2W0FA

Potassium channel kcsa-fab complex with tetraoctylammonium
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
218
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/metal transport
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
publication title Structures of Kcsa in Complex with Symmetrical Quaternary Ammonium Compounds Reveal a Hydrophobic Binding Site.
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2008-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w0fA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w0fA02
2HFFB 2D7MA 4LAQH 1RI8A 3OKDA 5D7LB 2NXZC 3VXPA 2E7LC 1IRAY 3N9GH 4QRRE 4GKSB 1AQDA 3MV9B 1FYTD 4M5ZH 4KHTL 5C0IB 1MCWM 2ZUQC 3GGWA 4X0KA 4LPTA 2HT3C 1FVCA 3H3PL 1KN4H 4WEMB 3WD5L 5E4EC 1WVZA 3VXUD 1C5BH 5CEZH 5F7EL 1CIDA 3D9AH 1Q0XH 3O3BB 3OKMA 5I1JL 4DW2L 4JPVL 2IPKA 4OLUL 4LSQL 5HI5C 4R96B 1JGDA 3UBXI 4V1DE 1QHPA 2MWCA 1HKLH 3TGXA 3IDYB 5CEXB 4EDWL 3D25A 3DBXB 4IIQA 4D9RD 4KMTH 4P9HL 3WHE1 3VWKC 1AO7E 4LLUA 4XP4L 1BM3L 1AD0A 1A5FH 4OBRA 3OPZL 1RSFA 5DVKA 4D3CH 4YBLB 2NW2B 4W4OC 3TN0B 2NR6C 5F96H 4K07A 3Q1SH 5EUKB 5C9KA 1CLZH 3VI4F 1IGTB 2VKWA 3WJJA 2OCFD 4N5UA 2H9GB 4FQ1H 4JRYB 3BQUA 2QSQA 5IMLA 4MAYD 3HMXH 4M48H 4RMSA 3ULUF 3SE4C 4ZDHA 3VH8G 5CEYB 3IRPX 4PJHF 4YNYA 1GAFH 3FO0L 3HS0A 1Q9OB 3FFCA 12E8H 5D5MF 3IDMB 3TBSB 3MNZB 4RFOL 5C07D 5AG9A 1MCLA 3RBSA 5HVFB 4Y4HA 1KEMH 4DGYH 2F58L 2C4FU 3IDJA 3KYOB 3PP4L 3NVQA 1FRGL 3T08A 4L4JA 4UV7H 4J3TA 1F97A 1EEZB 2P1YA 1NBZB 3RAJL 1R3LA 4HIEB 1NCDH 3BEWA 1H3PH 1EO5A 4X83A 1S9VB 4UV4L 4AIXA 1IEAB 3LY6A 3G9VA 4BSVA 3FB5A 5JOFB 4HUVA 2WIIB 4R4FH 3B9KB 5JLZA 4YK4C 1UXSA 2VISB 4OD2B 2R2BA 4V2CB 1WZLA 4L3CA 1T20B 1YEFH 1FG2B 4FRWA 4DKFL 4PRPE 2R4RH 3QDMA 2PXYC 4KDTA 1OQXA 1JGUL 3ULSB 3AY4A 3CC5A 4NQED 3Q48A 5K9QI 4MMXC 1CZ8L 4Q6IA 5DEZA 1NGXA 3FFDB 1KB5A 5IHUL 1HCVA 3TIEA 3VXOB 4WU7A 1N5YH 4OZ4A 3AS2A 1S7RA 4PB0H 5MEPA 4L3AA 1CR9L 2HJFA 1IJ9A 4NKMA 4I48A 4MYWB 4GUPB 1MHHA 1WZMA 3SDAD 4NRZB 4MDIB 3RWCA 1TMCB 4RFNB 5E2TH 4YZFE 2G9HB 1FPTL 1S7QA 3DRTB 4NHUA 3L5IA 4LASH 3ARZA 3MLWH 3KYNA 5AZ2H 2IGFL 3CX5J 3D85B 3M1BB 3DNKA 3MRDB 2X40A 5GRUL 4G8GD 3TJHC 3PXJA 1FFNB 3CU7A 3MLSH 1AGCB 2I9LA 4XHJC 4XNMB 4GG8A 5HYIA 3BPOB 2LABA 1NC4B 3W9EB 1ZVSA 1UCTA 2GTWA 1YEIL 2OJZL 4OTXH 2Z31A 1RIUH 3MO1B 4RGMC 2DQCH 2F54A 3SBWA 1NEZB 3S96B 3BZEB 2FEDD 4UT6L 1JUFA 3ZTNL 5DXWA 3CZJA 3QNXA 3BPNB 3MJ7A 4TN9A 4XMKL 4R0LA 2OJEB 5C09B 2J12B 4IRJB 2FD6H 3UAJC 5HHNB 4L8SB 4IRSC 3HA0A 1P7HL 3OZ9L 1L6XA 4CDHA 3QQ4B 4JPWL 1QLFB 4ODHH 2P5WD 1OT1A 3UTSE 2HT4C 3VXMA 3S88L 5F9DC 1M4KA 1NAKL 4O9HH 2ZUTA 1IEHA 3KPPA 4E41E 1HOCB 1NAMA 1ZE3C 4YHZH 5DRWB 1J10A 1J7VR 5HTSA 4BSJA 1OTSD 3LPGA 2XZQL 3OJVC 2X44D 1ZANH 1WICA 4PRDB 4M6NH 1HH9A 2IFFL 4NQDB 4LOUC 1JPSH 3IF1A 1UT9A 1NEUA 1C12B 1AE6H 3BP6A 1G7MA 4KRPB 4P3CH 4KC3B 2H6PB 4JAMA 4OCXH 2M26A 3EDJA 1Q94B 1AI1L 3F7YA 3TWCH 1JFQL 2J8UF 4OF8A 5ESVB 2HVKB 5CMAA 4O4YL 4JPIA 5T1LA 3LQAH 3QDHA 1QYGL 1IM3A 1L0XA 2Q20A 4NJ9L 4R8WL 3RIFK 1GC1H 5IR1B 5EOQL 4JO4L 5B4MC 4NM8H 4KXZI 2YC1B 2ZCKH 3T65B 2MKWA 4Q9QL 4WW2B 2X4OB 3C5ZA 1GZQB 1RK1B 4G9DA 3X3FH 5D70L 3MRCA 4CVXB 4X6CB 3DI3B 5E5MA 1MJ7H 4YDVB 1GC1C 1VDGA 4KQ3L 3O3EB 1TVBB 1QBAA 2AABH 3D6GA 4PV9B 2B0SH 3IKKA 1MFEH 4F8TA 4F15C 4KROC 3RX8A 1WAAA 4P2RD 3BZ4B 2CKBA 3DRQA 2XI9A 5KSUA 3OR6A 3BW9A 3FN9A 4OFVA 1NGZB 2IMMA 3D0VB 2W0FB 2HKHH 1JF6A 4OZFH 4CN6A 2Y7QA 3WMSA 4P2QA 2C5DC 4Y5XA 2EDJA 1RZKH 2MOVA 2VDLH 2ZG1A 3FB7B 2DYPB 2N1KA 3FZUC 4P5TA 2OZ4H 4M3JA 3KYMA 5FKAB 1H3VA 4ODVH 2ADJA 1GYAA 3EOYG 5F7MC 1RZKC 1UB6B 4PY8J 5GJSH 3ME0A 5F97E 2CQVA 2YPVH 4GOSA 5IK3A 2IG2L 1WITA 2UWEF 1M05A 4KJYA 3T0XA 4LQFH 4AL8H 2DD8L 4NBXB 4TULL 4EI5A 3PWUA 4DK6A 3GIVB 4WU5A 3OBAA 1N6QL 1N2RA 3ARQA 3L3IA 4L5FH 1J05A 3MSPA 4NWUH 5D7SL 4HWZA 4M7KH 1MFBH 2JTDA 5HHVH 4PGDB 4JHWL 4H26A 4WEUD 5C08D 2FRGP 1LK3H 4PJHB 4Y16A 1KENH 2X09A 4ZXBC 1P84K 4OZGE 1NAML 1S5HA 3BT2H 3QEQB 2R56L 4TUJA 3UJTL 4JLRB 4CMMB 4FQLH 1G9MC 5D5MB 5FV1L 4JVWA 3DURB 4NBYB 3VFGH 1OP5H 4PJ8D 1WZKA 2WBWB 4MA8H 4BFBD 4LLMB 1NMCB 3WFBL 3GSVA 5INDA 3DWTA 5KANI 5D7KD 5DJDA 2WBJC 5CILH 2EDRA 1E4KA 4E0RA 5INCA 5I1IH 3CFKA 4KK9C 3UCRA 3BKYH 1HH6B 3HTLX 3QHFL 1EEYA 1NL0H 2ZNWA 3F58L 5EBGA 1FZOA 2Q8BH 1ZA6A 1JGLL 1JL8A 1ZT1B 3B8SA 1O7SA 3UYRH 1NCWH 1WBZB 4GW5B 2D0FA 1DVFC 3ARGA 5DUML 1IGFH 4R7DB 2VLKD 4PRIE 1IM9D 4XP9H 4OLZL 4EI6A 5D6DA 4PJ5B 1IQDB 4WIQA 2DTSA 3IGAB 2VC2L 4P59H 1A8JH 5SWQA 1PG7H 4FTVD 3DROA 4ZUWB 4HKJA 2A0LD 5K93A 1R5IB 4GRWH 1RULL 1JYXA 3X3GL 3TYFA 3RWFB 4U1IB 5DFVC 1RHHB 4O2FA 3NABH 3CVHB 2Q86B 3S37L 1I8IA 3BKCH 3LIZH 3ABZA 5DD1L 4JFDE 3IDIA 5EBWB 4NKIL 4LARL 3GJFK 3ZKMD 5JPNB 1FNFA 1FBIH 4BM7A 1NMAL 2SEBA 3DUHA 2YPLA 1ADQH 3ZSSA 3VG0L 1RQ5A 5HYJA 5HVWA 3U9PL 3U4EB 4NHCH 5C0BB 2XTJB 4KK5C 5L88H 3MRMB 2IF7A 1A64A 2DQUH 3Q3GA 5B3JE 2Y36H 4LEXH 1RIVH 1IGJA 1CE1L 3LKPA 5D1QB 4Z76B 5EA0H 5C0CE 4F57L 5IB2A 1LE5A 1HHHA 5SX4I 5GRXG 5T3XD 4NQCB 5HHOA 2ENYA 4TSBH 4N0CC 1QLRB 4YX2H 1JGVH 5EO0A 3Q6FA 3GJEB 4KVNL 4PB9H 3MRBB 4FHBD 3MZTA 5DJ8B 3NIDE 1WBXB 1JK8A 