2W0FA

Potassium channel kcsa-fab complex with tetraoctylammonium
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
218
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Kcsa in Complex with Symmetrical Quaternary Ammonium Compounds Reveal a Hydrophobic Binding Site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/metal transport
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
total genus 41
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2008-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w0fA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w0fA02
3KJ6H 4UAOB 3U46A 1CE1L 5GGUA 1XF2B 1IZKA 2C3WA 1EDQA 3SGDI 1DTUA 3GMRA 3ZYZA 5C07B 1NJ9B 1I3RB 2EH7L 1YEKH 4TSBH 5TF0A 1MAKA 3MBEB 5FCUL 3TGXA 1FYTB 1H15B 1IGIH 1PYWA 3CK0H 3DROB 1WZKA 2BMKB 3D69A 5DURD 2GTWA 5D1XD 4CADA 4FZ8L 4LNRA 4UV7H 5AEAA 5DVNA 3R8QA 1F4WH 4L8CB 4JDZB 3D85D 3QFJD 3CFJA 1S5HA 3BZ4B 4UV4L 1INDL 1I9RL 4A2LA 1P6AB 3LRHA 2I26N 4GRLD 2HVJB 2HFEB 3UC0H 3QUMB 5BRZA 1A6AB 1I1CA 3QIWB 1JE6A 1TETH 5HDQH 3OKKA 1CXKA 1DVFD 1T0NB 5CEZD 3PIQA 4XMLH 2CDFB 1HHKA 2XXCB 3RVVC 1T20B 5F1SA 2R39A 4NUJB 3KHQA 4JPVL 5SX5H 4MJ5A 5T1LD 4LHQB 1INQB 1OAKH 3QIWC 1P4LA 1QSFD 3IU4H 4QYOA 3ARGD 4H5SB 1UYWL 4GAYA 5K93A 5DEFA 1CD1A 3C8KA 1FVEA 3TPUB 1G7PA 3OR7A 4YHOL 3SDXA 1NGXB 1FAKT 4KROC 1WV7T 1N5AA 5M94B 5C71A 2X1QA 1J5OL 1IGYA 5GRVL 5EU7E 4B41A 4RZCA 1CFTA 4X6BB 4XMPH 1OD9A 3HE7C 3MCG1 3DXAB 4J8RA 1B2WH 1DUZB 4BH7A 2EDLA 2VOTA 1CE1H 4PRPB 4NKMB 4ZS7L 2YBRA 5EZLB 4GH7B 4NN6B 4P5KB 5B3JE 4U6TA 3TIDB 5H35A 5CZXD 5GISH 3WLWC 2GJZB 5DC0A 3PP4L 1O0VA 1TJGL 3MUGA 3LEVL 4LDEB 1G1CA 2G2RA 4WO4D 3IDXH 1HYRC 4KRPD 1KEMH 5F97E 3BVNB 4PY7A 5BQ7B 3DSNA 3VFRA 1E4JA 1MCQA 2H26B 3MV9B 5DT1H 5GGRY 1BIIA 3VFPB 1YEIL 2VLKE 1ZANH 3ZKXB 4I9WD 3T77B 4M7JL 3MGTA 1NCWL 1ACZA 3I75A 4M7JH 3MJ9L 2RR3A 3E2HB 3WSQH 3T09A 4JO3L 1P2CA 3DGGA 4ZSOB 4G9FD 3MRQA 4E41D 3CMGA 3GSNB 4NZUL 4GQ9H 3B9KB 2EZ0D 3NA9L 4CW1B 5H2BB 4U0RC 2UWEE 4IOFD 4DN3L 2VE6A 4P4KA 3HRPA 3VXSB 4LNRB 4NQDE 3V4VH 1EVTC 5C3TA 3K2MC 5I1JH 3BFOA 3W9EB 2E7LC 3FQXA 4G9FE 3C6LD 4L8BA 1UH2A 1LK3H 4ZS7H 2Z91B 3FT2A 4NJ9L 5D2LA 1YYLH 5T3ZH 1AO7B 5GSRA 3R0MA 3DVIA 4KVCL 3QUZC 4L4TA 2EIZB 4KRLB 1Z9LA 3QWOB 2RJMA 3SE4C 4ODBD 3DVFA 1WT5C 4EKXA 3O3DA 4EQ3A 5KZCD 4BK4A 5CP7B 1AXTL 4KHXH 3CDGB 5GQBA 1MIML 5DK2A 1NCUA 2R1XA 5I8OH 2AJXL 1KPRB 2H6PA 3DRQA 4PY8I 5DR5H 2Q1EA 1HHKB 3ZTNH 4RFOL 2FL5B 3ULUF 3ARZA 1NBZB 3VFMB 5B39A 4G8GE 4NHCH 4ELME 4Q9QL 4G6MH 5EU7C 1MJ7H 2R15A 4WWKC 4Q9QH 3LN5B 2HKHH 2V5TA 4P2OD 1T89C 5IBUB 1JIBA 4TTGA 1HHGA 2MFNA 1H8OA 3JWOL 1SYSA 2DDQL 3B9VA 5E7FA 3MRIB 3RBGA 2B1HH 5T1DL 1Q9LA 3UBXI 4NRXB 3OG4B 1NPUA 1OARH 3O45B 4X5XB 3C6LA 4WHYH 4FP8L 2AEPL 5FDWB 3KYKH 3PL6C 4PJ9B 4APQA 3CH1B 4EN3B 1HHJA 3IFLH 3KPRB 3P4OB 4QF1A 5EFIA 2FBJL 2PW1B 5I17A 1OTSC 4PGDA 3FQNA 4OAWB 4B50A 3HMXA 4RGNE 4K7PH 1OB1A 4K7PL 4CJ1A 1EO8L 1MCBA 2FRGP 3I2CL 3T2NL 3QIBB 3ARED 4C54A 1U8IB 1ZSDB 5HVFB 3MGTB 4YHOH 1HXYB 2VXQL 2F58L 2NXYD 4PLOB 3EYFB 4DZBB 3RDTC 5KTEH 1YY8B 4L29B 5D2LF 3HUJB 1NBVL 3K1DA 4KI1A 4KQ3H 5DZOA 4ODHL 2R2CA 3G04B 2VLJA 2NY0D 1JPGA 2D9CA 5DRXB 2HH0H 3MRCB 3D3VE 1RJYB 2W9EH 4Y0GA 5FECA 5D1ZD 4GJTB 4JZJA 4F3FA 1REIA 4JFZL 4JZNA 1JHLL 3WNNA 3UJIH 1VHPA 3IRZA 2EYTB 4UIMB 3IYLW 5EU4A 3KPSB 2NY1C 4NKOB 3K4AA 1OLZA 4JHZA 2WQ8A 2UWEF 5HXMA 3LKQB 1J18A 3CZFB 2FATH 5CUSL 2BNQD 5E8OB 3QBTB 1Z5LA 1F90H 1S3KL 4L4VA 2JK5A 3QJFB 3BI9X 1FO0A 5EO0B 3DYPA 5T3XE 5DJDA 3CZJA 4JFED 4D9RE 5FO8A 2Z35B 1EK3A 1IRAY 1KC5H 1VFBB 3V7AE 3S5LA 3SJVA 2DJUA 2VR9A 5JMOC 1XR8B 1I1AD 4R97C 2AJYL 2QSQA 3GSUA 4U1KB 1QBML 4IRJA 1IGIL 4M8VA 4YHMH 1JK8A 1QFUH 2VIRB 5B38A 5MP6L 4K3EL 2IG2H 5CEYA 5C0FA 2EIEA 3C5ZD 3BH8A 3K2UL 3MQIA 3ZDYE 3L3GA 2FHCA 2OL3H 3BOVA 3GSVB 4MNQD 3BEVA 2BOBB 1AGEB 2YMXL 4XWGL 1YA5A 1U8PB 2E27L 4LPTA 2BXYA 2FJFA 2YXFA 5EU3B 4AJ0A 4LCWB 2ICWB 4JHAL 2X89A 1IKNC 1NGQH 2X4NA 1D7FA 4GBXC 2IPTL 4QHLB 1H3PH 3BKMH 1BX2A 4NJAH 1BVLB 1B4JL 3MO1A 2L7UA 4JY4B 4G43A 3GSNL 1H3TA 1YJDH 3KPMB 5CZVH 4Z7UE 2QSCL 1EFQA 5DFVD 3F12A 1C5BL 5I30H 1OP3K 3O3AB 2BVUA 5HVGB 4LSQL 3V6OA 1ZHLA 2FWOB 3JV0A 5IMLA 5FYKU 4U1SA 5FCSH 4D94A 3N1MC 1MI5D 4HG4K 2BNRA 3PE9A 4KXZI 1PBYA 3Q2CA 4HJ0D 3JV4B 1R3LB 3EHBC 5ADOH 3ULUL 4H1LB 1X4XA 4P57A 4XPTL 2KZWA 1CK0H 2R0KH 5T3ZE 3VG0L 2ED7A 4A6YL 1EAJA 3FN0L 3STZA 5HSFA 5CP3H 4J2XA 4I0PD 4QOKD 1Y6NR 1ZTXH 5GGSB 5CGYC 5E5MA 3ULUE 1DLHA 4PJFB 2E8YA 5E2UH 1MCKA 3H9YA 3KYKL 2B5IC 3NAAH 4RQQA 1VKXA 4CU8A 4EOWL 2RCSL 2WWKO 5E2TL 5A43C 3IAPA 4LSSH 1RVFH 3P77B 1CGVA 1Z9OA 3AUVA 4F7PB 4MAUL 4QRRE 3IJSA 5JQ6H 3GIZL 3C5JA 4NSKA 3IDIB 3NH7H 3O2DL 3C2AH 1V5JA 1ADQL 1CGUA 4OV6F 5AZEH 1K8DB 4IDJL 1R0AH 1PSKH 5DHYB 3O3EB 2FDBP 1FE8L 3OKLB 4LLMA 2YC1A 4X6CE 3MJ9A 4OCXL 1UKSA 3HI6L 4HUXB 3SBWC 2WSKA 3VFVA 4OKDA 4Q0XH 4HS6A 3TCXA 4Y19A 3H3PL 1U41A 3QHFL 3UX9B 1DVFA 4Y16B 4UNUA 3OR6B 4HIXH 3O3BB 2DLHA 3QEQB 1LP9A 3S9DB 4HT1H 4PRPA 5IVXF 5KW9H 1ULVA 4P46B 1C16B 5EOCL 3VMNA 1ZA3A 4ZTPH 2B2XL 4L5FH 4NM4L 4MB4A 4M6NH 3RA7L 4UU9B 4FQ1L 1NANH 1TJIH 2I24N 2VSDA 