4DP0X

The 1.5 angstrom crystal structure of oxidized (cuii) poplar plastocyanin b at ph 4.0
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
99
structure length
99
Chain Sequence
b'VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin B, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
total genus 20
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp0X00
6PAZA 1E67A 1AAJA 5IY5B 4BXVA 2YAQA 4NAJA 4YL4A 3WG7B 2YQBA 3CVDA 1J9RA 2MTAA 4JHVA 4DP8X 4F2FA 2YARA 4Q89A 2ZONA 4KNSA 1OCRB 2BO0A 3GXUB 5I5IA 3BVDB 4DP2X 4GP8B 1PLCA 1HAWA 4FAAB 4QLWA 5ANHA 4ZK8A 3AZUA 1BQKA 2FT8A 4GY4A 4NB7A 2Y1AA 3FU7A 1L9PA 1CYXA 5I6NA 4DP7X 1KCWA 2H5UA 1A65A 3ABGA 1BXUA 3PLYA 1OCZB 1WA0X 4F2EA 5I26A 3EH3B 4A66A 2DYSB 3OMNB 4N8UA 7PAZA 4HHGA 1JXFA 3AY2A 2XV2A 3OD3A 3ERXA 4DP5X 4E9YA 4ENZA 3FYIB 2XWZA 5FC9A 4DP1X 1M9WA 3H4FA 3OMAB 3FU9A 2TSBA 1PNDA 2IWKA 3EF4A 2MRYA 3FS9A 2GHZA 2IAAC 4G7QB 2J57A 3HB3B 2I7OA 3IE9A 2BHFA 1GR7A 1MG3C 1ZDQA 2J55A 4P5RA 1PCSA 4GXFA 2VSMB 2TSAA 2FQEA 2X87A 3NSFA 4DPCX 4BWUA 1QLEB 4A68A 1BXVA 2AVFA 3SBRA 2EIJB 2PPDA 1AS7A 2IDFA 1JOIA 5B7MA 5LDUA 4YVNA 3TASA 2DV6A 4YSCA 2VN3A 4W9ZA 1JZGA 1OE3A 2HRHA 4BDVB 3NJIA 2CAKA 1ID2A 1V10A 1V54B 1KCBA 5B1AB 4DP6X 1XB6A 1ZIBA 3OQRA 3S8FB 3T6ZA 3KW8A 1AANA 1XB8A 4GYBA 1SF3A 3NP4A 2Q5BA 4G7SB 1AOZA 4X4KA 4YSUA 1OF0A 2PPFA 2XVBA 1BAWA 1JXDA 3CZUB 1MG2C 2VW7A 2YAHA 4K9JA 1R1CA 4TXVB 1J9SA 4PAZA 1JVOA 5D4JA 4YSRA 2CUAA 1SJMA 2YAEA 5I6KA 1W8EA 4HAKA 3GDCA 4AZUA 3S3CB 1ASPA 2BWDA 3N55A 1OCOB 3FU7B 3ZX1A 3FQ1A 1B3IA 4HZ1A 2IH8A 1IBZA 3PAZA 5AFAA 5B1BB 1AZRA 1EHKB 1L9QA 2UX6A 4AX3A 4FA7B 2YAMA 4QKTA 1RZQA 4EF3A 3FSVA 4DPBX 2UXVA 1A4CA 1L9TA 1NIDA 5F7AA 3N2JA 1A3ZA 4G70B 1W6LA 4UANA 1ILUA 1M56B 2UXGA 3SBPA 1CURA 2BW5A 2BP0A 4YSSA 5E9NA 4AKOA 2R7EA 3CVBA 2XV0A 2HX8A 1IBYA 2Q9OA 3NJHA 1A8ZA 1NPNA 1NIAA 1PZBA 1NWPA 2PP7A 1BYPA 1EZLA 4A2GA 2Y69B 2H3XC 1N70A 1AZBA 1NWOA 1L9SA 3SBQA 4GP5B 1GS6X 4JHUA 4CSZA 4E9TA 1GY1A 4HIPA 5D4HA 1E65A 1PLAA 3AG2B 1ET7A 3EH4B 3S3BB 2HXAA 3ZDWA 2PP8A 1OE2A 3FSAA 1ILSA 2VM4A 3NSYA 1X9RA 1GYCA 1SFDA 2UX7A 4WKXA 5B1JC 1RKRA 2FT7A 4HALA 2VSKB 1GS8A 4M4RB 7PCYA 4BWWA 3UGEA 2HZHA 4KO6A 1AQ8A 8PAZA 5F7BA 1FA4A 1J5DA 2YXWA 2FT6A 2YAOA 1SHXA 3QJRB 1ET8A 5B1JA 3FQ2A 1E5ZA 3UAAA 1TKWA 1KYAA 1PZAA 1AZCA 3TU6A 2H47C 1AG0A 4A67A 4YSTA 4KOBA 3D12B 3UABA 1IUZA 4NERA 3NJMA 2AZAA 5D4IA 2XV3A 4G72B 4JKNA 3PPSA 1OCCB 2YXVA 4BWTA 3V9CA 3CDZA 3CVCA 3AW5A 2OCCB 3IBOA 1SF5A 2WSDA 5I28A 5B7FA 2XU9A 1I53A 1NTDA 2BZ7A 2CALA 4L0PB 2VMJA 1DYZA 1JZHA 3CG8A 3NJLA 4KO9A 2PCYA 4M3HA 3L45A 1JZEA 1ASQA 2IDSA 2EIKB 2IDUA 2AZUA 2FNWA 2W8CA 4DP4X 3QQXA 3NP3A 3WKPA 2PPCA 2HRGA 4E9RA 2IWFA 4YSQA 2BWIA 3OMIB 4G71B 1WA2X 2JXMA 2PLTA 5I5MA 3T6XA 4DP9X 4MFHA 1OV8A 2GI0A 2XX1A 1QHQA 2OV0A 2BP0B 3WNIA 4W1TA 2R7EB 1JZIA 3QJSB 3TBCA 2BZCA 4YVUA 1L9OA 2DY2A 3NJFA 2DWTA 1W6WA 3IN0A 3WNJA 4E9VA 1ZV2A 3DTUB 1J9QA 2YAPA 1A4BA 1KGYE 4N4YB 3ZIYA 2JKWA 2PPEA 2XXFA 1L9RA 1CYWA 1YLBB 2QT6A 1SDDA 4E9XA 3IEAA 2W88A 1T5KA 1WAEA 2X88A 3FSZA 1PLBA 5AZUA 2NRDA 3TBBA 5I6OA 2VM3A 4GP4B 1URIA 2E86A 1MDAA 2IH9A 1AS8A 4A2DA 1JZFA 1NDTA 3X1FA 1OOWA 1AG6A 2RACA 3FU8A 3PXLA 3JTBA 4Q8BA 3FPXA 3NYKA 2J5WA 1SNRA 5B1KA 1FFTB 1WS7A 3UAEA 2PCFA 9PCYA 3DKHA 3PAVA 1GS7A 1ZIAA 3FYEB 1AIZA 1JERA 2A3TA 1ET5A 2FQGA 2PPAA 3WKQA 1KBWA 3BQVA 1NZRA 2EIMB 2IDQA 4KNTA 1BXAA 4BK5C 2P80D 3U25A 3NSDA 2I7SA 2GB2A 2JFCA 2DWSA 1NICA 1PF3A 4A2EA 1WS8A 1F56A 3CDZB 1AZUA 4AKPA 2EILB 4P5SA 2I85A 1BYOA 1TEGA 1KBVA 1J5CA 3FQYA 1NIBA 3PAUA 3ABLB 3UADA 2GBAA 2VW4A 4HCFA 1VLXA 4BXSV 1GW0A 3AG1B 2FWLB 3TA4D 3NSCA 2HLEB 1OE1A 1MZZA 4UAHA 3KW7A 1BEXA 4A2FA 1XMEB 5PCYA 2P80A 2ZWNA 3H4HA 2BP8A 3ABKB 1ZDSA 2B08A 4DPAX 2ZXWB 3G5WA 4HHWA 4YSOA 1AZNA 1N68A 1E5YA 1KDJA 1GY2A 3X1EA 1XB3A 3EHBB 2HX7A 1ASOA 5PAZA 1QNIA 5A7EA 5AKRA 2IDTA 2WO3B 1PNCA 2N0MA 3PCYA 1E30A 2FQFA 1GSKA 2QDWA 1UATA 2XXGA 1IKOP 3EH5B 3IN2A 3WI9A 1ADWA 1CC3A 1HAUA 1PY0A 1TEFA 2XLLA 3FT0A 1KV7A 4UF7C 1PMYA 2XX0A 3S8GB 3SQRA 3WIAA 3NT0A 2AANA 1SDDB 3ABMB 3QJQB 1ZPUA 1KDIA 5B7EA 4RH4A 3S3DB 6PCYA 1PZCA 1X9UA 3AG3B 1SFHA 3H56A 2FTAA 2YAFA 1RZPA 3X1BA 1BQRA 5TK2A 3QJUB 5TK4A 1TU2A 3T71A 1A4AA 3X2QB 2BW4A 4YSPA 2UXFA 3ASNB 4E9SA 3X1NA 2CBPA 2B3IA 3UACA 4KO5A 2GC7C 3HEIB 4KO7A 4E9QA 4A2HA 1JZJA 4YSDA 5I6MA 2XUWA 1J9TA 1NIFA 3MBWB 1V55B 2QPEB 1SHWA 5I6PA 4E9WA 3OM3B 3JT2A 5EHFA 3RYMA 3X1GA 4DP0X 5B3SB 4HCIA 2DYRB 2GIMA 1FWXA 1M57B 2FJSA 2QPDB 1AR1B 2UXTA 2IWEA 1NIEA 2QDVA 4PCYA 3MX0B 1HFUA 1NINA 1WA1X 4HCGA 3NJGA 1JXGA 2ZOOA 3NJKA 2CJ3A 3QPKA 3T6WA 4YSAA 3QJVB 2J56A 3FSWA 2AFNA 3T9WA 2CCWA 3ZBMA 4G7RB 3AG4B 2OJ1A 4KNUA 3T6VA 1AS6A 3V9EA 3DIVA 1BQ5A 2WO2B 4AI7A 5I6LA 1DZ0A 1PAZA 1NPJA 3FPYA 5I5JA 1JVLA 3ASOB 2EINB 4KOCA 2BP8B 4AKQA 3C75A 2LLNA 3QJTB 2VW6A 4BDVA 3NJNA 2FQDA 2GC4C 4F7KA 2PP9A 3NJJA 1AACA 1IC0A 2HX9A 1ETJA 1MZYA 2GSMB 2XYBA 3GYRA 4CSPA 4WTQA 1CUOA 4YSEA 1RCYA
chains in the Genus database with same CATH superfamily
