2WBWB

Ad37 fibre head in complex with car d1 and sialic acid
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
b'SLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBER PROTEIN
molecule tags Structural protein
source organism Human adenovirus 37
publication title The Cell Adhesion Molecule "Car" and Sialic Acid on Human Erythrocytes Influence Adenovirus in Vivo Biodistribution.
pubmed doi rcsb
total genus 31
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2009-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wbwB00
2ZUVA 2D7OA 5CSZB 4KHTL 3FFCE 2AJ3B 3CVHB 3W2DH 4Q9RL 35C8L 1PG7H 4P9ML 3DRTB 4XPGL 3FQNB 4Y5YB 1T7ZA 1REIA 4PJGA 4ZXBA 4MDIB 3TCXA 2ICWJ 1LEIA 3REWA 2Z35B 2DLTA 5I19L 4JO3L 1D5IL 2P5WA 4F7MA 4FXLA 2APBA 2ATPA 1U3ZA 4AEHH 2BOBA 4UQ3A 1H3VA 1FHGA 3GJFB 3U2SB 3PWJB 3RPKA 4K23L 1T22A 2I07B 3ZT6A 1TNNA 1DLHB 3P3YA 4EOWH 1OAXL 4H8WH 1PW3A 3LKRA 4KC3B 3OKOB 2A0LD 2ADJB 5HI4D 2XZAH 4HQQL 3C87A 2E9WA 5HY9B 2HKHH 4PRBA 4I0CC 4G8IB 3TNNA 5IJVB 2PO6D 1MI5D 4CVXB 1KPRB 1K6QH 1FAIH 4X6CF 3KPLA 3VFVA 1FZKA 4MNGA 3WLWD 3BW9B 4P99A 1AP2B 1NDMA 1T80A 4I9WD 3RA7L 5C0DA 5BS0A 3ROOB 2YK1L 4J6RH 2AGJH 3VGAC 3AAZB 3IFNH 5DFVC 4A2MA 4V2CB 5FXCH 3VCLA 3KPQB 3MXVL 3BPNC 3QUMH 1OARH 4PJEB 1B0GB 1R3HA 4ONFL 4FQJH 4O00A 4JVUA 1Q94A 4M6NL 2I60L 3NFPA 1SYSB 3U4BH 4WI9A 1ZLSH 5CJ5A 5EH1A 1T20B 2X1QA 1CD1A 3C2SA 3KS0H 4I4WB 4TYUA 3OAYH 4PB9H 4NKOA 3BGMB 5JW4M 3EZJB 2WBWB 1CXFA 1R5WB 1RK0B 2EXWC 2FO4A 2VXVL 2WP3O 5E56A 3SKJL 4IOSD 4JN2A 5BXFB 3CC5B 3ARFC 2P24B 2R56L 2VITA 4MZ3A 3T0EC 2BJMH 4BM7A 4C83A 4PY7B 3OWEA 4ZTOL 2V6HA 5CSGA 3TV3L 2Y5EA 4NN7C 3TF7C 2CKBA 1EHLL 1HHIB 2YR3A 4Y2DD 4HMDA 1MF2H 1VFAA 4HF5H 1EX0A 3J7HA 3V0WH 1R3HB 5KANI 2QQNH 4XZUA 3MRPB 3T4AA 1OP5K 1VKXB 2VABA 3GSOB 3QIUD 1EAPA 5I19H 1A64A 2YZ8A 2IGFL 4QY8B 3B5HA 4B7LA 4NKDB 4G8FA 2EDNA 2NY5L 3HCVA 4LCCC 4P2OB 2R0KH 1A6PA 3DV4B 1A4JB 1MJJA 3CSPA 3B9KB 4MDJA 4HG4K 1RJCA 4Q7DA 5IJVA 3CPLB 3DETC 3L3IB 3BAEH 1K6QL 1J8HE 1MHCB 2ICEB 2Q8BH 3WCYA 4ZD3L 3BSZL 4APQC 3GK8L 5E6ID 2BP3A 2BXZA 2FECI 3GUTA 3G6DL 4CL7A 3IDYB 5FOJA 1T22B 4PGBA 3IAQA 1BIIB 5GGQH 1JNLH 5IHZA 2YUZA 4L29A 3N0PB 4YDJB 5SWSA 3REWB 4XHQA 3QEHB 4G42B 5HI3D 1JTOA 4UBDC 2SEBA 2W38A 4GKNB 5IFJB 1RURH 3KNBA 3W39B 4OCNC 4KZDH 2XA8L 3KS0J 3H9ZA 3C6LD 3UPRA 3JTTA 3DXAD 4Y4KB 2NY6D 5T3ZD 1EFQA 5DUML 5T1MB 1WZMA 3ARBD 1PYWB 4OF5A 2EZ0C 1NCWL 1YMMA 1KTDA 1UVQA 1BD2D 2A77H 4D3CH 4HWBH 1EPFA 3B83A 1IGIL 5E1HB 5SWZD 1FZOB 4OGXL 3AM8C 5TPWH 2W65A 1JUFA 5I1JH 4G8GB 3A67L 3K7UA 3JV0A 1DSFL 2VE6B 3ARFA 4LSQL 1D7FA 1QD0A 2VLLA 3EKCA 1HDMA 1LO5B 1HIMH 1YEKL 4MNQE 5B8CA 3MNZB 3BN9D 2W65B 3ARFD 4Z7UF 3GM0A 1PZ5A 4PV8A 1S9XB 4OT1L 3W0WB 3E6HA 1Q72L 4JPWH 5E00A 3VXRE 5EO1A 1JL8A 4X9BA 1QBAA 5FFLA 4NZTL 4F33A 2E6QA 3PP4L 2BSRB 3RNQA 4HLZH 5HHMB 3DO7A 2VKXA 5D1XC 1QPXA 5D6CB 2DJ4A 2HH0H 1MJ7H 4OCWL 1GGBL 5E8DL 5IMOA 1INQA 5CGMA 1J8HA 2VLKA 3HZVA 5I1CL 5KG9B 2Z4QB 1F3JA 3IF1B 4ZUSA 2JIXB 4DZBB 3RA7H 1MY7A 4WFHD 1ETZA 5MI0C 1U8IA 1FNSH 4ZSOA 3X3GL 4MAYD 5D1XA 1UZ8B 5IVXA 3PF2A 5DJDA 4KRPB 3PNWA 2AEPH 1JPSH 5KZCD 3EYUL 3GSNL 3MCLL 4O02H 5K33A 1BVLB 4X6DB 1FGNL 3LKNB 2RIKA 1J8HD 3RVTC 4F7MB 2V5MA 4PY8I 2DIAA 2CIKA 1WFNA 1XIWC 4UTBH 4NBYB 12E8H 1ZVHA 2ITCB 1U8QA 4GAJL 4MMZC 1FVDB 2Z31A 2I9LA 2D4FA 2UVEA 4R4FL 2YPVH 5H37H 1RZIB 3MRPA 3ZO0A 2WWKO 3DHJA 3PHQB 4Y4HB 4DVBB 5SX4I 1S9VA 4OQTL 1TZGH 3UJTL 5IV2A 3KYKH 1BD2E 1X6NA 3Q6GH 2GTZB 1AXTH 3HHRB 4WO4C 4Y1AA 1QFOA 5C0FB 1OT1A 4MA3B 1RUAH 5FA3A 1E6JH 5F6IC 2P5ED 5FUZL 3UTPD 4CVZA 1RK0A 3R06A 1T03L 1BOGA 1UZ8A 3VI3E 4JVPA 4OZHB 3S5LB 2H8PA 1T20A 5ID1A 1FN4A 2EDKA 4PJXF 4LHQB 1ZANH 4FFWC 3HCVB 4P5TB 2B2XL 1GC1L 1NGWB 5D7JC 4KV5E 2NY3B 2RHEA 5DMYA 3SHSA 2YUXA 3QIWA 5EU6A 1INQB 1K5NB 3QDGB 5GSVA 4HUNB 3TN0B 5C0AB 4PJEA 1QPPA 3PABB 4FXKA 1FBIH 2CO6B 1D6EB 1QBBA 4HJ0C 4YK4C 3GGWB 3RBGA 2D4DA 5D2LE 5CGYD 1FLRH 4PJ5D 2J8OA 3I2CL 3ZDXE 4S1RL 5LWYL 2N4IA 2E9JA 1S9XA 2A83B 2E8ZA 3JWDL 2DN7A 1KG0B 5EUOE 3CGTA 5FUOH 2RCSH 1WCBB 3VWKB 5C9JB 2VITB 3WHE1 5D2NA 5ITFA 4X4XA 5FGBA 5E6IC 4JY6A 3IDXL 4XHJC 4LBEA 3O2DH 3RAJH 4CADA 3NFNA 5F6IB 4LP4A 3TT3H 4XRCA 1C08A 3VWJD 5LCVH 5CBEA 2EEBA 1IQWL 1U2HA 2GCYB 1KB9K 5DHVH 5D1ZA 3HR6A 2X1XR 2NX5E 4KI1A 4LRNL 1G1YA 1QNZL 3SDDA 4MJIA 3EDKA 4HPOL 4GUPB 3UP1A 4X98B 3OTTA 5DEZA 1UWEL 1KENH 4LDEB 1TFHA 1NMBL 3BP4A 4RISH 2R23A 3SDAC 4HUUA 5ETUB 2DM2A 1I3RA 2AJUL 4N5ED 1P7QA 3BW9A 2FR4A 3H0TA 3AFLA 3ULVD 2YXMA 1MVFA 4PR5A 3MMEB 4HKZB 1RUKH 2EDDA 1TPXC 3BKCL 4TPRH 4IS6A 1UYWL 3QJHB 4ODBD 2R4RL 3P30L 3QUXC 4LPYA 3BN3B 4PP1C 4R2GC 5ESQA 1U8OB 2XFXA 3LKOA 4OM0L 4J8RA 1URLA 1YYLL 4PGDA 4NQEB 3U2SA 1UH2A 4J3TA 4P3DA 3HRZB 4DW2L 1KJVA 3BD3A 3JWNC 4NC1C 3NCYP 3T1FB 5JMOC 1CR9L 4P49A 4DKFL 4PRPB 4YDIL 4RWYL 4XP4L 5FM5O 1S7UB 2B4CH 4MJ6B 3T65B 1FVCB 2AEPL 2DQHH 1I7TB 1ZSDA 4JO2L 4PBWD 1NFIA 3TPUB 4PGEA 3S37X 4IM8A 1P1ZB 4HGKC 3U4EB 2G2RA 4MQXC 1T0PB 3MLXH 4GKZB 3HNTH 1SYVA 4NQCA 3NGBC 2X4PB 2FYYA 1U8LA 5C08B 4XCCL 2X4NA 3NIFF 3HNVL 3BJ91 2OMNA 2OBGA 1MLCA 5C08D 4OCYH 