2X70A 5GRUH 4E9LA 3MA7B 1VADA 4HH9B 1TJIL 1BQHB 2IANA 5E94B 3HZMA 4BQBA 3ILQD 4WI2A 4Y2DD 4D9QD 1U58B 4OF3A 5I66A 5I19H 1G0YR 1FN4A 1IGCH 3BUTA 5E0QA 2UV3A 2X4RB 4YXLH 3EYVA 3QO0A 1UXSB 3U79A 4TOYH 4POUB 3QFDA 2CPCA 1ACYH 4HJGA 1IGJB 4FQPA 4YEEA 3B2VL 1MHPL 4JY4A 3TZVA 2Y23A 3NIFF 4P2RE 2F5AH 5DR5L 3VDBA 1I7RA 3V5HB 4UTAL 3TVMB 3H3BC 3GIVB 1D9KD 2GAZA 5CILH 3V4PH 4GW4B 4RWYL 1NC2A 4LKXA 2P49B 4H1LA 4TRPL 1SJVA 3HPJB 3SE9H 4WU5B 3MLZH 3E6HA 4UTBH 4MJ6B 3VWJD 4UT7H 4ESKA 1E4KA 1J0KA 5HHOB 5KG9B 2H41A 2N7AA 3QZWB 2A6DB 4RIRB 1ZEAH 1T5XA 4K8RH 3WLWD 4P3DB 3WUWG 1LEIA 1YEEH 4JFPA 2A9MH 4I5BA 2IGFH 4MS8C 4BUGA 1N6UA 3I6GA 3TIEB 1AXSA 5AD0B 3SO5A 5E24E 4R0LA 4ZUSB 2P5WB 1ROWA 4L8SC 1KTLA 4HWZA 1CTNA 1Q9WB 1W0WB 3BPOC 5BS0D 1I7TA 5E00B 4PRHD 3V9FA 1CDUA 1A5FL 3RDTA 2FIRT 2BHUA 1HSAA 3DX8A 4IRSD 1WAAE 3TYGH 1CLCA 2XWBB 1CICA 3AREC 3JZ7A 3R4DA 1I9IL 4LVEA 1BZQK 4AH2B 1T2QH 3X14A 2SEBB 5J1SC 3UJJH 1TMCB 4OQ1A 5MEPA 4M48H 4XNUL 4X6DF 2JE8A 4JVWA 1UH3A 2J8UE 4WHTB 4I3SH 3ZKQD 1H3XA 1HHHA 3V7MA 2Z8SA 4UDTB 2FEDD 3TBWA 5DZNA 1QLEH 4NBXB 3LEYL 2JJVA 2GJ6A 1B4JH 3OKNB 2IPKB 1KELL 5SV4A 4L3CB 1TJGH 5CEZL 5IGXH 2VN7A 2EXWC 3L3HA 5IHLB 3G6JF 5E9DB 4MGXA 3QQ3B 1UXWB 2GJJA 4XMPL 5DJZB 5C6TH 3ZE2E 1XT5A 4OD2A 4XP4H 3WO4C 3WIHA 4GS7B 5DD6B 4M1CD 4NKIH 1QSEB 1FBIH 3VH8A 2ED8A 3T2PA 3DLQR 1YN6B 5C0GA 3RZCA 1E27B 1C7SA 1BZ9A 5LBSH 3VWKC 2QQKH 4OCNC 4BFIA 3WN5C 5E00A 3I6KB 4AIOA 1U8LB 4HIEB 1CZ8L 1Y18B 3GSNA 1HQ4A 3RTQC 4JFXB 4UBDC 4S1SH 3OXRA 3HKFA 3T0EA 3QUMH 4U1HA 3GI9H 3T04D 3TO4A 1IC5L 1DQLH 3TN0B 1P4LB 4L9LB 4ZAKB 3BGMB 4JJ5A 3S96A 1XF2A 5HYQA 2HT3C 3AS2A 1WEJH 2WUBL 1IGFL 1DBJH 5FOJA 4KKAC 1GC1H 4LLYA 1QRNB 2HJFB 5DMYA 1YYML 4KUZH 3O8XA 5F3BA 2Z8WC 4HWNA 2Q3ZA 1CFQB 1XGUA 2IALA 1KCVL 2DMCA 4XCYA 5C0JB 4ODUB 3TA3A 1A3RH 1J88A 1DN0A 1JGUL 1CFSA 3LIZL 4KV5E 2VSCA 1XF5B 3ES6A 2Y5TA 2F8VA 2LTQB 4YFLF 2XT1B 3PGFH 5EIIA 3O3EA 2NW2B 1JJUA 5I30L 1AR2A 2AK1L 3SCMD 3KYOA 4O2FB 1V7ML 3WFHB 3SBWA 3UJTH 1GGCH 1IZJA 1G7HB 5IKCA 2AJXH 1KN4L 3H9SA 1Z3GL 4ZPVB 2BNRD 2NY2B 5ICXA 5I1EL 4GXVL 1K2DA 5GGUB 5IBTL 3O6FA 4IRJB 3NCFB 1OP3H 3VRIB 4XXCC 4F57L 4JG1H 3TESA 4L3EA 4HK0B 1EEZB 2BVOA 4M7ZB 4OIAA 5GRUL 4MJ4A 2AKRB 5ITFA 4DW2H 4V2CB 2V6HA 3C9NB 4L9LC 2DM7A 3JTSA 5T33H 4PR5B 1AP2A 4KVNH 1HHIB 1YEJH 3PGDB 3U4BL 3KLDA 3IFLL 5JW5A 3OR6A 4KKBD 7CGTA 2MPAH 1N6VA 3KYNB 4FQJH 3TV3L 2G5BB 3V52H 3BPLB 2XXMB 4QNPF 3HNVH 4LVOB 9CGTA 2UVFA 5EH1A 3O2DH 5CHNA 5T1DH 4RFNC 2WW8A 2ORBH 2PYFA 5ESVB 5SWQA 3SJVE 1A9EB 5AZEL 4C56E 2V17L 4W68A 4XCFH 1IFHL 5FYLH 3V6FA 3DYMA 1MCHA 3T2OA 1YC7A 1RZ7H 1JTTA 5DJXB 1AQDB 5F70A 1E4XI 5BV7H 3PF2A 4RFNB 5IV2B 5CSBA 2NLJA 4M93C 5GRJH 1SEBA 4HS8L 4BSJA 4G6JL 1G6RL 4G6AC 5TDNB 4CNIA 5D2NE 3O8XC 4KQ3L 1JN6A 2NR6D 4RFEA 4YHPA 1OPGH 4PJDF 3MGAA 3B8SA 1Z3GH 3BZEA 1XIWC 3UTTE 3ZDXE 5JXAH 2JLLA 1QBAA 3RKPA 4FG6D 4PYGA 2OQJB 2HP4A 4ISVB 4FQLL 5F1KC 3ZE0E 5D7JA 5TQ2L 4Z78A 1NDGA 4HS3B 1QSEE 4FA8A 5GGTL 4XX1E 1JZ4A 3TFKD 4AG4L 4JM2F 1J7VR 2WBJA 4MNQE 2D7OA 1FYTD 2OSLB 3EGSA 4UILL 2CGRL 5E8PB 5J7CC 1EX0A 2W9DH 2P42B 3MLWL 2HVKA 3BP6A 3S5LB 4YUEH 3MLYH 5ICYA 2CD0A 1EHLH 2D7TH 1H9VA 5DFVC 3ME0A 2NX5D 3DX7B 3MZGB 5I1CL 3R06A 2Y9RT 1PKQA 1JPFB 4UTAH 4M1DH 1YUHB 2R56H 3MLUH 3L1OH 3THMH 3X3FL 1MJUL 1DVFB 3EHBD 1XCTA 1YNTA 1W0WA 5DWUH 4F9PC 4FFYH 1OSZB 1I8KA 1OF2B 3GJEB 1X5AA 5JHLL 5DWUL 4UI2A 4I0PC 1KJ2H 5I16A 3S37H 2YRLA 5BV7L 2H9GB 4YDVB 1G6VK 4UT7L 1N0LA 4XVSL 1TIUA 4L3CA 1RZFH 3MJ8A 4JFFE 3DROA 4OBSA 3RWFB 3BP5B 4HGWB 3B3IB 2ESVB 4YX2L 4NO5A 2N7BA 1DUYB 5DRXA 3VXOB 1KCVH 3O6FD 5BZWB 2B20A 2R2BA 1QBMH 4KI5D 3ULVE 5JUEH 5CBEB 5C2BH 1HDMB 5KSAA 3FQRA 2P5EB 1UVQB 2J2ZA 5DMKA 1NL0H 1MOEA 2IBGA 2QQLH 5TFSH 5IEKA 5GZOC 4I3RH 4PJDA 1GVIA 1IAIM 1KFAH 3L7FA 5BRZE 3DXAE 1CL7L 1I8IB 3M17B 3VWKB 3UC0L 3TBSA 3NZ8A 2IBBA 2CLVA 4DGIL 5EBGA 3N9GL 1FO0B 1J8HB 4QTIL 2JB5H 4LRNH 2XTJD 2JB5L 1F4AA 3BP7B 5I71B 4LLAA 4JLRB 5L7XH 4M1GH 4MB3A 2AJZA 3P9LB 5E4EB 3FO2A 3F7YB 2D03L 3OAUL 1BLNB 3MBXL 4QTHA 4UT6H 4KJPD 4Q74A 3ULVL 2J1KA 3OAUH 1ZVSA 1TVHA 3MUJA 5D7IE 3IVKB 3O4LD 4K3GA 3RHWK 1Q9LB 3PQYB 1N26A 3QJHB 1JF1A 2VIRA 1A1NA 5B38B 2AERT 3PGFL 3KLAA 5F72S 1K3IA 5BVJB 2XOTA 1G0XA 3VXOA 4PJ8A 1UWEH 3MV7A 1DQDL 4I18A 3BHBB 4P5TC 3RVUC 3B9KD 3HNVL 3MRGB 2DRUA 3BXNB 2VLKB 1DANU 2L0DA 4FXGB 4JY6B 1MCPL 1D5MA 1KJMB 4LMQE 4PJDB 4HULB 4ODTL 4U3CA 5JNYB 2J88H 5C2BL 4PGJA 3UYPA 2AQ3A 4LFHG 4IIQC 1NFDA 1VGEL 5JIKA 2X4UB 2GFBB 5EC1B 4OCXH 2A73A 4M4RA 4LOUC 2D4FA 4X6DE 4KY1H 4N5EC 4HAGA 3MLPA 3WIHL 3KYOB 4O2FA 1YQVL 3VWJA 2C1OA 4OZFB 3MX0A 3P9LA 3WIHH 1BEYH 2VLJB 2XICA 3MLXL 3MA7A 4LPUA 4MSWB 4NT6A 3VI3E 5BZDA 3T1FB 3WXVL 3JWDC 2ZUWA 1JHKL 1XH3A 4D8PB 4WI7A 1BWMA 3OTTA 4JO3H 5ESQA 3SO3C 4UT6L 1UJ3B 1MCCA 5CS7A 3HE6D 3FQTA 3RWEA 1IGCL 1MHEA 3B8YA 4DCQB 4JREC 5T3XL 3EYOB 3HC3H 4PJCE 4TYUA 1JZ7A 1UCBH 1ZHKB 1IQWL 3PNWA 4Y89A 5ACMA 5AG9A 3UZVB 3P9MB 4P5MA 1UM5H 2BMKA 4JQVC 2ZJSL 1FIGH 1H5BB 4M61A 3WFEH 4NJ9H 2Z31B 4LPVA 1A6UH 4PGZA 5DHVB 3WFEL 5DZLA 3VFTA 3WNOA 3V2AR 4Q9BA 4CW1A 1T0MA 1KEGL 4NZJA 4O2CB 3UBXG 