4DP0X

The 1.5 angstrom crystal structure of oxidized (cuii) poplar plastocyanin b at ph 4.0
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
99
structure length
99
Chain Sequence
VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin B, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
total genus 20
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp0X00
1NINA 1OCZB 3NSYA 2I7SA 3ASNB 4KNUA 1NIEA 3N55A 1V54B 2BWIA 1OE2A 4JHUA 3UGEA 5I6KA 3NT0A 1E5ZA 4E9SA 3T9WA 6PCYA 4DP8X 2Q9OA 2BP0A 1E30A 1OCRB 1PMYA 3IN2A 1XMEB 3V9CA 4AZUA 3QJVB 4A2DA 3CDZA 4YSDA 3WKPA 3UADA 4BWUA 4DPCX 1PCSA 4HHWA 1UATA 1QLEB 5I6PA 1ASPA 3SQRA 2GIMA 2IH9A 1ET8A 3X1GA 2E86A 1E67A 2HRHA 1T5KA 2UXVA 1XB3A 3WKQA 2PP7A 3S3CB 2YAEA 2NRDA 2QT6A 2XWZA 4YSTA 5D4JA 1XB6A 3MX0B 5FC9A 1M56B 1X9RA 3PCYA 1KDIA 2BZ7A 1QHQA 1KBWA 3FU7B 2J56A 2X88A 4A68A 4UANA 3N2JA 1V10A 1I53A 1RCYA 4HCGA 4NAJA 5AKRA 1AG6A 2XV3A 1MG2C 2H47C 3FQ2A 1AAJA 1SFHA 4G7SB 1BQKA 4MFHA 1PZCA 4YSSA 2B3IA 2BP8A 5B1JA 7PAZA 4BXSV 3ABGA 4HIPA 2VW7A 2PPCA 1KBVA 3NSDA 4YVNA 3S3DB 1FWXA 4YSEA 4AX3A 3FYIB 1BYPA 1PZBA 1NIAA 3OD3A 2BO0A 2XUWA 1KV7A 1AZNA 1AQ8A 9PCYA 2OV0A 1HAUA 1NZRA 3QJQB 4GP4B 4N4YB 3FQ1A 4ENZA 5I6OA 3CVDA 2DWTA 3NYKA 1MG3C 3T6ZA 1SF5A 1L9RA 6PAZA 2FQGA 1OV8A 2PPEA 4GP5B 2BZCA 2IWEA 3GXUB 1W6WA 5IY5B 4TXVB 3HEIB 2YAOA 2XYBA 1IBYA 2UXGA 2FT6A 1A4BA 1JZHA 2GSMB 4UAHA 1AZBA 2CJ3A 1PAZA 2UXFA 2PPAA 1X9UA 3UAEA 4KNTA 1BYOA 2QPDB 3SBQA 3WNIA 4P5SA 4HCIA 1AZCA 1IBZA 3DTUB 4DP4X 2TSBA 1AS8A 3X1BA 2CBPA 2XVBA 3UABA 2YXWA 4E9QA 1ADWA 4KOBA 3WNJA 5PCYA 3WIAA 3IN0A 2VW4A 1ET7A 3SBRA 4HZ1A 1ID2A 5D4IA 4DP7X 2GHZA 2DYSB 4G7RB 4YSAA 4KO9A 3HB3B 4JKNA 4E9TA 2XX1A 3OQRA 1JXDA 1XB8A 1BEXA 1N70A 1PLBA 3FU7A 3FSWA 2IDFA 4HHGA 3IBOA 3QPKA 3WG7B 3BVDB 2PPDA 2J55A 4L0PB 1CYXA 4N8UA 4FA7B 1PNCA 2CUAA 2EIJB 3DKHA 4DP1X 3ASOB 2BW5A 3AZUA 1ZIAA 4DP6X 2YAFA 2FQFA 2IAAC 3CVCA 5TK4A 1NWOA 5I6MA 3IE9A 1WA2X 2TSAA 4GP8B 3TA4D 5B1BB 3ERXA 3PPSA 4PAZA 1YLBB 1ILUA 4KNSA 2PCYA 4NB7A 3QQXA 1NDTA 1ASQA 3S3BB 4YVUA 4BWTA 4F7KA 2HX9A 3NP3A 3RYMA 3MBWB 2MRYA 1A8ZA 3AG2B 2R7EB 2UX6A 5B7FA 3OMIB 4FAAB 4X4KA 1W6LA 2PCFA 5B3SB 1J9SA 1E5YA 1ETJA 4DP9X 2UXTA 4KO5A 1L9PA 1E65A 4PCYA 1RKRA 2N0MA 2AANA 1ET5A 1WA0X 4DPBX 2CALA 2HXAA 1ASOA 4E9XA 2DYRB 3NJJA 4G70B 2XLLA 4HAKA 4BXVA 1PLCA 2EINB 2Y1AA 2GBAA 2PP8A 3PAZA 2WO3B 5I5IA 1IC0A 2FNWA 1ZIBA 2AZUA 4Q8BA 2ZXWB 3X1NA 1TEGA 2FJSA 4GYBA 2EILB 4QLWA 4WTQA 4G7QB 4E9WA 2J57A 1WA1X 2YARA 1L9QA 1J5DA 1RZPA 5B7EA 4BDVB 2PP9A 1SNRA 2HLEB 5F7BA 4BK5C 4K9JA 3BQVA 3AW5A 5I6LA 1AIZA 5PAZA 1BQRA 4YSCA 3H56A 3X1FA 7PCYA 5EHFA 1MZYA 1OOWA 4YL4A 1WS7A 1BXUA 5A7EA 2X87A 1AR1B 1TKWA 3FPYA 4KOCA 2CCWA 3TU6A 1OE3A 1J9TA 1OE1A 3EH5B 1PNDA 1F56A 4P5RA 2BP0B 3S8FB 3ZDWA 1NPNA 2JXMA 2IDSA 3QJTB 3FSVA 4A2GA 2VM3A 2JFCA 2XU9A 2OJ1A 2I7OA 1ZPUA 1L9TA 3C75A 3ABKB 3FS9A 4F2EA 3PXLA 2FT7A 1A4AA 1NTDA 4YSOA 2Q5BA 3TASA 1GR7A 1MDAA 1TEFA 3CVBA 2FWLB 2ZOOA 3G5WA 4EF3A 4W1TA 1A4CA 5B1KA 3NJNA 1IKOP 5B1AB 3T71A 2VSKB 1M9WA 5B7MA 1ZDSA 3JT2A 1OF0A 3FU9A 1GSKA 2R7EA 4G71B 3T6VA 2WO2B 2PLTA 3SBPA 3D12B 3NJMA 4YSPA 3WI9A 1IUZA 1GS8A 1R1CA 4M4RB 1W8EA 3FYEB 1JXFA 1AS7A 2I85A 3DIVA 3NSCA 5LDUA 2FT8A 2GI0A 3CZUB 4YSQA 3CG8A 3FSZA 3GYRA 2YAHA 2RACA 4A2HA 4W9ZA 5I5JA 4AKPA 1NPJA 1KCBA 5AFAA 5I5MA 3OM3B 1JVLA 1J9QA 1DYZA 2FQEA 1KYAA 5TK2A 1J5CA 2VSMB 2HX8A 1BXAA 2DV6A 1DZ0A 4A66A 1ZDQA 2YAQA 2YAMA 1JZFA 4DPAX 5I6NA 1PLAA 3NJKA 2IWKA 2P80D 1CURA 3QJSB 1JZIA 1NIFA 2ZONA 1L9OA 4CSZA 4HALA 2PPFA 3NJGA 1M57B 2FQDA 1GY1A 3FT0A 2AZAA 2Y69B 5D4HA 4A2EA 3ZBMA 1EZLA 2UX7A 1RZQA 3EH3B 4QKTA 4UF7C 3NJHA 4GXFA 1ILSA 1AZUA 2FTAA 2VW6A 1JVOA 4AI7A 1AZRA 1SFDA 2B08A 1NWPA 2GB2A 1HFUA 3FQYA 3L45A 1FA4A 3KW7A 4A2FA 1AANA 2XXGA 1BXVA 3AY2A 1SJMA 1PZAA 1GS7A 2YQBA 1ZV2A 4DP2X 1J9RA 1KDJA 2VMJA 2YAPA 2LLNA 3KW8A 4RH4A 3ZIYA 1SHXA 4DP0X 4YSUA 1KCWA 2BW4A 5ANHA 3NJLA 3ZX1A 1SDDB 3AG1B 2YXVA 3EH4B 1FFTB 2HZHA 2IDTA 2P80A 3UAAA 1BAWA 4NERA 5I26A 2ZWNA 4M3HA 3FPXA 2W8CA 2JKWA 2AFNA 4JHVA 1CC3A 3AG4B 1TU2A 3FU8A 1GYCA 2VM4A 1HAWA 1QNIA 1CUOA 2GC7C 3PLYA 3UACA 5B1JC 2AVFA 2IDQA 3NSFA 3H4FA 3NJFA 3X1EA 3CDZB 3QJRB 3PAUA 1SF3A 1N68A 1AACA 1VLXA 1PF3A 4GY4A 4E9VA 1L9SA 1WAEA 2IWFA 2WSDA 4ZK8A 2QPEB 1B3IA 4Q89A 4AKOA 2QDVA 2DWSA 3X2QB 3NJIA 1AOZA 5F7AA 3U25A 5AZUA 4WKXA 4E9YA 4YSRA 3IEAA 2XV2A 1WS8A 3EHBB 1BQ5A 4BWWA 3GDCA 3V9EA 2A3TA 1JERA 4HCFA 5I28A 2OCCB 3S8GB 4E9RA 1URIA 1MZZA 4KO7A 4CSPA 1JZEA 2GC4C 3TBBA 4G72B 2MTAA 2EIMB 2W88A 2BHFA 1EHKB 1PY0A 2J5WA 3ABMB 1JOIA 2H5UA 3QJUB 3JTBA 3OMAB 2HRGA 3T6WA 1GW0A 1A3ZA 1JXGA 2XX0A 5E9NA 2QDWA 3NP4A 2BP8B 4DP5X 1JZGA 1AS6A 1CYWA 3AG3B 4KO6A 1OCCB 3T6XA 1GY2A 2CAKA 3EF4A 3OMNB 1A65A 3TBCA 1OCOB 1NIBA 1SHWA 4F2FA 2VN3A 2IDUA 2H3XC 1KGYE 1JZJA 2XXFA 2BWDA 4AKQA 4A67A 2IH8A 1NIDA 2DY2A 3ABLB 3H4HA 4BDVA 1SDDA 8PAZA 1AG0A 2EIKB 1GS6X 3FSAA 2HX7A 3PAVA 1V55B 1NICA 2XV0A
chains in the Genus database with same CATH superfamily