2A83B 3RUGE 1TENA 4XCEA 2BSED 2EDRA 4NX0A 1HWHB 5K33A 3VXOA 4Y4HB 3QUXA 4D9LH 5DLLA 2D2OA 4G9DA 2BSRB 5T1MB 1OCRB 4HUXA 4PJEB 5F7LB 4RMQA 1SZNA 5F1SA 3TC9A 4GBXA 4MNGE 1KCUL 3X3FH 4AYFA 2A1WL 3D69B 1FF5A 2CBQA 4QXVA 1ZWIB 4J6IA 5JOFA 1EEZB 2XHNA 2CLRB 3CLEL 3VFOB 1N4XH 4OV5B 5D70H 5I6NA 4EZKA 1KCWA 1A65A 1KB5H 1YEFL 4QHNA 1Z9PA 4XN2A 5I1IL 3BZ4A 5F7DA 4YDVB 2OSXA 4GS7B 2GJ6A 3WTUA 1BGXH 3B56A 2WCGA 2NY6D 4DO6A 4DO5A 1ZLVK 1T5WA 2PO6D 1XXFC 3U9UA 1JXFA 4LRIA 4X5LA 3OD3A 4DP5X 5LN8A 1UD6A 5KVMC 4IRSC 1H6FA 3GKWL 2F2HA 2Q7NA 2LABA 4W4NA 4YFDB 2LT9A 3QFJE 4FFYH 4JFEA 4XPHH 2MPVA 3B4NA 3S2AA 3EOBB 4X4XA 4N2BA 4W9DC 1P7QB 4P57B 5DUMH 1VZGA 5C09D 4QAMB 2HA1A 2I27N 2QGDA 2CBTA 4ZFGL 2F19H 5AG9A 2YZ8A 3IE9A 3NIDB 5JHDE 4KI5C 4Z7WF 4Y7MA 5F88A 1UGNA 4R3SA 4MQ7B 4KDWA 4MZ2A 3V4PL 1CL7H 1AD9B 1CBVH 3QO0B 1HJCA 3HE6B 2VXQA 1KYOK 4GRMB 4QOKE 4WHTB 3DVIA 4QHLB 1D5ZB 3TZVA 1AKJB 2A6IB 3FNKA 3GNMH 1JTTA 1KZQA 2NZ9C 2IOOA 1LO4L 2EIJB 3QUGA 1YO4A 4HF5H 1WCBA 4HUWA 3WELA 4ETYA 4Z7QB 1AS7A 5B38A 1OOAA 2BH0A 1NOFA 2IDFA 5DJYB 1RH8A 2ISDA 3LMJL 5J1AB 1UURA 1J8KA 5T1LB 4MAZA 2D3JA 1G7IA 4OF5A 1A4KA 4OM1L 4UQBA 4JQVC 3QUYD 4W9ZA 4IBUA 2R2CA 1LEGB 2IPTH 4ADIA 2H41A 4ACTA 1F4YL 4ZYKA 5TJWK 3F5WA 4OD3L 5FYKU 5LGJB 5LGHL 1UXLA 1SM3H 4JDZB 1EJOL 3TV3L 4Z3HA 4PY7B 2VJXA 4XP5H 4ICWA 1QP1A 4UB0H 3B2MA 1NGPL 1QQDA 2F1EA 3GXIA 1IL1B 1G7MB 2X9WA 4X80L 2OCJA 5L4MA 2IQ9L 4FNUA 2R69H 1BAWA 3KM2A 4ENEC 1YEFH 5E2WL 4J8QA 1R1CA 2PN5A 1WGVA 3LJ3A 1W91A 3QEHA 5F21B 4PRID 5D4JA 4D8OA 3VD1A 5D7HA 3U46B 3OTTA 2COQA 4AUUA 1LO3L 5HPOA 3O3EA 3S5YA 2IQAA 3E7JA 2XTJB 4J6RL 5D7JD 3UJJL 1ZGLP 5I71B 4IRJD 1F3DH 3N55A 4FEIA 1OM3L 3MOQA 3FU7B 1I75A 5A40E 3TF7C 3G9AB 1B3IA 4ZMTA 2P47B 4J8RB 3VXSA 3EGXA 3SPJA 2IALA 3GB7A 3B7YA 3IDMA 5E5MA 2DQHL 3V8CA 3FT4A 3MXVH 3BP7A 4M6AA 1NIDA 1T83C 3RY5A 5IB2B 4IMKC 1LVEA 4QYAA 4ODSH 2MCMA 1RMFH 4XCYA 2VLJD 1CT8B 4JPVL 4NQXA 3O81A 4TNFA 4XVJH 3IGAB 3TO4C 5E9NA 3PL6C 3STZA 4OZIF 3K71A 3UPCA 1E5AA 4HJ0D 4YGVB 2BP3A 3PWVB 1LO4H 1QEWB 5AZ2H 4MDJB 4HAFA 2OMTB 1OP9A 4P4RA 2BSTB 4XRCB 4WI5A 4ZFFB 1XV8A 3BP4B 1U8CA 4POUB 1Q9KB 3FB7B 5LLIC 2H9GA 3IU3B 1JNNH 4HQQL 3VXQB 4Z6AT 1RZKC 5EUOB 2AEQL 5ICXB 2H3NB 1ZSDB 2YSSB 2VM4A 1K9TA 3FCBA 1EJOH 3GSWB 1L3WA 3NPSB 1NCWH 1H9VA 2DF3A 2VSKB 2X4OA 3NABL 1VFMA 3OWEA 3V4VA 1VFAB 3DV4A 4RMRA 1PU0A 4X80H 5EOTB 1FV1B 2IQ9H 4TUUA 2ZOLB 4LAQL 2EXTA 4AEEA 5CEZD 4MSWA 4BE5A 4HWEH 3B8SA 2QGBA 3PHQA 4GO6B 5JMRA 1DTUA 1GPOH 5DK0A 5F70A 2FT6A 3EKCA 4AUYA 1E6OH 3U7WL 4AQAB 3HC4H 1I8UA 5TGBA 4BM7A 4HIJB 1WFMA 3RPIA 5ITFA 4J6RH 4FZEH 3T4AA 1E40A 3KJ6L 1J0YA 1RVFH 5CBEB 4RIRB 2BY2A 3C2AL 4FQ2H 1HXMA 2EDBA 3GMOA 4NYLA 5IHUL 1O9WA 1L0QA 4WI0B 5D96B 4X6DE 5DVLA 4TLTA 3BKJH 3VACA 5FDWA 3AW5A 2IPKA 3FC8A 3DARA 3ZDZB 4W70A 2QKIA 4HFUH 1ZV5A 4MB4A 1EFXA 5CP7B 2OYMA 4OZGF 4PS4L 3OXRB 4X6CF 1BF8A 1HEJC 3CFDA 2G3NA 4CN1A 4Z7VF 3SB3A 4NO2B 3PIQA 4K55A 3C60D 1Z9OA 1ZS2A 1PZSA 2FD6H 3VWJD 3CSYA 1J86A 3FQWA 4HOMA 2X7LA 2VABA 2P5EA 5DHXB 2BWIA 4G71B 4ZFOB 4NZUH 3T6XA 5CJXC 1NLDH 4NCC1 3L5HA 1EFQA 1V05A 4Z0XA 4MCZA 2YGVA 4HKXA 3K0WA 5C0BD 4EZJA 3NJVA 5T3ZL 2J88L 4BSVB 3CFMA 5C0RL 2FX9L 3C6SA 4MA3B 3D4ZA 5KYUA 3CU7A 3RNKB 2DY2A 2AK4A 1W6WA 3IKCA 2Z4QB 4PW4A 3CC5A 2BSSB 1A9EB 3X13A 3MJ8B 4N2KA 4PH8A 5KSAB 4B9FA 3GSQB 1A4BA 5AYUL 3LEYH 3VI4E 4CMHB 2PPEA 5H35B 1UM4H 4GW1B 3BN9C 4MXVF 2NYYD 2W88A 3V5DA 3U7WH 4PD4K 2NY4D 4H26B 4A37A 4Z5RB 2K0RA 5AW2B 2VM3A 2WP3O 3LNIA 4EN3D 2BCMA 4DTGH 3EO9L 4XAKD 4WFFD 1HI6B 2CNZA 3KJ6H 4A2DA 2JCCB 5ID1A 5EEZA 5DJDB 3HPJA 4EI0A 4F7EB 5E6IC 3C2AH 4MLIA 2C3HA 3MRJB 5E8DL 3JTBA 1XF5A 2BIOA 1QTYT 1GYAA 2ZPKH 4G3YL 2YJQA 3FB5A 1FFTB 4JPQA 3MNZA 1B90A 1XH1A 1KEGL 4P2YA 4XVSL 3GI9H 2DJSA 3MV7B 3MKKA 4LCVA 4XN1A 3WSQL 2ZUXA 2EDMA 3MLTA 2ZKHL 4Y4FB 1FJ1B 4PJAA 5HTSA 3VO0A 1PJ9A 2VB5A 1F4XH 4PJ5A 1U2CA 4H0LC 1SOQA 3MBEA 4JJ5A 4HPHA 3VJ6B 4O02A 1WQVT 2DWSA 1LE9B 4N28A 3QXAB 2P48B 1DJSA 5C08D 3NEOA 3TNNA 3CE1A 2H0EA 2I85A 4ZD3L 1FQ9C 2YD9A 3DK0A 1KJ3L 1NGYA 4KK9D 5GISL 4GG6B 3FFOA 1LDPL 4B60A 2BPBA 2HLEB 3I6KB 1HJBC 4N6RA 1UD4A 4M1GL 5KYYB 2FL5A 4Z77A 4JB9H 5HD8D 3QO1B 5ESAB 2Z1KA 5C0RH 1H8OA 1JVKA 3V6FA 3DPBB 3EGDB 1NBCA 1WTGT 2A9NL 3F05A 3MA7B 4L3EA 4OZGE 3BSHA 3S4SG 5HHNA 1J5OL 4RGMC 1DFBL 3CX2A 3IDGB 4P5TC 3RAJL 5F7UA 2VZTA 1CL7I 2NY5C 3EG9A 4X99A 4WGVB 1CF8L 3JXAA 3ZR5A 3NRFA 2VDLL 1N9PA 3NEEA 4LO9A 1OP3H 3VNZA 4KROD 3S35X 5G4OA 2Z92A 3CAFA 1UXSA 4KRPD 3T77A 7TAAA 4NZDA 4U2YA 4MD5B 3UH8A 2DQTL 5I0YA 2NR6C 3J2PA 4UF7C 4LFHD 2WTPA 2ZSWB 4G83A 4R4BB 3P02A 1CVSC 1F86A 1TOXA 1CFVH 2ATPA 5KWYC 4PJFE 2HKHH 2L8AA 5D9SB 5IBTL 1FORL 4Z7OE 3O45A 4NQTA 1QVOB 2NCEA 3GIZL 4N2MA 2ODHA 3UJTH 3AITA 4UBDD 3ASNB 1O5PA 1UG9A 3BZFB 5EORL 2Q6WA 1S7SA 2BFGA 2CBPA 4MNQA 3RX9A 3SKMB 1NCHA 3KPMA 5AB0A 1M53A 2GC7C 3HMXH 5INCB 4MS8D 4XPTL 1Z1WA 5E8NB 2VDMH 4PGCB 3BZEB 2VITA 2IANB 4PLKD 1QO3B 2C1OB 1U9KA 3DURB 5H8DA 1SLUA 1U3HD 4LSVL 4JL2A 5JXEA 1KJ3H 4HJTA 4HCIA 3FL7A 5H2BA 1CPUA 3KS0J 1XIWA 3MJ7A 4GI9A 4XAKE 2EUWA 4WFFE 3FQTB 5K9KA 2NMSA 2ZE0A 2Y24A 4JRYE 1IEHA 5BRZB 1P2CA 1OD9A 3ARFC 3PGFL 2A9NH 3KGSA 2CO4A 