4HXAH 3TBSB 3D25A 4JDTL 3SDDA 4XNXH 1TCRB 2DQDH 1AY1L 3LEXB 5FYLD 1EXUA 1NLDH 4RNRB 3PWPD 4MQTB 2EC8A 3VXQB 5SX5K 3EYUH 2I5YL 1CG9A 1JHLH 1FNEA 2ZOLA 2R8SL 3W2DL 4OZIB 1LK2A 1W8NA 1HKLL 3ARGC 2FB4L 3EO0A 1DBAH 3HCVB 4CGTA 4QKXB 2CRYA 1F58L 1MF2L 1WBYA 2A9ML 4XX1G 3RGVB 3HI1B 5F96H 1CE6A 4YC2C 3PWLB 5JLZB 3ZDZF 2J8OA 2NY5H 3MRJB 1DQTA 2VYRE 1Z2KA 4NNPL 3I02B 2IBZY 4LHUA 2OX5A 2R29H 1CGWA 5E99L 5JOFB 4L8BB 1N5YL 2QQQA 5GHWL 1Z0MA 3E8UH 3T0AA 4DQOL 4HV8A 4U1GC 1KYOJ 4HF5H 1P7QD 1PY9A 3AFLA 1FFOB 5C09A 1YMMD 4WHYG 3DBXB 1HHGB 4NQCE 3U82B 2ERJB 4JRXB 3G6AA 1A4KA 3ABZA 2FIKA 3C5SB 3VDAA 4RGNC 1CF8H 1T1XB 4ZFGL 3E3QC 1NBZA 4YGAB 4FQQA 1N3NB 2GK2A 4MZ3A 2A38A 4Z95L 3SDDD 1KPRA 3QQ3A 4OM0H 1EAPA 1EO7A 5HGHA 5D1QA 4Z7OF 2NY7H 1L7TH 4K3JH 4MHHG 4IRZL 2PCPA 3ROOB 5ALBL 4KRMB 4Z0BL 4X6CA 4JRYE 1ORSB 3UTPD 5CWSB 1LO3H 3INUL 5FYLE 3VFNA 5KSUA 4HCRH 1WBYB 5FGSA 3RGVA 3JUZA 4RIRA 1FFPA 5E03A 4GO6B 2F5BH 5BQ7A 1RY7B 4LRNL 1QFOA 2Q8AL 3WHXB 3L5IA 2DWEB 2Y25A 4UOJA 5CFHA 4S1DC 5HHXL 2AJUL 4DJMA 4X6DB 3SDXF 1T22B 4HIIA 3QDGB 1EEUA 2ESVE 3PABB 1C5DA 5HYSB 3UTSA 1CYGA 1VFMA 3QIBA 3GI9L 3M45A 3KGRA 3RIFF 1NC4D 3C60C 3MRRA 1SQ2N 2IAMD 4OCRL 4UNVA 2HRPH 1DLFL 1W72H 3D6GA 3G6AB 3QULA 4NQDD 2ATKB 2DKMA 2XKNB 3IDGB 5SWSA 3VG0H 3QUZD 2YA2A 2EDXA 2R69L 1XFPA 2GK0B 1DBJL 2O5YL 3UXFA 4NKOA 3ARDD 5L0QB 4M02A 3G9VA 3GSOB 1OL0A 4Y19E 35C8H 3QNYB 4GOSA 4W4OC 3HNTL 3QIUB 5CJOH 3VXUD 3O6FC 5GSVA 1VPOH 4OM0L 4LLUA 5KJRH 3O0RH 4NZTH 2DM3A 3O6MH 1TVBA 2OL3L 4S0TD 2AK4E 3HCVA 1IT9L 4M00A 3NABH 5E5RB 1RIUL 1SMAA 4Z77B 2GJZA 2DF3A 5F89A 3MA9H 2MOVA 4DGIH 2XRAH 4P2YA 3RKDC 4ENEC 2V7HB 3VA2C 1NCWH 4QY8A 5D6DC 2X4SB 4LSTL 5DJ0B 5GGQH 1EH9A 4ZFZA 5ISZA 1ZHBB 5GGQL 1NCDL 5I8CA 3RDTB 1OWRM 3JTSB 4X7EC 2QADD 1AXTH 3O11A 3QG6B 3SDAA 1NUFA 3VI4E 4YDIL 3REWB 3U1SH 4UMGA 4IMLB 3QH3B 2W07A 4NYLA 5F7NC 3RWDA 4YHKL 4X0KB 3S3SA 4FQ2H 4QRUA 3N1FC 3HC3L 3ZE1E 4BQCA 3WNPA 1I1AA 5FKAA 4K7PY 1S8DB 1U93A 4MJ2A 5I76A 2W0FA 4EBQL 3BZDA 3IU3B 4YR6A 3BH9A 3T0EE 2X1WL 5GZNC 2FR4A 1J1XL 4NFCA 5FYLL 4I2XE 2Q86B 3DGGB 4UUJA 2RCSH 3OGOE 3S35H 2X4QA 1I7UB 1ZWIA 1JZ8A 5EZOH 2GIYA 4JLRA 5D7IB 4X5LA 4X99B 3FZUD 5IESH 4L4TB 3LS5L 4KTDL 4GLRI 1Y18A 4G6ML 1EGJL 1J8HA 2WAHA 2P45B 3QUYB 4LASH 3HI5L 1UACH 2VN4A 5SWSB 2CRIA 5DVMA 1JWSA 4ONOA 2ZOLB 5DFWH 3T4YA 5C0DB 1P4IL 4O9HH 2E6PA 2F58H 2XI9A 3D3VD 1WCBB 2F54B 2MWCA 1BLNA 1K6QL 3LV3B 2JJTC 3LKRA 5D72L 5E8EB 4AENA 3I3EA 1M05B 4WWKB 3GMPB 5DK3A 4LLDA 3NIGF 4TUJB 1UENA 4QOKE 2DL2A 3MRGA 1NGQL 1RK0B 3BXNA 5E5MB 3MNZA 1G7LB 1K8DA 1KLUB 3OHXA 5I74C 1QSEA 2DB8A 5JW3H 1A7NL 4BKLB 3BW9B 5HHVL 4GAJH 1KXQE 5J6HB 2O5ZL 4GAJL 2HFFB 4JFEE 5IB4A 4EEEA 1NGYB 5TQ0L 5JOPD 4NP4L 1L4IA 4E5XA 1TDQA 3QSKB 5D7LD 5DJ6B 4Z95H 5ACZB 3FB6B 1FAIL 4W6WB 3QCVL 5DDHB 2XTJC 2IAND 3GMMB 4M5ZH 1ZLUK 3U7YH 3ECBB 1MRCL 2P5WD 4CRPA 5EZJA 2Y5EA 4HGWA 5I1HH 2VMFA 3EOBA 2FHBA 5I0ZA 3WJJC 3HLAB 5DEZA 2VXUL 1J05A 4J7RA 5ETUA 5KS9F 4JN2A 4MWFB 5L2JB 1KPUA 1CGSL 1NUDA 5BO1L 4PRPD 2ADFH 1AIFA 5BO1H 4ZNEA 4WI4A 3KPLB 4HJJL 2IFGA 4PJ5E 2D0FA 5L9DH 4FFYL 2YD4A 3ZDZE 2NY5L 3LKSB 3D69B 3FCTA 1NL0L 4GRMB 5GGRB 1VGKA 5F6IB 2P4AB 3NABL 3OKDA 1E4XL 4MDJB 5CGYD 1LVEA 4HH9A 1OTTD 1VADB 1IL1A 1P84K 3HR5B 1K4CB 5D8JL 5MI0B 3H8NA 3G5XB 1JF6A 3CVIH 2C1PB 2GUOB 2NY3C 2VLRD 3IAGC 43C9B 4V1DE 1PAMA 1R3KB 2DOCA 4BFBD 4RX4A 3BPCA 3A67L 3IS0X 1UB6A 2Z8VC 4NFDA 5JW3L 1NGPH 3V5HA 3AC0A 4XCEB 1DEDA 1VA9A 2M8XA 2IC2A 4MJ6A 3HHRB 1OTUC 2NLJB 4J12A 2BXZA 2OTUB 1G9NL 5K9JL 4MDIA 4MJIE 4NN6C 4E41B 5D5MB 3VFUB 1HWHB 1ED3B 2BSRB 3HNSL 2YZ1A 1AH1A 1S9YB 1H3GA 4YHKH 4YGVA 1TCRA 4LAQH 4YHYC 15C8L 4AENB 2VRAA 2DN7A 3PDOB 1WZLA 2R9HD 2VDOH 1GZPB 4ZMAT 4DVBB 4XPAH 4X8XA 1F8TH 1YYLL 3FT3B 2Y06L 4XBPA 5T3ZL 4S1QL 3WXWH 1MREH 5ID1A 1ZT4A 2QTEA 1BFVL 1HCFX 5EWIL 2DQCH 3DUUB 2PXYB 1YECL 1HNGA 4UIKH 2EH8L 2R1YA 2A74B 4F7MA 3B43A 1S9VA 1X7QB 5I15H 2AK1H 4GRLB 4KTYA 2YKLL 5HHMD 2NY6D 4NQSB 5I15L 1FYHB 2MSPA 3LB6D 3RVTD 3W0WD 1NQBA 5I1EH 1DSFL 3QCUH 1JNJA 1R5WA 1X4YA 4U1NB 3ILQC 5TDNA 4XPTH 1CU4H 3QH3A 4P46A 2W92A 1EEYA 3IKCA 5TJWK 3EOBB 2XZQL 2CDGA 3QWQB 1MFDL 2XWTB 1P9MC 5E1AB 4L8DB 2BNRB 3NCCB 5CJXC 4Y5XA 3SE8L 5F8QC 3ZKMD 3AY4A 3P30L 3RWCB 3VFOB 1MLBB 5DJ2A 1UJ3C 4M8QA 3OZ9H 3O11B 3QG6A 4NRXA 5K9JH 1YEEL 3OJDB 1GZPA 1GHFH 4PG9B 3SKJL 5EG6C 1QSFA 4H0GA 4DGVH 2WUBH 3BQUA 1KTDB 1YEFL 4PJ7E 1LO0H 3FRUA 1BZ7B 1ADQH 1AD0A 1WTGT 3K4ZA 3RIFK 4XH2B 2EDWA 2OLDA 4PYHA 3PWNB 1JRHL 4N8VG 3Q3GA 4YPJA 4XI5D 3RVWD 5FO7B 4ENED 5DUPL 2EKSB 4ZAKA 3OMZA 4HFUL 3SOBL 5C3LD 1R3KA 3SDCD 3TNNA 3TH4T 3C60B 2NXYB 4P9ML 3T0EB 1PDKA 5IQ7L 4ZO9A 1UADC 5D7KE 1RU9H 1QRNA 3MV9D 2JTDA 5T5NF 3SGDH 1JPST 4HIEA 1G84A 3D9AL 3U0TA 4F7TA 1NLDL 3LDBC 1FPTH 2NY0B 5CD3A 1SYSB 3KPSE 3G5ZA 1MCEA 1T89A 4JPKL 3LEYH 4QXGL 2X2YA 3QNXB 3UTQA 2GK0A 4K71C 5L9DL 4GMSL 2J12B 2ZUTA 3V0VB 4KGLA 2WP3O 5IB1B 2VH5H 1RI8A 1TTUA 3MLZL 5I0DA 1Q1JH 4JKWA 4YBLB 4XNYH 1V8HA 2VDLL 3UEZA 5D2NB 2BNQB 5EB9A 1ZHBA 3RIAF 1I1YA 3ZYJA 4BZ1L 4QRQA 2R29L 3QQ9C 4W6YB 2YS4A 1N5YH 2YR3A 3U9PL 2LQRA 3HUJF 3MPCA 1KBGH 4JQIH 2P8MB 