4RBPH 3TBSA 5FYLL 4F58L 5E4AA 3UTTA 5J1TC 2F7PA 3ASNB 4MD5B 4EMZA 2ZUTA 4X6DA 2NCMA 2MCPL 3ATBA 1V3LA 3CJJA 3N5AA 5BS0E 3WL9B 5E6IC 5ISZB 2HJKA 1KPRB 1A9BB 4JHUA 3UGEA 3ESNA 1XF4A 4F9PC 1MCCA 2CR6A 3PV7A 5L8KB 1TJMA 4LNVA 1BXXA 4J3OD 1S6NA 3H9SB 5IGXL 2ZP0T 4LQ1A 1SXNA 1OW0C 1RZKL 4RISH 2XV6B 2ARJB 3K2KA 1T4KA 4DKTA 2DIAA 4YLCA 1NCIA 1GKOA 1SXCA 4DPCX 1L6XA 1U4FA 1UATA 1UENA 4H20L 1FV1B 3BLBA 1AD0B 1Q1PA 4FL4B 4JKPH 2QLVB 2PYEA 2HJLA 1CI3M 3NBNA 1PZUB 2QVIA 1Z9OA 4UQ3A 2DKSA 3KDMB 1T5XB 1MCRA 4KRPB 3V0DA 2YAEA 1THCA 1HKFA 2HMID 5C09A 1QYGL 3FQNB 4R97C 4MGXA 3VSVA 1AXTL 1W8NA 3LAFA 3BH9A 3RWIA 1HQRA 1T1ZA 2DD8H 4MXQC 1T1WA 4MMZA 4U1KB 5J56B 2BMKB 1OAYL 4MCZA 2X88A 1G7QB 1RI8A 5BV7H 2IOIA 4NAJA 4AQOA 4AOFA 5E6IB 1Z5YD 5AVWB 1N3NA 3N41F 1BDYA 3B2VL 4QJ4B 2H3NA 4LNRA 1I8LA 3JVGC 2EE3A 2OJEA 4I9XA 4NQEB 1CDHA 4MRBA 1HILB 4KK6C 3ETBF 2VDLB 1VFBB 3WGVB 2DEXX 4NC0B 2VMCA 1G6RB 4ZFOL 2DRUA 3FTXA 2Y1ZA 1BYPA 2YRBA 5EZLB 5C0ND 2BP5M 3VACA 4CDGC 4B95C 3DETD 4CN6A 1GGUA 1KJ3H 1OAJA 3HMWL 3L81A 2GIXA 3MUZ1 5LAXB 1ES0A 5CCKH 2ZX9A 4JKMA 2E9BA 2X4RB 1NCAH 1AI1L 2Z31D 2HRPH 3EDDA 3NYKA 4GI9A 3VD5A 4IM8A 3UBXI 4YXLH 4IBVA 3KL3A 4OQTA 4S10A 4R97B 1RY7B 5AQ0A 2BVQA 3WKYA 5KSBA 5EOCJ 2BZCA 3V0WH 3IKKA 1LNUB 2M8XA 2C9PA 4NKIL 1BGXL 3REWB 4PH8A 5HJBA 4YNYA 4KV5F 1UOVA 5DEZA 2FZ3B 3QAQA 4PRNB 5IUCA 4P46C 4AH2A 4DZBB 3BO8B 2QPDB 3PXHA 1I1YB 2P3YA 4IIZA 5JIQA 4HLZH 2HLFD 4ERSH 3VFVB 4JG0H 1JWUB 1MLCB 4GNKB 2ZXEB 5FV2A 1QHPA 2WWKO 1R47A 4ZPVB 2ZYHA 3DLQR 1ET7A 2FIRT 4FE9A 5F7DA 2EVGA 4Y9EA 2C1OB 4EKXA 1MCOL 3GIZH 3IJEB 4G7RB 1T89C 3TO4C 5IEHB 1L6ZA 4Q74A 3IFLL 4WFFE 4BFJA 4XXDB 4U1HA 2IALB 1RZKC 2J43A 3F7VA 3BJLA 1UC6A 3RILA 4X0NA 4G83A 2YPLE 5D9SB 1EO5A 5T8IA 5CLWA 3VXPA 4BFEA 1ZHKB 3WTWA 2B9AA 1D5MA 4NI6A 2C3VA 4QHKI 4NQCE 4WWKC 4N2CA 3CVCA 4R2GD 1N6UA 1EV2E 1O7DC 3N40F 3O2WL 1FCGA 3MRDB 1F13A 3N42B 1TSHA 3KXFD 4IMKA 2AEIT 5JOEA 2Z8SA 4XXCA 1F58L 1LD9B 1T3FA 4HWEL 4P46B 1H8LA 3FQUB 4B9YA 4ZSOA 4FQXA 1F3DJ 3SKUD 5EBWB 1E7VA 1BZ8A 3T0BA 4R90L 3ZZLA 5JNYB 3C5ZC 3FQTB 1KXVC 2DQUL 4PJ5D 4QNPF 1FL3B 2FHBA 2BCKB 2P28B 4NCC2 3VFUB 1FYTD 4XN9A 5EZOL 2RB8A 1FP5A 1EH9A 4HK3N 3J07A 3Q5YA 3I75A 4X8CA 5DZJA 2YN5A 3TO4B 5KW9L 5CM1A 4XN8A 2ZOLB 4GINA 1L9PA 1YMMB 4D9RE 3BP6A 3IMWA 4QKXB 1NDGB 3BP5B 5E4OA 1WPCA 3HNVL 3LH2L 3PY9A 3GSQB 2J4WH 2PTTA 3CQPA 4NFDA 1E40A 1HEJC 1PDKB 1DQDL 3OAZH 3WNMA 2C9SA 4DQOL 1P4IL 2GBAA 2AVGA 4P48A 5J0BA 1BAGA 1RIHH 4KKBC 4WWKB 3TJHC 2CRIA 2K7QA 1ZIBA 2OTUB 2OCJA 4GYBA 2V4LA 4QO1A 3LEVH 3GLDA 2DLFL 2CDGB 4ES8A 2BNUA 4BFOA 3ORJA 5CN1A 5B7EA 1BA9A 1MAML 3ARTA 2DYPB 3QDJD 4HS3B 4N2OA 4WFGD 2V9TA 3GZQA 3VXRA 3DDFA 1S9VB 1AGBA 3C5ZB 1ZD6A 5H37H 2OMWB 3GBNL 1YEGL 2LABA 5DXWA 4BH7B 1ROWA 2R2BA 3J7HA 3KEDA 5DD3H 1AKPA 3NCXA 2EACA 1Q0XH 3FPYA 3MLVH 3GHPA 2VABA 1YJDC 3RZCC 5A6MA 4AIZA 1HSBA 3VFOB 4UBDC 1OE1A 1ECYA 2PCPB 2FO4A 2J8UF 4X0KA 1F56A 4LHUB 4ZDHB 3IJSB 3ZDWA 4PW9A 4M5ZL 2IDSA 5EA0H 3R0MA 1ZA3A 1EJFA 1JVKA 5DJXB 1A5FH 3U0WH 1HINL 3LZOA 2WM0A 2XRAH 3AJ7A 4CC4C 3HRZA 4P9ML 5F89B 3CDGA 3UH8A 4Z78B 4WI6A 5JHDD 2BRRL 4OM0H 1BD2A 1RP8A 1K3ZA 4LSPH 3L7FB 5E8PA 1XD0A 4GKZB 5FB8A 1NTDA 1T0NA 1R3JA 3QZLA 5DYFA 4PLNC 5DTFA 3SPIA 1G87A 5DZLA 3PJSB 2F9BT 1MCKA 4GRLC 1HJBC 1YQVH 2QHRL 2Z0UA 4I0PD 5DMKA 3CBKB 4J3UA 4TSBH 3FH7A 4MNGB 3UZEC 4B9ZA 5K9KB 1CGSL 4OB5H 4WDIB 4JY5L 5TF1H 4FZEH 3E8VA 3H1ZA 2E74C 1N6VA 1SJHA 4JO4H 1U92B 2X6MA 3Q8BA 3RDTB 3ROOB 2EDXA 4MS6A 4XOAA 4M4RB 2X2YA 4HH8A 5ANMB 4V33A 4JZJA 4EAEA 2JKSA 5E1AB 1AH1A 3RZCB 3NA9H 4YSQA 3MV8D 4WFED 5IB4A 1M42A 5I6XC 1MCDA 3RNKB 4ABQA 3PABB 3K2UL 3IMSA 4TS6A 4UDUB 4E0RB 1TTBA 3RB7A 2CM5A 2JELH 1FE8H 4UTAA 4GMTL 5DC2A 1U8OA 3EIFA 4LLVA 2OP4H 1V7MH 1F41A 4QXTB 4PLOB 4GQPH 5IJBC 3OSKA 4KROC 3Q06A 1QR1B 1S78C 4J39A 4BKSC 2YAQA 4FCHA 4QOKE 4GKNA 4G1MB 4PJEA 3RUGA 1JBJA 5I19H 3B3IA 2C1PA 3E6HA 2Z7UA 3EOYG 4HV8A 3HC0A 4OCWH 4P2OC 4PW4A 4GRLB 4LO9A 1R5WA 5I6NA 2HFTA 1LLAA 3BZEB 1S3KL 1D7FA 2A0LD 3ARDA 1MVUB 5JZ7C 3FT1A 1ZT4B 3DO3A 4CSZA 1YEKH 3QWRD 4LEOB 1K6QL 5IK3B 2XJKA 2Y7NA 4C4BA 5AVSB 3PJNA 2XQYG 1P7QD 2VKWA 3D4ZA 3OMZA 2N1KA 5TE7H 3TPUA 2P5EB 1PBYA 2FECI 1J8HA 3WJLC 1UACL 2Z8WC 2XI9A 5DS8B 3QPQC 4YDKL 5GSVA 3KR3L 4LSRH 1PYWA 2XBTA 5I6XB 2RIKA 2Q6WA 3KPPA 4PWJA 4AI7A 5ITFB 2OK0H 2A6IA 4ZUTB 1CXKA 3HE7D 3QULB 4XOCA 2FJHB 2QQKL 4IKNA 4JFFE 5SWZD 5KJ7E 1NDMA 5T3ZL 4JQIL 5DRNA 5MEND 4XNDA 2YKKA 3D4GA 4F5CA 2CO7B 1XF3A 4ALAL 4P2YA 3DOHA 1YEJH 4BK8A 3D09A 4KROB 4URTB 1OO2A 3TO2A 3ZIYA 3V0IA 1UD4A 1YEHL 2BDNH 4OVVA 5CSZB 5DJYB 2BK8A 4XVJL 3S34H 4JRXB 5I17B 4AM0A 3HG1B 2YXVA 2YD2A 4P2OB 1UA3A 4NPJA 5T3XH 3IDGB 3TJEL 3ZW3A 2P80A 4JS7A 1IE4A 3C8KA 2ZYIA 4DN3H 3MRLB 4GLRI 3WHE1 2YUWA 3HN5A 3ULVE 1J5OH 4FFZL 5FYKL 4AK1A 2J8UB 3QIBC 3U6XA 3WFBL 2DDQH 5FPIA 3KVDD 3UJTH 4Y5XC 4HCRL 2Y7MA 2VXUL 4G9FD 3C6LA 2IFFL 2LV4A 2V33A 3JTSB 3L9BA 4E42A 4B9GA 4IKLA 1NCTA 4OBSA 1OB1A 2UUDK 3LV3B 5AAWC 2ZCZA 3FW6A 5HGGS 2WUBL 1ZLEA 1PD0A 5I16B 4GXVH 2XTJE 4J5VA 2F68X 2EDQA 1Z3GH 2FLMA 5T3ZE 2CJUL 5D2LA 5IB3A 5E2JA 1GJIA 1BF8A 1UA7A 1ZVNA 1WFMA 1KZYA 4NKMA 1RHHB 4V1DB 5IQ9B 4ZK8A 3VAEA 