4DP0X

The 1.5 angstrom crystal structure of oxidized (cuii) poplar plastocyanin b at ph 4.0
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
99
structure length
99
Chain Sequence
VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Plastocyanin B, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
total genus 20
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp0X00
1RZPA 2YQBA 2QDVA 4YSQA 3FQ2A 3FYIB 1OCZB 4N4YB 1A8ZA 2IWFA 3FQYA 5B7EA 1PCSA 4YSSA 2YAMA 2PCFA 3X2QB 2XYBA 3AG1B 1J5CA 4BWUA 2BP8A 5B7FA 3G5WA 5PCYA 1MDAA 4GP5B 4MFHA 1W6LA 5F7AA 4K9JA 4BWWA 2EILB 3ABGA 1JOIA 5B1BB 1OE2A 2I85A 3AG2B 1PF3A 4AKQA 2VMJA 2ZONA 1XB3A 2BWDA 1PY0A 5LDUA 4GP4B 2PP8A 4YSAA 1DZ0A 1ID2A 1SF3A 4E9XA 2FT8A 3H4FA 2PPDA 4YSTA 3SBPA 1OF0A 4BXSV 4HCFA 1TU2A 2BP0A 1SHXA 3ZBMA 1F56A 1WAEA 1MZYA 3EF4A 3BVDB 4E9YA 1M57B 2XXGA 2DWTA 3PAUA 2HRHA 1CURA 4AI7A 2WO3B 3EH4B 3UACA 2VM3A 2VSMB 1W6WA 3T6WA 2PP9A 2BHFA 3ZDWA 3D12B 2VW6A 4KOCA 1A4AA 3S3CB 3JTBA 1SDDB 1FA4A 2VM4A 3GYRA 1BXVA 2UXGA 2XV2A 3NJMA 4BWTA 2B08A 3DIVA 3H56A 1BXUA 3C75A 2W8CA 1JERA 1AQ8A 1IBZA 1GY2A 4E9TA 2IDFA 3SQRA 1J9SA 1BYOA 4P5RA 1PLCA 3UAAA 4YSEA 1MG3C 3ASNB 1WA0X 3FU8A 1NTDA 2DWSA 3V9EA 1E30A 1N68A 4KNUA 2I7OA 1J9QA 2XX1A 5A7EA 1PZCA 5B1JC 3DTUB 1MG2C 3CVDA 3NP3A 5I6MA 1AG0A 1AG6A 2FJSA 4A2FA 4KOBA 3AG4B 4EF3A 3GXUB 5TK4A 3IE9A 4A68A 4KO9A 2DV6A 1WS7A 2YAFA 1PLAA 2FQFA 1MZZA 2TSBA 2DYSB 3IN0A 5E9NA 1AS8A 4Q8BA 3JT2A 1M56B 3SBQA 4YSDA 1SFHA 4AX3A 2J57A 4DP2X 3EH3B 3FSWA 1AZRA 4G70B 5I5IA 4HZ1A 1GR7A 4M3HA 4A2DA 4W1TA 4GYBA 3QJSB 3OQRA 3OMIB 3TBBA 2FTAA 4BXVA 4F7KA 2XV3A 2BO0A 1L9TA 2BW5A 2GI0A 1JXGA 2IWKA 2VSKB 2J56A 4DP1X 1JZIA 5B1AB 1SNRA 2HX7A 1E67A 2CJ3A 4KO6A 3MBWB 2EIJB 4KO5A 2PLTA 4E9SA 3S8FB 1TEFA 3CDZA 2ZWNA 5I26A 4X4KA 4DP9X 2JFCA 1ASQA 1A65A 4TXVB 1RCYA 2FT6A 2PPEA 3FYEB 1GY1A 2XU9A 2H5UA 1DYZA 4WTQA 3ABMB 8PAZA 5I6OA 1KDJA 2GBAA 1KYAA 2YAPA 4YSPA 3NSYA 1OV8A 1RKRA 2WSDA 4DPBX 5EHFA 3PLYA 1SHWA 3U25A 1OOWA 3KW7A 1A3ZA 3PXLA 1CYXA 1IKOP 5D4IA 1EHKB 1L9RA 1KDIA 4E9WA 2EIKB 1GS8A 4DPAX 5I6PA 1T5KA 3X1NA 4FAAB 3AG3B 4G7QB 3IN2A 4KNTA 2X87A 4G7SB 2IAAC 1CUOA 2VW7A 4JKNA 1I53A 5ANHA 4E9VA 4DP0X 2ZOOA 3NJNA 3NJKA 3NJGA 3NSCA 2AANA 4YSOA 4E9RA 1PNCA 1AIZA 1XB6A 3PAZA 3UABA 2YAHA 2R7EB 2W88A 1URIA 1AS6A 5AZUA 1BYPA 4GXFA 1JVLA 1X9RA 1AS7A 3FSZA 1XB8A 1NWOA 2PPAA 3PCYA 2HXAA 1YLBB 1KGYE 2YXVA 2PPFA 1ZDSA 3SBRA 2GB2A 3QJRB 1FFTB 1OCOB 1ZIAA 1BQRA 1V55B 3FSVA 5B1KA 1ILUA 2AZUA 3EH5B 5F7BA 2IDQA 4RH4A 3T6VA 4A2EA 6PAZA 4KO7A 4UAHA 3NJHA 4FA7B 1RZQA 3IBOA 1IBYA 2XWZA 2HX9A 3CG8A 3QJVB 1L9PA 3PAVA 3OD3A 3NT0A 1QNIA 3BQVA 3NP4A 1AR1B 2BP8B 1GW0A 1JZGA 1SFDA 1X9UA 1OE3A 1B3IA 1JZFA 4HHWA 2IH8A 5B1JA 3FS9A 4WKXA 1GS6X 4CSPA 1A4CA 3NJLA 1AZNA 1AZUA 3IEAA 1AOZA 3WKQA 1ET8A 1ZPUA 1UATA 2X88A 9PCYA 5AFAA 3T6XA 2CCWA 4PCYA 3QJUB 2XX0A 1CC3A 1WS8A 4G71B 1BQ5A 1BEXA 5IY5B 4DP6X 1ADWA 1HAWA 3S3BB 2BP0B 2HLEB 4YSRA 3WG7B 4BK5C 3ABKB 2GHZA 4YVUA 2YARA 6PCYA 1QLEB 3FPXA 4AKOA 4E9QA 1QHQA 1NIBA 4A66A 1NWPA 3X1BA 3ERXA 1IUZA 4NB7A 5TK2A 3TASA 4HCIA 1V54B 2UXVA 2DY2A 2FWLB 1EZLA 3FPYA 3AY2A 2OV0A 1JXFA 2YAOA 3OMAB 1E5ZA 1NINA 3X1EA 1L9OA 3KW8A 5D4JA 1E65A 4HALA 3N2JA 2UXFA 1BQKA 2CBPA 1ZV2A 2BZCA 3NJFA 1SDDA 3H4HA 2OJ1A 1N70A 1NPNA 3T6ZA 3QJTB 4G72B 4YSCA 2YXWA 4N8UA 4AZUA 1AAJA 2HRGA 1J9RA 2YAQA 1KV7A 1NIDA 1NICA 1WA2X 2E86A 3QJQB 4GP8B 2I7SA 3CZUB 4DPCX 2Q9OA 2B3IA 2XVBA 4ZK8A 3T71A 4M4RB 2ZXWB 2HX8A 1R1CA 1OE1A 3QPKA 2JKWA 4YL4A 3V9CA 2H47C 2QDWA 2XUWA 7PAZA 4NERA 3UAEA 3WIAA 3X1FA 1FWXA 3DKHA 2EINB 3OMNB 4GY4A 3AW5A 4P5SA 3WKPA 1TKWA 4YVNA 1ETJA 1ET5A 2GC4C 2XLLA 2PPCA 3TA4D 5I5MA 5B7MA 2GSMB 1PAZA 1J5DA 1ASOA 1ET7A 2TSAA 2QT6A 3FU7B 3L45A 3MX0B 1NZRA 3FSAA 3ZX1A 1M9WA 2H3XC 1AZCA 2A3TA 1PZAA 4A2HA 4F2EA 1A4BA 2PP7A 1NDTA 2MTAA 1GSKA 1GYCA 2FQGA 1KCBA 2PCYA 2XXFA 3GDCA 3WNJA 3WNIA 4YSUA 1AZBA 2IDTA 3X1GA 3NSDA 3PPSA 3AZUA 4BDVB 3QQXA 3EHBB 4DP4X 1KBWA 2BZ7A 3CVCA 3NSFA 1E5YA 4A67A 2P80D 3TBCA 2CAKA 1AANA 1IC0A 3NJJA 2UX6A 1XMEB 2BWIA 1L9QA 2P80A 1GS7A 2Y69B 1SJMA 5I6NA 2QPEB 1PZBA 3FT0A 3CDZB 3HEIB 1ZIBA 2UXTA 2J5WA 1BXAA 5I6KA 3S3DB 4UANA 2MRYA 1KCWA 1CYWA 4DP8X 2XV0A 4F2FA 3WI9A 4DP7X 5B3SB 2YAEA 4HIPA 5I28A 2EIMB 4JHUA 2NRDA 1NIEA 4CSZA 3OM3B 2GC7C 2IDUA 1NIFA 4DP5X 1TEGA 2AFNA 4AKPA 2FQDA 2VN3A 1KBVA 2OCCB 3N55A 2FQEA 3TU6A 2IDSA 3FU9A 1AACA 4Q89A 1ASPA 2JXMA 3RYMA 1SF5A 2CALA 4PAZA 2CUAA 1PNDA 4KNSA 3ASOB 4QLWA 2RACA 1PMYA 1VLXA 4UF7C 2WO2B 1JZHA 2AZAA 4G7RB 2Q5BA 2QPDB 5D4HA 3UADA 4W9ZA 2IWEA 2LLNA 3CVBA 4JHVA 7PCYA 2AVFA 1WA1X 1OCCB 4NAJA 3ZIYA 2HZHA 5PAZA 1NIAA 3FU7A 1PLBA 1L9SA 2IH9A 4HCGA 5I5JA 2GIMA 2J55A 1ILSA 1JZEA 1ZDQA 2DYRB 1W8EA 2UX7A 4L0PB 3HB3B 1J9TA 1BAWA 3FQ1A 3ABLB 2FT7A 4A2GA 2R7EA 1NPJA 1JVOA 4ENZA 5I6LA 1JXDA 3UGEA 4HAKA 1HAUA 4BDVA 1V10A 2FNWA 5AKRA 3NJIA 4HHGA 2N0MA 3S8GB 5FC9A 3T9WA 4QKTA 1HFUA 2Y1AA 1OCRB 3NYKA 2BW4A 1JZJA 2VW4A
chains in the Genus database with same CATH superfamily