2RGSA 1EEZA 3KJ4B 4LEXH 2BVPB 1JFQH 4Z7VE 4E41E 5MEPB 2R56L 4X0KA 1TFHA 2Y72A 2DM4A 2NY5C 4YE4H 5E08L 4HC1L 2IAMC 4JFDD 5CP7A 3FZUC 3HI5H 4X83A 5K33A 1JRHH 1L0QA 2GI7A 4ZAKC 4PJCA 1NGYA 1M7XA 4NQXA 2BY3A 4M1CC 1I3GH 4GG6B 2FECI 5ACZA 2EDOA 1S9WB 2X9XA 2YEZB 3LRGA 1NC2D 1KPVB 4IMKC 3ARFC 3GJFK 1S8DA 1U93B 1YN6A 2WV3A 2QLVB 1NFIB 4NRZB 4F9LA 2W65A 4OD2B 1KCRH 4GRWE 4LLQA 3HG1A 4LIQL 1U3YA 4Z76A 5ETUB 3GB7B 4CJ0A 3S97C 1DL7L 4OAWA 3D0LB 1RJLB 1OGAA 2E5EA 2W0PA 2A0LC 1N64H 3CH8A 3BISA 2R0ZL 1RJZB 4MX7A 4QGTA 2EIZA 3P4OA 3RX8A 3V8CA 4CBPA 3K3QA 1F42A 5DD3L 5ICYB 1R6VA 4FFZH 4QHKI 3H6JA 1S7QB 2UY7A 3MV8B 3OKEA 5JIPA 2VITB 2BVPA 5CZKA 1MRFH 5F7LB 5JXED 2I25N 1E28A 3C60A 2DQGL 5GPRA 3VRLE 2QQKL 2A6DA 3TCLA 5L8LB 4OCYL 5HHXH 2XY1A 4YDKH 1HSAB 3TNNB 4EDXB 4Q6YA 5FB8B 1SEBB 4QHKJ 1I3VA 4HK3N 4POZD 3QNZB 1OHQA 4EOWH 4ZTOL 4JPIA 2X4PA 4Y4KA 5LWYH 3MFFB 3MGOA 4YHML 2GTZA 4K3EH 2CKBA 4M93B 3GJFH 4QRRB 1U8MB 5AUMA 1CD1B 1FZKA 3HFMH 2CDEB 3VXMB 3J7HA 4HPYL 1F11B 1M71B 4U1IB 3MLTA 5IHZB 5BXFA 3AVEA 4MJIA 1ZAGA 4MD5A 2NW3B 1BQLH 2EE6A 5TDPB 3OKNA 3KNBB 2YUVA 3MXWH 5HJ3B 3FQNB 1MAML 3GBNH 5J13C 1A6VL 3LN9A 2X1XR 1PGRB 3HNTH 2XRAL 3K8LA 3HE7D 5AWNH 3DO3A 4C55A 1MVUA 3EKCA 3OKMB 4NO3A 4ONFL 4Q9RH 4ONFH 4C4KT 2WLYA 3SE8H 2CDGB 4WI6A 4N0CD 1RUPL 2CO6B 4PP1C 4P4KC 3DHJA 4NHUB 4QOKA 5HHNA 5C9KA 3IU3A 25C8H 4M7ZC 4U3HA 1HXMA 4BZ2L 3DRTB 4M6MH 4QWWC 4NQXB 3DMMB 3G08A 4Q7DA 3MFGB 3MXVH 4PJEF 3VJ6A 2MJWA 2WM0A 1MLCA 5EO9B 1KCSL 5SV3A 3S36X 2Z8RA 5J1AB 3NN8B 12E8L 1PD6A 2MKLC 2NCMA 2OBGA 4JANB 4JFEA 4CVZB 4YHLL 3VU2A 4PD4K 1FFRA 3FTGA 5JHDB 1IEHA 2YKLH 3D39D 1F6LL 4U6HB 5ILTH 1IQWH 2MPAL 5F7FA 1CGXA 1J0HA 2VABB 3OB8A 4GBXB 4L4VD 5C08E 2XQBL 4GG6F 2PTTB 32C2A 1XZ0B 3HE6B 4GUPB 5A2JH 5CAYB 1L7IL 4JQXC 2FX8H 1CFSB 3ZE1F 4RWYH 5DUBB 4XVUD 5H8DA 3MLRH 3RNKB 1MRDL 1EGJH 4CL7A 4R8WH 3SKMA 1KULA 4FABH 2OTUA 5F9DC 1OQOA 43C9A 3D25B 3DETC 1BM3H 2V7NA 5CP3A 5JHLH 4U1SB 3C5ZA 3QFJA 3OKEB 4OFDA 3QNXA 4XCEA 1JF1B 4Z7WF 5HDOA 2WNGA 5K9KB 3CAFA 2FO4A 1JRHI 4CMMA 2YA0A 4GAYB 1T5WB 3HZYB 3IS1X 4MD0B 4N0YL 4QNPE 5M95B 1A6PA 3TCLB 3R0NA 3RUGB 4FQCL 5HHOE 2BFVL 4UDTA 3ZKMC 2WWMD 2XNAB 3W11D 3NVQA 5FGBC 5DD1L 4M6NL 2YBRB 1MHEB 3PV6B 1LDPL 4J3XA 5IROA 1KLFA 1CXFA 2OR8A 5CEXA 5AYUL 3ZSTA 4HJGB 2A9NH 2VDKH 1IC1A 1WBXA 2R4RH 5SWZB 5ICZB 4G9DB 2HTKC 1Q9WA 2RQ8A 3LCYA 3MLWH 1C5DB 5CLTA 1LE9A 3G5VA 2AXHA 4YBQD 4QXUH 1T03H 5BV7C 4HUXA 1MHCA 4UQ2A 2ADJA 3MSPA 5DS8B 1LWRA 4WJ5B 4QXTB 4U0QB 2CK2A 1R3LA 4KDVA 4KZDL 2XQBH 2BNQE 2AI0H 4WCYH 1T83A 2YEZA 4LLWB 5TQ0H 3FQRB 1P1ZA 4JPKH 4XC1H 3HAEG 2DICA 4PJGB 5CILL 5JXAL 3QI9A 4G8GA 1A22B 3FCTB 5KN5B 5LWYL 1Q8MA 4JM2A 4P23B 4Y16A 3SE9L 4XWOD 4RBPH 4G43B 1MFEL 3BGFC 2Z93A 1RIHL 3BEWB 3QDMD 4KI5E 5E6ZA 3B2UD 3D1MC 5E9DD 2JJWA 4NM8L 3VGAB 1RPQA 2X4NB 3T1FA 1QR1B 1NCBH 1HINH 1YPZA 1NCBL 4RGOL 5D5MF 3GMOA 3MYZA 4L3EE 3NZ8B 3UTSE 3OB0H 5EN2B 3VGEA 5KS9E 3CFEA 4Y1AE 2NY3B 3TT3H 3RVTC 5D1ZC 3O9WD 2GCYA 4WUUD 5DC9B 1EV2E 4PJ8C 4LLMB 4X7SL 2Y07H 1R24A 1OVZA 4QTHB 4KXZH 1MJJB 2R4RL 1TVHB 3BESR 3T08A 4Z78B 5E99H 4ZAKD 4XHQA 4JZJC 4R90H 3DI3B 5F9WB 4PLJC 1I3RA 1BD2A 5F9JB 1RZFL 3C8DA 4HUVB 1QLRB 4CMMB 1DBKL 1RURH 4WTXA 1FL6B 3TVMD 1P53A 3CLEH 4P9HL 4EIZC 1U95B 3ARFD 3HLAA 3QFJB 2ILLA 4TUOA 4JFQB 3BPNB 1D5BB 3BQUD 4FXKA 5JUEL 4N0UB 1B0RB 2JIXA 4Y4HC 2VDNH 3RWJA 5E8EA 4JGUA 1T1YA 4XP5L 4JO1L 4RAUA 12E8H 1P4BH 3O0RL 4NZTL 2EC9U 3ARWA 4YBLC 3QXWA 4G7YH 1QA9B 5FKPB 3VXRB 4OD1L 4ZUWA 2ZCLH 5I1LA 4IEFB 3GDBA 3G6JE 1Q0XL 4X80L 5D71H 4OB5H 5GS3A 3CSPA 3H3KA 4XP4L 5T1LB 5JQHC 2J6EH 3C5ZC 1J0IA 5EFIB 4R4BA 1BFSA 1ZWIB 4AIZA 5I8CB 3T8XB 4YJZL 1DDHB 1RZJH 3NGBC 1QOKA 5CBAB 5J1TC 4PS4H 4PRDB 5E6IC 4WENB 4Y19B 4FHBD 3C09B 2VLLA 4YDIH 3LMJL 3PHOA 2BOBA 1KGCD 3QUML 4ZQKB 3LSOB 5T3ZD 6CGTA 3OPZL 4DUVA 3TH3T 1KG0A 3E2HC 4GG8B 3MUZ1 1GGIL 1MQ8A 1RHHA 4WUKL 4LCIL 5FV2A 3VG9B 3VFWA 5FM5M 5IM7A 2AEQH 4DGYL 4EBQH 4TUJA 3N1QC 4EUPA 2EDFA 5F96L 3HA0A 3KPQA 3HS0A 5T3XD 3GJFB 5BS0E 1C08B 3AGVA 2W38A 4WO4B 2KBGA 4JZNB 4P59L 1MSPA 1HOCA 5D9SA 4XBEL 2APVA 4P59H 3WO3B 4M3JA 2FWOA 5GJSL 1WWAX 1XEDA 4JN1L 1YEHH 1I4FB 2PXYA 4LQFH 4IS6B 5J4MA 5ADPH 1BJMA 2YPLD 4HS8H 2E7CA 4MXQC 3L3OA 3ARPA 4HUUA 3SDCA 4PJGE 2YD3A 1W0VA 5JR1L 1EO8H 2IFFH 4RX4D 1CF8L 3DRQB 4P2CG 4ZFGH 5IB5A 2WIIB 3EDDA 3MV11 4FQXD 3MA9L 3V6ZA 1C5CL 3V5DB 4PTTB 2F19H 3BHBA 3LQAL 4KJYB 3VD3A 2F19L 4O02L 3LQAH 4UV4H 4OUOA 3X3GL 5FUZH 3LRSA 1FLRH 2VH5L 3KPOA 2WZPD 2AABH 1CDCA 3QUYD 4U2ZA 2OQJA 4G6FB 2JJSA 4I2XB 4HUMB 1JWMB 1MWAA 2HTLD 2NTSP 2I5YH 4TVPL 1HINL 4I1NB 1N7MH 2NTFA 1T2JA 5EU6E 2ARJQ 5K9OB 1R3IH 4DFIA 4B7IA 1CD8A 1H8NA 4F58H 5B3NA 3VXTB 2BX5A 3P2TA 2NZIA 1JTOA 3TNMA 5KSVB 5F3HA 4XRCB 5HYEA 4G8FA 2DS4A 4YXKH 5CUSH 5HGHB 1MFBH 1B6DA 3DX7A 3L3KA 4I0CC 4X6EB 5DJ0A 1KIRA 4XVUC 1N3NA 3L7EA 2F54E 4D0BA 3L3IA 4WU7A 4YC2B 4HZLB 4H5SA 1NAKH 4JQVA 5HDBE 3L5HA 1BF2A 4BH7B 3MRNA 4JRYD 2KQNA 4GRWF 4R4FL 2J5LC 3B6SB 3VRIA 4EZMA 1QHOA 3TF7C 4QRPB 1G6RA 1IGYB 5F21B 5DD0L 2JCCF 4Y8AA 5MEND 5EUOA 3KLHC 4IRJD 5CJ5A 2J4WL 3LRSB 5IQ9B 4Q6IB 4N9GB 