2EO7A 4FFYA 1MEXH 4MDRA 1UJTA 1AHKA 1QTYT 1XGUA 4WNQA 4YLBA 5E5LA 1TQWA 3X2QB 4AKOA 5L2KB 4NM8H 2ORBL 3GSOA 4GAGL 1CXIA 4LLDB 4L29B 4WI0A 4BWWA 4M8RA 1MRDH 5LQBH 5I28A 5CINL 5BZWB 3LRKA 3UTTD 3INUH 2VGLM 5CZXD 3EGXA 4YQXL 1E2VA 3SE3C 5IMMA 3A67H 4PJDE 4QTHA 3CMOL 3ARGA 3KCPB 3N40P 3JWNH 4PRDA 1PZ2A 2WCGA 3BLKA 3FUKA 1UEYA 2HFGH 3J27A 3QIBB 4YDIL 5MEQA 1A4KB 1B2WH 3D9AH 5LXGL 3FH8A 2H5UA 4Y5XB 3WFCL 2CD0A 1XGYL 2YGQA 4YJZL 3OMAB 1A3ZA 3X14B 3NZ8A 2OZ4L 3IRCA 5C0DB 3GXPA 5CLZA 2VZOA 2A74A 4B9JA 3DSFL 4KK8C 4Z8FL 2PYED 3LZFL 2EDOA 4BK4A 2VN3A 2LQRA 3FT2B 1P2CB 1MI5A 4WCYL 1OF2B 4RWHA 2DY2A 5C09D 1WT5A 1A1OB 5F6IC 2ZCLH 4NLAA 2E59A 3DOIA 4L3EE 4ODUB 3GLAA 4NJ9L 5F7EH 2JQZA 2QGCA 1B9KA 5CCJA 2GK0A 2NDGA 1XEUA 5BXFB 1M6OB 3IGAA 3NSYA 3X3GH 1VADB 4LGRB 2Y36L 4UT6H 3KPRB 3RJDA 1NCNA 3AWGA 4LSVH 3DTXA 3QIUA 1U8JA 1J5HA 3QDMB 3DOSB 3ZO9A 3UMTA 3T9WA 3BT0A 3WLBB 4B53A 4QRPB 1OCRB 4ALAC 1VCAA 1UKTA 2WNKA 5CBEA 5C0JA 4S2SA 1CZ8L 2WWNA 1UM4L 4YSDA 4HUXA 2HFFB 1IC5L 3GSWA 4DUXA 4HHWA 3PHSA 3MRQA 5LUMA 3COOA 4ZQKA 3QP3A 1HXMA 3QCUL 4WHDA 3BRDA 2WQVA 1T5KA 1OY3B 3QZWG 2QSVA 3VRJB 4JPKL 5I30L 3S3CB 1IJ9A 1HZHL 4PJCA 1IAIL 4FERA 5A16A 2H4EA 2R69L 3SJVB 3FFCD 1X5YA 1ZHBB 4YGVA 1A66A 2OXGB 5F6IB 2WBKA 2X10A 5DZOA 4HPHA 3K6OA 4NUPA 4R4FH 1OD7A 2NY0C 4EDXB 1E27A 4X5RA 4H8WH 1FAIL 3CXDL 3IFOA 4MJ6B 4PJHF 3HJEA 1I8MB 3HNTH 3LZPA 1I53A 3C5SA 4AVHA 5GGRY 2D4FA 4NI3A 3GJEA 3I02B 4CC0A 5K1NA 3MNVB 5TQ0L 4OLWL 1T6BX 5TPWL 4G6FD 3DRTA 4R4ND 5L2JB 1AGFB 3L3KB 3EFDL 2VLRA 4F7PA 1YY9D 3P30H 3FQXB 3N1FC 4PJ9B 4ABVA 2GUYA 4XXWA 1FZJA 2WN2A 3QO1A 1UWXH 3MGOB 3HAEA 4JM2F 4TLSA 4U7MA 2KBGA 4ODVL 3U46A 4MYPA 2W65A 2H3KA 2X44D 3CFEA 3NCBB 4JM2D 4MAZA 2BSRB 1JPTL 1YNLH 4ELME 3TCLB 2GY5A 2SEBA 2X6BA 1P84K 1U6AL 5DLML 1WSST 3LPPA 4JZOB 4MQ7B 1R5VB 2Q76B 2NY0B 2QEJA 4PBWD 3FULA 5IVXA 3IJHB 1V5JA 3OR6B 4WW2B 4G8GB 5EUKB 5IG7A 2ERJC 2YAOA 1DN0A 4ZZKA 3D25B 3MRMB 5CUSL 4AYSA 1HHHB 2APWA 4PREB 5JYLA 4A6YL 4GIOA 4JRFA 4A55A 3U30C 3WNIA 4LASH 4FQXD 4Z0XA 3ZQ9A 2BHZA 1AHWA 2TSBA 5GGTA 1D5BB 2A9CA 3KPNA 4GG8A 2N7BA 1MFNA 3Q6FB 3O8XD 4N9GA 4DP7X 5E00B 3QDGD 3IGKA 5IMOA 5D72L 5INDA 1JNLH 5EB9A 3ZE0E 2UY6A 1BLNB 3ZSTA 1XB8A 5AVQB 1PZ5B 3RY4A 4RDQF 2W60A 1JIBA 1DFBL 3THML 4YAQB 2QFPA 1TCRB 1E4KC 1E2WA 1NGXA 3FMGL 4DP1X 3TNNA 3ASOB 3GHBH 2NSXA 1L7TH 1A21A 2I9LA 1IFHL 3BQUC 2ERJB 4ZTOH 3WIIH 4KRMB 1BOGB 1GOHA 1KBGH 4YWGL 1JFQH 2P44B 32C2B 4MJ5B 2UWEF 3FB5B 4QRTB 3TZVC 1Y18A 4PTUA 5ILTL 2F2HA 5JO5A 4MCMA 4UI2A 1UFUA 2NUPA 5AW2B 2FX8H 3ZE2E 1Q0EA 1YLBB 3U30B 3IBEA 2AK1L 3O3BB 4KUCD 2AMUA 4KH9A 4ADGA 4ANKA 3VXRD 4L3CB 4WI5A 4QHNA 1OSZA 1W15A 5ICYB 4JLRB 1T66D 3PFQA 3VXSB 4QHMB 1AC6A 5GZOC 1R33A 4D0DB 4PRBA 1TQVA 4MMXC 3OKNA 1J9SA 1X7QA 4N85A 4HZLB 4PJHB 2OR9H 5MHSD 3OF6D 1WIPA 3BKMH 1T0MA 1K2DA 5D6CA 5DJ8B 3A4DA 3DJZA 4L23A 3K6FA 4RMSA 3GJFH 3CX5K 5HHXL 5DGQA 1UEMA 4LZKA 4EXKA 5AW5B 2EINB 4YHPB 4URKA 3CN1A 4X8JB 1ZE3C 2EEFA 2K78A 1BD2D 3BQUB 1OQXA 3E9TA 4U3CA 1KEGL 2EUWA 4I3SL 1KB5L 5F3FA 4Y1AB 4UV4L 4OT1H 2E5EA 4Y88A 3B5HA 5T1KD 3BMWA 4NKOB 3QHFL 1G7IA 5D7IB 1F02I 4XBGA 2WLZA 1VCBC 5EH1A 2AP2A 1IJNA 1BZ9B 4Q9QH 2BNRB 2VM9A 2PWGA 1VGEH 3H56A 4IS6A 1NUFA 2F7IA 2E56A 3STLA 4IYKA 1BZEA 2Z4QB 2B0SH 4HIIB 5F1IB 4MMXB 3IRPX 1HN1A 3VFMB 4Z6AT 1WYJA 4S0HA 3QNFA 3FUNA 4P5RA 3WFEH 4BELD 1KIQA 1TVBB 1E4WL 5FHAL 2O4EA 4LARL 4PGCB 5MEPA 1IBGL 1DFXA 1MQKL 4L8SC 2EDJA 3TM6A 1G9ML 1ZLWH 5H35B 5G2NA 3T2PA 2L7JA 3H2PA 3W9EA 1BHGA 3GMMA 1E28A 3PXLA 1KJVA 2NY5H 3V5DA 2ATAA 3VGGA 2CU9A 5IB5A 3AREC 4HOWA 3U0TB 2EQDA 4FMFA 5F96L 2I26N 4X6FA 5HD8D 1HCVA 1YNTF 5B7MA 2XVLA 1LP9F 4Y9BA 3VFRB 3BDXA 3US1A 1AQKL 5IEKB 4OJAA 3RBSA 1I9EA 3OKDB 4JNXA 1Q94B 2D2OA 3WI9A 1IUZA 1XGRB 35C8H 4HKZB 4I9WE 4AENB 1JPGB 3BJ91 1HE7A 1KCSH 1QSFE 4O58H 4PI2A 2JB6B 5FM8A 1FH5L 3QI9A 5C0BD 5JHMA 3QH3B 2E0PA 4HF5H 2O5XH 1ZSDB 4JGNA 3GFUA 3MBED 3C2SA 1NC4B 4P2AA 5FYJH 4IK6A 3HZKB 4KTEH 2O5ZL 4A6YB 2CA4A 3GIVA 4M3KB 2ADIB 3GSRB 2YRZA 1YEEL 3T3ME 1BCIA 5DFVD 4L8SB 5ICXA 2OXHA 4PLKD 4JFVA 2BRQA 1HEZA 1SYSB 4X6CB 4XVSH 3SDXB 4JQXA 3T1WA 3EOBA 1ZHNA 4NO3A 5HHNA 3KBFA 3RY6A 2R29L 1DUZA 1F45A 2WTRB 1CFQB 2AJ3B 4XMXA 4NAQA 5JDSA 2NQDA 2XN2A 3AREB 4HJ0C 4X7FC 3K71A 4JFXA 2P80D 3S5YA 5I1HL 4RQQB 1H6FA 4JO5A 2A99A 3CBJB 5IB1A 1D5XA 3K1KC 4BSWB 4Q9RH 2EKJA 3DK0A 2PW2B 1F4YL 4KFZC 4XMPL 4Z7VF 5E9DB 4ZXBC 4WRLA 1ZA6A 1JF1A 2IGLA 1OGAB 1AMXA 4WEUD 2J20A 3U1SL 5JIHA 1U8KB 2FYYA 1TJGH 2FX9H 3WENA 3VD7A 1VFAA 3CPUA 5HHQA 1U8QA 3WTVA 2IXQB 4M1GL 3CSYA 5TDOA 3OKMB 4A7SA 3JV6B 1A7PL 2P26A 4HU8A 3MODH 3B2DC 2OMZA 4MA3B 3NG5A 4P2RD 3RJOA 4AQZA 3EUUA 3KW8A 1F4WL 3KYKL 1M3IA 4L9LC 3DPBA 1R4XA 2BW4A 3SGEH 3NJLA 2WMPB 1M2OA 4I7ZC 4NP9A 3A47A 5I26A 2CBTA 3IFPB 4JY4A 3E0GA 1QVOB 2X70A 3SN6N 1E4XH 3GMOB 3VG0L 1G9MC 5GRVK 1S7VB 1CFBA 4B7LA 2VN5A 4MSWB 4Y2NA 4ZXBB 3T1FA 3A0OA 5KYUB 2FWOA 3S35L 1IARB 3SBWC 2IADB 2YC1B 1BM3H 2Q8AL 4GT7A 4TLKA 5DVPA 1N5AB 4WEMB 1KB5B 3RVWC 5JOPD 2JB5L 5GGSB 3QR1A 3KH4A 4I0KA 1NGPH 1PF3A 3FOLA 4TTDC 1FNLA 1PPIA 2XFXA 3OGCB 