLA 1JPSH 1AO7E 5DLML 4WRLA 4IKIA 2F8OA 1TCRB 4Q9RH 2A6KA 3HHSB 1PL3A 2EQDA 3H4FA 3FCSA 2YAOA 1XIWA 3OKLB 1FO0H 4M7LL 3EH2A 1RZQA 3MRFA 2EILB 2RH0A 4MHHG 2GUYA 2H3KA 1CN4A 3A21A 2EDDA 1U8JB 1BZEA 1IQWH 2UYLA 2CJTA 3APNA 3MOAL 4FG6C 3EAKA 4PVLA 5JIMA 5D1XA 4W9FC 1ZAGA 5C71A 2WKLA 3SDCC 3VA6A 1NQBA 1GVIA 5C0CD 1J11A 2C7UB 4C55A 1LJMA 5EUOE 1FZKA 1T5WB 5HHMD 3CSPA 2CU9A 2WO2B 2WTPA 1CLYL 2BNRB 2WWOA 5HYIA 1J8HB 3PF2A 4YSRA 2H6OA 2D7PA 2Y6SC 3NCJH 3QZWA 2YUWA 4HH9A 2EZ0C 3I2CH 5AD0A 2I69A 2FBRA 5CD5C 1IT9L 5I0DA 3VXRA 1RULH 4N1EA 2WBJA 5D5MA 1HXKA 1ICTA 3IFOB 1R24B 2L0DA 4XVUD 3QUMH 6FABH 1O5PA 4UTAA 1D6VH 5ICYA 2VQ1B 3FMGL 2RCSL 3UDWC 1RZKH 3LH2H 5BW7A 1D3CA 1ZE3C 4GEJA 3O11B 3NJHA 2CLVB 4NYLA 3L5JA 1EAPB 2DQEL 4H20H 5DI8B 4IRJB 5EUKB 1T0PB 1DVFC 4YHOL 5LXGH 2WYZA 4IBVA 2D0FA 3D3VB 3AQZA 2O26U 3QHZH 3VI3B 3TBVB 1SYSB 2C9VA 2BS71 2L8AA 2PCXA 1JFQL 3F58L 3GI9H 1CJYA 2V17L 3D33A 3V0EA 5F7EH 4BFFA 2HVBA 3OKOB 5D1QE 5K9JL 5EOCL 1QBLL 3FK3A 3IF1B 1BJMA 3OMIB 5KOMC 1M7IB 4E5XA 2C9RA 4NOBA 1BCIA 1G6RH 2CQVA 5D9SB 2PCFA 1IGTA 4O2EB 2VR4A 2ESVE 1MCRA 2Y07H 1K8DB 1OGAA 3KDMB 5EU3B 1RKRA 3CXDH 3FNKA 3O0RH 4M3HA 1U8LB 3MR9B 1N5YH 1IM3D 4X7CC 2Z35B 5DS8A 3MRCA 3OKNB 1G7IB 2Q9OA 2IWEA 3E2HB 4N5EC 3ULUL 5E6IA 5ALCL 7PCYA 5C0AA 5KW9H 1BD2D 4PWHA 4N1CA 2J5WA 1QTSA 3K2MC 2KQMA 5AOKA 4IBWA 1JWSA 1WBXA 5G4MA 4HGKC 1YG9A 3OB0H 3RURA 3U4EB 4A37A 1U8IA 3IDGA 2NDFA 3WUZA 4JANA 1VEOA 3EO9L 1BDYA 2OQJB 4S1DD 2QT6A 3MLVL 5C0CB 4RQQB 5F8RC 3IT8D 1E67A 5IMMA 5F71A 1WRFA 4AYBA 1PD0A 5HGBB 2UXFA 4S1SL 5HHMB 2BY2A 2AW2A 3GIZH 4TULL 5FF6B 1KPRA 1QVOB 2R83A 2ITEA 3QQXA 4HWEH 1VB9A 5I16A 2IPTH 1RD6A 5JIDA 2J21A 3B7UX 2WJ7A 3FU3A 3ZX1A 3CSYA 3FO9B 3VYOA 5MI0B 1K4CB 4XN8A 1HYSD 1DVTA 1S8DA 2P8PA 5KZCD 2B59B 2ENPA 3IETA 4XN5A 1UC6A 4WFFE 1NDGB 4KPHL 2WAHA 12E8H 1BQLH 2KL6A 2NCMA 2XV0A 3QC5X 4R5VA 4L3FA 5F3FA 2X2YA 1LO5A 3QQ3B 1AE6H 4LVHC 4TNVF 4ODHH 4HOZA 4FQCH 4U0RC 5I66A 1K5NB 3UIZA 4QGYA 1Z9PA 1U8KB 1ZLDA 5IWLC 1KPVA 1UM6H 1DUZA 3AU0A 1A65A 2CDEA 5CJOL 4KTEL 3VI3E 2WNXA 2XVLA 3KCPB 2H9GB 4MMXA 5FYKH 4EUPG 