2WBWB

Ad37 fibre head in complex with car d1 and sialic acid
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
b'SLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBER PROTEIN
publication title The Cell Adhesion Molecule "Car" and Sialic Acid on Human Erythrocytes Influence Adenovirus in Vivo Biodistribution.
pubmed doi rcsb
source organism Human adenovirus 37
molecule tags Structural protein
total genus 31
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2009-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wbwB00
3HB3D 5GRJH 4Q58C 3QEQA 1OLZA 2VLKB 4CMMA 3AC0A 4NQEA 5ESQA 2ADGB 2NXYD 1F11A 1RUAH 1RMFH 4O4YH 5A16A 3MRFA 4PD4J 3SDCC 3VFTB 5JQHC 4DKDC 3SKNB 4HWZB 1F6LL 4NZUH 4G7YH 4KHTL 3QIWB 1RZKC 1OB1A 1ODAA 1QA9B 2DBLL 5CEXA 4WGWB 2APBA 4NRYA 3REVA 3GJFK 2QKIB 4PV8A 4DN3L 4APQC 4CN1A 2WIIA 3WIHA 1A5FL 1CYGA 3M1BB 4MD5A 1J1OH 2DIAA 2VXUH 3LEYH 4PJ7B 1GRWA 1ZEAH 1T1WB 4YBQD 1NGPL 4M6OH 4MNQA 1HIML 3F7RA 1HK6A 3LPFA 1F4XL 3GB7A 3U2SB 4ZXBD 1N4XH 1ONQA 5E99L 5DJCA 3QULA 4ZO7A 3ZO0A 1C5DB 3VI3E 4WCYH 4YO0A 2F8VA 2WIMA 1CXIA 1P7HL 3W0WE 3SOBL 1G9NC 4YC2C 5CBEB 1LE9B 3DX7B 1ZHBA 3MRHA 3H3PH 5DMGC 1YMHA 3ZKXC 2WBKA 5HD8D 3QWOB 4JG0L 1ADQL 2OMBA 4M5YL 1WWWX 5H37H 3N06B 4O9HH 2XA8H 1KGCE 2AJUL 3BEVA 5E94A 3C60A 3E3QC 4JN1H 4Q0XL 5E2UH 2C4FT 3VFPB 4PGZA 3TF7C 2WBWB 5EN2B 4CDGC 1JGEA 1OWRM 2DTMH 1PLGH 3ROOB 1X5KA 2VZ1A 1QKZL 1XH3A 2A9ML 2D0HA 2FGWH 4HKZB 5CUSL 1NEZB 3CCHA 3S35L 2Q76B 5HGDB 3AS0A 1U6AL 1VDGA 2NR6C 3SKJH 4ODUB 4HQQH 4TSBL 3B6SB 1CTNA 3QH3A 2BX5A 4KC3B 5IF0B 3NFPA 3QI9D 2BXYA 1UKSA 2VDPH 2HT4D 4GO6B 5IROA 5LGHH 3WFHB 4K23H 5CD5D 1YYMH 1J18A 1QNZH 3QZWA 3RNQB 2R0WH 1DTUA 1HEZA 4HKBA 2JKXA 1O5DT 5FECA 2E8ZA 2AV1A 4ELKB 5BV7B 3RUGA 4PJ5A 3EYQD 4QTHA 5GGRA 1MI5B 1LDSA 3GMNB 4XMPH 1G1YA 4EI6A 2V9QA 5D7JC 5SX5H 2DQDH 5I1AB 2N7BA 5M95B 3MO1A 4AL8H 5D1XD 3EYUL 3PHQB 5AYQA 2HKFL 2OS7A 3LDBC 1YY9C 1ZHNB 1P5UA 3LOWA 2V2TA 4RISL 2XQYG 5DJ0A 5DA4A 4LBEB 1JPFB 4LCWE 1KJMB 5CJQL 3K1DA 4NUGH 3F7QA 4DN4H 4PRNA 1IGCH 1GOGA 3OB8A 1VPOL 4LOUD 4RFNB 5L2KB 3KJ4C 3IU3A 4W6WB 4PP2B 1ZWIA 4F9LA 5IP4A 2AJXL 4WV1A 5GRVK 1OD7A 3BZ4A 4N0CC 4PGJA 1EEYB 4KJQC 4LVOC 3ALWA 4X80H 4FMFA 3GKWL 3KLAB 4G6AD 1RK0B 1MRCH 2IQ9L 2JCCA 5JXEC 3QJFA 2IBGA 2CXGA 6FABH 1UADC 4KK6D 4CVWA 4TULH 4KKNA 5ICYB 3GSQA 5E2VH 3UTPD 3LB6D 5JORA 1WZ1L 3V8CA 4KKBC 3O4LD 1X5YA 2IQAA 3FB5A 1V5JA 2P5ED 5I76B 2CLZA 5MEOB 2W9EL 3DXAB 3QDMB 4WEBL 2APTA 1RHHB 2PXYB 3OB0H 4HHAA 5BW7C 2MQ0A 1CLYH 3QDGB 4QHLB 2J6EL 1T4KB 5I1GH 4KZEH 2G60H 3O8XB 5D72L 3I02A 1F02I 5EU4A 4HBCL 5K9OB 2OTWA 3W39A 1KF9B 4WFHE 4L8BB 5BJTA 5C0IA 3I2CL 5GGUA 3IDGB 4JRYB 1KBGL 5C86A 3FT2A 1LO2L 1INEH 2GK2A 3QNXA 2KBGA 3RPIB 4UOJA 3LKQB 5D7LB 1QRKA 4XCNB 1BAFL 2DL9A 5E9DB 3Q6FB 2Y25A 4Z7WB 1A47A 2DM7A 1UQSB 3QNYB 3WBDA 1MRDH 3EOAA 1OSPH 2B1AL 4E42B 1S7SA 4OF5A 4LLWA 1JMXA 1AHWA 5I8EA 4Y2DB 1KPVA 4G6FB 2AK4D 1D5BA 2CKBA 1MCRA 1MCJA 5IEKB 2J8OA 1ZLUH 5DVKA 1XF3A 3MRKB 1HHHB 2C3VB 1JWUA 3MUGA 1IMHC 4P5TB 1DBML 1CTOA 3DVNA 4HEPG 3U9UA 4LSPL 4ZOBA 1OAYL 4CGTA 1MVFA 5EUKA 4HCRH 3K2MC 4ZNEA 4YAQB 5T3ZL 3T3ME 5J12B 5HHVH 3RWCB 5IJVA 2H3NB 4U33A 4J8RB 4PB9L 3S37L 1NGYB 5AD0B 4QOKA 4XC3H 2HVKB 1S7UB 3GJFB 3AUVA 4OZFH 4Q9BA 4ZSOE 3H0TA 3VWKC 5I1DA 2YD9A 5AZEL 5F7UA 5DDHB 1UB6B 3U0TB 5IW6B 2NY0D 3Q3GA 3VXUD 2P42B 5GGVL 2EEAA 2AJZA 1AC6A 3O6MH 3FQWA 4KKCD 3VFNB 3O41B 4WDIB 4F8QA 3IETB 1RURH 3OWEA 3BZEB 3GIVA 3K8MA 4M1CD 3BQUD 3QFJE 5F7WC 2GITB 2H9GA 2MWCA 5DMKB 4HUNB 2QADD 3V4VH 4PLJD 3IF1A 1I7RB 3BEWA 4JLRB 5DD0L 3DO7B 1UXWB 3LQAC 4NQVA 3QXDA 1GIGL 4HUMB 1D5ZA 2BJMH 3MLSH 1CGYA 3PWPE 4NC1C 4ISVB 4QRQB 4HGWA 3RTQB 1N2RA 4HK0A 4Y5YC 5FUOL 5J9PB 3PP3K 4CU8A 4I5BA 4ACPA 1YDPA 2HLFC 3RUGF 1QLEL 3NABH 1KYOJ 1A02N 5J4MA 2PTVA 3T4AB 1XR8A 5F97E 5E03A 2D2OA 1RUPH 1KIQA 2LU4A 1JZ7A 1N6VA 4HS6B 3EOBB 3SDDA 1FPTL 4OZIA 3SKOA 5DHVB 2OR9H 3QIUB 3VG9B 3TN0A 9CGTA 2X7LA 3GJFH 4QXGL 2DQTH 4XB7A 2AXHA 1D5IL 3ARRA 5HYIA 4ORGA 3PUCA 1NPUA 3C5ZC 5T5NG 1BZQK 5MERA 2OM5A 1ZKAA 5IB4A 5IT2H 2WLZA 4L4TA 4TRPH 5BZWB 4J3SA 2OP4H 2CIIB 4ONHB 4K3DL 4V1DE 2FHFA 1XZ0A 4MJID 1W72B 3JV6B 5IMLA 3MRNB 4QHKJ 1YY8A 5D2LA 4P4KC 5GQBA 1FFOB 1IC4H 3HC3L 1DLFH 2JCCF 2XPGA 3BPOB 1CU4H 4HW6A 5JHLH 2ZP0T 1J9CT 4HMCA 4RBPK 4XBPA 1F4WL 1QRND 2ICWA 2RFXB 4IRZH 4KY1H 1RQ5A 2LFGA 3MV9D 4BSWA 2QHRL 3SBWC 2VZTA 3WO3B 3FO9A 5TGBB 3SJVB 2GJ6E 4X9FA 3VE0B 4XCYA 3UBXG 1FZMA 1X5AA 1CICC 4QRSB 2Z9TA 3OKMB 3VWJC 4KJYA 4NM8L 1K8IA 4IRJB 4PP1D 4OI9A 5ID1B 3JBG7 4O2EA 4OM0H 2R9HD 3VRLE 1V7MH 2M26A 5TFSH 2YEZA 2VAJA 4EOWH 4X8JB 4Z7NE 1A6TB 4Y5XA 4DOHB 1TETH 4YDJB 1CBVL 3OAUH 3DWTA 2ICES 1C16A 4Y1AA 1HH9A 1S7WA 3B2UD 1J1XL 2J8UA 5DC9B 4IHOA 2DIBA 3MC0A 4HIHA 1T0NA 3GJEA 4PRIA 4KGLA 2ZOKB 4PS4L 2YXFA 3MCLH 4S1SL 4JQXC 4B0MM 4ZTPL 1R0AL 3WFBH 1NFIA 3LS5H 1IBGH 3TVMB 4U1LA 4ONGH 4PJIE 2FR4B 2WAHA 4R90H 3IFLH 3P9MA 4J6RL 3U7WL 1P7QB 3TO4B 5I16A 3D3VA 1J5OH 1VACB 3ZTJG 5IM7B 4L3ED 5JLZB 1KIRA 2FL5B 4AIZB 1YNTB 3H3KA 5TDPA 5T1KB 5EZIL 2BNQA 5ADPL 2WWKO 3QUZB 3EFDH 5MHSD 4LPXA 4IDJL 