3RWCB 1TTFA 2YK1H 4K4KA 1YNTB 5H37A 3BKYH 4H5SA 4PS8A 3SE8L 1A64A 4RMTA 2WLNA 1HKLL 4GQ9L 3IEAA 4AG4L 1NBZA 4WU5A 1Q9KB 4L9LB 2VDNL 3KPTA 3O41B 2D7TH 3FQRA 3LSOB 4E9RA 3B2UD 3PG2A 1QFWM 1BVNT 4KO7A 5ABAA 5I8CA 4AYEC 3O4LA 3GBEA 3LOWA 3DUHA 1BQHG 4M1CD 4TYUA 1RXLA 3QIUD 4AT6B 1FNSH 5DJDB 3RTLA 2VLLB 5FOBB 1AZVA 5AYUH 1F2QA 1KIRA 5K39A 3TA3A 5HI4D 2JJSA 3BAXA 4HFWA 3NH7L 1H9DA 4PJ7A 4HAFA 1EDQA 3BHBA 3K6NA 5SWQA 4IKJA 5CD5D 3U82B 1KTJA 4DN4H 4L1SA 3K3QA 4W4OC 1QKZL 2X9ZA 1JPFA 3UBXB 5B4MC 3WXVH 5T5FA 3CXFA 4MDJB 5JW4M 5LNDA 1G7LB 5AW7B 4PGDA 3KLSA 3T77A 3UP1A 1P4UA 2P8MB 4N0CD 2WZAA 2EUZA 1QUNA 2H3XC 5T1LA 3TP4A 2A77L 5GXBB 4MYWB 2BFVH 3QFDA 4PJGF 5KBNC 3B9AA 1TR7A 2G2RA 5EU6A 1X5AA 3C5JA 4KUZH 5AKTA 1CTMA 3TEWA 4I88A 3GXNA 1ZVSB 5I9QC 3P0VH 2QZQA 3Q3GA 5I1JH 3ZZSA 3OR7B 4PJIE 3S37H 1BVLA 3OAYH 4BQ6A 5KBDA 4Z7VB 1MHCB 3MUHL 1I3RB 1QFWH 2ITEA 1NIEA 4XVUD 5D1ZA 5E03A 3LIZH 3FCGA 4LHJB 3KGRA 2BNQA 3GSVB 5AVYB 5HYSG 5I6KA 3HMXA 2NXZD 4KXDA 4WFHE 3ULAB 4W9CC 1XGTB 3MRGB 4Z7WE 1A7OH 2A9ML 1HJCA 1CLYH 1XGPA 1HK6A 3LXAA 4ELKB 3WKPA 5E08H 5J12C 3P4NB 3IPEA 4OZFG 1PCSA 2Q2EB 4YN3A 3X12A 1I1FB 1NFIB 3TWCL 1EO8L 3WMSA 1MJUH 4XWOD 3VQMA 3VQ2C 4B50A 4BGDA 2BY1A 5KS9E 3L16A 3FF8A 2AV1A 3K6SA 3G04B 3D33A 4N0YL 2IAMC 2QT6A 1JDAA 1JGUL 3P11L 1MCBA 3QFGA 1ROCA 1SOXA 3MX0B 4XNBA 1X9RA 3MMEA 1JI1A 4WI2A 4ZAKC 3PCYA 1AVAA 1KDIA 5I9QB 1QMUA 5D7JA 4JCMA 5IFJB 3B7RL 1OAKH 1RZFL 7FABH 4TUUA 1F1DA 4N2FA 1FORL 4HCGA 3L5WB 1R5IA 1NFAA 3NK3A 4LCWB 4E5XA 4HVBA 4PUBL 2XV3A 5EOCH 3CIAA 3RHWF 1ND0A 4O9HH 1SEQL 2FCBA 4J4PD 5IQNA 5EIIA 3BAIA 43C9A 3AS1A 4DZ8A 1VF5C 4BXSV 5FUZH 4M56A 5B8CC 3M6DA 3X11B 1LK3H 5J12B 1N59B 3S3DB 5DJAB 5EF3A 1S9WA 4AMKL 5HHOD 4ZW7A 2UZIL 4R3SB 3FONB 3FCBA 4P5TA 3VU2A 3ULUL 2AI0H 1HHGB 3S4SG 3CC5B 9PCYA 5C3TA 2AJZB 2WLIA 4G8FA 1F00I 1MIML 4LFHG 4NZTL 4XPFL 2PR4H 2IAMB 3MJ7A 2PCFB 4IIQC 3DVFA 3ZYIA 4G3YH 5F1NA 1DE4B 4NBXB 2IG2H 1TZHB 2OSYA 1F2XK 2WP3O 1JI2A 2F54B 3GXUB 4BFKA 5E2VH 1OAXH 5E1HB 4DCQB 3FO9A 3PWJA 3PWNA 3CVHH 4H25A 3L3GA 2FT6A 4IHOA 4GSDL 4JO3H 2FK9A 1OSYA 1CCZA 4JB9L 3H42L 3F5WA 1D5IH 4ZBJA 5KSVB 1BYOA 4NHCH 4PRID 5HI5D 1GW6A 4L8CA 5DMGD 5B8CB 1K4CA 3MYJA 1TTUA 4HW6A 5IV2B 4H26B 4PJGB 2Q2LA 4E9QA 1DQML 3ULUE 3U7YH 4EVNA 3UTSE 1NBQA 2R0KH 5IFAH 4HOZA 3EYVA 3SBRA 1RFDL 4ADIA 4HZ1A 2EXWC 1QSEB 4ZPTB 3EOTH 2CCLA 2VYRE 3UYOD 3BFOA 3GXDA 4JKNA 2G0KA 2YMXH 4KTDH 4LKXA 2H9GB 3RTQC 4LSSH 1O6SA 4OIFA 4X7TB 4PJFB 3SDCC 3MYZA 2LT9A 1KV3A 4NWTH 2R0LH 4IIQB 4XO9A 3H7LA 1PLBA 5CEXB 4Y5YC 3MCLL 2XA8L 3GO1L 4N8UA 3WEXB 3FCSA 4DK6A 1CTNA 2P43B 4PJBF 1JHLH 4FA7B 1EEYA 1WFTA 2IV8A 3L2MA 1JZDC 1J5IA 5BRQA 4LLUB 5IWLA 1D5RA 4U1MA 2HA1A 2TSAA 1ZS8A 1A6PA 3QSKB 1QR4A 1GZHC 4JN2A 2PCYA 3WHXA 2XPYA 4I0CC 2WXFA 1X5IA 3KWUA 4F7KA 3AMLA 3Q1SL 3MRIB 1D7DA 3UTZB 4DAGH 2EYRA 3B8YA 5IHUH 1T83C 2ZSWA 4ICXA 4PW3A 3V4UL 2WXRA 2KHAA 4QXGH 4FI8A 4GKLA 4MNHA 4ZD3L 5A2JH 5JW4R 4UT6A 3MA9L 2BSSB 1ORSA 2ESVE 1OP5H 2H2PC 2YIHA 1XH3A 3C60C 5EN3A 3NZHL 3RTQB 5HYJA 3SDCB 4C56B 5CBAA 3GPEA 2Y5QA 1BQHB 3CVIL 3KNBB 4FQIL 4XMKL 5BQ7A 4UQEA 4OV5B 3B9KC 2CALA 1MFDL 1UB5A 4Y5YB 5TH2B 4R5TA 4M02A 3KWTA 3BGFC 1SY6L 3A6BL 3VM5A 1Q1JL 1S7QA 4N86A 4EI5A 4HKBA 4DGVL 1CGWA 3DECA 4NQXB 3FO2B 1G7PB 5I1KH 2HT3D 1PX4A 3Q48A 4MCYA 3V0FA 4B9CA 3PGDB 4FQ2L 1OKEA 3VJ6B 4E9WA 1OEZW 4LBAA 4OCSH 5K1JA 4MXVF 5AAMA 1KOAA 3O3DB 3F7YA 5I76A 2H7WA 3MAWA 4D8PA 4FDWA 1IIKA 1GOGA 4BZYA 5B38A 1ZT7B 3UX9B 2HTKD 3VFGL 4IRZL 1MZYA 2CGZA 2VQ1A 3QQ4A 4AITA 1CT8B 2NY3C 3MV7A 4FD0A 3R1GL 4KK5C 3IDNA 5HYEA 1AJ7L 1FLRL 3LHPH 3PV6A 3BEWA 3WMQA 3WKML 3ATAA 2DIJA 4FTDA 4H7VA 4JJHA 4XCCH 3C60B 2IGFL 4HKXA 4C83B 2WUCH 4FI6A 1JTPA 4Z77A 1T5WB 5HYSB 1HC1A 1K4DA 3B9KB 5AW0B 5BRZA 4L4TD 2FNBA 3E9UA 4OJYA 4B9PA 4HIJA 4IKKA 3BGFB 1U91A 3L6FB 5E1GA 4PG2C 2QHLA 2WXLA 3WTSA 4ODTL 4OW6A 4MHHI 1R3LA 3CZEA 5IBTH 5EU7E 2QGDA 4JVWA 4HWZB 4D8OA 1RZGB 1X6NA 1IVTA 3TF4A 2FWLB 4EF3A 5FHBH 3QRLA 1CVRA 2VSKB 5EZIH 2XWBB 3ULVH 3P9LB 3BP7A 2CHWA 4MD0B 4DESA 2FWSA 1R24B 3RGVC 3DXAE 2BIPA 2QTEA 4XO5A 5I1GL 4WW1A 2ZUUA 4Y9CA 5C0RH 2NY3B 4HIHA 1E8YA 4L8DA 5KANI 3VW3H 4FXGA 4XVTH 3V0JA 4IMLB 4A2HA 2X4UA 2EKSB 4OZ4B 4AQ8A 1QAWA 3NIDF 1SRDA 4HG4K 4X80L 2CKBA 3CFBB 1IMHC 4F7TB 3L5JA 5IHWA 1FZKB 1RZIB 1ZTXL 2KQMA 1JVLA 1ETZA 3P4MA 5IW1A 2FQEA 5JDJA 1T7ZA 2BFGA 1J5CA 1L0QA 3VXQB 4AZ8A 1NGZB 3O3EA 1EMTL 3ETBJ 1NCDH 2F7OA 3GMNB 2HPTA 1TETH 1VFMA 4N2DA 2GJPA 5ESAA 1B6UA 5IQOA 2X9WA 3NCJH 3MCYA 1IGML 2P5WE 3V0AC 4R5XA 4OD2A 5CEZH 4NO2A 2KZ1B 1UHVA 1LK2B 2I24N 3D39D 4YHMH 4G5ZL 4WI7A 4EOWH 3RGVB 3RI5K 2PABA 1UYWL 3BEVB 3CCHB 4DTGL 3KPQA 4AYDC 3FNKA 5C9JB 2WKLA 1WK0A 2BH0A 4N2LA 3S36L 2KLSA 3D18B 4LOUD 1YMHA 5INCB 1H5BA 2GCYB 1PSKH 1I1RA 5F1SA 2OYKA 3D0LB 3D34A 4HGWA 4O2EA 4IOFC 4BCZA 1ZTXE 4PJAB 2R1WA 2WLHA 1MUJA 1I85C 4NZFA 3TVMA 3EO1B 1S7SA 1A9VA 3KW7A 3WD5L 1BXVA 2YPVL 2W0FB 4QHLB 1CDJA 3EFFA 4OZIA 4K7PX 1INDH 1YRKA 4W9EC 2NYKA 5EEYA 3BIKA 3K5RA 4M9PA 2NNAB 5KVEE 2Z7YA 4AGPA 2NW2B 4MB5A 4QRSB 5ENWA 3O4LD 4UOQA 3V6FA 1O6TA 1LMIA 1KJ2H 