3BUDA 2BNQE 1L5GA 3HLKA 4OGQC 4A68A 5DK0A 3PUUA 4X6DA 4IMKA 1BQHB 3W82A 2VZSA 4X6BA 1OIOA 3RVUC 3WS6C 8CGTA 3FAXA 3KWWA 4FQLH 4F9LA 3PJSA 3MRMA 4KKLD 4X7TB 7FABL 3MV9D 3P2TA 4OSUL 2BSCA 1I3VA 2GSIA 2DRUA 3BVNB 2UY6A 3UL4A 4U4BA 4LHUD 5EZOH 2HLAB 1AO7A 1TU2A 1HHHA 1GGIL 4O02B 3SE9H 4H13C 1D5IH 1IM3B 3SKOA 1TQCC 1UT1A 2Q3AA 1TETH 1E7UA 2MHAB 3BDXA 4MSWB 2BSTA 4KNUA 4ZMLA 2BSSA 4PGZA 1MWAL 2UZXA 4IRSA 4Y4FD 1H3XA 1BD2B 5FR3A 5LAXA 1UACL 2FNWA 1LWJA 2A1WL 3MRBB 5I1LA 5IQ7L 5I5IA 1VZGA 2O6FA 5K1VA 3US0A 3T3PB 2CKBA 4HT1H 2KHAA 2K78A 4OZGF 2ENSA 2H2PC 5IHZB 3Q43A 1JHTB 1NWOA 1V8HA 4H1LA 5EUOA 2R69H 5F7HA 5HHME 4Q6YA 4N3UA 4G8FA 2XFGB 3CN2A 4OLYL 4WI6A 4L0ZA 3FQNA 4HWZB 2QADC 5HGDA 3VD5A 3ARSA 3FO2B 2YLKA 3GMQB 3HNVH 3QFDA 3LJ3A 3CDYA 4GFXA 4N9OB 2ITDB 5KZCB 5EMYA 2Q20A 1SXZA 1MFNA 1KIQB 3P11L 1A6UH 4PRDA 5EOTA 5AVYB 1PNDA 1CFBA 5ITFB 1MVYA 2FGWH 1WYJA 4RZCB 1WO2A 1HL8A 2F54D 5GRXG 3IDIA 4ZFOB 3RDJA 2VDPH 4MXWH 3EBHA 4B9ZA 5DJ0A 1A7PL 2JJTA 3BUQA 1KJ2A 3FOLB 5E95B 4CMMB 4PHZA 4ODUA 4I1RA 3MGOA 4WNSA 1VKXB 4ZI8A 1ND0B 1KF9B 4R0LA 2WNGA 5IEKA 3GGWA 5D2NE 4X8CA 3L48A 1DQMH 2EUXA 2W9DL 5EORH 2J8UF 1A4KB 4NPKA 2DAVA 5DGRA 3D0AA 1I9RH 3CD4A 3GXNA 2R56L 2FEJA 4LL1A 3EJPA 5D1QA 3DVGB 3GHBL 1KACB 3UPAA 4DKAA 4ZO9A 3CC5B 1UHVA 5FYLE 5L88L 3UJTL 5L2JA 3MV9B 2F74A 2J55A 3M17B 3O8XD 4JO4L 3GSXA 5MERB 1JPGA 3O3DA 3V5HA 2ESVA 3B3BA 3QPQC 4LHUB 4I89A 3HHSA 4JM2F 5IFAL 5TD4A 3OKLA 4N0UB 4AGMA 3ZZSA 4IEFA 4P57B 5E2WL 5GGSB 1PZBA 4TLTA 4WFED 4HUXB 1UKSA 4Y4FB 4I8DA 1CD8A 2M83A 3RJDA 2XC8A 4Q0XH 1FFRA 1G4RA 3T3PE 3GZQA 3X1BA 4Z7QB 5KSBF 5E6SB 4E68A 1IJNA 4ALAH 4WY7L 1KCLA 3C9NB 5K69A 1AR2A 2BCKB 3QWQB 3HNSL 5C09B 4A2LA 1HXYA 4KH2A 3N40F 2JQAA 2LR4A 2VZVA 2EDXA 2XVBA 4C4UA 4Y5XB 1CCZA 1DANT 1KTDB 1OSZA 3GK8L 4CRPA 4KKRA 1KN4H 3AVEA 1ZMYA 2OS7A 3DTXA 5DFAA 5IHUH 4YDIH 3TJEH 4YZFE 1A6PA 1JPTH 2HG5A 4F93B 3VWJC 1FRGL 5CBAA 1YQVL 4I48A 1MAJA 4LASL 3AT9A 4RAHA 4NPJA 1AAJA 2FX8L 2X09A 4KVCH 3ML9A 2EJ1A 3GSRA 5DO2D 4B53A 4OZIF 2F54B 4XP6L 3K71B 4QY8B 1EAPA 1KBGL 4YXKL 3A23A 4PJXF 1O6SA 4XTRC 4JG1H 5TGBB 