5D7JB 2D7TH 3ALXA 5DGRA 3HUJB 1HZHL 4UINH 3U46B 2IEPA 4ZUVA 2WLIB 1PDKA 2H32B 4L2YA 3TN0B 3FUEA 2VLLA 4H88L 5J1AA 4G80B 5BRZB 1C5BH 4XMUA 5TF0A 1DFXA 5IESH 4EBQL 4GFTB 4CVUA 4JFYB 4EDXA 3EO1B 3HNSL 3U6RA 4APQA 2WQSA 3HTLX 5CZKA 4H26A 2DYPB 2SEBB 2IG2H 3H3PL 3IAGC 3ZE2B 3PHAA 4K9JA 5LWYL 1IAKA 4G5ZH 1CBJA 4KKPA 3LKPA 1INEH 4RQQA 3D69B 1SDAB 3D07A 2YD2A 3TIDA 5LBSA 2DMGA 5D4QA 4XO5A 2P52A 3PREA 1B6DA 4JDEB 2VZUA 3L3JB 4X99B 5IG7A 3ZL4H 1EAQA 4MNGA 4L2LA 5F96H 4KK9C 1TTBA 3VU2A 4GW4A 5DVMA 4ZW6A 4JG0H 4E9YA 4BFBD 1M57B 1LEGA 5C0NC 3MLZL 4FC3E 4AC2A 5FHAL 3BJLA 2VM3A 4ODTL 3DROA 4RBPH 4PCTA 1TJIH 4ZFZA 3UOAB 4JPWH 1CXKA 5C9JA 2GCYB 4NM4L 2O72A 2QLYA 4LVHB 3OF6A 5EA0L 4KAQH 3JV0A 3HZKB 1QKZH 1GGYA 5EEWA 4PM1A 5F9OL 2J8HA 2X28A 2NMSA 4HDIA 3IDGB 3L5XL 4ONFL 3GMMA 4HKJA 3V6FA 1LO3L 2P7TB 1J9SA 4M4PA 5EU6D 3K2UL 3MKKA 1PLCA 1XEDA 4L4VD 4G6JL 1CXFA 1XX9C 2UWEB 3FU8A 3SGJA 3B1TA 3JTSB 5GRVL 3IF1B 2E9IA 2EDTA 2BSTB 3ZTCC 1BD2A 3JWNH 5C7ZA 4OD2B 1AG6A 1XAUA 1OD7A 2GFBA 2BVQA 4Q6KA 2X09A 4LOVA 4XMLL 4ZDHB 3FQXB 4YHZH 1EMTH 1KIQA 4Z5RB 2P5WA 4ODXB 1TYEB 2FIKA 2NTSP 4YQXL 1PG7X 3VB8A 2LGNA 1F11A 1GAFL 2GT9A 4Q8BA 4Q0XL 4FFWD 3OX8B 2XVLA 3T8XB 3PIQA 4MMZA 3EOAB 3SBQA 4X6FA 1MEXL 5KZCB 2X53A 4ODVH 5T8IA 4A6YB 3ZKND 4L3EA 4PJ9D 1FH2A 3BAWA 4ZRGA 3VRLE 1QSFE 5AWNL 3KNBA 2F53D 3ULVL 1DVFD 3CD4A 4OB5H 1URZA 3N40F 1EJ6A 3LPWA 2AXGB 1A7PL 2QPUA 1S9KC 3DGCR 3LZRA 3HMXH 5E5MB 2VQ4A 1NC4D 3RWEB 2GSIB 1P4UA 3S37L 3MLVL 3IJHA 4HULB 4KZCA 4DUXA 4XPBL 2H1PL 4LESA 5C0BD 4M6NL 3VGAB 3S8FB 2XG4B 3QORD 5C08A 1TEFA 3WFDH 5AW2B 1BZOA 4HCRA 4F33B 1AZVA 1P7BA 3FSOA 4WI2A 1PW3A 1KZYA 1S3KH 4YBLC 2Y6TE 3K6OA 5T1KA 2CDFB 2CJUL 3CHPA 4RDBA 1I8IB 2DMHA 3F7RA 1DYZA 4LNRA 1ODUA 1OLLA 4WQOA 4MDJA 1LDPH 1H19A 2XPZA 4QD2E 3SDYL 1G9MH 1WWCA 5EV7A 3TM6A 4AIOA 1NL0H 5F7MC 3KW7A 2QELA 5EF1A 2O93L 1FIGH 5GGTA 4N0UA 4P57A 1NFDF 1G7QB 4RAVA 3LKRB 3U0WL 3GB7A 4K2UH 5A40E 4K7PX 4GT7A 1T5KA 2WINA 2WKOA 2ZQKA 2WN3A 1A6VH 1HQ4A 5DDHB 4AEHH 4UZSA 3X11B 4NRXB 2IAAC 4Y4KB 2QVFB 5H8DA 3MBED 5KN5A 3PWLA 1QNZH 3SN6N 4DP0X 4Z7WB 1TJGH 1AO7A 1ZVYA 2WTPA 4HKZB 5KAQF 3QIUA 4NQVA 2E7HA 4XODA 2Y7LA 4I77H 5F7LB 1URIA 3P73B 1I9RL 1NUFA 2WQAA 5JPNB 4AG4L 5IB4A 3E1F1 4B9CA 5D2NB 3GZOA 3HI6L 3O6KH 1JNJA 1ADQL 1X3DA 5ECJE 3CPLA 1OAUH 5BJTB 1KGYE 4NZUL 4P2CG 4GKLA 3HMWH 3VXMA 1QWUA 1LP9F 5ALCH 1FFTB 5EORL 4DAGH 4NQSB 3R4RA 5FYJU 5SX4I 3OSKA 2QGBA 3EFFA 5DLMH 5EZLA 3INUH 4AM0B 3DI2B 4XNXH 4ZQTA 2VDNH 1P1VA 1NBCA 2P24A 4AZ8A 4FG6D 3BWAB 3SCMB 5FUOL 1TVHB 4ZQKA 5EU4B 3APMA 3OHXC 1MHEA 2HTKD 4QJ5B 1P7HL 2OQJA 3KLQA 5T1DL 2PYEA 4HUUA 2H3NA 1QATA 2EQDA 3MA7B 1MXDA 4GKOA 5LLIC 4CW1B 1UH3A 4J6RH 3KLHD 2MWCA 4X7EC 5GRUH 1OT4A 5INDB 4FFYA 4IGBC 3LKQB 4KKCC 3TBTB 4C4BA 4M8QB 4KKBC 1KELH 2Y06L 3RNKB 1HXMB 2VLKE 1WS8A 1J48A 1G9NH 2V0AA 2FHBA 3MRRA 2DQMA 4NZJA 5IY5B 2BP0B 3ROLB 4HWEL 2DLEA 5FOJA 4ORGA 1AYOA 5H35A 5E6SB 1U3HC 3H7BA 2XTJB 3ABKB 1UZ6F 4PJHF 1J1PH 3DVGB 3IAQA 1UWXH 3TO4D 1I7TA 3ISRA 3HC4H 4AMKL 5AVZB 5GGUB 4A66A 2BS8A 4FMFA 5D5MF 1R3HA 1S9VB 4O2EB 2FJHB 3KDMB 4PJGB 2BSSA 2YBRB 4W81A 5EBWA 1SUJA 2F54D 1SXZA 5MP6L 3BHBB 4JPKH 1FFPB 5D93B 2DMBA 4PGDA 3SYOA 5CIPH 5HYJA 3MRIA 4MQ7A 4R0LA 2CRMA 2R8SH 3C5SA 4OTXL 3LDBB 3BLBA 5DJZB 3VFSB 2HTLD 4YHOL 2E27L 4IBTA 2A9DA 2NNFA 2W0KA 1VEPA 3FFCE 5I30L 4W9FC 2GJZB 4N1CA 4W9IC 2ERJC 3OPZL 2R2HB 4F80A 3ARFA 2MKWA 2E7LC 2XZAH 1ZS8B 3GD1C 5KBKA 1PYWA 2W92A 1ZLVH 1PZUB 2NXZC 5KTEL 2H47C 5FGCE 1GYVA 2JELH 3T3MB 4N8VG 4H40A 5LBSL 5L2KD 3PL6C 1NMBL 3FMGL 3V6OC 4IKLA 1U92A 5A2BA 3GMLB 5BO1H 3P3RA 5FOBA 4KQ3H 1ET5A 1QBLL 4N0FB 1XL6A 3EYUL 5AB9A 1NMCB 3VFTB 1YPZB 4X5WA 1YYMH 3Q05A 4GKZA 4XXCA 2K7PA 4RFNC 4ALAH 2VL5B 3JBG7 1ND0B 2WJ7A 2HT4D 1Y6KR 2BNRB 2JCCF 4P3DA 1KUMA 1B0GB 3VRIB 3C9NA 2JCCA 3O2VH 1VFMA 3DURB 4FQ2H 1HVXA 3QG6B 3T4AA 4MAUL 1GYWA 3O6MH 2IQAA 3BSZA 4D0BA 1AZBA 1DLHB 1NC2D 3N50A 1RURL 3UPAA 1A7OH 4WUKH 4YDKH 4OD3H 1D5IL 2DQCL 2WTRA 2R69A 1L9QA 3P4OB 2XTSA 4ABQA 3QHZL 3B9VA 2MCPL 3WNOA 1TTCA 1U8HA 4PJIE 1ES0B 1O5DT 1U42A 2YZ1A 5EBMA 5IM7B 4F37F 3V4PH 4UNIA 2ZUQB 3VXRB 4GO8A 3FCUB 4Z7NF 5AOLA 3IFNH 3O8XC 5EU7E 2CKNA 5C1MB 4J3SA 5DA4A 2NW3B 4BSWA 2FK9A 2ITCB 2X4NB 4LCUB 3G3LA 1H5BC 2Z92A 1WG3A 1T1WA 2E8ZA 4X9IA 1MQ8A 1NIEA 2LAGB 3NK4A 3BDYH 3PXHA 4XZ4A 5D2LF 4ATTA 1NIFA 5IQ9B 1AKJD 5KYNA 1MJ7H 2QEJA 1SLWA 4QXGH 1VFAB 2IAMD 1A21A 4XN1A 4XNAA 3TEZA 4YHIB 3RVVC 2XWBA 2E75C 3RVUC 4AVHA 4ATWA 4X80H 3NIGB 2RMNA 3L95A 3H2QA 4MXWH 1A3LL 2E6QA 3JUYA 4WWKB 5D7JC 5LGHH 3GRBA 3MXVL 2IFFH 3LVEA 3PFQA 4U1KA 3DRTA 5C7XH 1X5MA 3FTUA 2XNAB 4FTVA 2I27N 1PMYA 2RACA 4Q6IA 1XCQB 3TN0C 3E8UL 1T03L 3BKYL 2A83B 5CZVH 5CCJA 3QZNA 2OJEB 2N4IA 3W39A 5DQDL 4W9ZA 3BMWA 3AGVA 3NFSL 1NAMA 4PTTB 5I1AB 2D0GA 1KLGB 4LIQH 1MCWW 4PR5B 1OSEA 3QUYC 3C87A 3QPQD 3CX2A 3B9KB 3H42L 2IANA 4A7UA 5I5JA 3IDIB 3KM2A 5EO9B 2YA1A 3K5SA 2ICEA 4Z77A 4FYRA 1MHHA 2UX7A 1SY6A 2YEZA 3DJTA 4D8PA 1F4WL 1HHIB 2VDNB 3EGXA 4C59B 1TFPA 4NQED 3LN5B 3ABLB 3CH1A 3GJFK 4AQZA 1NPJA 3A24A 1WFNA 2ZAIA 4G6ML 3MJ9H 4R4ND 1ANUA 1AOHA 5IK3A 3BPNC 5IF0B 4ZW5A 4F8PA 1ID5I 3NJIA 1FH5H 