4LSPL 3BX7C 4GSDH 4NKQB 3ROLA 1U58B 1G7LA 5J11C 5F21B 4OI7A 4B41A 1U8NA 2JJSC 2Q6WB 4YXLH 3LSOA 3SDYH 2HRPH 3VXTB 1YEEL 1A7PL 4WEMB 5F93C 1BMGA 2EYTA 3B2VL 3C5ZB 3RUGA 1QLEL 4O9HL 2XPGA 5A1AA 4R3SB 2VIRA 4HGWA 4PRPD 3X12B 2W60B 1NDGB 3TJEL 5HYSG 4YHOL 3ULVF 2DQCL 5DFTA 5DFVD 3UTOA 3V6OC 5M7QA 3P4NB 1IM3B 1DFBL 4OCMC 5DJ6A 2EDQA 4HJJH 4RFNB 3NIGF 3BPLB 4ELKA 3CX2A 1IC1A 2WMPA 4LNVA 1IC5L 1MCQA 4NQXA 5CUSH 1IL1A 1P9MC 2FBOJ 3UTQB 1N6VA 3IDGA 4ETQA 3GMNA 2R29L 4TOYH 1L0YA 1DE4A 5A2IH 2R0WL 2VMFA 3U0WH 2R2EB 5HI4C 5FECA 5CZXC 4HS8L 5IB3A 1XCQA 3L3DA 1BFTA 4JFED 5F3HB 3ZTJH 2HVJB 3RIAF 4C58B 4GRMA 4U6YA 4URTB 4KDVA 5EB9A 3RWJA 4PJ8A 3V0VB 3L3KB 2BOBB 4UQ3B 3BZ4B 1KCKA 3PG2A 1UWXH 2BVPA 5A40E 3B43A 1UXSA 5DEFA 3H42H 1F2QA 4R3SA 4YHML 2DQDL 4ZUTA 4WUUE 1MCBA 4J4PC 4PLNC 4CMHB 3RNKB 3QPXH 2V7HB 3W0WE 2R8SH 5K9QG 5BZWA 3OF6D 2NY1D 1QVOB 2VDQH 5L6YL 4MJ2A 5KW9L 4DAGH 3FJTA 2W0FB 4YIQA 4JGMA 2IQ9H 2GJ6B 1L7IH 2Y5TB 5HI3C 4R96B 1KPUB 1UFUA 3WMSA 4LLDA 4HK3N 4MAYB 3QNXA 1W8OA 3QNXB 5EZIH 2VLRD 4KDTC 1VHPA 4LIQE 5TGBA 5FKPA 2P4AB 4ODUA 4LPXA 3VD9A 3U30B 4Y0GA 5KSAD 2FEEI 2PYEB 2IAMA 3ILPA 1X4ZA 2FJFA 3Q1SH 5HHPB 1BBJB 2VXSH 1OSZA 4G8EB 2WINB 3ZKNC 3NPZB 5KSBA 4LK4A 4QRQA 4F7TA 2I9TA 1XGRA 2EC8A 2VDLL 1CFSB 3K8MA 5DEFB 2ZNWA 4Z7VB 3SGJC 1RJLB 4TVPD 3BP7A 3OXRA 5B22A 1WK0A 4GRMB 3NIFE 3DBXA 3IJHB 2NW3A 5TE4H 5IF0B 1RPQA 4YFEA 1UM5L 3TVMC 2FD6L 2QBWA 4JFQB 4FFWD 3FAWA 5A43C 5I75C 2FATL 4LSVL 3S5LG 4Z7UA 1A5FH 3UPAA 3DGGA 3HI6L 2J8UF 1X5IA 1U8HA 4X4MA 3RRQA 3TM6A 5HYIA 3BHBB 4L4VB 2QEJA 3EFDL 1YA5A 1HXMA 5J12C 2RFXB 2Y6SC 2AJYL 3IETB 2ICWI 5EG6C 4XXCC 4R4FH 3H9SE 3DX6B 4U0QB 5D5MB 1T1XA 1G9MC 4NQVA 3L5IA 4XP1H 3EW3B 4GOSA 1BJMA 3HNTL 4Z7VA 1J9CT 4S1RH 1BM3L 3DYMA 5I1HH 1S7WA 2FWOB 2VDPH 4L8BA 1N6UA 4HHAA 4U1KB 5HPMB 3T2QA 1N7MH 2WINA 4DOHE 1UH4A 2R1XA 1G9ML 3BKYL 1Q9KB 4QOKD 4ZFOL 3MR9A 1NKRA 1XIWB 5DD5L 5KAQF 2E9IA 4FMKA 3MJ9L 5INCA 5DJ8A 4HIIA 2VLJB 3IDXH 1P4BH 4BQ6A 5DC9B 3HMXH 3F5WB 3IDYC 3WNLA 1AXSA 1G9NC 1CFTB 5C07E 2X9WA 1LHZA 3U36B 3RUGE 1IQWH 2XZQL 4OFYD 3LS5H 5AD0A 4E41E 2VAAA 4Y5YC 3V5DB 3KVQA 4LU5H 5JW4R 3AREC 3VXME 4H25B 1KV3A 3MRIA 3NFSL 5IHLB 2H2PD 3TYFB 1JZ7A 1H5BC 4PJFF 1NC2B 1FC2D 1RHHB 2VH5L 1XF1A 5ALCH 1N3NA 3NTCH 1MAMH 3E8UL 3P0YH 2Q76B 4AT6B 4HFWB 3GKWH 1MFBL 2FRGP 3B5TA 4ODSH 2HMID 1P2CB 2W9DL 2FJGA 2KDGA 5D1XD 3MOBL 3SGJA 5TE4L 4NQSB 4HFWA 4ZFFA 5CD5C 5GS2H 4PJ8B 3VXOB 2CR6A 2YWYA 1JCKA 4E0RB 5D72L 3Q3GA 4DEPB 2FSEB 5EFIB 4HIHA 4LFHD 4CMMB 4NN6C 3H2WA 3RHWK 2EDWA 3QEGH 3OZ9H 4FG6D 1F58L 4G6MH 4AEIH 2IBGA 2OI9B 3WO4B 4JG1H 1U91B 3TO4D 1CDYA 3DIFA 3GMMA 1OTUD 4P46B 1MWAA 1OAQL 5FA3B 1HEZA 5IB1A 3L5WB 2XV6B 3VH8A 3BESR 2ZCHL 4JFDD 1I8MA 4G6AD 5CJOH 2NY5C 2OL3H 5KVEL 2NY2D 1KULA 3LN5A 4S1DC 5C6TL 2F53B 1EHLH 3ULVC 5GRVL 1EUTA 4BFIA 1VENA 3KPMB 4I18C 1NH6A 4I0PC 1XF4B 2PF6A 1PG7W 2PW2B 2YBRB 4MQXD 3LHPH 2BHZA 1JMXA 2AKRA 1YJDL 4LKCA 4F80A 3VXSD 4ZO6A 3C60D 1NMAL 1XIWD 3MJ9H 5MENB 3GSVA 4JM2B 4KHTH 3RUGB 4WI2A 3MV9B 1RIHH 1I1AA 3BRFA 3FB7A 3RGVC 5MEOA 3MLWH 1ACYH 1U8NB 2HJKB 4H1LG 4ZG1A 32C2B 3QWQB 3WFEL 1K4DB 2G9HB 3HE6A 1WAAE 3PHOA 5I66B 5ITFB 2HLFC 3WSQL 4N0UE 4GO6B 5CEXB 5F1IA 4ODVL 3EOBA 5DVNA 3RDTC 1BP3B 1I1AC 2XTJD 4ONHA 3ZL4H 5C08A 1OD7A 5IG7B 3T0EE 1WICA 2PYFA 4PJDF 3VXQA 4PJCB 4YXKL 1YMHB 2MWCA 1NGXA 5GRUL 4JFQA 2XRAL 1G7PB 4LCCB 4MSWA 5JIHA 3FO0H 1ZK9A 3GGWA 4OZFH 2E6JA 3PGDB 2VLKB 1GVIA 3HZVB 5DMGC 3VWJB 1QO3A 3DX9A 5ILTH 1D6EA 3QEQB 4XGZA 4MZ2A 1WIOA 1YY9C 5CHNB 4LPVA 4XNXL 3AC0A 1CBVH 2YPKB 4YHYC 3ARPA 5H94B 5F6HJ 4B53A 5EOCL 1NEUA 2AJSL 2YD2A 1FG2A 3P2TA 4PJ9C 3KR3L 4UDUB 4XH2B 3U30C 5AG9A 4G9FE 1A7QL 3O6LH 5CP3A 5TDNA 1BBJA 6CGTA 3ULUL 1QQDB 4M8QA 1QEWB 3DXAB 4Y4KD 5EO9B 1DZBA 1PLGL 3VXPA 5E2TH 4N0UA 3S98A 5DRXB 4I77L 4J3WA 5I1JL 1T2QH 5D1ZD 1TVHB 4PB0L 4OV5B 3VJ6B 1TQBC 3QFJE 3QXDA 1AFVH 3PL6B 4V1DE 2VZ3A 3CFEA 5AEAA 5DWUH 4NZRL 3KPSA 3BKYH 5J6GA 4OLWL 1J8KA 2EE9A 3PIQA 5D71H 1M1SA 1MWAH 2H9GB 1CGSL 1A4KB 4F58H 1CD8A 3VFGL 4I18A 4JRYE 1V5JA 4JQVA 3UBXB 1DBAL 1XGUA 4N0CC 3DO3A 3JTTB 4EN3B 5FUZH 5IFHH 2ESVB 4KJPD 4O2FB 5I1LB 4LEXH 1IRAY 2IG2L 3FAXA 4RA3A 2BMKB 1QG3A 1FCCA 4EN3D 1PX3A 2LU3A 1NC4A 3WFBH 4MD0B 1T1ZB 2YKLL 2YD1A 4ONFH 1R5IB 1BWMA 4JFFB 5I1DA 1OTSD 4QRPB 1CICC 3KYMA 1XCQB 3F7YB 4OSUH 3FB8A 4JQXA 2JJVA 3MLUH 2MQ0A 2O5ZL 4PRHD 3PWUB 1FFQA 1AHWB 1HZHH 5D1XB 2VC2L 2OP4H 1VFUA 1MRDL 5AWNL 5ICYA 3ULSA 3JV5A 4WUKH 4U2YA 5D7LD 1U8KB 3ULUE 3MCLH 3U6RB 2VDLH 4XPAL 5LGKA 5B39G 3BP6A 4QRUA 2IFGA 3CK0H 1ADQA 2H26A 4JFYB 1P7QD 1SEBA 3U48A 5IIEA 4WV1C 1EVTC 4OLUH 4L9LA 4PJ5A 4X0KA 2X9XA 3ULUD 1UM5H 5J9PB 5IESL 1SJHA 3QDJB 2XPGB 1KN2H 4BA8A 1ZAGA 4PRHE 4LAJH 5H37G 3OKMB 1NGWA 1XGYH 4ELMF 5DVOA 2JJSA 2X4UB 1VB9A 3LH2L 3O3UN 1FN4B 1QYGL 5F9OH 2UYLA 3BFOA 3CSYB 4AIZB 5L88H 1YY8B 2BDNH 1T1YB 4Y4FC 4HV8B 3MRGB 1FO0A 2P24A 3IRZA 3WUZA 1ERNA 3EYSH 3NA9L 5C8JA 3Q1SL 4EI5C 4M6AA 1EJOH 5ISZB 4NPYB 5TPWL 1UCTA 4PLJC 4G8GA 3VMNA 3PDOB 1FJ1B 5AYUL 3EBAA 3QXVA 5I1KH 4KVNL 1NBVL 2FDBP 2X4TB 4AENA 4AH2A 4ISVA 3MREB 4KKNA 