1QFOA 1YJDC 2DJ4A 2E9JA 3VD3A 3EXJA 1JZJA 4G83A 5D7SH 3AB0C 2HFTA 4KRPD 4HUCA 3VI3A 5FW7A 3R0MA 5A40E 3L2MA 3G04A 1SYSA 4XWGL 2BP3A 1LE5A 1UCBH 2BNQA 1PX8A 1LEIB 2Q86B 3V79C 4F80A 1C5BL 4GAFB 1CICC 3CSFA 1IC5L 3EOYG 4BFBD 5C0ND 3LVEA 1QWNA 2HZHA 2VQTA 3GJFB 1NCDH 5DMKA 3WJMB 5JPNB 4LCIL 1DYZA 1N70A 2OA9A 1ZIBA 3IF1A 3UCRA 1OWRM 3OF6D 4U3HA 3I74A 2XWJB 3D34A 4M1DH 3REVB 1JZ4A 4O2EA 1A9EB 2WQSA 3O8XB 2MOQA 3AGVA 4WDIB 2QSCL 5HDWA 3WKNA 1JTPA 2Z35A 2BP0A 2R1YA 1SBSH 4YNYB 5C08D 3I75B 5CJXC 1W91A 5ERWB 2YLHA 3QI9D 2FB4L 1WD8A 1UZ8B 3IJSB 3ZR5A 4WI0A 1V55B 3GQFA 5CSGA 4PB0H 4F8PA 3ZTJG 5DYFA 2DL2A 4DTGH 3F01A 3MJWA 3SSGA 1FAIH 5E4EC 2QR0B 2X1QA 2SODB 3VMOA 4GO6B 2WJ5A 1MH5B 5AVSB 2W60B 1OEZW 3ASWA 3GXPA 4S0TD 4JDVA 4R4FL 4X42A 4LCVA 1NANH 4XC1H 2PF6A 3B2DC 4J1UA 2IWFA 3WBDA 5FF6A 1KXTB 1A9VA 3CFJB 4BDVA 2CRYA 4HIHA 5IHHA 1A6VH 1BFSA 2Z91A 3FKUS 3V52L 1LP9F 3FO9A 4NB7A 4MAUL 4YL4A 2ZOLB 1GZHC 2B59A 1MFBH 2IVFC 3I3EA 5K9QG 2R23B 3LQAH 3T0DA 1NDGA 1F0LA 4L1SA 3WJJA 3ARBD 1AXTH 3FRPG 5F7MC 1I3GL 2H2SC 3DOSA 4JW3A 5EIVA 4YC2C 1NC2D 2HJKA 1K5NA 5FYJH 5AVZB 1HWGB 4KUZL 1U8KA 1FC1A 5CU9A 1JTOA 3SJVD 3L5WB 1E4XL 1XSIA 2CHNA 2EYTA 1A8JH 3WY1A 3B3IB 3ECUA 4NQSB 2V33A 4LDLB 4KRPB 5D2NA 3I6SA 1AGFB 2ZYIA 4LU5H 3EUUA 5H37H 5JYMA 1RIUL 4Z5RB 3RGVD 1SJHB 4GSXA 1QUNB 4YFDB 3TN0C 1AACA 4DGYL 1BQHA 3SE8L 3C5ZD 5CLYA 4HFWB 4GS7C 1YEFH 1D7DA 1HHIB 3WNIA 4Q9BA 2F9BT 1N7MH 1DBAL 3Q8AA 1M56B 3A67H 3LOWA 1BYNA 1T83C 5EU5A 3BVNA 1PD1A 4HXAL 5EU7E 4NQEB 1G7LA 5HD8D 3D1MC 2HLAA 2F7PA 1UYWL 3R1GH 3PWPE 4O02A 2IC2A 5CAYB 1N0LB 4UNIA 4WIQA 1ASPA 5EA0L 1IM3A 5AUMA 1IGCH 1SOXA 3M7OA 3E0GA 2BP8B 5C08B 4NERA 2JKSA 4NO2B 3KJ6L 1JK8A 3IPFA 1E8ZA 1MVUB 3CJJA 4R3SB 3QI9B 1BD2A 4MNHB 3APCA 1JSYA 3K72B 3MRBA 2HTLD 4TS6A 1OZUA 4FNRA 3MLRL 3WKYA 3RBSA 1T80A 3R18A 5DJXB 1PSKL 1W0WB 1P84J 1PDKB 3AY4C 4RMBA 1WFUA 4P2RE 2VN3A 2FBJL 1JHTA 1D5BA 4HC1L 3DX8B 4Z7NF 3MCLH 2X4PB 1MIEH 5DJYB 3U4BH 1FNGB 5JHDB 5I8EB 1TQUA 4HWZA 3RGBA 2WSKA 1BVOA 5FFOA 5DA4A 1XGYH 1CDUA 1FGVL 5CJQH 1CDJA 3RTQD 4X6CB 3V0DA 4NC2B 5GS1A 1MAML 