2YZ8A 2JK5B 4UZUA 4S1QH 3QGVA 2R2EA 4P3CH 3I9GL 1F2QA 4GQ9L 4HV8B 5ACMA 3WL9B 2H0PA 3CSYA 1KLFA 3CN3A 4WTZG 3QWOA 5CJBA 1ED3A 3JWDH 5SWZA 1A1OB 3WNMA 4P4KD 4KTDL 3HI1B 1CN4A 2VKXA 4XTRD 2CR6A 5A2AA 1KIRA 4B96A 4WFHE 1QPPA 2XIBA 3F6IA 3NPSB 3QEHB 1NGPL 5T5NG 4I0KA 1EO8L 2ZP8A 2EUXA 3UZVA 4H8WH 2PCFA 4WK2B 3TPKA 3AG1B 5LJYH 2BOBA 2BP8A 5F8QC 1WGVA 5JW4Q 1PKQE 3K80A 1F8TH 1ZTXH 4NKDB 3UEQA 1XH2A 2WXFA 3ILPA 3US1A 2NY7H 1IGFL 1P6AB 2I85A 4LDEB 3CV5A 3DV4A 3Q1SH 3BZDA 2BWDA 3GSWB 4N28A 5AOJA 5DMJB 2IH3A 3C08L 1BPLB 1TF4A 4QHKI 5EU6E 3L5IA 5DMIH 4L4VE 4MTMA 5CIPB 3S8WA 4BXSV 3NIFB 2RA1A 4PRIA 1D6VL 2HLFC 4ZMYA 5J6HA 5IGXH 2YO3A 1UACL 2X6AA 3L4UA 4G2AA 5A2JH 5F1SA 3VFVB 1NJ9B 3N85L 3THML 3RIFF 5DHYA 3MU3A 1DANT 4JFQB 4HEPG 1ZXQA 3C8DA 2WVSA 4GBXB 1WV7T 2VM4A 4QRRD 1SVZA 2JKLA 4KUZL 2P45B 5J0BA 3NN8A 1UH4A 3BUBA 2EXYC 2EAEA 4N6RB 2VERN 4OIFA 1FL3A 3O3DA 3F85A 4PGBA 1A9BA 3Q1EA 3UGXA 1RLWA 3GPSA 1SUHA 3QB7C 3H9YA 3U1SH 2VUKA 3MV9E 5LAXA 3FQUB 2A1WH 1CQYA 1IARB 2UY7A 4FFYL 2AJUL 4JJHA 5DSCA 2EVHA 2Y5EA 3CDFA 4BCXA 3KPSA 4K3JH 3MLWH 3VGAC 3TPUB 2F53E 5TE6H 1KENL 5J12B 1R5VB 3MLYH 3R06B 2XX1A 2WYIA 2R0WH 1Q94B 5ICZB 4NZTH 5FB8B 2WVUA 3GSQA 1MG2C 3CVDA 4XPHH 1NFKA 4GEIA 5CFHA 5C3LD 2YK1L 4OI9A 3OSVA 4WGVB 4XWOD 2FLBT 5C0BE 5I17A 2W59A 2R2BB 2TSBA 1PG7L 4DGVL 3MMEB 1EZSA 3H9SB 1EEUA 2GSGB 1A2YB 4DEWA 5FYKL 2VDOL 1M56B 4L8DA 5DCCA 4Z76B 4PG9A 4JMXA 5DRXA 2O61A 4HUWA 1T21B 1QSED 4JKPL 3JSSA 5D7EA 1N67A 5CZXC 4JR9H 1C8QA 3V4PB 4A2DA 5D7LD 4M5ZL 5TFSH 5E08H 4NN5B 4UDTB 1B88A 1LTXA 5IOPB 4Y4KC 1EBPA 1AXSA 3JV5A 4OUOA 4JFPB 5JHDB 4LCCA 3GUTB 3ZHLA 5LO7A 4LVEA 5GS3A 3BWSA 5TQ0H 4OF3A 1UWYA 4ONOA 4HS3B 2OR8A 4OI8A 1C1EL 1MCSA 2P47B 4PWKA 3ILQD 5I8OL 4YHMH 1KB5L 3KLAA 1OT1A 2WB7A 3TCTA 2X4SB 3UGUA 2FX8L 1I1YA 1JV2B 4Y16A 3C60B 1VADB 5JPNC 2NXZD 4ZSOE 4XMKL 1K5WA 4WW1A 1ASQA 4LP5A 3BAKA 4WF7A 3FT4A 4ANKA 2IMMA 3QXAB 4R7NB 4MB3A 2BZDA 3GJEB 1X5ZA 2CBOA 3RIAF 1NEUA 2WJ5A 4Z78B 2F1BA 1OV8A 4YGVB 2BIHA 3ET9F 3INOA 4K8RH 4WHYG 2QSVA 5C0EB 5KVEL 3PNRB 2YFOA 3HRZA 4X7SH 3UBXA 4TULL 3ZYJA 3SCMC 4FHJA 1BFTA 3GTNA 3CSBA 3M1CA 3OR7A 1JUFB 1UXLA 2YEQA 3MNZA 2PABA 3D87B 1FGNL 1L3NA 4RRPG 4CKVX 3SGEH 4HPYH 5K9OA 4K7PL 4LMQE 2CUHA 3A67L 3BGMB 3CXFA 2IH1A 4JQIH 1DQDL 1ZLDA 4KXCA 2QQKH 2Y3NA 5CBAA 1E6JL 1DLFL 1LYQA 3PPEA 2R69L 2X40A 1JNNL 1EGJA 2AXJA 1RZKH 1QLEL 5I18H 1GHFL 3FUKA 2H4EA 1RZJC 4LRNL 1NCUA 3HPJB 3KLDA 4G9FD 3MBXL 2UZXA 5DS8A 3EH1A 5JOFB 2F5AH 5CILH 2VMDA 3U30B 2XTJC 3O8XD 4NIKB 3I6KA 1EDYA 1JNHB 2HXAA 3V0AC 4GLRH 3UH8A 3GBMH 4WHDA 2PPFA 4HZLB 2IOOA 2GB2A 3O0RH 5AENA 2MCG1 1YN7B 1OCOB 4AMXA 3FSVA 3KYOB 5TDPB 2Q87A 1CGWA 3FQWA 3LKOA 3TO2A 1D5MB 3MRCB 3V52L 4F9PA 4ZX6A 1HNGA 2D9QB 2LR4A 4JY4A 1LEIA 5D1ZI 4G8IA 4XNQA 4TSCH 4R7LA 5FGSA 1AHWC 2G4GA 5D7JD 3LDBC 1B0RA 2CLZB 4WO4A 5DURB 3HKZA 2F54E 2VR5A 1TCRB 4HIJB 4Z18A 3PV7A 4IIQC 3FUJA 2Z31B 1DEEB 2NSXA 3TN0D 3UPRA 3JWNC 1M7UA 4KY1H 3DARA 4IOFC 4X8GA 2CM5A 2Y36L 3GC3A 2HFTA 4JZJC 5BRZD 5FS5A 3DX8A 9PCYA 1FLRH 2CBQA 1JGUL 1LK2B 3QUGA 2DYPD 3BH4A 2ZCKH 5JMOC 5JW4N 3ARTA 1WZ1L 4TS6A 1JGVH 2EZ0C 5E4IA 2OA9A 5TF1H 3MPCA 2VC2H 3BD3A 4Q4EA 4H2AA 1HL9A 2D2OA 3Q2NA 3BAXA 2WXRA 4J8QA 1CFBA 4FJ6A 4E9QA 2JIXA 4R8WL 1N12A 5F70A 2N1KA 3IMTA 1IQDB 3ERXA 1MLCB 3OKDB 3Q3GB 1MAML 3AT8A 4GS7B 4ODWA 2EDOA 4PVBA 1DQQA 4QKXB 2WWMD 2YGOA 5L2KE 3N1PC 3QCUL 4MS8D 5KSBF 5HVFB 3SKOA 1XCTB 1MCPH 2X1XR 4ZPVB 4F7CB 1DN2A 1AJ7H 3QISA 1UJ3A 5E8EB 3UZQA 3T0XA 3V79C 2AK1L 4OR1A 5GS1B 1B0IA 2FWSA 2QSCL 2ATKA 4PI2A 4LGRB 4PJAB 3CN4A 4R90H 3WJLC 2VLKA 1NICA 4PB9L 2YGVA 4YNYA 3T2PA 2BC4A 3MRJA 5KYXB 2Q9OA 1HCVA 2F19H 3FKUS 3GSNH 3NA9H 1MOEA 2ZUQC 4YFLF 2ZUYA 1G9MC 35C8L 3SQOH 3V95A 5J8OA 3EO9H 2ZWLT 4WY7L 3NCYP 3IMWA 3LQAC 4IRZA 3V7AE 2WYHA 3OAUL 5K39A 4XE0A 4WU7A 3UAEA 4CU7A 5F3FA 4ZAKB 4PWFA 3NFNA 1A5FL 2R1XB 5KOMC 3OAYH 4I3RL 3P2BA 4U1IA 3U7WL 4ZYKA 1ZJBA 2JJSC 1CL7H 4ODUA 3VI4B 1IIKA 5BZZA 2ALAA 2DL2A 3LB6D 2DQUL 2CR3A 3MX0B 2VRKA 5I16B 2WXJA 4HGMA 4U3SB 2UUDK 4TQ8A 4WWKC 5DEGA 3N1QC 3VWKA 3KHQA 4O2CA 1U4FA 3QDGB 5FM5O 1BZ9B 5C6PB 3FFCA 4LSRH 4G6KH 2VJXA 3L3DA 2MTAA 1PSKL 4M03A 1IBHA 4KHTL 1D2OA 3GSVA 4MDRA 4UWQB 4H8HA 1RZIA 4N2NA 1EHNA 4ZD3L 1A7RH 2GW5A 2X4UB 1CIDA 3RZCC 3QHFL 2WQVA 3RGVB 4FI8A 2JJUA 1C5CH 3ZLQC 5HDQL 2EXYD 1E5YA 1I1AC 1AGBA 1PX3A 3CZFA 4HXAH 1FL5A 3U7YL 4EZLA 2OR9H 7FABL 2WUBH 4O9HH 2WOYA 1JPSH 1S8DB 2WNGA 1U8OB 3STLB 5AG9A 5BXFB 4JDTL 2CH8A 3NCFB 1SJMA 3OKOA 1TUPA 1MVUA 3PUUA 5GSRA 1OAKH 1JGDA 5IJBC 4KXZH 3QDMB 4X83A 5CJXC 3WXWH 3NACH 1T0NB 3SE8H 5I19H 1A9VA 4IMKA 3VE0A 3HHRB 3UTQB 1KJ2H 2ZOTA 4EN3A 4F2FA 1NBVL 3S5YA 2YAEA 4IHOA 5IFHH 2EIMB 3IU4L 2GTWB 2EJ1A 1HE7A 1T89C 3KGRA 3MACH 1OQOA 4XC3H 3BYTA 3RFZC 3O3BB 2D0HA 3FOLB 4MA8L 4F2ME 2Y5TB 3I6GA 2VQTA 3D85A 2JH2A 4HWUA 3WS6C 1DJWA 2G5BA 1PLGL 3GLDA 1KFAL 3O4LA 4KQ4H 4TVPH 3VSTA 3P11L 1YNLH 5HVWA 5JW3L 5A16B 4N8VB 4UCFA 3BEVA 1F4YH 3ZE1B 5ETUB 3JYCA 4PJIF 3OKNB 3RVXD 5DFWH 3DLQR 1UB6B 2AZAA 2HFGH 3D2TA 5HD8C 1WUZA 4K94H 4GMTL 2QPDB 1UQSA 3A6CH 4BK5A 1N0LB 5HGBB 