5DLMH 1UJ3A 4WRLA 5B3JF 3IDNA 4MAYC 1MI5B 1F6LL 4Y4HD 4Y4FA 5I74C 4M7ZB 5JMRA 2YEZB 4RNRB 1KNOB 2F9BT 1JMZA 3BQUD 4KXZI 3SDDC 4YNYB 3RX7A 4NC1E 4QHLB 4PG2A 1I7ZA 1C1EL 1D3CA 3RVTD 3ALXA 4M5ZL 4EUPA 4PRID 2YS4A 1NAMB 3S96B 4LLUA 1N2RB 3GSUB 4POYA 4G42A 3QEHA 1V3LA 5TE7L 3EFDH 1I85A 4MYWB 4XWOC 5FYKU 9CGTA 5E4EB 1KCSH 4P5TC 3KLDA 3MYZA 4ZO9A 4OZIA 1GRWA 43CAB 1BIIA 5D7JB 1FYTB 3AU1A 5ABDE 4TUOB 5DD0L 1M7DA 1U8OA 2XFXB 3SOBH 2Z8VC 5ICYB 5MP6L 3OV6A 4PV9A 1IKFL 1F4XH 4HWUA 4M1CD 1JGLH 3MRJB 3VFPA 5JORB 4PJ7E 3PQYD 1Q8MA 2K7QA 4K07A 4Z77B 1A7NH 4ZSOB 5KSAA 1M7DB 2VLJE 1X44A 5F9WB 3GMQA 4UNUA 2BNQD 4TUKH 4RA0C 4GKOA 1YEKH 3IKCA 1EHNA 1HHHB 1ZT7A 4H8WC 2RQ8A 2AJVH 2JE8A 5JA8B 3S96A 2VDKH 3D25B 4U6VH 4QTHB 2NX5B 1OGTB 3IXAA 5C71A 1A3RH 4V1DA 4WEBH 1Z5LB 5C0ND 3MFFB 5JW4N 4IHOB 5ITBH 2BSED 5HHQB 1IE5A 4RGNC 1IC7H 2IPTL 2APFA 4X6DE 4QKXB 1MCOL 1CFQA 1CD0A 2H3NA 3EO9L 25C8L 3K4DA 4X8JB 4G9FB 2B4CC 2DM3A 3E6HB 1FZJB 2CRZA 4AENB 5I1CH 3T2OA 1T7VA 3TESA 1TZHA 4FQ1L 4U0RC 1FJ1A 2YPLE 4YHZL 4EI5A 4JN2B 3MRDB 2EDJA 4XMLL 1LILA 4X4XB 2YRZA 3QFJB 4UOJA 5DSCA 3TH2T 1FYHB 4AJ0A 1BD2B 3CSYA 3G9VA 5C0BA 2HKFH 5F7DB 3VGDA 1DLFL 1UXWB 3WLBB 4LP5A 1FL5A 1ZT1B 2NY6C 4U1HA 4XAWH 1I7RB 5D7KE 1ZHKB 2YUWA 4P3CL 5HGHA 4IHOA 1JRHI 1ZHBA 3CFBA 5T33H 3D39D 4DFHA 3ZKMD 5D7IE 1V05A 3EOYG 4QTHA 5FM8A 1JZ2A 3MV9D 5C0AA 4XCEB 4KHXL 1ZGLB 4GS7C 4GKNA 1IMHC 5GHWH 3IU3B 1UQSA 4EUPG 3C8KB 1BQLL 3SOBL 3QUMB 1YQVL 3DUHA 7FABH 4P5TA 2X4SB 4LMQI 4JM4L 1FZKB 4MNGB 1IM9D 3GMQB 1MIMH 4QRPE 3S5LA 3UJTH 4OZGF 1IQDB 5GGRY 1KIUA 1MFCL 3MLYL 1W72A 2ADIA 4Z18A 2OR8A 1ORSB 4ORZC 1JPST 4JEGB 2GEEA 4X5XB 1BZ7A 2FX7H 3C6SA 2M26A 3BUTA 3VH8G 1K3IA 5EU3A 4CVWA 2O5XL 1BBDL 1B90A 2XTLA 4JFFA 5TFSH 3JV4A 1RZ8B 1DBKH 3ESUF 1G9EA 1U95A 4KU1A 3MCKA 4YFDB 5IEHA 4WFGD 3V95A 2I25N 2EDTA 5F1KC 4OQ1A 3VE0B 5LCVL 2R15A 1EZVY 5DJZA 1G7HA 2R2BA 3C5SB 2AEWA 2PW2A 5J13C 2JLLA 1JZ8A 5FIEA 1EO5A 4Y2DB 1FAIL 4HWZB 3G5XA 4G80B 1QFWH 5A2JH 2YEZA 1HQ4B 3OGOE 1FL5B 1ZT1A 1HILB 4LARH 5C0JB 4WWKB 3TNMA 2APVA 4QWWC 2IF7A 5C0BB 4OLZH 3P0VL 1NMBH 4RISL 1LK3L 3NZHL 5EU3B 3IFNL 4YXHL 4K7FA 1DDHB 5FK9A 4QCIA 1TVHA 4X5XA 4QOKE 5DA4A 1C5DA 1QSFB 4U05A 4JFPB 3CXHK 1L0QA 3U7WL 2V9QA 4HV8A 5FB8A 5GS0D 3FOMA 3QUYA 1AIFA 4WHCA 1QLRA 1CICD 4MQSB 3N1FC 4UDTB 1Q94B 2EH8L 3TT3L 4S0SD 1IEBB 3RBSA 4M43H 2HAZA 4MXWL 4NO0D 5EO0B 3QDJA 3IFPA 5CLWA 4L8CA 4I0PD 4Y19D 2CDFB 1EBAA 3WUWB 5IEKB 2DQUH 4R6UA 5EUOF 5DURD 2QHRH 2VZSA 5D1QD 3PWVA 3G5ZA 2V7NA 1MREH 4MXQD 5IVZA 1AFVL 5E2JA 3KLAA 3EYOB 4I2XB 1NGXB 4KROC 4N0CD 5J13B 3WLBA 3O6MH 2WQ8A 2PO6B 4JFEB 1IJ9A 4TQEH 3C08H 3VFVB 1IC4L 4M93B 1UADC 4L1DA 4NNYB 1OAYL 1OTUC 3MNZA 4XB7A 3LDBC 3TO4C 3MC0A 4PJ7B 4D9QE 1AHWA 4DZ8B 2VE6A 3ARFB 5ANMA 4C54A 5HVWA 3O4LB 1I8KA 5F7WC 3C60A 4KWUA 5HDBE 1LO4L 4LEXL 5DK2B 2ED8A 5GGTH 2ICES 5T5FL 1LK2A 1G0DA 2WAHA 4EXPX 4P0DA 5MEOB 5C0EB 1KIQB 3MTRA 5IGXL 4C56E 1BJ1H 5E8OA 1DL7H 2X2YA 4KRPD 4PBXA 3GIZH 4RGMC 1OM3L 2XY2A 4RMWA 3EGSB 3GK8H 2NX5A 1J0JA 2AJXL 4Q58C 5GQBA 1U92B 5AYQA 5IVXE 4HKXB 1OWRM 1LDPL 3BMVA 3GSNB 1RJYB 3D18A 4LSTH 3SKMB 2LTQC 4NIKB 1TVBA 3C5JA 1H3TA 3KJ6L 4U1SA 1QRND 3VFRA 1ED3A 5F70A 1PQZB 3GRWH 1NLBH 3DX8B 2LV4A 4HS6B 3SO5A 5HYQB 5I8OL 1QFUH 4DKAA 1AD0B 1ND0A 5LGJB 2VLRB 5EBGA 4UILL 4CMMA 5IF0A 3F65A 1GGCL 5GISH 5GZNC 3BEVB 4LKXA 1F58H 4LSPH 2MSPA 4XVUD 3VFSB 1AJ7L 1RFDL 4OUOA 2ZUWA 1KOAA 1OGAA 1S78D 3RVVC 5TE6L 1D9KB 4EIGB 3SE9H 5H94A 3EYVB 1FNEB 1KUMA 3RGVD 4XTRC 3VI4F 3QCTL 4YK4B 1ZWIA 4HZLA 2IALB 3OXSA 1F4XL 1JPSL 3CSBA 4MX7B 3VGHA 1JPFB 5BVPH 4ZS6D 4WO4A 5DQDH 1FDLH 1WWBX 4X0KB 4RAHA 4XMPH 3SKJH 4BQ9A 3GSNH 3UJIL 4NNPL 2C3WA 5EU4B 2BNRB 5JQ6L 2CMRH 3BP6B 1YMHA 4LVOC 2CKBB 3LQAC 4XPGH 2BVUA 3QZWB 2AK4B 5MERB 3S88H 1FFPB 2P5WE 5A3ID 1KJ2B 1W0VA 2D9CA 1L9NA 4GBXB 3WNMA 3OJVC 4RX4D 4PJBF 4OZGA 4XWGH 5D6DA 5EORL 4HKJB 3W9DA 4G7YL 1IBGL 1S8DA 3BKJH 5HDQH 4MLIA 4I0PA 5SWZE 3OJMB 4IBLT 3GMPA 5AZ2L 2PYED 5KSVB 4QHMB 1MCOH 2FL5A 1Q9KA 4JQXC 1CXLA 1WCQA 3QIUC 5K93A 4NT6B 4PJ9D 5T3ZE 3LKPB 5D96C 1V7NL 2YA2A 5CINL 4WFFD 5DD0H 3S36H 1S7WB 2HLAB 4YHZH 3RWFB 2WUBL 1SJHB 4N0YL 2VZUA 3D48R 2FL5B 3L6FA 3N9GL 4CVUA 4EVNA 3IJSA 4JJ5B 2Q8BL 1JF6A 2J8UA 3U9PH 2XN9B 4OKVA 2Q8AH 3RDTA 3JWDH 4EJ1C 1TQCB 1KCUL 5E6IA 1I1CA 4N9GA 5JR1H 1AO7A 2AQ1A 2AXGB 3L5WA 4IRSC 3UYRH 4XBEH 1E27B 2MHAB 2JB6B 1FFPA 4W6WB 2FJHB 5TF0A 2V5TA 2IAMD 1MHEA 3M17A 1N26A 1RK1A 3LKRB 3VXNA 1FGVL 4H0HB 2C3XA 4HIHB 2NW3B 3IJHA 5JPNB 5ITBL 3O2WH 3O6FA 2XWTB 1MCRA 1OT2A 3VXMD 5EBMB 4P4RA 1EGJA 2BNRE 3MJ7B 5JUEH 4M5YH 5JIPA 3UJJH 5LJYH 1N4XH 4ZFOA 2CDGB 3BPOB 3CDGB 1NBQA 4L8SC 4CJ0A 1JWUB 1VGEL 2IAND 2EE3A 3O3AB 3ZKXC 3FMGH 4OLYH 4Z0BH 3C5ZA 4HWNA 3U0PB 2YPKA 3PWNB 4R90H 1EO8H 4KJQD 5TQ0L 4Z0XB 2ESVA 3EYQC 4PGJA 1BEYH 4HT1L 3VFSA 4Y4HC 1KIRB 4HH9B 2HFFB 5F44A 4GXVH 2ESVD 2J2ZA 3R1GL 3WFDH 1A6AA 2HA1A 2PXYD 3ARVA 4HWEL 5J1AA 3VA6A 4MCYB 2PO6C 4ODWA 2V2TB 3MRBB 4PG2C 2AI0H 3KPNA 5J3HD 1T89C 1MLBB 4JFOA 1AO7D 1JIBA 3RY4A 4NDMB 4CW1A 4NQCB 3RJQB 2DQJL 1Q0XL 3UAJC 2XZQH 3B9AA 2JJUA 3REVA 