1FBIL 3NRPA 2RR3A 2JK5B 2EAEA 4LMQE 3INUH 4ILDA 4FG6C 3T8XB 1SBSL 1HHHB 1I7TB 2GYSA 2CG9X 2VQ4A 5G4MA 3LVTA 3SOTA 1JS4A 1TJHH 2Z8VC 3JVGC 2I69A 4P2RD 5DS2A 1R4XA 4X7TB 1OSEA 1CD9B 2C3GA 2HSIA 3P40A 1JV2A 1NFIA 4JKPL 4AI7A 4EQ2A 1JPEA 1IGIL 1G9EA 1CCZA 5ESVB 4FNTA 5I5JA 1E9PA 3EOTL 1A7QH 3QDMB 4GAYA 3ASOB 4Z7NE 4JK0D 5ISZA 4LIQH 1B4JH 2PMZA 3CFBA 4XMLL 1MAJA 3GGWA 2PP9A 3ATFA 2F53B 3O3UN 5JLZA 2VXUL 3RL2B 3LQZA 2H6PA 1IGCL 2EH8H 4GRWH 4K3JL 5CF3A 1UB5B 3O8XA 3UTZB 4JM2C 5IBTH 3ZKNC 1ZLSL 4JHAL 4LHUD 3CVDA 5CN3A 3GIZH 1S7RA 1Q94A 1QLEL 4CSTA 3QORB 5KJRL 1Z32X 2V2WA 4QXTB 1W72L 4LQFH 5EORH 3MJ9H 2V37A 4OZHA 4C8XA 4N0RA 5KYWA 4W68A 1BLNB 4NKOA 1JWSB 4MMZA 3EFFA 3EH2A 4HCRH 3U0WL 2BNQA 1MIEL 1UT9A 2J43A 4HIHB 4LCYA 4NKIL 1D9KB 4BGLA 1L9PA 1EK3A 4ZXBB 2AI0H 1G0DA 4LSVH 4OI9A 2NW3A 3N1PC 5J12C 3SYAA 1YUKB 3ZRSA 2Z31C 3ARUA 4XNUL 1RUKL 3MCYA 4KZDL 3AQYA 1RSYA 1Q72H 5CGYD 5IHZB 2H4EA 2D7NA 4LLQA 3S0PA 3ZN6A 2QBWA 4CVUA 1EHXA 1A0QL 1I8LC 5GRVL 1ZVSB 1ACYL 1LNUB 1SBSH 3H4FA 4X9HA 3EH1A 5I1CH 5B3JF 4QHMA 1EUTA 2D7TL 3II1A 3KWWA 4FI7A 5LGKA 2OS7A 3GSVA 2WBJC 2XZZA 1WT5C 3EF4A 3SBWC 4DQAA 3D39E 4I48A 1C1EL 4HK3J 3QFGA 4O2FA 3WNNA 4NENA 4UOQA 4KY1H 1T7XA 3GMQA 1AHMA 4B5EA 4YL9A 3T04D 4Z7UE 2X4QA 2V17L 1QFUH 5CZXD 1KSRA 1GGTA 1T4KA 5D2LE 3P11L 1NUDA 1GJUA 3SGKC 1R5VA 1JOIA 2P8MA 2CMRL 3ZMNA 1H6EA 5H37G 4U05A 1YC7A 5A2BA 4WK0B 4WJ5B 4OZFA 4XXDB 1FVCB 5BO1H 2HVKA 2C3XA 5CD3B 1W72H 3U82B 3GLAA 2UZXA 3QEGL 1MQKH 4ZUWB 2BXZA 5AVRB 2G2RA 4R96B 3ULAB 2MQ3A 2OSLA 1YC8A 5A2LH 1OQOA 4OLUL 2A9DA 2NQCA 3G5VB 1JPTH 1BF2A 1RK1B 5CD5D 1MIEH 1O6TA 4XCEB 1LD9B 3IWVA 1E43A 1EIBA 1S46A 4LEOA 3VXOB 2VR7A 1NFDF 1A6ZA 2R9HD 1YRKA 5E99L 1F45A 3BW9A 4G9DB 2ZG1A 3D34A 4HKBA 4HUXB 3W57A 4XPAH 1T66D 2G0KA 1QRKA 2XRAH 1SJMA 4XNMA 3L4VA 4WTXA 2EXYC 1YDPA 1UH3A 2V5SA 4HZAA 4YHMH 4AYFB 4G6KL 4KVNL 5K59F 4KH2A 4PB0H 1K5NA 3SO5A 1BBDL 1TSHA 4IDJL 4KKLC 4QHNB 3GLZA 3LRKA 3BZ4B 2VC2H 1J8HA 5ETUA 5F7DB 4ZSOA 5ICZA 2YR3A 2GJ6B 1MSPA 1C1EH 5ALBH 2YD0A 2XZCH 3D2UA 4UOZA 3U9UB 3WIHH 5DZJA 1XX9C 3EYUH 1YAIA 3LEXA 4FXKA 2OXGA 3QUKA 3LHAA 2OZ4L 4YSSA 4JFEB 1PGRB 3QA3A 1QTPA 1YPZA 4L05A 3KLKA 4OI8A 1EZVX 4KKAD 2GQHA 5E03A 1IT9L 1EZLA 3L4YA 4MJIA 1GL4B 1YEIL 4RWYL 5LAXA 3WLWD 2H26A 1JP5A 5F88B 5HHPA 1GS6X 1P53A 3JV0A 1L5GA 1RFDL 2ARJB 3PDGA 4AYID 2XC8A 2K4WA 3VFUB 4JAMA 3TZVB 3KBPA 1D5BB 5HJDA 3SDAD 3B1UA 3GD1C 4QNPE 4G2AA 4GPVA 1WCBB 4HUWB 4OQ1A 5B38B 1LP9F 4M5YH 3MUJA 4MLSA 3I3EA 2F0CA 1AZZC 4QIRA 3CPLA 4MRBA 1KB9J 1G7IB 4HLEA 1A4KB 4LLWB 3S88L 1U33A 3QP3A 4LLVB 4CU8A 3IF1A 1FA4A 3GTTA 1XD1A 2YAOA 4ZYKB 3REVA 3WFBL 5CBAA 1FE8L 2CGYA 3F5WB 1HIMH 3ESPA 2H47C 1DJZA 2VRAA 1YEEL 4OCMC 3UABA 4MDIA 3S35L 4EPSA 2AXFB 4XB7A 3ILPA 3BJ91 3BQUA 2R4SH 3SDCC 4BWTA 4BCYA 4DGYH 1GYVA 4LVNC 4Y9CA 3AU0A 3BUTA 3D3VD 2D9QB 4YHOL 5I28A 4NHCL 1KUMA 4GQZA 5IVXF 2XIIA 2YD1A 2D7PA 5I0VA 3CZNA 1NTDA 3O3EB 5KS9F 4ZMAT 4Y5YC 2IQAB 4I7ZC 4IK7A 4L0PB 4M9PA 4YEEA 3KGRA 1MREL 1YJDL 4WNJA 1MFBL 4WUKL 2ICWJ 2WOYA 4B0MM 2O6CA 3HFML 4KHTH 3PXHA 2IDSA 2GFBB 3QR2A 2FNWA 1X7TA 2OL3L 1WZ1L 2YD3A 1S3KH 4KC3B 3TM6A 3EGXB 3VXSB 3GB7B 1NC2B 12E8H 4OT1H 3IDMB 4P46D 5E5MB 3P2BA 5CJOL 4JW3A 4AK1A 3EO0A 2XYCA 3FT4B 3BP7B 1VFBA 4KXDA 4E0RA 1DQKA 4XCYB 5D1ZC 3VA2C 3QQDA 3OR6A 4NQXB 4B9KC 1E3FA 2IF7A 3DYMA 2OV0A 3CFIC 4JPWH 4X83A 1SN0A 3STZB 1OGAD 3K71B 3KLQA 4I87A 1B6DA 4LDEB 4NZTH 2WWKO 3BVNB 4MAUL 5T5NG 3Q2NA 2YBGA 1A3LL 4P4RB 3KBEA 5AAMA 1ETA1 4H0GA 4U1KA 1RIHL 3OJ2C 2CJTA 1JXKA 2NY0C 4Y4KA 3N40P 5DWPA 2H9GB 1X9QA 2XPGA 5INDA 4UOW0 2C26A 5K39A 1UWEL 3B1TA 3OJVC 2YKLL 1AS8A 2JMRA 1EHLH 2X4OB 4J3XA 4ONGL 1QI5A 4J12A 4WJG3 5F9DC 3U1SL 3DV4B 1LQBC 3V4VB 3DO3A 4PJBE 1MFUA 2ZWKA 4BZ2H 2HH0H 4CVWA 2UWEE 4ECNA 3AM8C 4K5OA 3P69A 4YBHA 5DK0B 2WTRB 4DK6A 3HLAA 3ULUD 4N1EA 3QCVH 5GHWL 1YNKH 2XZAL 4GLRH 4TS6A 5FO7A 1Z9NA 2XG4A 5FOBA 5ITFB 5J6GA 4I88A 3T4AB 1AIZA 3ZL4H 1R3IL 1G9MC 2CH8A 5LCVL 1EDYA 2KZKA 2NUPA 3IXAA 3ZDYF 4PB9H 1Z0NA 4FP8L 1G94A 1FC1A 5JQ6H 1HXMB 3AS0A 3B9KD 2Y3AA 3GMOB 4NYLB 2ZUQB 3BT2L 2PXYA 4YXLL 4IJTA 1WZ1H 5E8OA 1PF3A 5FDWB 3FUKA 3WHE1 4AKPA 2IPKB 2WAQA 2O72A 4MQXC 3WO3B 1MKFA 5CJOH 3PJSA 3FQYA 3TIDA 1F11A 1EFXB 2VUYA 4BK4A 5HGHB 1PG7W 2ZCLH 3AG1B 3PNWA 4Z1PA 4AXWA 2J1ZA 4WI3A 3TA4D 2J8OA 4I0PC 5E08L 4TUKL 5C97A 4P3WA 3CFDB 2APTA 2X3AA 3PIQB 4MQTB 3H54A 3CSYB 3FQWB 3PAYA 2X7LB 2VABB 2WV3A 1N68A 1E5YA 1ZAGA 2M83A 4G8IA 4YZFE 5ES4B 5IROC 1RIHH 1I85C 2C9AA 3QCTH 4FI8A 1VF5C 3D3VE 5IVOA 1LE5A 1KEMH 3MJ9A 5F1NA 4Z0XB 2QADC 4GFXA 4MCZB 4HKXB 3LKSA 1OLLA 3Q8EA 5HHMB 3PY9A 1DQMH 2ZXEB 5T3ZD 3C6SB 4HCRA 5KYUB 4YBLB 1G7LA 1JRHH 4R90H 2AK4B 5D2NB 3IKCB 3M17A 4ONGH 3CC5B 3EJJX 5A2KH 3IN2A 5FR3A 3CFJA 1X5ZA 3U1SH 4NZJA 1TEFA 5C0CE 3O4OC 3WKNA 2XLLA 1YQVH 3WN5A 1J05A 2E46A 2FEEI 4JFFD 2Z9TA 3V5DB 3RKPA 4N20A 2XQBH 1R34A 5MP6L 3V6BR 1IC1A 2XZAH 1MFEL 1SFHA 2O5ZL 4S1SL 5D7LD 4I13B 2FTAA 5HGBB 3KL3A 1T6BX 1H3GA 1JCVA 4AYMC 3VD4A 5LNGA 5ID1B 5LCVH 1F1GA 3HPJB 3SDXE 5IOKA 2VN7A 2DS4A 3VFRA 3FTZA 1GVIA 4F8QA 1CDJA 1XF5B 1I7UA 