4DP0X

The 1.5 angstrom crystal structure of oxidized (cuii) poplar plastocyanin b at ph 4.0
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
99
structure length
99
Chain Sequence
VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin B, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
total genus 20
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp0X00
2HZHA 1SDDA 2FQFA 2QPDB 3NYKA 3S8GB 3UACA 1GSKA 4G72B 1NINA 4BXSV 2B08A 1MG3C 2VSKB 3NJMA 1AS8A 4PCYA 2CAKA 2FTAA 4BWTA 4GXFA 4QLWA 1E65A 3CZUB 3QJTB 2YXVA 2GC7C 4DPCX 2DWSA 1M56B 1WA1X 2BP8A 3T9WA 7PAZA 3EH4B 3JTBA 1NZRA 2QDWA 4AX3A 2IWKA 4P5SA 2P80A 2EILB 2PCFA 2IAAC 1AS6A 3FSWA 4GYBA 1PCSA 2DYRB 2R7EB 1OE1A 1ET5A 2DV6A 3BVDB 1MG2C 1KYAA 5I6MA 2WO2B 4JHVA 1A4AA 1ASPA 3ABLB 1IKOP 1E30A 4P5RA 1TEGA 4BDVB 4GP4B 1N68A 4BWWA 1PNCA 2UXGA 1ASQA 1NWPA 4DP5X 4YSCA 3U25A 3NT0A 2YAMA 3CVBA 2WSDA 3KW7A 4F7KA 1BXAA 3SBQA 3SBRA 3NSCA 1NIEA 3V9EA 1NTDA 3X1FA 1KDIA 3QQXA 1UATA 1AZNA 3AY2A 2PPEA 2JFCA 3FU7B 1GS8A 4G7RB 4WKXA 4YSSA 3GXUB 4BWUA 1TU2A 2WO3B 2IWEA 5D4HA 1V55B 2VM3A 3FS9A 1XMEB 3TU6A 2YQBA 4W9ZA 3RYMA 2XLLA 5I5MA 1CC3A 4ZK8A 3BQVA 1L9RA 1URIA 3OMAB 1L9TA 2E86A 3H4HA 3ASNB 5TK4A 2DWTA 3ZIYA 3ZDWA 3FQ2A 2J5WA 4NB7A 3TBBA 2BZCA 2PPDA 1CURA 4YSEA 3TASA 3DIVA 1ZIBA 4A2FA 1XB8A 3HB3B 3N2JA 1WA0X 4DPBX 1QHQA 2Y69B 2GBAA 4HAKA 5I6OA 3AW5A 3NSYA 1JOIA 1NIBA 3IN0A 1B3IA 2BHFA 3QJRB 3FU9A 1JZEA 3QJVB 2PP9A 3FT0A 4M3HA 1AQ8A 1SF3A 4YSPA 4E9SA 3CVDA 3FSVA 1M9WA 4DP0X 2MRYA 4MFHA 1SNRA 1AANA 2BW4A 1YLBB 4A2DA 5B3SB 3AG4B 8PAZA 3IBOA 2YAHA 2XU9A 2AZUA 1GS7A 5B1BB 4WTQA 1BYPA 1DZ0A 2JXMA 5I6NA 3OMNB 1GYCA 4A66A 5D4IA 1JERA 3C75A 4AKOA 1KCWA 1SFDA 1ADWA 2VW6A 4HCFA 4HCIA 1BAWA 5FC9A 2PPAA 3NJKA 1T5KA 2B3IA 3CDZA 2IWFA 5AFAA 3OM3B 1OCRB 3NJLA 1NPNA 2PP7A 2ZOOA 2EINB 4YSUA 1BQ5A 3T6XA 1MZZA 2BW5A 5LDUA 5E9NA 1JZHA 2IDUA 1ZV2A 5I26A 1NWOA 1WAEA 2AFNA 3T71A 3WKPA 4HALA 3FYIB 4HZ1A 4DP2X 2OV0A 3PAUA 3PCYA 2XVBA 5B1KA 2XYBA 5F7BA 5F7AA 2XX0A 4FA7B 2ZONA 5I5JA 4E9QA 1GR7A 4YSRA 1SDDB 1JXGA 4A2EA 2XX1A 4KOBA 1J9RA 3NP3A 4NAJA 2FQEA 4Q89A 4DP7X 3NP4A 5B7MA 4QKTA 1R1CA 4AKQA 3PAZA 4UF7C 3QJUB 4YVNA 1L9SA 4HHWA 1KV7A 4N8UA 2IDQA 1A4BA 2ZXWB 2BP8B 1PY0A 3AG1B 1NIAA 1OE3A 2EIJB 1SHXA 4A67A 1L9QA 2PCYA 3CG8A 1M57B 3DTUB 1SJMA 2IDFA 2J57A 3NJJA 4M4RB 4HHGA 2CUAA 2BP0A 1A3ZA 3FPYA 1JZJA 4W1TA 1I53A 2H5UA 3ZBMA 3UADA 6PCYA 1XB3A 1PZBA 2GHZA 5ANHA 4FAAB 3FQ1A 1V10A 4AZUA 1JZGA 4A2HA 1XB6A 2VM4A 1KBVA 4G70B 2PP8A 2GB2A 2XXGA 4GP5B 3NJIA 2FT8A 1WA2X 2VMJA 1N70A 3PLYA 5I6PA 1IC0A 1TKWA 3S3BB 3X2QB 2XXFA 2BZ7A 1NPJA 1ZDQA 4E9XA 2UXVA 4DP6X 2UXFA 1GY1A 2TSBA 2XV0A 2YARA 2J56A 1FFTB 2ZWNA 3ASOB 3PAVA 2YXWA 2OJ1A 6PAZA 1RZPA 2GI0A 5PCYA 4EF3A 4KO7A 4GP8B 1PZCA 4KNSA 2PPCA 3IE9A 2BWIA 2BO0A 3WI9A 3T6VA 2W8CA 2CALA 4JHUA 5PAZA 4E9TA 2EIMB 4NERA 4DPAX 1RKRA 2IDSA 1VLXA 1EZLA 3UAEA 3WNJA 1KDJA 2AVFA 3QJQB 1KBWA 4E9WA 1WS8A 1F56A 1KCBA 3NJGA 1BQKA 1L9PA 1AZUA 2JKWA 4G7QB 1MDAA 1PLBA 2UXTA 1L9OA 2CBPA 2GSMB 3FPXA 1A8ZA 1W6LA 1HAWA 2CJ3A 4KO6A 1A65A 3T6ZA 4KOCA 3UABA 1AOZA 4JKNA 4PAZA 1CYWA 1PF3A 3WNIA 1BQRA 1W8EA 1HFUA 1PLAA 2BWDA 3S3DB 2X88A 1IUZA 1BXUA 2AANA 1OCZB 2H3XC 2QDVA 1NIFA 1PLCA 2I85A 2W88A 3WIAA 4RH4A 2EIKB 1PMYA 2P80D 4DP4X 3GDCA 3TBCA 1OCOB 5IY5B 2A3TA 3ERXA 2FT7A 1QLEB 1TEFA 5D4JA 2N0MA 1QNIA 3FSZA 4E9RA 2VN3A 3IEAA 3NSFA 4N4YB 2XV2A 3MBWB 5B1JA 4AKPA 2YAFA 3CDZB 3QPKA 5B1JC 1GY2A 1JXDA 1OF0A 2GC4C 2HX8A 3ZX1A 1E5ZA 3IN2A 4YVUA 4G71B 3S3CB 1CUOA 1BEXA 4YSAA 2UX7A 1GS6X 1J9QA 1W6WA 5A7EA 2Q9OA 2TSAA 3OQRA 5I6KA 4L0PB 2NRDA 2R7EA 2HLEB 3NJNA 1SF5A 1AIZA 1BYOA 3WG7B 1IBYA 4BDVA 5I5IA 2HRGA 1ASOA 3QJSB 2Y1AA 2IH8A 3SBPA 2I7SA 3AG2B 3AZUA 3S8FB 3X1BA 4DP8X 4UAHA 1SFHA 1AG0A 3EH3B 1ILUA 2YAEA 5EHFA 1AS7A 4ENZA 2YAPA 3G5WA 4DP1X 3OMIB 2FT6A 4KNTA 4UANA 3NJHA 3L45A 2DYSB 1E5YA 3SQRA 3FU7A 1ILSA 1NICA 4AI7A 2OCCB 1NDTA 4KO9A 5AKRA 2XV3A 3D12B 3NSDA 2QT6A 2H47C 1JZIA 4KO5A 2YAQA 1AG6A 5B7EA 5I28A 2VW4A 2GIMA 1ETJA 3MX0B 3FYEB 3N55A 2BP0B 2YAOA 4YSQA 3ABKB 1ID2A 2X87A 2HX9A 1JVOA 3T6WA 4TXVB 2VW7A 4HIPA 2AZAA 2MTAA 4KNUA 3KW8A 3H56A 4A2GA 4CSZA 1ET7A 4YSTA 2FQDA 3FSAA 3DKHA 3H4FA 1JXFA 1V54B 4Q8BA 2HXAA 4A68A 1RCYA 3OD3A 3HEIB 2FNWA 3CVCA 1OE2A 2XUWA 1MZYA 4G7SB 1AZCA 2FQGA 3AG3B 5TK2A 4BXVA 5B1AB 3EHBB 3JT2A 2IH9A 1EHKB 2HRHA 1X9UA 2PLTA 2RACA 3X1NA 1CYXA 1J9SA 1OV8A 3WKQA 1AAJA 1AR1B 1SHWA 1GW0A 4YL4A 1PNDA 1DYZA 2XWZA 1AACA 1IBZA 4F2EA 3ABMB 1PZAA 5I6LA 4DP9X 1J5DA 4X4KA 1AZRA 3EF4A 7PCYA 1E67A 1X9RA 1A4CA 4HCGA 2UX6A 3ABGA 3X1EA 3X1GA 1ZIAA 2DY2A 4E9VA 1OCCB 1FA4A 1WS7A 9PCYA 1NIDA 2Q5BA 1J9TA 3TA4D 3UGEA 1HAUA 3NJFA 1J5CA 3FU8A 1OOWA 3PXLA 2QPEB 4GY4A 5B7FA 3FQYA 3UAAA 3V9CA 1KGYE 4YSOA 1AZBA 2HX7A 2VSMB 1BXVA 4E9YA 4F2FA 2IDTA 2FWLB 2PPFA 5AZUA 3PPSA 4BK5C 1FWXA 2J55A 1PAZA 3EH5B 4K9JA 4YSDA 1ET8A 3GYRA 1RZQA 1JVLA 2I7OA 2FJSA 4CSPA 1ZPUA 1JZFA 2LLNA 1ZDSA 2CCWA
chains in the Genus database with same CATH superfamily