2VLJA 2CUIA 1ZT4A 3FB7A 1BQHB 1ZHLB 2JK5A 3VFOB 4AEHH 1AIFA 3MLPA 5C0AB 2IANB 2X4SA 4J1UB 3SKMB 2PETA 1I8MB 1X5HA 4LLUB 4WWKC 4Q6IA 2VITA 1PGRB 3B9DA 4TNWF 5HHNB 1IZKA 5CCKL 3WNMA 3NVQA 4JO4L 2JB6B 3MV8D 4XZUA 3IGAB 5BVJA 3P0VH 3UPCA 1KNOA 4GFTB 3GIZL 2VXVL 4HXBL 3DGGA 3GK8H 4M61A 1JZ2A 3MZGB 5EZLB 1EJOH 1IL1B 3HG1D 2FH8A 3QEGL 1TCRA 1K6QH 4LSQL 3DTXB 1P7KB 2VISB 2X09A 1AR1D 4MNGE 1NMAL 2IEPA 4E41B 1I3RA 2FATL 5DEFB 3FO2B 3MJ8B 2WUCH 4GXVL 4HWEH 1D5XA 2WQ8A 3UPAA 1O7VA 4EDXB 4MDIB 4R2GB 2FX9H 5HHPA 2VXQH 4GG8A 5EZOL 1DBKH 5EO1A 4GBXD 1AI1H 5IQ9A 4CADA 1SJEA 2F8XC 1ZT1B 4U6XB 4CVXA 4W6YB 2FLBT 5E8DH 2K1MA 2FX8L 5DHYA 1EHLH 3VXSE 4OZIF 1AO7D 4L4VD 1R3IH 2C9AA 1MCOH 3LVEA 4NWTL 5MP6L 1OGAE 1ZA3A 5DK2B 4XH2A 4MZ3A 1PKQE 3GMOA 4LASL 4H88L 1P4BL 2CRMA 3GMPB 4ZUWB 1C08B 4R97B 3N9GL 4JM4L 2O5YH 4JPWH 5C0CD 1RZIB 4TUOA 3MRJB 4M3KB 1HSAB 1NC4A 4M9PA 3WSQL 5D2LF 2ESVE 1BZ7A 4PRDA 1BBDL 4OSUH 1HOCA 4GRMB 2ZCKH 2Q7YB 4NO3B 5GS1A 3C9NA 5FKAA 4YZFE 4FHBD 2QQLL 1DANT 2CDFB 2DQIL 3MPCA 2ERJC 2ED7A 5I66A 1MREH 4K71B 2DYPB 1K4DA 3RY4A 3VFGH 2UZXB 5ITFA 3X12A 4R7DB 5DTFB 5FYJU 1F58L 4DFHA 1XGTB 3PP4L 3TZVB 1S3KH 5IVZA 3L5JA 4U6HB 1SY6A 3RWEA 1NQBA 4YDVB 5CLTA 3NACH 2QTEA 2UZIL 1WWAX 3WYRA 3W2DH 4ZUSB 5JUEL 1OF2A 3MNWB 2AW2A 3HMXA 5T1LD 2P5WE 4ZS6D 5EPMA 4LU5H 4EZMA 5E2WH 4W4OC 4AENB 1PYWB 3F5WA 2BVOB 2OZ4H 3RY6C 1ZGLP 1IEBA 1M7DA 1T0PB 2N4IA 4JRXA 4P2OA 4CJ1A 4MQXC 5L9DH 3D69A 3I50L 3O6LL 1OCWL 2VLRD 3VH8B 1IGFL 5K93A 2J8UF 3MRGB 1WWBX 3QUYD 1ACYH 4ONOA 3HAEB 3SQOL 5CGYD 1CXEA 3BUTA 5EDXA 1VCAA 3P4NA 4G3YH 3INUH 2ARWA 3OXRB 5HHME 5ESAA 1EAPA 3HFML 1F45A 3C6LD 5HVHC 4GAYB 3PP3H 1N6UA 2NY2C 4EUPH 3P9LA 5D1QB 4PRPA 1A6VH 4FA8A 2A0LD 3QO0B 2XQBL 2WBJC 1CCZA 1JGLL 1XIWD 1A1OA 1S5HB 4OCWL 5I0DA 3P77A 5LQBL 1ZT7A 1N3NB 4MD4A 3G5VA 2XKNB 3A6BL 4OFYA 4P3CH 5E8PB 2BOBB 5EO0A 3BJLA 2IBBA 4XPBL 1CFTA 4LP4A 2XN9D 3A67H 1ZK9A 3L1OH 4PJDA 2R1WB 3HZYA 3VXME 5JDSB 1H3PH 1YMME 1Y18B 3BP6A 4QNPF 1OTTC 4MVBC 5KG9A 3NA4A 3C8KB 1A7QL 1EPFA 5FM8A 1FO0B 3QUKA 3KLHD 1YEKL 3HNTL 4JZJB 4P46A 3GHEL 1SYVA 4U6TA 4DCQA 3BDBA 4XPFL 1CQYA 3MV7A 4PJ8B 4GW4B 2FHCA 4WUUE 1OAUL 3LKSA 1QFWL 5H35B 3MJ7A 3QP3A 3RWIB 2EH8L 1DEEB 4R6UA 4KK5C 1MFBL 8FABA 5DJ2B 3HAEH 3O2DA 5EBWA 2E9JA 5FM4A 1JZ6A 2W65A 1S5IH 1JWSB 5ADOL 1KEGH 1U8LB 4RCAA 5JDJA 1FNEB 1Q0XH 1U8PA 4RBPH 5GGQL 3QEUB 3UTTA 3NCJL 2ZCLH 5C0BD 5GRWA 1KEMH 3A6CL 4X6CB 4PRAA 1NBZA 5JO5B 3H9SD 5E00B 1JK8A 4JY6B 3F7PC 4GRWB 3UCRA 1DDHB 1KTLB 4O5LH 1HKFA 4HWBL 1WZKA 1I9JL 2F54D 3S34L 1J05B 1QFWI 5F96L 5DD1H 4MJ2A 4Y7MA 4RGNB 2HH0L 2DB8A 1CXFA 1UC6A 1JIBA 4PJGE 4N90D 1KB5B 4ZFFA 2P24B 1ZV5A 4NQCA 3HN3A 4HIEA 4KFZC 2GY7B 2C3WA 4Z95H 1ZA6B 3OKDB 3ROLB 5SWZB 4JPIB 1VSCA 5BOZG 1FO0H 1I4FB 2EIBA 3OJDB 3OGCA 4MAUL 4YXHL 3ARGB 3UC0H 3SE4A 5D70H 2OCFD 1EUUA 1D9KB 1LD9B 2KL6A 2UWEA 2VE6A 3MBEB 1C12A 3EYSH 3G5YB 2AXGB 3UTQA 1E4XL 3SDXB 2R0KH 3VFWA 1MCFA 1C8PA 1H15A 4XBGA 4LPVA 4PUBH 3VXRA 4CW1B 1G1CA 3WD5L 4MQ7A 5KN5A 2XI9A 3KYOB 4M5ZL 1QP1A 1YUHA 4RAUA 4NKIL 2V2WB 1B0WA 5CEZH 4GKSA 1NSNH 2YSSA 2ED8A 5D7SL 5J1TC 5IKCA 3HC0B 4GKNA 4GRWH 2EIDA 4KUZH 4RMRA 3EHBC 3VFVA 3BD3A 4E0RB 3F7YB 5EOCL 4WO4D 1UM5L 2HFFA 3SCMA 3H7LA 4ZUUB 3ARBC 2DDQL 1E4XI 4DWHA 1RUAL 3L7FA 4HKJA 3LSOB 4ZUTB 4KPHH 1RMFL 1ZLWH 3MYJB 2PTTA 4TVPH 5FO8A 1SMOA 4KXZH 5C9JB 2EKJA 1F3JA 1YNKL 3D0LB 3SGDI 2NZ9C 1T1ZB 2EDYA 2VMFA 3RY5A 1Z3GH 3BW9B 4O2FB 4LRIA 1P4LB 1QO3A 3TEUA 2F53D 3S88H 1CGXA 2EDEA 3ZKND 4C56B 4XNQB 2EXYD 4LVNC 3BGMB 3T0EA 1UWGL 4YEEA 4NNXB 4NP4H 1J1OL 2VXUL 3LEYL 5K59F 3O3BB 4MA3A 3W81A 4KAQL 4Y5VA 2A73B 3HS0B 4LSSL 3HR5A 5D5ME 4I2XA 3N1FC 3MBXH 4JFFB 5JQ6H 4RDQF 3TBTB 5C07B 4GAGH 1Q9LB 4OIBA 3C5SB 1FNGA 3C5JB 1JF6A 5I73B 1YPZA 5B22A 5KVFH 1KLGA 5CEZE 2MHAB 1NC2D 1G7PB 1W8NA 1DVFC 1GGYA 3PE9A 3ILQC 5E5RB 4AG4H 1VGEL 2C26A 2IC2A 5L8LB 1ZSDB 1FYTB 3ZKMD 4YNYB 3ZKSD 3B9KA 1I1FB 4ZFOA 1RIHH 1JGUH 3DROB 4FQCH 5B38B 1SYSB 1MQKH 5E2UL 3BDXA 4U4BA 4TVPE 5C0GB 2R23B 4NKDA 4HUUA 2DJ4A 5B4MD 4PJDF 4RX4A 2NY3D 3ZHLA 5C8JB 5FB8A 2DD8H 3OZ9H 4O2CB 3FZUD 3D1MC 4C83B 2DTML 1PLGL 3RWFA 3MR9B 3CFJA 1QHPA 5GGTL 5IIEA 4ZO9A 2BNRD 4P23B 3HUJA 4NIKB 5E95B 5DI8B 3STBA 1JBJA 1MFNA 4NRXB 3Q1SH 4EI5C 1DR9A 4JFHD 4RNRB 3SKJL 2NTFB 2XY1A 5K33A 4G8EA 4HQQL 1KUMA 1B2WH 3L3OA 3EZ8A 3SDCD 1P4IH 2DMBA 1MLBA 2VDPL 1GH7A 4QY8A 2EIZA 4WTZG 4R3SB 5JHDA 1QNZL 3MRIA 1FE8L 5KVEH 5FDWB 3FQNA 1CE6B 3CXDH 4HLZH 4MNHB 1J0KA 1VENA 3D2UB 4U2YA 1HHJB 1JYNA 1KOAA 3MJGX 2LU7A 4UQ3B 1CL7H 3FT4B 3X14B 4Z78B 3UTSD 1FL5B 4JO3H 1MJJA 2WZPD 5FA3A 2NLJA 5I74B 1YEGH 3RDTB 5BRZA 2AGJH 4IMLA 1CE1L 1WF5A 3WDIA 4AL8L 4HS8H 2FRGP 4NQDA 3PGFH 3JVGC 4KVCH 1WQVT 4JKLA 1PX3A 4K9EH 4M9OA 2HJFB 5HGBB 3BGAA 1QEWB 4JREC 3WHE1 4Y4HC 1RZ8A 2FIKA 2FO4A 1FZJB 1EMTH 4GG6E 5DQJA 2EDNA 4G8IB 5DRWB 5C92A 4Y4KA 1RUQH 2QHLA 2XTJE 5CHNA 3QUXD 5IG7B 4KI5F 2C3XA 2EKSA 5D2NB 4PREA 1S9YA 2UWEF 1NL0H 2D03H 5DJAA 1ZHKA 3MUHL 4PTTB 4X9GA 5HYQB 3HE6D 2ZJSH 3GUTA 5DZLA 4EBQL 5JTWA 3RWJB 1MOEA 1E4JA 4UT6H 2Z31D 4JAMA 2R56L 3T2PA 4S0SD 1FGVL 1RI8A 3CSBA 