1UENA 4Y4KD 3ULUD 3V5DB 4UOZA 1R3IL 2AVFA 4IJ3B 1NCHA 3BKCL 1HOCA 4JFOB 4QOKA 4XPGH 5I8EB 5TE7H 4AL8H 3ASWA 5IEKB 1DBBL 1OARL 4JO3L 4PJFF 2C7UB 4BIKA 1U8NB 4QUOA 4XPAL 3CVHH 2WUCL 3GSRB 2GIMA 2HP4A 5FUZH 3RVTD 4UM8A 4AH2A 4OCXL 3GHBH 1WEJL 1T7WA 2VR9A 3WS3B 4LQ1A 3PGFL 5H2BA 2G5RA 1MHPH 3E38A 3QO0A 4KI5F 4J3OG 3IDXL 3S0PA 4HAKA 4H8VA 1F4AA 2CA3A 4KPHL 1HYRC 2HJLB 1Y0LA 5IB1A 5B8CA 3MRMA 1B4JH 3NRFA 3A6OA 5DD0L 4D9LH 1S7VA 2DWYA 4KUCF 2A7BA 1K8IA 2R29H 2XPGB 3VWJC 1MPAL 1NUNB 4RZCA 3Q0HA 4XN7A 1PZ2A 1RZPA 1GZPA 3OJMB 5F7FA 1SEBB 2VWEE 2Q10A 2FSDA 2WXHA 1N0XH 1U8MB 4M1CC 1PEZA 4M48H 3SCMD 4MQXD 1J05A 1YECL 3ATAA 4WI0A 4NPKA 5BNXD 1QBAA 2VC2B 1I7ZA 4G43A 1F13A 4M5YL 1T2QL 3B7UX 4AW4A 1DDTA 4HHAA 1LD9B 4FXKB 5EH1A 4K9EH 4S1SH 2ZUVA 1W6LA 4KH9A 5DI8B 1UADC 1AQMA 4ALAC 1T1ZA 2R2CA 3WN5B 1SN0A 3VD1A 1M1XA 2OZNA 3ZTJG 2ZONA 2XY1A 2P1YA 4ELMB 1RZJL 4XNYL 2AK4E 3H4FA 1FNSH 4MX7A 4YSTA 4XN9A 2JQMA 2XQBL 4WHYH 2XTJD 4QXUH 2CZNA 1BWMA 4OZGE 1I8MB 5LCVH 3BP5B 3JVGA 2VH5L 5IKCB 4GPVA 5C0DB 2HRHA 1JK9B 2YD3A 1W6WA 5AOKA 4O51B 5E56A 3Q43A 1EH9A 5KANI 5IV2B 1KZQA 4DFIA 1M7IB 5K1JA 4XOAA 4QEGA 1BAFL 1WAAE 3GSNB 5KSAB 2XIDA 1QABA 1E9QA 4CVXB 1K8DA 1VACB 4G6FB 5D7IF 3U0PB 1QI5A 3TXAA 4MXVE 5L8LB 5K59E 1KPUB 2HLAB 1V7NL 4H5SA 4E36A 3DA0A 4H4NA 1RUPH 1PKQA 4M5TA 1UWGL 4AIZA 1QSEE 1AH1A 1A3RL 3HHSB 1H3VA 3ISYA 5BVPH 2OCFD 2EEDA 2UV3A 4IOFD 5BZDB 5D7LE 3F3HA 3SGDH 5EU6A 1JZ5A 3RKDD 1RK1A 1HXYB 4L4VA 1HIMH 3S96B 2I7OA 2J2ZB 3LN4B 4WFED 3MRKB 5D1XC 1G84A 3DPBA 4DSYA 1IM9B 4RWYH 1UH2A 5IB3A 3T8VA 5GZND 3ATBA 3NP3A 2EZ0D 2OMWB 3CMGA 1ZV9A 3B1UA 1H15B 4KOBA 4JRYE 1V3MA 2WW8A 3VTMA 2AJSL 3DX7A 2VDRL 1EXUA 1WS7A 3IFOB 4UNUA 2DQEH 2WLKA 1JPST 4G42B 5EZIL 1JV5B 3OR6A 4X6DB 4K4KA 1RPUA 4R97C 4PY8I 4IOIB 1EUTA 1II4E 1ORQB 4I4WA 5IT2L 5HHMD 5FYKU 2BX5A 4JFXB 2BNRD 3QPXL 3M1OA 5CEYA 3DVNB 3V6OE 2Z7YA 4TV3A 1E27B 1YEKL 2AAVA 4M3HA 4B27A 3ULVF 3HS0C 43C9B 5CMAA 3BLKA 2ZXCA 1BEYH 1MQKL 4PJ9A 4Q9CA 5JPMA 2J88H 1U8CA 4ZMVA 1KJ2B 3PWPB 1Z3GH 1XQ4A 1IBGL 2MNWA 3HVDA 4W9KC 1M71B 4MQSB 2F53A 1DVFA 3EYVA 3P4LA 4P04A 3MI6A 2Q86B 1KYOK 5GGVH 5GGRB 5T1LB 4OLXH 1G87A 2DAVA 4FQXB 2R39A 2YMXL 4KO6A 1NC4A 3DX4A 5HHVL 3BZEA 4KO5A 2ED6A 4P2QB 4PB0H 3VXRD 4NUGL 5C0BA 1QO3A 1VB9A 1YO4A 4D0DB 4IRZL 1YAIA 3U30C 1HINL 2ZWNA 3JWDC 1G9ML 3QORA 4FKHA 1ZHLA 1NCJA 1ZLWK 2DN7A 1W0WB 3S9DB 1PX8A 3LQAL 1JZ3A 2DTSA 5DU7A 4G9FE 1WPCA 3X17A 2JXMB 3AQYA 1BAGA 4U1MB 3WFEH 1XIWB 2EIEA 4B95C 4KTYA 3VUAA 3U25A 4UT9L 4CU6A 1KXVC 5ANMB 5BOZG 1J1OH 5BO0D 1Y6MR 5F0PB 2GI7A 1EHKB 1QWHA 3EG9B 4WWKD 1XGUA 2PCPA 3V0WH 4Q4IA 4Z0BL 5KVFH 3CVHB 5CP7A 4BCZA 3N04A 2Z91B 4N2HA 2B20A 4CMHB 1UCBH 3MJ7B 5CP3H 1DJZA 1PZ5A 3U4BH 4TNWK 4FQLL 3TZVC 2EC8A 1SQ2N 4DTGL 3LPOA 2Y6SD 4PBWD 1CLCA 3VA2C 3EJSA 3GXFA 4ZMXA 3EDDA 2C4XA 1JXJA 2CJTA 3QNZA 1S7XA 4NO3A 1N5AB 2IXQB 2ESVB 4MHHI 3MBEA 3BFOA 3UG3A 4EIBA 3FRPA 3HUJE 5KAQG 3AXIA 3M86A 1WO2A 2OMVA 5F7EL 4RFEA 1MNUL 1E4XI 5IFAH 4DVRH 1VJSA 3RAJH 3B9KD 4QTFA 2C9PA 4O02L 5C70A 5BRZE 2I07A 3QZWA 5E8NA 4DZBB 4YFLI 1FFNA 2EH8L 3D39E 5MHSD 3SGKC 1XCWA 1VZGA 3FU6A 4I87A 5ABZA 1JHTA 25C8H 4N3TA 4BEIA 2V17L 5GS0H 5EOQL 5HDWA 4X4YB 3ZE2E 4I3GA 2QHLA 4GS7C 3I3BA 5DR5L 5EOCH 2A77L 4OY9A 1KTCA 2RR3A 4Y8AA 5F7BA 3U2SA 3MO1A 3PHOB 5LB1A 3QFJB 3EOTH 4MD5B 4FQCL 1ZA6A 3W2DL 4R7VA 1VENA 5F3BA 5A7BA 1XGYL 4FFTA 4MMYB 3ARZA 1SJEB 5FV2A 4OSUH 2Q8BL 1MJUH 2DLIA 3OB8A 1QNIA 4XMTA 5J57B 1OSPL 3KVQA 3UYPB 1L3WA 3D6GA 5FO9B 3NJVA 4K07A 3MQIA 5DLLA 3WHE1 4YDNA 4CSPA 1XGQB 5HD8D 2W07A 2FJFB 3IEAA 1BOGA 4MA1C 4GW5B 3TH2T 3IXAB 2NY0B 4AYDC 5C0RL 5B3JF 2WXKA 2UZIH 2YGQA 5JNYB 1BEXA 1UOLA 4HBCL 1ADWA 4ZODA 4XPTH 1HAWA 4XMPL 4JFDB 3LZPA 4M9OA 1I9JH 4F7MA 4QO1A 4OV5A 4CBPA 3QFGA 1P7KA 2DPKA 4HFWB 1AHMA 3QWQB 4QXTA 4Y4HC 3VFGL 3GMNA 2BIPA 4A63A 3DHJA 3CK0L 2UWEE 4HKBA 4N2CA 3CMOL 3TASA 3SPJA 2HRLA 1YYLL 1G7MB 1ACXA 1CG9A 4U0QB 3PHQB 3WHXB 4DN4L 1MWAA 4DVBA 43CAB 1KGJA 4U1NA 1LILA 4OZFG 1L9OA 1KXTA 2F54A 1ZVSB 3U9PL 1N9PA 3SHSA 1U8PA 4GBXD 2EO7A 1V8HA 1J0HA 5I15L 1FZKA 5DJ6B 3RGVC 4NC2B 1XZ0B 3WFZA 4CC4A 4YSCA 1MW2A 5DRNB 2DM3A 3QS3A 4OLVL 5DEFA 3HCVB 3P9LA 1Z6JT 1DBAH 3AADB 3CZUB 4JKMA 1CVSC 4LKXB 1NCBH 5KJRL 3U6XS 3EBHA 2HKHL 1BQSA 4BFKA 1QUPA 1CLOH 1FG9C 1I7RA 2A6IB 5ACLA 4J3OH 1KBKA 5HGAA 3SPIA 4ZX5A 4NZFA 7PAZA 1S4IA 3S34H 3BEWB 1OALA 3NDZE 2J5LC 4HT1H 4OCWH 4EI0A 1HN1A 2OMXA 1TKWA 4I7ZC 4ADIA 5DK3A 5I5MA 5L2KA 1H3PH 3W3BA 3GXPA 1GMEA 2HN7A 5C92A 4QHMA 1UHVA 2HKAA 4AK2A 3L45A 3BVVA 4BA8A 3FH7A 3BW9A 5I66B 3DSNB 3OG4B 1FFRA 4HMDA 4QF1B 3VA6A 3I3DA 5C0JB 2W38A 3H9SD 2V5SA 1UZ8B 4XX1E 5AW9B 3X14A 2CKBB 5T3XH 5CINL 1QA9B 4Y2DC 5ILTH 2LU7A 1RK7A 2VYRE 4U1JA 2VERA 1KCBA 4IYKA 1RJLA 4R3SB 2IPUK 3WNIA 5E8PB 4N0RA 3X1GA 3V0HA 1DJGA 3T0EB 1KBWA 4RA3A 4AE1A 2P80D 5GGQL 1NC2A 4V1DB 5HPMB 4BKTC 2BWIA 3CFEB 4XAWL 3ZYIA 1ULVA 2VJ8A 5JHDD 5DEJA 4OFIA 5KSUA 2AJZA 3LN9A 3A4DA 1MCOH 3MRDB 4X9GA 2LTQC 5I6KA 2IVFC 2BFVH 1J5CA 1VGEH 3TURA 2VDLL 3ULUE 2R1WA 1FVDA 3C60D 4ADJA 4BKLA 5IR1B 3K72B 4Z7WE 3APCA 4U1SA 4FNUA 