4LPCA 4MDJB 1FRGH 5JUEL 5TE6L 4MQ7B 4U1NB 1OSZB 4KFZC 1QUNA 4X4MA 3CFQA 3GK8L 3R19A 3UO8B 3W0WD 1EDQA 1NDGB 2B08A 2DM7A 4E5XA 2ZQKA 1JK9B 3TFKC 4WKZA 1QSEB 1EJOH 1ED3B 5AW8B 5KYXB 4OGZA 4MX7B 1JV2B 3CZUB 4NPYB 4XPBL 4MAUH 1XGPB 5DK0B 4QHUA 3QULB 3P11L 4QRAA 1WA1X 3HFML 4BFKA 4LEXL 5K9KB 3TH2T 3EJQA 2G75B 3DX6B 1XSKA 4IK7A 4A2MA 5IQOA 4M6ML 3VD5A 3HJ0A 5CINL 3BSGA 3DMMA 3PUCA 2CWRA 5I6MA 5CN2A 3HR6A 2BNQE 2NOYA 3E8VA 4G5ZH 1LXMA 12E8L 2Y5TB 4HIJA 5D7LD 1P1VA 1P5VA 1RL1A 3HMWL 4GP4B 3SPIA 3STZA 2X6MA 3BGAA 3G5YB 3B2VL 3UX9B 3KJ6L 4NSKA 3CMOH 3J27A 4PHZA 4K55A 4UT6L 2OMZA 1MHHA 4MDRA 3K71A 1BG9A 1AD0B 2CDGB 3CVBA 4X7CC 4XCFL 2GITA 3P9LA 1KYOJ 4NWTL 4XP1H 1COBA 1RERA 2Z4QB 5CO1A 3IGKA 2DH3A 4AH2A 1AZNA 3HLAA 3O2WH 1UQSB 3BC9A 3HAEH 3FU7B 4ZMWA 5IMMA 2J20A 2R1YA 4XOEA 4JW3A 5EFIA 1OCWH 1X6NA 2JQZA 2KL6A 3NCFB 4O4YL 4ZI8A 1I8KA 1BX2A 1E9PB 4B0MB 4PGZA 4G6KL 3QNZA 4F7TB 1XT5A 3QDMB 4KRLB 4BJLA 1I8IB 1RIHH 5EWIL 3ZKSD 1UXMA 1BV8A 3VXRE 1MRCH 1D5MB 1J8HA 1I31A 3W81A 3QDHA 2CLRB 2VLME 5IB4A 2X6AA 4GAGH 5LQBH 1BQHA 3L3JB 1V7MH 4KXBA 5H94A 3FAWA 4AL8L 1S9KC 3RFZA 1H5BB 1NFDE 3B8YA 4DVBA 3LZFL 4M6NH 3DNKA 4HBCH 4B9KC 1L7TL 2APTA 3LEXB 1KBPA 1LO5A 2OYLA 4YSEA 3TESA 1A1OB 2X4RA 4P4KD 3E80A 4X5RA 4YR6A 2ADGB 5HJ3A 3V6OC 5GRWA 3KLQA 2Y7QA 1KNOB 4N9OB 4XXDA 5IQNA 1JRHH 1NC2D 1QWUA 3L95B 1YPZA 1OB1A 2OYPA 1AOHA 1JZEA 4OB5H 3ZHNA 1AQ8A 4E2OA 4Z3IA 3NOIA 1CD1A 3RPIA 2CLVB 3BUDA 2J8OA 1J18A 5CR8A 3RDTB 1KLUB 2X4OA 8PAZA 3V9FA 4YHYC 2VDOH 3FQTB 2ICWA 3RB5A 4A1RA 1Z9LA 1FPTH 5E2UL 2JXMA 1DP0A 4NKIL 2DAVA 4LU5H 5IEHB 5B38G 5KYYA 5IK3B 3ULUE 4B9JA 1A6PA 1IAOB 1U8PB 4PW9A 1YY9D 1CT8B 4MAYA 5DZAA 3QISA 4PJ7B 1FQ9C 1KCWA 4HV8B 1RZ7H 5K9QG 2ADJA 4FEMA 2P26A 4HCFA 4FQ2H 2VSCA 4HUKB 3RGVC 5LLIC 1BAWA 3CHPA 4KWUA 1P7BA 2EICA 4AYFB 3GHBH 3CDZA 4KX8A 2XWBA 3QG6B 1OCRB 5E7BA 2PP7A 1U2HA 1EDHA 1MZZA 3RY6C 3BDYH 3WE6A 2BOCA 3SODB 4X7SH 3D2UA 3Q2WA 3SCMB 3VFGH 4TUKH 1PG7H 1SN0A 5KZCB 1DEEB 5EF0A 2EACA 3I9GL 4PVNA 1MREL 3M1BB 4I0PC 4N8CL 2O30A 4D0CA 2HFEB 4M1CD 4K7PH 4XNBA 4DP2X 5FGRA 2XKNB 2FZ3A 2MTPA 4ATTA 3PL6B 5F7UA 5F7BA 4ZMPA 1WC7A 2M83A 4B96A 3LMJL 1KYFA 4KOBA 1E4KC 4H1LH 1ZOXA 1T03H 2BINA 3SGJC 4IS6A 4PJIB 2NXYD 5FCUL 1EEYB 3RKPA 2VITA 1E8ZA 3P1VA 3VGFA 1UZ6E 4F7MB 3CZJA 3PAZA 2CCLA 2IQ9H 5BUGA 4N0YH 5FXCH 4YFEA 2WBJA 1ES0B 1IC5L 4ZFOB 4FC3E 4OV5B 4XPTH 3VFVB 3SDCB 3SDAD 3ZN6A 2DYPD 2APFA 1PY0A 3PHQA 1I7UB 1NIAA 3NTCH 1OE3A 4W9KC 1NCCL 1L0YA 1QFHA 5J7CC 5HDLA 3VXRA 2V17L 3IDJA 4FNRA 2BSED 3ECWA 3QUYD 4QR7A 1HSBA 5BVJA 1XR9B 1A3ZA 5T1KA 3H9ZA 4JN1H 3OSVA 3HE6A 4H5SB 5HHQB 2LABA 4MMZA 6PCYA 5KOVC 1NFDA 1CICD 2HKAA 1MCWW 4I2XE 4BSVB 3VTAA 2DQCL 2EP6A 1J11A 2MIZA 4TSBH 2CJTA 4IBVA 5H37A 5BMFL 3IFOA 1IGFH 2CD0A 2HLFD 4IJ3C 4YC2C 4CMHC 5GS2D 1XZWA 3OC8A 5D6CB 3VXUB 1LO2L 5E4IA 4BFEA 5HD8D 3VWJA 1RAMA 1EAJA 1FFPB 4POZD 2VDNL 3PLYA 2R0WL 3EYVB 2AABH 3ATBA 4FMVA 1NCIA 1LD9A 1QLFA 2PNDA 4XVUD 1DUZB 3CUPA 1FGVH 5K1JA 3KL0A 1FJ1B 4GBXC 1SBSL 3HZKA 4NQVA 2EDMA 2IGFL 3CPLA 1NEZG 3PP4H 1T21B 2BPBA 1JVKA 3VD7A 1BAFH 2YRZA 4RGNC 5C0CD 2AK4D 1G4MA 1IBDA 3OJ2C 1A47A 3BPNB 2OTUB 3HC3H 1GZPB 3OLEA 5PCYA 1XSOA 5EZJB 4BFJA 3VH8G 1RFDL 2VDOB 5FYLH 1T22B 4E9TA 1XGQA 3WSQL 4B53A 1RKRA 1OK0A 2O5XL 3LKOB 4KKCD 3LKSB 2IDSA 5TFSH 1BZDA 3N43B 1Q90A 4CVZB 4NDMB 4QRQB 5C6TH 3MGOB 2R56H 3QWRA 4K8RC 1FL6A 1L9PA 4X50A 1HSAA 2E9BA 4QHPA 1UEYA 2VDPH 1KJ3L 1N5AA 5JDSB 1XAUA 2YKLH 3D1MC 1CR9L 2IG2H 1A0QH 4E42B 2JNZA 4UDTB 2XNAB 1DJSA 2AJUL 2NUTB 4RDBA 2IAMC 5MI0C 5DMKA 1CFQB 5CBEB 1UTDA 4ELMA 3P0VH 1C1EH 3GSUB 3EDFA 4JFPA 3S3DB 1UJTA 3PYCA 4MS8D 1FG2A 2ZP0T 5JNYB 1OLLA 2FEEL 2Z8SA 2TRYA 2JCCA 4QRSB 4HU8A 5ECJE 1UM4H 3GIVB 1ZGLM 3QUMB 1OCOB 4DO4A 5LN4A 5EOCJ 1TEFA 4OGYL 1W0YT 5IG7A 2R69A 2X6CA 3OG6B 5DQJB 4M56A 3IK2A 3OG4B 2PYFA 5FGBC 2GJ6A 2YPLE 3BGMB 1T2JA 5E6UB 43CAB 4UNTA 1N0LA 3T65B 5JHLL 1FI8C 4AKPA 4MQXD 5G5DB 3ZX1A 2GC4C 4ZTEA 3IN2A 1HI6B 3E3QC 4G71B 4F24A 4JVUA 4G8AC 1QRNB 4G6ML 3VFUB 1UZGA 3CFDA 4G9DA 4Y4KA 1G6RL 3JV4B 5F8QC 2J6EH 2R7EA 3GMOB 1JD7A 1U8LA 3F04A 1CGUA 4XMXA 4KXCA 3FT4A 5EZOH 4DKFL 3U1SL 1MY5A 3QUKA 3ARTA 3VI4F 4Y4FB 5DJDB 3WG7B 3W9EA 5AAPA 2B2XL 1SOXA 5HYJB 3S9DB 4X8XA 3AQYA 5C07D 1NUFA 1T4KA 2Q8AL 2WXQA 1TO5A 4GAJH 3SQOH 4KU1A 1BZEA 3DHJA 1TQWA 2YPKB 1J88A 2MSPA 3M8OL 3ZMRA 1PAMA 2YAPA 3PWJA 4NIYE 3EO1B 4LSSH 3D50A 4QRTB 5AVTB 5J3HC 4F8QA 4KZDL 5HYSA 4KGLA 4FQCL 5C1MB 2BVEA 1RUQL 4TTDC 3MODL 2FO4B 5HJGA 3K4AA 2OSYA 2F53E 3C5SB 1UURA 4R7XA 1BVLA 1IZJA 1BP3B 2DWDA 4GO9A 4NXKA 2Z8VC 4LESA 3W9DA 5IUSA 4F92B 1YJDL 2G0LA 5FO8A 5I28A 4X8CA 4PRPD 4YDZA 3IDXH 1DLHA 3BGFB 3ABKB 1GZHA 5T1DL 2H32H 4P23B 1A6ZB 1CFVH 3PY9A 3UBGA 3KXFA 1MELA 4K3JL 3VXMB 2MKLC 5LXGH 2H45A 4M7LH 5IMKB 1PEZA 3D4GA 3MRQA 1V54B 5EUKB 1D9KB 4ZUVA 2MCMA 2HXAA 3UO1L 4WWPA 4A68A 3ZLQC 3ZE0B 3PABB 4OCYH 5I18H 3ZGHA 4YUEL 3MACH 4BCXA 2XUWA 5I17B 3FTZA 1O7DC 2H1XA 1R17A 3AM8C 2P1YA 3UEQA 4W9IC 4K9EC 4R4FL 4GW1B 1Y6KR 3ESPA 4LRIC 4DIXA 1TQTA 2MQ3A 1JDAA 5FOJA 1I75A 3O8XC 1IGYA 3KNBB 4R96B 3C2AH 4MHHI 4AJ0A 1D5XB 4ERSH 2X40A 4IBUA 4Y5XB 5C70A 4QWWC 3IT8D 1I4FB 1KIPB 3Q8EA 