2VKWA 5FA4A 2H32B 4H20H 4U6XA 3WE6B 4EN3D 2ID5A 2C5DC 3QUMA 5BRZB 1FJ1B 4YZFF 1PZ5A 3FB5A 3ILPA 3FFCD 2C3GA 4I3RL 3AB0C 5F44A 5C08D 4PJAF 5D7KD 2DI7A 5ENWB 1XF5A 1CG9B 1MCWW 3ES6B 2A9NL 2VDKL 4CAGA 4RRPG 4PP2B 4J1UA 4WFED 4WEUD 4R96A 4P0DA 1MFNA 5GJTL 2F8XC 2B0SL 1OB1B 4LVOC 1A6TB 1C1EL 4WGWB 1IQDA 4GBXA 1C1EH 1G7HA 5IKCB 3HZVA 4RMTA 3SDXB 1CFNA 3T77A 4XCNB 2FGZA 3ZZ1A 1G9MH 3S88L 2R0LH 1N59B 2O5ZH 3LMJH 2DYPB 1GGUA 1BVKB 5I1KH 2AJ3B 3BO8B 4HGMA 4YDLC 1OCWL 1P6FA 1PG7H 1QSZA 2VISB 4X6CF 3T4YB 4AMKH 4YHZL 4XZUB 3O45A 5A40E 1YEDA 2PUQT 3PQYD 2FO4B 4NUGL 3U0TB 5ADOL 3RKDD 4FQHB 1AP2B 1B2WL 2YRPA 4JR9L 4PG2A 2VB5A 5HYJA 4XPAL 2GITA 4NN5B 4M9OA 5SWZE 2NNAB 5DRNB 2IQAB 2VXUH 2ZCKL 5IFAL 1MCPH 1TQBB 3IDNB 1NGZA 4Q6IC 1UG9A 2HLFC 1JI2A 1YMHA 4J4PD 4JM2D 3MCLH 3S5LG 3LD8C 3MROB 4PV9B 1HIMH 1HZHL 2VZTA 5EUOF 3HRZA 4HK0A 2X1OA 3QFJE 2H3NB 1E4WL 1NSNH 2AQ2A 4ZXBA 3FOLB 2EIDA 1FDLL 4MX7B 1FZOB 1U3HB 3T3MF 5ICXB 1FVEB 3TPUA 4ELMF 2I9LB 1I1AB 5FKAB 1KACB 5I6XB 5IEHA 5DT1L 1EHAA 1NEZG 2YPVH 5IP4A 4OFYD 4RMUA 1LNUB 1BEYL 2ZCHL 3MRIA 4A6YA 2O5YH 2CJUH 4JZOA 3CSYA 3VFWB 1LGVA 1VEMA 1PLGH 1BQSA 4LIQE 2V2XA 4Y4FB 2CLRA 5F6HI 5IJKC 1U8OA 4F2MA 1N2RB 3UTTA 4PB0H 5EOQL 4EDXA 2V2TA 2H32A 2GSIB 1VESA 3NACL 4HT1L 5B39G 2K3TA 1G9NH 3L6FB 3STZB 2YUZA 3QDGA 3QUXB 4Y1AB 1N7ML 1TQCB 1XR9B 3E1F1 5F7YC 3BGMA 5C0NC 5F88A 1AO7A 3TVMA 2FX7L 4KROB 3RY6A 4JR9H 1Y0LB 3X11B 1P9MA 5KVGH 4OB5L 4WW1A 3LQAC 1LMKA 4QHNA 3OF6D 2HJFA 1D5XB 1A4JA 1WGOA 3KDMB 1YQ2A 1KCSH 2IMMA 1IQDB 3E6HB 4OZFG 2P47B 3TLRA 2M26A 4XXDB 2VERN 5IFJA 4JJ5B 2PN5A 2ZUUA 3F7YA 3LZFL 3RY4A 3L5JA 1D6VL 4MS8D 4K94L 2H45A 4RFOH 2GUOA 1H0DA 1OWWA 1AGCB 4OKVB 3KXFA 3I6GB 4N0YH 1A9BB 3IFNL 1ED3A 2NQCA 3LQMA 3OAZH 3GSWB 5GGSA 1HI6A 4KMLB 5TE4H 4H20L 3O41A 3MLSH 5KSAD 2I07A 2DD8H 2WBJC 4YK4C 3U7WH 4FZ8H 3RGVD 3U83A 4MVBC 1NMCC 4XP1L 4ORZC 4CN4A 4PGEA 2P5EA 3B83A 1VFOA 4EXPX 3BKJL 4GXUM 2IH3B 1FGVH 2SEBA 4OM1L 2G60H 4QYOB 3ZHKA 5DS8A 1SMOA 1BX2B 4WW2C 3G5YA 1QNZH 4JE4B 5IMLB 4RISL 4JRXE 2CIIB 2H32H 3VGAC 4JN2B 3SDAD 4G6JH 4FXGA 4JY6A 4HK3J 3NFSH 5FV1L 1QO3B 3VXPA 3O9WC 1MCJA 2AXFB 5I75C 1ZT1B 3WFDH 4I3GA 4EUPH 1FNHA 3BAEH 2XN9E 4C83B 5I1IH 1FFOA 5C09B 1C5CH 3LKPA 1OSZA 1QFWH 3VFVB 1UYWH 5GRZA 5C07E 5ECJE 5F7WC 2X9YA 3EJYC 3ZE2F 3MR9B 4U1KA 1OTTC 3NCJL 4O2CA 3IVKA 1FNAA 3NCJH 3ZMRA 4OZFA 2MCPH 3U6RB 1K5NB 2ZOKB 4M43L 4PJ5D 1D6VH 3HZKB 1S7RA 3CUPA 1MAJA 2O61A 1CDHA 4U1LB 1YEGL 1OAYL 5EDXA 1C08A 1RHHB 3OJDA 4Y2DB 4F7PA 4YPGB 2R8SH 4TUKH 5ELIA 1M6OB 2CRMA 3RWCA 3VFOA 2CLVB 2P44B 2DD8L 4M3KB 3BWUC 3LHPH 3TT3L 1CGYA 4YXHH 4NP4H 3KPPB 4XTRC 5FEBA 4NPYB 1QP1A 5F9AC 1XIWD 5F9WC 5JOEA 3Q3GB 1DFBL 3L3JA 5CCKL 3QCVH 4V1DD 1DFBH 3F5WB 4YHZH 4QHUA 3EJJX 5CKGA 1B4RA 3UTZB 4FRWA 2YA1A 3V8OA 1WFUA 2VISA 4M6AA 1S5IH 4R9HA 3MRBA 5K59F 4XBPB 1SJHB 3E3QE 2UZIH 2W0LA 4MA8L 5CIPH 1EXUB 5FHBL 1KJ2B 3GI8L 1RJYA 1B0GB 1BHGA 4JM4H 3GSVA 4UU9A 5DTFA 5B38G 3PWVB 4LHUD 4OZHA 1X5XA 4XPHH 1CR9L 3QI9B 4G8GB 1ZA3B 3VXUB 4MAYB 3DX9B 3FQUA 1FYTE 2CKBH 4EN3C 5C6WH 4MAUH 4AEIH 5F71A 1HI6B 3PWPB 1UQSB 5TDOA 4AIXA 2W0FB 1HN1A 3CX5K 1M7DB 5FOBA 1B3JA 1D5MB 2AK4B 5JW5B 1LO5B 3P0YH 3BSZH 3OV6A 5T1MB 5L88H 3N0PB 2HFGH 4PJ9A 1KB5H 1A1MB 5DGRA 4BQ6A 3GMLA 5SWZA 4N90D 3CD4A 1IGJA 4JO4L 1SM3L 4GSDH 3DMMC 2ZG1A 4KKBC 1NLBL 3CSYB 4PGDB 5JXEA 5D71L 3MODL 1IAIL 1XAUA 4K2UH 4AY0A 1MCDA 4QXTA 1KJ2A 1J5OH 4OLWH 4Q97A 3RVWC 3WNKA 1JZ2A 3DO7A 3X12B 5CSGA 1JN6B 2DDQH 3KHOA 2B39A 3FFDA 4IHOB 3B9KA 4WV1A 5DVLA 3KR3H 1KIQB 1QQDA 4RMWA 1J1XH 4ZSOA 1X6LA 3O8XD 4DTGL 4DVRL 3TA3B 1NKOA 4CU7A 4MZ2A 5EC2B 5IFHH 3EYQC 3LKNA 4PFEA 2BHYA 3BWAB 1F4HA 4K3HA 3SDXE 1E28B 3GGWA 3TBTB 4RFEB 1I9JH 4OZHF 4GUPA 1M6OA 4FG6C 3UO1L 4G5ZH 3BW9A 1XGQB 3TJEL 4X6FB 1DJSA 5JW4R 3DUUA 5MI0C 3WD5H 1AHWC 4K7FA 3QWOA 3WKNA 4JFDA 1PSKL 5CINH 5L0QC 2FD6H 5D6DA 3MRCA 3OXRB 4M4PA 1S9XA 4M7KH 3TN0D 3WS3A 5JHDD 1SVZA 2CUMA 2JK5B 4P5TD 3RVUD 1CS6A 2AJVH 1MFDH 3ETBF 3N85L 4ZOAA 3RWIB 1I7ZB 1PLGL 4P23C 4HMEA 1IM9B 3WNLA 3EO1A 3WLBB 3HTLX 3L9RA 3MLVL 4OQTA 1XGRA 3U9UA 3U4AA 5CD5C 2BOCB 4RAVA 3MLVH 5DEGB 4PB0L 5EOQH 2DQTL 3A6CL 3K80A 1UXWA 1PKQB 5DLMH 3V4VL 4YR6B 4RZCB 1FC1A 4X6BA 3KXFB 3UJIL 4OLWL 1MNUL 1UWGL 3G5YB 2BCKB 3GKZA 4O02H 1E4KC 5D7IF 2AJSL 5EIVA 1LK3L 3FJTA 5EULV 3HS0B 3MRPB 2D2OA 3QIUD 1HHJB 3KPRA 2HYMA 5D2NC 2NW2A 3CXDH 3MV7E 2OXGA 5C7XH 2CGRH 1QG3A 1IAKA 3NCBB 2FR4B 3WKMH 3PHQB 4TVPH 2G2RB 1AC6A 4WFHE 3NIDE 4OGYL 4APQC 1CGTA 4QRPA 3H9SB 2ESVA 1F6AA 1X5ZA 3HG1B 3QULB 3D9AH 3QO1A 5GRYA 3S4SG 1QEWB 3S98A 4E0RB 1AKJA 2Y7QB 1QO3A 3VXPB 1TNMA 4Y4FA 1JF5A 3FO1A 3MZTA 4ZPTA 4QRUB 8FABA 1DUZA 1AQKL 4R26L 3IRPX 2K1MA 3ZT5A 3DGCR 5EBLA 1IGTA 3LKPB 1S7WA 5C0JA 4NO0B 1BAFH 4LP4A 4YFDB 2EYSB 3CDFA 4XVJH 1VACA 2AEPH 3HMWH 3MRFB 4ZUVA 4NIKB 4NKIL 3KLSA 3DRTA 2PO6A 2L7JA 5A2KH 3HUJA 3GHEH 5FHAL 1EHNA 4ZUWB 1ZANL 2Z91A 1WICA 2P5EE 2YPLE 3FT2B 3SE4A 3UP1A 4KJPC 4DQOH 2PW2B 3RHWF 2AW2A 3MV9A 1A7QL 1Y6MR 3EYSL 3OKKB 5IIEA 2FBOJ 3OKOB 1H8SA 3V0WH 3OHXB 3SDAC 3UZEA 1D9KA 1LE9B 1G7JB 3GFUA 4GSDL 2LABA 4RMVA 3HI1A 2YD5A 