4M8UA 4DGWC 2JNZA 2IV9A 2R15A 3L1FA 1R5WA 3FB5B 2X6BA 3MNZB 3P30L 3VXMD 3QUZD 4KQ4L 4TNWF 3MN8A 1SUHA 4H88H 2GIXA 3H7BB 1U95A 2EDQA 3QIBD 3NIDF 4PYHA 2FO1A 2FX8H 1L7TH 3A4AA 3MLTB 4S1RL 4H2CA 4PJAB 5CUSH 5E08H 4GUPA 4TUKH 1AD0A 2FWUA 2NY3C 1KV3A 1WBYA 4NN6B 4PJ5B 5DHMC 4CSSA 4Q9RH 3MBEB 4JJ5B 4YXHL 5HYQA 2JH2A 3US9A 3WKYA 4O02B 5C92A 3TN0A 4ZNEE 1XCTA 5JTWA 2IV8A 1MCKA 4Y19A 3M86A 3LSOA 1HFUA 4JDVA 3TNNB 5JIPA 4QRPE 4L0YA 3IYLW 1JXGA 1VB9A 5GRVK 4NKQB 5I6XB 2X70A 4FXTA 4FQHA 1NGYB 1W72A 4IHOA 3RG1C 2NX5A 4YDKL 4ZTOH 4ATTA 3U0PA 1H5BA 4O58L 1U2YA 4N6RB 2FL5B 4Z77B 4HPYL 4R97C 5EF0A 4PLJC 3V6FB 4PMFA 1BIHA 1IV8A 3HKFA 3MFGB 4ODHH 1OT2A 4TVPH 4L3EB 1TVBA 1OTSD 5HHNB 4A38A 2V5YA 2OTWA 5E70A 2Z35A 2OAAA 3O6FA 2DPKA 5I76A 3H3KA 3EG9B 3HG0A 3VG9C 4X99B 2DQDL 3MOBL 2MPAH 3HNTL 3SO3C 5M94B 4EDWH 1BFOA 3VI3E 5CXPA 1MFEH 2ITDA 2Z92B 3MLPA 3GBEA 1DL7L 5MEQA 1UXSB 2K6ZA 3T77B 1J9RA 5I8KL 4AQ1B 5DGQA 4DP8X 2VN5A 3DXAA 2R1YA 3RBGA 3ESVF 4JG0H 1ZVNA 3T0XA 4RFOL 4PJEE 4GI8A 2DM7A 5ANHA 2ATPB 5T1KB 1JBJA 1FH5L 1O7SA 4JFDA 4PJ8D 3P30H 3RWCA 3OF6A 4M62L 4AWJC 1JMXA 5EOCL 2QZ5A 5J11C 2LLLA 4LNRA 2ODIA 1A6VH 2WINA 3O45B 4FRWA 4PJCB 3GUTA 4ISVB 3U2SA 2V9TA 1KFAH 2Q6WB 3C87A 1E6JL 1HQRA 2W65A 4MNQB 3OMNB 3KPMB 2E76C 1KGCD 2XIDA 3MUGA 5EG6C 1A14H 2JQZA 2WXIA 2E27L 4PGBB 2VITB 4KMTH 4CBZA 4XO5A 5CWSA 3ZZLA 4JFFE 4KV5E 5CIPH 1M9WA 5FGBA 3U2IA 1XGRA 2QELA 4RSYA 1H8SA 3QARA 3WFEH 3SJVA 2VDRL 5H2BB 3LN4A 3QULA 3H2PA 1XIWB 2CPCA 5GJSL 1WGOA 3MJ7B 5K9KB 1QI3A 5F72S 1YEHL 2I7OA 3EUDA 2FX7L 4FQXC 3FN3A 2JQAA 4Y5VC 3BAWA 5CR8A 5EUOF 5JPMB 1OB1A 1AR2A 2VR8A 4GXFA 1YVLA 5F9WC 4AEIH 1AMYA 4X2UA 5CM1A 3NSFA 1ZJBA 5DSCA 2J8UE 4M5SA 2ORBH 2QQLL 2JIXB 4XAWH 5LN4A 2ALWA 4QPEA 3LNEA 1TO5A 1ZT1A 3AT8A 3ZR6A 1JV2B 1NFIB 3BH8A 4Z7QE 4M4RA 2VZ1A 1E9PB 4GAYB 5H37H 4N90D 5ISZB 1DVTA 5MEPA 2ENQA 4K7FB 1TFPA 5E2UL 3GGWB 3V6OE 1J1OL 2B4CL 3BC9A 3VXUD 3T3ME 5ICYA 5I19H 4OLZH 3QUYC 5JLZB 4YIQB 3LQZB 2QSCL 2H6PB 4X9YA 1SF3A 2J6EH 4UV7L 2BFVL 2X4TA 3LRSA 4JFVA 5DJ6A 1AOZA 1FIGH 4RISL 1LMIA 4JO4L 3O8XB 1VA9A 4RFNC 3CQQA 4FG0A 3ZDZF 3CZUB 4ANUA 2EUZA 1S7RB 1Q94B 2VDQH 2AITA 4KMLB 4WUUD 2V2WB 2JELH 1OW0A 5D1QA 4OZHB 1HWWA 5J13B 2BNRD 3WDIA 5KYWB 2YAEA 1NMAL 1XGYH 2FBJL 4NKOB 3SD2A 4MMZB 3EFFB 1BLIA 3MACH 3KEDA 5BOPA 5EPMA 4GLRI 2BNQB 2XTJE 4AGOA 4LCYB 2YPVL 4JZJA 4HZ1A 2NW3B 4U31A 4BQCA 3TS8A 4D3CH 2BVEA 2V6HA 2YEVB 3MODH 3O0RH 4OIIL 2BVYA 4AL8C 2H1XA 3AY4A 4IRJC 3V0WH 3GZKA 1OCWL 1Y6KR 4HS3B 4UIKL 4LLQB 5CJQL 2AVGA 1T2JA 3NCYP 5GS3A 4WENB 1E4WL 5L2JA 1ZA3A 3ECWA 4NPYA 3C6LC 2BS71 4X5XA 5HDBE 4AIXA 2YLHA 1J0KA 3R18A 1TQWA 3MZGB 4UOJA 3S37X 4QHMB 1TCRB 4IU2A 2L7UA 3GSVB 3ZTDC 1Z9LA 4XNQA 4OGZA 5KVFL 4JFUA 4A2GA 1ZRUA 3FF8A 4XX5A 2VERN 4I48B 3V4UL 4L37A 1XAKA 1DO6A 2HRPL 3BISA 4TLUA 2YSTA 1TR7A 4O2FB 4L5FL 1GHFH 2VERA 4HJ0C 5FYKL 4NENB 1ZT7B 5E5RB 4WO4A 4BZ2A 1ICTA 3GMQB 2AJSL 4HJGB 3K80A 3VRJA 4PVBA 1E65A 5E7FA 1RZ8A 4H25A 1J1OH 4XB8A 5ECJE 2PP8A 2X4QB 4PJXF 1KXVA 4NQCD 5EUOE 3HNSH 2UX7A 3DJTA 1A02N 1UJ3C 2CGZA 5C0AA 3K4AA 1T4KB 2DL9A 1FSKB 5FW7A 3HG3A 5JDJA 3LH9A 1GYUA 3EDJA 4N0UA 2VR3A 4RISH 1JRHI 1R5VB 3QXWA 4UV4L 4WK4B 2P8MB 1AO7A 4XH2A 1UWXH 7PCYA 3D25A 3EJCA 2Q2EB 2PWGA 5FB8B 2ZG2A 4KRNA 3BPNB 4OZFB 4D8PA 1J5DA 4ANXA 2UZXB 2OL3A 5GGUB 1C5DA 3MRDA 2G2RB 3CLWA 3Q13A 1Z66A 3HHRB 2GBVA 2OSLB 1AZCA 1JI2A 5FUZL 3K6SA 4GRLC 4KOBA 4RGND 1VGEH 2QGCA 2QPFA 3OVUB 1RZ7L 2B14A 4HKZA 4J39A 4JLRA 2QEJA 4LEOB 4ZDHA 1I1RA 2O5XL 5F3HA 2ENYA 4YQXH 1MNUL 5KZCB 2R8SL 3WY3A 2IOIA 2NSQA 2ATAA 4HKBB 2W0KA 3VGHA 4GG6F 3RZCD 5JHMA 2DLFH 2XIBA 2Z6FA 3MLRH 4XNMB 3S4SA 5B7FA 1YDPB 2WNGA 1I53A 3BGAA 1T89C 2VZ3A 1ZK9A 1E4WH 1JTPA 2ZQKA 1KBGL 2XICA 1K5NB 3GZPA 2BZDA 1BD2D 4J3BA 5FKPA 5CNHA 3VFVA 1HL9A 2WXLA 4OGYL 3QXTA 4FNRA 4HWBL 3KYOA 3TT1L 3WKPA 4NUGH 3TFKD 1MFAH 1ODUA 1J8HB 5ETUB 4LSRH 3AREC 2D7OA 5FYJU 1X4YA 4XMUA 4ZSOB 5ICZB 3ILEA 3J27A 4E9RA 2Q8BL 4PGJA 5CU9A 2W5PA 4YSQA 2C4FU 1MAML 1WA2X 2MHAA 3D2UB 5DVNA 4JKMA 3K6IA 5I5MA 1M71A 1ZLEA 3VWJC 5LHDA 3LEXB 1OV8A 3HHMA 2OXGB 3KLLA 4FXKB 4XMXA 2R0ZH 2A7BA 2XX1A 3QUKB 4XN9A 4DN3H 4G82A 3P0YH 3HJ0A 1SVZA 3QA3B 3HRZC 3TBCA 2ZXDA 3NCJL 5AW8B 4ES9A 2VYRE 3DOSA 5GGQL 3PWNA 4KZEL 4MJIB 2XI9A 4Y1AA 3VG0H 5LAXB 2VUOA 2H26B 1YECH 4QTFA 1GXEA 2H1PL 5HHPB 5LCVA 3W37A 5IFAL 1JI1A 4I0CC 3EFOA 1YLBB 1L5GB 2VMEA 3NDZE 2Y7SA 2H2PD 2YBRA 3MR9A 3DMMD 4PRAA 4JAMB 1PLBA 1P4LA 2OI9B 3TBBA 1CGTA 4YLQT 1QHPA 1UQSA 2BS8A 1LEKA 2OQJA 1JZFA 4FQCL 4ODUA 4YDMA 1MHEA 1NDTA 2NY4C 3APFA 3FT1A 4UUJB 1N10A 4G6JL 3K1DA 2JCCE 3W0WD 4YDIL 3CPLB 2J6WA 2RACA 1TF4A 4Q8BA 3GMRA 1DVUA 3EBHA 2OMXA 3GJFH 3IF1B 3VXRD 5HDQH 3REVB 5CBAB 4UCFA 4LPWA 1Q0YL 3SPCA 5E8EA 5FECA 2VGLM 3BSGA 1FYTA 4H1LG 4WK2B 5L4IA 3PWPD 3OJMB 2R23A 3BCDA 2BWQA 4PJHB 4MDIB 2F08A 3MV7E 2OJZH 3T0EA 5I15L 4IIZA 3BGFB 2EIMB 3EDKA 3ILPB 4FEMA 3HBZA 3EYOA 1BXAA 3BQUB 4F7TA 4ANKA 1UVQA 3CN1A 5JIIA 3TT1H 2WANA 1KTBA 4GKSA 4JG5A 3T1FA 5IT2H 1VZHA 3QEQA 1OWRM 3QDGD 5C71A 1KBVA 1MJ8H 2R39A 2NCMA 4Z23A 4N8VG 1MHPL 2B0SL 4B6ZA 