2G9HB 1UVQB 3WUZA 1MCWM 2R29L 5CSZA 3SGEI 3ZT7A 2AEPL 4ZPTB 5GJSH 5BV7L 4UIMB 2AJVL 1AGFB 2OXHA 3H9ZA 2X5PA 4P2RA 1DJSA 5FAAA 2CGRH 1G6VK 1LO4L 2V5MA 3MLVH 2FH6A 1CFSA 1YJDH 3PQYE 4UBDC 5I30H 5HY9A 3FQUB 3V6OE 1G7JB 1U2CA 2XY2A 1U91B 4YHZL 3LEVH 3I85A 5GSRB 2G60L 3VMNA 4XPHH 5C0RH 5EH1A 3RQ3A 1Z9MA 4N8VA 2UY6A 3BPNC 1QZ1A 1OWWA 3S5LA 5I0ZA 15C8H 3QIBC 4HF5L 1QBMH 5CWSA 3AAZA 4JHAH 1G0DA 2GJZB 4D0CB 3SDYH 5HBBA 4P9HL 5D7JD 3DO3A 3OJ2C 1TZHB 2GUOA 4XBGB 1FORH 5C08E 1BLNA 2XWJA 3ZDXF 1MRDL 2GSGA 1OSPL 3QEQB 3QAZB 3E2HC 4CMMB 4AT6A 3KAAA 5ESQB 3RNKA 5IHUH 4UUJA 3GRWH 5EC1A 2KPNA 1F11B 1YY9D 1U8JB 4CAGA 1PZ5A 1JHLL 5A16B 3MRFB 3U1SH 1T83A 3MXWL 4JY5H 4Z7VA 1N64L 4RZCB 1K5NA 4RMVA 1YPZF 4FZEH 4BZ2H 5DVOA 1OB1B 1IFHH 4TNWK 3S4SG 3S3PA 4NYLB 4Z76A 5J13C 2Y06L 4YBLC 1KB9J 5TPWL 5CEXB 4N0CD 1KFAL 4NRYB 5CZXC 3REVB 3P4OA 5ACZA 1ZXQA 5DMIH 1A3RH 4PV8B 2DI8A 1B3JA 3CZFA 3HE7C 5JOPE 2WIIB 5HHVL 4MD5B 3NCMA 5JXED 5KW9H 2FEEL 1N5AA 3KVQA 3O2WH 4BM7A 4UT7H 1IGJB 5CZVH 5A43C 4JFYA 2P8LA 5ALBH 3BKCH 3WN5C 1MCIA 1U8OA 4LPYA 3GB7B 1G7MA 1L6ZA 1EJ6A 1P53A 3O6ML 5JR1H 5DJCB 3QULB 3UYPA 4XP4L 3HUJF 4ZO6A 4YO0B 3KPSA 1RURL 1OP3K 1CFBA 3FO0H 5EBGA 3U30C 5BZDA 1X6LA 3U79A 4NJAH 1ZHBB 3MRHB 4GUPA 4R4FH 3V4VL 1YMHB 1IZJA 1U8QA 2ZUQB 3D9AH 1YA5A 5HHQA 3ZYZA 2I5YH 3B8YA 3MYZA 3BEVB 5E94B 1EBAA 1EUTA 3O6FB 3C60B 4JFDA 5E2JA 5EOQL 4P9ML 4X9HA 3SDAC 4OZ4A 4M7JH 1WC7A 5D1ZC 3QWRD 4AK1A 5DWUH 4HZLA 3NABL 5ACLA 5KSAA 3MLUH 4X99A 2PO6C 1RUPL 2EO1A 4P5MB 1XH3B 4Y8DC 3WIHH 2YK1H 3CCHB 1IT9H 3T77A 3LN4A 3QH3B 1LO0H 2DQTL 3NFPB 1FRGL 4XP9H 4LHUD 1BQSA 4M02A 1G84A 2PYEA 3QZWB 1Y6KR 5KSVA 1HEZB 2X4PA 5F8QC 2OL3H 1JGVL 5FECB 2AV1B 3RUGB 3PF2A 3VXNA 4PJ5B 1C7TA 4QTHB 5GGRB 5ISZA 3FHQA 4OKVA 2F19H 3CSGA 3MJ9A 2DLIA 1IC4L 5IB1A 4FFZH 3KDMA 3MO1B 1CU4L 3GO1L 3RFZC 4HIXH 4MA1C 2CD0A 4KY1L 4CUCA 2V2TB 5EO9A 3LPGA 4NWUH 2D7NA 2EIEA 3IU4L 5JMOC 4RFEA 5E4EC 3MGOA 3V5KB 3QFJB 5DJ0B 3WMSA 4M4RA 3OJVC 2DN7A 5MEPA 4ZXBA 4PRNB 1TFHA 3L3GA 5DEGB 4K7PX 3BWAA 1P9MA 1ZWIB 4CNIA 2DWEA 5A2JH 1CGSH 4WV1B 3B9EA 3BZ4B 2Z91A 3D39A 3PNWA 3HRZA 3RBGA 1BZ9A 4OM0L 3Q6GL 2APXA 4X4YA 3O9WC 5DQ9A 2ADFH 3X13A 4KI1A 2NY1B 5FYLL 4XNXL 3RVXC 1CWVA 35C8H 5GS2H 1EEZA 4JY4A 3JWNC 1VEOA 4O58H 4I18B 3UJTH 2NY6D 2JCCB 1L7IH 2EC8A 3QJFB 4M48H 3SE3A 3KPQB 4MNQE 4U05A 1K3ZA 3D18A 5HVWA 2HLFD 3GSQB 4HWUA 3K46A 4Z7QE 5JORB 4Y4FC 3WLBB 3NTCH 4A2LA 4P3WA 2IQAB 1KTKE 1W72L 3FB5B 1J0JA 3MCLL 4ZS7L 3WFBL 3LS5L 4LLQA 4HHAB 4CL7A 4HGKC 3GI9H 4R90L 2VQUA 3WV0A 5HGHA 1NH6A 3SO3C 2RHEA 2HTLC 3H7BA 1DBBH 4ZAKD 3AMLA 4AY0A 5DC0A 4RA0C 4QRPD 3T0DA 2EDWA 2C3GA 3MLXH 1DN0A 1Q9KA 1Z9OA 3I02B 5EU4B 4DKEH 4XC1L 4JDTL 4Z7VF 1XCTA 2OTWB 1C5CH 1G6RH 3W39B 1MEXH 3ARTA 5F7DA 3TPUA 5C0IB 4JJHA 5GGUB 2BY2A 1DQML 3BT2L 3FT2B 5C7XH 4U1GC 4GRLA 3QNXB 2W0FA 3V0WH 4FFYH 4F37F 5E6IA 2UZYB 5GRYA 4U0QB 4P4KD 4L3CA 5GRUH 5IUSA 4HPYH 4N5UA 3O11A 4ZOCA 4LEXL 5F7MC 1YYLH 4MCZA 3TIDA 1S7SB 5DJDA 4IJ3B 5F70A 2DS4A 3BAEL 4LLWB 1I3UA 2PR4L 1AHWB 1A8JH 1RZFL 5I8EB 5GRVL 5E1AA 1KPVB 3FMGH 3MACL 3P0VL 5D1XA 1PDKA 1D5BB 2CKBB 3VD9A 2MCG1 5CJ8A 3HR6A 1XF3B 2GIYA 3U0WH 1CICD 1EJOL 5T3XH 3VWJD 1JWUB 3MUGB 4NO2A 4TTDC 1JPTH 1U3HC 3DVNB 4KROC 4LLAA 4OZGE 3U9UB 4JM2D 3PGDA 4EDWH 2YD7A 5EUKB 1UWXH 1EEUA 1MCLA 1T2JA 4EXPX 4HWEL 1F4HA 3ULVF 1CG9A 4NNYA 1CFNA 2AS5M 2I60H 5IJVB 4X7TB 2CDEA 1HSBA 4C59B 4QOKB 4M6NL 1X5GA 2FX9L 3PGCA 3H0TB 5I1DB 1FLRL 3UAJC 1F42A 3CNKA 4C4KO 1AFVH 3Q3GB 2F58H 5IEHA 4AQOA 3U4BH 4H1LG 2AJZB 1MWAH 1C7SA 5EOCJ 4FS0A 4PJCE 1L0QA 4U0RB 4JHWH 3FQWB 1JNNL 3M17A 5EU6E 1EHLL 3GIVB 1W8OA 4FQXC 3KR3L 1J0HA 1R3IL 2H9GB 4JCLA 4AEEA 5FHAH 4D94A 3IF1B 3BEWB 4JGJA 1NBVH 3QXDB 5E56A 1D5ZB 1VFAB 4HGWB 1HHGA 3QCTL 2JELH 1N2RB 4HK0B 4K2UH 1GXEA 4I5BB 4JPWL 3E8UH 1IC5H 1KCRH 1YDPB 1R3LB 3P0GB 5DFVC 1FNHA 4KV5E 1XR8B 1I8LC 4FTVE 4LCCA 3V7AE 1CDUA 4AYFA 1KIQB 4ONFH 4WWKD 3W0WD 4OSUL 4M93B 1MHPH 3HC4H 4R0LC 3SDDB 3V0VA 2VKWA 2ZCKL 3CH1A 5FOBA 4K7PH 2XTJC 4OZIB 3SKOB 1CLOH 5B21A 3TN0B 4PJXE 4EN3C 1MREL 1WBZA 1XEDA 2X7LB 5KANG 5FGSA 3C6SA 4ORGB 3O0RL 1R6VA 1S3KL 5MERB 5IB4B 1RZJH 4L4TB 3W2DL 5E8OA 4NQSA 2AEIT 1WFNA 2VNCA 4DUXA 1XZ0B 3DUUA 3PL6C 4PRHD 4YFLI 5IMLB 5F7FA 3IDXH 1YY8B 5D2LB 4PGCB 3CLFH 4DKFH 3ZDYE 1FG2A 4P2QD 2XPGB 1PZUB 1OP3H 5ALCL 2Q8AH 3V6OC 4D8PA 1FAKT 4XBPB 5C09E 5DZOA 1GGTA 4ELMA 2YPVL 2ICWB 4N9OB 3WFDH 1IKFH 4BSWB 3GSNA 3FO9B 4URTB 1I7UB 3INUL 5C2UB 4XCYB 1FZMB 5GRXG 1KCSH 4K9EC 1CDBA 3ARFA 3BMVA 4KJYB 1EZVX 1DQJA 1K8IB 3FAWA 3AU1A 3VFMB 3U4EA 4L8SB 5TQ0H 4X6FA 3HPJA 1A6VL 3GMMA 2NW3A 1NCCL 3AB0B 4O2EB 1JN6A 1J8HA 2DQHH 3UZEA 5JMRA 1OAXL 2YEZB 4PYHA 4Y5XB 2R39A 4PJ9C 3ARXA 3PABB 1HH6A 3BOVA 3GMLA 1C16B 4Y1AB 1HH9B 4N1HB 3EDEA 2J8UB 5I75C 3IAGC 3A67L 3L1OL 3P0YH 4IHOB 1S9KC 3DMMA 3OAZK 3KXFA 3VGAC 1QSED 1SBSH 1T0NB 3OBAA 5CP3A 1E6OH 3GJEB 4NBYB 4PRIB 5IBUG 1MJ7L 3BP5A 2IGFL 4MDJA 2Y5TA 3VFRA 1NFIB 2Q3ZA 4FZ8L 3UTPE 4U1LB 1INQA 3O4LE 2Z0BA 3P9MB 5IBLD 4LAQL 2VR4A 3WL9B 1NMBH 5I16B 1NDMA 2P5EE 3D3VB 2IAMA 4MMXC 4PJFA 5J11C 1KIRB 2XOTA 1BM3H 2AJYH 