4QNPE 2FO1A 4JQVC 4JB9L 3LEVL 4XNUL 3HG1D 2DQTH 4FHBD 4TN9A 4I1NB 3H9SD 4NHCH 4OCWH 3GIVB 3K4AA 4FP8H 1LE9B 1OOAA 2F15A 3IFOA 5ESVB 2EDHA 2YMXL 5ICXB 1YEDB 3NCYS 4Z0XA 5SWSD 1FL3B 3L7FA 4UNTA 4KGLA 2B0SH 5DMIL 1WUNT 1S7XA 1S7VB 3U79A 3I6KA 4X5WA 5JHLH 3CK0L 3IFLL 3UAJD 1NCBL 3UYOD 4LQFH 4YWGL 1T6VN 3QH3A 3SBWA 4Y16B 2CLRB 2YSSA 2Z8RA 5D5MF 1O7SA 4JPIA 1SHMA 1TZIA 4NQXB 4PGCB 3S35H 1HEZB 4FQ2L 5IB1B 4U3HA 4U1SB 4GLRI 4MD5A 4NO3A 4MWFA 4N5EC 3EOBB 2DQHL 1VCAA 4HWBL 1A3LL 2IWGA 4LMQE 1RJYA 4WV1A 2QQKH 1A7RL 1IM3A 3ECBB 1Z3GH 2BY3A 3ARQA 3JWOC 3MGTA 4QF1A 5IW1A 1J05A 3T0VA 2BC4B 3K74B 4X6FA 5E2WH 2QR0B 5EBWB 2K9UA 5EULV 3MROA 4KV5F 1EEYA 2VH5H 4BFGA 5F96H 5FM5M 3FONB 4LLAA 1NLDL 3LRSA 4IOFC 3GMLA 4OGAC 3QHTC 5FYLH 2GSGA 4OD1H 2XIDA 1OSZB 2D0FA 4LF3B 2AABL 3ZDZF 3M8OL 5H35B 2GSIA 1UCBH 1W72L 4JY4A 4MLSA 2V5RA 1F6FB 1JRHH 5E5MA 1I4FA 2QQNL 4O4YL 1S8DB 2QSCH 4QRRB 3UTTE 1ZT4A 1M7IB 4WUUD 5FYJU 1OAXH 3TJHD 5IGXH 3QFJD 3TZVC 1LMKA 1MH5B 1HZHL 5IQ9A 4FRWA 2A6JB 4DUXA 3LRHA 4M6NH 1CFTA 4R96A 2YUVA 3D0LB 4GW4A 2GT9A 2VLKD 5CCKH 2X70B 2WLYA 5C3LD 4JFEE 1JF5A 1FG9C 1ZLWK 1DFBH 4QGTA 5EPMA 3Q3GB 2NNAA 3OBAA 5GS1B 5IW6A 2HFFA 1I3GH 4JCMA 5EN2B 1WAAF 3T3PF 3EYUH 1CZ8H 4YZFE 5DVKA 1I85C 1HN1A 3QUZA 2HTKC 4HHAB 1GAFH 5FUCC 5GGQL 3CDGA 4PJCE 5KVDH 4XP5H 4YPJA 3TV3H 4P9HH 2XI9A 2NY7L 2EIZB 3SDXA 2HTLD 5FB8B 3C8DA 1LE5B 3RVXD 1HQRB 4YUEL 3QEQE 4ZXBC 1C12B 4FFVD 3SQOH 3PJSA 5B4MD 1FO0H 1AR1D 4WV1B 1TQCC 2J12B 1M71B 3DUUA 5KSAC 4QEGA 1WEJH 5J12B 4XBPB 3BXNB 2UV3A 3H3PL 2MKLC 2G5BB 5I30H 4KROB 1H3GA 4MJID 3FO9B 2IGFH 4PD4K 4BJLA 2R8SL 5BZDB 5FO9B 4LLWA 1KJ3H 2MCPH 3T2NH 4LPWA 5C0JA 5JHDE 3D69B 1WLHA 3F7RA 4PP2A 3RWDA 2R2HA 2IMMA 1FSKB 5H8DA 4D9RE 5DURB 5I6XB 4ELMA 5J11B 3V0WL 3IU4H 4XPHL 1N59B 4HMEA 4LIQH 1J0ZA 1RJLA 4U7SA 1SMOA 2R2BB 2W60A 1FLTX 5JZ7C 3LEXB 5I2IA 1IGML 2XQBH 2V9TA 3L3JA 3LV3B 4G9DA 2CUMA 2FWOA 1W72H 3L7FB 4P59H 4XPFH 1PJ9A 2ARJA 3DLQR 2CDEB 4PJDA 4G3YH 3AY4A 4PJHF 1FNFA 2VR4A 2DMBA 3C6SB 4PBVC 1DBBL 4CU8A 4HKJA 3QRGH 4FABH 4ODUB 4PLOB 4RWHA 4U6TA 4PP1D 5DQ9A 1F02I 1CFNA 3A6BH 3CD4A 1H0DB 3QI9B 1ETZB 3MLUL 3V7AE 3CJJA 1OLLA 3CFDA 3MRBA 4N0YH 5EZOL 3GMOB 4ZUVB 5FUCE 2CGRL 3SJVA 3QDGE 2WZPD 3NACH 3QG7H 4WW2A 4YBQC 4FTVD 1TCRA 4XPAH 3EJJX 5C92A 3T0BA 1XT5A 1ZA6A 4PJXA 1TDQA 2JJWA 4J3OC 3DOSA 4TSCH 4M7KL 5DRZA 5B3JE 5ENWB 5ISZD 4ALAL 1ZHLA 3D3VE 4Y5VA 2VN4A 1BJ1J 4Z7WF 2ZSVA 4G8EA 1OSPH 2DBJA 3NOIA 4U1IA 1AIFB 3MJ8B 4XNZB 4MAUL 5JLZB 1H3XA 3O2DA 4NQCD 3WO4C 1LO2L 2F8OA 3RIFK 2HFTA 5F3HA 1LGVA 2R0LH 1SM3L 2YKLH 4JANB 5SV3A 1EO7A 2VLRA 1J1XH 4UNVA 4RAVB 1J0IA 1Y18B 5JXAL 3WXWH 2OTUA 4ELME 3FZUC 5ERWA 1TZHB 4OSUL 1X6LA 2HFEA 5D7JA 3VDAA 4FNLL 1AC6A 1WBYA 1E0OB 2G75B 1P7QB 4IOIA 3CH1A 3SKMA 3B4NA 4DGIL 4LIQL 1LVEA 3BP4B 5JOPE 1OGAD 3RL2A 1GC1C 2NTSP 4JHBA 1DQLL 3PXHA 3I50H 4DGVH 5HSFA 4HH8A 5DHYA 3UXFA 4M48L 1K4CA 2OR9L 3PP4H 4UBDD 3RGVB 3Q6FA 2FBJL 1NBZA 1MJ7L 1ZT7B 2LU7A 4KHXH 3SY0A 2J6EH 5F1SA 1BFVH 3MCG1 4J3SA 2L4OA 5IWLC 1S78C 5DF0A 1OB1A 5LAXA 4F2MB 3TBVA 4PJFA 1DBBH 3AY4C 3C6LA 1JK8B 1IGIH 2M8XA 4OF6A 1IEHA 3UZVB 2Y07H 4M43L 4MXWH 1EFXB 1J1PH 3GKWL 3LB6C 4XNMA 5FKAB 3TZVB 4YJZL 1GAFL 1WIUA 1RI8A 2C4FU 2A83A 3QO1B 2WIMA 1X5XA 4ZYKB 3PP3K 4GKZA 1BLNB 5A3IC 2ZUUA 4YDVA 3DVNB 4FQLH 1CDHA 3M1BA 2AV7B 1F3JB 5D72H 3QNZA 4JPWL 5B38B 3D85A 3P11H 1JP5A 3H9HA 1N2RA 1CVRA 4W6XB 2F5AL 4I9WE 1ZGLA 4L3CB 2GI7A 2Y72A 4EUPB 4M1GH 5KVGH 5D6CA 4BZ2L 4LQFL 4YWGH 1HYRC 2NTFB 3K0WA 4FXKB 4M7LH 5HD8C 4P5MA 1K3ZA 4W70A 3O2DL 2C1OB 4GRLD 2EYTB 4MJIE 3PGCB 4X7DC 4QRUB 1KJ3L 2BNQA 2MCPL 4NQUA 3O9WD 3T2NL 3ORJA 4EOWL 4F8QA 1KJVB 4F15B 4XNQB 5EOTB 2I24N 4D2NA 3QUYB 4PRDB 5EU5B 3MA7A 3MX0A 3UTSE 2X4TA 4ZNEA 3H7BB 5E6YA 3RWEB 3PQYA 3JV6B 4R7DA 5IMLB 2PCPB 5IHUL 5EU7C 1WZLA 1LK3H 2P47B 1MLCB 4IS6B 4WU5A 1JGUH 3QCVH 2Q7NA 3S9DB 4WEUD 2LVEA 1MPAL 5I74B 3B8SA 4HUMB 5FYKL 1J12A 3OHXB 2FYYB 4OLEA 4P59L 2C3HA 5IW3A 3UMTA 4G7VL 2DLEA 1S7RA 1YNLL 3D18B 5ILTL 1RQ5A 3RTQA 3AREA 4WI3A 5F89B 3P77B 4PGEB 3HPLA 5I6XC 3CDCA 3UEZA 5F7UA 2ICWB 3O45A 4BKLA 3WDJA 3KNBB 3W39A 2OTPA 1EUUA 1CU4L 4XNYL 3T1FA 5HDOA 2AQ3A 4RAUB 1AI1L 2WW8A 3O41A 4PJHB 4ZNEE 1D5ZA 3WD5L 1C08B 1U8KA 3LKNA 3Q6GL 2ZPKH 5GJSH 5EOQL 3JV4B 2C3GA 3QWRD 3MPCA 3PP3H 3ALWA 1YEGH 1KB9J 2NY2B 2ZJSH 4FS0A 2OTUB 1I8KB 3QPQD 5E2WL 5GGTA 4B7IA 5TDPB 1CBVL 2R0ZL 3A6CH 3GB7A 4PJ7A 4JANA 5BO1H 4HPYL 1EGJH 4QRPA 4P2QE 4R4ND 4MHHI 2FIKA 1EXUB 4P23A 3M45A 3D0VB 2QADB 2PO6A 5KS9F 5JXEC 1B3JA 3H8NA 1T7WA 5SX5K 4Z8FH 3EJZC 4XVTH 3R8BB 4MDIA 4XC1H 4W4OC 4JPVH 3ZYOA 1RZJH 2XKNB 3OJDB 4XVJH 5A2LH 3VD7A 4LSRH 2YPLD 4XWGL 3RZCD 3GBNH 5HHVL 3EYQD 4LL9A 3VW3H 4YHKL 4M3JA 3S4SB 3JWOL 1P7KB 1D5MA 3TC9A 1JFQL 5KSBE 3LQAL 4PJCA 3AB0B 4UV7H 2O5YH 1S7QB 3HC0A 4M7JH 3QWRA 5D7SH 1FZMA 1DBJH 1MRFL 1GJIA 3DSNA 2VR5A 5D6DC 3G6DH 5FO8A 3VFOB 4JY6B 5AZEL 1P84J 1TXKA 1IKNC 2NXZC 4TUJB 4PRIA 2CR3A 1OP5H 3EOAB 1H8OA 3H7BA 5ICZB 2D7QA 5D1QB 2CDEA 1FZJA 4U6HA 4PLKC 3HRPA 4WWKA 1KTLA 2BNUB 5IV2B 4EUPH 2NYYC 4JFHD 1MOEA 3BPNB 1MFDH 3O9WB 1FIGL 1IKNA 