1GH7A 4LAQL 3ZT7A 3W11D 3S8WA 4JY5H 3SDCB 1A4KA 3HE6A 1CDUA 3N9GL 4X98B 1Q8MA 2FECI 3WEXA 4Z7WB 1H8SA 3OB0H 2JK5B 4M5ZL 1T7VA 5AD0B 1YQ2A 2IBGA 4RSVA 1G6RB 1DTUA 3C5SA 1KN4L 2FWOA 1A7BA 2D4FA 4QXWA 1CFTB 4YFLI 2E6JA 5JDSA 1C5BL 5FYKU 5CEZL 5HYFA 3GSUA 3D9AL 1Q0XL 4XNQA 1WWCA 5CJXC 5DUBA 1F11B 4XI5C 4K8RD 3C60A 3H42H 1C8PA 4MJIB 2ORBL 4XRCB 32C2A 1HKLL 5E9DD 5JNYB 4G42A 1G0XA 1R5WB 3ZE0F 3I6LE 4YPGA 1RD6A 5DHVB 4CADB 3JTSB 2GCYB 4MVBC 4KMTL 1BP3B 3BH8A 1VGKB 1GGYA 1UZ6F 2FO4B 3OJDB 5IF0B 4GW1B 2P8MB 5MP6H 1TFHA 5D2NE 1JWMB 4K2UH 4JO3L 4OM0H 2XQYK 3D0LA 1A5FL 4D3CL 3NN8B 4RRPG 2P46B 1JE6A 4WHYG 3CNKA 1XR9A 2J8UB 4ONFH 5C2BH 1RUKH 4OFYD 5F96L 2YA1A 3T1FB 3IT8D 3Q1SL 4HH9B 1YMHB 3KLSA 1CLZL 4M3KB 2P24A 1AXSB 1F6LL 1XGTB 4X4YB 4JM2D 2A6DB 1S7TB 3C6LD 2C3VA 3MBEC 3SCMB 1LHZA 4PJFE 1U8JA 3D3VD 4FQ1L 2IAND 2AJ3A 4M48L 2NXYD 5C0AA 2DRUA 1YEHH 3NZ8B 3WUWG 4HMDA 1A6VH 2C26A 1GAFL 4GQ9H 1OD7A 3UO1H 3C8DA 12E8L 3HR5A 1YUHB 3RIAK 1MF2H 3GUTA 4WWKA 4ZOAA 4ETQB 3UPAA 1KEML 4DGYL 1EX0A 2P5ED 1EO8H 3GMPB 3ULVE 4UB0H 5DMJB 2CLVA 4Q58C 4QRPA 3T77A 4AK1A 3REVA 4UV7L 4BQCA 2BSSA 4EEEA 1MUJA 2A9ML 3QQ9D 3KAAA 4JN2B 3L5WA 1A9BB 1NCDL 5ICXB 1H3PL 4LMQI 4J3WA 1NANI 2ZOKA 4XTRC 1YEJH 4D94A 1MIEH 3EDDA 3OGCB 4R4FL 1GVIA 2UWEB 1A3RH 4MHHG 4NO0D 5DJZA 2EECA 4P23C 4Y4FB 4ZFZB 2YD2A 1BVLB 4MSWB 4NZTH 3CXHK 1TNNA 4MA1C 1YEFL 5FYJL 3QI9B 5L8LB 2R4RL 1GGBH 3TCLA 5IESH 3QXAA 4RWHA 1VADA 4HJGB 3VA2C 1FVDA 4ISVB 5EU6A 4X7CC 2BNRA 2DM3A 4OZIB 1EHNA 3WJLA 1A9EA 1K4CB 4M93B 4M7JL 4PJBB 5EIVA 1N5YL 1DUZA 5KSVA 1OWRM 3QDGB 4PB0L 4JO1H 3X13B 3EYOB 4KPHH 3VD5A 4OKVB 1KLFA 3QQ3A 1V05A 2X41A 4GBXB 1T6WA 2BNQA 1G84A 5FHBH 2PYFB 4DKAA 3FRPG 5E2TL 3VXSA 2ADGA 3T2NH 4X7FC 3FQXB 1EBPA 1PZ5B 1FZJA 3KPRA 5EU5B 2GK0B 1JN6B 3MLWL 1CWVA 5AZ2L 1U3YA 2OTWB 5KSAB 4EN3A 3T8XB 3GSWA 3MLSL 4OZFA 2VLLB 4WI6A 2VUYA 3TC9A 2VR5A 1RUQH 2UY7A 4UDUA 4C4KO 1QVOB 1BD2A 5C9JB 4MNQA 4OTXL 1RIUL 3RDTA 1Q9KA 1P4IL 5FYLD 2DQCL 1BJ1J 4U3HA 2ZSVA 4WRLA 4MAYC 4NOFA 2L7UA 1YECH 3GBLA 5F88A 5E94B 3AS3A 5A2JH 5BV7B 4HUUB 1WAAF 3MJ8B 1IGCH 2AK4B 3QFDA 3OKMB 4H1LG 1N3NA 4DEPB 2FD6L 5FK9B 3L3DA 4HX1B 3W0WA 4NC1C 1INEH 2VMFA 3MCKA 4ODHL 1TQCC 4WV1A 3LPFA 4OCSH 4JFZH 3D25B 4XPFH 4WI9A 2ZUXA 2XWJA 2Y9RT 4YHZL 3FO2A 4Z7UA 4EVNB 4LLUB 4MD0A 5HGGS 2VZOA 3LDBC 4WUUE 3KR3H 3INUH 1M6OA 2LQRA 4YEEA 1ZANL 4M6NL 4F7TB 2EEDA 1CICA 3C9NA 1JPSL 2CH8A 3HZVA 3ARFD 4GG6E 2BXZA 3M45A 1NGYA 4P3CL 2HFTA 3OXRA 2PO6D 1FFPA 3QH3A 4OCXL 1OCWH 3TWCL 4Z0XA 3P0GB 5T3ZE 2F8OA 2GQHA 2H1PH 1A1NB 1BWWA 5IMLB 4HS6B 2GAZB 5CS7A 3LQAL 1HWGB 5DK2B 4YNYB 1OD9A 3HS0B 4NM8L 1X44A 5GGTH 4OFIA 4Z7OE 3QEUA 2DTMH 3OX8B 3V95A 1RZFH 3X3FL 2MKLC 1FO0H 1MJ7L 2VLJA 1Z6JT 4F9LC 4P4RB 1XCQB 4Y5VB 3SDAC 3RGVD 3IDJB 2AABL 3TA3A 3QDAA 1NDGA 5AZEH 2O5YL 2B0SL 5BZDA 1MFEL 5CZVH 1YNTB 3UYOD 1R3LB 4LHUA 3DUUB 4AYFA 5L8KB 3RP1A 1I75A 4LCWB 5CJ8A 3FB5B 1S7XA 4FFYL 4Y0GA 4QOKD 4PD4K 5HSFA 4P46B 3VGDA 5J11B 4LQ1A 4J1UA 5F7LB 4RGNB 5E70A 3TNNA 1JHKH 5SWSE 2R2BB 4L3CB 5HDQH 1IC5H 2OZ4L 3QDMB 3KXFE 4ODVL 1ORQA 5DJ0A 5GJSL 5GGSY 1AGEA 3CC5B 4JDVA 1A6ZB 1E28A 2YPVL 4G8EB 4AL8L 1OAZH 4LQFL 4Q6IB 3HAEG 1KB5B 4LP4A 2VWEE 2GT9A 4KI5F 2FEDC 4C56D 1WT5A 4OIIH 2V2WB 5D1XD 4WTWA 1S7RB 4KTEH 4UU9A 3B2VL 5KVDH 2D4DA 1UKTA 4L5FL 3VJ6A 3DV6A 3QWRA 4M7KL 1MFBL 2R23A 4H88H 1MHHB 3WXWH 5HHVL 4HS3A 4P3WA 1I1AB 3RWCB 2DB8A 1LK3L 4PLNC 2PYEE 1G7QB 3O9WA 1LEIA 3VXRD 3FB8A 4NP4L 5BMFH 2F53A 3OXSB 3BT2L 4ZO9A 5LAXA 2Q7YA 3VCLA 1OTSC 1HCFX 3RJDA 1Q72H 3KYNB 3AM8C 4FQLL 3T0BA 1V3JA 4LRNH 4BFIB 3EYSH 1A1OB 2VQ1A 3VFGL 2VLRB 4L4VB 4QRRA 1LE9A 3D69A 1DUYA 2EDNA 4MA8L 4ODSH 1ZOXA 3VRLE 5HVHB 2GTWB 3QIUB 1DR9A 4PBVC 5CILL 4NNYA 4DFIA 2QSTA 5I1IL 1CGUA 1FGNH 4V1DA 4N0UB 1A6AB 1NL0L 4RX4D 3P11H 1RZ8B 4BFEA 2EYRA 2FZ3A 3MJ7B 1BQHA 5IJVA 4R0LB 2K1MA 3VMPA 2Q8BL 3UYRL 1FLTX 1NQBA 1NCWL 1AO7A 1JTPA 1PZUB 2YRZA 4GAGL 5K9QG 4XP9L 2YRLA 3NZHH 4X6FB 4FZEH 3S34H 3KPPB 2ZUSA 4P59L 1PG7L 2FIKA 4KKAD 3GM8A 1LDSA 3MROB 4JFPA 4BZYA 1AHWC 3WO4C 1N0LA 2PCPA 3Q5OA 1MCWW 2WUBH 3NABL 4IM8A 5FB8B 2CD0A 3BKCL 3LIZL 5F9JA 1SMOA 1XCTA 2R2EB 3KPMA 4JAMB 3F7RA 1FBIL 3S5LB 1DP0A 4F33A 2UZYB 3SE3C 3QUMH 1ADQL 3VWJB 4JGJA 1I8LC 1A2YB 3O3DB 4OSUH 1ITCA 3IVKA 4NHCL 5IMMB 2CRMA 4APQD 5BS0B 1IM3B 5L88L 2DQUL 3WKMH 4F8QA 2Y36L 3OAZH 4LEXL 1RJCA 1RIVL 5SWZE 5EA0L 1MH5A 1I3UA 1IL1B 4YDLC 3MRCB 2DIBA 5DEGA 4TSBL 1T21A 4YX2L 1JGVL 3QXDB 1CGYA 2YD8A 3DVIA 4PB9L 1JNHB 1AFVH 1HILA 3V8OA 1IAOA 5IB5A 5LGHH 3FQUA 3HPLB 3TFKD 4JY5L 4LSSH 4DVBB 2CKBB 2OMNA 1KT2A 3C6SA 3DGGB 2VZVA 3OR6B 4IHOB 1MIMH 4PRPA 1UG9A 5ACZA 1LP9A 4PJ8C 3HZKB 4P2QB 2BVQA 3RNKA 4DOHE 3NAAH 4HWEL 1QBML 2QQLH 5B21A 4RFEA 3RY6A 1OSZA 3V6FB 4P5TB 4CNIA 5DQDL 3NTCH 4Y2DB 3VI3E 2UY6A 1BFTA 1PX3A 1S7UA 3DECA 3SDDB 3TO4A 1G7HB 2HYMA 3PWUB 4WU5B 2DI8A 1PSKH 1SYVA 4DZ8B 3CFEA 2W0LA 5MP6L 4OM0L 1N2RB 3L3IB 2EDBA 5TF1H 4HWZB 2VXTH 1KULA 1V3MA 5BRZE 1I7UA 1FL3B 5C2BL 1RUKL 3MOBH 1S5HB 1BLNB 5K9JH 4G7VH 1U8LB 4TUJB 3E2HC 4CUCA 1ORSA 4P5KA 3O0RH 3OKKA 1NBYB 2MHAA 1A7NL 4M61A 2BY1A 1YEHL 