5TDPB 2BNQB 2R4SL 1QYGL 3G6JA 5I19H 1I85A 2VLJB 1DBJH 1ZT4B 1Q0XL 3FB7B 1J86A 2ZCLL 4OZHA 5F7HA 1A0QH 2JK5B 4FRWA 1MJUL 1KEML 2X4SB 3BE1H 3SGJC 3AM8C 3MMEA 2BFVH 4Z18A 1BWWA 5ANMA 4RA3A 2BCKA 4I9WD 4O5LL 4PJEA 5ITBH 4MQXD 4Q6IB 2VITB 2MPAH 2X4NA 4DEPB 4JKMA 1HZHH 5DD1L 4EEEA 4XZUB 2DKUA 5AG8A 4KRPB 2ITDA 2DQJL 1AXTH 5BVJB 2B5IB 3CFEA 5GS0H 3DGGB 4M61B 2W60A 1AXSA 1TCRB 5BVPL 1FO0L 2EDLA 2NY2D 1V3MA 3BSZH 3EYVB 2AK4E 1BQLL 1I9RL 4Y19D 4OD3H 5DT1L 4MAYA 3UC0L 3MRBA 1I3RB 5D70L 3CFCH 2G75A 4NN7B 3NAAH 1WEJH 5F7NC 1D5XB 3EYSL 3VD7A 4RIRA 2R0KL 4H1LA 4LSUH 2X4OA 4HMDA 3LH2L 4PUBL 5EO1B 4I8DA 3UYRL 5IQ9B 2ZG2A 5KSBA 4JGUA 4CADB 1OTTD 1SJEB 4GW5A 4MVBD 1E27A 5GHWL 4CVXB 5T1DL 2IWGA 1TZGL 1U58A 4KDTA 5I1IL 1QSVA 3TA3C 5DHYB 5CIPA 1MI5D 4MXVF 2BOCA 1KJ2A 3VXUE 3I3DA 4UINH 3O3UN 2FGZA 4WFED 4G7VL 4J4PA 2VQTA 4DGYL 4KK5D 4S11A 4XH2B 3RVTC 3F6IA 1AGBA 4LGSB 3TT3L 1KB5L 3GMOB 3KPTA 4IRSC 4L3EA 5I6XB 4IOFC 1F4AA 2I9LA 4YDLC 1J88A 1Q94A 2J7LA 4I0PC 1FL6B 5TE6H 1WV7T 4TUOB 3MXVL 1EGJL 5L2KD 1NC4B 4OBSA 1I1AC 1TQCC 1BZ7B 4PRDB 4D9LH 1HOCB 2CMRH 4EKXA 5KTEH 1YEIH 3C9NB 5FKAB 1A4KA 1LWRA 1S78C 3R1GL 1DE4A 1AQKL 1WVZA 5I66B 4NQTA 4ELMF 1K4DB 3PWPD 1M4KA 3QRGH 4HH8A 3X12B 3MV8A 3PIQA 3QDJE 1LE9A 3MBXL 3DJ9A 2IG2L 3O3AA 4FQLH 5IVZB 4J3TA 1CD9B 4KRNA 2BVUA 4ETYA 4MS8D 4L1HA 1DN2A 1IQWH 1DLHB 1ZANL 2OI9B 1NUGA 4IMKC 1OF2B 3HG1A 4Y2OA 4EQ3A 5D6DA 3QDMD 5EPMB 3ULUF 3QWQB 4YXLH 3NFNB 3IJSB 5DURB 3NA9H 3F5WB 3V6ZA 1IEBB 1M7DB 1WWCA 2V6HA 4P2OB 4JRXB 1RIHL 1BWMA 1JGUL 4MJIE 3D69B 1MQKL 3ARDC 5F88A 5IOPA 1VFBA 1LEGA 3ZKQD 4NHCL 2HJKA 2Q76A 4ZFGH 2OX5A 4RAVA 2LTQC 5D7IA 3P4NB 2DD8L 3OZ9L 5ESAB 3EHBD 4OGAC 4TYUA 4V1DD 5D7LD 3WE6B 1QRNE 1W0WA 3MV9E 3ARBD 1TNNA 3LS4H 3P9LB 4YK4B 4PRPB 4R4NC 1WFTA 2W1NA 1AP2A 3V5DA 1B2WL 1MIML 4JG1L 4PJFF 2WWKT 3BH9A 1A6WL 5DSCA 5FGRA 1F2QA 1A1OB 32C2A 4JRWA 4Y2DD 2BP3A 3P77B 4G6FD 2UY7A 1ZT7B 5LAXA 3G5VB 5KVEL 3ISWA 3G6JF 2P46B 2A6KA 3SPVA 3HB3C 5EO0B 1CFTB 5FF6A 4OZHF 4LVHB 5EORL 4PJDB 4P5TD 3HZYB 3HMXH 4PJHA 3FQXA 3BP6B 4OGYH 3VW3H 3MNVA 1CL7L 4JFQA 2EDTA 5KG9B 5LXGH 3QUKB 4PJEF 2X1QA 4OF6A 4P46B 3U83A 4OIAA 1SYVB 4F80A 1YEGL 3N1QC 1MJ8H 2AGJL 4W6XB 2KUTA 1UYWH 1I1CA 4PG2A 2A38A 3LKSB 3PGFL 3MJ7B 3BISA 5BXFA 1CFQA 8FABB 1IAIL 5EBWB 2KZ1B 1C5BH 1WIPA 3JV4A 1IARB 1CL7I 5SV4A 3UTTB 1U8PB 2YUVA 4Z0XA 5J7CC 1Y0LA 2IPUK 1RUQL 2C4FU 5TJWK 1BBJA 4PRAB 1NBZB 1JK8B 2O26U 5T1LA 4LARH 5C0FA 1CXKA 3U9PL 5MHSE 4MXQD 4LCIH 5KBNC 4LCUA 5E6YA 1AKJA 3IDJA 3LKOA 4WJ5A 3BIAX 1U92B 5I8KL 3PHSA 5B8CA 3DRQA 4XRCA 3T0VA 4OFKA 1TQBC 1MNUH 2VLRA 4HJJL 4ZFFB 5ICZA 5KSBF 2UYLB 4NQCB 5FUZH 4A6YH 2VZUA 3MGTA 4JZNA 4HJGB 4HIEB 1QPPA 1KXVC 3K80A 5HD8C 3F12A 3O8XA 4XHJD 12E8L 2FJHA 3BX7C 3OGCB 4EI5D 2E7LC 5D7KD 1A3QA 3C6LA 4G8GA 1P5VA 3GHBH 3BN9D 4HAGA 1YJDL 1JZ3A 1OARH 5GGSA 3MRMA 3QIUD 1FV1A 4WFGD 5DJXA 2UWEB 3JZ7A 2VE6B 4FABH 3WFEH 3QXTA 1C12B 4XVSH 3UTQB 5FYLD 2VH5H 1QSFA 2G2RA 3VFWB 1FCCA 4XPHL 1KIPA 1H15B 3BZFA 3KNBA 4RSVA 2F15A 2EE6A 4XCEA 3S98A 3VXRB 4MQ7B 1QBML 1GGUA 1YUHB 1UT9A 4DQOL 4RAUB 1WK0A 2XN9A 4GKSB 2YSSB 5IKCB 4OLZL 3QI9C 4MA7L 4GKNB 4PJBA 1FORL 2HT4C 1OTUD 3VFVB 3QSKB 1EVUA 3TJEL 2HFFB 3SCMB 4MJ6B 2X4QA 3G04A 3ABZA 4UV4L 3L7FB 4HKJB 2YA2A 1GJIA 3VGFA 5EZJA 3IFOA 4M43H 2PTTB 3E6HA 5FO8B 2L7JA 4OV5A 4WHDA 1AO7E 3U1SL 3LKPA 1HINH 4F37K 4L4VE 3WO4B 4J2XA 1F3JB 3FONA 3KPNA 2W0LA 4JY5L 1YQVH 1NCAL 2RGSA 4G9FE 3DARA 4NSKA 1EO8L 1NGPH 4F15C 5I1JL 2IH3A 3H9YA 1QO3B 2GKIA 3MRRA 1H5BC 1A3RL 5C0BA 3KGRA 4CJ0A 3VXSD 1CLZH 3RGVA 1HIMH 4YUEH 4FXKA 4WI7A 3T0EB 4K3HA 3CDCA 4UNUA 1OPGL 1UG9A 5C0CE 2JF1A 1HYSC 3MODL 5KW9L 2JJTC 1OGAD 5E99H 2C1PA 2F54A 3O2WL 4MA3B 4KKLD 5A2KH 4UT7L 1W0VA 4Y5VB 4Z7UE 4TQEH 4WU7A 1FSKB 4LOUC 4TN9A 3SOBH 3HR5B 3W82A 4I2XB 5D7IF 3DLQR 4JLRA 2VTFA 4M7ZC 5JR1L 3RZCA 1FNGB 3ZYJA 2CO6B 4M5YH 2AJUH 3MGAA 1YPZB 2ZUYA 3VXOA 2KDGA 3CFDA 4G6AC 3FO0L 1KLGB 1RZJC 4Q0XH 2EH7L 1S7RA 4P5KA 2JIXA 3TVMD 2BK8A 3SE8L 4R4FL 1KCUH 3D9AL 2ZG1A 5EUOA 1P7QD 4KK9D 3B9KB 3I6GA 5FYKH 4ZFOB 2EC9T 4YEFA 4I13B 1QKZH 4N0UA 1N8ZA 4NN6B 3G5ZB 4HEME 5CUSH 1T2QL 3QIBD 4NKDB 4HUUB 5T1KD 3S37X 3FO1A 3FFCD 2EDRA 2CR3A 1U6AH 4S10A 4PJHF 4TSBH 5GGRY 5FB8B 1CXHA 3D85D 5C0AD 3RWFB 5IIEB 3CFJB 3HUJB 3WIHL 4PJAA 2ZWLT 4MHHI 3OKNA 5DA0B 3RVVD 4NFDA 5BZWA 4G8EB 3L3OB 1A2YA 4WY7L 4XP9L 1HYRC 4QY8B 2VIRA 3MRIB 3RWGA 1O7SA 3FQNB 3R06A 2D0FA 3UZVB 5CZXD 4YWGL 2D9CA 1WCBA 1LP9E 1KELH 3EYUH 2WLYA 4PGEA 3HE7D 2HKFH 4QTIL 3IDIA 2HFGL 4NFCA 4E41D 5HHOA 4RISH 2F53A 2BDNL 1MJJB 5FA3B 2NLJB 2VDKH 5CKAA 5BRZB 4IMLB 2VDMH 3OKMA 5CJQH 1GZPA 3G9VA 4G5ZL 4NQDB 3U6RA 4KQ3H 1FFPB 4HIXL 4R2GD 4X5LA 4KVNH 2AJXH 1FVEA 2IALA 5IW1B 4U6VL 3OV6A 2CPCA 1RZ8B 2PYFA 2RJMA 3GKWH 2XT1B 2FO4B 3VXMD 4QLRA 1YMMD 5DQJB 1FH5H 4WHYG 5I8OH 4U1JA 4Y4KB 1IAMA 1H3VA 5DQDH 3FFDB 1OAKL 2EKSB 5SWSA 4PREB 1S9YB 4Z7OE 1NC2A 2EEBA 2ADFL 5DJAB 1ZHKB 2NY0C 4H5SA 3GUTB 4WUUD 4O00A 3NOIA 4O58L 1KCVH 3UJTL 2BVEA 3E1F1 4JAMB 3H9SE 1BD2A 2BVQB 2W9EH 4KKCC 4WEBH 5D1ZD 1D5MA 5HYJE 1A7RL 1U8MA 4M1CC 5CSZB 3BQUC 4X7FC 3TBWA 2NY5L 