5ADOL 1T0NA 4WCYL 4WHYH 2NXYD 1HOCB 4XBGA 3CFCL 5DDHA 1A2YB 4BFIB 4XPBL 2Q1EA 5DQDL 3NABL 2H26B 1AGEB 3QA3B 3TIEB 1HHHA 4G8GE 4PLJD 2C3VA 2NY4C 2X7LB 4F8TA 2UWEE 4UUJB 2MKWA 5SWZA 2FIKB 3UJJL 2EKJA 3RVWD 4MA8L 3TFKD 4F3FA 4ZS7L 3KPPB 5HDLA 1S9WA 5DD5H 1PD6A 3R06B 5TDPA 1FRGL 1MHCA 3VDCA 7CGTA 2G9HA 1HSAA 1R24B 4YC2B 4XCYB 3SDCD 1KCRH 4DAGL 3WFBL 1X9QA 5JO5A 2EXWD 1J7VR 2EIZA 4K8RH 3U7WH 1TJIL 3G9AB 4K23H 1ZLUK 4G8FB 2BNRD 3THMH 1NL0H 1F42A 2V5SA 3QUZB 3SDAB 4AL8H 4MA1B 2ITDB 4YHKH 1CG9A 5C0IB 1A2YA 3ULUF 1ACZA 1JGUL 3QCVL 4GRWH 1LO0H 4XNUH 5DHYB 4OZIF 2Q76A 4HGMA 1MPAH 4U1LA 5MEPA 4JB9H 4NQDB 1NMCB 2OSLB 3RWGA 1I7RA 4U0RB 4FQHB 2GT9B 1PSKH 4H1LA 5E00B 4C56B 1CQYA 3LQMA 4K9EC 3OR6B 3MREA 5E70A 1J86A 2MPAH 3KXFA 1BVLA 3IRPX 4HCRH 4O58L 3KYNA 2AK1H 3EOAA 3VGBA 2ZUSA 3F6LA 3QXDB 4H5SB 2HLFD 3GMMB 4LASL 4LLMA 4X6BA 5JHLL 1GGYA 3BGMA 5I8KL 5HVHB 5E5MB 2W59A 2X4OA 4F57L 5IMLA 4W4NA 4D8PA 3HNSH 3MRMA 4WFFE 1BIHA 2VO5A 5CP7A 5TQ2H 5IFAL 4MD4A 1CF8H 3T77A 3G04B 2X4UA 3RU8L 2R1XB 2Q20A 5JUEL 1EAJA 3VG9B 2DQGL 1ZHLB 5HHQA 1LWRA 4TTDD 5DO2D 1XMWA 3IXTB 4OZ4B 1JNHB 3QIBD 4UV4L 3VGFA 1MELA 4RGOH 1PLGH 2RGSA 3KPQA 3P4MB 1A7RH 3SCMB 4PJXB 1J1PL 3SE3C 5C0CD 2XKNA 4X6FB 4PJ7F 3SBWC 3BZEA 4OD3H 3VWJA 1BVKA 1NGZB 2Q3AA 4JRXA 5IVNA 3MGTB 2E7MA 4YX2L 3QNZB 3UBXG 3WS3B 4WW1A 1AP2A 3SKNB 1YJDH 4OLWH 2IQ9L 1JWMB 2OS7A 2HFGH 3S3JA 5LGHH 1R5VA 3BHBA 2OR7A 4L4VA 3TLRA 3ZE0F 4RFNC 4LSTL 4DVRH 2F54D 1NAKH 1PGRB 1JZ4A 3TZVA 1V7MH 4JFHE 1IC5H 5FGCB 4Z7UB 2ADJA 1T4KA 5FV2A 1WBZA 1VADB 3NN8A 4WO4D 3L5XH 1L6XA 5KTEL 2A1WH 5JOFB 4RZCB 4FQIH 5TE7H 2DYPB 3ARGC 1B2WH 2EKSA 3MRLB 1A4JA 1Q1JL 3MRNA 4NJAH 4IMLA 2DRUA 3D87B 4KRPC 3RKDC 5ESAA 2P7TA 2NY0D 1LEIB 1F3RB 1ROWA 1AQDB 2J3SA 3GSVB 4NC0B 5I2IB 1CE6A 5CSBA 2R1WB 2DDQL 3WKNA 4U3CA 1JYVA 5JHDD 1UM6L 5F72S 3D2UB 2FJFB 1DQDH 1PBYA 4F37K 3GIVA 1LE9A 4XP6H 3QIBC 4NWUL 3DX6A 4WI4A 5AWNH 3BQUA 2H9GA 3GRWA 1A6WL 5E4EC 4BK4A 1Y6NR 3QQ9C 2VL5B 2YXFA 2HT4C 2AVGA 5IHZB 2CK2A 1HXMB 3NIGE 3MUZ1 5I1HL 4OZFG 5CEZE 2BX5A 4OI9A 4DKEH 2NXZB 4OV5A 1IFHH 1OL0A 5H2BA 3STZA 2VUYA 4BH8B 3BI9X 3BISA 2O5XH 2CLVB 4LHUD 3L3IA 1CWVA 1C12A 3S3SA 3JV6A 2JIXD 3B9KA 4MDJB 1A3QA 1JHLL 2B7DT 4YDKL 3TWCL 1LE5A 4HH9A 3L7EB 3FHQA 1CVSC 3HC4H 3OAUL 4MA7L 1JN6A 3RWHA 4NUJB 5EZLB 3PWNA 4XB8A 2FEDD 2YA1A 5DWUL 1XGRB 3C09B 1BOYA 2VTFA 4Y1AD 1OQXA 4IDJL 5JQHC 2CDGA 3WL9B 3OKKB 3GJEA 2EDLA 3B6SB 3ARGD 1A6VH 3BD4A 4O5LL 1IAIL 5CJOL 1Q9LA 1N8ZA 4G6AC 5HVFB 1X5GA 5DA0B 2HJFB 4AIXA 5IIEB 5BRZE 1GIGL 5HGBB 4FQCH 1JV5A 4OLXL 3O6FD 3H9YA 4TVPH 5GS3A 5GPRA 5E2VL 1UACL 4MJ4A 4GAYA 1HKLH 3FCTA 2OZ4A 4LLDB 2YD5A 1ADQH 1EJ6A 3FQXA 2DLHA 1DANU 3WFHA 3RGHA 1ACYL 2O26U 3D9AL 4YEEA 2DI9A 2DQIH 5CKAA 5SWQB 2B2XH 4WW2C 5D7LA 4F2MA 5J1TC 5BCAA 2YD8A 4HS3B 3VD5A 2HLAA 3P0VH 5FYJD 2BMKA 1L9MA 1NFDE 5MENA 5BVJB 1IGFL 2AEIT 3FQTB 4P2QB 1A0QL 4O2FA 3MUGA 1T7YA 3MGAA 4KUCD 1DN0A 1N59A 2EIBA 2J88H 2XA3A 2OCFD 1XGUB 2NLJA 2V17H 2Q6WA 3VFNA 3GEWB 3S37L 5HHXH 1RZKH 1FQ9C 4P2OD 1T66C 3I2CH 3U4AA 5L2KA 2NCMA 4JKPH 4G6FB 5GJTH 1R0AL 2GIYA 3W11D 1OAYH 2C5DC 1WIPA 1HH9B 4JHZA 4MD5B 4D9QD 1JWSA 3MLRH 1ZTXL 4JFFD 1T03H 5I30L 4FOMA 4P4KD 3MXWL 4NRZB 4FQ2H 5DJ6B 2A73B 5GGRB 2OL3L 5HGBA 1F3DJ 4NNXB 4X7SL 5C6PB 3LN4B 5CJXC 2IADB 1SM3H 1AXTL 3CUPB 4OAWA 4ZFFB 1N64H 3VG9C 5JOEA 1S7UA 1X5JA 4MJ6A 3T65A 1JHTA 4JDVA 4PJDE 3NZHH 3C9NA 5E08L 4FNLH 4ZXBB 4Q9CA 1P7HL 2EC9T 2AP2A 3MODL 5ENWA 1OGAB 5EBLA 1FPTH 5I8EB 1D5BB 4NCC2 4KJYB 3WO3B 4Y2DC 1KEMH 4RMSA 2A9NL 4WI7A 3IDJA 4BFEA 4NQEA 5B8CC 1YPZA 3V79C 3RTQC 4KKAC 5CJQL 2RBLA 4YQXH 1XZ0B 1U58A 1RULH 4LCUA 5GGRA 1HSBB 2CLVA 4NKMB 5KJRH 4HD9A 1OARL 3JUYA 3QXAA 1HINH 2PR4H 5D7IB 3OZ9L 5IG7A 5DJCA 2JCCA 4GW5A 4TVPE 5C0RH 1MH5A 4ODHL 1U8LB 2DBLH 3VXSB 5IVXF 3WYRA 1FVEB 4AL8L 1YMME 3ZSSA 2BSSA 4ETYA 3QULA 1VACA 2P48B 4KK5D 4X6DF 3WNKA 2W9EH 5J1AB 5I1GL 2F19L 4KKCD 3V6FA 2YN5A 3O4OC 2IPUG 1KBGL 5DJ8B 4PJ8D 1I7TA 1XF5B 1D5BA 2YN3A 1NSNH 3MV9A 2ZNXA 3EJZD 3L3JB 3LV3A 1YYML 4P2CG 4TUKL 1JHTB 4JDVB 3HUJE 3Q5TA 4PTTA 3D3VB 2XKUA 3BZ4A 4XC3L 5HDBF 4KVCH 4LGSB 3BJLA 3MJ7A 4P46C 3RL1B 4G9FD 3VXRA 5DJYB 1OW0A 2CD0A 3EHBD 3QI9D 4J8RB 3LN4A 2FX7L 4KUZH 3O4LD 1T1XB 4OQTA 1F4AA 1IGCL 3MJ6A 4XXDB 2A73A 3VXUD 4ZPVB 4H20L 4G43B 1DE4B 1QLFA 1CF8L 2ZG1A 2WWKT 1MFNA 3CVIH 2MHAA 1DL7L 3DMMD 1JWSB 1J5OH 4GXUN 2Z31C 3ZYJA 3I9GH 2COQA 3HE6C 4P46A 2H32H 2A6DA 3QUKA 4PJAB 4QRPD 4UV4H 4I3SH 4WFHE 4D0DB 4FTVA 1SY6A 4R4BB 3WS3A 1IM9A 4DGYH 2Y7QA 2OJZH 1HQRA 3G5ZB 3SKOB 4FFVC 5DJXB 1KN4H 4M6OL 1KLFA 15C8L 3C60C 2J8UE 1GZQA 3WE6B 1OP9A 3EYSL 3NA9H 5C1MB 4DCQB 1IGJB 4OD2B 4OZ4A 1RZFH 4OF3A 2HKHL 3QCUH 3QIWB 3DI3B 1F97A 3SN6N 3NCJL 5JNYA 2IH1B 2H6PA 2VN7A 5JPMA 2DQCH 1OVZA 2DLIA 2ED9A 1ORQB 2FD6H 3PV7A 2FEEL 5ACLA 4JFDB 2EE2A 1C8PA 3PQYE 1Y0LA 1N3NB 2AW2A 3OKEA 3HNSL 2X70A 4LLQB 3NPSB 4HUWB 5DUMH 1C5BL 5FKPB 2H2PC 2A6JA 2F54B 2QHLA 2GW5A 4MCZA 5C09D 5HYJB 3BUYB 4L3EB 3EOTH 1KN2L 1A1NA 2CO7B 2XQYK 3HZMA 4QRTA 3BGFB 4PRIE 4HULB 3KPNB 3QQNA 5C9KA 4P23C 3WJLC 2DM7A 3VRJA 3UTTD 2ZJSL 1MCLA 