4OVVA 4BK5A 1T5XB 4LDLB 2XOTA 4LU5L 4OJDH 4GG6E 1DBML 1D7FA 1BP3B 1MRCL 1QFHA 1WC7A 2Y1YA 3M8OL 4J3VA 2EIEA 5CHNB 1QKZL 3NCJH 4PGDA 3K4ZA 3RA7H 1JXJA 1G7HA 3B83A 4MJ5B 2IIJA 1JHLH 3FAXA 5HD8C 1HHJA 4JFYB 2H1PH 3EO0B 1XB3A 3SPIA 4LSSH 1VFBB 2TRYA 4J27A 3SD5A 4A04A 3CHQA 3EJZC 3FB6A 1NMCC 2F5AL 5LO7A 3DVGB 4E0RB 4IOSA 3QQDB 3OR6B 4AGQA 5CFAA 4BQ6A 1TFHA 3ARDA 3V7AE 4WEBL 4AM0A 1WTLA 3O2VL 2YQ3A 1S5IL 1BD2E 2Q3ZA 2QDWA 2QQKL 2VDNH 2XXGA 1UA6L 4HT1H 4MCYB 2XDHA 4AV5A 2Y07L 3N85H 2ICEB 3NZSA 4U1KB 2IC2A 4HLZG 2X1QA 1I1AA 2APXA 4KRPC 4Y4KB 5KJ4A 3OKDA 3SE9H 4BFEA 2AP2A 3B5GA 1OAZH 4U1SA 2XPGB 4X9BA 4LLYB 3TO2A 5K39B 1R3HA 1ZEAL 3KXFD 2YGNA 4JFPB 5CIPA 4MB3A 3KE0A 1DSYA 2UXFA 1JNHA 1IFHH 4LP5A 3X1NA 3NGBB 1HTYA 2B1HH 4W4OC 2V4LA 3TA3A 3F65A 5L88L 4GW5A 3KPRA 4YLBA 4KO7A 4IBZA 2OA9A 4E9QA 3MRHA 4ONHA 3HLAB 4UBDC 5IQ7H 2BX5A 5T1DH 1J88A 4ZTEA 2A0LD 5FO7B 4MAYA 2IANE 2XG4B 4H8WL 1XF2A 5J6GB 3UTTD 3RVXD 3S36X 3SKJL 1F90L 4MQSB 3OZLA 1DUZA 2DL2A 3K1KC 4WU5A 2NUPB 1DBMH 1M57B 2YIHA 3SZ6A 4ZPTA 4HMCA 2VNCA 4YX2H 1CLYH 2VDLB 1BPLB 1QKZH 2PXYB 2F54A 5FK9A 5E8OB 4DKFH 4NC2B 5BRZE 2FYVA 2I9LA 1VGKA 2MQ0A 5H37A 4MTMA 4ZPVA 2GPZA 3HI5H 3NJKA 3QG7H 2MCPL 4V1DD 3TIDB 3UTSA 3VWKD 4PM1A 3VFTA 1F11B 1T04A 4U0RB 3H9SA 3PNWB 2F5AH 3AXLA 4AXWB 4MMYA 5IGXH 2H0FA 3IE4A 3EYSL 4N1HB 1DVYA 4GB9A 3U30C 5CGBA 1PAZA 2MNWA 4N68A 3QUXD 1S5IH 2J6EA 3UBXG 3HI6H 1UA6H 3QDME 1A9BA 1E2VA 4G8IB 3TESA 3H2QA 1QWUA 2WUCL 1NCDL 2FQDA 3GEWB 4GBXD 4U1HA 5TDNA 2V9UA 2X2YA 1LE5B 5EOQH 5F1NB 1WUNT 1ZVYA 4NNPH 3ZJAA 3GPSA 1UB6A 3G6AA 2F53E 4FXGC 1YY9D 1VFOA 1CUOA 3MRPB 4JANB 1MI5D 1UT2A 2AJYH 3S37L 1J0IA 1K6QL 2Y3NA 4AIEA 1QWHA 4F57L 5DJZA 3DWTA 2N7BA 3FFCD 1G7LB 4GMSH 4O00A 2HFFA 3KWTA 3GBNH 2WLLA 3M17B 3O4LD 2EEXA 4K94H 3CFJB 3PFQA 1W2KT 5DXWA 4JGMA 2OR9H 2FJHA 3WN5B 1J05B 3ETBF 1QUNA 3HI1A 4FQ1H 4XP1L 4JFQA 4ZMNA 1A6AA 4UT9L 1SEBA 5IP4A 2ZX8A 1QSED 4NB7A 3ZE0B 2KH2B 4FQQB 4NC1E 4ZS7L 5D7IA 1F90H 1OVZA 3SKJH 3AQDA 1RPUA 3U7YL 4WWKD 5I26A 3CD4A 4JRXA 4M6NL 5BOJA 5EO1A 1TJXA 4K5NA 2SODB 1M6OA 1I7UB 2OP4L 5HPMA 5AVSB 3BKYH 2NYKA 1R5WB 4HU8A 5CINH 1OPGL 2WY3B 3U36A 1UUSA 2ZX9A 2X0UA 3PF2A 4DP1X 2WQRA 5ESQB 5I30L 1U95B 3ZRFC 3JV6A 3FU9A 2CKBL 3JWNC 4HBQA 4GUPB 2GI7A 4NN7B 1QASA 4UNUA 1AD0B 3JWDC 5HHOA 1WBYB 3WFCL 1D2PA 4G7QB 5HYQB 3L8QA 3F7LA 3TN0B 4X7FC 1XCTB 3B34A 4L2LA 4G8GA 4OM0L 4JDVB 4Y19B 2VSMB 3EJSA 3NN8A 3OZ9L 3ZDXF 1F97A 2WUCH 4OLXL 3S3JA 4XBPA 3RGVC 3RVTD 1QLEB 2CM5A 2X70B 1E5BA 1W72B 2V7NA 1NGWA 2IMNA 4IHOB 3IAGC 4NN5B 2NX5B 2R4RL 1H5BB 4DGVH 1KMGA 5DD5H 5F89A 4K7PX 1R9FA 4YMPA 3IPFA 3LKPA 3NK4A 1DQQB 1JK8B 3KPQB 2E8ZA 1JNJA 5JOPD 2VN3A 1D7DA 3WIIH 4P9HL 2OTWB 4JZOA 2Z35B 1AGDA 3WO4B 1MFMA 3O6FB 5I76B 2EDEA 2FJGA 1V54B 1XB6A 4QTHA 4YHYB 4V1DE 4ZBJA 5ANMA 4UT9H 2B5IC 5HYJA 5C6WH 5I0DA 5DT1L 1VHPA 1BFOB 4G7SB 1JG9A 3VNYA 5DEGA 3MKGA 2ITDB 2XVBA 4MGXA 2Z8RA 3WFDH 3Q8AA 1G6VK 1MG2C 3DXAB 2R1YB 1UA7A 3SPHA 3GI8H 5CD5C 1MCIA 4M6NH 4E41D 1TNNA 1RUPL 1R3JA 3W56A 2QKSA 3CSTA 5LKNA 4ZO8A 4WW2A 3CUPB 4EI5A 1C16A 4Y16A 5LVEA 1AQDA 2XN2A 3KVQA 4AL8H 4CRPA 4G6FB 1WZAA 4Y2OA 1OPGH 1T66C 2BWDA 3K6NA 5DWUH 5J57B 3REWA 3TVMB 4JO8A 5FO8A 2FUTA 3K0YA 4RAVA 1TO4A 4LNRB 1I9EA 1IGJA 2P3YA 5IW1A 4YFLI 2WINB 2IH8A 1MJJA 3UAJA 3F7QA 1OAQL 3WFCH 3GUTB 4FA7B 3U2SB 4DAGH 4QKTA 1JUFA 4EF3A 1A6PA 1HQRB 2W65B 3DVNA 2GJ6E 1L9TA 3BH9B 1GTFA 3MUGB 4ZAKA 5F7AA 5BS0A 4MZ3A 4LPVA 4MMXC 1A5FL 3CU1A 4A7SA 3BGMA 1RV6X 3GMMA 3EZ8A 1XGRB 3N3EA 3Q9PA 1CLCA 4JGUA 3P2DA 1TZIB 2I5YH 1XL4A 2DEYX 3F2LA 4JFEE 2IFFL 3SJVB 4BHUI 3LN4B 3NOIA 3QULB 3ULVD 1MOEA 5EU6D 3FTUA 1NAKH 2GSIB 4BFNA 3ARGA 1L9SA 4ES8A 1OB1B 4KKAC 4M56A 4PJGF 4QCIA 4P9HH 3TURA 2N59A 1SUJA 2EIZA 3AG2B 5DSCB 4F7MB 3WLWC 1TZGH 2DDQL 5FFLA 1OGTB 3ZKXB 1EVTC 1MVFA 4FJ6A 4PR5A 4OUOA 1X9RA 4LVHB 5IREA 1AY1H 1PBYA 3JTSA 3OL2A 5IOPA 5F7MC 1EXUA 1JGIA 3BH8B 4M4RB 3TLRA 3L13A 4Q2ZA 2VKXA 4LKXB 1Y18A 2ZOKA 4WSGA 5MEPB 2H6OA 2X4UA 4QGTA 4O2EB 2RBLA 3QQ3A 2GSGA 1RUPH 1WAPA 1PLGL 1EEYA 2CRYA 1U3JA 4KGLA 5B1JA 1DQDL 1W0YT 1ZHKA 2QV4A 3KNBB 1PZAA 5I16A 1G0YR 3F04A 1F8TH 3L7FA 4XWGL 1IUZA 4NERA 2C3WA 1UD2A 4TKWA 2X4TB 5F96L 2MNUA 2G5UA 5DA4A 2Y06L 3P77A 1LDSA 2XWBA 1PL3A 2GITA 3ZTCC 4BHUA 1X3DA 2P5ED 5AW3B 2BIPA 1FAIH 3WHE0 5K5YA 5EBMA 5JOPE 4YBQD 3FT2A 2F15A 3C6EA 3UJIL 3HUJA 4OLYH 4HJJL 4EJ1C 4I18A 3GMNA 2ZNXA 5EPMB 5EBWA 4FC3E 3FH8A 4C59B 3RQ3A 3N9GH 4KU1A 2Y36L 4KITB 4JZJB 2DLTA 3BWAA 3Q2WA 3DX4A 3KD4A 3ES6A 4UZSA 3BPLC 1BZDA 2HRGA 5CKGA 4OTXH 2W9EL 1ND0A 4DETA 4DN4H 4N2LA 3VXSE 4OCXL 3GC3A 1UZ6E 3WXVL 4X9IA 5IWLC 2D7QA 5L2JB 2WIIA 1ZA3B 1U92A 1K4CA 4NPYB 4TQEH 4X5XB 1DQLH 3OGCA 4NO5A 3PPEA 3S36L 2AKRB 2MH4A 1HILA 4HK0A 5D1XA 1DSWA 1L9OA 2G30A 2DTML 3CQFA 4OF7A 2NY2D 4NIKB 5DYOA 1CLZL 5JYMA 1N64H 4HUKB 4L37B 5I73C 3MNVA 5GS0C 3NQKA 3H3BC 4WO4B 1Q0XL 2XXFA 3F6IA 4TMPA 4E9XA 3H85A 4YHPA 3VRJB 4G43A 4HZLA 1RZ8B 2VXVL 3FN9A 4H25B 1NOLA 4WI2A 5BVPL 5C3LD 4XNXH 3VYPA 2Y6SC 4MA8L 4XT1C 2IAMD 5C0AB 4KX8A 4P4KD 3HRPA 2ENJA 4N0UB 2E7LC 3IMTA 3IFLL 4XH2B 3PHAA 