3TBTB 4ZFGH 3VFVA 4HJ0D 1W0VA 4YIQB 1KUMA 1U8PA 2YUWA 2FHBA 3NFNB 3TM6A 4PJ7E 3UO1L 2Q8AH 3ZKMC 4ZPVA 5K59E 1MF2L 2HWZH 4RZCB 3EGSB 1YN7A 5INCB 1OOAA 3CFKB 2FJHA 1SJVA 1EO8L 1CFQA 2X4RB 5M95B 4UB0L 4O2CB 2X4UA 3B9DA 5T3XH 3F7VA 3ULVH 3UTSA 3QUZB 2W9DH 2HRLA 3UZQA 1YEJL 4E41A 5FUZH 5F6HI 2JCCE 4JFYA 2YXMA 3MACL 5I1EH 4RA0C 3ZDYE 1A3RL 5FYKE 1JWSA 4JG1H 2BVEA 4NNXA 3CXHJ 2QADB 4HW6A 3V0VB 1RUAH 2DQFB 3PQYE 2NY1D 3BSZH 2WP3T 4IOSD 3W11C 3D2UB 3O6LH 1GGBL 4D0DB 4N8PA 2EO1A 4BQ8A 5JQ6L 5I8CB 2G2RB 4KKNA 4MJ4A 5T1DH 4TNWF 1KG0A 1JJUA 3Q5TA 5EOCH 1MI5E 3T3ME 4K8RH 1QBBA 1KBGH 2AEQH 2AKRB 3UTTB 4XNZC 5GGTA 2A73A 4JO1L 3LQZB 4LLQA 1QSEB 4KPHL 1S7SA 3MX0A 2SEBB 4K8RC 2R0LH 3BYTA 3DMMD 1YNKL 3FHQA 1FO0A 4FQHB 3QNZA 3HNSL 2YPLB 5TE4L 1CD8A 2X4PA 4QRTA 3QHTC 25C8H 3T2NL 3Q3GB 2IBBA 5KTEH 3X12A 1IGJB 3LKPB 2H32B 1LE5B 2CLRA 1HHHB 3D87B 5L2KB 4U1JA 5IG7A 3GMLB 2NQCA 4JG0H 1Z0MA 2Z4QB 5EO0B 3ZKXB 4IMLA 1F90H 2VDQH 1DE4A 1OM3H 1GSMA 3KPOA 1IEBA 3NCCB 1J87A 1JK8B 1RUQL 1Y6NR 2EC9U 3B5HA 1S9WA 4JM2C 3T0DA 3C6LC 1P2CB 1R5VA 4N9OB 3IS1X 1UH4A 4UTAH 1R3KA 2JLLA 4KHXH 1YECL 3HE7B 5JDSB 2GK2A 2IAMA 5DC0A 1IGCL 5JUEH 5DVOA 4XNQB 5DUBB 2IPUK 2BY2A 4QRQB 1MNUL 4HKXB 3HC3H 3U36A 1P5UA 4LNRA 32C2B 4OCSL 4JFZL 2YUVA 3LRSB 4XPFL 2Q6WA 3TF7C 4AMKH 1KNOA 3QQ9C 2GSGA 3WBDA 4OZGA 3STBA 2BVUA 5H2BA 3DO3A 4QXGH 2PW1B 3KR3L 1XR9B 3INUL 5FECA 1A7RH 4JFOB 4K23H 2GHWB 3PWPB 4L9LA 2IQ9H 1MVUA 3ARDB 5A43C 1VACB 5EOCJ 5IQ9A 4B41A 4HMCA 3F65A 1OCWL 2C3VB 5DVMA 4C57C 3MUY1 1CDBA 1URLA 9CGTA 2H1PL 4Y1AE 5T3ZH 4JGUA 1IC4H 3FQRA 1D5MA 3VXUE 4XPBH 4D0BA 3PHOA 2BC4A 3H0TA 1DLFH 3MRIA 1OW0C 4JFXB 4JRXD 4OCYH 4KH2A 4LCCB 5GGTL 4WW1A 5FGBC 3MV8B 1RZFL 3OKYA 1FO0L 2GUOA 3ARTA 3MODH 3GUTB 4X4ME 1T3FB 1TTUA 3DXAB 2BK8A 4RNRB 2XKNA 1T22A 2AJUH 5IMKA 3REVB 4NZRH 4QKXB 5CZVL 4PRIA 1MUJB 2CKNA 5I16A 1FV1A 3FO1B 3B4NA 4D2NA 1J12A 3NFPB 4PD4J 3IJHB 5I0DA 4EUPB 3WFDH 3JWDH 5I1AA 2EYTA 5GGQH 3BISA 1XF5A 1S5IH 5HDQL 1IC5L 3H9SA 1CN4A 1TCRB 4ENED 4BK4A 3JWDC 3QQNA 4JFDA 5D7LE 3QXAB 5CP3A 3K74B 3IU4H 2AW2A 1FVDB 3PL6D 5EU6B 5J3HD 2BNRB 2CRIA 3MV9E 1FJ1A 2Z8SA 1MHCB 2IMNA 2RQ8A 1S9XA 4W70A 2EC8A 4OIIL 4ERSH 2I27N 2C9AA 4RAUA 4J3XA 1LO4H 5ILTH 4KTEL 1YY9D 1EVUA 4K94H 2DL9A 5KVDL 4XP6L 1U8HA 3QQ3B 2WLZA 5IIEA 4GAYA 4H88L 4TVPD 5C0CA 1JPFA 3WXWL 5ENWA 2YEZB 2BNQB 2QQQA 4KKCD 4KTYA 2ADGB 2QLVB 1ZTXH 5C7XH 5BMFL 2MJWA 3KPRB 3HRZA 4N8VB 1PG7W 1Q72L 4Y89A 3D18A 4LRNL 4NO5B 5DYOB 5MERA 3EYSL 1CG9B 4WFFE 2XZCH 3MJ6A 1HEZA 2DLEA 1GGUA 5I1DA 3LMJH 4ODSL 2YMXH 2GY5A 4RAVA 4ZAKA 3ARFC 3P77B 1BD2B 5ISZB 2PO6C 4C83A 2X10A 1Y18B 3RDTB 4K55A 5DDHA 1EGJH 3F7PC 4NQEE 1HNFA 5I71B 4KVCH 3TIDA 3SO3C 3LKQA 5DK0A 4JRYE 3MREA 1FGNL 3QIBD 4NC2B 1EZVY 4PREB 5TPWH 1NC4D 3P11L 3EOTL 3HPJA 3F5WA 4KRLB 2M1KA 3L3OB 3TYGH 5EIIB 1BZ7A 4WWID 3PUCA 2FJGB 1HIMH 5J6GB 5D2NA 3QFJD 4U1LB 1LP9F 1H15B 1FG9C 1ONQA 3RGVC 1I7TB 2H45A 4FZEL 3W5MA 2D2OA 3S34L 1ETZB 4LMQE 2BDNH 4LL9A 1VFMA 1J1PH 3V7MA 1NSNH 3WKNA 1OGTB 3T0VA 4H5SB 4JFHE 4MJ5A 3L3HA 2B5IC 3SO5A 3RIFF 1ZT4B 3SGDI 4ZSOE 4PJFA 2EIZA 2WUBL 3MLUH 4GJTB 3CZFB 4TRPH 1CICB 3C9NB 3CH1A 3E3QC 5IHZB 4S1RH 3E6HB 1F02I 3HZVB 5LQBH 1CGTA 1ZGLA 1NGYB 4YZFF 3OXRB 2IJ0C 2ZG3A 4M7ZB 3UDWC 2V2XA 4Z0XB 1PYWA 3T0ED 2EH8H 3EYVA 5HYSG 4PTUB 3HC0A 1D9KB 4NQDD 4LDOB 4ESKA 4B7LA 4OSUL 4LAJH 4TUOA 4QY8A 4NFDA 1T1WA 2XN9B 3P40A 3WKML 2VDOH 5D1XC 3QEUB 2R2HA 1DQDH 2Y06H 5DMIH 2Y25A 2VLJB 1EXUA 3OAYH 3QSKB 3X14A 5I9QB 1EMTL 1RZJH 3ROOA 1B9ZA 5BZDB 4ETYA 3UP1A 1L7TH 5LGHL 4X8JB 5E6IA 1FSKB 4LHUB 5DZLA 4LSSL 3LSOA 2IBZY 3RVUD 3LZFH 4R2GD 2ICCA 1S7XB 1MIML 3CVIH 2BVPA 4HH8A 1QFUH 5ANMB 4YHIB 5I73C 3B43A 1RJYA 2NY2B 3KPSD 3BZFA 3QIWA 2QR0B 2BVOA 2DBJA 3NAAL 3VGFA 3EJYD 1WJ3A 2QQLL 4YBQD 4LBEB 1I8KA 3VGAC 3V52H 3NTCL 3SQBA 4IRZL 5DA0B 4QGYA 4J3VA 4DUXA 1F58L 4HKBB 3O8XD 1E28B 3M17B 4HK3J 1D6EB 4UQ3A 4M6MH 5IHBA 4WFED 4XXCC 1S78D 3ZLQC 1J86A 4XCFL 1AC6A 4I0PB 3HG1D 1PSKL 1X9QA 5EH1A 1RJZB 4LVNC 3VDCA 1FNSH 5EBMA 3SGJC 2AJZB 2V6HA 5TF1L 5CSGA 2XWTB 4JZOB 2J7LA 3U83A 1BX2A 4KY1L 4KAQH 5C09E 1F13A 2E27H 1VPOH 5ECJE 5J0BA 3DYOA 4HS3B 1B4RA 5B38B 1YQVH 2VB5A 3O9WB 4ZOBA 3DYMA 3FB8B 3UZEA 3MOBL 4ZFFA 4LDEB 1RIHH 4P2RE 1FCGA 5GGRA 5B8CA 5ID0B 5K9JL 3AMKA 4KI1A 4G7VL 3ILQD 4KKAC 4W6WB 1UYWH 4CU6A 3KWWB 4NPYB 3C09C 3O0RL 4QRRB 4ZYKA 1UKSA 4ACPA 3R06B 1LD9A 4ZFGL 1ZMYA 4E42A 1H0DB 4BUGA 1C16A 5EDXA 5MHSD 3MGOA 3NPSB 2Q8AL 2YK1H 3U2SB 4L8DA 2MMXA 2XA8H 4YAQB 3PWVB 5B39G 1MSPA 2BERA 2FJFA 4O58L 1X6LA 4I8DA 4X7TA 3ULVL 2K7PA 3L3JA 3RI5K 4KXZH 5HI3D 1BBJA 4IDLA 5KG9B 2FZ3B 3BRGC 1BQHB 2W9DL 5IJVB 3RX7A 4U33A 3S3SA 5CHNB 5FUZL 3ARBB 1DLHA 3ZTJG 1EFXA 3ES6B 1DQJB 4AQOA 5J4MA 1HQ4A 5I1EL 3MRGB 4X6CE 1A4JA 4WUUA 3WFZA 2A1WH 2Y5TA 4JG1L 4PJEE 4XMLH 1KLUA 3BKJH 3Q0HA 5FYKH 1RUAL 1GRWA 3BSZL 2DF3A 3TFKC 5FGSA 1NC2A 1U8QA 3O6LL 4GG6A 4JFPB 2PXYA 2ARJQ 3ZYZA 1A6PA 3CCHA 5T1DL 1XGPA 4Q9BA 2VLME 5EOCL 1X4YA 4PJ5D 2VDKH 1F3DJ 3E1F1 2VDRH 5IQ7H 1FAKT 3QZWG 2AEQL 1KBGL 4ZFOA 4OZGF 1CD9B 1XGUB 1LNUA 3HLAA 4ZPTA 3AU1A 1FIGH 3LVEA 5DURD 2YR3A 