1QUPA 2F7OA 1L7IL 3STLB 3ZUNC 4CUCA 1GCYA 2P43B 3WLBB 2LQRA 4M00A 5I74C 3ARBB 2ATKB 3ZL1A 5LGKA 1WFJA 4FADA 3LHPH 1ZS8B 4CVZB 5JORA 4Y1SA 1NC2B 3K2UL 3FOLA 3Q0HA 2YXFA 1IKFL 1ND0A 4IU3A 4XNXH 1HK6A 4MA1C 3PYCA 2A5UA 5EOQH 1BF5A 3C5SA 5J4MA 4K2UH 3IEAA 4Z18A 1A4KA 1FCCA 1I7UB 2CIIA 3UROR 3JYCA 3KD4A 1CDHA 4DETA 3RGVB 1BQSA 5HHVH 2WV3A 3DC0A 4NUJA 4X99B 1B6DA 1JZGA 4TVPD 3C5ZB 3DVGA 4X6EB 3DBXB 1DJIA 4YHIA 3GDBA 4FQ2L 4P3WA 1S9VA 4ABUA 4K73A 4JZJA 1S9WB 3PRZA 5JDSB 4UT9A 4WU5A 4FEMA 3N44B 1N10A 5I6XC 1P7HL 4AEIL 1AHWB 1F1DA 3RFZC 1URIA 4OQTH 4I77L 1H8SA 1INQB 5C08E 5GGSA 1AMXA 4HULB 1CE1H 2AQTA 5IQNA 2DWYA 5EO0B 4XMLH 4X9YA 4CMHC 1TQBB 1Q72L 2OLDA 2VABB 4Y4FA 4WW2F 5DD0L 5FO2A 3HAEH 3RVTD 5DMIL 4UQ9A 3FFCD 1P5UA 5C6TH 5AVRB 1DVZA 1M3JA 1N0XH 3MKGA 3QCVL 4TL5A 2Q76B 2BCKA 3HI5H 4RFOL 2Q7YB 1V27A 4FN0A 1AG6A 4ZS6D 2NUTB 4PQXA 3PDOB 3Q5YA 1M9WA 3RA7H 3MRPA 1KTDA 1KEML 2C1PB 3ELAT 5ELIA 4TUJB 5BZDB 2XFXA 1OCWL 3V6OE 1A4AA 2D3VA 2XXCB 3P0YL 3WNLA 2J20A 1NEPA 2P47B 2QLYA 4MA3B 1TFPA 1OV8A 2BSBA 2NW2B 2ICEA 3QPKA 4X6CE 3RTQB 3ZE2F 2GQHA 3V5DA 4EQ2A 3QIBA 3S96A 5ISZD 1OTTC 1MDTA 3LQZB 3OHXA 4K5LA 4PRAA 1JZFA 2OMVB 1NCOA 2B3RA 4QTHB 5BVJB 3ZQWA 4EVNB 3ULVD 2XXFA 1W0YT 3GTNA 1D5MA 2HVKB 1KN2H 1BFVH 1Y1UA 2UXVA 3D4ZA 1EAJA 1FE8L 1MG2C 2A83B 1NUDA 2J4WH 1BM3H 4FTVD 5F7KC 5E8DH 3RB7A 3U79A 5BRPA 1KTCA 3BP5B 3SJVE 1SBBA 4BBWA 1OD9A 2NXYC 4ES9A 4OJAA 3P3UA 1IBGL 4R4NC 5ABZA 3A0OA 4GKOA 3MUY1 5AOJA 4IRZH 3AABA 4ZYKA 1A3QA 1MCJA 1SN0A 1KJVB 5KSBE 2MFNA 3P4LA 25C8L 3MCKA 3REWB 1E9QB 4NZRH 4P4KC 1B0WA 1MFUA 3WJMA 2MCAA 1R75A 2WWMD 5JPNA 4PJ6A 4M62H 1SDAB 1FNEA 2UWEB 1BZ9A 2XWJA 1QNIA 4CVWA 1D9KB 2Z31D 3REVA 1JTTA 1YPZB 2VISB 5IMLA 5M95B 3CMOH 1WBYB 3X2QB 4WDIA 3RQ3A 1YEIL 4ANUA 5IB5B 5L2KD 2A4CA 3PWPA 3S3SA 4JKPL 4OW6A 1XGPA 1YEEL 3ZHKA 1OGPA 5IB3A 4OCRL 5LWYH 1P0SE 2XN2A 3HZMA 3FT2B 3N0PB 4L8DA 4LF3A 5FDYA 3HNTL 3TJPA 2D4FA 3FT4A 3SE3C 3ZOAA 1RZFL 5EEWA 1CF8L 2Y5QA 2VZ1A 4CVXB 1R5WB 4G1MB 1NGYB 1ITBB 3K81A 2VR5A 3FFCB 2W81C 3WXWH 4BH7A 4OZIE 2FO4B 3TC9A 1KG0B 4OFVA 4H8WL 4DEPC 1OCOB 4J2QA 