3STBA 1KPUA 3ULVE 1OOWA 1IM9A 4F5CA 3FPXA 1BZ9A 4XXWA 1SNRA 1A6WH 1NGQL 2CO7B 2VMFA 1JPST 2OL3B 4C56A 3CFTA 1C5DB 3MRDB 4H1LH 4TSCL 5E5LA 2JI1A 5SWQA 2AQTA 3LPFA 3PAVA 4HJJH 4LASL 2WQ8A 1MCWW 3K6SB 3FYEB 4HKZB 1UC6A 4KRMB 3HMWL 1NZRA 4JLRB 5EFIA 4ZDHB 2IDQA 1G4MA 4OD2A 5F3HB 3ZQ9A 1MRDL 1N59A 1FZKA 2O6EA 4KJQD 3IMWA 1GIGH 4JM4L 2VXSL 4HSCX 1RJLA 2FUQA 2ZZUT 3KBFA 3GSNH 3L9YA 4EIGB 2XWDA 5F0LB 4RETB 1I8IA 1TIUA 2NXZD 2GEQA 1P4IH 2VW4A 1LTXA 1UEMA 3R0NA 1I8MA 2FWLB 2Z8SA 3HE7A 3GXPA 2PETA 3C09B 1A25A 5FKPB 3VFVB 2ZCHL 4U1NA 4BSJA 1HX0A 1KLFA 3K46A 3AB0C 4JG9A 1OM9A 3QSKB 3JZYA 2ZAGA 4YHLH 4R7NA 4UINH 2VAAA 5EZIH 2N0KA 1F4HA 2WKOF 4U7KA 3CCHA 3J8F7 4ZODA 2P5EE 5GRUL 1QSFD 1M71B 3MLXH 2P9RA 4JKLA 4FKHA 4UZGA 1U4FA 4AQOA 3W9EA 5BNXD 2R2HA 3N0AA 5SX4H 4G6ML 5HHME 2EEAA 1RU9H 2WN3A 3DOSB 3D51A 4L29B 4M03A 3MOAL 3PWNB 4GAGH 5IESH 2WPGA 3S9DB 4APQD 3NCXA 4G7YH 4W9IC 1ACCA 2GAZA 2GJRA 1PD0A 2AK4E 1WFUA 2W1NA 4Y1AB 1ADWA 3IFLH 3ROOB 3SKNA 3FT0A 1FZMA 2ENPA 4NAMA 3WIAA 2HRLA 1RZKL 3EFOB 4YUEH 3QJQB 3BHBA 3MLVH 2YBRB 4GS7C 2NNFA 4PRAB 4PJCF 1CE1L 4TSCH 3MQIA 5IQ9A 3MCKA 1G0XA 3JWOC 4LASH 5DQJA 2BY1A 3QAZB 2FWSA 4K7PL 4Z7WA 5DFAA 1QWNA 1UQSB 1LEKB 2OQJB 3A4FA 4ODUB 4WKZB 1MHEB 2CA4A 4LEBA 3TH4T 2WBXA 4Z18A 5GPRA 5E56A 2B3IA 4AJWA 2VR9A 4IIQA 4KO5A 3VQ2C 3GMRB 3QHFH 4WO0A 4TULL 2OMXB 2VXSH 4BUQA 1JYWA 3NFSH 2G75B 3ZE1B 2EDNA 5FECB 3CN3A 5E8EB 2Y5EA 2WP3T 1FYTB 3ZVVA 5EIIA 2YOCA 2JJUA 2R23B 3WTYA 3G5XA 3HE6C 1RJYA 5E4EB 3T0EB 2OMZA 2FLRT 4Q9QH 1IRAY 5E8PA 4NO0A 4PJAE 4X7EC 3EYOB 4YE4H 4F7TB 3V0DA 1UVQB 1IBGH 4PJ5E 5FPIA 1KCVL 3QIBC 1SXZA 4KKBD 1ZT4A 4GKSB 5IM7B 3T1FB 1NINA 4ZW6A 1Z0MA 3EFDH 3QPKA 3T6WA 1MJUL 1USQA 3QJFA 4J28A 3FSWA 4WTZA 1K72A 2DWXA 2CCWA 3U6XS 2Z4TA 4WZ9A 5FYLH 2F9BT 5CLYA 1YNLL 3S96A 3V9EA 3W11C 1CDIA 1BSIA 1WC7B 4K71B 1TQTA 2Y23A 2XVKA 5TF1H 3EJYD 1DZ0A 4UT9A 2I26N 4PGDB 1HU8A 2GHWB 4BZ1L 4O2CB 2PR4L 3FU0A 2DBLH 3J7HA 5KSUA 3L3IA 1SOKA 2OX5A 3SHSA 4L3EE 1HHJB 1JFHA 3NJNA 4QO1B 2RFXA 3BYYA 4I2XE 2J1KA 2O6PA 3ZGIA 4LCWA 2HX9A 4XCNA 1AHWB 1OTSC 1SQ2N 1KY6A 1UA3A 3H7LA 2C7FA 1JZ5A 2GABA 4JVPA 4DVBA 4BQBA 1OZUA 1NL0H 4L48A 4M7LL 2H7WA 3L2NA 3QJXA 1MCOL 4L4VA 5I71C 3HW7A 1OEZW 2DH3A 4Q89A 2ZT9C 3RVWC 1CXEA 1NCTA 2CKBA 3IJEA 1ZV9A 1CK0H 4TL4A 1I1AB 4ZNCD 5TPWL 4M48L 3RVUD 1WFJA 3UC2A 1LO5A 1AP2A 3OKDB 4OZIA 2C8NA 2CDFA 4J3SA 4NJ9L 5TE4L 3RTQD 4U6HA 5E1IA 4U1SB 3O9WD 4NP9A 5EZJA 1XH3A 1FG2B 2R0KH 2QPUA 4P04A 3WNPA 1R3HB 3I9GL 2RAMA 1OCZB 2KQMA 5CIPB 4EIZC 3LHPL 1MW2A 3BP5A 3F7VB 4ADJA 4BQ9A 3KR3H 3ZKMC 4PTTA 4LRNL 1JNHB 4JQIH 4U0QB 4A2LA 1KCVH 3TA3B 2X6MA 2ADFL 4GW5B 3KPRB 4HHGA 4MNQE 2WLIA 1QABA 2DWDA 3MRHB 4B7IA 4ONHB 4X6BA 1CXHA 3NA9L 4M1DH 1XF2B 2K6YA 4UILL 3IB4A 1Y6MR 2V8MA 4RDQF 1DUZB 4WU5B 3TJEH 1PNDA 1ZOXA 4ZPTB 3ARRA 4R0LC 2Z93A 1E8XA 4S10A 3VGDA 2BHFA 2F54B 5FK9B 3RIKA 4BZ1H 4D9QE 3ZZ1A 3LZFH 3NPSC 4NI6A 3MRMB 2ERJB 3BUBA 4L8SC 4ZPVB 4GMTH 3LN5A 4PREA 1JDCA 2YMOA 1OAXL 5CEYA 3QIWA 3BLPX 1Y07A 4NFBA 1T04B 4BFGA 2DIBA 4G59C 2Q86A 3H9SB 2WK2A 2ADGA 3AXLB 4JHBA 4MMYB 5KBMA 5JA9A 1ZK5A 4M7LH 4Q56A 5B7MA 1Y7VA 2PF6A 1A9BB 2NY5L 3I84A 4X6CA 5FCUL 5E9AA 4ZUVA 3QJHA 4U1HB 5TDNB 5L2KA 5T5FH 5DVOA 2EYSA 4M48H 4RESB 5D72H 4Z7VA 3E3QE 4KTYA 3NK3A 1UB6B 3G6AB 5TE4H 3BKML 5C6TL 3NP4A 4JE0A 1YA5A 3UMTA 4YSUA 3B43A 3CTTA 5DJZB 4UTBL 4O5LL 4F2ME 4UT6L 4MVBD 4POZC 1DR9A 5DRZA 5C0FA 2H2SD 3RVVD 3WXWH 2CUAA 3OKLA 2E9BA 3BFOA 1EGJL 2FJHB 2G4EA 4R8WH 1S7WA 3RJDA 4OZHE 2YJLA 3HI1B 5K9QG 5LBSL 4JFQB 1A6AB 3QFDA 3NCMA 5D6CA 4LHJB 4OSUL 1SEBB 3W5MA 5AW6B 5BQDA 1SXCA 2XN1A 5JHLH 3SE4A 1G43A 1JFQL 1N2RA 2BNQE 5E2VL 3LV3A 5D7IB 5A2AA 3TJPA 4YJZL 5C8JA 4JRXB 4DWHA 3GXFA 5DURD 5AAPA 5GZOC 3PXJA 4OGXL 3WJLC 2HN7A 3D52A 5EO1B 4JREC 3ZUNC 2OJEA 4G7VH 3C5ZD 1M6OB 5HPMB 3N2JA 4GQ9L 3KL0A 3CN0A 3ULUF 3R8BB 5K9JL 1YUHA 2CK0L 1N19A 3BVVA 1GRWA 2K8MA 5AW9B 4CMHC 3AS1A 1S8DA 5I8OH 1T0NA 3LRMA 2UVEA 4BD4A 3JV6B 3NJHA 5DD3L 3PE9A 5AW4B 1HE8A 1ML0A 1EEQA 5BMFL 1BVZA 1QUPA 3DTDA 5HHOB 2EC9T 5DC0A 4M6OL 1J0ZA 1NWOA 3WTVA 2X10A 4G8GB 1AH1A 1HINL 2YK1H 3MRFA 1CDHA 3MV9D 3HN8A 2XWEA 3CWGA 1TMCB 5JIHA 2HXAA 4M5ZH 2ZWLT 1NGWB 2V7NB 2VRKA 2ZYHA 4U1JA 4FTVA 4G8AC 3IBEA 1QD0A 2DD8L 4H1LA 4ZX5A 1RKRA 5SX4I 2DMKA 4JN2A 3T2NL 3LKPB 4AV0A 1GAFL 1ROCA 3AVEA 4UT6H 4Y4FC 5T3XD 4Y1TA 3VQLA 4P23A 2IG2L 4JZOB 1CG9A 1HL8A 4PJHF 1KOAA 1FL3B 3T08A 4Y5XB 5AVVB 2FJGB 1CD0A 2DKSA 4QTHB 5DEFA 5ANMB 4XBEH 5HYJB 3CQPA 4X8GA 4N8VA 5DEGB 1F3RB 1PIFA 2XV3A 4JKNA 1AZVA 1JFQH 3EF7A 2R2EA 4DSYA 3H42L 4NS0A 4DKDC 2APBA 2WNXA 3CFCL 3BUDA 4RGNC 5J4MA 3DJSA 4XCFL 1IC7H 3WKML 5FUCE 3L3OA 1NFKA 1R3JB 1MCLA 1VDGA 4WW2B 1RURH 3QI9B 2K4AA 1C16B 1Z9MA 2CJUL 2VAJA 4Y16B 1AQDB 3LIUA 3HG1D 4HD9A 4HJEA 2VMJA 4Y2OB 3RZCC 4W9CC 3REWB 3LH2H 5FO8B 1IGJB 2FJUB 3BCFA 3L3DA 3N43B 5IW1B 4TTGA 4WI9A 3KAAA 1MJJB 1X5AA 2VE6A 2CZNA 2KZBA 4BCZA 1KC5L 4AQEA 4ERSH 3LY6A 4JQXC 3ZTJG 3OKOA 3D85A 3NMEA 1CXIA 1J8HE 2HKFL 2AJXL 1T03L 4M6OH 4ZSOE 3DVNB 4I9XA 2B77A 5K1VA 3TFKC 1X5HA 5BS0B 4LCIL 4OQTL 1A1NA 1MJ7H 1D5RA 