2EP6A 3OM3B 1PKOA 2X6CA 2DKUA 4XX5A 1JWMB 1QBBA 2QKIA 4XBEH 1AKJA 1GJIA 2Q76A 1RIHL 2IAMA 4JHWH 4UAOB 1MCFA 5D2NE 1JZ4A 5LNGA 2JNZA 3I6LD 1CYGA 5DJ2A 5G4OA 1AR2A 1B90A 1S9YA 4MA7H 1WCBB 4PAZA 3R7QA 4QHUB 3G6AB 3FTSA 3LEXB 4LO9A 1JZHA 2F7RA 5E2VL 2NY6B 1KN4H 4LBEB 4FXGB 3REVB 4XH2B 3NZHH 2XACC 1MFCH 4AT6A 4DN3L 4B6ZA 4MB4A 2CO4A 1ZLSH 3Q6FA 3QNFA 4PW3A 2P44B 4PLOB 1YJDH 2IPKB 4I0PB 2DQJH 4JM2D 2VDML 1PLBA 5AL0A 2IH9A 3WY1A 1H0DA 4LE8A 3L1OL 3F6JA 1IAOB 1J7VR 4U6HA 4YPGB 2J4WH 4F2MA 4RMBA 3V5KA 5JOPD 4GSXA 4LPVA 3FQ1A 3ISWA 3T1FB 3WJMA 3ORJA 1BQLL 4Y5YA 4NQEA 2YGNA 3FCTA 3KLKA 4M6OL 4TSAL 3JWDL 2MEJB 4RA0C 3QZBA 4BDVA 3RY6A 5I76B 1I3VA 4K23L 3T9WA 5DJ0A 4NNXB 3CZSA 5CCHE 5TDOB 4LCWB 1P4IL 1QFWI 4MCYB 1DVSA 2VXQL 1K4CB 1H8NA 2G4EA 2XTJE 3VI3B 5LQBH 2BFGA 5KSAC 1UD5A 4QRAA 2BSED 5E8DL 2W9DL 1E6OL 3CSTA 4PLKC 1P2CA 2OXHB 4ZOEA 5CGYD 5ELIA 4P4KA 1RIVH 2H2SD 1CE1H 1PZDA 1J88A 4FQIL 4N2LA 1MRDL 2BVYA 1GVIA 4NXKA 3FQYA 4PJGE 5A6IA 5BV7H 3L3HA 1ZTXL 5FO7B 5CD3B 5JLZA 3RUGB 1YEIH 2HH0L 2Z31D 1M3IA 3NJXA 2YQ3A 4W6YB 1FZJA 4S2SA 3FB8A 2X4PB 4JKWA 1RLBA 1U33A 4W68A 1CGSH 4WEUD 1NCWH 3ARVA 2YXFA 3NIDB 1OAXL 5SV3A 3WTXA 5FFLA 3C09B 4OM1H 2KUTA 2CDGA 3AG2B 1FQ9C 3I75A 4PGCB 3B2UC 3L3GB 4UB0L 2JI2A 4WFGE 1S46A 2PP8A 4YSAA 4JK0D 4XP1L 4G8FB 1SF3A 2IGFH 1BGXH 3JWNE 1KSRA 5DJAB 1TJXA 1DFBL 1XF4A 4CGUB 5IJKC 2IPTH 5IB5B 4LQFH 5MI0C 5D1QC 5D7SL 1LO5A 4WFEE 5CFAA 5EO1B 2HKFH 4IS6A 2GK2A 4I9WD 3UTZA 2EXWD 1SZNA 2B9BA 2X6UA 4GXUN 4TNVF 5D96B 4RISL 4L1SA 3T3ME 2P46B 1Q1PA 3IE4A 4WI9A 4LU5L 3J27A 2DWEB 3FN3A 3QZPA 4S10A 5ALBH 1WK0A 1INDH 2YD4A 4XVOA 3RPIA 2ARJB 4QRRA 4AWJC 3ARGB 2B08A 1YPZE 1MFAL 4NO2B 3TBSA 3G5ZA 4OT1H 2G9KA 3WD5L 4OKVB 2VDQL 4NCC2 3DO7A 2BNRE 2DF3A 4Q52A 1T7VA 2J1YA 3DJ9A 3WSQH 1KTRL 3EGDA 4MJ2A 4MD4A 4HP5A 3WXVH 5L4MA 5I1HH 4OFDA 3S3JA 3BO8A 2FGWH 3ULAB 4MRBA 4J3XA 4OZGF 4AYEC 4XGZB 4JL2A 2I32A 2ITFA 2CXGA 1QBML 2NY2B 1O0VA 3MLSH 4V11A 5E70A 3BCFA 2W0FA 4WEBL 4TUUA 4MA3B 4UV4L 3Q48A 2A99A 4ZAKD 1FNEA 3W9DA 2C8NA 1DCEA 1J1XH 5AKTA 1WAAF 1UKTA 5H37G 1DQVA 1XBDA 3ARRA 3DX6A 3O6FC 4Y5XC 5IROC 1WBZB 2YAFA 3BPCA 3VXRE 2OP4H 4K94C 1WAAA 3ARBB 1AE6L 1W0YT 4MXVF 4KK5D 5K59F 4D0CA 4JN2A 1QUNA 2E56A 3C2AH 2Q8AH 4AL8C 4LMQI 1QYGL 2MPAL 4N0CC 3V6ZA 1DBMH 3QDGD 4CDHA 4EI5C 1QSEA 4KKRA 3U0TB 4MBOA 1UXSA 1XD0A 1CPUA 3BVNB 1BSIA 1RPKA 2F1AA 4LDOB 3WUZA 4LLUB 5B4MC 3BSGA 5D7LA 3RGVD 4F7KA 3KM1A 4ES9A 1JF6A 2V2WB 3NIGE 1VESA 1R3KA 2EUVA 1WWAX 4GAJL 4AENA 1MRCL 3WE6A 2J56A 3Q2VA 5C0CB 2HX7A 4UQAA 3HNVH 3W81A 4LL1A 4MWFA 3ZL1A 5ESAA 1L5GA 3ATEA 1Y7VA 4FI7A 4LLWB 2E7LA 3BWZA 3K4AA 2I60H 2X70B 1T83A 3V0FA 3UIYA 3IMUA 4K8RD 4YS4A 3GNMH 3WNLA 2VXSL 4U6YA 5D8JL 4H20L 4XRCA 4ZMQA 3S36H 4HC1H 2DQGH 4DFHA 2L04A 1J10A 2IALB 2FR4A 2HMID 4HJJH 1D7FA 1NLBL 4OZFH 3OTTA 1D5BA 2FX7H 3T1WA 2FJUB 4OFVA 4Z9KB 1SHWA 1Z9LA 5JO5A 4LSTH 3BZFA 5MHSE 2EADA 1ZHBA 1D5XA 3VD2A 4LARH 4LGSB 1OP5K 4PRAB 4PJ7F 4P06A 4LCYA 5I6PA 1I1FA 4WCYL 5DMKB 1CQKA 2YPKB 4DIXA 4NJAL 3U2IA 2K8MA 3OXRB 4N24A 4JKNA 5DK2B 1WDAA 2CHXA 2UYLB 2DH3A 4ZMWA 3X12A 1ZD6A 2W60B 2AMGA 1C16B 2NY0C 2QGCA 1A7QH 1JWUB 2ICCA 5IMMA 4IRJB 2EDEA 2Y7MA 1PX4A 2APBA 2Q3XA 4YLCA 4ZS7H 3UABA 3JUZA 1CGTA 2W88A 4G8EA 4G9FA 5AZUA 5SWQA 2FYYB 4QAMB 4RGMC 2CO2A 1O6VA 4JZOB 5D9SA 3O8XA 1ICTA 2KH2B 2F74A 3UTSB 4IM8A 5C0FB 3MYJB 4YXKH 2ZXGA 3VXTA 3F64A 5E2JA 2EYSA 1ZK5A 4PIRF 1QR4A 1QW8A 1QSZA 2ADYA 3T6VA 1BX2B 4FYSA 3KYKL 3CFKB 1DE4A 2FZ3A 1BXXA 2XWZA 5AW4B 1B2YA 3NIFE 2BJML 3HAEA 1TQSA 5A2LH 4QXWA 3QUXB 3SPVA 4PMEA 2R0KH 2VITB 5ACZA 1QVOB 4TM9A 5D7JA 2NR6C 4MYPA 4OJCA 2VXUH 1BM3L 1UXWA 3HUJA 4ZMNA 4FFVD 3A21A 3U46A 2X1QA 5HDOA 1CIUA 1LM8V 3FT3B 2Q7AA 3NJLA 3TN0A 4BZ2L 1X5IA 4Z3TA 1AOZA 3VXSB 1ET8A 4RVBA 5FEBA 4N90D 4G80A 1NFDB 2BCMA 5BRZA 5ADPL 5GISH 1WP6A 4JFYA 5DGQA 1BQ5A 1BCIA 4LHUB 3WAJA 2YA0A 1J18A 2DYPA 2F5BL 3DJRA 2SEBA 3WKML 2ZWSA 3SKMB 1JTTA 2F1EA 1A0QH 2OW7A 1F41A 2BDNL 4YHLH 3T6QC 2KL6A 2V9QA 1XMWA 2XY2A 5CEZH 1F1DA 1NCDL 3D69A 4HQQH 2FH8A 1ONQA 1X5XA 1I82A 1NWPA 1JVKA 5DZJA 4JDEA 1UASA 3L3JA 1S7QB 3O81A 4X99A 3F58H 1OAYH 1A4JB 2WP3T 4NCDA 2NYKA 3VXPA 4X6EA 4FOMA 4LSSL 3IFPB 4JO4L 4BFIB 2Y5QA 3SDAA 1Q9LB 1WCQA 5KSAD 2HFEB 1D3CA 1JZ6A 1T2JA 2GCYA 3CFMA 4PLKD 3PWJB 1LP9B 4G6FD 2ARWA 2AABH 2GEQA 3H9SE 8FABB 2YXWA 3VO0A 1JPTH 2J1WA 1ZRUA 3HZKA 5EU5B 1CDGA 3MNVB 5IQMA 1HTYA 5F7WC 1KEGL 1LK3L 2A74B 1Z66A 5DYFA 5AZEL 1T20B 2Z0BA 4ODSL 3PJSB 3JV6B 2G5UA 2L3BA 3F7YB 3II2A 3F5WB 3QPKA 4FCAA 2P7TA 3V9CA 4O58H 1K3IA 3I74A 4OJFH 3QULA 2UWEA 1LMKA 4C4UA 3P1VA 1IM9D 5CN1A 4I88A 3OMNB 5F6HJ 3KWTA 5HHXL 4FMKA 3IF1A 5DJXB 2BSTA 4S1DD 4OLUL 5ISZB 1HDMA 3VG9C 4OD2A 3P0GB 5E1HB 4XP5H 3FQXA 4ZFOB 1SN5A 4Z5RA 2DZEA 2B2XL 3MCYA 4BD4A 2WLMA 4ZS6C 4UAOC 5F7YC 1JK8B 2ZPKH 3FT2B 3T4YB 3HOGA 1KJVB 1UOKA 3OX8A 1I9IL 3QC6X 4NP4H 3EOAA 4XVUC 3AWEA 1L9MA 2VR3A 4HZAA 3NSDA 4F20A 1R9FA 2WXIA 2NY6C 4A6YA 4FXGC 3E6HB 5D5MB 4JQXC 4WO0A 3C5XA 2EIBA 5KVDH 3RZWA 4ODBD 3I6LE 2X89D 3N0PB 3PWPD 4NRYB 4I13B 2A9MH 2Y69B 4LIQE 1VHPA 1XWVA 2XQYG 2BHZA 