4J8QA 1NEZG 1NMBH 3BIAX 4JDTL 2IAMA 4P2RA 5IVOA 4U1JA 5ADPL 3X14B 2Z0UA 2W60A 3BWUF 5EN3A 3UTQA 4UQCA 2HUHA 4X5RA 5C8JB 3B6SB 1YNLH 5E99H 4S1RH 4S10A 4K7PX 3AXLB 3A3YB 1BPVA 5C0GB 4P5TC 1RVFL 1M05B 1PLAA 5GIRB 2XVKA 3GXFA 4LQFL 2EDQA 3CGTA 3LS4L 3ENEA 3U6RB 2XY1A 3OPZL 1NBVH 4FYTA 5IT2L 4JFZH 5ISZB 1OALA 2A6IB 1Z7JA 5KYUB 4J39A 1UEYA 1ZT1A 2GI7A 2FNBA 2XZQH 3BUIA 3L4ZA 4ZX6A 2WQRA 3SOBH 5DQDH 4BA8A 2F1BA 1U8HA 3VX0A 1S78D 4G80A 1NDMB 5AAWC 3V4UL 3VFGL 4FTVB 1JNLH 3ZDXF 4LFHG 2XBDA 2IWGA 5E4AA 3B3IA 4PY8J 4IQHA 1BHGA 1AGFA 2VDNH 3HW7A 2QPEB 3GRWA 1VGKB 2YEVB 3KAAA 3ROOA 4W6YB 3VX1A 3LZPA 2GK0B 4Z5RA 1AP2A 1SJHA 2VUKA 3PWNB 4UBDC 3O41A 1AD0A 3MX0A 4QXTB 1HSAA 4L5FL 4TVPE 3U9PH 4AX3A 1BMWA 1AR1D 1P7KA 3SDAD 1X4XA 1VEMA 3FF7A 1OAZL 5EH1A 4JQIA 2UWEE 3UPRA 3NAAL 1TKWA 2WW8A 3UZQB 2YXWA 3US9A 2VO5A 1MFCL 3VD0A 1U58B 1SHXA 4M56A 5IG7B 3IGAA 4JZOB 5FX3A 3VACA 3X3FH 4AG4L 2MPVA 5CS7A 2ZUVA 5L2KB 4ADGA 1N0LA 3W38A 4PJ7B 1LP9E 4GUOA 5DR5L 1E65A 2JNZA 3SPVA 4H25B 1RHHB 2BP8A 4JAMB 3A4EA 3JWNH 1YEWA 5HDOA 5C08A 1MHEB 5BVPH 3ZE1E 1MVUA 4JLRB 3TBTB 1F00I 4AJ0A 1GMIA 3T2NL 4LL4A 5SX4I 3BN9D 4ZMQA 1CLZL 3FFCE 2G2RB 4OR1A 2QQQA 3KPNB 3C09C 4CILA 3ZYOA 3B4NA 1A64A 5T1JA 5FYJU 1GHFL 3Q6GL 2D7MA 5C0JB 3KGUA 1R3LA 3NN8B 4UCFA 4AKQA 5CEZE 3DX8A 1R33A 3VYPA 2DM2A 3FYIB 1AZZC 1CDCA 4JDZB 3VG0L 4IOSD 1E5UI 3LZOA 4O2FB 4XHJD 5F1SA 5I8EA 2I32A 3V6OA 3BDBA 4WHTB 3JWDC 4EQ3A 1H9VA 4CGUB 4JNXA 4DO6A 3O4LE 3O9WD 4PLOB 4I9WD 3VB8A 2KDGA 4NO0A 4X6CA 4LMQE 1WE5A 2YGVA 3C6LD 3GO1L 1N8OE 2F53E 3OKYA 4PV8A 5IMKB 4G6AC 1MW1A 1F86A 1UWFA 3CUPB 1PZCA 4QNPF 3ZRCC 3ARBA 2ATKA 1NGZA 4XNMA 1XD0A 1ZS8A 1MHPH 1E4WL 2GKIA 1LDSA 1NC2A 4IU2B 4KVNH 5IV2A 4O4YH 3CBJB 4FTVE 5IJCC 1AY1H 3BVTA 2AHIA 4TQIA 2Y1YA 4MZIA 3SJVA 4B9FA 4ZW8A 1SJVA 3G08B 2OX5B 3SDCD 3RP1A 1IBZA 1M7DB 1SGKA 2K8MA 3INOA 5GGTL 3SGJA 3MBWB 5D6CA 2V2TB 3PHOB 1BFOB 3EGXB 1PIGA 2OCJA 3L2LA 1XV8A 3QJQB 5FGSA 4PJCF 3UP1A 1H0DA 3VVVA 4YHNB 1H6EA 2Y2YA 3NJFA 3RGVA 1F18A 5KSBA 4X99A 1AS6A 1NCBL 2VDRH 3DGGA 2JWYA 2A0LD 2Y6SD 4X6EA 3ABMB 3MKKA 1AR1B 4QHMA 