1DCLA 1A64A 2I07B 4EDWL 4NNXA 1A5FH 3JVGA 2BY2A 5ITFB 4EI5D 4JCMA 3K46A 1FNEB 1MRFL 4K7FB 1W0VB 5C07A 2P7TA 2N56A 5DUBA 4DZ8A 1MPAH 2PR4H 1HNFA 4YHPB 4L3EB 4X4ZA 3T0VA 3L9RB 4W81A 2FSEA 5I1HL 2CDEA 4NN7C 4P3DA 5FUOL 2NXZB 1G9ML 4R2GB 2GEEA 2A77L 4GAGH 4LOUD 2X1PA 3QEQE 3HZYA 5HGBA 4ZUVB 5LAXB 4ZXBB 2WBKA 5C0ND 3UYRH 1JGVH 5AAMA 4EI6B 1V3JA 4KJQD 3ARFB 5ISZB 4PRIA 4U49A 1RFDL 1U2HA 1IJ9A 1JNLH 4ZO7A 2O26U 1U92B 3SDDC 2NY6B 4HIJB 4NT6B 3WDIA 4DCQA 1WWCA 5IBTH 5A2LH 4A6YB 2BSSB 1LO2L 1KXTB 4NQSA 1SBSH 5KAQG 1C12A 1MRDH 1SY6A 5FGCE 4N0FB 1FFPB 4WIQA 5LBSL 1OQXA 3QHZH 4PS4L 2FL5A 4ZPVA 5DRZB 3UTOA 4HBQA 3V95A 3VW3H 4HKXA 3WSQL 3VXRE 5ESAB 5HYQB 4Z8FL 4CU6A 5T33L 5I8KL 1DBMH 5T1KD 1VEOA 2YUXA 1OAXL 1PKQE 4P2RB 5I8KH 2ADJB 1BQHA 2IANB 3QDJE 2DYPA 4X7SH 3VRJB 4AL8H 3NA9H 4S1DD 1JYNA 1ORQA 3QAZC 3DV4A 3RVXD 4U2YA 4JAMA 2WBJD 3MYJA 1VFAB 4W6XB 4PLNC 4NQEB 3BMVA 2EDJA 1IKNA 3CPLB 4YGVB 5DVOA 3G6JB 4XMKL 4IBLT 3F7QA 4JVPA 3BE1H 2ZSVA 3LKOB 3QIWA 2ATKA 2OJEA 3PJSA 3MV7B 2AXGA 2VZ1A 4NRYB 4TTDD 5EPMA 5INDB 2VXSH 2GITB 5FYJE 5DQDH 5J11B 5IF0A 4PJ7B 4DFHA 5GJSH 5L8JB 1GGTA 3QJHA 5EZIL 1DQJA 4L1HA 2HMIC 4H26B 1KJMA 1JNHB 1YMHB 3LEXA 2C1PA 4YAQA 1U91A 3UYRL 3BYTA 3MACL 3W11C 2LVCA 1SM3H 3VFPA 1J8HD 3V4UL 5LVEA 5FB8A 4NWUH 2AEWA 2XTJB 3RFZC 1XCQA 1IL1B 4CVWA 1T6WA 2QJDA 3OJ2C 2VLRA 4O58L 5F9JA 3LY6A 1V7MH 4KK9C 1T66D 3RWHB 2HRLA 3SGJA 2VUYA 2EXYD 2FLRT 3NCEB 4K94C 3WIFB 3RZCC 2EECA 2X44D 3CFIC 5DTFB 2OTWA 2H2PD 3MLTB 4PJEA 5IHZA 3LS4L 5AG8A 4DN4L 5DYOB 2AJ3A 2DWDB 3BO8A 5DJ2B 5IVZA 3QWRA 5GGTH 4AEEA 2OM5A 5GRVK 1D5BA 1NCNA 4C56D 1UVQA 4O2EB 4R2GC 4OV5A 1HSBB 3RBSA 4L8SB 4DTGH 4DVRH 4BSVA 5I73C 1I7TB 4FMFA 4V1DA 2OI9C 2QADC 4L9DA 3BDYL 5ENWA 3BEVB 1MQKH 3QRGH 4Z76B 2Q7YB 2NYYC 2DIBA 3OXSA 3VGBA 1IAKB 1XH3B 2BVEA 2XIDA 1KSRA 3JWOC 1HCVA 3GMMA 1YNLL 4J23A 3EFDL 4PJHB 4WEMB 2VTFA 5ANMA 3PUCA 4CMHB 3P4MA 2JJUA 1FN4B 4YXKL 1WIPA 5HHQB 4XWOC 5MEQB 5DEFB 3ALPA 2WP3T 1X7QA 5SX4H 3MLRL 5FCUH 4H1LG 5F1OB 1OGAE 3JXAA 3TYGL 5EZIH 1KYOK 2AJVL 3N85H 3PGCA 1IGMH 3GSUB 5D7SH 1YUHA 3MRNB 2YMXH 1RUMH 1TZHB 5KTEL 2IBZX 3SCMA 1YPZB 4PGCB 3V5DA 4GAFB 4G8IA 1NC2B 3REVA 3V0VA 1F45A 3P77A 1OAYH 1MHHA 4UOW1 5F6IC 3CC5B 1NBYB 4NQUA 2LAGB 4XHJC 4PJ8D 4ZTPL 1DBBH 3QDHA 2EDBA 3IFPA 4O4YH 4RQQB 4LU5L 1W72B 2X9WA 5TQ2H 2IEPA 4N1HB 1C8PA 4FQLH 1QFWM 2PETA 1D9KC 2ZUSA 5H37G 3LKQA 1HDMA 4Q9CA 1KB5B 1SJEA 1M71A 5D9SB 3BPCB 4X98B 4L8CA 4X80H 1Q0YH 4O51A 1WSST 5SX4I 4JY5L 4W4NA 1PX3A 1OAQL 3U30B 1RHFA 4MYWB 3GBLA 4YUEL 1M4KA 2YK1L 3DURA 5DMGD 1OAQH 3R1GL 1LEIB 1A1OB 1X5JA 2GSGB 1PQZA 2ICEB 4H26A 3QXAB 2EIBA 4QRPE 1B0RA 2JIXB 3STLA 4ODXA 4LEXL 4HUVA 4HHAA 4TULH 2EDNA 4DZBA 3ZSSA 4KAQL 1GL4B 3DWTA 1V3KA 2Q8BL 4K55A 1BJ1J 4MA1C 3SDCB 2D31A 1JPTH 4UB0H 2DWDA 3ARBD 1IM9A 2XYCA 5FOBB 4N90E 2A6KB 5CJQL 5I66B 2BNUA 1ZLVK 3WIIL 4P5TA 4G3YL 1YYMH 3KYAA 4KUZL 3IXAA 3D0VA 3H0TB 5FA4B 3C2AL 3UTQB 4DWHA 1U8PA 5DI8A 5GGSY 3UBXB 3HZKA 1AGDB 3PP4H 4LRIC 3GMLB 3VGFA 4X7FC 5C1MB 5D1XB 1RZIB 2JB6B 4RWHA 1A7BA 2X7LA 5DDHA 3EYSH 4X4MA 1U6AL 3GO1H 2PYED 4MA3B 2NY4C 1U3ZA 3MACH 2A83B 5EBMB 5HHQA 1U8IA 2V5RA 4MNGA 3KYNA 4GQ9L 3QIWD 1YMMA 4JM2B 1YEIH 1ITBB 3O4LE 3LN5A 2EXWD 4JKKA 4P2QA 1BJ8A 4LPXA 1RAMA 2DQEH 5GZND 1KG0B 4GG8A 3AY4C 1LP9B 1DBKH 4P57B 4ERSH 1TITA 4A6YH 1QSFB 1JK8B 3FO9A 5DJXA 5IK3B 3CMOH 4PLKD 3LKSA 3S4SA 1MREL 5J12C 4N1EA 3Q1SL 5CBEA 2NZ9D 2PYFB 5ESAA 5C0DA 1X5FA 5I1AB 3G08B 1J1PL 5J6GB 3MV01 1BBDL 4MXWH 3C2SA 1ZLVH 2WIMA 3DXAD 5TDPA 1BBDH 5B4MC 2LTQC 4MDIB 5I1DB 1UCBL 4OTXL 4H8WL 2E9WA 5DJDB 5CJQH 3IFPB 4RSVA 2ZG3A 3U4EB 5HY9B 1UB6B 4PV9A 3GIZH 4U0RB 1G7JA 4LNVA 1H3UA 3JTTB 1HXYA 3QUYC 3LV3A 1WBZA 4NQEE 5ICZA 4YEFA 3GHBL 3EOTH 3WFBL 5F9OH 4XCYB 3EGSB 4XNXL 5EUKB 3VGDA 4M7LT 3CLFL 5BW7C 1FV1A 3JWDH 3ZTJG 2GHWB 2OTPA 4ODWA 1EMTL 2JCCE 5D7JB 3SKNA 2JKXA 1FDLH 3RZWA 1KJ3L 5GS1A 1S7XB 3WD5L 5JTWA 2Z92B 2EEAA 3O2VL 2YPVL 4WI9A 5D1ZB 3TBYB 1HYSD 4IOFC 1R3HA 3QYCA 4IOIA 1EAPB 1SJXA 1LP9F 3JV6A 1A3LH 1K8IA 2CUIA 4TQEH 4JPIB 4DUWA 4UINL 4WEBL 5BCAA 1A3LL 1FLRL 4LCUA 4JDVA 4ELMB 3QJFA 4BFIB 5EO1A 3LIZH 3VXSD 1OT2A 4NQVB 1XIWA 2P48B 1R5VB 1UA6L 3QCTH 1JGDA 4JANA 4JFEB 2YK1H 4XNUH 3LQZA 5C9JB 5JOFA 1D5IH 3RWGA 1IC4L 2OZ4A 5IVXE 1NCCH 5INCB 4PJBA 1I3UA 4OI8A 4Y5YC 5J12B 4NBYB 4X99A 5KVEH 1EGJA 1MHCB 5EORL 4EQ2A 1OAUL 3FOLA 2DLFL 3RNQB 2K7QA 1FZOA 2NX5B 5F1NA 5E2VH 2V2TB 4PJIE 5GGRA 3P40A 5BOPA 2LE9A 3QUXC 2FYYA 4RGNB 2GY5A 3S36H 5J9PB 3KVQA 3IFOA 3C5ZB 4IM8A 2AABL 4ZOEA 4XI5C 5EA0L 3V6OE 1FZMA 1OOAA 1VENA 2FX9H 3D2UD 4JFQA 5GS0C 1T2XA 2XPGB 2YN3A 2PNDA 1R3IL 5C09E 2Z4QA 2APFA 3NIFE 2ZSVB 1KC5L 3PG2A 4KWUA 2EEDA 3LHPL 3RWHA 2PYEA 5C0BB 3GMPA 4WGVB 3UTSB 2AJYH 5GSRB 1DQLL 1JYXA 1X5IA 3AM8C 3VGHA 5AYUH 4XCNA 1OD7A 1GIGH 1K9TA 4XXCA 3QUKB 4XXDA 5IVNA 4U1HB 4PRBB 5B21A 3SJVD 4ELKB 2JCCA 4RA0C 4JB9L 4R6UA 3KDMA 2HLFD 3CFDB 2DLEA 4P5KA 1F3RB 2LU3A 4KK6C 3O41B 1T5WA 4NHUA 4JFYB 2BK8A 4JHAH 3PGDA 1QUNA 4ZYKA 5EUKA 4Z7QF 1F3JA 1FIEA 1PQZB 1OPGL 2ICEA 1NMAL 4P2QE 5GSVB 4PJAA 4HKBA 5KVEL 2CUHA 3EO1B 2H8PA 4Y5VC 3ARYA 3IDNA 