3MODH 1UA6L 5L9DL 3UJIL 5I1IH 1IGCL 2B9AA 3NPZB 4OZFB 1X7QB 1ZIBA 5T1LD 3KH4A 3RX5A 3WIHA 2AXGA 3ML8A 4PPTA 3P30L 3O2WL 4FQXD 4OQTL 1WTGT 4L1TA 4U6VL 4WVRA 5E5MA 4MASA 3PAYA 4ONGL 3RWEA 3OBAA 3CIQA 3SDXB 5B3SB 2G9HB 4TVPD 4Y1TA 2EC9T 2NNAB 1UB5B 2ZXDA 2OK0H 4UOW1 2OJZL 4J1UB 4ERSH 3OJDB 4XWGH 4Y1AA 1TEGA 4F33A 4P59L 1P53A 1CBVL 1EZUA 2FQDA 1KBVA 2CDFA 5K69A 1NGXB 3UC0H 2ROYA 5JOPE 3RHWF 1XIWD 3NCWA 5IEHB 3JZ7A 1MVFA 5AAWC 4NWUH 2GBTA 4NKIL 3ZVVA 3CVIH 3CZJA 3K71B 2M2DA 1CLYH 1TU2B 1FZMB 4L5FL 3GBNL 3LS5L 1FYTB 2FRGP 1N4XH 1GZQB 4G6AD 1G7QA 3LKRA 2C34A 2YKKA 3ZE0E 4JO2L 4UIMB 4AVJA 3RU8H 4XBGB 4HKXB 2ZYSA 1K3ZA 3T8MA 4UDUB 3ZGIA 3BVXA 4UNVA 1KCSH 1T0PB 1CLZL 1Y6NR 5AALA 4B97A 3ULUF 3PUCA 4FN0A 2PWDA 3X11A 4NRXA 1YNTA 4ABWA 4Z7WF 2ESVD 4OZIF 1L4IA 4U49A 4WI6A 1CFNB 4Y2OB 3QR2A 4ESKA 5ID0B 5LXVA 4PG2C 5BUGA 2Y07H 4WI7A 4Z7IA 4DW2H 5DHVA 4PJ8B 4YH6A 5E6ZA 4BCYA 3AUVA 2UY6B 4HPOL 4D3CH 1Z9OA 4PLJD 3EHBC 2J20A 3P73A 4BGDA 1P5UB 2CD0A 2VAJA 5KWYC 1HAUA 3TYGH 4NN6B 5D2NA 4TTGA 2LVCA 4GO6B 5TGBB 1RU9H 2DQDL 3F01A 5BJTA 2Y1AA 4Z7NB 2AJXL 4NQCB 1CGXA 1U2YA 4NQSA 1OZTG 2OL3H 1Q4NX 2CHDA 1NDMB 1X44A 1BZDA 4IBYA 3QFJD 4P9MH 3ARGC 3MKGA 4R7DA 4P46A 4YHYC 4I9WE 4AM0A 1OCZB 5GJTL 1A8ZA 1UVQB 1ZSDA 3EXJA 2FD6L 1TVHA 3SDDB 4RMRA 4QDGA 1KC5L 5FGBA 1E8YA 4HU2A 2YAMA 3MGOB 5I1CL 4F3FB 3MNMA 2FATL 3QAZB 1WT5C 2AAAA 1THCA 3HS8A 1VERA 4OIIH 5L8KB 3KJ6L 1KBPA 1LJMA 2WIIB 3MA7A 4RDQG 4XOBA 4CW1A 4HIHB 4I3SH 5I8CB 3ABGA 4OCRH 1V7ML 5INDA 1N3NB 2NY0D 1TZAA 3TBTA 1OTUC 2NY2C 2X9WA 4AKQA 4PJAE 1QRNE 4M8QA 3GHEH 3RNKA 4E9XA 2HG0A 2MOGA 5F21B 5TQ2H 3IU3B 3BVTA 4JB9L 3ZO0A 5FA3B 4ZMPA 5J13C 4DJMA 2BP0A 2CHNA 3ROLA 2C9XA 2CO1A 4V33A 5I1KL 4E5XA 4YC2B 2CLRB 4POZC 4PJDF 3DVGA 2WWKO 2OYPA 3VFOB 1DUZB 3IJ9A 3DYMA 5EUOA 5GGUA 3EDKA 3GI8H 2QR0B 3WOVA 1WIPA 3JTBA 2APSA 2HWZH 1CFQB 1DQLH 3KVPA 2XPYA 4U0RB 1G1YA 1S9VA 4O2EA 2AVGA 4PJGA 2J6EH 2G0LA 3BVWA 3ESOA 3UJTL 3SO3B 5A3ID 3LZLA 5BVPL 4MAYC 3SPCA 3VI4E 1FFPA 3ZHFA 1FP5A 1RZ7H 4JPVL 4EI6B 1XR9B 1F45A 2IDFA 5DJZA 3VFSA 4E42B 3RWGB 2WXPA 2YUZA 2WXGA 1WFMA 2GKIA 4NLHA 3QDGE 2YSTA 1KCUH 3CXHK 1U3NA 2R4RL 4P5RA 1AFVL 1LNUB 3ULSB 3L4XA 3MOAL 2DKMA 1QACA 2OMTB 4IHBA 2GJZA 4K3GA 1RJZB 1T4WA 1LXMA 2D4DA 2R2HA 3WNPA 3LXCA 1ZLUH 5KS9A 1ZS8A 2G60H 3EZ8A 5JQ6L 5E9AA 4RWHA 5B1JC 5FV1L 3LAFA 1UGKA 3MV8B 4E2OA 5GZNA 4HOXA 3RDTD 1SJHB 3FTWA 4H0IA 4A68A 2EVIA 5LGJB 3BVUA 4G1EB 5DD1L 4PIBA 2DYSB 2J6WA 3QDME 1AP2B 3GMLA 1PL3A 2EDWA 5EN2B 4CNIB 3F83A 4NZDA 4QAWA 3VFTA 3LIZH 1YPZA 1BM7A 2CDEB 2B77A 3L7EB 2VL5A 1KPVB 1ND0A 1Q0YH 3U7AA 4HOWA 2BNRA 5FYLH 1NGQL 1EFXB 2W65A 4MQTB 1B0GA 1HWGB 3QJSB 4JQVC 2BOLA 3VACA 3VRIA 3HMXA 4MLIA 3IDJB 3VYOA 1MIEH 3DURA 5CGMA 1RVFH 2WMPB 5DYOB 3QG6A 4AQEB 3T0ED 5IZ7A 1S7WA 2BW5A 1DLHA 3QHTC 4OKDA 4X8CA 4V1DD 2A38A 1DBJH 2EUWA 4IDJL 2B5IB 4OCSL 3KDPB 1MXGA 1I1RA 3N1FC 3ZE1E 4LSQL 3S36X 5HI5C 1P4BL 3G08B 1DDHB 1HOEA 1KBGL 3P4OA 4PRDB 1WF5A 4GI9A 4XVJH 1MVYA 3G5XA 2OMYB 3DO3A 1ES0A 3WDIA 5I6XB 4LDLB 5IM7A 4M7LH 3WDJA 4KMTH 4Y9GA 3VXRA 2K70A 3WFEL 2VMEA 3B5TA 2AEQH 3N6YA 3Q6GH 4NHUB 2XWTB 4KFMA 5HYSG 3X3FL 4TRPH 3EFDL 2NW3A 1CD1B 2B1HL 4A1RA 3LXAA 5DWUL 2IIJA 4I5BB 5BV7C 4TL4A 5IQ9A 3WJJA 1K6QL 3VG0L 4PJCF 3KAAA 4FKKA 3TCLB 1YY8B 3B8YA 1VFAA 4JPIB 4ZS6D 4KXDA 2LQRA 5E2TL 4M62H 2YXMA 4OM0H 4YHIA 4GFXA 4DPAX 3ZRSA 2VIRA 3AG3B 4HWBL 3VXQB 1BBDL 4XVUD 2YSSB 1JNLL 4TLSA 2XNAA 2NY6D 1L7IH 1IKFL 2IBZX 1KGCD 2Q3AA 2Y7QB 4NO0D 1XCQA 1RUQL 1DJSA 3WGUB 4LK4A 1MCDA 4L4TB 2A83A 4E68A 1P7QB 1YEEH 5HI3C 2MQCA 2OJEA 5CJOL 2DLHA 3LNGA 5GS0D 4MKTA 1LVEA 2ZYHA 3M7OA 5CCKL 3DDFA 4I0PD 1H9VA 2NY1B 1A4KB 4PTTA 3WIHL 5I1AA 1KLGA 2R7EB 2CWRA 4PR5A 1JYNA 4RGNC 1UUNA 4LOFA 1FHGA 3B9KA 2GYSA 2OL3B 1G7JA 2HVKB 3HN8A 4N90E 4AQ1C 3T77B 3IDIA 4N3UA 5EO9A 1X5KA 2K9UA 5GHWL 5TPWL 4ZO9A 4W70A 5D70L 3QJRB 2A0LD 2DMCA 3Q8EA 2BY1A 3LN5A 1FO0A 4R4FH 5B1KA 3QEGL 3T2QA 1J11A 4Z6AT 1XD1A 1OGAB 4ELME 1G9HA 1MCJA 4AIEA 2AITA 1U2CA 3BT0A 5IF0A 3HG1B 4MDIA 3L5JA 3MLTB 2JK5A 1T6WA 4LCWD 3G7TA 2OXGB 3NCYS 4IBSA 1ETZB 4HJIA 5BUPA 3MCKB 5I23A 1XHHA 4HV8A 3LIUA 2UVFA 1AGCB 1YN6B 2KQMA 4JFZL 5C71A 3SOBL 1A1OA 1WYJA 3KYAA 5BCAA 3OAZK 4ZO7A 5LXGL 5FCSH 3HI1A 5F44A 4OBRA 4B9KC 2A74C 4YX2H 5IW1A 4LDCA 3QEHA 1SXAA 3AS3A 4HXBH 4ZTPH 2CCWA 4PCYA 2A2QT 2F9BT 4PV8B 1C5DB 1CC3A 4E0RB 3HNTH 1D7BA 1A6PA 4NGHL 4ODHL 3EJYC 1BJ1J 2LLGA 3H7LA 3BIKB 4NKDA 4XO9A 3EH2A 1LWJA 1CMOA 2X3BA 2AKRA 1F86A 3WO4B 1A3QA 1TTGA 5JIQA 5MEOB 3X1BA 1BVKA 3T0AA 4NB7A 1J87A 4GJTB 4PRNB 3IFLH 1JJUA 2OMBA 3ES6B 2YAOA 2VR8A 2X4TB 1UZGA 3WY3A 1NSNL 1E65A 1HSAB 1YG9A 1O9VA 3VFVA 2UZPA 4HALA 1NJ9A 3N2JA 3QI9B 4L18A 2CBPA 3QWNA 5HDBF 2XKNB 4JFQA 5I1DA 2OJ1A 1TFHA 3GK8H 4GBXA 3O3EB 3QJTB 2PW1B 4X6DE 4R84A 1ODAA 1XTMA 3LH8A 4J3OD 4OGXH 8CGTA 1AAJA 3LEYL 2APFA 4PJEB 1MHCB 3AACA 4OF8A 5EO0B 2C9SA 4DO5A 1ZANH 4NQXA 2IFGA 4M1GH 2ENJA 3BN9D 5CUSL 5F1NA 1R1CA 1HILB 3PWNB 2JB5H 3FQUA 3MCLL 1XF2B 2QDWA 4DQAA 1WSST 1PZ3A 3PWPE 5JORA 4EN2A 5C8JB 3BRGC 2NY2D 3DKHA 3TPUA 5DVLA 5JQHC 1R5VA 1NKGA 2WVTA 