1A9BA 4Y8DC 3A6CL 3JVGC 5FGCE 1CFVH 2I9LB 5DJZB 5D70L 1N0XL 1QOKA 4FZEL 4U1NA 3QDGA 1K5NA 2BJML 1EO8L 2ITCA 5TQ0H 4EN3C 4TULH 1IGJA 3BOVA 35C8H 5ALBL 1P4LA 2P8MB 5L2JB 2W1NA 4IMLB 5DD3L 5EBMA 5EIIA 4X6DA 1D5IH 3V8OA 2F74B 4EI6B 2MNUA 4NNXA 1ITCA 1Q9WB 2R69L 4HBQA 1EK3A 3CFKB 5D5MA 4K94C 4UT7H 1AGFA 1QRNE 1AGCB 5L88L 1WITA 3ARBB 3LD8C 2J1KA 4N0FB 3ZDZE 3HE7A 5IB5A 2RFXA 3MV01 1FV1B 1PG7X 3F6IA 4APQD 5JXEA 2VJXA 3NTCL 3O9WC 5AG8A 1GZPB 1P9MA 5DLML 3HZKB 2R0KL 1A02N 1AGEA 3C2AL 4C55A 3SKUD 4MVBD 1NCNA 2I5YH 2E27L 3IJSB 4JJ5A 4IOFD 4JFZL 4FQXB 2PR4L 3MQIA 2DI7A 3S97C 4OLUL 5C07D 4YGVB 1OQOA 1CE6B 1CFSA 2BRQA 1YEFH 4CNIB 4GW1B 3O9WA 2JB5L 2ERJB 2XWBB 3TA3C 3FT2A 4J1UB 1T21B 2ADFH 5L6YH 5BV7L 1CLOH 1NGQL 2IC2A 5ELIA 2F19H 4YO0B 1ZLVH 4CU7A 2VISA 2DYPA 1VDGA 3QDME 4D8PB 1T5XB 3U7YH 1IT9L 3KXFE 3RUGF 1T4KB 4YPGB 2IJ0C 2VXVH 2CJUL 4WUUB 4XI5C 2IH3A 5JXAH 4OBSA 1J88A 2AK4A 4DQOH 1VA9A 2Y5TA 4NKMA 1ITBB 1NCDH 5DVLA 5KG9A 3QQ4A 4PFEA 4EDWH 3T09A 3O3EA 1OCWH 1MFAH 3SJVE 1FFOB 3FQWA 4QXGH 4F7PB 3H9SB 2CDFA 1E28B 4OB5L 1R3IH 3OJDA 1SMAA 2YD3A 4PRPA 1FNHA 3S6CA 3BKML 3C9NB 1ZANL 2OK0H 1CLCA 4G5ZH 4C4KT 1T1WA 3HC3L 1L6ZA 3T77B 2XWTA 2ED7A 1BAFH 2IADA 1FNAA 3D85D 2MMXA 4XCYA 1VEPA 3VXNB 3I6GB 3UO1L 4CUCA 5T1KB 1C5DB 3GMNB 3P40A 3JSSA 4JG0H 1P6AB 3RY6A 2B5IB 4YXKH 4ODTL 2OL3B 3O11A 5FO7A 2WBJA 4X5LA 3ZDYE 3O8XB 3ZZ1A 3MACH 2A0LC 3QDMD 2C1PB 1Z9LA 4K3GA 4ZQKA 4EBQH 3GO1H 5GIRA 3SGDH 4OZHF 2NY1C 4FQHA 2ZUTA 3AB0C 3NCEB 4OKVB 4WUKL 1GGUA 1BVZA 4X4YB 4JR9H 4LLUB 3BKCH 4X98A 1MCEA 3F12A 4FQLL 3LKSA 5DDHB 4KAQL 1F4YL 2VABB 4PJEE 3PWPA 4UU9B 4CU6A 4Z95H 3QAZB 4CKVX 3H7LA 4OFVA 1FVDA 2Z31B 3DARA 4TSAH 3MOBH 1YYLH 5KOMC 2DTML 3SE3A 5GS0C 4MJ5B 1KNOA 3B9KC 1HH6B 1X5AA 4ODXA 2XZZA 5ESAB 2QLVB 1S7RB 2BK8A 1XGTB 4KK5C 1MQKH 3PHSA 4OCRL 5JO5B 1YQVH 4ISVB 1LP9F 5EIVA 2EH8H 3NFNB 4I0PB 2UY6A 2DQGH 2P49B 5CWSB 4ZUUB 3C60B 1SJVA 2GTWB 2P8PB 5FDWA 3WD5H 2J4WL 4NPYA 1A14L 3F62A 2H1PL 1BX2A 2CRYA 1INEH 3O2VH 3SDCC 5CIPH 4G8GD 1NBYA 2JCCE 4LU5L 1F4HA 3ULVL 3WXVL 4NP4L 2AJUH 1JWMA 1U93B 2OXGA 2ZCLH 2UZYB 2D3VA 4FFZL 1QA9A 1D5MB 1GPOH 4RGNB 2BERA 1MAML 4GMSH 5GGVY 5HD8D 1N8ZB 2NY6B 1EZVX 1CGTA 3VCLB 1JZ3A 1IBGH 3BKJL 5HDQL 4Z7NE 5J9PA 3GJEB 4XPTH 4M3KB 1VKXA 5LG1A 3LRGA 3JUZA 2IEPA 2PETA 4O2CA 5DT1L 5HGHB 2XG4A 1XF3A 4QHNB 4ERSL 4NQDE 4PJIE 1B0WA 2R9HC 1B0RB 1H3PH 5E03A 1Q1JH 2FNBA 4RQQA 1R3LA 4MD4B 2IAMC 4YFLF 1IGYA 4JM4H 4C83B 2HVKA 1AI1H 1CIDA 5ESQB 4G8IA 4PJEF 5I16B 4JFPA 3GHEL 4Q2ZA 4LGRB 4QGYA 1EFXA 1QHPA 3DVIA 2AJXH 4H5SA 1OTSC 4YHPA 1JK8A 3KYNB 5E0QA 5HHME 2JF1A 4S10A 4ZPTB 1FE8L 1U6AL 3MSPA 4C56A 2NY7H 3O41B 2VL5A 2DS4A 1WT5C 3WIIH 1CLYL 4RIRB 4LVHB 1B0GA 5KN5A 1T04B 2ZUQC 2RCSL 3ARXA 4LPCA 2G5RA 3EGSA 4UTBL 4PJ9B 4DUWA 5I8OH 1NFDA 5AAMA 4DUVA 3H3BC 4XVUC 4MNHB 1ZHNA 1L7TH 3N1MC 3RZCC 4P23D 5BS0B 5C0DB 2CIKB 1G6RB 1YY9D 4YDJA 3UTSD 3KYKL 3EO1B 3FB5B 2BVYA 1MJUH 3G5YA 3KPLB 4PRNA 3QEUB 4QXTB 1MFAL 3SE8L 2EXYD 2L0DA 3P4LA 5KSAB 4RMTA 1IILE 2DM4A 4NWTL 2IFFL 1IAOB 4QRSA 4YHOH 4TNWK 4E5XA 5DJDB 5DHVA 1EFXD 5BVPL 2ZCLL 3T3ME 5C86A 3PQYB 2MQCA 4OLXH 3U0TB 43CAA 3GDBA 1CICB 2X4RB 2WM0A 3WKML 3ZYIA 3NCMA 4RQQB 4TULL 3V7MA 1HHKB 2C3VB 1JTPA 5EU6D 4XH2A 1YEIL 2GJZA 2Q7YA 1JE6A 3WJJA 4ZOEA 2DWEB 3VFMA 2D31B 2GK0A 3FQNA 4P5MB 3UZQA 3L95A 3P4MA 1UA6L 1QSED 4LAQL 1KLGA 1QR4A 3FFDA 4FXGB 1S5HA 1P6FA 2ZUQB 3DROA 1PAMA 4JGJA 3QQ4B 3ZDYF 4JE4B 1OAUL 1A1OA 3VI4E 4NM8L 5CFHA 5K9KB 4OZHE 3WJJC 4DK3A 4PV8B 5CCKL 5ICZA 4NGHH 3Q5YA 5DQ9B 2X4OB 3GKZA 3FTGB 5IB2A 5I9QC 5KAQG 4XNMB 1MCFA 3TT1L 2E27H 4U2ZA 5C8JB 4CVZB 4M7LT 3O8XC 3EHBC 2D7TH 3QI9C 4JDZB 5FYKE 1CZ8L 3R0NA 1G9NH 1S7QA 4KJQC 3C5ZC 2ZOKB 4LEOB 3V4VH 1F90L 3SY0B 1HQ4A 2OSLA 3RWGB 3S4SA 4Y4HA 3CLFL 4GLRH 2PTTB 1VFBA 3LEXA 2OM5A 3U7YL 1IC7L 2IPTH 3G5VB 1K4CB 4JM2F 3LPGA 3OB0H 5DEGB 1OGTA 3THML 4HKBA 4DTGH 1M7XA 3DMMA 5B38G 4MHHG 4OGYL 4TNVF 1DEEB 1DCLA 1UG9A 2D0HA 4QXWA 4F9LA 5IKCB 1YQ2A 5IHBA 3CLEL 3ARWA 4DFIA 1U95B 5FO9A 4JZOA 4ZQKB 1DN2A 5IM7B 5E08H 2FECL 3EDDA 1CTOA 1U2CA 3ULSB 3B2VH 1HIML 3T04D 1JNJA 5HY9A 3RVUD 4PJXE 2I5YL 3F7YA 4Z5RA 5ID0A 3IGAB 4M61B 4KVNH 4WHDA 3UTTA 4F3FB 4PJCF 4QXTA 3QDAA 1BFOA 4FTVE 4N1CA 3IT8D 4OZIB 4YHNB 1JGDA 2QKIA 3BT2H 1MJ8H 5L7XH 1OB1B 5LAXB 5T33L 3KLHD 2WLZA 5F7EL 2GHWB 3O0RH 3S7GA 4FQIL 4I5BA 3RPIB 3ULUC 3IU3A 2FJGB 1AKJB 4RSVA 4QO1A 3O3DA 1U0QA 5IROC 4DEPC 4KJWC 3STLA 3BDXA 1MI5E 2J6EA 4KMQA 3HAEH 4K94H 5SX5H 1HWHB 3UO1H 3GSOA 1S7TA 5CJBA 4X9IA 5I73B 3QYCA 2W9EL 2I60H 3CFBB 5EPMB 2XXMB 4JKKA 1ZVYA 3LEYH 5F89A 1I3GL 3G08B 4PJIB 1MVUA 3RL2B 1IAKB 3GMOA 4ZUVA 2XOTA 3SJVB 3JBG7 1TCMA 2ADGB 3VGGA 4GRLB 1EMTL 2W91A 5TF1L 2VLMD 4U6HB 3V4PH 4QRTB 1NSNL 3TJHC 1H0DA 4KK6C 5HYJA 3AXLB 5BJTA 1I1FA 1R6VA 3CC5A 1YUHA 4YDLC 3GJFH 4WU5B 3B8YA 3OL2A 4QXGL 1R5WA 2FO4B 2IMNA 2B1HH 4OIIL 1ZEAH 1C16A 3FFCD 1BWWA 4XNYH 3PE9A 1W0WB 1YY8A 1QEWA 3IDUA 4W4OA 2HG5B 4HAGA 1YNTB 1ORQA 2FX9H 4I3RH 3CVIL 1J0YA 5F9OL 3BPCB 4G9FA 5HGAA 3OKMA 4RMRA 3GSRA 3I9GL 4NYLA 3RVVD 4P4KB 1GH7A 1IARB 3GMLB 3ARRA 3FFDB 