1L7TL 3K2UH 5HD8D 3RWDB 1P5UA 4OD1H 4R7DA 4YK4B 4I48B 2QQLL 5TFSL 3PL6A 3QDAA 3V0AC 5LCVH 3C6LC 5FDWA 4PBVC 2FX7H 4JFPB 3MRLB 5IHBA 1LD9B 2HG5B 1X5LA 4OLXL 2W9DL 2UVEA 4HIHB 4S1QH 1A9EA 1U2CA 4I8DA 1P69B 3SE3A 4HUWA 2G5RA 1YJDL 3WFHA 3W5MA 4HPOH 4ODTH 4YHNB 4OT1H 3S35X 2Q6WA 4DEPC 2VZ3A 2PO6C 4P2RA 3REVB 1J9CT 4XC3H 5IG7A 4KHXL 2R0LL 4JFXA 5CKAA 4KK9D 1YDPB 4PRHA 1KEML 3NIDF 2H2SC 1DDHA 2KUTA 5CLWA 3C87A 2GTWB 4RA3A 2Y1VA 2E8ZA 3PGCB 4Y16D 3IFNH 1GZQB 5GZOD 3Q6FA 2XN9D 1X5YA 4ZQKA 4UZGA 1JV5A 3QDJA 5K9QG 1S5IL 5D2LB 2MCG1 2HT2D 4OD3H 4X5WB 5FO9A 1QFHA 2G9HA 1BJ1H 1FNSL 1GAFH 3FO2B 4PJFE 1YEHL 2EYSA 5C0AE 3OKYA 4LQ1A 3EDEA 1JGUH 5LGHH 1OTSD 3LEVH 3NACH 4OZGA 4H88L 2UUDH 3HB3C 2Z31A 3B9DA 1GHFL 3DV6A 3VD5A 1YNKH 1ERNA 1JBJA 4DVBA 1X6NA 3NH7L 4POZC 1JI1A 4LMQI 4NBZB 4QRTB 1NUNB 5IIEB 1UACL 1NKRA 2GQHA 2ADIB 3QDMA 5C0AD 1F4XL 4J8RB 1MVFA 3IJYB 5DJ8B 3RWIA 3GMQA 1FL5B 4LCYA 1O7VA 5FUZL 3RI5F 4B0MM 4ODXB 1JTPA 2VLJE 1LO4L 4WUUB 1GOFA 2HWZH 3HC4L 2AV7A 1B88A 4D3CH 3MBED 1U3JA 2VWEC 2VQ1B 1WFOA 5GS2D 5JPMA 1Q72H 5HGAA 5HGDB 4MSWA 1D6EB 3ZL4H 2P8MA 5LJYH 2D7TL 2H9GA 4YDVA 2VC2H 3OKDB 1XGTB 5HYJE 5EU3A 4F58L 4H0HB 3DVGA 1L7IH 5E2WH 5BV7B 3SQOH 4P4KD 2OYPA 1K4DA 4G7VL 3RAJH 3I50H 4Z7NE 1TTGA 1FNGB 1JPFA 5EOTA 4PJEE 3N1PC 5EU5A 3BPOB 1MWAH 4PRDA 3QXVA 2OK0L 1WWWX 1M1SA 3QAZB 2F53B 3ARGB 4K8RC 4OZGE 1T04A 3OGCB 2HLAA 3IKCB 1W8OA 5DRZA 1NMBH 2Y6SC 3LS5H 4KTDH 3PNWB 5MENB 3MJ8B 4ORGB 5INCA 5B8CC 1AGBB 4H25B 2D7PA 4N1CA 4KKCD 5L2KD 4ZDHB 3LSOA 3DUSA 1HYSC 3C6SA 1A7PH 3GJFA 3D18B 4LL9A 3RWJB 3HPJA 4GKOA 3SQBA 2CR3A 2VLME 1QQDB 4OUUA 2EO9A 3SDDB 1CXIA 5FM5O 1NAML 2DKSA 4EI6A 2NX5E 4I13B 1WZ1L 3BD4A 1TLKA 3FRUB 4BSVB 5KSVA 3X17A 3SGKA 3MLYL 5JOPE 4OT1L 4G9FA 3IJSB 1RK1B 3NPSC 3R1GH 5KANG 2JCCB 2OZ4L 4P3CH 4HUUB 3F8UB 3IU4L 4ODSH 4PB9H 1OSPH 1HK6A 3T0ED 1OAKL 4M1DL 2P5WE 3DPBA 4D9LH 2C9AA 2ZKHH 2F15A 2R4SH 4LF3B 5TPWH 2EDKA 2UWEA 2AJZB 2XWTA 1G0DA 1G7MB 1MPAL 2PR4L 1U8NA 3AU1A 3VCLA 4Z5RB 4MQ7B 2EYRA 3SN6N 2AV1B 3K8MA 4Y4HB 4PLKC 3MRHA 4LCCA 2Y06H 3BGAA 2GKIA 4XPBH 3BRFA 3T65A 1AGFB 5EU6A 4D8PA 5BVJA 2ADFL 4M9PA 4JFZH 4YBQC 4DKFL 4F33B 2Q8AH 3MR9A 2FB4H 4I18B 3JWNC 3AS3A 5LQBL 1CZ8H 4DKEH 1UCTA 2F9BT 2PTVA 1ZHLB 3D85A 5HVHC 2YPLA 1MIMH 1KT2A 4YIQA 3LH2L 3T8XA 3OF6A 1RIVL 1NFKA 5LGKA 2R1WA 4OJFH 2BC4B 2BY0A 3WCYA 3ROOA 1CLZH 2H3NA 3E8UL 1AO7E 3GSRB 1WEJL 3WN5B 5IK3A 4Z7NF 1F4XH 3RX7A 1ZHKA 2MNUA 1QVOA 3K1KC 3VW3L 3H42L 1RURL 4KKLD 4LHJB 1MH5B 4Y4KD 4FNLH 1NCDH 3Q0HA 1MJ8H 2VR4A 3ET9F 1G7IB 4FP8H 4ERSL 2BSRA 4GRWH 3DUHA 1VKXB 5ISZE 1MCFA 4IRSB 5EN2A 1FLTX 5ITBL 4U6YA 1RULH 4HIXL 4H25A 3E6FA 5HYJB 1IEAA 1WK0A 2R2HB 5T3XH 4ALAH 4LAQL 2OI9B 2QADB 3C6SB 4F37F 1FSKC 3B3IA 3DIFA 5HD8C 3O6ML 1YEDB 2YD8A 2DIAA 3HMXL 3K7UA 4QRPD 4LDOB 1B0GA 2QSVA 1A7OH 2A6IA 3RPKA 3MV9E 1CDJA 3H9HB 4LLVA 5DHYA 4OLXH 5F7HA 3L5WB 3KPTA 4B53A 2FH8A 5JW4N 2GJ6D 2GTZB 3MRBB 4WW2A 5I19L 1XF4B 3C09C 1KEGH 3P4NA 3MV8D 3PDDA 1FV1B 5KVDL 1HQRA 2XWJA 3MCLL 1U9KA 1LEKB 4EVNB 3ULVC 4HFWB 4MD5B 5TE7L 3RTQD 4RAUB 2Q20A 1BOYA 2B8OT 4OCLC 5IUSA 3DARA 3I75B 4G9FB 3BT2H 1IARB 5DRWA 1WT5A 1YEJL 2H2SD 1KENH 4KU1A 3W9DA 1QKZH 3CFKA 3KJ4C 3VD9A 2R0KL 1BIHA 3IDMA 1N8ZB 4U6VH 1WVZA 5HI3D 1ZGLB 3L3GB 3ORJA 5C8JB 1EFXD 1G7MA 4U1JB 3U6RA 1AHWB 2BSTA 2IADA 3D0LA 3K74B 1MY5A 4L1DA 3UPRA 1OAXH 3IKKA 2AV7B 2VZUA 3FQXB 2Q76B 2DBLL 3F12B 5F7KC 4OZ4B 3O6LH 3B5HA 4LARH 4LLWA 4ZUTB 1FCCA 2AAVA 1A7NH 3MRRB 2VABA 3RY6C 3FKUS 4GFTB 2UUDK 1R5WB 5IB2A 2IPUG 4MD4B 1QFUL 2ZJSH 4P4RB 4ZD3L 1UZ8A 5BVPH 1CFBA 3FO1B 4RMSA 1URLA 3FB8B 4LSPH 1ZT7A 4L3AA 4KMTL 3SCMB 3AMLA 3HI6H 5IFJB 3SOBH 1Z6JT 1INDH 1I9RH 3ROLA 4CVXB 1U3HD 4WW2F 4KHTL 4X4ME 4S2SB 2DQDL 2NY1B 3N1GC 1S7TB 3GZKA 5EUOB 4J3VA 4XPBL 5BZWA 2J8UA 4FQHA 5AAWA 3CXHJ 4YFLI 2V7NB 5D7IA 4WDIA 4NNYA 1DL7H 3WYRA 3IXAB 4MJIB 4AEFA 4TRPH 4TUKL 5F88B 2QSCH 5CJBA 4Z77A 2NY2C 2Y5TB 4X5WA 1U8MA 4YAQB 1S9YA 1TVBB 1RIHH 4ODUA 1F90L 1OARL 3WUWA 3HZVB 3WFCH 5FUCE 1RJCA 3VFGL 4YH6A 2OJEB 3VWKD 2QSTA 2KDGA 5INDA 4WWKA 5H94B 2JELL 4ZUSA 2QBWA 3VI3F 2EDRA 5D8JH 5L6YH 2FBJH 3B2VH 4UBDD 1QNZL 4Y5YA 4NZRH 2MQ3A 1U42A 4Z7VA 5DK2B 3QEUA 1KJVA 1TZIA 2HTLC 5E2UL 1BVKA 4PG2C 1JFQL 5EIIB 2R23A 5CSZA 4MNGE 1XGYL 2EDDA 3GI8H 4ZTOH 4Y16C 2RBLA 3DSFL 1AQKH 3MGOB 1I3GL 2D0HA 1M7IA 2Y6SD 4I0KA 5ERWA 3PWPE 1ZGLA 2P8PA 2BNUB 2VXQH 4KKCC 5LG1A 5F7EL 2HT2C 1GCFA 2OMNA 3MROA 3ARXA 1AE6L 4WTZG 5C0CA 4X4YA 4PJBE 4PJHF 1NGZB 5E6ID 5FYKL 1ES0B 1H3PL 3BKML 1FZMB 1TETL 2X4QB 3FONB 5L88L 3AS0A 1KCRL 4WFGE 2DLIA 1IKFL 1JL8A 1WLHA 5JA8B 4ZFOA 2EDYA 1MLBA 4NO3B 1S7QA 5HVHB 2B4CH 1N64L 5GGVH 3QFDB 3MJ6A 4DEPB 1ZA6A 3FTGB 5IJVB 5J3HD 5IV2A 2IH1A 5DA0B 5C0BA 3WHE1 1FYTA 1H15A 1PYWB 2LV4A 4K71B 4C58B 3V6FB 1MVUB 3ZTJH 4L4VE 1RUAL 4WHDA 3PP3H 4OCMC 1CTOA 3RWGB 3FB7A 4NHCL 3SDAB 1CXLA 1OW0A 5IW6A 5IB2B 2J3SA 3OAYH 5FA3B 4Z18A 1UJTA 4OFPA 4HPOL 5HPMA 4HWEH 3W0WB 3JWOH 3MBXH 3ULVH 4I3SL 3P0GB 3MFFA 4PTUB 1OM3L 4D0CB 4G6KH 1A47A 3A6OA 4K3DH 5IW3A 4KUCD 3FFCE 3QPQC 4LLDB 3OPZH 3MCKA 4JPWH 3MRQB 2KPNA 2P5WA 1BD2B 3Q5TA 3GEWB 