5T3XD 1AR1C 1Q94A 3QR0A 5ICZA 5D6DC 1HZHH 3QIBB 4FNLL 2APXA 2NPLX 1X5GA 1F02I 3ARDC 3QRGL 3GSOB 4P2QE 5JIDA 4H88H 2QQLL 1MJ8L 1RHFA 3JZYA 1XL4A 3ARBD 1BIIB 4TVPE 2R2BA 3NQKA 1M9WA 4PW9A 4EBQH 3QJXA 1H8SA 3DYPA 3HNSH 3VMOA 3H9SA 3U4AA 4J39A 2GSGA 1A2YA 4JY5L 3ZZ1A 5I0DA 1IJNA 4Z76A 1H3GA 2H6OA 4P23C 3H3PH 4M7LT 5LWYH 3MRQB 4DWHA 1HSBB 1T21A 3MTXA 2ZJSL 4X2UA 4K7FB 4ZUWB 5JMRA 1P6FA 4AVIA 1IC0A 2WCSA 5ANME 2UX6A 4URTB 1T5XA 2P80A 4UDTA 5B39B 5FECB 4F27A 2DOCA 4HSAC 5KSBB 1ZLEA 4IBQA 5DC0A 3CDZB 2APWA 4JFPA 5JHDA 3NA4A 3ZSTA 1N7ML 1XF3B 5C0CD 4ZI8A 3RPKA 3MLZH 4LPUA 4OZHB 1KIUB 5FHAH 3AVEA 4Z7QB 1XSJA 2NSMA 3LQZB 4ODTH 5AW6B 4XNDA 1BYNA 3UAJC 4F1ZA 2AV7B 3EJQA 2ESVE 1MAJA 2X4SA 4NM4H 1XR8B 1JV2A 3L17A 3C60A 1VADA 3AJ7A 5KSVB 3IJEB 2IDUA 2R56L 5EA0H 2RQEA 1ZMYA 4NN6C 5IUCA 5AAMC 5JXED 3IXTB 3WGVB 1R34A 4MNQA 5F9OH 2BHUA 1R33A 4R7NA 5K1VA 3V4VA 3FU9A 3O3AB 4XXWA 3D0AA 2PWHA 3L5XH 4ONFH 2FJGA 3IJ7A 3L5HA 2CXKA 2HT2C 2P48B 1LO3H 3G04B 4YGVA 4EZKA 2XWXA 3K2UH 5C0EA 1JDDA 4R5TA 4NFBA 1SLUA 4G6JH 2RCSL 2OSYA 5E51A 4L0YA 4WWOA 1QR1B 2D7OA 4UF7C 4DHLA 3CBKB 5CNHA 3TFKD 3BGAA 2AS5M 2Y7NA 1JF5A 4HSCX 1OPOA 1CZ8H 2Z35A 3UADA 5F7HA 4Y4FC 2VRQA 3QFJE 1XH3A 2BNQB 3BGMA 1J8SA 7PCYA 4FDWA 4XMLH 3O0LA 2GBVA 5IBUG 2BRRL 1E8XA 4YQXH 2BINA 4W6WB 5E6IB 2C4FU 2R15A 2WBJB 2ZTBA 5LGKA 4IRJD 1GAFH 2X2YA 4JM2A 4J4PD 4Q0XH 2AGJL 2HSIA 3FTGB 4R2GB 1G6RB 2JV6A 3HPJA 2Y23A 1MEXH 3HLAB 4N5ED 1ZAGA 5F7UA 1KCVL 5JOFA 1H6EA 3UGEA 4ZUTB 1PCXA 3DHUA 1LQBC 2Q1EA 3GF8A 5AKRA 5AWNH 3UTSD 5C6WH 1JNHA 2XVKA 2MOQA 4L3AA 3Q5OA 3B3IB 3ZE0F 3ULVH 4LP4A 1O5PA 4JFDE 4HZLA 1MJJB 1K5NA 4AQ8C 1M42A 1YN7A 1A7PH 4MBRA 2XTLA 3LHPL 1D5MA 4RMWA 3SO3C 2NNRA 1OSYA 2PXYB 3T08A 4IKJA 1LDSA 3TNNB 3S37H 3MLVH 1U93A 2VLRB 2BSEA 4GUPB 4XPBH 2H1PH 4N4YB 5C09B 3A0OA 4M6NH 5BPPA 5G5DB 4UQDA 3QUXD 2X7LB 3U2JA 1SYSB 3OKKA 3WFHB 5EG6C 3FO9B 2CLZA 1YDPA 4HIJA 1TCRA 3LXBA 2Z31A 1DEEA 2CJUH 3VXSD 5F7AA 1FFOB 4YLBA 4YDZA 1OE2A 2QADB 4PJIB 3SDYH 5IVOA 2I5YL 1DSFL 1PY0A 3PP3H 4BZ1A 3NVQA 2X6VA 2Z65C 3IDUA 3Q2CA 1LK2A 1E9PA 3PDDA 1TMQA 1X4ZA 2XN9D 5HGDB 1WZAA 3LHAA 1XGRA 1E7VA 3U0WH 1JG9A 3R4DA 1U8IB 2VM9A 1YVLA 1GGTA 2DWTA 4H7VA 4PJFB 1TJHL 1FO0L 2E0PA 2DJSA 3D12B 2AV1A 2WVVB 3ZSSA 1A4AA 5FFGA 4HU8A 2KI6A 1IQDA 1MLCA 3OKDA 4XMVA 3NEEA 2O6PA 4MXQC 1BXVA 4RNRB 5I0YA 3MUZ1 4TTDC 1ZY9A 3QUZB 1XCTA 12E8L 4WI8A 2GK0B 4F7CA 1FHNA 4HVBA 5F88A 1I9RH 3FK3A 5E8EA 4AG4H 3CHSA 5IBTL 1YMMD 2GBUA 3ALWA 4M6ML 5GS1A 2R51A 5F7NC 5DZVA 1O7SA 2OI9B 3HI6H 1ADQH 4PJAA 3CHOA 4HOMA 1IC4L 3KYMB 2ED9A 4C8XA 4UQ2B 3O11B 3J7HA 3K81A 4NZUH 4PTUB 4PGEB 1OTTC 1TZHB 3MRHA 1IGIL 3QIWC 5EORH 3SJVD 5KYXA 3T0EE 4W9JC 3SE9L 2NY3C 3E3QC 4V1DE 5KYUA 3BWUC 5GGRY 1KCRL 4Y5VC 3ARQA 2WSPA 3CLEL 3VDBA 2QTEA 4B53A 1CI3M 4D94A 5BRQA 3FO2B 3FAXA 1EIBA 5FUOH 3IE9A 1G7LB 1JE6A 4ZAKA 1P84J 1YC8A 4H1LG 1SXCA 4R6UA 1QZNA 2R1XA 5T1DH 3P9MB 5ISZD 3VGGA 2QJDA 3VI4F 1DQJA 3RX8A 4HAGA 4WI3A 1BF5A 4GRLB 3G9AB 4F7EA 3Q06A 2G0KA 3WNKA 2WZAA 4FLHA 4ANXA 3AUWB 3MX0A 1AMXA 1E4WH 5I16A 5A2IH 3L3IB 2L7JA 1I8LC 4U3SA 3U4EA 5KVFE 4DKTA 2Y06H 4X98B 2WM0A 1OGTB 2W9EL 3NK3A 4LSVL 3QDGA 5CGBA 1KY6A 1BZ9A 5DA0B 3MV7B 4GRMB 4CN6A 1GXEA 4HWEH 3VFMB 3AXLB 2DDQL 2X4UA 1CFSB 1T03H 3RGVA 2I9TB 1V27A 4DO6A 3B2PA 5DQ9B 5B1AB 2ATPA 3CX5K 3BQUC 4AMKH 3CFBB 3D50A 3STLA 2VXTL 1QLRB 1U8OA 4UV7L 2NY1C 1G0XA 1NGWB 1UWFA 2EIJB 5BXFA 1N19A 2VABB 5D7IB 1TQCC 1FAIL 1KGCE 3L9RB 3QR1A 5E2UL 3FF8A 2X4QB 3QUML 3C5ZB 1JTPA 1W0VA 4TXVB 1U30A 5MP6H 3RKPA 1T0NA 5J4MA 2FT6A 1E28B 2F8OA 4EUPG 3T3PB 1AD0B 3UTQA 5J1TC 4OTXH 1DO5A 2GBAA 1ZGLB 3ZJAA 1E4JA 2A9NL 4YHOH 2E27H 2EYRA 3FQ4A 2GTWA 3PLYA 2OSLB 5I30H 5K9JL 3CIAA 3IYLW 2IJ0C 3FOLA 4HFUL 2H2PC 2Y5TA 4NHCL 3RWDB 3OPZH 1BZQK 3GLEA 1KDIA 1X5HA 3QG7H 2W5PA 3NCCB 2YOCA 2PR4L 1N6UA 3ZE1F 5TDNB 1E3XA 4I1PA 3QXDB 4N8VA 5KTEH 4DK6A 1BVLB 5HYQB 4XCFL 4M7JL 5ETUA 3OKNA 3K1KC 4LCWE 5FCUL 3GTVA 3VI3E 2NUPB 5LBSH 1NMBH 3FMGH 4L48A 1GZHC 4OGAD 1FN4B 4KROC 1IGTB 5FF6B 1QBLH 2QMKA 3EYUH 1N0LA 1F5WA 3VXOB 4EEEA 5HGBA 5DJCA 4AGPA 2XWJA 1DL7L 1JZDC 3O9WC 4OJEH 4JFOA 5FK9A 5I8EA 5IEKA 5ESQB 3EJJX 4Z7OB 5KVGL 4YXKL 4K5MA 4PJ8D 3RUGE 1U8NA 3FSZA 3MUUA 1TLKA 2P8LA 2EUZA 1P1ZA 4F57L 3K6NA 1ZT1B 3NIDE 5EEVA 4I2XB 4O00A 3WS3A 2DQTL 4MAUH 5L4JA 1LE9B 1P4LB 3AGWA 5TD4A 1ZGLM 1RURH 2H8PB 4GKNB 4S11A 1ML0A 2BVTA 4RH4A 1UCTA 5IBLD 3OGCB 3V4VL 1D5IH 2DQCH 4XCNB 3E9UA 1S7RB 2HJLA 3HE7B 4NQCD 5DJDB 1U8QB 3QI9C 3QHZH 2MCPH 3PG2A 3A6BL 4XP4L 4K3EL 5C0IB 2QGDA 2NZ9D 3ZRCC 3BZ4B 3ML9A 4HS6B 5INCA 5HYSB 2RTTA 1SEBA 5CJQL 5DUPL 5EIVA 1OE3A 4KV5F 1U8MA 2MNUA 1ZHNB 4OD1L 3O41A 3OHMB 2V3DA 4ICWA 3SDDD 4DUVA 3H2PA 5F97E 3AS1A 3LS4L 2VL4A 5B21A 4WRLA 1S7TB 1ZPUA 3FO1B 3TX4A 3OG6B 3POHA 3TTYA 1Y18B 5AB0A 2JJWA 1J0IA 1U41A 1UUSA 4X9HA 5JUEL 3RJDA 3DOIA 3QARA 1LD9A 4FXKA 1N26A 2QVTA 2Y9RT 5DI8A 2E5EA 3PE9A 3WN5A 1A3LH 1PQZB 4CSTA 5L8JB 2X2HA 3MXVH 4AEIL 4ELMA 3LRLA 4GQRA 3QIBC 4WV1B 4Y2LA 4YFEA 1GL4B 3PF2A 4KRPB 5DMYA 4YMPA 2MCMA 4ZG1A 5FXCH 3E8UH 4YHKL 3PS6A 1E5BA 3BKYH 1I8MA 2OV0A 5L6YL 