3OKLA 3NZ8B 1O0VA 1REIA 5J1AA 5GS0C 4PJBF 2Q6WA 5D72H 3O81A 4P2RB 3QO1A 4JVUA 4HBCH 4HFUL 4F7MA 2NY4C 3KPLA 4CN4A 3QUZA 1J0ZA 2R2CA 4RMSA 2ITCA 4Z77A 1CFSB 3I2CH 4J3WA 4IM8A 3L5XL 1KBGH 4BQ8A 4HUVA 1DBBL 4F7CA 2DYPD 3SDCA 4KMTL 1BAFH 4N8VB 1IAOA 3TZVD 1OD9A 3ARUA 3ZLQC 1U8IA 2B1AH 4HX1A 3S5LB 2JB5L 2PN5A 3LIZH 2JB6A 3MLZH 2VDLH 5CWSB 3V0WL 4J23A 3AAZB 4FFYL 5EIVA 3IGAA 2K7QA 1NLBL 5GRUL 4LHUG 2AERT 4K7PY 4KDWA 5F9OH 4APQA 2GUOB 4KHXH 2I9TA 1TVHA 1YYLL 2ATPA 1BLNB 2XWJB 3DI3B 2GSGB 4ODXB 2X9WA 4UILH 4B5EA 1MF2L 3UTSA 4AMKL 4AT6B 3RNKB 4F9PC 4UUJB 5EC1B 2IMNA 5TDNA 2E5EA 1DBMH 4X98A 5EFIA 1CR9H 1PZ5B 4YPGA 3FMGL 4PFEA 1OAYH 3IDYB 5DEFA 3FO2A 4M3JA 5T3ZH 2ZKHL 3WNKA 4Z7VB 1BX2B 1NAMA 5T3XL 3ZYOA 1NBYA 1K5NB 1FNLA 4RGMC 4JFEE 3S37H 1JPTL 4XTRD 4Z76B 4YXKL 5ESVA 5M7QA 1ZS8A 1WSST 3P4OB 4UOW0 5ACZB 4EDWL 5AZEH 2XZAL 3CZFB 3M8OL 1FIGL 1PG7L 2D7OA 5EUOF 5D1QD 2VDQL 4I3RL 5GGVH 4HD9A 3D5OF 1N0LA 1N5AB 1FAIL 4QRRE 5GS3A 1JYWA 4DJMA 4HC1A 2DQUH 5SX4H 2P8LB 2DQEL 4Y4FD 2E7CA 4HS3A 4YIQA 5EU7E 3AGVA 1U8OB 4UAOC 1AC0A 2R9HC 3EJJX 3L5HA 1FP5A 1SM3H 2R69L 4PJAF 3KPSB 3TH3T 2YD5A 3NCYP 4NOFA 3AREC 5BZDB 1T66D 1BF8A 4BQ6A 3NCEB 4QKXB 5FHAL 2WQRA 4GUPB 4LQFL 1U8QB 4PJ8D 1QLEH 1NGXA 4FP8H 1XGYL 4WI2A 4JPKH 1C1EL 1YN6A 4JFDB 4K2UL 4I3GA 2I26N 1FPTH 5ABDE 4OZ4B 1E0OB 3E8UL 1IC5L 1X4ZA 5T3ZE 4GSDL 4HZLB 4BH7A 1HQ4A 5KSAB 4BSVA 4X99B 1B4JL 1MHPL 3HC4L 1ZVSA 3EJZC 4X0KA 3BP7A 1CLOL 2GW5A 4YDVA 5T1MA 3T77B 3JSSA 3WKMH 1DQQA 1JPSL 3LN4B 3LKRA 2AJ3A 2OJEA 1A22B 5GS1C 4K3DH 2B4CH 2NXYB 4K8RL 3HNSH 2YPKA 2PYEB 5DXWA 1JJUA 1D3CA 2EZ0D 4TTDD 1NANI 5KSVB 4OLYL 4HULB 2X4PB 2DLEA 4JHBA 5L6YL 1UJTA 3CVHA 1N5YL 5SWZD 5LWYL 2VXSL 5TF1H 3VXNB 1XF1A 1ERNA 1JF1A 5BCAA 4GS7B 5ISZB 3ARGD 2QHRH 2ICEA 3CLFL 1NUFA 4OKVB 1TIUA 5BO1L 5D8JH 1D9KD 4ODBD 5KZCB 3U82B 5IB1B 3MBED 1CD0A 3KDMB 2DQFA 3CX2A 5JXEA 4GAYA 4NM8H 2HLAA 1KPRA 3VRIA 5DD3H 3WFDL 1IKFL 2WUBH 2P8MA 5EO9B 1QQDA 4H8WC 3B9AA 4RFEB 1Q9WA 3MGOB 1NCDL 2A6DA 1BFOA 4FQHA 3NH7L 5MEPB 4ZXBB 2D4FA 3L3GB 4ZODA 1IC7L 1N3NA 1RJZA 3BWAB 3GBLA 2VN7A 4CNIB 2DWEB 4JJ5A 5BW7A 3CIQA 2Z91B 3D39B 1J1XH 3PNWB 3HRZB 1BZ9B 1MCNA 4X4YB 3DUHA 5DQ9B 1HWGB 2DQHL 3X13B 2R1WA 4GBXC 1CQKA 4Y0GA 1EEZB 1Y18A 4F2MA 5H2BA 2CK2A 4ZPVA 4ZTPH 1R0AH 3RIAF 1T5WA 1DANU 1IJ9A 3J8F7 5HI4C 1CT8B 3P0YL 4GW4A 4M7KL 5I9QC 3L5IA 1EH9A 3QWRA 3RWIA 4FFWD 1DEEA 4FQ2L 1D6VH 4ETQA 2XTJD 1I7ZA 5IB3A 2GQHA 3IS1X 2BNUA 2WV3A 5EZIH 4LLQB 5ADPH 2COQA 2WSKA 4X6EA 4EN3D 3EBAA 1U8LA 1FNEA 5HGHB 1NMBL 5I1EL 4CMHC 2AV7A 1F4YH 2FBOJ 4XPGL 4YX2H 1NCWH 4NNPL 1DN0B 1Q9KB 2AJYL 3OSKA 1LDPH 3RX7A 4JFFD 1F8TL 4LK4A 2Y72A 5F7DB 5C07D 3TPUB 5CCKH 3KPRA 3PL6D 4OCSH 1BEYL 2NXZB 4GRLB 2W0FB 4X6DE 2Y1VA 3WXWH 2H32H 3N1PC 2BFVL 4H0IA 4L3CB 1L4IA 2ZPKH 3GIZH 1KTDA 2VXVH 4HXBH 3O11B 2GAZA 5ITBL 5F6IB 4E9LA 4MCZB 3TIDB 5DJDB 1FYTD 1IAKA 2ICWI 3OKDA 3FAXA 4UV7L 1NLDL 5E1AB 1AXTL 3VWKA 2VR5A 3LAFA 1NMAH 3S4SB 5D1XB 2FATH 5JIKA 3WS3A 2DICA 2XRAL 3BPLC 1LD9A 5L0QB 4JGMA 4BKLA 3QQ3A 5HI5C 4NO2B 4O02L 3SDXA 3S97C 1AD9A 1VFUA 1GC1L 2RCSH 1U8HA 3PGDB 5EZOH 1A7PH 2FSEA 3S96A 2NYYC 3CFCL 2Y7QB 4YFEA 1CG9B 1A9EA 3KYOA 4NNYB 1CFNB 2X4TA 3QUYC 1WEJL 3CLEH 2CDEB 4NM4L 3MCKA 1U8KB 1H3TA 1HSBB 4LSUL 1MAKA 3KLDA 4OFVA 3PGCB 1YEJL 3U46A 4Y5YA 4L8CA 4ZUUA 2FNBA 5IEHB 3BD5A 5MP6H 3D2UD 1VHPA 4U1HA 1T7VA 4BK5A 2V5TA 3O4LB 3M17B 4JFOA 5H37G 1G7LA 1P4BH 5MI0C 4KUCF 2H6PA 1T1ZA 4UINL 5E24E 3UJIL 1TPXB 1TENA 3N9GH 2W07A 4BZ1H 1UZ8A 1P4LA 5DUPL 2Q86A 5BS0A 4XPAL 3WSQH 1T04A 5H94A 1I75A 4LLYA 1BBDH 1HHGB 3C5ZA 4U7MA 4NNXA 2ORBL 4J3OC 2E7MA 1Z0NA 2QQLH 2HG5A 2DQIH 1MHHB 3PDDA 1EV2E 3V5HA 5JW5A 1S9VA 4LCCB 2VERN 3NPSB 3V0VB 5L2JA 4P4KA 3CH1B 5FOBB 1YEIL 3DNKA 3C5JA 4UTAH 4QXUL 3ZZ1A 3VI4E 1LO5A 4NOBA 1WBZB 5EA0H 4U1MA 3HI6L 3QQ9D 5JUEH 4NZJA 4D9RE 3C6SB 4WVRA 3QT2A 1JFQL 1P69B 4FQLL 5LBSH 1HCVA 3KJ6L 1IGIL 1UM4L 1T2XA 4HK3J 1WJ3A 3NGBC 1NFDA 1CICA 3VWJA 3X11A 5E8OB 3O6LH 4NQSB 1OCWH 3OMZA 3DUUB 1TTUA 2HFTA 1VFOA 5D71L 1BOGA 1E6JL 3SQOH 3NA9L 1OM3H 1FG2B 1GZQA 2Z8RA 3HFMH 3QXVA 5CFHA 4P23A 2AABH 2P4AB 4D8PB 4HXAL 1I1YA 5DJ6B 1HQRA 4ELMB 4NRXA 1NEZG 1S9WA 2KQNA 3GM0A 3GSNB 4MMZC 1DQDH 2ZUUA 4AEIL 2XQBH 1FDLL 1YEHH 1A1MA 3KPMA 5E7FA 2GCYA 5MENE 3ARFB 5LQBH 1DQJB 4OLXL 3AU1B 2W38A 3U4EB 3A6BH 3WUWA 5TH2A 4OLWL 4X6FB 3HPJB 4S1QH 1T3FA 4Q97A 2NW3B 3GMMB 3P40A 2VLLA 1JN6B 1J8HB 4NQED 2BHZA 1G9ML 2QADB 3X3FL 3WEXA 2BSTA 2A74A 3LHPH 3RBSA 1HH6B 5HJ3A 4I0PD 4U3CA 1SY6L 3GMLB 3HNTH 5AUMA 3RDTA 2E9WA 1QSZA 4HUXA 3WHXB 5K9KA 3DMMB 4WO4C 3HMXL 3KXFB 1OAUH 5JNYA 4QXTA 4OGYL 1NGWA 2EH8H 4RFOL 2V5YA 5GPRA 4LDLB 1CN4A 1E4KC 3BP5B 4LIQH 4MDJB 3KS0J 2Y5TB 5EU3A 3VFRB 1A6ZA 4XB8A 4WWKA 3FT3A 3W0WA 3PHOA 1MJ8L 5F9WC 1INQB 3RVWC 4OTXL 1UYWL 2HWZL 5GGQH 2DF3A 4G8IA 3NCJH 2IAMB 4XP6L 4PJFB 3T3PF 4U3XA 1ZGLM 3NIFF 4MNQD 3HZKA 3FN9A 3ZKNC 1I9JH 3S34H 3G6JB 3SDXF 5EU7C 5F96H 1CF8H 5TE7L 4OZHB 4QRPE 4LCYA 4OGZA 3R0NA 4JE4B 5FV1L 1GVIA 4JR9L 1U93A 2EDOA 3CVIH 3MMEB 2V7HA 4LARL 3ULUH 5ANMB 1FCGA 2VAAA 1V3LA 2BCKB 2B2XL 5JW4N 2X4NB 3ET9F 1NKOA 