4Y8AA 5T1MA 2AXJA 3KPRE 1SVZA 1OAZL 3QDGD 1DQQB 4XAKE 3QUZD 3CLEH 1CDIA 1X3DA 1NPUA 4GAGL 2QR0A 5EBWA 4BSVB 2CH8A 5AYUH 3N1QC 5E5UB 4Y19A 1KEML 4JFYA 4NKIH 3BZFA 5KVFH 2AXHA 2GJZB 4UV7L 4PIRF 2VQTA 3MV8B 4UINH 3PGFL 1LEGB 1ZGLP 4P2YA 1KPRA 2JJTC 3L3GA 3VDBA 5C0RL 2VOTA 5E1AB 2WBJD 4XBEL 3B9DA 2ICEA 1Q9OB 4TOYL 1DQJA 4JKWA 3CPLA 4RBPH 4WENB 5J3HC 4IIQB 2EEAA 12E8L 2HJKA 4NOBA 1D5ZB 3I6KB 3ARDD 3UX9B 1HHJA 4KTDL 1S7XB 5MHSD 3JVGA 4R8WH 1NBZB 4OCRH 5AUMA 3HI6H 4H1LH 3PWPD 1SY6H 4NSKA 4MVBC 2VWEE 1OLZA 1B4JH 4JM2D 1IAIM 5MEQA 1MCWW 4HZAA 3LKSB 4BQCA 1T04A 4Z76A 2FH8A 4KJWD 5CBAB 2WV3A 3DYPA 1GCFA 1MHHA 1WV7T 5FYJL 4XMPL 2J5LC 3HE6D 2G75A 1U3HD 4H20H 2F58L 5HGDB 4M00A 1WC7B 4X99A 3B9VA 1AY1L 5DJCB 5D2NC 4RX4A 1UKSA 1G6RL 2CK0L 3DYOA 1M7IA 3ZDXF 4PTUA 2EH7L 5ISZA 4DTGL 3X17A 3VRIA 4NFBA 1K9TA 3HFMH 3SO3C 1KCVL 1RZ7H 1ZTXH 4KK8C 2F5BL 4AIZA 4M8QB 5EU5A 2FH6A 3VXOA 2EDYA 3V6OA 4JAMB 4XCFL 5C0NC 1OP3K 3VG0H 1SYSA 1R3KA 4HUXB 5CS7A 1OAKH 4UT6H 1LP9E 2ATKB 2PW1A 3HUJF 4O2CB 4KK9C 1UB6B 2JTDA 1EEUA 3L9RB 2D7MA 3RQ3A 3TA3A 1GZQB 3WE6A 1MNUL 2BY0A 4LPTA 1LD9A 5GGUB 1V7NH 5CINH 5JPNA 3AS2A 5DJXA 3ROOA 3D85B 3HE7C 3D39A 1F11B 2J88L 1NDMB 2OXHA 3D0LA 4PD4J 4L4TE 4PJAA 5TH2A 4E42B 3SEPA 4MWFB 3FQUA 5EC2B 4S0TD 1EHXA 3OPZL 5GJTL 3WIIL 1WJ3A 5ADOH 4PJGE 1MFEH 1R0AH 3WN5C 3O6LL 2VXUH 4YR6B 3B5GA 5F1NA 5SWSE 2IPKA 4DOHB 3DVGA 2B1AL 5L2KB 1SEQH 4Q9QL 3RTQD 2GY7B 1FORH 5INDA 3TBWA 3ARDB 5TDOA 4M93C 1FFRA 5F88A 1A9EB 4LLYB 2B4CL 4MD0A 5JW3L 1WEJL 3RWFA 1I7UB 5DUBB 4HCRL 4FABL 4NJ9H 2N7AA 4U6XB 4JREB 3TO4B 3LAFA 1MJUL 5E9DB 1NGPL 2IANB 3FB6B 1CN4A 2DQUL 4JM2C 3CXDL 1N7ML 3MROB 2IFFH 4L4VE 5E7BA 4OGAD 3HG1A 2JELL 4NQVB 3R0MA 3VXMA 1F8TL 2PTVA 3MUHL 4EDWL 3Q2CA 1YNKH 2AK4D 3PV6A 5LGHL 3LDBB 5IBTH 4LLWB 5T1LB 1WBYB 1RUAL 4MNQA 5E2UH 3QUXD 4KMTL 4NDMA 2E7BA 4CW1B 1Y6MR 3QZWG 5DZLA 5L8JB 4GAYB 4WHTA 3ARSA 4JFOB 4DN4H 3QZWA 4G5ZL 2D03H 1I8IB 4J3VA 5DRXA 1T2JA 4LLVA 1LEKB 2AAVA 4LAQH 1GOFA 1NEZA 2HH0L 2EO9A 1T83C 2D7NA 4MB3A 2FSEA 5EFIA 3TFKC 3DX7B 1EJOL 1JPFA 4TSBH 5F9DC 3W81A 5L2JA 1J1OH 1Z2KA 1PKQB 2VAJA 3IU4L 1ULVA 4X4ME 1RVFH 1MNUH 2KPNA 5IWLA 4GQ9H 4L4TA 3ARBC 4PJAE 1JYWA 1FL3A 2W9DH 2LVCA 4EXKA 3LN9A 3H9SA 4LQ1A 1QTYT 2Y36L 3SDXF 4XPFL 4F57H 4UTAH 5FCUH 1QKZL 1FFOA 1Z9MA 2LTQB 5EZOH 5CMAB 1R3JA 4JR9L 4LHUG 3VRJB 5T3XD 4Q9BA 5DJAB 3HZMB 2VXUL 5EU7E 2KL6A 4OZGE 5E9DD 4LCYB 5D93B 4ZFZA 3WN5A 5AD0B 3H3PH 3ES6A 4LHJB 4MNQB 4U1JB 2AXFA 4QRRA 3P4OB 2V2TA 2YPVL 3OKDB 2CKBH 1MQ8A 3LS4H 3L3HB 3TH4T 3MOAH 4YHLL 1QBMH 1MCCA 3D2UA 3MRFA 5E8PB 3O6ML 3F58L 3S35X 3WEXB 3RNKA 3ZE0E 1F6AA 5CZVH 5D4QA 2JK5B 2BZDA 5I76B 5J4MA 4P46D 4NZRH 3AUVA 5KTEH 1YEJH 3QCUL 1X5ZA 3V0VA 3WIFA 3X14B 3E0GA 4DGIH 1LK2B 4LFHG 5T1LD 5TDOB 2CMRL 4PJAF 4CADB 3KDMB 1NCAL 2R2EA 1CDCA 4LSUH 4R9HA 3H3KA 3SE4A 4S1DD 5BZDA 2GITB 3ES6B 1Z9SA 4KKCC 1JRHL 1XGQA 1DUZA 5K9JL 3CZFB 4E42A 5IB5B 4ELKB 5CGYC 2A9MH 3HB3C 4WW1B 2H32B 4HUKB 4B0MM 2BNRA 3TCLB 1VEOA 1BJ8A 2R1YB 3BZEB 3GBLA 3I6LE 3KPOA 4QLRA 4LHUB 1KELL 3X3FL 2VDNL 1LD9B 5GGUA 1UWGH 3LIZH 4YGAB 2B8OT 2ZKHH 3P9LA 1P4LB 5JDSB 3QQ3A 1DQTA 3MZGB 3OKLA 2B5IC 3FO1A 4JZJA 4S11A 2WBKA 1N0XH 4HG4J 2AJSH 1PKOA 3BEVA 1NKOA 5T3ZL 3T3PE 5KVDL 1G7MB 4MAUH 4OCXH 1SVCP 5C0BD 3S35L 4P9HL 4JRYB 3MRIB 5H2BB 4KQ4L 4Y4FD 4QCIB 4KY1H 1J0KA 2XN9E 3VXSA 4FG6C 5DJ0A 3SQOL 3WN5B 4M1DL 1KC5L 3K8KA 2JCCB 4GW5B 4JO1H 1SY6L 4H1LB 3QXAB 1OAZH 5IB4A 3QR2A 2C7UB 1MVUB 3NIDF 4G80A 3CVHH 4HWZA 5E8EA 4Z7VF 4NQDA 2WUCL 1RZIA 1UB5A 4U4BA 1FRGH 1BZQK 4LF3A 1MCSA 4PG9A 2AK4E 2EZ0D 2OQJB 4PJFE 2ITDA 1FNEA 3DPBA 3VA2C 1L4IA 3TO4A 3IAPA 2QADC 1ADQL 4F37F 2WSKA 1NC2D 3FONA 5DC4B 1RIUL 4KUCF 4XAWL 5IJKA 1YEFL 2DF3A 3DX7A 2N7BA 4BZ1H 3TBWB 4QRRD 5EUKB 1EEZB 1DVFD 2ORBL 4RMVA 1IM9B 3BH9B 1RZJL 1LO0L 4LLVB 4AIOA 3CAFA 3QJHA 1MHEB 1QRNA 1SBSH 1IL1B 2GUOB 4YE4H 4RMUA 3V6BR 3QHFH 4KXZH 1U9KA 5EC2A 1U41A 3T0EB 3LEVH 2X4SA 1QLFB 1W8NA 1I3RB 3V4UH 4Z7QE 3D39B 4JPKH 4YH6A 3DBXB 4NGHL 4LASH 2VDPL 4XCNB 4GUPA 3CNKA 4PREB 2NLJB 3VFNB 1U3JA 4X5WB 2EDRA 4WU7A 2B0SL 4JFFE 4NO0A 1HOCA 3MUGB 5JR1L 3WIHL 4HXBH 4Z0BL 5DI8A 5EA0L 1IEBA 1K8IA 3TA3D 3MBEC 1ZHKA 1QFWM 1F6AB 1VFMA 4XCCH 4DKEL 5ICXA 1JYNA 3K80A 4YHIA 3N85H 4F9PA 5E8PA 3V4VL 3BKMH 3BRGC 2JCCF 1F4WH 1TTUA 3LH2H 4CDHA 4K7PX 2VDRL 4I3GA 3O4LA 5F1NB 5IHUH 1N4XL 4PTUB 5D2LF 4OZGB 4LDOB 1I75A 4DZ8A 5IB2B 1DDHA 4Y4KC 2P1YA 3QIUB 1KJ2A 4Z7OF 2XYCA 1QLEH 1KYOJ 1FPTL 1FNLA 3JWOH 2YPLB 4GXUM 4PUBH 3RZCB 1KGCE 1IAII 1KPUA 3OX8B 1YEJL 2DQTL 2H41A 4NO5B 1A6ZA 4WWID 3QG6A 4Z7WB 4C59B 1XZ0A 1BECA 4FQQA 4WTXA 4U1LB 3MRRB 4NHUA 5DRNA 2ESVE 4XC1L 1KLGB 4HF5L 4Y4KA 2BVOA 5AZEH 5C09B 5HYJD 4MXVE 2BOCB 3PABA 4J6RL 5IBTL 4F9LC 5IT2H 3IFPB 1UA6H 4NSKB 3U0PA 3KPRA 1AH1A 2V2WA 2DBLL 1UT9A 1EVUA 2AEQL 5EU6E 5GZND 4LOUC 5JA9A 5CUSL 3TN0D 1JN6B 1GGIH 1XCTA 4P4RB 2QKIB 1KACB 2DL2A 2DKUA 3ARZA 3UTPE 3MFGB 4KZEL 5DZNA 1QACA 2Y06H 4AQOA 5EZJB 3D9AH 3OAZK 4Z7UE 1F5WA 5D7SL 1C5BH 2Z92A 4LNRB 3MLPA 2OZ4L 4M62L 4E5XB 4JVWA 4NN5B 5E8NB 1KLUA 1P4IL 2NY2C 3DX8A 2DLFH 3KXFD 3NAAL 