5C8JB 2ZKWA 5KVDH 1C12B 5GQBA 2VTFA 1GKEA 5B1CA 5FECB 3TA3D 5K9JH 2VM4A 2YQ3A 3CFDB 3HBGA 3DA0A 2Y23A 1Q9WB 4P2QB 5BJTB 1JPEA 4RGND 3OAZK 4NJAL 5DD1L 4M61A 2JQMA 4ZFZB 3U7WH 2LLGA 4PRHD 4OKDA 2AEPH 4XR8C 2DOCA 2XPZA 1A3QA 1ACYL 4YHNA 1MFAL 1OP9A 1HXYA 1T7XA 2HWZH 4KV5E 5EU6D 4ISVA 4M6OL 3K7UA 2WKGA 5EUOE 5KTEH 3F6IA 4M6MH 3EJYD 4P06A 5ESVB 1INQA 4QXUL 3WHE0 3PWLA 1JGDA 3TEYA 2A3TA 1JS4A 2ICCA 3QRGL 2OCCB 4GJTB 5FGCE 5TGBB 3VH8B 2VIRA 2VDOH 4JHBA 1URIA 2XWCA 5EU4A 3ATFA 2G9HA 4M6NH 2C3WA 1HZKA 2XPGA 4IOIA 3NABL 3PHQA 4MB3A 3AFLA 3KJ6H 4XRCA 4L18A 4GKSB 4XHQA 3VA6A 4I2XE 3EYFB 3FH5A 3IDXL 2VISB 4YHOH 1ZGLM 3AT8A 1Q72L 4ESKA 4P4KA 3LXBA 3VUAA 3CN4A 5A2KH 2D0GA 1F3JA 2BS8A 2FL5A 4J28A 5EOTB 2Q10A 3B43A 4JY6A 3IDJB 2JI3A 4QTFA 2WQ8A 3T6XA 2CAKA 1A65A 3MBXL 2OSWA 4ZUVA 3HPLA 4JFYB 4U6TA 3JWNG 2E4TA 2F8OA 5JORA 1A6WH 3KXFE 3FB7B 2CJTA 3KLHD 3ZDZF 4GRMB 3FDWA 5IVNA 3HC3L 2D9CA 3VI4F 4PVLA 3QT2A 5EF1A 3FT3B 3P2DA 4JL1A 3EO9H 5J89A 2Y9RT 3LEYL 3ZYOA 5JXED 4WKZA 1CBJA 2Z31C 3NPZB 4B7IA 1EQWA 4OZGF 4ZX3A 4FYRA 3IS0X 2ZX8A 4RFNC 4CBZA 1WE5A 5FUOL 4OLXH 4Z3IA 3ZGIA 1MNUL 5DC9B 1L9NA 4JHAL 2OL3H 5CNHA 3CLEH 3TEXA 2O26U 5EBGA 2PWFA 1KT2B 3GB7A 1X4YA 1T21A 4QXWA 5FGBA 2AERT 2WZ6A 3D8MA 4KPHL 4DP8X 1WFIA 3FUDA 2XWTA 2JK5A 4G1EA 5EU3B 4F2MA 1M7DA 4UQBA 4Z23A 3ENEA 4M8QA 3IN2A 3NOIA 4G42B 4NENA 2G60L 3MLRL 3NIGB 4HKJA 1DO5A 1G9NL 4FZ8L 3PWPB 4Z3GA 1FIGH 2HLFC 3HTLX 3L54A 4K3JH 2GIMA 1X5LA 4LCCA 5FOJA 2P5EE 3BRGC 4P5MB 4E0RA 4P5TD 5JTWA 2EDRA 4MJ2A 1EGJH 3QA3B 2WBJC 4L1LA 1IT9H 5I1DA 4U2YA 3WEOA 1G7JB 2GW5A 2FEEI 2BVOA 1KIUB 1S7WB 5L8LB 3QDJE 3HRPA 1LDPL 4XCEA 1Y1DA 1SJXA 2MNWA 4WEEA 5KYXB 2F8VA 3OVUB 2Z31B 1PKOA 3SPVA 1QHQA 4RFNB 1DUYB 3FU7B 4NAMA 4ZFFA 2H0EA 4UANA 3Q5OA 4NO5A 3Q8EA 2P9RA 3ZZQA 5CAYB 3VRLF 2IH1B 3EBHA 4JRXE 1S3RA 2EVJA 5GGVH 5HDQL 3NEOA 4BFRA 4R2GC 2QADC 3BN3B 2EDWA 5EDSA 1FGNL 2Y7QA 3D07A 4EUPH 1QLRB 4ADJA 1UXWB 3IU4L 1P5UC 3ABGA 4ETQA 1M7IB 3MOAL 2FJGB 3MJ6A 4NHUB 5JHDE 1A3RL 1F6LL 4AX3A 1HOCB 3DJRA 2XUWA 5CWSA 1SEBA 1OK0A 1BBDL 1RU9L 2WBJB 1GYWA 5BS0A 1SVBA 4OD3H 3HCVB 2NNXA 2R8SL 3CZFA 3APFA 5DHXB 4A2MA 1JNNH 2EH7L 1L9RA 3FO1B 6PAZA 2OMBA 2ITDA 1NC2D 1MW2A 2PPEA 4ZW5A 3EDFA 3FQWA 1UWGL 4OFYA 3OZKA 1TSRA 5BO0D 3LVTA 3PXJA 3VYOA 1NLDH 4M9OA 5HI3C 4C4KO 3DBXA 1TZIA 4HIEB 1HYRC 1A1MB 1IBYA 4YS4A 1ADQL 5ADPH 5ID1B 4X4ZA 5LHDA 4WFEE 2VXQA 2OSXA 4R2GB 3UTQA 3L4TA 2QADB 2IANB 5EEXA 3K80A 2JIXD 1IGJA 1RZ7H 1GHFH 4UMGA 1P5UB 5FKAA 4Q6IA 3QJHB 3X1BA 4BM7A 3HPJA 3OKKB 3O81A 3QNXA 2WWOA 2OA9A 4P57B 1FIEA 3SCMA 4NSKA 1NGYA 3IJ7A 5GRJH 4UMSA 4MX7B 5JR1H 5CMAB 5IBLD 1DEDA 4KKAD 3PWVA 1MHHB 2EVFA 2ZCHH 5JPNC 5HYJD 4FA8A 3EH2A 2PF6A 2VWEC 4KY2A 5DRZA 4KVNL 1FFPA 4DKAA 1S9KC 2CG9X 1O7VA 2ZUSA 3BN9C 3BUYA 1CYXA 1IIIA 1G9NC 1SJEA 5GZNA 4QRRE 2XIIA 2DH3A 4Y5VA 3UO1H 4DVRL 2DQIH 2R1XB 3Q2LA 2BW5A 2H1PL 1SXAA 4N3UA 3U2SA 2A9DA 3DGGB 2R27A 2F7QA 1QBMH 5E51A 2FLBT 3M7OA 1OT4A 5GS0H 2AQ3A 2P24A 1IC4L 2F5BL 1UWYA 1CFNB 1WC7A 4PJXF 4QTIH 2D31B 3ZVVA 4PV9A 1A2YB 3HKFA 4YHLH 5CZKA 2ZJSL 5SWZE 4N2MA 5LN8A 2B5IC 3GS7A 1XF5A 3MRNA 1KGCD 2EDTA 5MENE 2G5RA 2IBZY 1I8KA 2OBGA 4JW3A 4GFXA 5HGDA 1L6PA 1K8DA 4JJ5A 1HHIA 4LGPB 1D5ZA 3L3OC 2WZ0A 2G5BA 3B7YA 3LIZA 4P8QA 1KY7A 2BZDA 4MAYD 3PJLA 2WKOA 3G6DL 3V6OE 4NRZA 5JW4N 2G4GA 2NXYC 5JPNB 2A83B 3NRQA 3IDIB 3UEZA 5CJXA 1I3GL 2VH5L 4DPBX 5CP7A 3D0VA 5BRZD 1TFPA 5CJ5A 2EXYD 2JCCF 1LWHA 4ZFOA 4N0FA 3GBLA 5ADOL 2O93L 3LQZA 4XGZA 3TH3T 1WICA 2SODB 3PAZA 4Z7UB 2DLGA 3DGDA 3V0HA 1OANA 5I1LA 4Y19D 4Q8BA 1NMAL 1KPVB 1GPOL 4YHIA 1AOHA 1JK9B 1G1OA 3BYYA 5H2BB 1EFXB 4OUUA 2EECA 2NY6C 2P46B 4F7MA 1J5DA 2DBLH 2OMUB 2DQCL 5F7BA 1BQLH 5AW6B 1Z5LB 2B5IB 1G0XA 4TUJB 4FNUA 3BPCA 2YPLA 1WUZA 3BH8B 4LIQH 4I0PB 3X1FA 5EHFA 4B60A 1OOWA 1MWAB 3UYPA 1MRCL 3QUHA 2NNFA 1KMGA 4NQCA 2Z0BA 3T4AA 2J25A 1K85A 3MXWL 5GRXG 5J9PB 3L3OB 4FNQA 4KX8A 1GZQA 5C0CE 1CDCA 3BW9A 5DJZB 4S11A 2NXYB 5D71H 1XXDC 2UZYB 4CC1A 3IU3A 3QWOB 5C0IA 4A2GA 4L37B 4AEIL 5F3HA 5GGVY 4WUUE 1E6OH 1MW0A 3QFJD 3SPHA 5ES4B 3F6LA 2D03L 4LQFH 3EYSL 4K94H 5BVPL 1CDBA 5GS2H 4MCNA 3HE7C 1PKQE 2XICA 4FYTA 1F8TL 4F2EA 1R3HA 1K5WA 3G6JF 2W9EH 3M1BA 2QR0A 3PIQB 3UYRL 3DO7B 2AXFA 4XNMA 3QZOA 1RUPL 1UWXK 2NY6B 4G80B 4N24A 4UNVA 5C3LD 2F5AL 4YDMA 2VXTL 3KAAA 2NLJB 3KLAA 3RWEB 3GLEA 1G4RA 3B6SB 1CWVA 3SGKC 3DIDA 4A7UA 3CFKB 2GJ6A 1GGYA 2VE6B 2N01B 1F0LA 3RPIB 2FEDC 2AEOA 2W07B 1W8EA 3FT4B 4AQ1A 1PX8A 2ZOTA 4M00A 3O11A 2FHFA 5DJ6B 4PTTB 3KZ8A 1MJJA 1NM4A 1TU2B 1P7QB 3CVHA 2H32A 4OQTL 3MNZA 4MLIA 4Q56A 5I5JA 4DQAA 1E43A 1JRHH 4CDHA 5IJVB 3BE1H 1QQDB 2IDCA 2A6JB 1JGEB 1PG7L 3O0RL 3WNOA 1QO3A 5DC4B 5FW8A 1A0QH 1ZANH 3ES6A 2A6KA 1KLGB 2VSMB 2EDBA 3HE7B 2HX8A 4DEPC 2YLHA 1JK8A 3NJXA 4A66A 1D9KA 3L9RB 4TVSa 2V2TB 4LCIL 1Z1WA 3JTTA 2HVKA 4JG1L 1IBHA 3VD4A 1XCWA 3QJSB 5MP6H 3VG9C 5DO2D 4U7SA 2E6JA 3BZFB 5EBLB 1B88A 1FCCA 5BZDB 1EZVY 4FQHB 5KOVC 2FQDA 3VTTA 2DL2A 3FFCE 1RULH 3EG9A 4PG9B 1WBZA 4A2EA 4M43L 3ZBMA 1GGTA 4PP2B 1RHFA 3DGCR 3RWGB 1GAFH 3OWEA 5L4JA 1LEIB 4IBSA 2FX7H 2XHNA 5F44A 