3K8LA 4C4KT 2YR3A 1EEQA 1BFVL 2V9RA 3PWVA 5A1AA 5CP7A 5HDOA 4YXHH 4MAUH 2ITDB 4TSAH 1SEBA 3C8HA 4XVUD 1RUKL 3C60D 3T1FA 1MNUL 2MMXA 3CFEB 1LE5A 2JJSC 4JQVA 2W60B 1AXSB 4OGAD 4OQ1A 3KYKL 5GSRA 3KYMA 2OTUA 1E4XH 5HYSA 1UEYA 2EE9A 4PLNC 3W11D 2MKLC 4R4ND 5KS9E 4MJ5A 4MAYB 3GHBL 4YHPA 3MRBB 5IHZB 1A3LL 1PG7W 3D25A 2G75B 3WD5H 5B4MC 4M5ZH 2BRQA 3HTLX 3WS6C 4FABL 4NKIH 1B4RA 4XVSL 3ULSA 1R5IA 1OOAA 4RIRB 2NY3C 2FECL 2VH5L 5D7SH 5GS2D 4H1LB 3GSRA 4X7CC 3O2DL 3QUMB 2X4OB 3FZUC 5EG6C 5I1HL 3O4OB 3ZL4H 2O61A 4PY7A 4L9LC 5EOCH 3K3QA 1UM5H 4QGYA 3Q2CA 2IFFH 3IJYA 5KSBB 1MUJA 3O3EA 4GW5B 2DDQH 1E27B 1U8JA 2NX5E 3TBYA 3CX5K 4POZD 1NGZA 1U58B 1NUDA 4HIJA 4LCWA 4C54A 1JYVA 4EVNB 4P2CG 5CIPB 2OJZH 1U8NA 1YNKH 1UB5A 1HCFX 2BOCB 2VZVA 4ALAL 1KJ2B 4PTUA 4RZCA 4YE4L 2FECI 2V7NA 2J5LC 4NYLA 4JN2A 1WIOA 3G5XA 3JV5A 4WHCA 4M43L 4POUB 1AGBB 3BXNA 3PWNA 4XNZB 1HINL 2X70A 1TZIA 4L3EB 1UWGH 1YQVL 1ORSA 2I9LB 1NFDF 1Q94B 4NFBA 3HNVL 2PCPA 4TNVF 4KAQH 1IGJA 2WMPA 2EYRA 3TWCH 5EU6D 1FVDA 1CLZL 4LSSH 5E7BA 4YUEL 5E2TH 2G5RA 4LGRB 4X6BA 4G8FA 2N1KA 1TTFA 1A4KB 3RY6A 5IESL 4S1RH 2WP3O 1DE4B 2V5RA 3FRPG 2ZNXA 4TQEL 4WI3A 1U95B 3MV8B 2DBJA 3PIQB 3VDAA 2B20A 3QUXC 3EFFA 3O3AB 1M1SA 1H8NA 1VGEH 2B4CC 4F58H 1KSRA 3NIGE 5T3XD 4FTVD 3HE6C 5CIPH 2M2DA 3HG1B 3O6FA 2Z31C 1KCUL 2YPLE 1BJ1J 4UNTA 3EO9L 4F7TA 1UKQA 4JFXB 3V6ZB 2WBJA 5HSFA 3EO0A 5FYKL 1YEFL 5DR5H 5F1NA 5JPMA 5GGTH 4V2BA 3MLTA 4P5MA 4PRHE 4ZOEA 5F88B 5IOPB 1VFBB 1LEGB 4QRUA 2HJKB 1GCFA 4UTBH 1KLFA 4WW2C 4RAVB 1UWEL 3BGFB 4P2QE 5D7IB 2X05A 1IGMH 2O5ZH 4QCIB 3VI3F 5CJOL 2AP2A 5DUML 4HH9A 1RJYA 1W0WB 1MFCL 1FE8H 1JMZA 4PBWD 1JI2A 1AP2B 2IH1A 3V5DB 3T4YA 3BH9B 5DSCB 3BRGC 1F5WA 4GLRH 32C2B 3DV6A 4LRNL 4OQTA 5C09D 3QPQC 5LAXB 1JHTA 3SE9L 5IBUB 4BQ9A 4ZSOA 5B39A 1A7NH 2VLKE 2A6KB 1S7QA 3SPVB 5FF6B 4CVZA 1CE1H 4NQXB 4HUWA 1Z5LA 1KELL 3G6DL 4PJHB 3FQXB 3MNVB 4JFQB 2YA1A 1ZGLB 1HYSD 3T08A 1OT1A 4AH2A 3V5KA 2VDKL 3QFJA 4ZFOL 5F1SA 1QSEE 2VDML 4BUHA 2H2SC 3SGEH 3WJLC 1RY7B 5DEGA 4I4WA 2W59A 4X9IA 4KQ3L 3WNLA 4RMQA 4KVNL 1PBYA 5BXFB 1CFQB 4N1EA 5HTSA 3QJHA 5F89A 4I3SL 3PWPA 4K8RD 3FN0H 4YR6A 2VSDA 3JV4B 4PJ7E 3KWWA 4EBQH 4I18A 4Z0XB 1FH5L 5I8OL 2CRYA 3DRTA 1Y0LB 3KPQA 2R56H 4BQCA 1FGVH 5DQDL 1BBJB 2VL5A 3CMOL 5T1LB 5GGVY 1B6DA 4LGPB 2R29H 5C0FB 3TNNA 2AEPH 3WLBA 5BV7H 4LCUB 3IT8D 1AKJB 3IDJB 2AJVH 3LKOB 3RAJL 4WJ5B 4HCRA 4KKAD 3MRLA 3RGHA 1KCVL 5B8CB 3VXTA 1T7WA 1FFQA 3DRQB 2FBJH 4XRCB 4XXDB 1LO4H 2B0SH 4I9WE 4K07A 2VLRB 4FQ1L 5ICZB 5T5FL 4KH2A 4M7LL 3MGTB 4JZNB 4OIIH 4OZFA 5GSVA 3OR7B 2APWA 1GGBH 4YHZH 3V9FA 3PWLA 1FVCA 1FL3A 3F12B 1AJ7H 5IVXE 1G0XA 2FJHB 4MYWB 3C6LB 4G8GB 4V1DA 2ICWJ 3ZSTA 5C0ND 1T6VN 3RIAK 4XMKL 3MRMB 1NMCB 5GGSB 4HF5H 1FV1B 3TN0D 5DJXB 1BQHG 4I0CC 4YLQT 3Q48A 4DVRL 1LMKA 3RU8H 4Y19E 1QSFB 4P9HH 2G2RB 1XIWB 3GGWA 3IVKA 1KIPB 3TIEB 3EAKA 3BZFB 3KNBB 3STZA 5CS7A 4XCEB 4ORZC 3LIZL 3MLZL 2VDLL 4L4TD 3ME0A 5ILTL 1LK3L 5IJKC 2XN9B 2GJ6A 1QLRA 5BMFH 1JHLH 3QDAA 4LNVA 1XCQA 5F9OL 4PJBB 2DLHA 4J3VA 4KHXL 1DFBL 5E6IC 1TJIL 3MXWH 4Q2ZB 2VQ1A 1N64H 3BKML 4UILL 2UVFA 1QG3A 2X4QB 3G04B 3HKFA 3OHXA 1CR9L 1EDQA 2Y06H 4NPYB 2VN4A 5EZJB 5TPWH 3IFOB 1KFAH 2H2PC 5LG1A 2EE2A 3E6HB 4OV5B 1MI5E 4KJWD 1MSPA 3LKPB 4HPOH 1CFVL 2XZCL 1V7NH 3FONB 4MB3A 3KPNB 3DX6A 4WFEE 4X7TA 3QG7H 4F33A 1XGUA 5CINL 3UDWA 2Y4SA 5IFJA 4NSKB 1QVOA 2F5AL 5J6HA 1KG0A 4KTYA 4Y16C 2IH3B 3HZMA 3MRRB 1JRHH 5C0BB 1DVFA 1NDGA 2QQKH 3RGVB 5C3LD 3ZHKA 4FXKB 3OL2A 1PAMA 5F7EL 3SY0B 1FYHB 5JA9A 4PJIA 2C1PB 4XP4H 1L7TH 2F54B 5L2KE 3IDNA 1W0VB 2DQUL 4NO0A 4WU7B 3X3GL 4C57C 3PV6A 5A2FA 4KWUA 3BHBA 4YGAB 5GS0D 2ZUSA 3HI1B 3RZCB 4YDKL 1SM3L 2NZIA 3B8SA 4YHYC 4U1KA 1VFAA 2NY4D 3VXOB 3CFDB 4ODHH 4LEOA 5EOQH 2NY6C 4P9MH 1S7RB 4P5KB 2JIXB 4EI5A 1YEDA 3I75A 4XWGL 1KT2A 3T3MF 1R3LA 2ZUWA 3U7YH 3UROR 5EUOB 3DVGA 4FP8L 3I6GB 5SX4I 4JPKL 5JXAL 3DXAE 3QDME 4M00A 5ENWA 4N0UB 2RQ8A 1N8ZB 2OQJA 3QDJD 4YQXL 1YEEL 3FO1B 3FQTB 3QDGE 4EUPG 1II4E 1KENL 1UJ3C 2VLJD 43C9A 2Y6SC 4H25A 5JW4Q 4CU7A 1EFQA 1FRGH 4ZAKC 5ECJE 4ERSL 3IDUA 4PJAB 5LGKA 5KJRH 4LKCA 4QHMA 5I2IA 4NDMB 1A1NA 2IPTL 4MNGA 2CJUL 4CVUA 3OKNB 4JRYE 4JKPL 3WKML 3FOMA 4M8VA 3IDMA 1JGVH 3VGEA 3ZDZE 5D7LE 2B4CL 3JVGA 1A2YB 4ZTOH 4J3XA 4KRPD 3HNSL 4L29A 5E9DE 1X6NA 2VIRB 4Z7WE 3RWGB 2VOTA 5E4IA 4PGCA 1RAMA 4RWYH 3R06B 4MX7B 5C2BL 2Q20A 4Y4HA 5GZNC 1JWMA 2D0GA 1WCBB 5IBTH 4NN5C 5TF1L 4PGEB 3GO1H 3VH8G 3IDIB 5F44A 2C1OA 3KYNA 5HHOB 2F53B 4XBEL 5DGRA 3ULVL 1I8KA 3VXSA 1I7UA 3HAEG 5D8JL 3IU4H 5HDLA 3FQRA 1U9KA 2EXWC 3LPWA 2OMNA 4JO1H 1GZPB 3RVUC 5INCA 2BY1A 2ED9A 4DTGL 1OGAA 4OI8A 3VFMA 3U6RB 1F3RB 4L8SA 1KXQE 5I71B 5DD3L 5DHVH 1PKQA 2WUBL 1FVEB 4CU6A 4JM2C 2IALB 5I1KH 3Q6GH 5ETUA 3B2VH 4CRPA 4JO2L 1MHCA 5FYLH 4XNXH 3WJJC 2PYFB 4XNMA 5KAQG 3ARED 4XGZB 3PABA 4U1JB 1KPUA 4Z9KB 3OJMB 4PV9A 5SWSB 1T20A 4IIQC 3RWDB 1NC2B 2ESVA 2ADIA 2X42A 3TJHC 1L0YA 4GQ9H 1D6EA 5GIRA 2IBZX 4H5SB 2YZ8A 1W72H 3T65A 3LD8B 4ZS7H 2AJSH 4K3EL 3GMQA 1BD2B 3VFUA 2P43B 5F6HJ 2GY5A 1D5MB 2P7TA 4HJ0C 1U8MB 3TBWB 3QIBA 4HK3N 1RVFH 3WL9A 1LHZA 2DMCA 3GNML 