5JW5A 3CFUA 3PGCA 3B7RL 1WBYA 4KDTC 3ILQC 2NY6C 3NMEA 4Y16B 2CMRH 1OCCB 1DQTA 4KI5E 1YNKH 3KYMB 1LE9B 1I7RA 2Z7ZA 1J9TA 3EJSA 1YAZA 1NMBH 4HZLA 4O5LL 4AZ8A 3I2CL 3NZ8A 2ARJQ 5IB1B 1J5CA 2PR4L 4IGBB 4XODA 2NNAA 3K91A 4GMSL 5I19L 5BVPL 3M46A 3PPEA 3MREA 4Q6KA 1SXSA 4FQLL 3D39E 3GB7A 5LB1A 1ZAGA 4CU8A 2XA8H 5GQBA 1T1ZB 4CJ0A 1JV5A 2X05A 3RTQA 1BBDL 3H9SB 5K33A 4YDKH 1OGTA 4WWKA 1J0JA 5CSZB 3VAEA 4I3RL 4JVWA 3BDXA 3U2IA 3PWLB 3ELAT 3QW9A 1EAPA 1ITBB 1JGEA 2Z35A 5DWUL 4JDTL 2JJVA 2IVFC 4APXB 3PJSB 4CC4C 4EAEA 4U1KA 5E6ID 2WZPA 3RUGE 4LCIL 1L0PA 4K3DL 4PJCE 1CD9B 1FH2A 1YG9A 2IPTL 4MJIB 3D4YA 4LOEA 5I82A 2ZUQC 4AMKL 2BSSB 1GC1H 2YUWA 1JHLL 2ADYA 4FQXC 4PJ8B 3AXLB 3TEUA 4HMDA 4M9PA 5IW3A 2DICA 3CFIC 5FCSH 4F2MB 3VRLF 1YN7B 4FQIH 1XR8B 2IIJA 5KOMC 1MRDL 5D5MA 4OD3H 2EXWC 1M56B 4OF5A 3OLDA 3JTBA 4H40A 1QNZH 4AX3A 2EILB 3MCKB 2PCFA 3LKPA 1EEZA 4PYGA 4RBPH 1V3MA 4OVUA 2ODIA 4LSVH 5A2KH 3EDKA 4X6EB 5E00A 3JXAA 4ORGB 1KCUL 1Z3GH 4GT7A 4JHVA 5ECGA 3D08A 4FG2A 4BDVB 2MNUA 3LYRA 1OGAD 2H32B 4GRWB 4Z0BL 3TNMA 3V0JA 2J1YA 4WO4A 2DJSA 5AD0B 1OY3B 4OIFA 4N86A 4Y5VB 1A9EA 2HTKC 5JIDA 1EUTA 1QSFA 2G5BB 4CBZA 1YC7A 3ZO0A 1U3YA 1OF2B 1NFKA 2A6KA 1Y1UA 4JO3L 5ABDE 4UTAH 1GMIA 4FX5A 2AQ1A 4WFGE 3WV0A 4CN1A 1AO7A 3L17A 1MFMA 4BWUA 3ESVF 5D9SB 1NGXA 5HYQA 2XIDA 2VM3A 4XXWC 4K7FB 4A37A 2YQBA 5DQ9A 1EO8H 4BE5A 1P7KA 2GY7B 1QRKA 3ZDZF 2AXGB 4PJ5B 2P5WB 1HZLA 3IAGC 2YFNA 4NOFA 4EKJA 4ZOCA 1XVSA 3HPLB 1IC7L 2B4CH 4YX2L 1U93A 4K94H 4ZODA 3ZE2F 4K71C 1F6FB 3UJJL 3FUEA 5FFGA 2Q7YB 2EYRB 5H35B 5D2NC 5AAMA 2NQDA 3LKQB 3O2DH 4K3GA 4X6FB 1ZV9A 2WK2A 4H0LC 3O6FA 5EOCH 4ZFQA 3TJPA 4ZW8A 5GGQL 1CZ8H 3QNXB 5FM5O 2OCFD 2C26A 1MHEB 5F1NA 2EDFA 3QUZB 2CUIA 25C8L 4RISH 3RKDD 1U4FA 1KPUA 2N7SA 2X6VA 1PFCA 3V55A 2OSWA 4AL8C 4DTGH 2GI7A 5IHHA 1NCDL 2HWZL 4GRLC 4TLTA 1MWAL 5D7EA 3BE1H 2YK1L 3SSGA 1DSFL 4Y9FA 1RHHA 4P3CH 1QOKA 4Y4HA 5ESQA 3AG4B 2UYLB 3HR5B 3WTTA 4EEEA 4JY4A 2BFGA 2XU9A 5BRZA 1N59B 3EFDL 5B1BB 3U9UB 3IKKA 4WTQA 4OZGB 1YY8A 4IBZA 1EFQA 4YEFA 1WPCA 1ZCRA 3RUGA 4NNYA 1KY7A 1W0WA 2YD6A 3GRWL 4UOJA 3WENA 2HA1A 3TO2B 3H0TB 3RP1A 4A66A 2IGLA 3DRTB 2VR7A 3EYQC 4Q7DA 4YL9A 3JWDL 4LLDB 4QUOA 5IWLC 4I0CC 4LPVA 1DVXA 3QO1A 4QJ3B 5CJXA 5IT2H 5FV1L 1VDGA 3P40A 5FUOL 1H19A 1JDDA 3U1QA 3VXQA 3AWEA 5LBSA 5TQ2L 1HZHL 4BH7B 3POCA 3BRGC 3IXAB 1BQ5A 4I85A 5I26A 3UYRH 2A9BA 2LU7A 1OAYH 1VFBA 4J23A 4JZJC 5TE7H 4DVRL 1XIWA 4LRNH 2G2RA 3QAZC 4KZ0A 5T5FH 1JGVH 3APCA 3TT1H 3VFPA 1X5LA 2CH8A 2A74C 4G8EA 3ASWA 4P3DA 2W65B 4ZX4A 4DNLA 3QDMD 3SPVB 4ZTOH 4OLVH 3ISWA 5BRQA 1K8IB 4IBYA 2E7MA 1ORQA 1T5XB 1WZLA 3OZ9H 5CS7A 3SOTA 1UD3A 3Q1SL 1GL4B 3ZY7A 2YOCA 4WHCA 1QQDA 2FYYB 5C0EA 1NOAA 3RURA 2AERT 3MRJA 3SJVE 1RLWA 1IAMA 4CADB 4A6YH 4FFZL 2EXYD 4UV4H 4YVNA 3X3GL 4ABUA 3HG1D 4N8UA 3SGDH 1FNEA 3JWNH 1Y7VA 1CGSH 1H3GA 3OAZK 4UOZA 3CLEH 2F08A 2WQSA 4Q56A 1BW8A 4JUTA 3SDYH 3K6IA 2YHGA 1CDBA 4TSAL 4IRSD 4WCYH 2ID5A 3CXHJ 3N44B 4TTGA 1YMHB 2IQAA 5DMGD 2H0JA 2AJVL 1XMWA 4U3HA 4DOHE 3R8QA 5A3IC 2H4EA 5DF0A 1I53A 3N40P 1QBBA 4UINH 5I66B 4XO3A 2F8IA 1PQZB 4M7JH 1TR7A 4BHUI 3WTUA 3U0PB 3ZR6A 5F9DC 3NFPA 4Z95H 1CFNB 1PPIA 1ZS8A 4BFBD 4G7YH 2QVMA 4H13C 3ETBF 4HKXB 4W9HC 4NPKA 3FTVA 4XX1E 1KLGA 4PJAF 4J6RH 1ID5I 5GS0L 2DN7A 4MB3A 1S5IH 4UQIM 1B88A 3H1ZA 3WTYA 3JSSA 1KCRL 4PWHA 3EH2A 1U3HC 3APMA 2V3DA 5C09E 4DAGH 3CVIL 2UXVA 4OM0L 1TU2B 4Z7OF 3FUIA 4FNLL 2TSBA 1MFEH 1XSJA 2Y9RT 4NI6A 2Q7NA 2G5UA 4ADGA 4JRFA 2R1XB 2OJZH 5IMOB 1J7VR 2OJ1A 2Z93B 4ZAKC 3RA7H 3SCMD 2NXZB 1QVOB 4HKZB 5KZCD 1VGKB 3KAAA 4ZX3A 3ZRFC 2IFGA 1NBZB 1XF4B 4HXBL 3BT2H 5E8EA 4DPAX 4NERA 5I2IB 1ZT4A 4HPOH 4AQOA 1MCCA 3FL7A 5B39A 4DCQB 3VXSA 2WQRA 3HHRB 1F86A 4R97C 1FYTE 1OPOA 2N4IA 2VZSA 3WFEH 3PL6D 1KDJA 4ZZKA 4N2DA 3ARBA 2KZWA 5FK9A 1EZSA 2WC7A 4MXWL 4DGYL 3WCYA 2IXQB 1JBJA 4Z7VE 1ZA3B 3A23A 4JM4L 4L4VD 1S8DB 4F9PC 3P4OA 4X6BB 4C83B 4NS0A 1EJ8A 2DKSA 3UDWC 4OLEA 2GSMB 4AYID 2E46A 3DGGA 3T77B 1HAWA 3EO9L 4PRHB 4R5TA 3EJPA 1R3IL 3FRPB 4XOCA 2CGRL 4PAZA 4Z0XB 1MCFA 1G87A 1N12A 5D70L 3SDCD 2XXCB 1K8DA 3MRHA 4LHUA 2BSTA 2WLJA 4MJJA 3DX9B 3PG2A 2O61A 3ZO9A 3ZTDC 3L7FA 2XWRA 2BOLA 2NNRA 4GUOA 1QLEB 2R83A 2EDYA 1M1XB 1QNIA 1RP9A 2H41A 2YSSA 4OLYL 5HHMB 3SHSA 1S9YA 2ZAHA 5C2UB 3NK3A 4KKAC 4GW4B 2Q20A 2PWFA 1EGJA 3SKJH 2PTUA 1MFUA 4GPVA 2ENJA 5E4OA 4PRAB 3T4AA 4ECNA 1CD8A 2YN5A 3K72B 3I74A 4X80L 3VXUD 4TRPL 3IVKB 1EJFA 1QPPA 3S3CB 1AP2A 2DQDL 3VCLA 2QQKL 3EOTL 1UGKA 2W94A 4NLAA 4MQSB 5C7XH 3MLRH 1YEIH 4F57H 2EO7A 3QXUA 3V7MA 4V2BA 3GO1H 3BFQG 3HG4A 4FZEH 1UWEL 2GJRA 3A6CL 4UQ3A 4XO9A 1U8OB 2XIBA 1U9KA 2XA3A 1WK0A 4FJ6A 1TVBA 4AUUA 2CLZA 4B97A 2JLLA 4NFDA 4RETB 4BKLA 1JFQL 3EG9A 3VFSA 1Z1WA 5DJ2A 1A7BA 4TNVK 1BZ9B 3VXNB 5E5LA 4UQ9A 5T5NG 2A9NL 1OD9A 3DUHA 2LTQB 4GSXA 5DEFA 1ZT7A 4FLQA 5B8CB 4PIRF 1JPEA 2E7BA 2GFBA 3EJYC 2C9RA 3UTPD 3FRUB 1FE8H 1IKFL 1K5WA 1RSFA 4G1EA 4Q4EA 4GG6E 1EVUA 3P77B 3O0LA 4OZHE 4PBVC 3PFQA 2DEXX 2ZXBA 3Q6GH 1IT9H 3KDMB 4LDEB 3BH9B 3PRZA 1AXSB 4L05A 3QEQD 2FBJH 4KROB 3D51A 4M8UA 1DO6A 3QYCA 4BA0A 1C8PA 4P2OA 2XT1B 