2EZ0D 5CD5D 1TO4A 1FFTB 2DKSA 4ZOBA 4Z7NE 5DJ6B 5D93C 1VGEL 1H3TA 3OX8A 4Y8DC 1U21A 4Z0XB 3ORJA 2XNAB 1FPTH 3FBQA 5EN2B 4P3CL 3ESMA 2CBOA 1P4IL 1J0YA 2CLZB 1OW0A 1GW0A 3C6SB 2W38A 1NJ9A 1U8QA 4M7JH 1INQA 4GO8A 3ERXA 4KV5F 5JO5B 1I53A 5GRYA 5LGHH 4F7PB 3Q9QA 5BV7H 5I0VA 2EXYC 2CDFB 1HNYA 2X28A 4MAYC 5EO0A 2AQSA 2BFVH 3QCUH 3APFA 1DVFD 1XD1A 3IS0X 3QCTL 2BVUA 4QF1A 4RH4A 5T3ZL 2XQ0A 1KGXA 4XB8A 1JWMA 4TQHA 4OZIA 1H3UA 1V3KA 4NUGH 3FHEA 4QWWC 2Q76A 4WNQA 4GBXA 1H9DA 4PYGA 5AW5B 2PLTA 3MBXL 3NCEB 4H4NA 4UV7H 1A5FL 2G2NA 2NQCA 2VC2B 3OJDA 4MBRA 5KVFH 3BH8B 3PDOA 2C1PA 2H47C 4AVJA 5BZDA 4A6YB 5F6IB 5AW4B 1KDJA 1MCKA 2BJML 4DGUA 4WKXA 3O9WB 4MA3A 5GQBA 2VZTA 3EYUL 3WLWC 2NW2A 2C7FA 2G60H 3HC0B 2XVGA 2Y5EA 1GGUA 2DQHL 2AAVA 2DY2A 3C6LB 1OSYA 4IKNA 1YNTB 1JGLH 1MAKA 2WIIB 4J3OH 3ULUC 4TNEA 4BQCA 5C07B 4EVNA 1D5XB 3R06B 5I18H 4G6ML 5E03A 4N5ED 2PN5A 1U6AL 2F6AA 5DHDA 2DMHA 4RSVA 4XMZA 2ZUYA 5FO7A 2GJRA 3HC3H 4UT6H 1HILB 1Z9LA 1BIIB 3BP5A 3SDDD 4PJBB 3H54A 1PFCA 1FSKB 3CN1A 4E9RA 6TAAA 3P2BA 4YX2H 5A3IC 3SDCB 2G3MA 5F7AA 2CJSA 2Z4TA 4GAYB 1HHJB 1MJ7H 3T0XA 2AGJH 4Z77A 3VDBA 4OZ4A 2Z3FA 4JO3L 1LM8V 1VCAA 2VDOL 3O6LH 1GGBL 1C12A 5TTRA 3REWA 1UEMA 2TSAA 4AQ1C 3WY4A 5HDBF 1NCUA 1U8OB 2EIZB 5EZIL 2LTQB 2MCG1 2UWEA 3D87B 1GZQA 1G43A 1DJWA 2YJLA 3POHA 4GW5B 2VISA 4LEOB 4NWUH 2F5AH 4HD9A 2AEQL 2BSDA 4Q6IC 4X7FC 5F6HJ 4JMXA 5KJRL 4M6OL 1WFMA 5IB5A 2ZUQC 3LKRA 3EKCA 3EO1A 2UVEA 3KPPB 3MRJB 2BWIA 4PUBH 1LP9A 2FTAA 4M7LT 2MKWA 3U2JA 3FT2A 1C7TA 3UACA 2AXJA 5FM4A 1IC1A 4EMZA 3O4OB 4N0CC 2YAPA 1NGYA 4HS8H 1DVFB 1LO2L 1BVKB 2V9QA 2B1HL 1W80A 3IJEB 1GYCA 3FFCA 2Z4QB 3FN0L 3GHEL 1LDPH 2Z92A 3CFKB 2OZ4H 4MNGE 5TE4H 1IZJA 3DJTA 4K23H 3T6VA 5INCA 3ZDZB 4BFEA 2WQUA 1WEJH 3G5XB 2GVYA 2JK5A 4X5WB 2XKNB 1TJMA 1J5IA 2VGLM 4DN3L 2MNUA 4OCLC 2FX7L 1CDGA 1X5FA 4KZDL 2RA1A 3ESVF 2NSQA 3AXLA 4LOUC 4W9KC 4UNVA 4M8UA 1YO4A 5F7DB 3Q05A 3O4LA 1LEGB 3BKMH 5F3BB 1LO4L 4X80H 5T1KD 2YPLD 4NDMB 1OPOA 4HK3N 1JBJA 3BIKB 1RUQH 5HGHA 2F53A 3QZNA 2HG0A 3ZDWA 1U8PA 1PKOA 2A6IA 3P54A 4ZX5A 1F4AA 3IMWA 1MLBA 3QORC 3THMH 2AK4D 