3OKLB 3T0BA 3CXHK 3FTGA 3EJZD 4XNYL 5J1AB 1D6VL 4GKZA 1T1YA 2Q6WB 4JVWA 1HI6A 1NC4D 3C09B 1H0DA 4XC1H 3QO1B 3EYFA 1A7BA 4JDTH 3NBNA 5FGCB 3D85A 3MJ9L 3QEHA 4F7MB 3MRPB 2VUOA 3KPLB 2BNRB 43CAA 2P5WA 2ITCB 4Z77B 3BRFA 3VRLF 1DQMH 4HUVB 3BT2H 1F4YL 4F7CB 4YX2L 2MSPA 1NCWL 3RX8A 1RU9H 4X7SH 5D7KE 3SDCB 2XG4A 1LDPL 3NIDE 3SGKC 4HT1H 4MCYB 1T7XA 3T1WA 4LEXH 4KDVA 5C0DA 1IAOB 3FB8A 4OF7A 1U8IB 1M6OA 2N7AA 4WFGE 4QHNA 1AD0A 2XG5A 4HX1B 3BAEH 3ZSSA 4OCSL 2PR4H 4GMTL 4L8DA 2BHUA 5D93C 5FYLE 1RZFH 3WXWL 1EO7A 5CGTA 1AY1H 3MACH 2HA1A 2ZPKL 3HE7A 4APQB 3G9AB 5FYJH 2I9TB 1TVHB 2ATPB 3TGXA 4PJIF 3UTSB 1UM6L 5EIQA 5FO7A 3GSXA 5LCVL 5TDNB 4X98B 3DVIA 4P2OD 4JRXD 3ZE2E 5EFIB 5JZ7D 4MB5A 1TDQA 1U3YA 3EYVA 4YPGB 1GHFH 4ZFZA 3IKKA 4HLJA 4PGDA 4YPJA 5BOPA 3WN5A 4LPTA 3NCCB 1FGNH 5I8CB 1NAMB 2BY3A 4BH8B 1NBYB 5C9KA 5ESVB 1CI5A 1ZS8B 4M6NH 2RCSL 5FOJA 1N0XH 3BYTA 3VXMA 1FLRH 3JWOL 4IEFB 1YMMA 2VRAA 3JXAA 1A7PL 4YC2B 4MA8H 4PRPD 3SJVE 3ZKXB 1NBQA 1GOHA 5HDBE 2R2EA 3CLEL 4XVJH 3CC5A 3GSUA 1JNNH 4B41A 5JIIA 2Y36L 4WUUA 4S1DD 5GISL 2OZ4A 5HI4D 3KR3H 1I7TB 3SDAA 4UMGA 3F6LA 4HS3B 2QQQA 4YIQB 4OFYD 5D1ZA 4G9FD 4XAKD 4DOHE 2PO6A 4R8WH 3BDYL 4DW2L 1V3JA 1Y6MR 5ID0A 3QCTH 1XGPA 3B5GA 1ZTXH 1CZ8L 4BZ1L 5FYJE 1LEKA 5JIHA 4ODVH 1FL6A 3CH8A 1EK3A 5CGMA 5DRNA 3MV7D 4UI2A 1RK1A 1NGXB 4EUPA 5C0JA 3QIWC 4Y88A 4J4PC 1YN6B 1DZBA 5EBMB 1A9BA 1NAMH 1PQZA 4PJGA 3OR6A 2KQMA 1UZ6E 3TCXA 2YD3A 5K9JL 4BH7B 3UTTD 2CUHA 1HQ4B 5IBLC 4L1DA 3H42L 2JE8A 4BSVB 2ARJQ 2JTDA 1G7QB 1G9NH 3DHMA 3WLWD 3O0RH 3CFBA 4BUGA 1ZVSB 4X0KB 3FFCE 5A3ID 5D7JB 3ZE0E 1RJLA 3BP7B 1IEAA 2YWYA 3I3BA 4UTAL 4HLZG 5T1MB 1DQQB 1DLHA 5EA0L 1S7VA 3LKRB 2AJ3B 3MV11 2OJEB 4KTDL 2IANE 5C0AE 4CDHA 3LDBB 4U1NA 4TNVK 1LGVA 2YPKB 3NFNA 3IJSA 5LBSL 5HI5D 1U42A 4NQCD 1JNLH 1SVCP 3L5WA 4JDVA 1T6WA 3TM6A 4IOSD 3WFZA 4NJ9L 3CVHB 5ALCH 2ID5A 3UBXA 5B38G 2NYYD 3KJ4B 1JF1B 2YPVH 1FNAA 3HMWL 1QFWM 2BSSA 1VESA 2ICEB 3O9WA 4LVOB 4M6AA 1OM3L 4D0DA 4KI5D 4YZFF 1A4JA 1T03L 2F8OA 5IFHH 3WE6A 3MOBH 4OAWB 2DQFB 2AABL 1SQ2N 2X9YA 3D6GA 4E41E 2J88H 2HLAB 5AEAA 1F90L 1KPRB 4FNLH 4P59L 3VRIB 1JF5A 2P8MB 1NCCH 1QQDB 1DQDL 4Y4FA 4TOYL 1SEQL 5C1MB 3OAYK 1Q9WB 1YEHL 1RSFA 1T22A 1OAXH 2HVJA 3VD5A 2A6DB 1BFOB 4FQHB 4OJFL 2CLVA 3LRSA 1RJZB 5TDOA 3R8QA 3THML 1EA9C 3MREA 4JJ5B 4P3DA 4S1QL 4XCCH 1OY3B 4UT9L 3SCMD 4F2MB 2YWZA 5H2BB 1MJ7H 5FYKD 4WUKH 4LPWA 3LHPL 5BV7C 4ZPVB 2IGFH 3EYOA 3UXFA 3BUYB 1DBAL 4FZ8H 3GEWB 1T5WB 1QBLH 4JHZA 5D5MA 3CVHH 4LAQH 2E3VA 4WI6A 3ELAT 1A14L 4ETQB 4LIQL 1I7ZB 5IB3B 1Q9OA 2BNUB 3NN8A 3MRQA 2R4SH 4X6EB 1QYGH 3F7VA 4YFLF 3BRDA 2FJGA 2AV7B 4LP5A 1MJUH 4NZTL 4DAGL 4XVTH 3GSNL 4RFNC 4LFHD 5HYJD 4P9HC 1WAAE 3ILPA 1U92A 3KPRB 1CF8L 1VGKA 2L0DA 1X7QA 4TPRL 3H6JA 4J7RA 1U3HA 5D9SA 1WT5C 3NFSH 2DQJH 3CVIL 2V9TA 3ULUL 2VC2L 2UYLA 2R2HA 2XNAA 1KTDB 3RHWF 4QHUA 4HUKB 2GAZB 4HJGA 1DUZA 4LNRA 4F7PA 5INDA 1T89C 1IAKB 3VXPA 5FHBL 5BVPH 1A21A 3K4ZA 4P0DA 4MS8C 1BQLH 2ZUVA 4TSAL 4WIQA 3VWKB 1I9RH 5DT1H 4WENB 3VGGA 3WS3B 4LF3A 5IHBA 3VMPA 2PXYC 4KMLB 2OSLA 4ZD3L 4JVPA 4BKLB 4RX4D 3QQ3B 4PB0L 5TE4H 1AD9B 2H8PA 1ZOXA 5CD3A 3LH2H 1U8HB 4FQXA 4YHOL 1CDJA 2FSEB 3O8XC 1MY5A 1XGQA 4OLUL 3S96B 3UYRH 2CUMA 1A9EB 1AGEA 2X4TB 5JIPA 3VDBA 2SEBB 5GHWH 1BP3B 1FFNA 5T1DH 3MCKB 1TZGH 3FL7A 1HKLH 5I1IH 3U46B 5CKGA 3ZL4L 4Y5YB 5JHDD 4PJGF 5T5NF 4L8CB 1K3IA 2IFFL 4MJ6A 4G7VH 1A6AA 4DGYH 2H1PH 4JFED 4K3JL 4U1HB 4MHHG 1I8LA 5CMAA 4XP1H 3TT3H 1KB5H 4JFOB 1R5WA 4GG6A 2OJZL 4R0LA 1G7LB 3N1MC 3RVWD 4Y2DC 3QHFL 2H6PB 2VL4A 4X4ZA 3C87A 1UZ8B 4EN3A 3SN6N 3MXVH 1EGJH 2Q86B 4QRRD 5BS0B 1T21A 4P5TC 4XPTL 4MB4A 1T04B 5H94B 2YXMA 4LLYB 1N59A 3C5ZB 1EHAA 2EDJA 2HG5B 3OKKA 3R1GH 5J12C 1AQKH 3V5HB 5JW5B 3RZWA 3TWCL 1S9VB 4U6YA 4OUOA 4Y4KD 3PL6A 5E2TL 1JPST 3MZTA 3GSVA 3K4DA 2IG2H 4OD1L 5L2JB 4P4KB 2XXCB 4S1RL 4Z8FL 4PY8I 3PQYA 3VA6A 1LO5B 1DL7L 1ZANH 5KAQF 4KZDL 4U1MB 5SV3A 3V6OA 3ZE1E 1UFUA 4X6CE 5IMOA 2VXTL 4GRWE 2HTKC 3QXWA 3AFLA 1GAFL 3S8WA 1UA6L 4N0FA 4F58L 4XNUL 5TQ2L 5IB5B 4HV8A 4MXQC 5T3ZD 2EDKA 1NFDB 2YUXA 1CICB 1EX0A 4RGNE 3VWJB 4BFIA 3MUY1 3X11B 1MFAL 3G5ZA 1KJ2L 4P2RD 4JKWA 4NHCH 1BOGB 3RTQC 2G5BA 5C08A 2ZOLA 1H3WM 1GZQB 1MCKA 3WIFB 3G08A 5SWZE 5DR5L 5FCSH 2W9DH 1F97A 4X5XA 3I6KA 4PJ9A 2WW8A 1I1YB 2LAAA 1HQRB 4XHJC 4UTBL 5D5MF 4YHLL 5ICXA 1S9WB 3L95A 3BN9C 1MIMH 1IGML 3S36X 4JG1H 5HVGB 1A6WH 2V5SA 2O5ZL 3QIUC 1GYAA 1A1MB 3VG9C 3KPMB 3OB0K 2GCYB 5L7XL 1MFDH 3D48R 4D9QD 3QZWG 5HI3C 5TH2B 3WUWB 1T3FB 2VLLB 4KGJA 5EORH 5DUBA 4ZG1A 3WEXB 2XICA 1MCQA 1UACL 2BSTB 1MCEA 1OAZL 2A74B 5HVFB 2DLFH 4WTXA 4XI5C 3HRPA 2W0KA 5HJ3B 1RIUL 2E6PA 5DRXA 2X41A 1A7NL 1OTUC 5AUMB 2HMIC 4Q9QL 4HUXB 2H26A 5K9KB 2HKHH 1T0MA 4EIGB 5JNYB 1TMCB 4QXTB 1FFPA 1NGWB 6CGTA 3DIFA 3SGJA 3BPOC 3AM8A 3FRUA 1TTGA 3L3JA 5DRZA 2YN5A 5IW1A 2B1HL 5EU3B 1IAIH 3WXVH 1A6ZB 3JV0A 2ZSWA 3FT3B 4WWKB 3W0WB 3PHOB 4GLRI 1OW0C 5F9JA 1HDMA 3MRCA 4PYGA 2D7PA 1MCPH 2A6IA 3LMJL 3RKDD 3QNZA 1ZLUK 5JPNA 2AK1L 3FFDA 3JUZA 3GRWA 4C56E 3V4UL 1XR9A 3B3IA 4PIRF 3FN0L 3HZKB 3U9PH 5C70A 1JNHA 4IRJC 3L3KA 2XZQL 4I1NB 2EC9U 5SWQA 