3CD4A 2FR4B 4HUMB 1Y6NR 4MJID 3VXSE 5J13C 4QGYA 3HI6L 1MFBH 3M8OL 1LEKB 4CADA 3IJ8A 3K0YA 5GRZA 2YGPA 3GBDA 2KDYA 3D69A 4Q0XL 3W37A 4YOKA 4Y8AA 3BAWA 3H9ZA 3ULSB 4S1DD 5CEYB 3VX1A 4W9DC 3TOPA 4QXVA 2CRZA 1JWMB 5D55A 3Q2CA 4ONGH 3ILPB 2GJZA 3Q6GL 3TT3H 5DWUL 1A6ZA 1UCBH 1R3IH 3LXUX 3ZRCC 1HWWA 5D8JL 3EHBC 1HYSC 2Z91A 2QQQA 3LKOA 1JGLH 5ANHA 3IYLW 4BFIA 5KJ4A 2R0ZL 1ZLVK 3RKPA 4UU9B 5T33H 3U2JA 2NTFA 3VG9B 1BAWA 3IE4A 3TBSB 4WHTA 4MMZC 1WIUA 2P42B 4U0QB 3UTTB 2GT9A 4HK3J 4X6DB 4Y4HD 2VAAA 2KDGA 4BHUA 2HJKB 1SVZA 2QPSA 1SVCP 1XF4B 4FQJL 3LKRA 2CPUA 4NBZB 4JPVH 1I8LC 1W8OA 1RQ5A 1DSFH 1AIFA 4QOKA 4IJTA 3HZMB 4JAMA 2NCEA 2NX5E 3M1CA 3T0EC 4Q2ZA 5J13B 4GSRA 1MCHA 5KANG 4GI6A 1AACA 1HOEA 4OLEA 3FRPG 5EBMA 3BVTA 4PWKA 3KPMA 2CWRA 5KBPA 1IAKA 4KJYA 3PDOA 5C7ZA 4I3RL 4OFDA 4YXHH 2ADFH 1WS8A 3EHBB 1OOAA 1FBIH 2F74A 3TT1H 4QYOA 5C09B 1QTSA 3KWWA 2MH4A 3S8GB 3O45A 3VMNA 5FYJD 3C2AH 4LBEA 4FABL 1KCVL 3KYNA 1XIWA 3BH9B 4UOW1 1HQRB 1T1ZB 3QDGE 3RWIB 1T1WB 4MMZB 5I71C 3QORA 4MCZB 3L1OH 4JFEE 4JFFA 1JYXA 5F0PB 3QPXH 4X2UA 4ODWA 2X09A 3EXLA 3G5ZA 1T04A 3T6WA 2H3NB 3UP6A 3D5OF 3HC4H 4LNRB 5J3HD 5HVGB 2OJEB 1HQ4A 4FFWD 1JFHA 3T0EB 1U8LB 4JDVA 2VQUA 1QG3A 4NNYA 3TBCA 1SHWA 3QZBA 4HUWA 2VLJB 4UM9A 2E7LA 4QF1B 1THAA 4XPHH 4Y4FD 2IH8A 1XCXA 3KM2A 4KFMA 2UWEE 3M1OA 4CVXB 4RSVA 1ES0B 4GRWH 2NW3B 4WTZA 4N3TA 3RNQA 3DVGA 1YVLA 3QUKA 1QNZH 3GRWA 4LF3A 4QPEA 1OCZB 3C9NA 1I9JH 1PZDA 5JYMA 3E1F1 1TQCC 1AFVL 1F90H 4JMNA 1V54B 2BVQB 5CLTA 4KHTL 2NUTA 5KSBB 1X7TA 3QARA 1FHNA 3CZGA 5I71B 3L9YA 3OXSA 4FP8L 1TTGA 3TFKD 4NPKA 4XNAA 4YNYB 3HG3A 4IMKC 3QG6A 4XXCC 2FYVA 3CDZA 4J3XA 4DGIL 4AH2B 2AXJA 1DQQB 1OD9A 5J6SA 4G6FB 3CHPA 4FFTA 5C6PB 4GUQA 4JBSA 3FTWA 3GDBA 4JPWL 4FFZA 2HRHA 1X44A 4PJDA 4PCKA 4JZNA 5BS0D 4UYPA 2VXVL 3ARFA 4ZMAT 4MDIA 4XC1H 4OGXH 4OGYL 2XWZA 5HDLA 1EZSA 1SQ2N 5AWNH 2L3BA 2PTVA 4C57C 1QEXA 5SX4I 4ECNA 2VUOA 1GRWA 3GBML 4N2NA 5LBGA 3BAEL 5IZ7A 5E8NA 2PXYA 4U1HB 3F7VB 4LCUA 1KBWA 1O7SA 2ID5A 5GISH 3WJJA 5EWIL 1TQCB 2ZX7A 1VFUA 1EXHA 4J27A 4G6MH 3LZRA 4MB4A 2QPFA 3GEFA 2C3VB 1JHKH 1XD1A 2AQTA 2Y2TA 3S5LG 2HN7A 6FABL 4FQPA 1NMCC 1XL6A 5KVGE 1R17A 1A6UH 1T3FB 1W2KT 4L2YA 2J88H 5GHWL 2BWQA 4L3EA 1J0ZA 4RRPA 4ZSOB 3E80A 4FQXB 1SXZA 4KKRA 1XT5A 5GRWA 3U48A 3H9YA 4XVOA 3WIHH 3SCMD 3U9UA 4OCYL 3QJQB 4JDZA 2K4AA 4XCNA 2DQFA 5FLUA 5I8KH 1E3XA 3EYOA 3DX0A 4OH2A 4HJ1A 5KVFH 3U36A 3I75B 4MS8C 3T3PF 1J12A 2ZXDA 1XSJA 1OTTD 3AGWA 4KMLB 3BP6B 2O6EA 3ZGHA 5GZND 4ZS6D 2EDKA 5GRVL 2D7NA 2NSQA 2PTTB 2Q7AA 2YOAA 1LP9E 2ISDA 1TJHH 4I18A 3RVUD 5HXMA 5TE6H 1YZZA 1GZPA 5C0BE 3W81A 2MQCA 3HRZC 4G9DA 4RZKA 2VZ3A 5M7QA 2ROYA 3DX8A 1KELH 3FUIA 3NK4A 4Z3TA 1EANA 3BWZA 3SDDC 2KZWA 3ZKND 1V3JA 4W6XB 4U2ZA 5DUPH 4QO1B 4QDGA 4XP5L 2F58L 2X28A 1NMCB 2BNUB 2MMXA 3CFCH 2C9XA 5LAPA 5KN5B 2YUZA 5L6YH 1NL0H 4QHPA 1TZ8A 4F5CE 4H8QA 4GO6B 3EYQD 3VXRB 2W91A 2WVSA 3BGAA 1AGBB 3G3LA 4KVCH 1I8UA 1L9MA 2VDLH 5D1QA 2O61B 3WUWA 3WN5A 4FFYL 3BVWA 4QHKJ 1G6RH 2YN3A 4TUKL 1I7TA 2R2BB 2FBOJ 3I2CL 3PGCB 3VXUA 3OQRA 4JZJC 3UAFA 1CU4L 3AM8A 3RQ3A 2YD1A 2VABB 4X7SL 4AIZB 2IQ9L 3LPWA 1HSBB 1PG7X 2C7UB 2FO4B 3D87B 4X0KB 3BVDB 1YDPA 4G6AD 4NUGL 2MCMA 3BKCH 25C8L 2UV3A 2CUAA 3FN0L 5J8OA 1JTTA 4MAUL 4XWGH 1RH8A 1ZA3B 2AXGA 3QAZC 4X4YA 1TJIL 3T2LA 4AVKA 4Y2DA 1MPAL 1AD9A 3CNKA 4NYLA 3K4ZA 2HTLD 3QXDB 3HRZB 4GP8B 5C0AA 3CDGB 2OZNA 3SGDH 3D3VD 1H6UA 1BD2B 3SDDB 1E8WA 5E8PB 4UTCA 1AP2A 2DQGL 3FRPB 1T0NB 1DSYA 1R3JB 2F8IA 3P9MA 3EJTA 5D2LE 5DTFB 4ELMA 4YX2H 4ZNEA 3ETSA 3SQBA 4DFIA 2UVFA 1NMBL 2BS71 3HUJF 4ZMVA 3MLUH 3ARDC 5DMKB 4PB0H 4WLCA 3QS2A 3HJ0A 1XH0A 1AR1C 1EBAA 2JKIS 4P59H 3RDJA 1DVTA 4DW2H 4P2RE 5I0WA 4HS8H 2C7FA 3CU7A 5DD5L 1SJHB 5KYNA 1KCUH 1FJ1A 1Z7JA 5JHLL 1GYVA 4JZJB 1RKRA 4P04A 1FPTH 4XI5C 2VLKA 4NM4H 5IB4B 5B39G 1MFUA 5A2CA 1ZGLA 5DQ9A 5AUMA 1PZ3A 4CL7A 4XC3H 3UOAB 3L5XL 3WTUA 3ILEA 2H6PB 3GI8H 1IC7L 1MIEH 3CHQA 4J8QA 1T2XA 1X5JA 3QAZB 4J23A 5DFVC 1M71A 3PQYB 1N6QH 1IC0A 1WBXA 4FQCH 3K8KA 4IDJH 2FEEL 4PLKC 2YUVA 4AWJC 2O5YL 1U8OB 2QVKA 4LLVB 4EQ3A 3AY4A 3DUUA 4XAKE 2XNAA 5E2WL 3Q5TA 1YY8A 2XN9E 4XNYL 3NZSA 4NQUA 1EFQA 1TPXC 3IS1X 4PJEB 3W9DA 2EC9U 3RUGB 3WUZA 4KRLB 3B3IB 2C1PB 1AQMA 1LO5A 1TOXA 3E6HB 3HC0B 4HV8B 5IFHL 1R5WB 3FK3A 2GJ6D 3ARDB 2NT1A 3T3PB 2YD4A 2HT2D 1AR1B 2CLZA 2X87A 2GY7B 2QKSA 5FGSA 3LZNA 2JSFA 3QJFA 5FYLH 4F58H 1EA9C 3C6LC 3TPUB 2YBGA 2A7BA 2X1OA 2OMXA 3AQXA 1J8HB 3D06A 1QBBA 4EXPX 5AG8A 1S4IA 3NFSH 3KH3A 3CN0A 1PYWB 2Q6WB 3KPPB 3T8XB 4IBTA 5FDWA 1DANT 1DEEA 1CE6A 1R19A 2FJFA 1RZKH 2A6IB 1DBKH 2J6EH 2R9HD 1MAJA 4JFDE 4TPRH 3AUVA 4LAQH 1NDMB 1DLHB 2BXYA 5DRNB 1D9KD 1PVHA 4LMQI 3WO3B 4IU2B 1RP9A 1C16A 5KVEH 2E9GA 3G5WA 4OTXH 3ZTNL 4Z9KB 3TO2B 4LP8A 3MBWA 2K8QA 2BOCA 4QD2E 1TPXB 3G08A 3JBG7 4XPBL 3VGEA 4TF4A 4LSUH 3L4CA 3O6FD 5D1XD 5DZAA 1QYGH 1O5PA 4PP1C 5BNXD 3ARGC 1IQDA 1AS7A 1IM3A 1AXTH 5BO1L 3DI3B 5IB2A 3U4BL 1RVFH 3FSZA 3C6LB 1OAYH 1FNEA 2OMVB 4E42B 3WLWD 1OB1B 2VAJA 4DK5A 2XVGA 1W0VA 2DKMA 4G43B 2ZUXA 2A74C 1KUMA 4NBYB 1FL5A 4RZCA 2QVTA 4HXAH 3T4YA 1O75A 1GCYA 