3FUNA 3LEVL 1I9JL 3CZEA 2MTAA 4ZOAA 4NQDB 1FYTA 1HEJC 5AZ2L 4KRPC 2E9JA 2FGWH 1YJDC 4G8GE 5I15H 2PW2A 4Z7VA 3RTLA 3IDYB 1S9VB 4AM0B 4CSSA 3Q8FA 2XTJC 3QUHA 5J13B 3SDXB 2F7QA 2QFRA 3V4VL 2CO7B 5JXEA 4WJKB 1E5UI 4OKVA 1TZAA 3C5XA 1QW8A 1F4HA 1JPSL 2E56A 2FR4A 1TPXB 2N7BA 5TGBB 3KGTA 4TNFA 4RSYA 3DVGA 1VACB 1QRND 1FL3A 3GGWB 4M61A 2QQNL 1DQKA 3ARDD 3AT8A 1ADQA 3BN9D 3C8DA 5KW9H 4PJXE 2WQVA 1UFGA 2OPCA 5I6LA 1F41A 4QRFA 2HRPL 1BGXH 3BQUC 5T3XE 4NKMB 3K3QA 3QFDA 4L2YA 5IBUG 4Y4FD 4LSQL 1K4CA 4HCGA 1OAZH 3OX8A 4P3WA 3TO4D 5HYJD 1FA4A 2DQJH 3IMVA 4NZUH 3I3EA 3TIDA 3V6OE 4IRZA 1NC4B 1U8NA 5ICXA 3KLLA 1JI2A 4YPJA 2Q86A 5KVDE 5F44A 3CLWA 1ZTXL 3GM0A 3DSFL 3MXWL 3FU8A 1AKJA 1QBLH 3BKYH 1NMAH 4YDJB 3R06B 2V7HB 4GY4A 2HCZX 4M7ZC 3RWFA 1IFHH 3WKML 4QPEA 3T0XA 1TT6A 5GZNA 2ZSWA 5AQ0A 5DZNA 4QTIH 4E9YA 2I5YL 5L9DH 3B37A 1KY6A 4ZZFA 1FSKB 3TF7C 4BK5C 1FWXA 3ROOA 2VDML 3F58H 2W60A 2XG5A 1SYVB 2ZX7A 2EVIA 1R19A 3TEYA 2P9RA 1G7QB 2AK1L 3OLIA 3QI9C 3MUZ1 1EZLA 1BLNB 2BCMA 2LLGA 2XWXA 3HCVB 1ERNA 1U8KB 3ULVF 2AQ3A 4BV1A 1UM6L 2ENPA 1PTZA 4P23D 4D7BA 4EPSA 5JO5A 1GSKA 3DJSA 1T6VN 1WIOA 2GSIA 5D72L 3GF8A 1HH9B 2ZCKH 1OXYA 1FFQA 1Q0EA 3VXMD 1W72A 2AJYH 3W11D 5FYLD 1IQDA 3FUDA 4I1RA 1KCSL 4LK4A 2VDKL 4JRYB 2DWSA 2X41A 1D9KD 2AJ3B 2X42A 2BP8A 3KLAA 1IILE 4R8WH 2D7TL 4HJSA 2MJWA 4LLUA 5KUKA 4KKBD 2QDWA 2GT9B 3VX0A 1IVTA 2QKIC 2DB8A 4PN6A 5DVMA 1H3UA 3HBPA 1DL7L 3LQMA 1OE1A 3NCYS 1MCPL 4Z7UB 3OKKB 4S1DC 5F70A 5JIHA 4P46C 3EIFA 4W9DC 1U0QA 1OP3H 2C9SA 2XPYA 5FLUA 3WN5C 4H8WL 3CSGA 3LSOA 4ZFGH 4G8GA 2JKJA 4MXVE 3NVQA 3DX8A 1J8SA 1NAMH 4M6OL 4ETQB 3ZJAA 2ENQA 4TULL 1IEBA 3U0TA 1NTDA 3X1FA 3HUJE 4PJEF 1PZ3A 2BIMA 2YBRB 4ONFH 4Y16D 4EI0A 3D25B 1U95B 4F8TA 4YXLH 5KS9E 3ARFD 3QIWA 5CSGA 2Q3AA 1IKNC 3IFPB 3QNYA 5DUBA 4EDXB 2H1LM 4J8RB 4M6AA 4ANXA 4U3CA 1RK0A 3BDBA 2EEBA 2CQVA 3TU6A 4IGBD 4PJXA 3V7AG 2AEPH 2JJTC 4FNUA 4UUJB 1AMYA 3WIFB 2NY4B 5TQ0H 5FKPA 1A2YB 1O9VA 5BV7H 4FXTA 5FPIA 5I0WA 1BVKA 2X4SA 1VEPA 2UWEE 3H9SD 4AIZA 4NZJA 2NY7H 4DKTA 4PV9A 1CL7I 3BSHA 4V11A 4KVCL 3HB3B 3WLWC 3IGUA 1L4IA 3V6OA 4GXVH 4FHKA 4G9FD 2Q6WB 4ZUTA 1K6QH 4MJID 2EEDA 2APSA 1JOIA 1P7QB 1KC5H 1G9HA 2PCPA 1UD6A 2ARWA 4EZLA 1YEKH 4JDEA 4XO8A 4PJ8D 4OU3A 2V2XB 3K4ZA 5IQLA 4N68A 1Z5YD 3QXTA 2DDQL 1H6UA 4WI8A 4JFUA 4E9SA 4TLSA 2F5BH 2GTZB 5CJ5A 3DK0A 5ICZA 4MAZA 1MI5E 1CE6A 3RWJB 5KJRH 1RUAL 2GY5A 3LQZA 4P5MB 2H1PL 3EYFB 3RWHB 5DRXB 5EORH 3V0HA 4NXSA 4PJDB 1MCLA 4WUKH 1HCYA 3C75A 3DWTA 3V0VB 1A9VA 2E5EA 3FN9A 3DV6A 2HG5B 2VR4A 2HFFB 5ISZA 1UT1A 4AV5A 4PRBB 2YO3A 2VE6B 1LVEA 4JO5A 5KVEE 1GCYA 3DDFA 1KT2A 4H8QA 3RY6A 2EINB 4MWFA 2C4FU 3IDNA 4JFDB 2EDRA 3JWDC 3TJEL 5HPMB 1W8OA 4JS7A 1WLHA 3QXAB 2XZCL 2ATAA 1HIML 1T20A 2IO5A 1FZJB 5ID1A 2K70A 4JDZB 1F4YL 4ANKA 5DS8B 4HUVA 4MGXA 3NDZE 2X4QB 4FG0A 2AI0L 5F7AA 1F2XK 1PG7X 3A4DA 4ZG1A 1E90A 3BAXA 3GTVA 3ECQA 1E4KA 1JXGA 3QIBD 2PXYC 2P5WD 1J9RA 3GMMA 1QUNB 5EO9A 4K7PX 4RZKA 3SGJA 4GRMA 1SMDA 4ZUUA 3HMXH 3MLZL 3HUJA 5AZEH 3NP4A 2ZCZA 1E3ZA 1SEQH 1X5JA 5DS2A 4E5XB 4WKZB 4GUCA 5G4NA 4HA1A 3TEWA 1EH9A 5J6GA 3K8MA 3RI5K 4MD0A 2VXQL 1KV7A 1PLGL 5H2BA 4LQFH 4QHUB 3TOPA 5ETUA 2IBZY 2W9LA 3E3QE 3QUZD 4O02L 2GIYA 4TOYL 5D1XD 4KK9D 3T2LA 3LS4L 2K7PA 1DFXA 3NIDB 5F7MC 4R5VA 4NO5A 3S3JA 3DMMB 1D6EA 2VYRE 3G04A 1FF5A 4WFHD 4TQEL 3U6RA 2R29A 3BJ91 4HIJB 3RZCC 1DZBA 1W91A 1P5VB 1T7XA 2H7WA 3FKUS 3I6LE 3LNGA 3MA7A 4Z5RA 2RFXA 3STZB 4JQIL 2KPWA 4NSKB 1SVCP 2V5SA 5BV7B 2OMZB 1MHHB 3AS1A 2IV9A 3K71B 5CUSH 2A9CA 2BFVL 1YN6A 4UOW1 3U4BH 4XZUA 3ZTJH 2GITB 2WWKO 3P9LB 2VZ1A 4H25A 1U8HA 5CP7A 3B7SA 1QFWH 1PFOA 4AH2B 1UD5A 3HLAB 3MTXA 4FG6D 4DEPB 5IMMB 1WAPA 4GBXA 4OCWH 3ZKQD 5CLWA 2R1YB 1VZHA 5IHBA 2WQXA 5EFIB 1ZDQA 4MA8L 4E9XA 5AVVB 2WLIA 3QEHA 1FAIH 4FI8A 3C8HA 1I8KB 3D30A 1XV8A 1BX2B 4JHWL 1MI5A 2ITCA 5DEGA 3QNZB 4AYEC 1OWWA 4J3BA 3HAEG 2WLLA 5GS0C 1DQQA 1V3LA 1J8HB 2HRLA 3PE9A 5F7EL 1YEGH 2AEOA 4PFEA 5IB4B 3EZ8A 5H37H 4IDLA 2VQ4A 1BQHB 3CD4A 1JZ7A 5KG9A 2NY0B 5H94B 4U6VL 3L3OC 2VC2L 3RFZB 1MCDA 4DVBB 3VG9C 4NENA 2E9WA 1LO5B 1XGTA 1X5KA 2X4RB 1V7NL 4YR6B 3BH4A 5KYWA 3RDTC 4FQ1L 5HJ3B 2Y7QB 1HK6A 5EF3A 5E9DE 4G7QB 1L6XA 4JFQA 3UBXA 2MHAA 1WAAA 3BVXA 5GSVA 4B9GA 4XXDB 4XAKE 1YPZB 1OB1B 4GQ9H 5CZRA 1KPRA 1JWMA 1ONQA 2B9BA 2IAMA 1CD1B 3RPIB 3WNIA 4OR1A 2WNGA 2K4WA 5T3ZL 1MUJA 1PLAA 1G1YA 2X4OB 1Q9OA 2NX5E 5MENE 1UWGL 1Q0XL 1IUZA 1IGCH 4D0BA 4OF3A 1OCZB 3T8MA 2ICWB 2Y6SD 1IEAA 1QFUH 1ZVNA 2JXMB 5B4MC 1QAWA 2R8SH 5KYYB 3TBCA 1WH0A 1KBKA 3FQNA 4FTDA 2MFNA 2WGNB 1F45A 2JSFA 3MJ9L 3EUUA 4UV7H 4MAYB 5FGBA 4JJ5A 5SV4A 3VFRA 2ADJB 2ZKHL 4GMTL 5AW9B 4ORZC 5L0QC 4KV5F 1MIML 4L3AA 5IFAH 2ZUVA 3CDZB 3WFZA 1XD1A 1F02I 2DD8L 2XWBB 4PWIA 1ZVHA 3U9WA 4R7LA 4BKTC 3ARYA 5HI3D 3OKYA 5EDSA 1F90L 4B3EA 1GA2A 3WE6B 4DKEH 2BOCB 3QJOA 3D2UB 2ICWI 3B9EA 4ZUWA 1W6WA 5A7EA 4UYQA 3QCUL 4MRBA 1Q9WA 4D0CB 5A40E 4KX9A 2CRIA 2N1KA 3NIFF 2FZ3B 2X3AA 5F7FA 1SF5A 3HBZA 3WTSA 2R69H 4I9WD 1EMTH 3GS0A 1WC7B 4NCC2 4X7TA 1JTPA 2NXZD 3QDJE 4ZMTA 2CHXA 1AGFA 2PN5A 2DQTL 3GKWL 3O6MH 2AC0A 4IS6B 3ME0A 