5I8KH 1FG9C 4LCYB 2BVQA 4WU5A 3EKCA 2O5XL 4X4ME 4GAJL 1U93B 4KKLC 5IVNA 1RHFA 4JFFE 2V7HB 4HJJH 5C07E 2VAAB 3OAYH 5FO9A 2V2XB 3OXSA 3NZ8A 1TJGL 2WWMD 3PWVB 4OCMC 1FNFA 3V7AG 5AZ2H 2FBJL 2R15A 5CP7B 12E8H 1BVKA 2BVYA 1OT2A 1SEBB 2B0SL 2XWTA 1IM9D 4JFDD 3T1FB 1LE5B 3LKNA 4A2MA 4OIIL 1FYTE 3TVMC 2EYSA 3HCVA 1GGBL 1VKXA 5KSAD 3KYMB 4GG6F 2OTUB 3TO4C 1AJ7L 4KK9C 5HYSB 3TA3A 3DURB 3LV3A 4MJ5B 1JHKH 3H8NA 4YHPB 3DI2B 3D25B 1NGQH 4XXCC 1RIVH 3ZTNH 1JV5A 4UIKH 3TLRA 3QUZC 4DQOH 1PKOA 3ULSB 3QPQD 3RU8L 1R5IB 4OGXL 5DO2C 1CVRA 3GSRB 4OLZH 2EYTA 5E5MA 4MA7H 4IRSA 2O61B 2PYED 4ODXA 4PY7B 2D7QA 3TJEH 4JQIL 4I0PA 2VWEE 3IJYB 2HYMA 1S7XA 1MUJB 3O3EB 4UV4H 3RVVC 1DCLA 3EZJB 3TBYB 1NGZB 5BMFL 3RL1A 5JA8B 3AY4C 4HIJB 4LCWB 1QSEB 1I1AA 5ISZD 3OKOA 1U8NB 1UB5B 1BX2A 2A77H 2H2SD 1NCAH 1JTOA 4PTUB 2CQVA 3BYYA 2V7NB 2ERJB 3JTTA 5KZCD 4K55A 4JN2B 1EO8H 4MWFB 3G5XB 1P2CA 5I1JH 2DRUA 3BXNB 3PWNB 2IJ0C 4JANA 2CH8A 1EFXA 4HPOL 1V7NL 2X70B 4HZAA 1TZIB 1Q72H 1ORSB 3NMEA 1OPGH 5DYOA 3O3DA 5DJ8A 5IFAL 2DJSA 3QG7L 1NJ9A 3MODH 5AYUH 3DVFA 1YN7A 3CU7A 2PCPB 4FQPA 4IMKA 4AZ8A 1OP5K 3TNMA 2A6JA 2EYRB 4P49A 3S36H 1HXYA 1JRHL 2QQKL 1FVDB 3B83A 3P9WB 2DQCL 2OL3A 4R2GC 3D39D 4X6BB 4G8FB 4FQIL 2DQGH 3S7GA 3VG0H 1L7TL 1EIBA 4Q6YA 4NUJA 3V7MA 2LVEA 3ARDA 2EH7H 2ZSVB 1PVHA 3GBMH 5D2NE 2FEEI 3SE8H 3EFFB 5IVXB 3CFKA 3REWA 3S3SA 1JRHI 1MPAH 2NTSP 3H3BC 5F1KC 4D2NA 5HVHB 4K94H 4ODHL 1HXMA 2XFXA 3OG4B 3H9HB 1T2QH 2NY2B 1WBYA 1XGRA 4QRTA 4Y19B 3U7YL 3PWUA 5F8RC 2MTPA 1F6AA 4F7TB 4M4PA 2WBJB 4R97C 4WTWA 3EO0B 4L4JA 1PG7X 3TYFA 5F1NB 1HNFA 5JPMB 3C08L 1DSFL 3MLTB 4RQQA 4D9RD 1R3HA 4WTZA 4QRUB 1QLFA 2JLLA 5ELIA 3P30L 1QFUL 1UXSA 5LKNA 1OGTB 2NXZD 4GRLD 3MFGB 4WY7H 2FX7H 4R7NB 4QO1A 1TJHL 5E6ID 4N9GA 4K71C 2CIKA 4HH9B 1RJYB 5KJRL 4ESKA 4OZGA 4UU9A 4DKAA 3TZVC 2IH1B 2H2PD 4YWGH 3T4YB 2FZ3A 2XQYK 1X44A 4P99A 2ZUTA 5J8OA 3ARPA 4QTIH 4ZTOL 2GK0A 2AEQL 2F74A 3DV6B 2HFGH 1JHTB 2BDNH 3QB7C 3QEQE 4RWYL 2KKQA 4ZSOB 5B39B 3PDOA 1S7QB 1SJVA 3C2AL 4NQEE 3B4NA 1KN2H 1M71A 4Y16D 4CVZB 4G9DA 4HUWB 5IBTL 1Z5LB 5E8EA 1G6RA 3KS0H 4G5ZH 5MEND 4LDEB 2I07A 4PBVC 4PJCA 5AAWA 3STLA 2OK0H 5EU6A 4U6VH 4AH2B 4YHKH 3QQ4A 4JO1L 1QD0A 3DYPA 1TVBA 4I4WB 4XTRC 4R4BA 2Y9RT 5F1IA 3UTZA 3QJHB 5F89B 1OAKH 3N85H 3CZJA 5I1KL 3PWPB 4K7FA 4YR6B 3B2VL 7FABL 5D1QC 3TT1L 3KWWB 4DGIH 4KRLB 3DRTB 4W81A 4WI5A 2E7LA 2VL5B 4HBQA 4FTVA 3L3DA 1A7RH 4WW1A 1CT8A 3TNNB 4QWWC 5FA4A 3WNPA 5DVMA 4GQ9L 2NY5H 2P49B 2H45A 1I9IH 4OQTH 3MRLB 3HZVB 2E6JA 2AJSL 3VXTB 3W5MA 4PJXA 1X5FA 25C8L 4HFUH 2P1YA 2FO1A 1T7YA 2Y6SD 5HGAA 2J2ZA 1T66C 1RVFL 4NKMA 4R26L 4JZJC 4OZFB 3DX9A 3L5XH 5GSVB 3BIKA 3E0GA 2BC4A 5GXBB 3GM8A 1H9VA 3PWLB 4PJ8C 1FVCB 1FL3B 4U49A 4EJ1C 3QI9A 4KMTH 4X8XA 4DZBA 2NMSA 2QQNL 1FN4A 1MWAA 5GJTH 1DQTA 4V1DB 1YNLL 1MLCA 4OB5L 1IKNC 5JW4R 3QCVL 2JB5H 4OCLC 4W68A 3ARBB 1RULL 1PEZA 2J4WH 1KJVB 1BVLA 1RU9L 1NLBH 4X7SL 4PGBA 4QGTA 1MRFH 3GGWB 4HT1L 3IVKB 5GZND 2PW2A 1I8IA 5C09A 3STZB 2HT2C 3B5HA 4NC2B 1MF2H 4AMKH 5M94B 4Z7QF 4HWNA 3MSPA 4D3CL 1ED3A 2GJ6B 1QLRB 2F5BL 1CK0L 5EU5A 1AY1L 1H5BA 3S4SA 5IQ7L 2WP3T 1XCQB 1IM3A 4RGNC 5FYJL 4LVNB 3JWDL 2EXWD 5F3HA 2ZKHH 2VQ1B 4L9DA 3RVUD 1A6PA 1G7IA 2JJTA 2EZ0C 2IBZY 3OHXB 4HGMA 4YXKH 3RA7H 3RUGE 3GSWA 4PJ5E 4UZGA 1GHFL 2XZAH 3M8OH 2MQ3A 1FIGH 1PG7H 1FGNL 2Y7QA 2VDQH 3ARGC 4I3RH 3DX6B 5J6GA 3U48A 2HT3D 3RHWK 1U8KA 1J8KA 4F33B 1BFTA 2NX5D 1XGUB 1D9KC 1FAIH 1FC2D 5IFJB 1QVOB 5J6HB 3ARFD 1N0XL 3MBEC 1KG0B 5IMKA 4OV6F 1KN4L 3HZMB 3QHZL 1MVUA 5MEQA 3TJHD 2DQEH 1DVFB 1NDGB 3IAPA 5DS8A 4MA8L 4UNVA 1MCSA 3ARQA 3ULUD 1FNSL 1AGCA 4JB9H 5DVLA 2XKUA 1J8HD 4PJIB 2GFBA 4XVJL 5JW4M 3O4LA 2R69H 3VD4A 4HJ0D 2QSCH 3IDNB 2P5EA 4NO0B 3OKEA 2FYYA 3PV6B 2ZG3A 1JTTA 1RZKL 1AQDA 3BHBB 4LQFH 4XX1G 4N68A 2Z35A 3B5TA 3DMMD 4AQ1B 3CDGA 3KXFD 2JCCE 4R8WL 2CKBH 1XGYH 2CLRA 4U1KB 3T2NL 1QUNA 4IBLT 1C1EH 4OZGF 2YUZA 2GSIA 1BJ1H 4LEOB 4N1CA 1FBIH 1ZTXL 4PY8J 5CILL 4ZO8A 4EI5B 1YEDB 3I75B 1KT2B 4ODVL 1MHHA 4OT1L 4POYA 4GSDH 5T3XE 1E28A 1Q1JH 3DVGB 1NANH 1BGXL 1NEUA 4OKDA 1AXIB 1FZOA 1B4JH 2IAMD 3L9RA 3K7UA 4L5FL 5ENWB 4LLDB 1FLTX 4FFWC 1VEMA 4FN0A 2OQJB 4MD0A 1NAML 3MRDA 2X4UA 2ADJA 1ACZA 1AGDA 1JUFB 1JPSH 3VCLA 2Q87A 1JL8A 43C9B 4G6KH 4OM1L 5FKPA 4H25B 4NBXB 4PJCF 1TNMA 5B3JF 1G9NL 1R24A 4K8RH 3RL2B 1CDYA 1WBXA 1K8DA 4CKVX 2FD6L 1X5IA 1X3DA 4LKCB 4QHMB 2AK4A 5I2IB 4N8CL 1A1NB 4MNGB 2YPLD 4OLYH 4ODWA 4OUUA 3EGSB 3IJHA 4RGOL 3H2WA 2APVA 3FOMB 1OP5H 5L6YH 3IDMB 4HC1L 1N5YH 3LY6A 5LWYH 2VXSH 4OCYL 4H20H 4L29B 5I73C 1UCTA 3ZYIA 1FJ1A 1OAQL 3AMKA 1JNLL 5BO1H 4JREB 4BSJA 1J1PL 2X4RA 4Y4HB 4M62L 1JWMB 4ZMAT 2EE3A 2EECA 2NQCA 4O51A 3MA9L 2GTWA 5DJ6A 4KV5F 5FGBC 1QR1A 2BVPA 3GKZA 5I18L 4G42A 2C1OB 4MAYD 3KYNB 1EXUA 3U7AA 1I8KB 3VXSB 1H3GA 4RDQG 4U3HA 3FQRB 3UPRA 3VXUA 3OKYA 5IFHL 1NCDH 3MOBL 4PJXF 3NH7H 5INCB 4HG4J 1IC7H 1OGAB 2J88L 4W70A 4FNLL 5E8NA 1PKQB 3NCYS 4P23C 4ZNEE 2VSCA 5HPOA 3BQUA 2Q8BL 2VLKD 1H8SA 5ETUB 3BVNA 4U1IB 5I15H 2FLRT 1MHCB 1M7XA 4XNMB 3BWUC 4NKOA 2VWEC 4QOKE 2IPKA 1KPUB 7CGTA 4KJPC 4PV9B 4LVEA 3DSFL 3QQNA 4XCCL