3VW3H 3H8NA 1TETH 4G43A 5KTEL 2IPTL 2FHFA 4NKOA 3VFNA 1P7QA 3T3PE 3HCVA 5JIKA 1FZMA 4L29A 1E27B 4JG0L 2VL5B 2XTLA 5CUSH 1T21B 3FN0H 2ENSA 4D8PA 5C0BD 1F90L 4CW1B 2VDQL 4NQTA 1HILB 3DPBA 1OM3L 3REWB 1FH5H 4MWFA 5DJXB 1T04B 3ULUE 3BESR 4PJHE 4DCQA 2VITB 5SWSA 1X5KA 1KT2B 1CLCA 1HDMA 2CUIA 3QEQE 1GIGH 4HIHB 3KXFA 2D7OA 4OFPA 1LP9B 3V5KA 5I18H 4UTAL 2W9EH 2BVQB 1T4KA 3OAUH 4GRLA 4KHXL 3QUYB 1ZWIA 4RFEB 5HHQA 4HJ0C 4U1MA 4X7DC 5T1KA 4NZUH 3T04D 4CNIB 5JUEL 2OI9B 1KGCE 5D4QA 1HK6A 2E6QA 3FONA 4XBGA 3ZHLA 5JW4R 1HWHB 4QF1B 3HC3L 3QUKB 2NY6B 3RBGA 2VABA 1MHEB 4UINH 2UUDH 4MQ7B 3KNBB 4AMKL 3OMZA 2PYEA 1CXEA 1KJ2H 3NGBB 3EO0A 3RPIA 1P4LA 4QXGL 3OJMB 4HDIA 3RNQA 5I17B 1MJJB 1AGDB 1Q9WA 3SGKA 1A7RL 2JIXA 4K23L 4F58L 3QUXD 1G7IB 2IQ9L 3BJ91 4FZ8H 4LLYB 3MLYH 2JJSC 3WHXB 3BUYB 4JREB 2NY1C 1A6TB 4PJGB 2B4CC 1FNEA 5B3JF 1WCQA 4UNUA 5ID1A 1TZGH 3OKKB 5TDOA 2YN5A 5T3ZL 3FOLB 2EXWC 1IC4L 3MRRA 4W6YB 4M61B 5A16A 3V6OE 2OK0H 4XPBL 3VFVB 5KVFH 1W0VB 1DLFL 1MAJA 1VFBA 1U8PB 4OCYL 4ZFOL 1KPRA 1J18A 1BPVA 5I1GH 4KDWA 3NIDF 3QULA 4XPGH 1V3KA 1INQB 3CD4A 3MODL 3DMMC 4JM4H 3O11B 4JFEB 5EZLB 1VENA 1UEMA 1VGEH 4PY8I 2R1XB 3PWLA 1IC7H 1CFQB 2X4UB 3FCTA 2AJUL 2QEJA 3F7VB 4GQPH 1W72B 5DWUH 3ARWA 4NZRL 4G6FD 1PD6A 5DMGD 2XTJE 3GMMA 5SX4H 1DDHA 3TZVD 4K71B 4ELMB 4DKEH 5I30H 2HVJB 3KJ6L 3PP3H 3BP4A 4DWHA 3L3KB 4NQCE 3GK8H 1FFQA 3G5VA 3WFDL 5GXBB 5LVEA 3TH4T 5GGQL 1K5NA 2XXMB 43C9B 2HH0H 1S5IL 1NCBH 3HHRB 1KELH 1B0RB 3A67H 3O6MH 5IFHH 3IU4L 3KJ4C 3EO9H 4Z77A 2KUTA 4ODUB 4Z7WE 1KPUA 2NY3D 5IFAH 5E00A 1XR8B 4PJ9A 1J0KA 4M6OH 5H35A 3MUJA 4H8WH 4ERSL 5FAAA 3QI9D 1XH3B 1XIWA 2IWGA 1OGAB 4QXTA 4DN3H 1LO4L 5ILTL 2A73B 2FCBA 1QA9A 1KLGB 4K94L 4S2SB 3O6FA 4NCC1 1OF2A 3LV3A 3GIZH 5SWZA 4H8WC 4FXKA 3QNZB 5I76B 4PJAB 2P5EE 4PJFF 5J56B 4MJIE 5D1ZA 5F3BB 4QRTB 1ND0A 1YJDC 5F1IB 1ZTXL 5C7XL 3P0YH 2VDPH 2RFXB 3QT2A 2GJZA 2ADIA 5A1AA 5JHDD 1JYNA 3B5TA 5IG7B 4LPUA 5F7YC 4I18C 3MV7D 2XZCL 4Q97A 1JMXA 4YUEH 3LMJL 2YMXL 3ULVF 1QPXA 1KJMA 5DQ9A 1Z5LB 2WK2A 1UJ3C 3TBWA 5AYQA 2BOBA 2QQNH 3I2CL 1R5VB 1J1XH 1EGJL 1U9KA 2XXCB 5GSRA 1AD9A 5KSAD 3JZ7A 2WBJA 4KVCL 5C0GB 1A1MA 3GJFB 1EAPA 1G7JA 3SY0A 4G8FA 5TPWL 4ZUTA 2JJTA 3TYGL 1UM4H 5JZ7D 3JTTA 2EDTA 5DI8B 3TT3H 2AV1B 5CD3A 4HS8H 1UACH 1P6AB 3OGOE 1B2WL 2BDNL 3I6GA 2E5EA 1C5CH 1NANH 2D31A 2E6PA 1NSNL 2GTZA 1MY7A 4LGRB 5E2WH 4OF5A 4BKLA 1LEGA 1H3WM 3WIHA 3IDGA 3PGDB 3KDMA 4I5BB 3EJJX 1LK2A 5E5RB 3MLUL 2IALA 3IFPA 1JPTH 4TRPL 5MEQB 4BA8A 4S1RL 5LQBL 3H9HA 1X7QA 3EOBA 5CGTA 4ENEC 2Q76B 4XX1G 2DLHA 3KPQB 2BMKA 2HTKD 4R97C 3IAPA 1BZ9A 1W0WA 4NRYA 5C8JA 4PJ7A 3AAZA 2EH8L 4UUJA 3PL6C 5J3HC 4QCIB 3PIQB 5K9OB 3MFFA 4NBZB 3BIKA 2I26N 3FQRB 2ADFH 1AKJB 2Z93A 4OZIE 3NCJH 3H0TB 3GSQA 5F93C 3QAZB 4PJBE 2VDOL 3DVNA 4EIGB 5HVGB 3MRPA 1DBKH 3NIFE 5KW9H 1YY9C 1DQDL 2Y06L 2GUOB 3QDGE 4M9OA 5DMIL 3ZYOA 3BQUD 2ITDA 5J6HA 5I75B 2JCCA 3U9UB 3VFWA 1RZJL 5IMKB 3FFCD 4KKCC 1L7TL 5D93C 1GOGA 4XVSH 1OL0A 4MCYA 2WUCL 5I1KH 4OGYH 4XP5H 2B20A 3SGEI 5I16B 1QFOA 1FV1B 1CCZA 3PQYA 2DQJL 3TT1H 2P47B 3KPNA 5FOJA 2CO6B 4Y4HD 3CVIL 4WGWB 5GS1B 1QFUL 5JW5B 4JJHA 2VDMH 4RDQF 5FO7A 3VMNA 5I1LB 1MI5A 3V52L 1QLEH 1A14H 3H9SB 3P4NA 4NRXA 3VRIA 3LD8B 3WL9B 3W39A 3AREA 2R0WH 1NFDB 3MOAH 1UWEL 5HHPB 1FJ1B 3QEGH 4M6ML 2QKIA 4KK8D 3RX5A 1GOFA 3HKFA 1JZ6A 2FBOJ 3QG7H 4MJ6B 3QIBC 3V6ZB 3L9RB 3QDMD 2YA2A 2Y5EA 1FNSL 4JQVC 4GG6F 2AK4E 3QJFB 4Y5YA 4JZJB 3LS4H 4GAYB 4OF0A 5C0CB 4FABH 5IWLC 1JPFB 2OP4H 4J4PA 4KAQL 3V5DA 1VPOL 1OB1A 1U6AH 1X5HA 2AERT 2J88L 1YQVL 3EDKA 4XCEA 1TPXC 5EOTA 1QUNA 1N5AA 5CP7A 1RIHL 3MRKB 3P9WB 3HRZB 2UV3A 1U92B 4KUZH 2R29L 4MA7H 5HY9A 4P2YA 2A6IA 3G5ZA 1UYWL 2E3VA 3O41B 3WIHL 1CLYL 3QG6B 4Z7OF 2RAMA 4QOKE 1T03H 4DVRL 4OD1L 4NQVB 2WINA 3QPQD 3CPLB 4AIOA 4GMTH 2I9TA 1J88A 5AG8A 1PY4A 1HEZB 5GS2D 5DK3A 5I1DB 3OKNA 2FYYA 4MQTB 3WNNA 2XPGB 3LS5H 5FM5M 4ZAKB 3L1OH 5ERWB 5DTFA 5C0FB 5IMOB 4LSVH 4C83B 2YK1L 2I07B 1I7RA 2J4WH 4NKQB 2XA8L 3T0EC 1Z9OA 3TIDB 3IJSA 3QRFM 1WFTA 5DK0B 3MREB 3NCBB 4XAKE 4C56E 1MHPL 5ESQA 4KJQC 5EC2A 5MEND 5F7KC 4K9EH 4W6XB 4AT6A 3O4OC 2R2CA 2Z31D 3PNWA 4P4KB 1BZ7B 1BJ8A 1KJ2A 3FQWA 3I50H 1XEDA 2F54D 3KHQA 1D5BA 1H3XA 3VD3A 1CU4H 2AJXH 3LEVH 3ROLB 2FB4H 2A1WL 1BFVH 4EOWH 1BIIA 1QO3A 3BKJL 4XMLL 5FYKL 5IW6A 1GXEA 4UNVA 1IC1A 2X1OA 3NBNA 1PQZA 2P7TA 4FQJH 2DM4A 4RMRA 3VH8A 3RVUC 3SN6N 1EERB 4L8BA 4P2OD 2MQ0A 3L3HB 3WFHB 4L4TB 4NN6C 1Y0LA 2VSDA 2DJSA 4LCWE 4PP1D 3VXMD 1WC7A 2EIZB 4PJFB 4ORZC 5FF6A 1KYOK 2XFXB 2LFGA 3VMOA 2VDRL 3EJYC 4YBQC 5IQ7L 4Y1AA 1QNZH 4KQ4H 4RGNE 5CBAB 3TJEH 3I9GH 3VXUA 5IM7A 1V7NH 5SX5K 1Y6KR 2V2XB 1PYWB 3EYVB 1KIPB 5TGBB 1FIGL 3O8XC 4YEFA 3VW3L 4TUOB 1BFOA 4QY8B 5FCUH 1DBAH 2Z92B 3U0TA 1XF2B 1TETL 1S78C 1OAYL 4X4MA 3V6BR 4P9MH 5L8JB 5MEOA 5LCVH 2EE9A 3AUVA 4M4PA 1S9KC 4PJIB 1AGFB 1I7ZB 2P8PA 2V9QA 5CUSL 5DJ2A 1G9NC 1VKXA 1UWXH 3FN0L 3O45B 4NN5B 5T1LD 4OLYH 4FXGB 1F2QA 2GJ6D 1FH5L 3C5ZD 3ULUH 4HJJH 2VXUH 2XIDA 3LSOB 2NXZB 3ILQC 1P7KB 2NX5D 1A7PH 4J6RH 1FNGA 2BVPB 1EA9C 2HFFA 4G6KH 4MXQD 3QIWB 5D7LA 5I18L 3RL1B 1OP3H 2W9EL 3ZT6A 3A6OA 