1E9OA 1X44A 3BGMB 3ZO0A 1IAIH 3GMMB 3WNIA 4H5SA 1NLBL 2P5WD 1DN0B 4OF8A 3WEBA 4Q97A 5GS0H 5KVGL 3Q5OA 3MA9H 1YPZE 4AQ8A 4DEPC 1TZ8A 5TQ0L 3G5YB 1KGXA 1MCEA 2OSWA 2VZSA 3UBXI 5F9JA 4MJIE 3ARGB 1CI5A 3ZIYA 4KTEL 1NEUA 5E4AA 5L0QB 2NDGA 5EA0H 1L9RA 1NKRA 4QCIB 1SDDA 2IG2H 3WJMA 2EIZB 1CICD 4UQ3A 4F8TA 1L6XA 4BFBD 2NRDA 5I6OA 4PR5B 4GP4B 2E86A 3HTLX 1G5AA 3JTSB 4Q0XH 3U4AA 2H2PC 2XN9D 5IOPB 3LS4H 1UKSA 4Q2ZB 1S9WA 1Y18B 4O4YH 2ZOKB 4Z8FL 3C5JA 1ZA6A 4NQDA 4HAGA 3SKOB 2GSGB 2KT6A 2HFGH 4LSUL 4W6XB 1EEYB 5I1HH 5FHBH 5HHVH 3DKHA 5CCHE 2ZP8A 2WUBL 2ZUSA 5F3FA 3MUUA 5I16B 1PKQB 3HKZA 3L7FB 5CLZA 5FYJL 3FK3A 2QVFB 3SE3C 1QAWA 3HBGA 3MV8D 1KBWA 2K9UA 1BJ1H 3P77B 4IGBA 1EAQA 2XWBB 2GITB 3L4CA 4Z3TA 3RB7A 4PCKA 3BOVA 3TPUB 3FHQA 3KPPA 3UEQA 5EBMB 4AEHL 3UBXA 4R4NC 2CR0A 4YS4A 3HUJB 4EOWL 2VLKD 3GMNB 4Y9FA 5TDOA 1XAUA 3DUSA 4L2YA 5EBWB 1MRFH 4HUNB 4F8OA 3BWZA 3BWAB 3KW7A 2R1WA 5PCYA 1T1WA 2P80A 4KRLB 3DSFH 4IRZL 3EDEA 4OD1L 4YSOA 1AZNA 5A2IH 5BZZA 5MENA 3QR1A 3PREA 2YC1A 1HZKA 1XZ0A 4KXZH 1ZXQA 4H2AA 3GSRA 1N5YL 3FAWA 4IRSD 1U92B 1K4CB 5AKRA 3FMGL 5CILH 2CRMA 2YMTA 3OGCB 4OLWL 4NO5B 3I50L 1AXTH 4PW3A 4OCRL 4EBQL 3GTNA 3PJNA 1E30A 4HK0B 5D1XB 4CJ1A 1O6SA 2E6QA 4Q74A 5EC1A 2A73A 4NC1C 2YD6A 4NZRH 1G1KA 4N2AA 5DYOB 4AMWA 4MXWH 4ZXBC 3MNVB 4H8UA 4AVJA 5E23A 4QRRD 3ZE0F 4JQIA 4YHPB 1MCWM 1MW1A 3UDWC 3ZL2A 4K3DH 4N2NA 1QG3A 4HZLB 4RQQA 2NZ9D 2NY1D 3H56A 4LP4A 1CR9H 3VFWA 2WWKT 3TT3L 2WGXA 3MRLA 2Q76A 2WWMD 3IETA 3U1QA 1DJYA 2IH3A 1OAYH 3T5WA 3T71A 4BJLA 4DGIL 2DYPA 4F91B 4D0DB 1KPUB 7FABL 1IM9B 4G6AD 3CHOA 1BZ9B 2ZX7A 5IJDC 1IM3D 4NM8L 4C56B 5I6MA 4BZ1A 4K8RL 4Z3GA 5C07A 2X6UA 5SWQB 2YGPA 2QHRL 3OM3B 3JT2A 3IGLA 3BSZL 3O11A 4XN7A 4PJIF 4HIIB 5EFIB 3WD5H 1OK0A 4OD2B 1BJ8A 3JV4A 4H8HA 3RDTA 1FZKB 3IMSA 3RVXC 3D0AA 3DUUA 4LBEA 4M7JH 2G5RA 1A7NH 1RJLB 2HPOA 1IILE 4XMTA 1XF3A 4KDTC 2QQNH 1AVAA 1I8IB 3FU6A 4M93C 4Y2DA 5D8JL 4OFYA 4F8NA 1IC5L 3QDAA 1P6FA 2ARWA 3KPSD 3VQ1C 1NFDA 1S9YA 2AFNA 2UVFA 3PYCA 4UNTA 3HE7B 3VXPA 1I8MB 2MIZA 4XX1G 3I50H 5T5FA 3TPKA 3VWKC 1VCBC 1Z5LA 1T2XA 3CFEA 5I6LA 1HZHL 4U1NB 2F18A 1KLFB 1YEGH 3CH1A 3QXDA 4R7NB 5DYFA 2VAAB 4PJ9A 5DMYA 2D03L 4FHKA 4RWHA 2YN5A 4GRWE 3WCYA 4LXFA 3OPZH 1FLRH 1ODAA 3QUXC 5DFVC 1ZANH 2GTQA 2GSMB 4JFDD 2DKMA 3TO4D 3VDBA 3PL6D 5D71H 2HJLA 3S34L 4LF3B 2R2HB 4LE8A 2AEPH 4GBXC 1KJVA 6PAZA 4FA8A 1FDLL 1GGUA 2DM2A 4NAJA 4YL4A 2YQBA 3L5XL 3AABA 4R4FH 4W9HC 5IW3A 4H8VA 3TT3H 5JHLA 4F2FA 1G9HA 1YY9C 4KNSA 1FFPA 4JFHD 4PRPB 4FHJA 3SKNB 4LNVA 3MBXL 7FABH 3AQXA 4DKAA 4GP8B 1PLCA 1FZMB 2Y22A 1T0OA 2Y7QA 4IKJA 2YZ1A 1IO4C 3QAQA 3I3DA 2WVTA 4R7DB 3WY2A 3BHBB 4ANVA 1MLBA 4EO5A 4NM8H 2D8KA 2JKTM 1CDYA 5LNDA 3ARBA 3F00A 3A4DA 1AYOA 3MCKB 2B16A 4ZQKA 2FIKB 5DQJB 2QHRH 2VLRA 1MDTA 4Z7WB 3PLYA 1WA0X 1Y0LA 4LSTH 2ZD0A 1E4HA 3BSZH 1A3RH 2FHFA 2WKLA 5F6IB 4H44C 3UPRA 3RDJA 3AS3A 4WWKC 5A2FA 2XV2A 3CDYA 2F8XC 3ERXA 3OLIA 3HZYA 2MSPA 1LP9A 1EO7A 2DQIL 4ABUA 5EIIB 5KTEL 4TNVF 1IC5H 4XNZB 2DM3A 1A6UH 3IWUA 3RHWF 3G5XB 1I9IH 1RJYB 4PY8I 4A7QA 2OMZB 4X7CC 5B38G 5ADOH 1QYGH 3TZVC 1P84K 1BG9A 5E8PB 1RZFL 4U1GB 2GHZA 4CKQA 3V52L 5DZPA 4KMQA 4OCNC 4W93A 3N06B 4WQOA 1DDHA 1U36A 3PWJA 4FFWC 1ZT4B 2C1PA 4TN9A 4Q6IA 1F02I 1KZYA 2VCOA 4Y19E 5FF6A 4KBPA 2NR6A 2XJLA 3IMRA 4UT6A 5CJBA 1O7VA 2CCLA 2HWZH 3QJFB 3FTVA 3VFGL 1DVFA 1BXVA 1KIPA 5AW5B 3UZVA 3CHSA 3QDJD 4QRUA 1IAII 1EGJA 4XP9H 4AIOA 2NX5E 3QIUA 3S96B 1MIMH 2DMGA 3WE6A 5LBSA 3RVTC 4WIQA 4EIUA 4ZZKA 5IVXA 5KS9A 2EH7H 2O61A 1QRNB 3TASA 1OAUL 3W2DH 5KSUB 1JZGA 3L3IB 5D1QD 2OX5B 5DMIH 3TBYA 1BZEA 2Y4SA 2DQEH 2RFXB 1T2QL 1V10A 4U6XA 4XCNB 1QBLL 2R0LL 3P9LA 3OQRA 4R2GB 2ED8A 3K2UL 1EAOA 1BQHB 3HG5A 4DVBB 4P2QA 1MFNA 1ZCRA 4X4KA 1OSYA 4HGMA 5CKAA 1YEJL 5D7SL 3HZMA 4R9HA 2DQUL 2D2CC 4L4VB 4DK3A 5C3TA 1VPOL 3ESOA 1Q1JH 2YAHA 1A7OL 1X5IA 1FO0L 1UGKA 2YUXA 2IGFH 3G6JF 5TH2A 4YAQA 2YD4A 1G7JA 3QPXH 2YHGA 3DXAE 4YSRA 2CKBB 2WXPA 2VOTA 1KLGA 1UUNA 3IJEB 3QUMH 1AP2B 1QFWL 5KBKA 2CDFB 4Y2NA 1QHOA 5DHVH 5AVZB 4ZUSB 1XH3B 4JFDE 2OR8A 1NC4B 5EF2A 3U79A 5FOJA 3L3JA 5KYXA 1TTRA 2EACA 5E6ID 5I2IA 3BP5B 3JVGA 5IMLB 3HG2A 1U8KA 4PTTB 1KF9B 5JXAL 2LFEA 4PG2A 3ZUCA 2JB5L 2H45A 1XMWA 3FQUA 4JFHE 3ATAA 1A3ZA 2G5BA 4XTRD 3A67L 4AG4L 2DWDB 4H20H 1DBBH 4UANA 5FHAL 4OAWA 2DMHA 3A47A 1AXIB 1UYWL 2WO4A 1KIRA 1N26A 3CVBA 3NUKA 1FGVL 2YXFA 4M29A 1PX3A 1X7QA 1RUAL 4DQOL 1PCXA 3WLBA 5AYTA 3SSGA 3SCMA 5LQBL 3NJXA 2QTEA 2Z93B 3SJVE 1AO7D 3BDYH 4NBYB 1RIUH 2KBGA 3FT9A 4N3TA 3SBQA 4CSZA 2BDNL 3ULVC 5TQ2H 4KXZI 2CIKA 5DD6A 5HYEA 3LN5B 5CEYB 2X4NA 2FVNA 3ALPA 4IBYA 3DI2B 3UZQA 3B8YA 5HHXL 1JGDA 2JJWA 2Q86B 1QBLH 1XEUA 2ADGB 2G2PA 3UBGA 1JGLL 1NANH 3A6BL 4KQ0A 4YHNA 1D5MB 1ORQA 4N85A 3VSUA 2EDWA 2YD7A 1PZ5A 3GHPA 5D7SH 3VGAC 3GM8A 5JA8B 3T4AC 2HZHA 3ILQD 2ZSVA 2WXMA 3OX8A 1UFUA 1A7OH 5JYLA 1FZOA 4LZKA 1JHTA 2BY0A 4ZZFA 1AGCA 3LKRB 4X6CB 2APVA 1D3CA 1WLHA 2ZUQC 3FQ2A 1LO2H 3QJHB 3UAAA 5L2KB 2H32H 2EYSB 2VZVA 3KYAA 3QW9A 4Z7VB 5EH1A 5C3IA 1HCFX 1MH5B 5IB5A 2APFA 4ZFOL 1HH6A 4LFHG 2QKIC 4C47A 3V6ZA 4PFEA 2QL1A 1M3JA 