1I1AC 3CFCL 1NCWL 2VITB 2FD6L 5GRVL 1VPOH 1FIGL 1OZUA 4L29A 3NA9H 2WBJB 5AW3B 4S11A 4HXAL 1QYGH 4KX7A 3LCYA 4MZIA 1A5FL 3PHQB 2IPUG 4PLOB 3RWIA 3DVIA 5IESH 4PD4K 1MVYA 2F54A 3VXRB 1OSPH 3IDJB 4DN4H 3QZWG 3ULVC 4JFXA 1YAIA 4FGMA 1XEDA 1RULL 2ERJC 3GSQA 1HSBB 1NLBL 1K9TA 5BVJB 4YSQA 5T1KB 2DMGA 4PRHD 1NMCB 1P4IL 3HE6B 4LZKA 4PUBH 4P9HL 4XBGA 4MMZB 1QASA 2AZAA 4MCYA 1NFDB 5DJ0A 4I48A 4PB9L 5C6PB 1GKOA 3QHTC 3ZRCC 3W2DL 5HVHB 2K6YA 1TCRA 5C0BD 5JA9A 3IFOB 3AROA 3WFDH 1I3GL 3H4FA 5E9DA 2AQ2A 3LZQA 1MFAH 4QRPD 2DIJA 3VWJB 2X4NA 2ZWLT 1RCYA 5HHMD 4JFFE 1JGUL 4OIIH 5I74B 3WU1A 1LD9B 1QLFB 4JPVL 3AM8A 3CUPB 3AG3B 3BCDA 3GFUA 4NQVB 3GBDA 4CBPA 3HZKB 2Z92A 4IYKA 4U6HA 3CPLB 4POUB 4LRIA 1IBGH 4XPFL 2N3JA 1BEYH 2NX5A 3KEDA 3O8XA 4AW7A 5DEZA 4NN7C 3ILDA 1X9UA 2LLLA 2O26U 3EJCA 3FUMA 1CYXA 4M48H 4PWJA 5FA4A 4A55A 4DQOH 5IB5A 4NJ9H 5KVGL 1GJIA 1DYZA 1QX1A 4NQSA 3T2OA 4JJHA 1XGQB 4BRVA 4WSKA 3CBRA 3MOAH 1N9PA 4KDTA 5J56B 4MHHG 1A4CA 1NBCA 3PNRB 2BHUA 5DVPA 4KUCD 1KELH 1FL6B 2QLVB 5B1CA 1HSAB 2VZ3A 9PCYA 3TBWA 1NIDA 5HI5D 4H8HA 1DDTA 2YD1A 1N5AB 4XRCA 1OTTD 3SKOA 3AWFA 3ARUA 3CXDH 1IGIH 2EVGA 2XCMC 1P84J 2ZAIA 5DMKB 5D4QA 4ELMB 5KVFH 4N85A 3ATFA 4JFPB 3W57A 2VKWA 3EGSA 4EVNA 1BJ1J 5KBMA 5L6YH 1OARL 1FG2B 4LL1A 5L7XH 1PAZA 3G6AA 3WTWA 2GAZA 1BOYA 2JCCB 2OTWA 5C0NC 4JO4H 5ADOH 4KROD 1EANA 3QDJA 1VHPA 2W1NA 4CC4A 2HZHA 2QZQA 2FQFA 2XBZA 5BOZG 1WBXA 4N90E 5IG7B 3FTWA 2G3XA 4WY7L 2PYFB 2GJ6B 4U49A 1TTAA 1OAUL 2OMVA 4NQDD 3WTXA 1N0LB 4FQXA 1MG3C 4QAWA 2CPCA 2H0FA 4FNSA 5FO7A 2KC0A 4GXFA 1TG8A 4ODTL 2JIXA 3MMEA 2KLRA 4R0LC 2OSLA 4OBSA 2VGLM 2EJ1A 2EEXA 2GC7C 4N2MA 3U9PH 4H44C 3ZZSA 4GEIA 4QJ5B 2FJGA 2A83A 3HI5H 7PAZA 3GJFA 4K3EH 4AGQA 5EC1A 1OAKH 3CFDB 4G9DB 5HGAA 4Y4KB 3BZDA 5AWNH 4NO0D 2YXFA 2JI1A 5KN5A 2R7EB 4A7TA 1U8LB 3AMLA 1CLOH 3FT4B 3ZMEA 1XGYH 3CSTA 3QUKB 4X4XA 5EIIG 2OI9C 4XO5A 2YD2A 4P5RA 3RY5A 3W9EB 1RK1A 1S2EA 1G84A 1SBBA 1XZ0B 1ZT1A 5CHNA 3PNWA 3DHUA 1T4KB 2CA4A 2EIZA 1DBKH 4P59L 4J3OH 5DA4A 3KL3A 4F7KA 3PWJB 4LNRA 3C5JA 1G9MH 1YEHH 3IDUA 3V9EA 3TPUA 2X0UA 5HYSB 5JOPE 4NC1C 4H8WC 4YE4H 2XC8A 1VJSA 5F7NC 3V4LA 3X17A 3R4RA 1EUUA 4RRPM 4UT6A 4RWYH 3MUY1 4X7DC 4TPRL 1BVLB 4GI9A 4H88H 1JYNA 4KY1L 2DM2A 2DWDB 1NC4D 1RI8A 2HKHH 4XXWA 5AW2B 3W9DB 5FO8B 1M71A 1RJLA 1DLFH 4QO1A 4XMKH 1DLHB 3PP3K 4NBZB 4ZK8A 4ZT1A 5KUMA 5J9PA 3GHEL 3KXFB 2B1HL 5AOZA 2VDRB 4CVWA 2J5WA 5CD5D 1KIQA 3ZKMD 3CAFA 2XQBH 3TASA 2JB5H 4KFMA 3MRQB 4A2FA 4L4TE 1L0QA 4ZUVB 3EJZD 5KBNC 5K69A 2D7NA 3K1DA 1HDMA 2KMWA 3L81A 4DF9A 4DPBX 1TZOA 3C6EA 3KPOA 4OGAC 4TV3A 2D4DA 3WY3A 1F1DA 5D8JH 4UWQB 3BMWA 4KKRA 4GRLA 4LARL 3BP4A 3C6LA 3NH7L 5CIPH 2AGJL 3T6QC 3VI4E 4FL4B 4XNXH 4UCFA 4OBRA 4JRYD 5C0RH 1O75A 4FMFA 1UA3A 1USZA 2NY3B 1IGYB 4XPGH 4NO2A 4L1HA 4HIIA 3VNZA 4WTZG 2WXGA 1HZKA 5EU6E 5JW5B 3Q2VA 1T0PB 4JKKA 2QVKA 3WGUB 3PGCB 5D4IA 3TYFA 4I87A 1WBYB 5IWLA 1AHWC 1I9RL 3KLSA 1J5HA 2G60H 1IAII 2Q76A 2Y5EA 2DW5A 5DK3A 1TTGA 3TEZA 3BHBA 4PGEA 1TJGH 4KRMB 4WFED 2CO6A 1I7RB 4HZLB 5D7KE 4AZ8B 3NZ8B 2NR6D 2ZCLL 4ZW3A 1M7IA 2NNAB 6FABL 3VD0A 1KXHA 3WO4B 2YBGA 4AEIH 1NWOA 3MREB 4LCWD 4AYSA 3GB7B 2WN2A 4PS4L 3O4LA 3T71A 2E7DA 1EWHA 4N2FA 1JV5B 2A74A 1DDHA 3RTQB 4XGZA 1DANU 1OGTB 4WWKB 5J11B 1MEXH 2O4EA 1FUNA 1INQA 4L0ZA 1MNUL 1EAPB 1JGEB 2Z35B 1KGCD 3KS0J 4U1KB 1G9NL 2WXJA 1UT9A 1NQBA 4YHML 1UA6L 5L8JB 2NY4D 3AB0C 3FNKA 3V4PL 3BMVA 3ZDYB 5C8JA 5JQ6L 3N5AA 5I16A 3IFNH 3VFOA 2VXUH 2R2HA 2EVFA 1RZKH 4HHWA 4F7PA 4F8OA 2QHLA 5D5MB 4LOUD 4G80A 2EDHA 3DRQA 5AOKA 4JG1H 1FC2D 3U0WL 4NQXA 4M3JA 2I9LA 2FEDC 1P7QD 2PCFB 3LKPB 3S5LA 1EEZB 3AGVA 2ZP8A 1DFBL 1OZTG 1PD1A 3UPRA 1FZKA 4IDJL 1LM8V 1QBMH 1Y0LA 2BP0A 2Y3AA 3QCVL 1TZGH 2H2PC 1MRFL 4HQQH 4OLUH 5E00B 4AITA 3DXAA 4KZEH 2DJ4A 3FQ1A 5FUCC 3TNMB 4XVJL 2JELL 2ZIDA 1SY6L 1FC1A 5HJDA 4WO4B 3QORC 3QB7C 4N5UA 4HEPA 4APQC 1RP8A 3S34L 5KSBE 3L6FA 2WY3B 4YBHA 3OPZH 1A9EB 5TDOA 4EJ1C 1FO0L 1KTBA 2LR4A 1QSFB 4BEIA 4AIXA 3KPRE 4M4PA 2DTSA 2XY1A 4HLEA 2A6KB 1U3HA 4BZYA 2WNXA 5FV2A 3VI4A 4LMQE 1AO7B 5LNEA 1NPJA 4DP6X 2C4XA 1DO5A 1NGXB 2QGEA 4PWGA 2ICES 5HYQB 5DQ9B 4ZAKA 1JTTA 6PAZA 2YKKA 1P7KB 1FGNH 1MFBL 3NCXA 4G6FD 1W80A 2CKNA 4KMTL 4OLZH 2QPFA 5EU6A 5AVUB 5GGVH 3U4EA 4ZO8A 1TQSA 2BO0A 1G1CA 1WHPA 2VRQA 4B60A 1U93B 3KBHE 3AT9A 4XCYA 2EECA 5TE4H 3BAIA 1RJZA 5LNDA 5HXMA 4Q6IA 3O6FB 4IOSA 3ILPA 3K6DA 4G6AD 3VE0A 4YHKH 5F1NB 4U4BA 4JHAL 4F9PA 1F8TH 1KPUB 2XY2A 5E6RB 1CTNA 3UDWA 3GZPA 3VU1A 5TF1H 5EU7C 2GTWA 1RMFL 3T3PF 2XPGA 5LWYH 3RIAF 4AJYV 3Q05A 1RHHB 3S4SG 4B0MM 4Y4HB 3RL1A 5ESQB 3LHAA 4JY4B 1BXUA 2AANA 5BRZB 1T66D 1AI1L 1PLCA 5CBAA 1YY8B 3NUKA 3RUGB 4DP4X 5J06A 4NNYB 1W0WB 5FO9A 3DMMD 2VKXA 2DQMA 1RZFL 2P49B 5LGHL 1XX9C 1IB5A 1EZVX 1NCUA 4LKXA 4JE0A 2XPZA 4R9HA 3IEAA 2YZ1A 5F7WC 5E08H 4N4YB 5D7JA 3QO1B 1UOLA 3BP5A 2UUDH 3VXQB 1OF0A 4FHBD 3ML9A 2WKLA 3W82A 1CXIA 2I07A 5EBGA 4AMXA 4HDIA 1E3XA 1N64L 4UILH 3T3MF 1G7HA 5JHLA 1VFBB 1UVQA 2V8MA 1CLZH 3AMKA 15C8L 1XIWB 5FYKD 2G2RB 3MLSH 2WKOF 4HK3J 3JVGC 3OB0K 2A9AA 3FJTA 3VFPB 4G8EB 4P3DB 1J5OH 2VRAA 2EEFA 