4TLUA 5IKCA 4IW4C 3GPEA 1T1YB 1NINA 5DQDH 5C0DA 5T3XE 2R27A 1JK9A 2YD9A 3NFSH 4QPEA 3AQDA 2V7HB 4O51A 4U3CA 2PNDA 4MZRA 5IV2A 3D5OF 3H42H 2RD0A 1KYUA 1M7IA 3HBZA 1F6AA 2BK8A 4TUOB 3CFIC 1MREL 3GSNA 5KSAA 5JR1L 5GGVY 3TEUA 4FE9A 3DIDA 4GMSL 4M1DL 4CVXA 3MLPA 1WA2X 1JRHL 3U0PA 1FL6B 1F4WH 5E23A 1KPUA 2HLAA 2K6ZA 2J44A 2Q20A 5CLWA 4PP2B 1WLHA 4G6MH 2ZXWB 4ZTEA 3HHSA 1JSYA 1NMAL 3CQPA 4IBLT 1S78D 1CXEA 1QOKA 1VKXA 4WTZA 2E7MA 1Z5YD 3I9GH 4BZ1L 1FWXA 1HXYA 1I9EA 2VUOA 2XVGA 2IOMA 4GQ9H 3MYZA 4ZNEA 4ACTA 2J2ZA 2BSDA 5AQ0A 5A2KH 5F9JB 1J5IA 2Z0UA 5C9KA 1IM9A 1ZJAA 4NKOB 3MV8D 2XRAL 1J5DA 4KTDH 2XBDA 2OMWA 3DMMB 4JG1L 4KMQA 2CPCA 4P2OB 4RGOL 2ZX6A 1NGPH 4QWWD 4X6DF 1EO8H 2BLFA 3IFOA 2K7QA 5BMFL 5C2BL 1SQMA 2A3TA 4G42A 4R4BB 3VGFA 1JV5A 4X6DA 2PP7A 4MSWA 4LZKA 5KVMC 2NNCA 1DN0A 1QAWA 2PCYA 3MFGB 3GMRB 2V3FA 4IOIA 4R26L 1ORQA 5EPMB 1JWSB 4KTGA 5FLVA 1JDAA 4IIZA 4JFXA 1WHPA 1EJFA 1EFXD 1IGFH 4QHNB 3C6EA 3DVNA 3NSFA 5BVJB 5HP5A 3C08H 4HJGB 1KT2B 5AB1A 43C9A 4L8SC 3QEUB 4X5QA 2NY4C 2X0UA 2YIHA 1UM6L 3WLWC 6FABL 2X89A 1KJ2A 3PWPA 4PLNC 3HBGA 4HYTB 4N9OB 1M71A 3HEIB 3RWCB 2PWEA 2YRPA 1TZIA 3CDGA 5E6IC 5ENWB 3SE4C 2O30A 3KBEA 1J9CT 1UACH 2Q86A 3N43B 5T1LA 5GGRA 1YSOA 4R2GC 1OTTD 3N85H 5J1AB 3THMH 4HEPA 3MJ8B 4FQXA 4IRSC 4NDMA 2E59A 4UYPA 5CJ5A 1GRWA 3ARWA 1SN2A 3JWOC 1BQHG 4FLSA 4YHNB 4APQB 4D0DA 4CSZA 4KUZH 1XGTB 1VZHA 2AFNA 2VJ0A 1X7SA 3FB6A 2P42B 5AVVB 3PP4L 4ZZKA 1JFHA 1W0WA 5CHNB 5JYLA 3LKPB 5EEUA 1YCSA 1A6WL 4RQQB 1MI5B 2JXMA 4OVVA 3RYMA 1TETL 1XIWA 5IG7B 3MA9L 1MRFL 2AJUH 2PXYC 4FFYH 5GZOC 3ASOB 3AY4C 2R0LL 4PGZA 1Q90A 3UTSE 1EBAA 1MCWM 2KT6A 2FAUA 3N91A 1KENH 5BW7C 2ZG1A 2V4LA 3DROB 3CVHA 4K71C 5TH2B 2Z91A 4R83A 3RWIA 2OTWA 2Q6WA 3H0TB 2JKJA 3QAQA 4WTXA 2C9RA 4Z0XB 2YK1H 4L4TD 1P7QD 2W0PA 1N5AA 5HHOB 2IXQA 2ESVA 2QADC 1PG7H 4DGVH 5KEZA 3MZGB 5LDSA 1BFSA 4JPSA 1F6FB 4F9LA 4H1LH 5FYKH 2VDOH 3WAKA 5JW4R 3ZR5A 4HKJB 1BHGA 2G3MA 4JM4L 5E1IA 4ZT1A 3VD5A 3VXSE 5I2IB 4JKPH 2CQVA 4JO5A 5AW5B 1NFDE 1QHOA 3G6JA 1QTYT 1KTLA 4M5ZH 5EBGA 5DFVD 2PTTA 1FGVL 4F8OA 1DTUA 3GI9L 4Q74A 2OS7A 4X4YA 1OGAD 2R23A 1D2PA 1JZJA 5G2NA 3WYRA 1S6NA 3R8QA 1EWHA 4YSQA 1JP5A 1NCAL 1FPTL 1MSPA 4JY6B 5D55A 1C1EH 3PHOA 2P5WB 5I8OH 1E0OB 1KB5H 3LZFL 3QFJA 3TP4A 3D52A 3VFNB 3D51A 3K0WA 4ELKB 4MD5A 2FX8H 1I75A 4MMYA 1SJEA 4WW2A 3L9EA 1QHPA 4X6FB 4XMKH 2COQA 3IVKA 4WSGA 3UYPA 4P4RB 5FO9A 1OAQL 5LBVA 5IVXA 3Q13A 4L3EB 4JDVA 2M26A 1I85C 1XGQA 4XCCL 1SM3L 2EILB 3PY9A 2FJFA 5EBLB 2OYLA 1PJWA 1WD8A 4EUPH 1LP9E 4GW5A 1XB3A 1QD0A 2JQZA 4GIOA 5LCVA 1DZ0A 2BOCB 4KKLC 5KVEH 3DSFL 3P69A 4KKAD 2PWFA 4YBQD 5JNYA 4TULH 4HGWB 4RRPA 4OFKA 3FZUD 4PRHB 2QHRL 4FHBD 3WTVA 2I25N 4GEJA 3A47A 1FGNH 4M00A 3DOHA 3OKMA 4K7PH 2M1KA 4HFWA 2VZVA 2EEAA 3A67H 3KWVA 1DQDH 1OAZL 2Y1YA 3OKLA 4QRQA 1AY1L 2WLHA 3FF7A 1E6JH 1JGEB 3SGEI 1YY9C 1DLFH 3SBWC 4TOYL 2R69H 4YK4B 1JNNH 5AYQA 1S7UB 3U36B 1G7MA 1QLEH 3QYCA 2FIRT 3PHQA 3WHXA 4HMEA 1GHFH 4LRNH 5ISZE 2BS9A 43CAA 3FJTA 1MCHA 3MBXH 1ZVSA 1UD8A 2PF6A 5EULV 4BFFA 3BE1L 2VN5A 5FYJL 4E9TA 1RV6X 1T0MB 4FA8A 5DJ6A 3JWNG 4ZX4A 3EW3B 2BVPB 4P57B 1XZ0A 4F15C 1GCFA 3UAAA 1NAKL 1DQML 3G6DL 5F71A 5DRNA 1CF8L 3DXAB 5DD5L 3HCVA 1H3TA 1E30A 3GXIA 1AGFA 5BOJA 1CICC 1PZCA 3H9HB 3V52H 5D5ME 4GLRI 3U1QA 2A6JB 4D7PA 3AQZA 1M7XA 2X6BA 3C5ZC 5AW7B 4L3CB 2ADFL 3VNYA 2A6IA 4LPYA 4UIKL 3WIIL 4BH8B 3BEWA 1YQVL 2DV6A 5FYLD 5L7XL 3RDTA 5DTFA 3QIBD 3NGBB 5GS2H 2Y22A 4ZXBA 3HKFA 3QA3B 5J1SC 2GITA 4IKIA 3SDXE 2F68X 4AX3A 2Y36H 1B9ZA 5IB4B 2J57A 3CHQA 4ZUUA 4M3JA 5I66A 3DSNA 3CPLB 3UMNA 4ZUSA 2PYFA 4QF1A 5C0JA 3O45A 5IOKA 1JGUH 1Q38A 2I9LB 2OCJA 1DBJL 2CKBA 4Q2ZB 3VQ1C 3NZSA 3VJ6A 1WZ1H 4R3SA 4MJIB 4IBWA 1CO1A 5CWSA 4GQPH 5EFIB 3T0EA 5HI4D 4LAJH 2P24B 4WU5A 4LT7A 3BP6B 4V1DA 2BWQA 1FYTE 4ZQKB 4R8WH 5LAPA 3UROR 5ADOL 3B4NA 5HPMA 4QYOA 2OQJB 2HT3D 1MAMH 2CK0L 5K1NA 2H3NB 4MNHB 3D0LB 3F7LA 5LBGA 1G7HB 3KPQA 4UQ9A 3QCUH 4RMSA 4KJWC 2CGYA 3B9AA 4WTQA 2H5UA 5FDYA 4DZ8B 2DBJA 2XZZA 4OBSA 1MNNA 1TQVA 2XN1A 2AK1H 2WBWB 5IR1A 2QSCH 2D7MA 2QTVA 3O2DA 1DSYA 3AT0A 4F37K 5FM5M 2ORBL 1CYXA 1IKOP 2IV8A 1GGCL 1MN4A 2LE9A 1JWMA 1YEFL 4PB9H 3HE7C 5D4IA 4XBPB 3RNQB 1GS8A 1I7TB 3NCBB 4IU2B 1U3HB 35C8H 1WIUA 3L4VA 5DQJB 1R3HB 1WCBA 4H1LB 2BSSB 2VDOB 3TJPA 1VRSA 3OAUH 4CRPA 4Z7NE 4NQCE 4QI3A 4QRPB 3K6SB 4QHUA 4LASL 2C3VB 3G6AA 3LEXA 1A5FH 3NJKA 2YN5A 4I3RH 4E9RA 2RGSA 3CN2A 4NO0A 4LBEA 3U7WH 1A6UL 3MRIB 4DKDC 4XH2A 4KZEL 2BNQD 3LVTA 2EABA 3ARED 2B59B 5J6GB 4F8NA 1W72A 3PAZA 1Z0NA 3HR5B 2DQUH 1RPQA 3QJOA 2XJLA 5E6ID 4HK0B 2WBJD 2IPKA 4I0PA 3S48A 5IQNA 1AS7A 4XN8A 5C0GA 2DW5A 4R2GD 5DJYB 5FKPB 1CL7I 4L1DA 1D5RA 4NKMA 1DJXA 1IAOA 1MCRA 2TRYA 4YPGA 5T33L 1PSKH 4KHTH 4KRPC 1PYWB 1KB5B 4RIRB 4BSJA 4ZD3H 1HT6A 2R9HC 3T1FA 1BQRA 4XCEB 3QHFH 1CB4A 3JWOL 4XVTL 1TPXC 4I18C 2NOYA 5HDQH 1IGJB 3EH5B 3U7YH 4QXVA 3S88L 1D9KA 1RSYA 7FABH 4JFVA 2VLMD 3OQ3B 5I76A 3VW3L 1IBYA 4BYHA 2GUYA 4JDTH 1U92B 1IE4A 1Q0EA 4UOQA 4E9LA 4G8GB 4NNXA 4LCWA 1R6VA 4MCYA 5C97A 3PL6B 2PXYD 4X5WB 3VI3A 5GZOD 4EUPB 4UQBA 1OW0A 2VLRD 5AZ2L