5FCUH 1BP3B 5IB3B 4P3CH 1H3VA 4PYHA 3SYPA 3FBQA 3MLYL 3IFNH 4NKMB 1PIGA 3LQMA 4UOZA 1TQSA 4WNQB 2YAMA 1MCJA 3GSOB 1LEGA 5GGTL 4WI0B 2Y07L 4Y9GA 4N2AA 2AABH 4N8VA 2ZONA 2YPKA 1FVCA 5IVOA 3B2MA 3LZQA 3ARRA 3CFMA 4B9KC 5FF6A 1CN4A 3EGXB 3VQ1C 4CMHC 1X9QA 1AI1H 3VWKA 5IMMB 4WJKB 4QTHB 1A25A 1P4LA 3ARGB 4PRDB 3RWDA 3FSOA 3CLFL 1GTNA 4H13C 4S1QL 5FDYA 1ZHLA 2W0PA 1J05A 5IESL 3EH3B 5MEQB 4UF7C 2XY1A 4AL8L 1IBFA 4QOKD 2H45A 5F7WC 2JKRM 4NKIH 4OM1H 4YDNA 5JUEH 2CDEA 1YJDH 3NZ8B 5I2IA 5AKVA 4LSTL 2A74B 3QHZL 5AAPA 3L45A 1EUUA 3LB6D 3UZVA 2O6DA 3U0PA 4HPOL 1N0XL 5I0VA 3A4EA 5B3NA 1MI5B 3VFNA 1QSFA 4JREC 3R7RA 5FO8A 5HHOE 2XBZA 1UVQA 4J1UA 3UAAA 1H8SA 1NUNB 1MCOH 3FFDA 2IPUK 3W0WB 2GG1A 4OFIA 3UIZA 2GK0B 2D3VA 3QG7L 3IGAB 3QORD 1OP5K 4X5WA 1BIIA 1DJYA 4HH9A 1F42A 2Z93A 4CMHB 4JFFD 4JHVA 1WFJA 4NC1E 5DRXA 1JMXA 3STZA 3DTXB 1EXGA 1U8JB 4X42A 1B9ZA 1SHMA 1QNIA 4HBCL 5KUMA 1GIGL 5DZPA 2X2JA 2CPCA 4XE5B 3ZOAA 3PP3H 5CBEB 2JLLA 5C0JB 4S2SB 4HEME 5IMKB 1GGCL 4HUXB 3JXAA 3GKZA 3TCTA 4GI8A 2UZXA 3DIFA 2W80C 3W11C 3SPJA 3DBSA 3RIAK 4MQSB 4XXWC 3MRQB 3AQYA 3BYTA 1T7YA 4EIBA 4NO0A 4ZQKB 3ULVD 2Y22A 2CHNA 3E8UH 1HXMB 4JKPL 2V9QA 4OF3A 4Q89A 5A6LA 2FBRA 4R90H 1PL3A 1R46A 4PRIE 3MNDA 4QJ5B 4WKXA 2VR8A 1DBML 2XV2A 4PJCB 4NQDD 5A16B 3UPRA 3FU3A 1XBRA 4JREB 3CIQA 4YGVB 4EN3D 5EZOH 1XGZA 3D7PA 1W9XA 2AQQA 4FTVD 4WO4A 1JWSA 3MLSH 1E27B 1Z9SA 2YLKA 3ZL1A 3IFOB 3W39A 3MJGX 4XX1E 3ZIMA 2DD8L 4FNPA 2J73A 3MRHA 3C5SB 3H3BC 1LO3L 3HNVH 3CZNA 5BV7L 1EPFA 3GJEB 2NXZB 1OP4A 1W80A 1QSVA 1P7KA 1DQDH 3QO0A 4KKCC 1P4IH 4KKLD 4YXKH 1JZGA 4DP5X 2N3JA 1K5NA 3TESA 4YR6A 1AHWC 2VLRB 3VXTA 1WBYB 5IR1A 4PJBE 2EYSA 5CEZD 3PRZA 4ONFL 3QO1B 5E5UB 3HAEB 4KTYA 3OG4B 4UQ2B 3U46B 5AVTB 1KJ3L 1NLBL 2ZWSA 5L7XL 2W65B 3CFEB 3S8WA 4NZRH 5DYOA 5LB1A 1VACA 1NINA 1EHXA 2PCXA 1NCAL 3IMBA 4IGBA 2I60L 4TVPL 1T4WA 3WEAA 4NFCA 1BBJA 3CQFA 2L4OA 5IVXB 3V0WL 4TNWK 2BHUA 2WCSA 5FO9A 5IG7B 2ICEA 4NOFA 3E6FA 2W94A 2Y06L 3QEQE 5FIEA 1HI6A 4ZMWA 1HINH 3VTAA 1N2RB 1E3FA 2FH6A 5CIPH 5T5NF 4Z7NF 2WVVA 4L3ED 4QHUA 1ZXQA 1R0AL 3TURA 3IM1A 5ITBH 4Z0XB 4Y7MA 3T08A 3B37A 3C6SA 1AHWB 3QJOA 1DQJA 2MKLC 2HFEA 2EDFA 2B20A 5I23A 4L0YA 3KPNB 3CFJA 4ERSL 3G9AB 4YHZH 4F7CA 4GG8B 4U6XA 4UTBH 4LEXL 5GJTL 5F0MB 1D6EA 2LR4A 2ATPA 4YEFA 5IMOB 3ZUNC 5INDB 1MJ8H 2UY6B 3GIZL 3BAJA 3POCA 1RJYA 1U2HA 4M7ZC 4APQA 1YECH 2AEQH 4Z7OF 4AK2A 5DFTA 3WKMH 2A38A 4MXVE 1BX2A 4LAJH 5FKPA 2W60B 2EIBA 3N2JA 2FWUA 1AG6A 5JPMA 1NGXB 1AAJA 3FOMB 3TNNB 1G9EA 3APDA 4IRJA 2YO3A 4CRPA 4GAFB 4HHAA 4JPIA 3EKCA 5B1JA 3PHOA 1Y18B 3CSFA 4PTUB 5JO5B 1L7IL 3KYAA 4L4TE 4HIPA 2NUPB 3IDMA 1CYGA 2IPTL 3LXCA 4XOEA 5HHVL 4LESA 5EPMA 2H0JA 4XH2B 4PJIA 1MFCH 3BC9A 5E2TH 2QSQA 4YE0A 4FYQA 1HHJA 5D1QD 1KV7A 4LEEA 1OSZB 3P3RA 3LYRA 4TM9A 3BH4A 3VXUD 3LY6A 4PRBB 3RA7H 3TN0A 3OKNB 2OSLA 1X7QB 4PBDA 2QLYA 1KTCA 3B7TA 4PU2A 3T6ZA 2I9TA 3T0WA 2VRQA 3BP4A 3ZPDA 1GTFA 2X0WA 3DHMA 4RFEA 5KG9B 4NQVA 1T0MB 2AV7A 1W6WA 1K2DB 1M1XA 3V5HA 5D6CB 5BVJA 3HE6A 3SKOA 1C08A 1H8OA 3SHSA 2J4WL 3N43F 1KYDA 1EJ6A 4GH7B 4TSCL 4Y2DD 3SGEI 3KR3H 4PY7A 5C97A 3MI6A 5C0AD 1AZBA 3RX7A 5KS9A 2WGXA 1W72A 2YD9A 2E3VA 1OLLA 2KLTA 3QUMB 3WAJA 5DA0B 1GH7A 3Q8FA 4OD1H 1RIHL 4M8VA 4POZD 3UAEA 1BZ7A 3F65A 1WWBX 2QQKH 4DK3A 1E4XI 4PRPE 3LEVL 1V27A 3NIDE 2WINA 2NYYC 2CR0A 1H3XA 2XVBA 1WGVA 1G7IB 3SYQA 4ALAH 4KOBA 4HMCA 1NGWA 2GJJA 1CLZH 2WP3T 3FTSA 3IN0A 4W93A 5PCYA 4EZKA 1UT1A 1ZK5A 1H6EA 2YMTA 4ENEC 4IS6B 3D52A 4M48L 4U3XA 5FO7A 3EXJA 3TJEH 4EO5A 3P54A 3STLB 3L5HA 3QI9C 5DD3L 1IILE 1N70A 2VOTA 3U4EA 1Q0XL 3MLVL 2VLKD 4XPAH 3HG4A 1KFAL 3D39E 5CJ8A 1VKXA 3BPLC 3V4VA 5MEPB 2IFFH 3WTYA 4XN5A 1ZIAA 3NTCH 3D85A 5EA0L 1DBAH 5ELIA 3N44B 1A3LH 4B27A 1WA2X 2XZQL 1A5FL 2WUBH 4PLJC 4QJ3B 3U0WL 4JQXC 1E5AA 4HSCX 3KDPB 3MCG1 3W9EB 3DO4A 1E28B 2CJUH 3IKCB 3VWJA 4KNSA 2YGVA 1ASQA 4LB8A 5T5FL 5IB5B 8FABA 1E90A 1S9YA 3MNWA 5FYKU 3GF8A 4X6FB 1OGTA 1YQVL 3UBFA 2NQCA 2ORBH 3DX9A 3BZ4A 4TSBL 5B3SB 3I85A 1NOLA 1E5YA 4OB5L 4R26H 1ETJA 3EO0A 3ZR5A 4JO4L 5F7FA 3Q2WA 4MNQD 2E27L 2QVMA 3QI9B 3CMOH 4I1PA 4IDLA 2ZP8A 4KZCA 4YDIH 4ONOA 2BS9A 4UCFA 1ETB1 5SWSD 3BPLB 3WFCH 3GIVB 3DHJA 5EIIG 4WGWB 3FUHA 1XGYH 3P3YA 5I5IA 1MJ7L 1IC1A 2OZ4H 4XO4A 3LKQB 1FE8L 4KTGA 5ICXB 2OXHB 3L8QA 4Y89A 4KJWD 3DSFH 1EEZA 4RGNE 2CLVA 2OP4L 3EOBB 1V7ML 4Z8FH 1ZHNB 4NO3B 1WA1X 1W16A 4ODXA 4QAMB 5HHNB 4Z7QE 2HLEB 3TJPA 2HCZX 2M1KA 2X1XR 4CU8A 5CGTA 4WCYH 4PRHE 5JDSB 2GI7A 5IM7A 3K71B 5IUSA 4LDCA 5I19L 2K6ZA 4JFXB 4JHWL 4WIQA 2WXNA 4OCWL 5HGBA 1BXUA 1QA9A 1CDGA 2CCWA 5IB1B 4K5OA 1D5XB 1UWFA 1YEKL 4MD4A 3VXME 3VDAA 4ODHH 1EVUA 1JD7A 1HS6A 5KZCD 3OB8A 3EJPA 1JF1B 1GJWA 5BUGA 5L4FA 1JUFA 3N43B 4LOUC 2VLME 5M95B 4MZ3A 3WDIA 5ISZA 2CLRA 1J87A 1ZVYA 4F8NA 1A9BA 2GTQA 4NFBA 2VNCA 3WJMA 2LU7A 2FYYB 4UT7H 3ECBB 4D3CH 5HP5A 1VFAB 1MCIA 4TNVK 5HHQB 1FQ9C 1UM4H 2DI7A 4HJIA 4XN7A 2YEZA 3CSYB 1FRGL 1KLFA 1XH2A 1GR7A 5J6HA 3RWHA 2OMZB 5L4IA 5HDBF 2ESVA 2WXIA 1M7XA 4H0HB 1AD0A 3QCUH 1BJMA 1EK3A 3GRBA 3T71A 1IM9A 4XZUA 3BIBX 1GSKA 5I30H 1QATA 5I1AA 5DHVA 2R69H 