4QHUA 2XY1A 2XBDA 4RMTA 4WWID 3ZKSD 4XBMA 5DRZB 3CV5A 4Y4HA 4JG1H 3IBOA 3SBWA 3TBVA 5C0FB 4P48A 1JAEA 1IAMA 1G87A 3FH5A 3OKLB 3W81A 4CDHA 4WCYL 1M4KA 3FHEA 2XKNA 2EJ1A 5D1QE 1S7WB 4LCCA 4ZW3A 2BINA 3A67H 4LEEA 5FKAA 3QFDB 4WTWA 5EN2A 1GZPB 2DQ6A 4YBQC 4TNWK 3D69A 3DNKA 1N2RB 3FUNA 4U3XA 1WWCA 5KSBA 1JGUH 1RUAH 4DPRA 2PPCA 5F7HA 4JPKH 3ZTJH 1AFVL 4Y1AD 1I3RA 4BA8A 1F6AA 2HN7B 4PRHA 2J1YA 4OV5A 3VD0A 2EDHA 4GXUM 2OJEB 3R4DA 4YBLC 4XO4A 1HK6A 4N87A 3WFZA 4EKJA 4YDVA 1LWJA 2WXGA 4FFTA 3LEVL 2BDNH 3MRQA 4N3UA 1YUHB 2FECL 3BAEL 1TETH 2ZOUA 1NDGA 2YPLD 1S8DB 1CIDA 1RZJC 3A22A 3UAFA 4ABVA 5AOKA 2GBUA 5CP3H 4TRPH 2GBTA 3B3IB 3IN0A 4E5XA 3ARFD 4X7SL 1I4FA 2EC9U 3CDGA 1F6FB 3KPNB 3DX9A 5I8CA 3EJUA 1F1AA 1OTUC 3MRFB 3IKKA 1T5KA 1U58A 4FG6D 5D5MF 2HP4A 3KL5A 4JDEB 5AVUB 1AD9A 1NCUA 4XN5A 4U1JB 4FTVB 3WUWB 4JGNA 1HNGA 1NOAA 1SOXA 4B27A 5E4OA 3WNLA 5D6DA 4JN2B 4XNYL 5C0AE 1YEKL 3NH7L 1L6PA 3IGUA 3ZE1F 1BAGA 5EUKA 5IFHH 4X8XA 4XZUA 2E7CA 1OARH 5FFGA 4N0UE 5TD4A 5EEWA 1EJFA 1YZZA 1AO7E 4P23B 2X28A 3NYKA 1K2DA 3QEQD 4OCYH 2A9ML 3EW3B 3UBHA 4TVPD 3MBEC 4LHUG 5T1LA 3ZTNH 4IRZA 4HULB 3IAQA 3FF7A 4HBCL 3G6DH 5DEFB 4OGAC 3O6KL 3EADA 1F4WH 2WKGA 4N8VB 3ZKND 2CDGB 2APWA 5E00A 3P54A 2QR0B 1F3DJ 4KNTA 1CD8A 4LOUC 2R2EB 1AQKH 4OCWL 3BFWA 4AVHA 1CLVA 1LHZA 1R24A 1AFVH 1CFNA 1F56A 1QNZH 1YYLH 5BV7C 4HGWB 3LZOA 5FS5A 3L3OB 1S78C 1IQDA 1U3ZA 3PQYD 1DJHA 1ORSA 4PCSA 2BOBA 4HJIA 3V0HA 4KJQC 3PAUA 1KNOA 1R33A 3M07A 4HCFA 2X4RA 2Z65C 3LEVH 1S7TA 4JY5L 3S3PA 1EDHA 3ARDD 3BAEH 2G60L 3PG2A 3T0BA 4M3KB 2AJUL 3LB6C 4GSDH 3L3DB 2CD0A 1E4XH 1S6NA 2QTVA 2Z31D 4Q6YA 4P2OA 2VE6B 3FRUA 4AQEB 1MCPH 1MWAL 3OKOB 4QYOA 4WFHD 3D85B 2BCKA 3NCWA 2JE8A 3CBJB 3L9BA 4O51A 4A7UA 4IKKA 1A1NB 5T8IA 1E9OB 2P43B 3ZT6A 2FAUA 3DIFB 5IB2A 2OR7A 2KZWA 2VR6A 4H5SB 2FIRT 2WBJD 1CT8A 1BEYH 4GJTB 2WN2A 4ODTH 1UATA 4KUZH 2Q3AA 3QR0A 1WEJL 1HCZA 5SWZA 3SQOL 3VRLF 4F37F 4ELKB 2UYLA 3NH7H 1QEWA 4YHKL 5F9JB 4L1LA 4Y1AE 3SGDH 1KV7A 3DECA 3BSZA 1KN4H 3HR6A 3FN0H 3IGKA 3T3PF 3GPEA 1SDDB 3HCVA 5EEVA 3WJMB 2A9MH 4UQ3B 4TSAH 4MAYD 3GM0A 1AQMA 3BP4A 4HUVB 2BSDA 1TSRA 1PZ2A 3VXQA 2X3CA 1UASA 5ICXA 4W6YB 1XF4B 4PVNA 3O2WL 1RSFA 5LGYA 1NCAL 5B3NA 1S9WB 3C8HA 3NTCL 3C5JB 1ZA6B 1QSZA 3C2SA 3MJGX 4NQDB 1XIWC 5EOTA 5CEZL 4P8QA 1G9NH 3MGOA 5LG1A 3Q8BA 3UTSD 3VRIA 4CBPA 4ZX3A 1IZJA 1NIFA 2CJSA 4WAFA 1LK3H 1Z3RA 2QPEB 2YWZA 4RA3A 4TSBL 1SHWA 4HDIA 4MB5A 1FYTE 4JM0A 4JY5H 4S11A 3U9PL 5E9DD 3ARZA 5D1ZA 1MVUA 1Z2KA 2FJSA 1QACA 3T0EE 2UXTA 4IGBB 4B7LA 4G9FD 2OK0L 1CD1B 3KLHD 2AXWA 4PN6A 4C83B 1CFBA 3TH3T 1J7VR 3F7KA 4GKOA 1H3XA 3K5RA 3KPPB 3U9WA 1WG3A 5DZLA 3UBXB 4XC1L 4QRSA 3QEQE 2ITEA 3WFHA 1WAAF 3ARSA 2NYZA 4TVPE 4KKBC 3L1OH 3IM1A 4XZ4A 3QISA 3DUSB 4LSPH 4AMKL 5M95B 1NBZA 2CRIA 4FTDA 4KKLD 3E3QC 5B39A 5HSFA 4BRJA 2WO2B 2ESVD 2AGJH 1NAMH 3FPYA 2WM0A 2R1WB 1BQLL 1T1WB 2W38A 4N0YL 4UM9A 3WNMA 4KK5C 3OKKA 4YC2C 5MENB 3SQOH 2YC1B 1T4WA 2E75C 1XZ0B 3O8XC 4YHKH 1MN4A 3EJYC 2GC4C 3AU1A 1KB9K 2R1XB 2ROYA 3ATEA 2CDEA 3GSRB 4FS0A 4U1IA 1YYML 3LS5L 5EIQA 3QUMA 4ZX4A 5J13C 3P3SA 3D9AH 5DMGD 1KCRH 1NANI 4MMZC 4V2BA 5IG7A 1SXNA 1M7IA 2A77H 4L9LC 5DHVA 2MTAA 2A73B 5EC1B 4FERA 3GMPA 2Z64C 2G4GA 2JJTC 3RNKA 4JY4A 1PY4A 3GUFA 1DJGA 2VL5A 1F58L 3LQAL 3AFLA 3NTCH 4JVWA 4RMSA 5GZNA 4M1CD 3H2WA 1CI3M 3MJ8A 5I1KH 2GCYB 5KSAA 3JYBA 3SDDA 4RQQB 3UFIA 2D3NA 5H35A 2FT8A 1WICA 4YGAB 2WIMA 3VFWB 3RVUC 5DFWH 4JO3L 3MRLB 2Q76B 4Z5RA 3BEVA 3IETB 3TBSA 5A7BA 2IH3B 3VDCA 3UXFA 5SWSD 5JW3L 1GC1H 4A66A 2DYPB 2XBZA 3MUHL 3IMBA 4RDQG 3T0DA 5IBLD 1XVSA 4PJXA 3F58H 4KXBA 1F0LA 1NBVL 1G1OA 2VXQH 1SMDA 3MRJA 3NAAL 3KPRE 3CFUA 4OJFH 5C07B 2LTQB 1I85A 3KJ4C 1RXLA 1NMBL 1EMTH 1H8LA 3O6LL 3O11B 3SDCD 3GXNA 4NT6A 3JV4B 3EYVA 2J57A 3RDTB 5I18L 1YAZA 3GHEL 4GOSA 3DUUB 3NIGE 4H7VA 1FSKC 2F54E 25C8L 4OZFG 1UM6H 4CU6A 4I8DA 2ICWA 1BAFL 1C9SA 4YDJA 3QXAA 1FO0A 1BCIA 3FXIC 2B8OT 1DLHA 4J4PA 1NFDB 1S9YB 1SHSA 4WI8A 4TVUA 1TQBB 1XEDA 4I3GA 3UTSE 3AUVA 3L6FA 3H9SE 1WJ3A 4K3EH 2PPDA 1OZTG 2AABH 2H32A 3ORJA 3OBAA 5I74B 1TVHA 1Z5LB 1KTDA 2PYEA 3CH1B 3QXDB 3S98A 4PI2A 4NQEA 4UU9A 1WF5A 1MUJA 1SBBA 3CMOH 3D33A 4I9WE 4ELDA 4PJ9B 4Y2LA 5BZWA 4L4TB 3V55A 3EJRA 3LQAH 1F58H 2H0PA 4BZYA 4EI5D 4HHAA 5FUCC 2E8YA 3IDGA 3Q6FB 4TQHA 2HJLB 3BKCH 3FRPA 3L95B 4PBWD 3R8QA 1XB8A 3ZYZA 2VXTL 1KJVB 1IAOA 1V7NL 4ZTPL 3F12A 3T0VA 3T6QC 1FN4A 1FFRA 1UCTA 4K9EL 3Q8CA 1G1CA 4JR9L 3KHOA 4JN1L 1YN7B 2JF1A 1JVOA 1ITBB 2C3VA 4KK6C 1G6RL 4WNQA 3UCRA 3ZHKA 2X12A 1H9DA 4ZAKD 3EZJB 3OWRA 1QBMH 3TWCL 4JBSA 1FRGL 1UM5H 2H2SC 2WZ0A 4PLOB 3ARBB 4GSUA 1KJ2L 3MLUH 4DKEL 4ZQKB 4G5ZL 1SEQH 2VLRB 1BHGA 4RAUA 4XXCC 3T2PA 2E4TA 2VO8A 1X5YA 3UTPE 5AFAA 2KLRA 1W15A 1Y0LB 2DJUA 1AZRA 3O6LH 5DS1A 5D7IE 4I3SL 4AX3A 3SYPA 1KYUA 3NESA 4W9FC 4I0KA 4X5WA 5TFSH 2XXCB 2CK2A 4JRXE 1KBBA 3GRWL 4GEJA 4L18A 43CAB 1N7MH 5CP3A 1QSVA 3DYOA 3UPRB 1WVZA 3UTQA 1WHPA 2AQQA 5BUPA 4RGMB 3HZYB 4Z3IA 1LP9B 4P5TB 5INCA 1H3PL 3T65A 3SBPA 3MGTA 1CURA 1QFOA 4QHKI 2OULB 4HV8B 1RHHA 1E7VA 2FECI 3BZEA 2Q9OA 3SQBA 4EDXA 5DEJA 4JMXA 1C8QA <