2ZXCA 2NSXA 5CEZD 3QJSB 1G6RA 4MB4A 2C9AA 4PY7A 1ORQB 2AXJA 3ZDXF 1J8HD 4C4BA 2PWHA 2VWEE 4AIOA 3K81A 2AP2A 3KPRA 3EO0A 3PP3H 1WV7T 1QQDB 2GPZA 2AW2A 5C0EB 2NY0D 4Y2NA 1X5FA 3P4MA 5HYFA 2P42B 3MRJB 1G94A 4GB9A 4A38A 3DECA 1FDLL 3VSTA 1I9IH 2RA1A 3APDA 4DSYA 3SQRA 4C4KT 5I8OL 2NSMA 2PO6C 2YGPA 1FNEB 4XOAA 4Z7IA 3ISRA 1RURH 3E2HC 3HVDA 5AKRA 4ABVA 3D12B 2PABA 4KHXL 1GYUA 3VGHA 1X4XA 4J3XA 4DW2L 1AG6A 1AR1D 1KXVC 2ZYHA 3VU2A 2E8ZA 1LNUA 4FQHA 2IQAB 1H15A 4MS6A 3JWNG 2ZCHL 3Q5OA 5ANME 2PWDA 1J8RA 3SZKC 1CE1L 2VW7A 2COVD 2W0KA 2GEEA 2NYYD 5C92A 4XNYL 4ODWA 3ZGIA 5M94B 5BW7C 4MBOA 5AL8A 3NFPB 4Z1PA 5D71L 2EDOA 1ZS8B 4OTXL 5DT1L 5AVRB 5MP6L 3WXWL 1WTGT 1KSRA 1KLGB 3MRGA 2EDXA 4NJAL 3TH4T 1T2XA 4P9HC 1OAXL 4MAYD 4FYSA 3FDWA 3GJEA 3F7KA 3VQ1C 4P5TC 5CNHA 3TT3H 4HGWA 4IOFC 5JDJA 4Q9QH 5BNXD 2MCAA 3CHSA 2Q1EA 4HEMA 4I5BA 1FHNA 1GIGL 2SODB 4HD9A 3N0PB 4L9LC 4YHNA 2HRHA 5AW0B 2AF2A 2OR7A 5EOQH 1BF2A 3UZEC 3CFTA 3QZBA 3MRKA 2OA9A 4HC1H 1U8IA 4X0KA 4Q74A 2YGOA 3D09A 5DSCA 4MJ5A 5E8EB 1PZAA 3BQUA 1ZT4B 5TPWL 4WUUE 5B39B 1ZV5A 1DVFC 3VXSB 2H6OA 3P0YL 1S46A 2DEYX 1A6TA 1AH1A 3KLKA 3EFOA 2WQWA 2DY2A 3ARBB 5FK9B 3ZSSA 1RUPH 2IMMA 3SE6A 3SKUD 2NQ3A 5CJOH 1QSVA 4HSCX 3P4OB 4IRJC 1KENL 4XT1C 5SX5K 1A7QL 1OQXA 3DGGB 3KVDD 2PWGA 4NGHL 1FLRH 1DJZA 2W9EH 2QVTA 1RZGA 3UZQA 3MCLH 2WBJD 1AZBA 4JREB 1N0XH 4PLJC 1SXNA 5AZUA 2BIIA 1K8DB 4HJ0C 1TVDA 3MRHB 3IGLA 4LHUB 2BSTB 4B9ZA 3D52A 4HG4J 2DQFA 3VXRD 3QI9A 4L37A 1G0XA 1MLBA 4ENEC 2O61B 3EOBA 4LSPH 3VFNA 2C9UA 3L7FB 2NNXA 4RRPA 5AW1B 4UOQA 4URKA 4Q52A 4RFOL 3BEVA 2KI6A 1IM9A 1VENA 1KWGA 4YLQT 1TFPA 2YSSB 1J1PL 2BSDA 1S9YB 3MV9A 3U46A 2Q2LA 2AMGA 4HD5A 3CFMA 5E8NA 4NUGH 2WZAA 3BP6A 5FYJD 3EYUH 5CLYA 2GK0A 3T4AB 1Z66A 4OIBA 4Z7OE 4LSTH 5E4AA 2YXVA 2OW7A 1A7PL 2Q3XA 4AIEA 1AP2B 2BS71 1P0SE 1KJ2L 4YHOL 3VCLB 3A0OA 4X5WA 5DUPH 4UT9L 4XAWH 2QKIA 3MJGX 4TUJA 4DOHB 1OP9A 4UZSA 4QMEA 2VN4A 3DETD 1BMWA 3QG7L 4F9LC 1KYAA 4P46A 4UQ3B 3SE3C 2XN9A 3WN5A 1FFNA 1TVBB 4I4WA 2CLZB 4JO1H 1YNTF 3LD8B 3EG9B 3NCJH 4UQ2A 4BKLB 4BWWA 3VFSB 4EIBA 5JIMA 1CWVA 4D9RD 2W9DH 5DJ2B 5AUMA 4FYRA 4ZBJA 2EO1A 5DEFB 1ZT7B 4PJ9C 1LO3H 1LILA 5GSRA 2HT3D 3NSCA 2QVIA 1MCRA 2GFBB 2NZ9C 2ED9A 4G1EB 4J12A 3JUYA 5DHVH 3F7YA 5EOTA 2VMDA 1E4XI 2CHNA 3QWRD 4LHJB 2JWYA 4JGNA 3VW3H 1IKNA 3AWGA 5I8KL 3E1F1 2R2EA 1KIUA 4ZMVA 4YOKA 4HS8H 2XVLA 4LVNC 4P2OB 2JJTA 4WENB 2UY7A 4I0KA 2VDQH 2XZQH 2YMOA 4B27A 4I3GA 4UU9A 1ZHBA 4WUUA 4GSDL 2BY1A 4G11A 3ULUL 4U1MA 1FYTB 3ZDWA 3FQ2A 2HVJA 3H7LA 2R4RH 3QPQC 3FT3A 5F9WC 1PS3A 4FQQA 2AV7A 3K2UL 1Y1DA 1TQCB 1CURA 1P4LA 3V6BR 2OL3A 2FSEA 2PW2B 4Z7VB 4XHJD 4N0UA 5T1LA 2X6BA 1FRGL 3N04A 3DK2A 1SGKA 2BNRA 4KZCA 2GBAA 2FB4H 4JX0A 2KZ1B 1G7PA 2GJ6D 2IGTA 4OKVB 4PMFA 1O6TA 4EZMA 2A4CA 1HXKA 4L4JA 3ESNA 3GSWA 4POZC 4MVBD 1EJOL 3FT0A 4ANVA 2CRZA 2GUOA 3IFLH 2WZ0A 3EW3B 2Z91A 1J0HA 3FH7A 4XR8C 4Y1TA 5IBTL 4BH8A 2FR4B 1RZJH 1R9FA 1SNRA 5JLZA 4LLQA 4CMMA 1HKLH 2Y06H 3DVGB 4M61B 1FL3B 1RUMH 3D3VE 1J12A 2WUCH 3S7GA 4PJAA 4PR5A 4Y4KD 3KHQA 1UWXK 1MWAA 5I73C 5EF2A 5GGRA 3NACH 1MY7A 4Z23A 3MV7D 4OZIF 2HTLC 4IEFA 3QFDB 3MYZA 4G5ZL 1KIRA 1H3WM 4NWUL 4JM2A 1K4CB 4M62H 3OX8B 1TETL 1S7WA 1WQVT 4Z7QF 4X5XA 4EOWH 5FC9A 1KULA 4XNUL 4LSRL 3ZL4H 5EPMA 2BRRL 3GRWA 5I8EA 3TIDB 2VXVL 2EEAA 2R0ZH 3D9AH 1U8NB 1BD2E 5ICXB 3WUWA 1MLCA 2Q86B 2E27H 1P6FA 3GMNA 4IW4C 1WITA 1KB9K 3P3YA 1AKJB 4NZ8A 3HOGA 1G7LA 3BSZH 4YXHH 2CIIA 5I1AA 3RWFB 1JZHA 5C0DA 1IFGA 3UCQA 1JYXA 1FVDA 2ZSWB 4ANWA 5DJZA 1XBRA 4JBSA 4W9GC 3MJWA 2VL4A 1FYHB 3ROOB 4WZ9A 1JHKH 2W60B 2XG5B 3PAUA 4N2EA 5B1KA 4OFDA 1MFVA 1YYLH 5I5JA 2ENSA 4N2CA 1MRCL 2PXYA 1V3JA 1F58L 4TUOA 3U48A 5JO5B 5GIRA 1HNGA 2GSIB 3KXFD 4GAGL 3WNKA 4AWJC 5GXBB 5E0FA 4M5ZH 2CZNA 4OY9A 4M6NL 4HBCL 4N1HB 1IQDB 4OFYD 4R6UA 3BEWA 3VSQA 4FG4A 5DVKA 2WINA 1G9NC 1NA8A 3GMRA 2P5EE 2BP8B 3KLAB 4UI2A 3CLFH 2E3VA 3MV8E 3O3UN 3QZNA 4I3SL 2A0LD 1U8QA 4LLUB 1M57B 5JR1L 4OV6F 1SJMA 1JRHL 3N1QC 4OIAA 1JGLH 4HIXH 3ULUF 1EV2E 1T0NA 3RWDA 3B9AA 1JZJA 4WTWA 5HDWA 4CKQA 1Q72H 2F8VA 3F3HA 3RZCA 2HG0A 2XXMB 2NY3D 3LSOB 2ORBH 2ZNWA 3N40F 4G8GB 4YQXH 3G5VA 2W07A 4WTXA 3DX8B 4OJCA 1UUSA 2F58H 4DGVH 1FPTL 2VM4A 4PRNA 4LU5L 4FTVA 1HILA 4GP5B 1IEBB 5M95B 5C2BL 3U0TB 2IWGA 2CK0H 4PJHF 3UG3A 5I6PA 1AIFA 1J87A 3WTVA 5I1GH 4L8SC 4M3KB 4FQ2L 3FTGA 1KYDA 2ZG2A 3C2SA 2WOYA 4JLRA 1KB5H 2AJZA 2EE3A 3QIWB 5INCA 1IAIL 3QNYB 2ZAGA 2XV0A 4L2LA 5DYOA 5DUBB 2J56A 3D3VA 2WIIA 4V1DE 2V33A 1RK0B 2B5IC 2YA1A 2ZWNA 3FUHA 1DQDH 3OKMA 2C7UA 4EI5C 1G6VK 3HB3C 3ULVE 3BDYL 4PJXB 1NCHA 3L4XA 4X7SL 2ZOWA 5BQDA 5BOPA 3VFGL 4TUKL 2NMSA 4O2CA 1PG7L 5LBVA 3VWKC 5FKPB 4CAGA 2X70A 4OD1H 1TLMA 3L3OA 1BVKB 2X4SB 4K7PL 3RTQD 1UZ6F 1W15A 4WWKD 4AIZB 3U30C 3EXLA 3MBEC 4PV9B 1K85A 2BNUA 2AVFA 3MFFA 4GUPA 2JQMA 4GOSA 1BD2A 3Q8BA 2X28A 4N0CC 5FW7A 2WZPD 3PWPE 1E6JH 1YHPA 4ZUTB 3B1UA 3UIZA 1Z9NA 1QA9A 4Y5YC 2RAMA 3K2MC 3NDYE 1EBAA 2PCPB 3O4OC 3H6AA 3ILEA 4FD0A 4JDEB 4ZO9A 1W6LA 1BM7A 2O93L 3LXAA 4GO8A 1N7MH 4W9LC 2R15A 2WYIA 2A4EA 2ZYRA 2LU3A 2IQ9L 4N0YL 1BQUA 2OXGA 2OZNA 5CLTA 