2WSDA 4N3TA 4MXQC 2YD6A 5EZJB 1KPUA 3WSQH 1RZKC 2Z6FA 3MNZB 1B4JL 2O6DA 1NAMB 4FTVA 1L6ZA 2KI6A 2X4NB 3A6CL 3FQTA 5AZEH 4IK6A 4KDTC 4ZNCD 4KNQA 5IKCB 3SDDB 1E5BA 3B34A 4GUPB 4BRJA 1DP0A 4FERA 4F1ZA 1RZ7L 5ILTH 1VGKA 5J7CC 4PR5A 1XXDC 2GK0A 1F3DH 5IBUB 3WXVH 3VRJA 4Z7VF 7PAZA 2QADD 4Y2DD 4F8QA 2BOCB 2J88L 1G9NL 4KO9A 4NNPL 4D2NA 2BZCA 3TO2B 3BPNC 5GRUL 5SX5K 3WKML 3RZCA 2Z31A 5DTFA 3WY2A 3BYYA 4DERA 4F5CE 5IG7A 3RWHB 3VRLE 4JZOA 3WYRA 4XBMA 4ZTOL 3QDHA 4FFVC 2K6ZA 4J6IA 3H53A 1RK0B 1XGQA 3L4WA 3PXJA 4LVHB 2IPKB 4DESA 4J12A 4GRWB 4BFIB 3V4PB 5DHVH 4JAMA 3MOBH 2BVPA 5DQJA 4OF5A 1MHEA 5J11B 3MRLA 4PJ8D 4A2GA 5CLZA 5E0QA 4L1LA 2ICWJ 4C56E 4Z3IA 3B2UD 1BBJB 3T4AC 1YZZA 2B9BA 3KPNA 3IDXL 5EIIA 1KJ3L 2XPZA 3LZLA 2BHUA 1NM4A 4HK0B 5C0JA 2EH7H 5J1AA 3CN3A 5LKNA 1AXSB 1NSNH 4K71C 4ELKB 4JDZA 2E0PA 3EGSB 5FUZL 1UT2A 3BPLC 1C16B 2HWZL 4F15C 3DXAE 5A2AA 1KLFB 5DJZB 3X17A 1HZKA 1YYCA 4FQXB 3AWGA 2R29A 1Q1JL 1NCJA 4Y16C 3QPQD 3MRGA 3DHUA 5T1KB 2YK1H 2YPLB 2UV3A 1F41A 2YSSB 3O3BB 4G3YH 1E3FA 4KKBC 5IMKA 4BFRA 2WO4A 3BHBB 3MNVB 1TQCB 3CUPA 3OGCB 3J27A 5CMAA 5D4IA 2EC8A 2NYYD 2Q2EB 1XFPA 2AK4B 4UTAL 3IVKB 3K1KC 2OMTB 2K6YA 4JREC 4RGND 2ZQKA 1BXAA 1DSFL 3ARGC 3KJ4C 1HZHL 4JE4B 4PRNA 2X6AA 2X0UA 4QXVA 5H35B 3AITA 2QZ5A 2CO1A 3VD1A 2DJMA 2EACA 3BLBA 2Z65C 3G08A 3NJIA 4OD1H 5AVUB 2V2TA 4GG8B 2IADB 3HS0C 3MRDA 4OTXL 1BFOA 3EGXA 4NZJA 1TDQA 5F0MB 1QSZA 2ZT9C 1KZYA 4EAEA 1ADQH 1M3IA 4QRQB 5C9JB 3BSHA 1DQLL 4J3BA 1FFOA 5I6NA 1IEAB 2CO7B 4LDEB 2IDUA 5I0XA 4F58H 1IGFL 2QADB 3QJFB 4Y2DB 5GRVL 3SDAA 2C3XA 5I0WA 3ETBF 4N9GB 1QBBA 1S7RA 1YN6A 3L4UA 3GMPA 4B9GA 5BJTA 1BA9A 5F9OL 4Z0XA 3OMNB 3HI1A 1DBKH 5AEAA 1WHPA 2XNAA 1J7VR 4HOWA 4FA8A 2MCMA 3TU6A 4JPWL 3F84A 1XMEB 3T8XB 5E08H 2OTPA 3RL2B 2ED6A 2B4CL 2QPSA 4U1KB 5SWQB 2CLRB 1MFEL 2YPVH 4F7PA 4FCAA 2GSGB 4N2NA 3PG2A 3ARED 3LV3B 43C9A 2C9QA 1JVKA 1E50A 4XTRD 4PJ8B 2ZSWB 5E56A 4QNPE 5G5DA 2GEQA 1CUOA 2IDCA 2WNWA 4N24A 4YR6B 3TH3T 3DDFA 3WIIH 5JHBA 1ZA3A 3UBXG 3VJ6B 4J6RH 2EIMB 2NLJB 4AC4A 4MNGA 4WW1B 5ACLA 1ZHBB 5HBBA 1OOWA 2HLEB 3I9GH 4TKWA 3WJLA 