2VLRE 3CIQA 3OAUL 4L4VE 4GKSA 3MV9A 4NZUL 2E9JA 5E4EB 5C0IA 2J8OA 2P49B 5JPMB 3I02B 1G6VK 4MB3A 1CS6A 4P2QD 1ED3A 4ZO6A 4ORGB 3O3BA 4UQ3B 3RL2B 4WGVB 4UINL 2I25N 1NMCC 3JXAA 4R96A 3K8MA 5HI3C 4N0UE 4I0CC 2BJML 2CIIB 1KJ2L 5EBMB 5DRZA 1FVEA 1YZZA 3DBXA 1PDKA 4S0TD 5DC9B 5EU7E 5F9OH 2LTQC 3RWEA 3PV6B 1OTUD 4TTDD 3S36X 4EI5D 3OKOB 4OUUB 1N7MH 4FZ8L 4ZFFB 3MLYL 2KH2B 5B8CB 5GGRB 5IROA 3CDYA 5HGDA 3EAKA 3MRHA 2DQIH 5EUKA 1TZGL 3F12B 4OAWA 2C7UB 4NQSA 4KJWC 4ZYKB 4Y16D 4WENB 4NQEA 1LD9B 3VFUA 2OK0L 2ZUUA 3EKCA 5KVFL 4UT7H 5E08H 2H9GA 3JWOH 1IGYB 3D39B 4JRYA 4N1CA 3GEWB 3CVHH 5I1GL 3MGOB 4X6BA 4XPGL 1SVZA 4KRNA 2X1PA 1RUML 5CEYA 4UAOB 1P9MC 4JM4L 1YEDB 1Q9OA 1VGEL 2WMPA 1IC7L 1E6OH 2FLBT 4LFHD 5DWUL 1DN0A 3MNZA 5CEZD 1BBJB 5BS0E 2P45B 2QSVA 3MYZA 2WWKO 4U31A 3MFGB 3KYOA 1FDLH 3T4AB 4DKEL 3BPLC 5I30L 3VI3F 2F8VA 1EFXB 1EEZA 1NBZA 3U0WH 1J8KA 3GK8L 4HIEA 3S36L 3H2WA 1S9VA 4KZEL 1JYVA 1IEAA 4HWBH 1KLUB 1QFWM 4ZSOA 1CVRA 1NCBL 5JOFA 1KELL 2WIIA 3A67L 1U8QB 3G6DH 2FECL 3O6ML 5IFHL 1YEEH 2Z35B 2PXYB 3ARGD 3EO9L 1JWUB 3ELAT 3CCHB 1JZ7A 1X5LA 1T20A 2YN3A 5IFAL 4I4WB 4KI5D 3PE9A 4FMFA 4M6OL 2IH1A 4HULB 2V7HB 4H8WL 4XB7A 3ULSA 3K1KC 1G6RH 2CK0L 4DN3L 2OLDA 2P48B 3LRHA 4C4KT 4RMVA 3GIZL 3VXOA 2R0ZH 1Q9LA 2VQTA 1KFAH 2XQBH 4NC0B 1U3HD 1U8MA 3P0YL 4YDKH 1JF1A 2VDPL 1I4FB 5D7IB 4NGHH 5DHVH 3BYYA 1CDYA 1MCSA 1JPST 3HCVB 4IS6B 1FZMB 4RQQB 4RWYH 3P30L 4L29B 2YPLD 4PJ7F 5HYJD 3UZVB 4D8PB 5FHAH 5CKAA 2EE2A 3QUXC 4YUEL 4MWFB 3D85A 3M1BA 3RKPA 4NIKB 3MRDA 4DCQB 2W60B 4L9DA 5TFSH 1FE8H 5CFHA 1CI5A 5SWSB 5HHOD 1AGCA 1KTLB 2QQNL 4XNMA 1J1XL 5GS0L 4D9QD 1ZVYA 1WISA 4RGMB 3TVMA 2EIDA 5D2LE 5JDJA 2JCCF 4HT1H 1T4KB 1ZWIB 2XG5A 3DO7B 3ZDYF 2CLZA 3HE6D 1ZS8B 2J6EH 5FYJD 5CLWA 3H3PH 4CJ0A 1UM4L 4XAWH 1NEZA 3S96A 3BZEA 4YDJB 3TT3L 1ZLSH 2ED8A 4IRSB 4HS8L 5EN2B 3QYCA 2OJEA 5C09A 4IRJA 3VRJB 4L8SA 1UACL 3HFML 3T3MF 2PYEB 5DMGC 5E2VH 1QLFA 3C60D 1REIA 2DLGA 3EO0B 5E2WL 3RPIB 3TZVC 1E4XL 4P2RA 4EDWH 1D7FA 3RNQB 4HDIB 1U8IB 2E8YA 1HOCA 1EIBA 3BGAA 4K3GA 5DRWA 5EU4B 1EEQA 1JPTL 3MBXH 3OPZH 3OQ3B 4P9HC 5HYEA 5KN5A 3H9ZA 4PRDA 4PG2C 5JO5B 5ID1B 4WHCA 3LN5B 5TDOB 1C12A 2NY3C 1CD0A 1KCUL 1HI6B 3MRRB 5A16B 1QSFB 4ZNEE 4XBEL 3NCJL 1Q94A 1YN6B 1BHGA 1JNNH 1KPRB 3QI9C 2HVKA 5DT1H 7CGTA 5KW9L 3QBTB 5CIPB 3UTTE 1IBGL 2VZ3A 4DUWA 1QSEE 2AXFB 3Q2CA 5C0AD 4O51B 4WW2A 2X4OA 4M93C 1GZQA 2MPAH 4HXAH 3GSNB 4XCNB 2EEAA 5KOVC 2ZOLB 4PY7B 1B3JA 4CVXA 4X6CA 4YDVA 1LO3H 4YE4H 3GMMB 4PJEA 4F15B 3O3EA 4OGYL 4KROB 4HQQH 2HA1A 2EH7H 4XP5L 3TT1L 4WWKD 3I84A 5C0RH 3VFMB 5L2KE 2DKMA 5AYUH 3GB7B 3LN4B 4GO6B 3G5VB 4QRPD 4FQCL 4LKCA 2YBRB 1FYHB 2VDML 2OBGA 2DWEB 4M8VA 4LLWB 3D0VA 1A14L 2K9UA 4UIKH 2FGWH 1ACYH 1YPZB 5GRWA 2DN7A 4UT9H 2R0WL 1CXKA 2DYPA 3MOAL 4M03A 5KSAC 5FKAA 4U6YB 3CSYB 1SEQH 3QEGL 5E00B 3UYPA 3BP5A 5H35B 4NNPH 4JRXE 3QG7L 3UPRA 4OFKA 2JF1A 3LQMA 4QXTB 5FM5O 1QA9B 2AVGA 5JZ7C 3HI1A 3O6FB 1MCNA 1OF2B 3LS4L 2N7BA 3LV3B 2BNRD 5B4MD 2HJLA 5SWZB 5BV7H 3GIVA 4FABL 3BD5A 2OP4L 2OX5A 1U6AL 2XNAB 1G0YR 5F6HJ 2AJSL 1DEEA 4QHLA 1X3DA 4ZXBB 1NBQA 4PGDA 4KUZL 1EJOH 4MA7L 1JYWA 4DEPC 4PJHA 5C86A 1T03L 1FPTH 5EC1B 4GMTL 3TBVB 1TITA 4KFZC 3VXSD 3QEQA 4F37K 4QRUB 4YR6A 1BMGA 4IIQC 3SJVD 4KGJA 4HIXH 4JLRA 4CMMA 3PWPE 3LS5L 3L1OL 3TBWB 1H3GA 4LSVL 2BOBB 3BN9D 4GRMA 1I1FA 2HTKC 3ARUA 3EDEA 4MQXD 4XP1H 2FR4B 4LSDA 5GSRB 4LLMA 1AD9B 2J4WL 4EN3D 2WBJB 3ORJA 5DVNA 5A2IH 1EAPB 3SPVB 3N0PB 4G8FB 5DQJB 4RRPA 4K9EL 3WJJC 4MNQD 2D03H 5FUOH 1HH6A 3I50L 3MV8E 1LEKB 3BQUC 3GMRB 2CIKB 1CU4L 5CD3B 5IP4A 4OIAA 2AJXL 3LEVL 4WFHE 2FB4L 2I5YH 3K8LA 1DVFB 1BFVL 3VFSA 1X6NA 4EOWL 3WDJA 3DXAE 1CDIA 1KEGH 4ODXA 4HAFA 1WBZA 4GW5A 4KKLD 4ZTPH 4XNXH 1SYSA 2ED7A 3I6GB 1IARB 4Y2OA 4R7DA 4FQJL 1LEGB 1NAKH 1IQDA 3W0WD 3WUWA 4HV8B 3X17A 4Y4HC 2NNAB 1LK2B 1KYOJ 1T7WA 3IGAA 3TCXA 4DAGH 3IFPB 5FUCE 1CDCA 4ZUWA 4HPYH 2XZQH 1QNZL 4KQ4L 1X7QB 3EOBB 3RWFA 3TJEL 3I9GL 4MNGB 1HXMA 1GOHA 1RHHA 3FOMA 1V7NL 3GFUA 3UTZB 3CVHA 1PW3A 4G9FE 1DQQB 4NRYB 1BZ9B 1LVEA 5C8JB 4NCDA 3DUSB 4DQOH 5EBWA 4PP2A 4PRAB 5FCUL 1OAUH 1DBAL 5KZCD 4LVHC 4KK8C 4DUVA 4BSWB 4P9ML 2DWDB 5LCVL 1VA9A 5D8JH 3K3QA 4HPOL 3DVNB 4KDTC 2FEEI 1KB5H 5IJKA 4OZFG 3AY4C 4WJ5B 3QFJE 3MRMA 3DHMA 5J6HB 4YXKH 4OLYL 1S7WA 5JMRA 3VFWB 2P43B 1FN4B 1T0NB 4NQCA 3WO3B 3WLBB 4HWBA 4PJXB 1QLRA 4KQ3H 3ULUL 4HJJL 3N1QC 1K85A 1A7PL 2PR4L 2FGZA 5DJ8A 1FL5A 4G6KL 1WBXA 1V5JA 3TA3D 3QXUA 2EIEA 3VDAA 3D1MC 4JZNB 4AIZA 4Z7WA 4XXDA 3U6RB 5GGVH 3IFNH 4LHUD 2JK5A 1LMKA 2LE9A 4HG4K 1II4E 4PLJD 5AD0A 2XYCA 1G6RA 2YXFA 3CX2A 3AREB 5ISZE 3N50A 4PBXA 1DCLA 1PVHA 2QKIB 1F11A 4X80H 3RHWK 4XNYH 2P5EA 5FIEA 5HYQB 2X5PA 4Y19D 4ZUUA 2G5RA 1PGRB 5JNYA 2Z31C 3MNVB 3JTSA 2XG4A 4Y5YB 3EO1B 2Q3AA 5F9OL 3W81A 3SBWC 1K3ZA 3OJ2C 2FO4A 5IF0A 4GW1A 2VXQH 1NUNB 2E7BA 3KPTA 4XCEB 5EOTB 2K7QA 2XRAH 2AV7A 4R0LC 5EULV 4MD5B 3QWRD 1JMZA 4TUKH 5EO1B 3T1FA 4YXHH 2DQIL 3MBEB 1YMHA 3SGDH 2WINB 2EDYA 3RI5F 3O2DH 4PP1C 4BK5A 1XGTA 3O4LE 4XWOD 5J89A 4H1LA 5DMKB 1S7TA 3OKNB 3SCMA 2F53D 4UT7L 2FYYB 4ZS7L 3FRUB 5E08L 3B3IA 2DOCA 3JWOL 1LO5B 1UZ8A 