2VLKA 4XPTL 1NLDH 5ICZB 4YHYB 1NL0H 1BYNA 1CE6B 3NTCL 1FVCA 1PEWA 4LLMA 2I85A 1PMYA 3IYLW 1ZD6A 2WW8A 5E56A 3GDCA 4YK4C 1L7IH 3LQZB 3VA2C 3LNIA 5D4JA 4P2CG 4N9GA 4PJEE 3QP3A 1BQHG 3IU4H 2ZX9A 1Q94A 2VJ8A 3DV6B 4WEEA 5AVZB 5EIQA 5I0DA 1BREA 5ISZB 2GG1A 1SLVA 4TSBL 4WO4D 2YAFA 2OTPA 2P5EA 1IGFL 3VFMA 1WZ1L 3RVUC 5E1GA 3MV8A 1KT2B 1JYWA 3N1FC 5JMOC 4MWFB 1MFCH 3IDNB 4UQCA 1QSFD 4R7VA 2HLAA 5INDA 1LK2A 4HMEA 3OGCA 4Y9BA 2AABL 5EV7A 3O2VH 3U7WH 3VDCA 2Q9OA 4XN1A 1J86A 1I1FA 1OAQH 1T20B 2DMBA 2CDFA 4F58H 5AW4B 1AO7D 1R24A 2ZT9C 5ID1B 2K8MA 4QCIA 3VMOA 1RH8A 3PP4L 3UC0H 4HOXA 3F6JA 5CD3A 4HUVB 1BAFL 2J44A 1HC1A 1IBYA 4ODVH 3LRKA 4AG4L 3GHPA 1ICTA 1ZTXE 3HC3L 2Z31C 2BVPA 1NCAH 3GMMB 5EO9B 3FOLA 4GRMB 4NCC1 1AS7A 2ED8A 4ZUUB 3HUJB 1I1AA 3G5WA 1MH5A 5F3FA 4LP5A 4UMSA 3SQBA 3VD2A 2HSIA 2A77H 1XDTT 4KKLC 5J6GB 5TFSL 4FYQA 5F6IC 4KI5D 1DCLA 3AXHA 4X9GA 4AYGA 5TJWK 4MD0B 3O6FD 5C6TL 4MB1A 3LTVA 5H2BB 4QTHA 2R56L 4YS4A 2E4TA 1C12A 1UM5H 5ETUB 2VDPL 4FHJA 1JNHA 2D3VA 2YAQA 2I27N 4YBLC 4NO5B 4QOKA 3N55A 1D6EB 2JKTM 2YKLL 1OWRM 1I1YA 1A0QL 3G04B 2C3XA 4AUJA 3U6RB 5EEZA 3OBAA 2VAAA 5BS0E 3P0VL 1V27A 1VERA 4X5PA 4Y4HD 1HYSC 1YSOA 4Z5RB 3MA7B 3ELQA 2RFXB 3CPUA 5BRZD 4IJ3B 4A7GF 4YC2B 5E8OA 4CMHB 5I1JH 5KANI 5EMYA 1LQBC 3PWPA 1YN6B 1JXFA 4XZUB 5F9AC 1FLTX 1U3JA 1OD7A 3UFIA 2ATKA 4H25B 1U8HB 1V05A 2CHZA 2YD4A 1BDYA 4P48A 5F7HA 5EEUA 4JHZA 3NZUA 4G7SB 4NC1E 4LVOC 4GBXB 3FCSA 3QCTH 5TK2A 2I69A 1EDYA 4NN6C 1IRAY 1SXBA 2XFGB 3NAAH 2WLIB 3QEHB 4RGNB 4K73A 3MLWH 1MI5B 2ITCB 1DJYA 1GHFH 5DEGB 3KLHC 2V0AA 3CVHH 2WLLB 3V4VA 3ARZA 2WXMA 1DQQB 1AAJA 5C0IA 3ATDA 3KPQA 1XIWD 2J6EL 4PJEA 3VXOA 2QGCA 1D7FA 3WEAA 4PG2C 5KG9B 3CIQA 1TENA 4HFUH 3CBKB 1EAQA 1KEGL 3NIGB 4NENB 1XGTB 3PJNA 5KYWB 5H37G 2Y3NA 3BZFA 3CC5A 4JFQB 1RPQA 4NC0B 1GZQA 2MQCA 3UBXB 2MHAB 3SQOL 4JPIA 1R4XA 5E1AA 5GSVB 5HYEA 1TMQA 3L8QA 1JG9A 4GSUA 4LSSL 1ZJAA 4JFHD 1OOWA 1KPRB 4WFFE 2QPEB 1JWMB 1ONQB 1SLUA 4WFGD 5LBSL 2IAMB 5MI0B 5CEXA 1KGYE 3UJIH 1QEXA 3JVFC 3C60D 3PPSA 1MUJB 1TZIA 1Q9OB 1OGSA 4D0BB 3E9TA 3GYRA 1IEAB 3SPCA 3FQNB 1ZDSA 1A7OH 3IDXL 1BZ8A 3PWVA 4UTBH 1PX4A 2Y7LA 1CFVL 4G72B 3UBXI 3WHE1 3RAJH 4JJ5B 3VFRB 1M4KA 2BERA 4UBDD 4C56D 4HIEA 4Y7OC 1IGJA 3TCLA 3TF4A 1F4XL 4Y19E 4JY5H 4R0LA 2MQ0A 4M7LL 5LXGL 4M29A 2EC9U 3ZIMA 1AC6A 2D2CC 4FFWD 3WKNA 2APWA 2DWEA 3NZHH 4GW5A 1A4KA 2CM5A 2QELA 2VMCA 2Y23A 4Z7AA 5F9OH 4ZUWB 4ATWA 4OCYL 5I18L 5KBKA 2QV4A 3MACL 4ZTPH 2DYRB 4YH6A 1Q9WB 5BS0A 3UERA 4BM7A 1AXTH 1YA5A 1PJWA 3UTSD 1FNSH 2V5RA 4G59C 2M2DA 1ASPA 3B6SA 1IKOP 5CGBA 2HMID 3IAPA 3C2AL 4PJ6A 2UXGA 4X7TB 2N56A 4JQXA 3GLZA 4ERSL 3L9EA 2AV1A 4NM4H 1AGFB 3B2PA 3GIZH 2F74A 3ME0B 1I85C 5CZXC 5B38A 3STBA 4MMYA 1WFJA 1DBBH 4TQ8A 2HYMA 1MWOA 4L29B 3VXSD 3QQ9C 3CHRA 2DMHA 3ZT6A 4HWEH 3LB6D 1JJUA 3W39A 1MJUH 5MHSD 3ARBD 4U1JA 4HS6A 2CMRL 1CLCA 1YNKL 5D7IE 3RWIB 1EAOA 1XL4A 3H3PL 4MDIA 5HVHC 1S9WA 2F54B 2GIXA 5DZLA 3RVXD 4BQ6A 4FA8A 1NMBL 1V55B 4JFXB 3US9A 1EO5A 3GSQB 2FECI 3NGBC 3N1MC 1UB5A 3G6JF 4LEXH 3VWJC 3NBNA 3GBLA 2VERN 1MIEH 2E86A 3H4HA 4HF5L 4PJCF 4XBGB 5DD0H 5CINH 4MCYB 5DJ0B 2WXRA 2XA8L 4I48B 4A63A 2BS9A 1E40A 2WCGA 4YDKL 4LIQH 1TCRB 2JKIS 1QO3A 5FUCE 4F93B 1M7DA 1MCBA 3HMWH 5E9DB 1GVIA 1CIDA 2OMNA 1N8OE 4OCSL 2X4NB 1TZHA 5IR1A 3SB3A 2OQJA 3PQYA 3ULUC 2J8UF 2B7DT 2F19L 2YGQA 3J2PA 3UTTE 1V3KA 4YO0A 2X44D 4FLOA 2YRLA 4K23H 2WJ7A 4AYMC 2J4WL 2Z92B 1YNLL 4U6HB 5F72S 3A67H 2VLLA 3AQDA 3NIFE 2QADC 3BUIA 4OFKA 3CVDA 2NX5B 1M9WA 4MFHA 4HLJA 3O8XB 2BW4A 4FQIL 2HJKA 2EYTA 3MVSA 5CGTA 4IMKC 4WU5A 4OD3L 2ESVE 3FOMA 3LY6A 1CB4A 5FA4B 4ZFFA 2OMBA 3G08A 1JL8A 4G6KH 1Q0YH 5IB5B 3U2SA 1E8WA 2E9IA 4H26A 5EWIH 4NQSB 1LYQA 3SGEI 3CXFA 1TFHA 3WMQA 4LSVL 1N4XH 2K6ZA 3IGAA 3L4VA 1FHGA 1SFDA 5CZVL 1AHWA 1Z3GL 2NY6B 3QNFA 3VA6A 4NHUA 1KYUA 4YDLC 4M9OA 4EQ3A 1XAKA 1Z9PA 1L7TH 4L3CA 3TBWB 5GGRY 5AFAA 4DGUA 2XHNA 4XRCB 5D1QC 3SKOB 1LWHA 3NJLA 3MKKA 3ABZA 1HHKA 1IU1A 4TVPD 4XP5H 3VM7A 2IAND 2FLBT 1QWHA 2EDWA 5E9NA 1PD0A 1MCEA 3LNDA 3NESA 1OLZA 4QRRE 1A1NA 3HZVA 3D18A 1R3KA 1F42A 3GM8A 2D2OA 1QI5A 3EGSB 3FZUC 4L8DA 4EVNB 2EDNA 3G6AB 5IW6A 2GAZB 4JZNA 1T0MA 1NEZA 2OTWB 1MW3A 4XN2A 2I9TA 5E5UB 2P52A 3QDJB 1EO8L 5DD1H 2X89A 1CBJA 1K2DA 4P2OD 4A2EA 3IMRA 2X0VA 1WBXB 3H42H 1NEUA 1XD0A 4NAJA 3EH1A 4IKLA 2ZUQB 5T3ZE 2B4CL 2OMVB 3LVTA 4R90H 3KBFA 4FQXB 3VH8A 2HT2D 4K94L 2A6JA 1XHHA 4AEEA 5FO7B 2BHYA 1MPAH 4PRIA 4D2NA 2JIXB 3MMEB 3Q43A 1HU8A 4BZ1L 3MLTA 2OSLB 3GPSA 1KFAL 4TL4A 5EOCL 2BX5A 1J0YA 1A4BA 2FJGB 1CZ8L 2A83B 1OB0A 2ZXEB 3GJFB 4KHTH 5EC1B 3F7PC 5HGAB 5J1AA 4RMVA 2GK2A 2IDFA 7FABL 1IZKA 3MV01 5JXED 4NZFA 5KN5B 4HHGA 5JQHC 1N3NA 2CUAA 3G7TA 4DTGL 2V3EA 3FPYA 2ZOKA 2VXQA 3BE1L 4ZOBA 1DBMH 4X4XB 4P3CL 4Y1AE 4QHLA 4O02A 1MREH 1RK1B 4OZ4A 1ZT1B 5CHNB 3KR3H 1MW2A 1YMMD 3PNWB 3QORA 2EIZB 2M1KA 3FMGH 2KLSA 5I24A 4APQA 4RESB 1LP9E 4HUCA 1T83C 3KWXA 3NJIA 1NANH 3DYPA 4LNRB 3C5JB 4ZW5A 2FT8A 3LMJH 4LIQE 1NCGA 3TPUB 5FECA 1ZHLA 2XQ0A 4JQIA 3FCBA 2R4SH 3MJ6A 1JMXA 2RALA 4KKQA 4OLWH 3D8MA 5IT2L 2WWKT 1DE4A 4EN3D 4HUUA 3W0WE 