1FI8C 4BH8A 1K9TA 3INUL 4P2YA 3CU1A 4TOYL 4L3ED 5JXED 1PY9A 2F7RA 2KS0A 4FP8H 5DZPA 4WZ9A 5DVLA 3GLAA 2EDNA 4IOSA 4A6YA 4HIXL 5EFIA 1M71A 2P45B 1OAYH 2NXZD 4PJCE 3EDKA 5DJ2B 3T1FB 2ZP8A 3I3DA 5CUSH 3ARWA 1FGNH 2DICA 4K3JH 5JIHA 2GITA 3HI6H 2YPLE 4C58B 4J28A 4E42B 4N0YL 1YNTA 4DKEH 1MFDL 4K4KA 4NRYA 4BFNA 3RY4A 3ZY7A 4EBQH 4HG4K 5DD3L 1R3JB 1S7SB 3R06A 2IQ9L 2AK4E 4JVPA 3S3PA 4R97C 2DLTA 3LEVH 4W9HC 5HDRA 5I1GL 2OMUB 4ONGL 4WI9A 4XB7A 3VYNA 3IJ7A 4RGNB 1Q9OB 3LCYA 3LB6D 4R2GC 1HILA 4WKZB 4LMQI 3ATEA 2YD1A 5EO1B 3BZFA 3SDCA 1V3LA 4OGAD 5EO9A 5LNGA 3HMWH 4RVBA 4GAYA 1TCMA 4KZEL 1XR9A 3A6BH 5J3HC 3J07A 2M2DA 3MDJA 4N8CH 4NJ9L 1OZTG 4P23C 2JCCF 4XO8A 1S7XB 1IL1B 2RGSA 4NBYB 1XQ4A 4B27A 1WS7A 1IAKA 3EH1A 1U8OA 1XCWA 2JKRM 5H2BA 1DFBL 2VW7A 1B4TA 3LS5H 4LHJB 2BFGA 4FABL 4MS6A 3KWTA 5GGRB 5I2IB 4OB5L 4OSUH 4ORZC 3JVFC 5FHAL 4F5CA 3FU5A 4GMSL 5T5NG 2HRHA 3PGFH 1JHKH 3QNFA 4N2OA 2OTWA 3SGKC 1J1XH 2TSBA 1SDDB 3EADA 1GGIH 5HJDA 5I1HH 1CD1B 2H2SD 1BGXL 3IGUA 2MNJB 3II1A 3UDWA 2CR0A 3K5RA 2XZZA 3KG5A 3QHFH 5DK3A 5E1AB 3UAFA 2WBKA 1AI1H 5IY5B 2OBGA 3AREB 3MJ7B 1CDIA 1O6VA 1T0MB 4LRIC 2HT4C 5EPMB 4C56A 3S34L 2GG1A 3V4LA 1DVFA 2HFFB 4POYA 3IJEA 1A1NA 2D9CA 3AB0B 1NGQH 2CDGA 1BOYA 4JB9H 1YYMH 1KYOK 4AWJC 2CKBL 1OSEA 1Y6NR 2DQDL 2YJQA 4AM0B 3T0VA 2XXMB 4YMPA 3V4VH 3WTTA 1QLEL 3BUBA 3N0AA 3NFNA 3L9YA 5HI3C 2NMSA 2FQDA 1L4IA 1OY3B 3G5XA 4Y2NA 4L3EB 2OL3L 4X5WA 5IFHL 2XKNA 2FEEL 4L9DA 5HHPB 5FCUH 1X44A 3WHE1 3PGCB 4DP9X 5A2IH 1ORQA 1U36A 4KX8A 5DZJA 3O6KL 1TTGA 3CDZB 4RGOL 2NXZB 3DXAA 2ERJB 4K7FB 1JYNA 4FZEL 5B7MA 4QXUH 2X4RB 4I87A 5F3BA 3OG6B 4G1EA 1Z32X 3GWJA 5HDBE 1CBVH 2OR9L 3FONA 3NFPA 4HEME 3LXAA 3WCYA 1J86A 5JOFA 4J5VA 1NCAH 4QT5A 1YUHA 1HKLH 2AFNA 3H7BA 3IFNH 3T3MB 5KYWB 4HALA 2LT9A 3S88H 3EBGA 3O2VL 2X4NA 1A21A 1BMGA 4PPTA 5IKCA 1BBDL 4GW1B 4NX0A 5L8KB 3VGFA 4OZFA 4PJAB 3BW9A 1KIUA 3F05A 5FM5O 3SQOL 3FUEA 3QP3A 4IOFD 4JFEE 4J3OF 5SV4A 4HX1A 4EUPB 3SQRA 3LIZH 1T03H 1TZIB 1GAFH 1XMWA 3ATBA 3S2AA 4BUQA 3MNMA 3TWCL 3CFEA 4F3FB 4QYAA 3FSVA 1BX2B 1A6WL 3BAEL 1F8TH 3TO2A 1TIUA 5JUEH 3SPJA