5AAMA 4NSKB 3CVHL 1T5WB 5DTFB 2J6EA 2YD7A 5GRZA 5FGBA 2DDQH 1CD1B 3NZ8A 1KCRH 3HZYB 2HRPH 5L6YH 4U1GB 1E6OL 4BH8B 1YUHA 5EC2B 1MCEA 1N4XH 4AT6B 4ETQA 2B39A 2A9NH 2XN9E 4RMWA 2K3TA 3GMPA 1FDLL 3FQWB 1X5AA 3K4AA 4L3EB 2YOCA 4HZAA 1A9BA 5ICXA 4V1DD 1XMWA 1BIIB 4HWBL 1IAKA 4P23B 4N0FA 1JCKA 3OGCA 3C5ZC 3MA7B 1PQZB 3MA9L 5GGSB 3G6DL 4MA1B 4Y4FA 5EU3B 4ZUSB 3VH8B 1YEEL 1AO7D 1BVLA 5JOEA 3LOWA 5MI0C 5DD0L 2VXSH 4F7MA 1MFNA 1WC7B 2CKBH 2VC2H 4MXQC 5FF6B 1FYTB 4RCAA 5ANME 1XGRA 2R0KH 1MAKA 4HJGA 1U95B 3WSQH 4ISVA 1G6RL 1AP2B 4R6UA 3VXUB 4OZIA 5LBSH 4H0GA 1C5DB 5KS9A 1K4CA 4PJBA 1CLOH 1NKOA 2R0ZL 3NCMA 2VRAA 5I6XB 4U1SA 4Y5XC 1BFOB 3X13A 3EYOA 1I9JH 3U0TB 2XZZA 4OKVA 2XQBL 2DBLH 2FSEB 5MEOB 4GBXA 1MJ8H 4YDKL 5DFTA 4NGHL 1U3ZA 2ESVE 1CTNA 2PYFA 2APXA 3K2UH 1YMME 2DQHH 3B5GA 3FQXA 1PZ5A 4TTDC 5FHAL 2GK0A 1JN6A 2Y07H 3SDXB 1FZKA 4EI5C 3MRFA 3KLHD 2EE6A 4PGCA 5H94B 5F7NC 5E5UB 5TFSL 1FE8L 4PUBH 3V4UH 1DZBA 4YHNB 3ALWA 3MRLB 3T8XA 2DM2A 3HAEA 1MCFA 4HZLB 1KTKE 4WW2F 1QVOA 4HT1L 1UJTA 4Y16C 5C9JA 1NFKA 3ALPA 4MAYB 4X6CF 5SV4A 3K1DA 2J6EL 4PJEF 2J2ZA 1BWMA 3I85A 2AEIT 1GZPA 4QWWD 4XAWL 4PRPD 4WO4A 5E94A 4H25B 1ED3B 3B9AA 4HUUA 3DX8B 1ZLSL 3MJ8A 2AK4A 4G80B 5C07B 2ZJSH 3OL2A 1TQCB 4GS7B 5FK9A 4HX1A 2ORBH 5E2VL 5DRZB 1XZ0B 1FVEB 2ZUVA 3TO4D 3LH2H 1IE5A 3IAQA 3RWEB 1FORH 1E4KC 3UTPD 1MAMH 3LDBB 4MX7A 5KVEH 5BVPL 5GQBA 4EVNA 4A2LA 3BPCB 1X5XA 4JO3H 4QOKA 2R9HD 5T5FH 5F1NA 5LJYH 3MBXL 2QL1A 3R8BB 1ZEAH 3TBYB 3MCLH 2DKSA 5HGDB 4F7TA 4ELKB 4IJ3C 3MRHB 5GRJH 4LGPB 1AQKH 3T3PF 3M8OH 4DGVH 3ARGC 2ZSWB 4OAWB 4NQSB 2EICA 5D6DC 4NQEB 3VFUB 4JY6B 4KI5C 2QADC 3QCUL 4MDJB 5DRXB 2B7DT 3CAFA 1F6AB 4KKBD 1JNNL 1A1NA 4C56A 4HS6A 4X6BB 5DT1L 2GAZA 1PEZA 3ARSA 4DN4H 2JJWA 5DK2A 3GMOB 1DSFH 4LNVA 1OWWA 4PR5B 1GPOH 1QR4A 3OHXA 3S9DB 1U41A 5IB3B 3TESA 2MPAL 4HXAL 3OX8A 5ICYA 5CLTA 1HSAB 1DN0B 1LO3L 1R3JB 1U3HC 4FMKA 3F6LA 1XCQA 4P4RA 4Y5VA 4YE4L 35C8L 4HQQL 2EH7L 3MXWH 4NQUA 4S1DD 2W65A 4X5WB 5C0RL 5AYUL 1RZGB 3BMWA 4QYOB 1YNTA 2A9MH 2H32H 3AVEA 3X11A 3DUUA 4G8GB 4CU7A 3VE0B 4LCWA 3FT3B 3UTSD 4ZSOB 1L9MA 4X4XB 5EZIH 3OR7A 1B0GB 4P46A 4E41D 4UIKL 2FGWL 5I15H 1ACYL 4KMLB 4UT9L 2AGJH 4R4ND 5DUPL 1PX4A 2Z9TA 5FYJH 1SEQL 2NY7H 1LP9E 4WNQB 4LPXA 2IH1B 4NNPL 1K2DB 4TSAL 1A6ZA 3HE6C 5IV2B 3EDFA 3U7YH 4G8EA 4M5YL 5GSVB 5EO9B 3E8UH 2UZXB 4M7JH 3CLFH 5BV7L 4Z7VB 1IAMA 2V2WA 4ONGH 5IW3A 1Q9LB 5A40E 2A83B 5GRVK 2P5WB 1DL7L 1U8MB 5D9SB 1JF1B 1BF8A 4U3XA 1EJOL 1KIQA 1I1AA 3C60C 5J12C 1MCQA 1ZV5A 3FHAA 1G7QA 3VXNA 1SMAA 2WM0A 3RRQA 3OXSA 3GI8H 4HIXL 3GSOA 4BFIA 4BUHA 3CXDH 3P4LA 1A1OA 4IEFB 4Z5RA 2VLRA 4L4VA 1YNLH 3L7FA 3MGTA 1SHMA 3DIFB 1NJ9A 3SKJH 4Y4KD 4XP1L 4P2CG 4PJGE 3K4ZA 1R24B 3TVMB 4Z78A 5IVOA 1QEWA 5FV2A 1P4IH 2CLZB 3QIUA 4APQA 3RZCD 4M1DH 2D03L 3WNMA 5FUOL 4N0UA 2ATPB 1A6AA 1CL7I 1RZ8A 5F7HA 1UM6H 3V0WH 2I5YL 4JFEE 4Z7WF 1KEGL 2IAMD 3KPLA 4ZTPL 3VXQA 4XNXL 1NCUA 4EKXA 3FMGH 2FH8A 4P2RB 4DK3A 1KCSH 4X6FA 3GMNA 4XX1E 4WWKC 2FATH 1UH2A 3FTGA 4ELME 1M71B 4MS8D 4UOW0 4DAGL 5E0QA 3O2DA 4RISH 4HPYL 4MMZC 3MROA 4NZDA 5KN5B 43CAB 4EUPH 3MMEA 3WFEH 3KS0J 1VEOA 1G1YA 5FB8A 2GI7A 1J8HE 4DQOL 2X70A 3UEZA 5HGHA 1G7LB 2R2EA 1FC2D 1OAUL 3S5LA 4FQPA 2YD1A 5DVLA 4A6YA 2JJUA 4HSQA 5D8JL 3UX9B 2AEWA 3PF2A 3MLTB 1WV7T 1TVDA 3VWJA 2NPLX 5ITBH 1KB5L 1A2YA 3O3DA 4QRSA 5KVGH 5IKCB 1MY5A 1OGAE 3N85H 5IMMA 5BS0A 2PW2B 4YXKL 3WJLC 3DGCR 3LQAC 1NH6A 4PJAE 1IL1A 5C08B 2V2TB 2YKLH 3CSPA 4OUOA 4LU5H 2CUHA 4PJEB 3QXDA 4JDZA 2Y6SD 4WDIB 5JIHA 1JNHA 2O5YH 2HFEA 5BO1H 3HPLA 3RWIA 4EZMA 4UQ2B 1UFUA 4DVBA 4LKCB 1K8IA 4PJ8B 4PRID 2NCMA 3DGGA 4IHOA 4HG4J 5GGVL 4FFYH 3IFNL 5I8OH 5E1AB 3MTRA 4OI9A 4MGXA 3HZKA 2MNUA 1U3JA 4JFFE 5IOPB 3BN9C 1SEBB 1MLBB 3V6FA 4MQXC 4LCYA 4QNPE 4X8XA 1JTOA 4EN3C 4DGIH 3MUGB 4Y2DA 1GGIH 4X80L 3BP5B 2AXJA 3MJ9H 2Y23A 2J8HA 4XNYL 1ES0B 3UPRB 5JOPE 3SDDA 4JFDD 1G7HA 3CFJB 3J8F7 3RDTC 3BZDA 3HI1B 3ZDZE 2HJLB 1UC6A 5I71C 4DZ8A 2OQJB 5F1KC 2VXQL 4NJAL 3B2VH 2H2PD 4B5EA 3S35X 1MPAH 1DEEB 4JCMA 4QHLB 2XRAL 4KKLC 3UJJH 2OYPA 4IOIB 4OZIF 4X5LA 2IADA 1FL3A 4U3CA 5KS9F 4ONHB 4TUKL 3NCFB 3OG4B 3SDYH 4PJBF 5C0CD 5IVXB 4YXHL 4R7NB 3AMLA 4FTVB 3ECBA 4NP4H 3E2HB 1MQ8A 3NIFF 5L7XH 4L8CA 1BLNA 1D5ZB 2C3GA 3O2DL 4WV1C 2X89A 1U8LA 5CSBA 4YR6B 1RMFL 5KAQG 4GLRI 4OBSA 1CE6A 5D2LA 2YS4A 4NWTL 1NBYA 5I66A 2DDQL 2APFA 3PGCB 4GRMB 1I1FB 3TBTA 1QQDB 1I1YB 1INDH 1KCRL 3T4YB 2XQYG 4YIQA 2HRPL 4U0RB 4W68A 5L6YL 3SHSA 3NFNA 1OVZA 4PRNA 4FP8H 1YEKH 2DICA 1XT5A 3VG9C 4ZAKD 3C8HA 2EDQA 4ZOEA 2ITCB 1N4XL 1WGOA 4JB9H 5JHLH 4RZCA 4M7ZC 1C7SA 3EGSA 2A9NL 2X4RA 4R9HA 4O2CA 1NUGA 3MRQA 4HHAB 3QUZA 3GBNH 3BEVB 3Q5YA 3VFSB 1UB5B 2G5BA 1EDQA 3I6LD 4ODXB 1JZ8A 1L0YA 1SYSB 4GAGH 3SGEH 4JN1H 2DJ4A 4LIQE 4J3SA 3WUWB 3V0VA 1W0YT 2DQFA 2VXSL 2X4QB 2CKBL 3TA3C 4MAUH 3D2UA 5C6PB 4D0DA 1KC5H 2R0KL 5I8CA 4TNVK 3WSQL 2G2RA 4N5ED 1FSKC 1HXMB 1QSVA 4HLZH 4PLJC 4ZNEA 3FOMB 5LBSL 4WI5A 2ZNXA 3H9SE 3BRDA 1CLOL 5HGAB 2X7LB 4PP2B 3UTTA 2AKRA 1NFDE 3LQZA 1QSEA 1I9JL 3ZKSD 4JQIH 2VZTA 5E9DB 2DBLL 5D6CA 1R3HA 1MJ8L 4FQHA 3A0OA 1HYRC 1MELA 3K2UL 