2ESVA 1GY1A 4PP2A 4UZUA 2IH1A 4E9LA 1B4TA 1M71B 1PU0A 1RJLB 3FB7A 4EUPH 4HIQA 3EFFA 3UZVA 4B6ZA 1FP5A 4QO1B 2CGYA 1NCCH 4KO7A 5EF1A 5L8KB 5J9PB 3UYRL 3WI9A 1OAYL 1RJCA 5TE7L 5GZND 4X83A 2C34A 1NM4A 4LRNL 5T5FL 2LU4A 4G8FA 3KPSE 1JGVL 4K71B 3TT1L 3LH8A 2GHWB 1Z9OA 3RBGA 1G0DA 3NRPA 1KIQB 4MKTA 1H3PH 1NDMA 4N24A 5GRXG 2FATH 4O58H 3RY4A 4NFCA 4ZTOL 1KBWA 2EZ0D 3NJGA 4KTYA 1QP1A 3BD4A 5D7LE 3OZ9L 2F8XC 3C08L 1HDMB 1MDAA 2VJXA 3OJDA 4HFWA 3KPOB 1PLBA 4B41A 1LO2H 3FF7A 3RGHA 2J88H 4GRLB 3TFKD 3BP4B 1M3JA 2VDNH 3QUXC 4QRRA 2YR3A 4A6YL 3LIZH 4J3SA 2P8LA 2WXPA 2C3GA 4JKNA 4RAVA 1R34A 1T7VA 3FU3A 3VD1A 5HHOA 4P9MH 2IOOA 1CGSL 5FDYA 3UIYA 1O5DT 3CLEL 1B4RA 4NO2B 4HIIB 3NK4A 3AUWB 4WK0B 5DUJA 1NIFA 2W88A 3CU7A 4WCYL 3TYGL 4KVNH 4E68A 4WEMB 5KSUA 2VXTH 1Q1PA 3J7HA 4HETA 4YN3A 5J0BA 3ECUA 3HN5A 4ZMYA 4OFIA 5JIPA 5HPOA 3TYFB 4UINL 4ZYKA 4NRXB 3WFCH 4M7JL 3JV0A 4XE0A 1ZHNA 2Q76B 4QHKJ 4Z95L 3CN4A 5GS2H 3BHBB 4PGEB 2WHVA 5L2KA 2CO6B 1G1KA 3MJ9A 4G7YL 1W72L 3TO4C 2H26A 1S7UA 3OLGA 2YD8A 1M7IB 1YEEH 4J6RL 1GTFA 5DC9B 1S5IL 1R5WA 1KACB 5HBBA 3N06B 1AJ7L 3QAZB 1IGML 2V4LA 3JVGA 3O4LB 2X9WA 1MAML 2A74B 1GGIH 1DDHB 1HHGA 4XGZB 2O5NA 2K4AA 1XXFC 2X4PA 3FO1A 4DK5A 1T2QH 2RBLA 1MFEL 1INQB 2CXGA 2OZ4L 3KEHA 3EOAA 4KDVA 5ILTH 4GKZA 3DO4A 2OJZL 2Y7MA 4N3UA 2OMUA 3W3BA 3QWQB 5KYNA 4OM1H 2E0PA 5F7KC 1AY1L 2ZWZA 1A6UH 4JAMA 3ZSTA 3US1A 5T3XD 2KDYA 3BT2L 1GH7A 3GSNH 2P8PA 5C8JB 4OGYH 2NW2A 5I16B 3QFJA 5ITFA 3VFOB 2R2HB 4L3EE 1OTUC 4LL9A 5HDQL 4U1GB 1F0LA 2PO6A 5GPRA 1XF3A 3WFEL 3IU3A 3X13A 4F7PB 3QS2A 3WS3A 2FH6A 4AI7A 4B9CA 1N10A 4KO9A 4G80B 5JHLH 1DBJH 2DQIH 3L9RA 3DRQB 4WU7A 1W2KT 1KXVA 4XPAH 2MH4A 4NQXB 2I9LB 4R7NA 2CBQA 3S5LB 4F8PA 1ZMYA 3PJLA 3UPRB 1FZKB 1WSST 3ARRA 2BP0B 3TS8A 5EUOF 1GGBH 2C3WA 1E42A 2WN3A 4XPHL 4KKPA 1GMEA 3DXAB 3KPSA 2WYZA 5BW7A 4BUHA 3H56A 4U7MA 5E8DL 2EKJA 3FHEA 2L7EA 4NQEA 1UADC 1OANA 4J6IA 1QMUA 3RWGA 4JPWH 4B9IA 1P5UC 4UIKH 5E2VL 3L6FB 1REIA 2HFGH 5TDOB 5CAYB 3D69A 1CI5A 1I8LC 2XBTA 4P5TA 3DJ9A 3RGVD 4JG9A 2COQA 2X4TA 1U3HB 3VRJA 1MZYA 3SKJL 1JPGA 1PDKA 2BDNH 3VI4B 5CU9A 5I1HH 5ISZD 4OFPA 5GJTL 1UENA 4BQ8A 1ZLVK 2WTRA 5FFLA 2IH9A 2WWMD 3MODH 4HH8A 4L9LA 4MD5A 2VDNB 5ENWA 4GI8A 5AL0A 3SY0A 1WZAA 4ZAKB 1OV8A 1HXMA 3UZEA 2XV6B 4EXPX 3IXTA 3ARFC 3U4EB 5EU6B 3SE8H 4FQJH 3TTYA 3ULSA 5C7XL 1TQVA 2F6AA 1D5ZA 2MMXA 4I0PD 2XWZA 1ZLUH 1CBVL 1YUKB 3U79A 5LVEA 3BVNA 3LPWA 2NUPA 4DP9X 1BBJA 3L5XH 1DVFA 4HAGA 5T1DH 4RMUA 4R97B 4XCYB 3UCRA 4HU2A 4GG6F 1JPST 1RJZB 2KYIA 2B1AL 3ZKXC 2JJWA 3NN8A 4OZHF 5E4EC 4I88A 3K6FA 4Q6IB 3ILPB 3VE0B 1MCHA 3VMNA 2B39A 1E7UA 4KJWC 3CX2A 3QJFA 2YIHA 1FL5A 1WZKA 2VZTA 3ALWA 1S7QA 4HKJA 4IRJA 4JZOA 3UGEA 3CSYA 1QKZH 2LGNA 4JGJA 4IM8A 4X7FC 4QIRA 3GT6A 2GTWB 2XPGB 5E5RB 1FE8L 1X4ZA 2AJXL 2J43A 4YUEH 1NC2A 2VSMB 1QZ1A 4ZS7L 3RL1B 3Q6GL 4L23A 5HHXH 1GJWA 2QR0A 3ESMA 3HNTL 5CBAB 1RZQA 1EEQA 3HFFA 2FBJL 3HPJA 4Y89A 3WGVB 5FO9B 2ZKMX 2F8OA 2AK4E 1CXHA 4OVVA 5DCCA 2YOAA 3Q9PA 4WHTA 2V2TA 3OKDA 3CQQA 1J48A 2O6PA 4LKXB 5B39G 3QO0A 4L3EA 4Z3HA 4Y2OA 5D7JB 4Y9CA 1AS8A 1IAKA 2Z6FA 1PJ9A 1A25A 3BZ5A 3BP5B 5GRUH 4Z7WF 1Z0NA 2PF6A 1JE6A 5I15L 4DPCX 5DVLA 2I07B 3T9WA 3VX1A 3HHMA 4HDIB 1BF8A 1NUDA 3II1A 4KC3B 2NNCA 5SX4I 2P80A 4CVUA 1G7HB 1UVQB 1XEUA 4M4RA 3WJJC 4F9LA 2KQNA 4GBXD 4Z78A 1EEUA 1ET5A 1MG2C 4GAFB 3SE3A 3NFNA 4GIOA 2MOGA 4XMWA 4RGND 5D7SH 3VQ2C 3QUGA 1VSCA 2DKUA 4FQLH 1MI5D 3A4EA 3ABLB 3CHXA 2QFPA 2FEEI 3MR9A 1N68A 1G6RB 2R29L 4NN5C 2FJUB 2HJLA 4PY7B 5I1EL 2D7OA 1XGUA 5KW9L 1ZANH 3PWUA 4PJ9A 1MKFA 5AVSB 3KPRB 3EO0B 4N2NA 4YDMA 3T3PE 3P4MB 4XNAA 1BGXL 4K3DH 2AEQH 3N41F 4KK6D 3Q2NA 1ESOA 2WAQA 4K8RD 4MBRA 2C8NA 1YDPA 4NZUL 3F5WA 3KPPA 2BLFA 1Z2KA 2JK5A 1LNUB 1MRDH 4FQHB 4JKPH 2Z0UA 3BAKA 2GSGA 2DYPA 3SDAA 1H15B 1QBLL 2R2CA 3BKYL 1NMAL 4PLKC 4LEOA 2OLDA 4JO2H 5D1XC 4MA3A 1IFHL 4F3FA 3NQIA 5L9DL 1I3UA 1E7VA 5TK4A 4QTIL 4ODWB 2DWTA 4KJQC 2FJHA 1N2RA 5C0GA 4BINA 3F01A 5CZKA 1UHVA 1ZIBA 2RQ8A 1XB8A 4Z0BH 2J8HA 3MRGB 1VZGA 2XTJB 3OPUA 3BLBA 4TL5A 3TNNA 2DLHA 4RFEA 1A3LH 5C07E 3AW5A 3GJEB 3T3ME 3NSYA 2DIEA 5JOFA 4HGWB 2ZCKL 1JWUA 3SDDC 2AJYL 1ITCA 2FX8H 4I5BB 5I8CA 3B2MA 1USQA 4YSPA 3LN5A 3FU0A 4YHNB 4YGVA 2DLEA 4MXVF 4R8WL 4ISVA 1E3FA 3ZDXE 3MRKB 3I6GA 4Q58C 1U8IB 4X0KB 1ETA1 2PMZA 4NKOA 5DSCB 4MJ5B 4FULA 1GYCA 3BQUB 3EDEA 2VUYA 3N1GC 5LKNA 1IO4C 3MLXH 4AKOA 3I6LD 1QTPA 4CDGC 1A6TB 4JRXA 1CVSC 2BP5M 3EFOB 3VXPA 1YEDA 3VI3F 4BQCA 4ZFGL 2CKBH 5CKAA 1J1XH 1F2QA 3MBWA 4ALAL 5KBPA 1E8XA 5KS9F 1UFUA 1NAML 1E0OB 3QARA 4N20A 1TTUA 1SOQA 3ZDZB 3BAEH 5J3HD 2FIRT 3IETA 4YSUA 1ACYH 1KZQA 4M7ZB 5FDWA 4TTDD 1T5WA 1BVNP 1UASA 1RZGB 4XCCL 3UZQB 1NCTA 2DQGH 3MUHL 2AQQA 4HALA 4FN0A 4HZ1A 1UB6A 4KH2A 2UWEF 1DSFH 1F4WH 1HOCA 2DQFB 3SOBH 2F54D 4FNTA 3QI9B 4L37B 1MLBB 4LPXA 3BKJH 3EOBB 3VFNB 3ESUF 1KV3A 4LXFA 4M7KH 3DO7A 3BEVB 3V0EA 2AEPL 4KXDA 4YSRA 1IM9B 4NQCA 4WWID 3ARGC 4M8VA 2PW1A 2GCYA 2R0KH 5JHDA 3MV9B 3U46B 1KEMH 5TQ0L 1XGZA 2XWDA 3B2XA 3GRWH 5E8NB 4DP7X 3PU7A 3BP6B 5FGCE 1B4LA 3CX5J 4KK5C 2GK0B 1D7CA 5DGRA 2NY7L 3QJUB 1F3RB