1A9EA 3K72A 1M53A 4OY9A 3VWKD 1XCTA 2ZD0A 5DK0A 4DN3L 3KL5A 1JXFA 3N0AA 4OIBA 2X70B 3ZDZE 2FO8A 4LL1A 2VITA 1J5OL 4P0DA 3QIWA 3CG8A 1ANUA 1MFEH 2JJSC 1RMFH 3CXDH 4I1RA 3S97C 3VI4E 3UJTL 3T1FB 4U1KA 2FWOB 4X9IA 4A04A 1LO0L 3BSZA 4KMTH 4X5QA 5DDHA 2VL5A 3VFWA 4IOSA 3K6IA 4Z0BL 4OZGE 3VVWA 5GS0D 5AFAA 2YRLA 5GIRA 5TQ0H 1IBBA 3BCFA 3CPLA 4A63A 2CR3A 1RZ8A 2K45A 3D50A 1Z3GL 3TFBA 1EEUA 1FC2D 3EFDH 3FOLB 4I9WD 2PO6A 2TAAA 2XFXB 5EEVA 1QSFD 1LTXA 1I9IL 1VFBA 3EGDA 1ZE3H 4H5SB 1MEXL 5TD4A 3EGSA 1UZ8B 5HY9A 1NBZB 1XR9A 1UG9A 4FKKA 4NM8L 3NIFB 4UIKL 4ODVH 4WU5B 1NIFA 3EW3B 3O0LA 5T3XE 1GGIH 2ZAGA 3FQRB 4O02A 1JPTH 5D1ZC 5I8CB 1S7UA 4PCSA 5JA9A 1E9PA 2X4RA 4FQ1L 1PQZA 3A67L 5DLMH 1QZ1A 4A1RA 1EZLA 1CO1A 1ZWIA 1E5BA 5D4QA 5K39B 5EG6C 3D9AL 4HFWB 3U9PL 1LNUA 4PJ7B 4WV1C 3BHBB 4YDVB 1QRND 2PYFA 3JV0A 4KGJA 4J3TA 2ZSVA 2J3SA 4ZFGH 2AS5M 1JPFB 3MLXH 1HFUA 4A6YH 4PGDB 1CPUA 4R0LA 4NO0D 4O2CB 3DMMD 1AANA 3VI3F 3VRLE 2CO6A 3DXAA 4ANWA 4DETA 5BW7A 1QUNB 5T1LB 4PSRA 5I18L 3RIKA 3K6DA 3QFDB 5B38G 4DP0X 3OHMB 2G2RB 5EU6B 5IJKC 2GTWB 3SKMA 1LE9A 4PEEA 2Z64C 1UASA 3L4WA 2ZCLL 3QEGH 3Q3GB 4WO4D 4ZMTA 5D7JC 4GW4A 5EIVA 5D72H 3B8SA 5EULV 1ESOA 1BVLB 1G0DA 2VDPB 4JR9L 2FBJL 2JJWA 3ZDXF 2NR6D 5D1ZB 4A7VA 2H26A 3BWUF 2YD7A 2BNQB 2YKLL 1S7XA 3JWNE 3KLQA 4RDBA 4UT6L 3MLWH 3THMH 4TL5A 4EJ1C 5GS2D 1FNGB 3D2TA 2DI9A 2GFBA 3GMLA 5FUCC 5I8OH 5LNEA 1OAQL 1NCOA 4QRFA 3ZYZA 4AYFA 1CGVA 1ZHKA 4P49A 2BIQA 1XGPB 2QTVA 4WV1B 1IFHH 2P5WA 2F08A 4YWGH 4ICWA 3HLKA 3X12B 1IFRA 5ILTH 4D0CA 2CGRH 4OLVH 4P5TC 4OI8A 2PW1A 3NVQA 4Y8DC 1XAKA 4P46A 2AK1H 4BHUI 3KPSD 4K23H 2AV1B 3U25A 1X7SA 4FI7A 3DX3A 1UOLA 5AYQA 5EBWA 1E8XA 1BQ5A 1N18A 3G5VB 3POHA 1WRFA 3EDEA 4XNXH 3MMEB 2A2QT 3BUTA 4IGBD 2A73A 1NFDE 2HRLA 3HS0C 3ZL2A 5IHZA 2X4SA 5D7JB 2H0FA 4CSPA 2CQVA 2DZEA 4R4FL 3TCXA 1KYOK 3TO4A 4RCAA 4B6ZA 4WI4A 4P5KB 3NFPA 2B59A 5LCVH 2LAAA 4E5XB 1R5IB 3HNTL 1ND0B 1Z32X 3BP5A 3OB0H 3ESPA 3LS5L 2J6EA 5DQDH 3Q44A 3UFIA 4MASA 5EIIB 2ED6A 43C9B 1PDKA 2C9UA 2IBGA 3AG3B 4DZ8B 4YC2C 2ED7A 2VDKL 5JLZA 1Z2KA 2KPNA 2H0PA 1KEGH 1OCOB 3L2NA 1KB5H 5F9DC 1S9WB 3P30L 5HHMB 5E0QA 2GKIA 5EO9A 3TYFA 4P5TB 2CDGA 2A9NL 1QZNA 2A4ZA 3AVEA 3QHFH 3ABLB 4OZHF 2WLIB 4G8FB 4M62H 2ALWA 4PI0A 1RK7A 3HZVB 3MJ7B 5I8EB 3DROA 2W5PA 1KXVA 5JQ6L 1KGCE 4PJXE 2FRGP 1FHGA 1KB9K 1YNLL 5F1NB 3TYGH 3NMEA 3HS0B 1UD3A 1VZIA 2XVKA 2WXPA 2DPKA 4YFLI 4L48A 3IGUA 4XMLH 3VFOA 1E5ZA 1PLGH 4IRJD 2PCPA 3FO9B 5IWLC 2X5PA 3PWJB 5A3IC 3PWNB 3EAKA 4LARH 3LEXB 5AVUB 4H25B 4KK9D 3CSTA 3L3GB 4IHOB 1IBGH 4GSUA 2H6OA 4MZRA 1MQKH 4UINH 3PL6A 5BRZE 5EUOA 4DIXA 3F5WB 1G9MH 5DMIL 3UADA 4BWUA 4Q52A 5F9JA 3AXLA 1U8IA 4AYBA 4YC2B 4QT5A 4Z78A 4L8CB 2NNCA 1QOKA 1K4CB 2WK2A 4OCXH 5IT2H 1U95A 3O4OC 3MYJB 4KJPD 3T09A 3L95A 2JCCE 3WOVA 3L3DB 4Y19E 1RZJC 1UT9A 2VCOA 4JHZA 2JTYA 4EVNB 4BJLA 1LQSR 5F96H 3EYVB 3WY4A 3NAAL 4EZMA 4I2XA 5EOQH 4JRYD 1M56B 4QRUA 1RK1A 4P3WA 3RL2A 4LKXB 3ZDXB 1D6VL 4WDIA 2WO4A 4N1CA 3WL9A 2P1YA 5DD6A 2EZ0D 2J56A 3HE6D 3ZTJH 1FH5H 5KSAA 4CGTA 3HZYB 3FCSB 4PFEA 1C5DA 1O9WA 3RZCA 1EEYB 4IRSD 1WUNT 2O5ZH 1UXSA 4OGAD 4ZT1A 4EI5C 3RNKA 3GHBL 5D7LD 4U1MB 1XF1A 1L7TL 3B1UA 5CJBA 4F8PA 1YEEH 2HSIA 1JFQL 4HMDA 2Y4SA 3QFJE 3HI5L 3MRPB 1RLBA 4K3HA 1AQDB 4JN2B 1G84A 3JV4A 4KGLA 5AAMC 4CC4A 3WHXB 2MSPA 2JI1A 3Q7JA 3O4OB 1FSKC 1AZNA 1NAMA 4R8WH 2F0CA 4YHKL 3HB3C 2ZSWB 4EIZC 3UJJH 4Z7IA 5E6UB 3G6JE 3JYCA 4MNHB 5J11C 1JSYA 5LBSA 3T2QA 1LXMA 1DDHA 1P84J 1ORSB 3UJIL 5KBKA 1MVUA 1CFSA 1EHAA 2FQGA 3FRUA 4GP5B 2X6AA 5HYJB 3UZEA 5IK3A 5CBAB 4OJCA 3NCMA 3R8BB 4YZFF 2CHZA 4XMPH 4ATWA 3BKML 5BQ7B 4DHLA 3G6AA 5CILH 3D85D 4TXVB 1F4XL 2P5EA 3O2DA 3ARWA 4BUGA 3BLPX 2GSMB 3BAKA 3MSPA 5DS8A 2X7LA 4G7VL 1S7QB 1PAZA 4KI5F 3U1SH 3JVFC 4EI5B 4HKBB 1F6FB 1GCFA 5DZVA 4WGVB 3IXAA 4GRWF 4MCYB 1NFKA 3ZE1B 1N8ZB 3DTUB 3QDJA 3SDAD 3BD4A 1A7PH 5DT1H 4OT1L 2YA2A 4OQ1A 1U3YA 4OZHB 1ADWA 1EJ8A 2CO7A 3O9WA 5I76B 3VD3A 4RESB 1FSKB 5CGYD 5B38B 4BV1A 2XWJA 4YSAA 2VQ1B 5CSZA 3HB3B 3V4PB 2KI6A 4JRXA 4N1EA 3MV7B 3EJZD 5GRUH 4P3DA 3IDNB 3PS6A 1G7HA 5J11B 1RUAL 1PIFA 4CSSA 4HWBH 3PV6B 3BEWB 4FXGC 2B0SL 2J72A 3FSWA 4HHGA 4DO6A 3IF1A 4AQ8C 3WU1A 4MKTA 3PWUA 1OZUA 2CKNA 2J8UA 3VG0H 4HKXB 4H1LA 4Z77B 2VT0A 3RWFA 5L9DH 2EIZA 2YSSA 2CH8A 2HLAA 1UQSA 2VDKB 5JHDA 3JTSA 1WAAF 4HIJB 4TSAL 1U30A 4S1SH 4YBQD 2Q8AH 1DVYA 5HYQA 1XCQA 5I6MA 5IHHA 2ZT9C 1XF2B 1U91B 3AU1A 43CAA 1A02N 4MJIE 1R3LB 5T1DH 4AJ0A 4XE0A 2HVJA 3V6BR 3ZHFA 2DKUA 3PGFL 2NY4D 3JZYA 1WIOA 3APCA 3QQXA 1JGIA 1JGVL 2ZXGA 4YVUA 5GGSY 3DJTA 1AC0A 1CR9H 3LN5A 3OAWA 3QK0A 4UZSA 2FJUB 4GS7C 5HGHA 3I6LE 4AG4H 1HKLH 4KWUA 4KDWA 3OMIB 5L2KA 2WQWA 1RUML 5EO0A 2WXOA 4WW1B 1XBDA 4HIHB 3NN8B 1E65A 2IBBA 35C8L 4K5NA 2LU5A 2N0MA 4O58L 1KTKE 1H5BC 4FXGB 1HXKA 5ISZD 1U8HB 4HFUH 1ASOA 4HF5L 3HS8A 4PGZA 2X4UB 4FFVC 3CX5J 4X9FA 1KCKA 3VXOA 4E9XA 5FYJL 4XCFL 5E7FA 1Y1UA 3QQNA 4OLZH 1EWHA 2CKBB 5CIPA 1ED3A 3F12A 2ALAA 3H9SD 3BAYA 3CZSA 3TVMC 5IW1B 1ETZB 3OZ9H 4V2BA 1B4JL 4JG9A 1MHPH 1SN0A 4AZ8B 3O3EB 4GXUN 2ESVD 4Y4KA 4UTBA 4BDVB 5ESAB 1IEAA 4ETYA