2FDBP 2DQHL 1ZLWK 2D7PA 1AXTH 2ZWLT 1CQKA 1S7WB 1CDGA 2H32A 1S8DB 2Y07L 5F9AC 5L2KA 3SKMB 1JZ4A 1WT5C 3WS3A 5JXEA 3GMLA 3ULVD 2ICWJ 2Z4QA 4PUBL 3V4UL 2HFGH 5F3HB 4M02A 4JM2B 1FL5B 4U4BA 3L7EB 3D3VB 2IANB 4AIZB 4XWOC 1H3TA 3HUJE 1GHFH 4XMPH 4XXDB 1P2CA 5E6ID 2NXYB 2EDHA 3MRJA 2DJUA 4JRXA 5A3ID 4HWEH 5IFJA 1QBMH 1IAIH 3HE7A 1N59A 5LXGH 3QIWD 5DQDH 4F7EA 4Z8FH 3ZZ1A 1BVZA 2E8ZA 2ZJSL 4QRQA 4ALAH 3CDGB 2P5EB 2WZPD 4FQQB 4HKXA 4ZUUB 5DHYB 4OQ1A 3NPSC 3BWUC 3UTQA 1KCKA 3U4BH 3LH2L 3LRSA 4S0SD 2HTLD 3KLAB 1FORL 4W81A 1MAML 5KVEL 4XPHL 4LRIC 5L0QB 2Y72A 3UMTA 3NMEA 2GJ6E 1I85A 5T5FL 4DZBA 4X6EB 4ZODA 4XGZB 4NO0B 2PW1A 1T83A 1ZEAL 1VFAB 2AV7B 1MFCH 3MCLL 1XAUA 1I3RA 4JFOA 3IU3A 2ZCHH 3PWPA 5J9PA 2DMCA 5GRJL 4AH2B 1AQKL 3ARDA 3M8OL 4K7PH 4DGVL 1HHJB 1EHAA 1VACA 4HK0B 4HGMA 4QHKJ 4L4TE 1M7IA 3K2MC 5CZXD 1F8TH 4H1LB 4OT1H 4BYHA 3MC0A 5KVMC 4OF3A 3B3IB 5DZNA 2R1YB 1UZ8B 3AS0A 2OL3B 1I9RH 3BGMB 3ILPA 4D0CA 4HUMB 3T1WA 1A7NH 4DN4L 1IGML 1DSFL 3HI6H 1GPOL 3JVGC 4JFXA 1XF4A 5EZOH 4LCCA 5IBTH 4GT7A 4BH7A 1BJ1H 3MV8A 1WF5A 4WHTB 3U82B 2ZG2A 3F7QA 1T3FA 3DXAA 2D0GA 3IFOB 4RNRA 4LGSB 3MXWL 2X9YA 2LVCA 4KTDL 4PJIE 4YFDB 3PWJB 3C2AH 3BIAX 2BY3A 1IAKB 3FO1A 1E4XI 4N0FB 3U7WH 3NFPA 5EZIL 3KLHC 1EAJA 3IJHA 3MACH 1RFDH 4EUPA 4M8QB 5LKNA 4U1KA 3CFCH 5I15L 2DIAA 1QBLH 2V17H 4NO3B 2AGJL 4POUB 4WUUD 4F7MB 5IEKA 1TCRA 4G9FA 4X99B 3G9AB 4AQ1B 5DD6B 2NY5H 1XGRB 3SKNB 1P1ZB 2NY7L 5CJ5A 5JQ6H 2DQGH 2XACC 3IS0X 1NC2D 3W82A 4HWUA 3U7YL 5AEAA 2UVEA 5KS9B 2NY5C 3E8UL 1MHCA 4QWWC 1DANT 3CLFL 3B9EA 3RVTD 4RIRA 4ONGL 4AEHH 5T3ZD 4U1SB 1NCTA 1M7DB 3QFJA 3RY6C 2C1OB 3BRFA 1JNJA 1YNKH 2NLJA 4KMQA 3HNSH 4Z6AT 2YEZA 5TE4H 2BP3A 1TVHB 3TO4C 2HN7B 3SE8H 4N8VA 3GKWH 3MUHL 3GI8L 3IDNA 6FABH 5JIPA 1FZKB 2YD9A 2R9HC 3MRFB 1X5YA 5DJAB 4NO5A 5DYOA 4PGCB 1CG9A 3CXDL 5LG1A 1P7QD 1YNLL 3ARFB 3SKJL 3HAEB 3U0PB 2PO6B 4TOYH 3P77A 1RURH 5ISZA 1Y18A 4U6VH 5EUOB 5GHWH 1U8KB 3MJ9A 1NGPH 3BGFC 3FT2A 2HT2D 3EBAA 4OCLC 4KKBC 1KSRA 2XZAH 4M1DL 1GZPB 2AS5M 2F5BL 3D39E 5E8EB 4WO4B 1PKQE 3KXFD 4PREA 2VN4A 3PGFH 4OI7A 1UM6L 4QTHB 4GRLD 3V0WL 3L3OA 5T1KD 4HFWB 1MNUH 5EIIA 2FJGA 5J6GA 2EDFA 4ZD3H 3UXFA 5F7FA 4U1LA 4NUJA 1H15A 5BZWB 3CMGA 3FMGL 4M1CD 4S1DC 1KCSL 1I7TA 1W72H 3O3AB 1WWWX 4YXLH 5E6YA 1ETZA 2FATL 4MX7B 2B5IB 4YGAB 3S7GA 4FQXA 4QOKB 3L95A 4RISL 5F1NB 1OGTA 4H5SA 2XWBB 2PYED 3O4LA 3WFEL 1A7OL 1ZT4A 1NCAH 5FA4B 4I9WE 4CJ1A 2E7HA 3HNTH 4M6AA 1MCJA 3CZFA 2W1NA 5HDLA 1KF9B 4PGEB 4JQXA 5IHZA 3E6HA 1K3IA 2JIXD 3AXLB 4R4NC 1NMBH 3S4SB 4WY7L 4HFUH 4EDXA 2FBJH 4PTUA 4C56B 1D9KA 3QWOA 5I8EA 1J0IA 5ITBL 5KVGL 2NZIA 4RMUA 1F4HA 3N85L 4K7PY 3OHXB 5DF0A 2XN9A 4HXBH 3G5YA 3QXWA 5ICYB 2VUOA 5D2LF 1TXKA 2YKLL 1DQTA 2CPCA 3R1GH 4LU5L 5GIRA 4R90L 1L7IH 3MV01 5T1MB 4JVUA 4PS4H 2W65B 5D7IE 3T2QA 2Q87A 4M7LH 4MD4B 1CYGA 4X9HA 5BO1L 2BSRA 4X8JA 3X11B 3SKOA 5I73B 3QDJD 4FOMA 1MCKA 3D48R 1DFBH 3OR7B 4J7RA 3DV4B 5ANMA 2OR8A 4YHIA 5I8OL 3CDCA 3UBXG 3ZMRA 3LKOB 2QR0A 4X6DF 3WS6A 2N7AA 4LBEA 4Y4KC 2HLFD 3GSXB 1NUDA 4DGIL 5CWSA 5DJYA 3TPUA 2DI7A 1GGIL 2BXYA 4KV5E 2EYSB 1H3UA 3MJ9L 5SV3A 1WK0A 2HMID 2E7CA 4HKBA 1LO0H 4YWGH 1JGEB 3M17A 3GJFH 3RZCC 3QO0B 1D6EA 4LVNB 5TJWK 4F37F 1BEYH 4RGOL 1UQSB 4I0PA 2ESVA 1RJZA 4YHKH 4PJ9D 1U2CA 4G5ZH 1YMMA 2AJZA 4XP6H 1XIWD 1MPAL 2XWTA 2IAMC 4JZOA 3UJJL 1VESA 1KIQB 4I2XB 5DGQA 5BJTB 5B38A 5SWZD 2VTFA 1F42A 3SDYL 3VXNB 4HUXA 5BOPA 1SVCP 3IETB 5L7XL 5D1ZD 5ID0A 3C09B 3UTOA 2KBGA 1NLDH 4MS8C 4LHJB 4K3DH 4A2MA 3GSOB 4BFGA 3KWWA 4NPYA 3EYQD 4Z5RB 3L7FB 3K0WA 3MGTB 5EWIL 3VGGA 1NJ9B 3R06A 1ZA3B 2XV6B 4K7FB 4OLWH 1INDL 1CIUA 4Z78B 4XPAH 1H0DA 5C6WH 4L9LC 4NT6B 1QEWB 1VCAA 4FP8L 1YEKL 2R4SL 2EDOA 3U2SA 1QSFE 5JHLL 1ZLVK 4JB9L 4APQB 4YAQA 3PWVA 4HC1A 1T7ZA 5BVJB 5FKPB 4PV8B 2R1WB 2F5AH 2X2YA 2OTUA 3EOTH 5KG9A 4JJ5B 5TQ0H 3S4SG 4J3OC 3GBNL 5F7WC 2KL6A 5CHNA 3KPLB 3ARBA 3VXQB 3ES6A 1DQJA 1RUPH 1AXIB 2YZ1A 3MRGA 1N6VA 3BIBX 4CKVX 4JN1L 1UWGH 4LLVB 2Y6SC 1JV5B 3GMNB 5C71A 1A21A 4LIQH 5F89B 3FTGB 3GDBA 4MAUL 5BRZD 1KC5L 5L2JA 3U30C 2CRZA 3MMEB 5HDOA 2W07A 2EEBA 5FO8B 4PJDE 4DFHA 2DKUA 4CGTA 5KJRH 4O02H 4YFEA 2A74A 3RY5A 2X70B 4Q9RL 1YPZE 3HR6A 1TDQA 4J23A 4Q2ZB 5HGHB 3MCG1 5CP3H 2F74B 1XGUA 4I13B 3U7AA 4JQIL 1G7PB 3WIFB 4A6YB 1O0VA 4LLDA 3FQNB 2Z8RA 2LAAA 3HZMA 4AEFA 2QV2A 4ZO7A 3LD8C 4QRSB 4X9IA 5HHME 4HIJA 1KTDB 2QHRH 4PRHD 2N4IA 4OGAD 5ETUA 1S9YB 1AXTL 2W9LA 3B6SA 4MHHI 4HGKC 2H2PC 4IMKC 1E27A 2HP4A 5BQ7B 2VL5A 1JZ5A 5AAWA 2EKSB 2HFGL 4JDZB 4CW1A 1EMTH 3RWGB 2HFEB 1F4YH 3REWA 5DJXA 3HC4L 1T04A 4K7PX 3RHWF 4POYA 3RWIB 4PLKD 2VITA 2P8LB 1K8IB 5GGUB 5FYKD 1GHFL 4XMPL 3HRPA 1UENA 2KPNA 1HN1A 4HIHA 3PQYD 4WTXA 2PNDA 5TF0A 2X9XA 4YBHA 1IAIL 3QUYA 3T2OA 5LXGL 3STLB 3J7HA 4LCYB 1MCOH 4Q0XH 5EPMB 3KLDA 4Z8FL 3DOSA 2HLAA 4HUWA 4IRZH 1KTRL 1MI5D 2V5YA 4ALAL 3RGHA 4N1HB 4QF1A 2ARWA 4ZAKC 1F58H 2DAVA 3QUKA 3V4PH 3WDHA 2BHUA 5GRVL 1OARH 2NY0D 1MHEA 3U4BL 5CD5D 4XCFH 3FAWA 4MQ7A 3KNBA 3BD3A 2X1QA 4CAGA 2MSPA 3BN3B 5FGRA 1AIFB 4WTZG 1OAQH 3HMWL 1QRNE 5I17A 4KY1H 1MJJA 2MCPH 1MFCL 3QCTH 1AGDA 2IADB 2XT1B 5DS8A 2NY1B 