2HVKB 3CFJB 3QEGL 1UWEL 2LU4A 1AI1L 1OTUD 4N8VA 3UO1H 1AI1H 1I8MB 3WHXA 3ARQA 1YEFH 2AGJL 4WO4C 3O6FB 1UFUA 4HGKC 4HWUA 2UZYB 1JWUB 3EFFA 1LO2H 4DK3A 3ZKSD 2E7HA 4F7TB 5C07D 2P5ED 1RUQH 5FYJL 2V5MA 1JNNL 1MIEL 3TO2A 3CFBB 3GSWA 4LSDA 4JN1H 1JHTA 3QEUB 3KYMB 4BH8B 2ZUXA 2B1HL 3RGHA 2VQ1A 5IB3B 4JFFA 1IC7H 1EMTH 1LO4H 5HHPA 2YHGA 4DOHB 4Q9RL 4KY1L 1CLYL 4V1DB 4J4PC 1V7NL 2ZSWB 4Z7VB 3QNZA 1WF5A 2HH0L 3T65B 2XKSA 3AXLA 2VXVH 3MODH 4HSQA 4HWBL 2BNQA 4NM4H 2NY6C 2IPKA 3TA3C 4G80B 3DXAA 1OGTA 4X4XB 1FFNB 4TNVK 3SDYH 1LO0L 5C0IA 4OZ4A 4GRLC 3AAZB 4PUBH 5I1AA 2DTML 3VXRD 3KPNA 3O9WA 4LHUB 5L2KA 1T6VN 3DNKA 2CRZA 5IMOA 4UIKL 3H9SE 43CAB 3O2WL 4OQTL 1EJOL 2PF6A 5B8CA 4OGYH 4EUPB 2APTA 4NO5B 4P4RA 1ZA6B 2A6JA 3GMRB 1DR9A 3BN9D 1CD0A 5EBWB 3JTTA 1CN4A 5I2IB 1MH5A 4FS0A 1YMMB 1RZ8B 3WEXB 2BVTA 3HG1D 1NAMB 5IESL 1WTLA 4RMRA 4RBPK 3FQWA 3WN5A 1HKLH 4R26H 1PKOA 3D18A 1F58H 4XNZC 5J8OA 5L2JA 1FZJB 4R97B 3GMNB 5HVWA 5GS1B 4IHOA 5GS0L 1Q9OA 3OJMB 4WW2B 4NO0D 5D72H 3G5ZB 3QEHA 1UEYA 1CLYH 2BFVH 5I1GH 2APWA 3H9HA 4KJYA 3KPQB 1FHGA 1RK0A 5A2IH 3IJHB 3MRDB 4LIQH 2Y36L 4HQQH 3V0WL 3VXNB 1EO5A 2Z35A 4MCYA 2IQAA 1F4WL 2GCYB 4BKLA 2DMKA 4HKJA 1NFDB 4AEHL 4F37K 1XGYH 4U7SA 4WEBH 1F6FB 1G9MC 3QXDB 3AU1B 4NCC2 5DFTA 4Z5RA 3VCLB 3SHSA 4PJFF 1LEKA 4EVNA 4EDWH 1D9KB 4P99A 2EKJA 5D6CB 4ZUUB 4YQXL 3BP4A 2DQEL 4XAWH 3GNMH 4TOYL 1IAOB 1GH7A 4QXUL 3TBYA 1T03L 2E27H 5HHPB 4LEOB 4ZYKB 3QUZB 3BIKA 3D3VA 3R8BB 3RUGA 3VWJB 2Z31D 1ZVYA 2X7LB 3S88H 2X4TA 4HX1B 5FUOH 2VDNL 3C6LB 1VERA 4IOSD 2NXZD 3L1OL 3HAEA 3GSNH 1AO7D 4LPCA 1AGDA 2NY7L 5E1HB 5KG9A 1QRND 4ZG1A 4GRWB 1KLGB 5GGVL 4KMQA 3MNWA 5FF6A 5E2VL 4MXWL 2OP4H 4Y5XB 3B9KC 2D7MA 5E94A 4JREB 4NM8H 4LSQH 4MHHI 1UZ8B 3IXTA 3OJVC 1ZLUH 3HC0B 3GSQB 4XGZA 5EBMA 4XVTH 4ZSOE 3RWEB 4ONGL 4ETQB 5JIIA 4OZFH 1CD9B 3NZHL 4BZ1H 1NCAH 5A3IC 3S34H 2HJLA 2XFXA 2DQHL 3T3PF 3WHE0 4U1LA 3VXMD 4CDHA 1FG2A 2NY4B 4DOHE 4S1SL 4ZFOL 2OXHA 2J8UB 3CIQA 43CAA 5B8CB 3U0PA 3AMKA 4PJBB 1E6OH 2DQUH 2CMRL 1SBBA 3P30H 1P1ZB 5D7JC 3FO0L 2BVOB 4S11A 2C3VA 1DBML 1I1AC 3BYYA 1MEXH 3K8KA 1BWWA 1CLZL 4OFKA 3VRLF 2P8LB 3S3PA 3F7VA 1U8KA 2VXVL 1LE5A 1SEQH 4LSSL 4X9IA 1KGCE 3QDJB 3KPRD 4LDLB 4E42A 2KQMA 3ESVF 3JV5A 2R2EA 4HX1A 5DUML 3MREB 2F74B 3WS6A 2X41A 2MKWA 5BRZD 1RIUH 4J3TA 3PL6D 5DQDL 1CWVA 1NMCB 4MA1B 3GMNA 3HE6C 4C56A 3QG7H 3D2UA 4LVNC 1QPPA 5FK9A 1BREA 3EZ8A 5FYJH 1CXHA 4I5BB 5DJCB 5I8EB 4OIBA 5ID0B 2UY6A 4NN5C 5GS1C 5GRJL 1MY7A 5IVXA 5E6YA 5CEZH 5IGXL 4WI3A 3ZKNC 2YC1B 4OTXH 2X4OB 3H3PH 3QHFH 2Q3AA 5D2LE 2OL3A 4LLUB 3U30C 4M03A 5C0RH 4BUHA 1XR8A 2X09A 3ARGA 3C5JB 1KIPB 3AXLB 4R8WL 3MV8E 4H1LH 3QHTC 4F57H 4OLVH 2WIIA 4PUBL 1Q1JL 2XZQH 1OM3H 4YHIA 3G5VB 1KF9B 1NH6A 4LLQB 2BDNL 5DK0A 4NWTH 1FORH 3KPRE 4KJWC 4K94H 4BH8A 1JPSL 4N68A 3CFCL 1NFIA 5JZ7D 5BMFL 5DJYB 3BRGC 5HPOA 1NFDF 1B90A 3BH8B 5J56B 4LCIH 5C08A 3QPQD 1U8QA 5E2TH 3FFCA 1S9WA 5KVMC 3CC5A 1WIUA 2X4TB 3HFML 1KBGL 1MQKL 3MYJB 3QIBC 2VAAB 1ORSA 3WV0A 3BP6B 4PP1D 2HT4C 1KCUL 3D48R 4U1GB 1CDYA 3X13A 4N9OB 4X7TB 3F6LA 2G75A 4UAOC 3CVHA 3QUXA 4Y1AA 3RPIA 1CLOL 1JMXA 1ETZB 1FE8H 5EU5B 1BM3L 5KZCB 1K5NA 2ZOKA 1RZ7L 5GS0D 1YPZE 1S7TA 2E6QA 4NPYA 1IAMA 2HLAB 1EVUA 4MNQB 4A2MA 5SWZD 2QQNH 1T1ZA 4HZLA 1TVDA 1GJIA 2M1KA 4K9EH 1AGCA 3FOMB 4XTRD 2AKRA 5J0BA 2DLTA 4LCCB 1O7SA 3C08L 4ZD3H 4CADB 5HDLA 5HI5D 3C9NA 3BDBA 1Z5LB 3TO4C 4UINH 2DTMH 2ZUVA 3TPKA 2FCBA 4BQ8A 3MXVL 4R0LB 3EBAA 2G9HB 4NQEA 5K9KA 5IBLD 3EO0B 4Y2DC 3O2WH 1Q72L 4OQTH 1GGBL 1Y0LA 4P23D 3X11A 5FO9B 1KJVB 1TZIB 3EO9L 3FHQA 2AVGA 2C7UB 2P1YA 3P4MB 4AQOA 2CDFA 3BDYH 1U3HA 1RK1A 3F58L 2H26A 1EHLL 1D5IL 4TNWK 4D2NA 1FL5A 1V3MA 3WNMA 4YO0A 4QOKB 4D9LL 3HAEH 1AFVL 4KK8C 4PJIA 2OR9L 2V2WB 3O6KH 3QA3B 3TJHD 4JG0L 4XZUA 3STBA 1MEXL 3FMGL 1L0YA 3IJYA 5DJ8A 1E6JL 3QPXL 4CNIB 4MXVF 4UTBL 1KJ2L 3QIUC 5EO9A 2E9BA 2R69H 3MNWB 5FF6B 5F7EH 4NKMA 4GW5B 1FVDB 2W91A 3MJ7A 1AGBA 1WAAA 3WJJA 5DXWA 2PO6D 2V5YA 3EYOA 3W2DH 3S34L 4FN0A 4EUPG 1CT8B 1NMAH 2Q7NA 2F54D 3VH8B 2IH1B 3MRKB 3HRZB 4QGYA 2XZZA 4APQB 5IJKA 4P3WA 5F1IA 2VDMH 1ZLSL 1DQJB 4IRZH 1Y6KR 3B4NA 1CL7H 5KS9B 1RQ5A 2BRRH 2VWEE 4HBCH 3SPVA 4HKXB 4WFHD 2BRRL 5MHSE 2XKNA 3IDGA 5GJTH 3QO1B 4X9BA 1DE4B 3PWJB 2VL4A 3K4DA 1CIUA 4N0FA 1LP9E 4J3SA 1SVCP 3BUYB 4JB9H 1XF1A 4GT7A 1CFVH 1QSFE 1JYWA 3QNYA 1G7IA 4H8WC 3B6SA 4ZXBC 2XZCH 5ITBH 3FRPG 2VDQL 4NO0A 2XZCL 5D96B 1IM3B 3Q1SH 1T3FA 2VLJD 2Z31C 1FVCA 4N9GA 5FGRA 2FEDC 3QEHB 4F9PA 2BRQA 2ZPKH 2NXZC 2WLZA 1M7IB 4CKVX 4Y4KB 4OI7A 1OY3B 1Q9OB 1U8OB 4PJIF 3QISA 5EZLA 4F2MB 3IDIA 4KFZC 1BFOA 5H37H 1HILA 1X5HA 2QKIB 1RZJC 5FIEA 2PTUA 2BJMH 3SKUD 2BJML 4HKBB 1NGWB 4HV8B 3CFDA 1ES0A 4XBEH 3MBEC 5CJOL 2BP3A 1RZKL 2AXFA 1P5VA 1UWXH 1AY1H 3ULVF 1NDMB 5JPMB 3GO1L 2CIIA 1INQA 4PJCB 2GJ6B 3LH2H 1MI5B 4UQ3A 5E8NB 1GXEA 5IOPB 1VCAA 1DSFH 3IGAA 3QCUL 4KVNL 4OGAD 4MCZB 1N6QL 3L5XH 4HEME 5D7JD 3PHQA 2FO1A 4PJ9C 2X4OA 1DLFH 1HHHB 2VZOA 3MNVA 3O4LA 3MLXH 1RMFH 2ZG2A 5IT2L 3TT1L 4QCIA 2VJXA 3DJ9A 1SYVA 4M7KL 1GC1L 3VXQA 3C08H 3MRPA 3RTQB 3MMEA 4R3SB 4GMTL 1P4IH 4HC1A 2W65B 1PW3A 3B5GA 1LDPH 4KKAD