2ZCHL 1T0PB 1G7IA 5D2NC 2WWKT 3BP7B 1J0ZA 3ECBB 4J4PD 4LLYA 4K7PL 3WHXA 3BUYA 4L8CB 2WW8A 1CXFA 1A6TA 2P42B 4PJGA 1F8TL 5H8DA 2KQNA 1CFVH 3G08B 4OT1L 3BHBB 1CE6B 5D2LB 2C1PA 4JKKA 3ZDXE 4N5EC 1U58A 1I9RL 5I66B 2OR7A 3FOLA 1CFNB 2W59A 4MNGE 4PLOB 1E0OB 3CFIC 4HBQA 3HI6L 1HZHH 1ZGLM 5EZOL 5IBTL 3DMMB 1IZJA 4FFVD 3A6BH 3WCYA 4PRNB 1INQA 1BAFH 4Y19E 1T7XA 3O11A 4JFEA 5EZLA 2R1XA 4O58H 3AB0C 4X6DB 3TO2A 2RBLA 2V9RA 3RZWA 1W72A 3MRQB 5HHXH 4HIIA 3C2AL 1HHKB 1EJ6A 2G5BB 3W9DB 4ELMA 4F7PB 3ULVC 3U7WL 2HVJA 2VIRA 4PJCB 2ERJC 3R8QA 1KCLA 1RFDL 3L3KA 3LN9A 2XICA 1FGVH 5C92A 3DX7B 4PJXE 3CFCL 4UMGA 2ZCLH 3IKCB 3IRZA 3JSSA 43C9A 2VH5H 4NN5C 1QBLL 2V17L 1PAMA 3BD4A 3KJ4B 3LRGA 2BRRH 1SM3H 4MCZB 1B0RA 5FDWB 1J8HA 3GRWH 2NY5L 1R3IH 1RJLB 1PBYA 2DQGL 2VZUA 5E6IC 1DN2A 4ODUA 2EDEA 1OP5K 2O5XH 4HCRA 2EXWD 4OKDA 5HDBE 5A3IC 1XR8A 2X4TA 3QIWC 5AWNH 1XH3A 4AEHL 2OTPA 4U2ZA 4WHDA 1OGAA 4YHOH 1PY9A 4Y1AD 1KLGA 4P5MA 4S2SA 5D6CB 1R3HB 4UZGA 1EV2E 3RWJB 5I76A 5E6ZA 4PJAA 1KN2H 5IW1B 2E9WA 2X4SB 1FL6B 5F3BA 1JPGA 4JKPL 4YQXH 5F1OB 1W8NA 2HTLC 5F1IA 3FB6B 4QHUA 3SE8L 4DKDC 2RFXA 4JHBA 2IPTH 3GKWL 3DVGA 4I18B 4YC2C 6FABL 1SJHA 3WS3B 2LU4A 5KANG 2OSLA 3VFRB 4Q74A 3U79A 1QACA 2YSSB 1UJ3B 1T7YA 2LU3A 5D96C 4TOYL 2COQA 4PG9B 3P4MB 4JFFA 1J11A 2X42A 1Z5LA 3EYUH 1RURL 1F4AA 5CZXC 2Z91B 3JV0A 4U6VL 5GHWL 1NGPL 5B8CC 3SEPA 3MRJB 1DBMH 1E4WH 5C0GA 2XZAL 2L4OA 4JRXB 5IFJB 3GJFA 1N59B 5D7LD 3PGFL 4L1HA 4F7EB 5J1SC 5BW7A 2YD6A 3MV9D 4KDVA 5I8KH 4U6HB 2AEPH 3IYLW 5CBEA 5DI8A 1F45A 4ZD3L 2B8OT 3WFCH 2DLIA 1VHPA 5F8RC 2ARJA 2AV1A 1IFHH 3UTQB 4FQ2H 4UAOC 1W72L 2X6MA 2YUXA 4YXLL 4P57B 4Y88A 4M1GH 3NIGE 2B1HH 3G5XA 4L3EE 4OCMC 4DZBB 5FA3B 4P49A 2D3VA 2ATKA 3PGDA 4I5BA 3EOAB 3UC0L 1NCAL 1I3RB 3HNTL 3IU3B 3RTQA 5J9PB 4F58H 1IKFH 5MEQA 2YPKB 4NN7C 4R97B 2O26U 3QB7C 2V5MA 1NMBL 4WFFD 3RVVD 1M7IB 2Q76A 3PL6B 1MWAB 4HGWB 3TNMB 3KPQA 3EW3B 1QG3A 2CGRH 1FYTE 4HFUL 3OB0K 3TN0D 2FBJL 4Z7NE 5J13C 4HCRL 3VDBA 4K3JH 4QCIA 3ILPB 3PIQA 4D0CB 5K9OA 1AKJA 5GS0D 4XVUD 1XF4B 4HXBL 1ZLVH 3RVTC 4BH7B 2A38A 4QLRA 1HXYA 4JRYD 1HQRA 3BWAB 3R1GL 5D93B 1L7IL 4PS4L 3U9UA 3WHE0 2ID5A 4D9RE 4M7LL 2PF6A 3UTPE 4H20L 4Z95H 3VFTA 5DJ6A 2RJMA 4NFCA 4X5XA 5JORA 4OLXH 1DFBL 1MFAH 3KJ6H 3SDXE 5GS1A 2G60L 5HYSB 2CJUH 5DZOA 1KIRA 2VERN 4U1KB 5JW5A 4D9LH 1WFNA 3WE6B 1P5VA 5I1LA 4MJ2A 4JFHD 5IEKB 3G6JE 4G9FB 1T89A 4X7SH 5DFWH 5ESAA 3WL9A 2JKXA 1FNLA 5EB9A 1NFDA 3B9KD 4OIBA 1LO0L 4YWGL 2HT2C 3QIBB 4R4BA 5HHPA 5HGBA 5MENA 5DMYA 2DLTA 2W0KA 1NCNA 2V5TA 1BEYL 4RIRB 4MJ6A 3V6ZA 3DTXB 3L9RA 5EIQA 4YHKL 1NUFA 4G5ZL 4GRLC 3QFJB 3WYRA 3QJFA 1T80A 1N6UA 4N90D 2NLJB 4JZJA 5C07E 1TPXB 4NC1E 2VWEC 8CGTA 1JP5A 5IEHB 2M2DA 4CDGC 1F4WH 4K94C 3IXAA 4M1CC 1P69B 2CDFA 3MRKA 5JW4M 3BVNA 4OZHB 4P2OA 1U92A 3IDNB 1NLDL 2BX5A 3O41A 5E8PA 4K3DL 3QG6A 1G9EA 1RZIB 4CMHC 4Z0BH 1T2XA 8FABA 3ET9F 5DLMH 4NQVA 3CPLA 3HUJA 2Y4SA 1TQBC 4OLWL 4GKNA 1DBJH 2XPGA 3SGKC 1IGIH 2FLRT 4XPAL 5ERWA 3T0EB 5C0FA 4XVJH 5IMOA 4I3GA 3D85D 1T6VN 3P73B 3I2CH 3KVQA 3MV11 3FT2B 2I07A 5FM4A 4U7KA 5CGYD 4WVRA 3O4OB 1T2QH 2XY2A 4C54A 1IKNA 5GGRY 2R69H 3TVMD 2F5AL 5JR1H 3QR2A 3LKRA 3VFPB 1Z0NA 3H3BC 5TQ0L 1KPVB 5CIPH 5ADOH 4GXUM 4G6JH 4P4KA 4M43H 4F9PA 1VERA 1PLGH 1RUPL 2GJ6A 4NUJB 2X1XR 3ROLA 3GSNH 1UEYA 4XWGH 1UWGL 4NZJA 1BOYA 4LIQL 2NX5A 4R2GB 4ZS6D 1B2WH 4NN6B 2CO7B 4FQXB 5C09D 4IRJD 3L95B 2ICWB 3KPSB 1A47A 5BXFB 3WFHA 1KXQE 4G8GE 4L4TA 3O4LB 1ZHNB 3PABB 3RUGF 5B39B 3NA9H 2XFXA 5KJRL 4ODWB 4O02L 2HLFC 5CBAA 3U1SH 5I74C 4FA8A 1T66D 4P0DA 3O8XB 2J5LC 3V7AG 1U2HA 4EDXB 2IH3B 4YGVB 2HMIC 1KIPA 5TGBA 3HG1B 4R26H 1DANU 1MCIA 3QWOB 1RVFL 5I8EB 3H9YA 3H7LA 2Z92A 1XF2A 2QHRL 4KJQD 4JHAH 2MQCA 1MRCH 1HHGB 4KRPD 3BO8A 4Z7VE 4PJGF 1J0HA 1I1RA 3G5YB 4PJ9C 4PJIA 4UIMB 1AGFA 1I7ZA 3JBG7 3OKEB 3SE9H 1XIWC 3O45A 5GIRB 2VJXA 4ONOA 2P5WE 5D7JA 4FXGA 5T5NG 3VD9A 3O6FC 4OF6A 1H8NA 1F4YL 3WN5A 2VO5A 1WBYB 2BSRB 3QEHB 5C6TL 2WUCH 3IFLH 3QZWB 5D1ZC 3SKOB 2E7LA 4RMQA 1EHXA 3GRWA 1P7KA 1RZJC 3I3DA 1GGCH 1NEZG 2DQJH 3ESUF 1G9MH 1XF1A 4U49A 3EYQC 3NPZB 2E9IA 1E6JH 3RL1A 4B50A 4R3SB 1K4DB 1NPUA 1ZKAA 2EC9T 1MCOL 4BZ1H 4Q0XL 1BQUA 3O2VH 3BDXA 5CWSB 5DJYB 3TPUB 4OD3H 4NYLA 1BQSA 2H26B 4C59B 3S37X 5B3NA 2VLMD 5JPMA 4ELMF 3I02A 3IDUA 3NCYP 1F3DH 1DQLH 3V4PL 1UWEH 2BSED 5DEFB 1F3JB 4ORGA 2H3NA 5JW3H 1OARL 3RL2A 3VD7A 2NY4B 1CDHA 3K7UA 3QO1B 2DYPD 4GKZB 1CL7H 2ESVB 3AROA 2LTQB 1TJIH 4ZO8A 1U8OB 1BIHA 1YMMB 2CIIA 3GKZA 4J8RA 3ZE2E 4UILL 1C1EL 5IB1A 3VWKA 1PFCA 1OAQL 5ACLA 2JJTC 2MCPL 3PV6A 3QCTL 4W4OA 2J88H 3OKOA 3PHQA 4OUUA 4HUXB 1MRDH 3OV6A 5IUSA 1T1ZA 3I75A 2R29H 4K3HA 1CFVL 3CFBB 3WIHH 1CLYH 4DVRH 4OD1H 3ULUD 4PJAF 3F12A 2C7UA 1DJSA 3SE4A 3EHBD 1HZHL 2O61A 1ZLUK 3QEQD 1IGYA 3D39A 3O2WH 4V2BA 2PTTB 1PKQA 3A6BL 4FG6D 5DURB 3HMXA 1BAFL 4PYHA 1YEDA 3NH7H 1FAIH 2IQAB 5TE6H 2FEEL 1U3HA 3P9MB 5H37H 1KGCD 5F7DA 4XCCH 1XGQB 3K46A 1MHPH 2WV3A 5HHXL 2OTUB 3ZYJA 4TNVF 4OGAC 3BPLB 3MQIA 4AENB 4N0RA 4F3FB 4NQXB 4QNPF 2A2QT 3T4AA 4ODTH 1JTTA 3MLXH 5C08E 1ERNA 1FGVL 2ZCLL 2VH5L 2XA3A 3ZE1F 2BRRL 3ZDZF 1SM3L 2OXGA