2ARWA 3HI1A 3NCJH 4MA3A 3ZE2F 3QEUA 4XC3H 2FR4B 1QSZA 1A0QH 5BV7C 4ZAKA 3IFLH 1IGTB 3L3OA 3BQUB 5T3ZH 4NQEE 5CBAA 4JQIH 1G7QB 1CD9B 3DGCR 3KYAA 5E95B 3GZKA 3QDJE 3QP3A 4KY1L 3UC0L 3MLSL 5I1AB 5I17A 3FB6A 1H5BB 4YBQD 3QWOB 1MAJA 4Y16D 3AREB 1FFNB 4U6XA 5IEHB 1FSKC 4KTEH 4XAKD 3BWUC 3BPCA 2ZOKA 4LEOA 4XHJD 1UJ3B 2YOCA 1YN7B 4WDIB 1HXYA 3RDTD 1FO0L 4ERSH 1MAKA 2KKQA 5DK2A 4K7PL 1H3PL 4DWHA 2JJTA 1DBJL 1OW0C 3WLWC 1ORSA 4HIJA 1A21A 1NLDH 5T5NG 4NN7B 2ZCKH 1PDKA 2ZSWB 3BYYA 1IQDA 5MHSE 1KG0A 1FZMB 4P5TD 3RWEA 4HEME 1WBXA 3QDJD 4NCDA 2GFBA 2J5LB 5L2KD 3MV8A 3MODH 4HCRA 2A6IB 5IMMA 5IOPA 1NEZG 3INUH 1UACH 1B0RA 3T8XB 1QSFE 5L8LB 1WZ1H 1GOHA 5F7EH 2C4FT 2KZ1B 3PWLB 1GC1H 1P1ZA 1U8JB 4ZTPL 5FA4B 4L8DB 4A6YB 1RULL 5EORH 5EOCH 4WO4B 4U1MA 1SBSL 3BQUC 2WNGA 3VGEA 1FVCA 3JWDC 3NZ8B 3STLB 5EO0A 1ZHBB 4I13B 4P5KB 1MCNA 1U8JA 3O3DB 4WWKD 4KK9D 4HUXA 1FC1A 5HGAB 2VZOA 3I85A 3FT4A 3ARED 1KEGH 1WZKA 1U93A 3L1OL 3RKDD 3G04A 4JAMA 1EXUA 4P23B 5BS0D 4HC1H 1PZ5B 4LKXB 5F7NC 3X13A 2OTWA 1LO5A 4BQBA 3NH7L 3R4DA 4NM8H 1JBJA 4EI5D 5DSCB 1XEDA 3GI8H 3S37H 1M6OB 2OJEB 3MRJA 5HHXL 3VFPB 4FZEH 4L4JA 3QIBB 5F7FA 4U3XA 3X3GH 5FHAL 1RUPH 4FQXD 1MREL 3G5YB 3FRPA 4PRNB 4XXCA 3MV8D 4ZAKC 1A47A 5C6TH 4H26B 4OM1H 1UVQB 1HILA 4ACPA 3WFCL 2HTKD 2PUQT 4GRLC 5E99L 2Z35A 3WBDA 4K8RL 4HLJA 4P48A 3JTSA 5IBLC 4Q9RH 1PYWA 3QWOA 5FGSA 4EZMA 3LPFA 5T3XE 1NJ9A 4A6YL 1PVHA 4HKBB 4MJIB 1ONQB 3IDIA 3LD8B 4XVSL 3ZT5A 5D8JL 1VFBB 4X7SH 3BP5A 3L5XL 1KFAH 5AUMB 4NZUL 3I75A 3VG0L 3TBTA 1QFWL 4E41D 1BAFL 3IDNB 4XCFH 4M4RA 5DGQA 6FABH 3OAUH 5GRYA 3WFEH 2CIIB 1HYSD 3VWJC 1TZGL 4B50A 3BH8A 3ARTA 5FO7B 3ZSTA 4OLZL 4XPHH 1C5CH 3NA4A 4EDXA 1JNNL 4OB5H 4U49A 2HRLA 3I6GA 4GMTL 1FO0B 4Y5XC 3O3BA 1INDH 3AU1B 5IR1B 4HBCL 2UYLB 4UOW1 1QQDA 5M94B 4KK6D 1DEDA 4Z78B 5E94B 2QL1A 2AGJL 3QUMA 4BZYA 4PS4H 4X7FC 4HC1A 1LP9A 2GYSA 3FN0H 2C4XA 2VZTA 4LSDA 1NAMA 5HYJE 4APQA 2OZ4H 1T66D 3SCMA 4JRWA 3FQRB 2BVOB 5DEGA 2BSRA 4PJHE 3IYLW 1G1CA 3L1OH 1KYOK 3TO2B 3BEWA 4WW2B 3QG6B 4Z7WA 2CQVA 4X7EC 2EE6A 4U1HB 1MI5A 5IOPB 3OX8A 1HHKA 3W0WA 4ZYKA 4QYOA 4R2GB 3VWKD 2VQUA 2NX5D 5DMJB 2ZSWA 1C16B 4KVCL 3WXWL 5LWYH 2VLLB 3QFJA 3C08L 1AY1H 4K8RD 4QT5B 4XMKH 4JLRB 4X7CC 4TSAL 5FO8B 3AXLA 5BJTB 4ZS7H 3ETBF 2NW2B 4K71B 5HHOD 4R26L 1YNKL 2X5PA 4KTEL 3FFCB 4KGJA 1R5IA 3VU2A 5C0FA 2F5BH 3UYPA 3OJ2C 1CGSH 4GRLA 3I02A 5I0DA 1Z0MA 1KJMB 2H3NB 4X8JA 4BELD 5BMFL 1I3UA 3I75B 1P7KA 4PJIA 1K8IB 4JM2A 3HE7D 4Y2DA 3DECA 3WFZA 2P5EA 2NY3D 3W5NA 3VFWA 1G7HB 4ODTH 4ELMB 4DJMA 3BIKA 4G6JL 4QTIH 5C7XL 3MGOA 3HKFA 2SEBB 2VLRE 4PP2B 3RWDB 4I5BB 3WDHA 3EJYC 3MCKB 3WHE0 3IKCB 4GAGH 5GIRB 3SO3B 4RFOH 1N6QH 3DHMA 3TVMA 4X9HA 3IKKA 1RZ8A 3LZFH 2NQCA 1S9YA 3QIBA 4K3EH 3VJ6A 1H8SA 5CGTA 3V52H 3PUCA 2AABH 1JNLL 2I27N 2YC1A 5K9OB 3FB8B 3LMJL 3N9GH 2VXQL 2MCG1 2OTWB 2F53E 5EA0H 4JY5L 3B9EA 2AEQH 1MHPH 3RY6C 4U1IB 4OIIH 2ATPB 2EC9U 1I9RL 2P8MA 4L3ED 2BRRL 2F5AH 4A2LA 3ABZA 4QY8A 4MA7H 5IKCA 4UAOB 4PPTA 1J8HB 5M95B 4YHMH 3MLVL 3GJFK 3QDHA 1EAPB 3MV9E 3CVHA 2VDRH 2R2CA 3F8UB 5GGSB 1FNGB 2MQ3A 1S5IL 3WS6A 3PGDA 5T1KD 3MLZL 1CE1H 1JPGB 1F8TH 3I02B 3OKYA 3TYFA 2V2XB 3ZHDA 4JN1H 3VXRD 3QI9A 5IQ9B 3BPLC 1LO3H 3OHXA 1I1YB 1QSFD 3EDFA 4YHPB 1E4WL 5DD6B 4C4KO 4PRIB 1EV2E 2L7JA 5DD3H 4HEPG 1BX2B 1CDJA 1U8MB 2W9LA 4LLQA 4ZXBD 3UTZB 5IJKC 4XI5D 4K8RC 2FZ3B 4P3WA 4YUEH 4JY4B 2QJDA 4G7YH 3DXAA 3VI3F 4Z8FL 1CT8B 2GY5A 1KT2B 2WIIB 5B3NA 4ZMAT 4CJ1A 3G6AA 5JPMB 2DQFB 1NFDF 2HMIC 1XF3B 1CK0L 3DROB 4QTIL 5J6HB 1RUQH 5C0GA 4QXUH 3H6JA 1A7PH 5ADPH 2HT2D 3I6LD 4CMHC 1CU4H 2OI9C 3D25A 2Z93B 4I48B 5IW1B 2X4QA 2GK2A 3GMRB 3I84A 2ZPKL 4R4BA 4K3EL 3O8XD 5E94A 5FGRA 3D0VA 2GKIA 1CICA 2X4RA 2ZKHL 3FO9A 3O8XA 1KCUH 3HI1B 3N1GC 5E7FA 3DGGB 3QDMA 3MV11 2E6PA 3MLRL 4X7TA 5BO1L 2UUDK 2BCKA 4LNRA 3W2DL 3QH3B 2XTJC 1DLHA 3AS0A 5CEYB 1Z9OA 32C2A 3GSXB 3FHAA 4HK3J 4LCIL 5T3XH 1RU9H 1CTNA 2CXKA 5DMKB 1XGYL 1T1WB 4XP1L 1MFDL 3BZDA 5GJSL 4LDLB 1WWWX 2E5EA 4POUB 4RAUA 4YBLB 5IP4A 1YN6B 3C6LC 5F7YC 4MJ5A 4F7TB 4NBZB 5E6ZA 4PJGB 3WHXA 4U1NB 4AEFA 1K8DA 3IVKA 3KPSD 4Y19E 1WGOA 2BOCA 5HHVH 4RRPG 5HJ3A 4GG6A 2R0ZH 4X9FA 1JGEA 2DQDH 1YJDC 3T0WA 3WS6C 1X5KA 1A4KA 2OJZL 2AV1B 1BEYL 4HT1H 4MA1C 1E4WH 1FYTD 5L0QC 5BMFH 3DXAE 3SJVD 2YPLA 3RZCA 4LSUL 4WHYG 5DQJA 2EYSB 5KANG 2HFEB 3V5DA 5E9DE 4LCYA 4FA8A 1BF8A 4XMLH 5KSUA 3BUYA 4L3EA 2X6MA 3CXHJ 3QIUA 4YEFA 4ZOBA 4AMKH 4OF0A 1M6OA 2OJEA 4I0KA 3KWWB 3ET9F 3IDMA 1I4FB 4V2BA 4HUVA 1RIVH 1Y0LB 1YPZB 1CK0H 5EUOB 4JKLA 2DD8L 1RUQL 1XR8A 1FIEA 2H6PB 1FIGH 1X5LA 3PGCA 3CCHA 1OP3H 2Y1VA 3MA9L 3ZKND 1NCCL 4LGPB 2IQAB 2ILLA 5I71B 3NZ8A 1PKQA 4YGVA 3TT1H 1YZZA 2F8XC 4M9PA 3FO0L 4PJ5B 3EFFA 1X5HA 3KPOB 2CPCA 4GMTH 4MB4A 2F8VA 4GRWB 2EDEA 3F7VB 3HAEB 1VGKB 4MSWB 1QA9B 5TF1H 1NC2A 4Z95L 1II4E 5GZOD 5C2BL 2YD9A 5MEND 1U8PB 1RZKL 4H25A 2WWMD 5ISZE 3CU7A 4OUUA 4D0CB 3HLAB 4PGCA 2GUOA 1AO7B 2AXGA 3CX5J 4K94L 2LABA 4PGZA 3S34H 3ULUH 5T3XL 4MQ7B 3GBMH 3BH9A 4GBXC 1K4DA 3HE6B 3UTSA 1RJZB 2D0GA 2QADD 1PFCA 2Q86B 2CLZA 4BSJA 1JHKL 1DANT 3BE1L 4PB0H 2UWEB 4GG8B 5D9SA 3FB7B 3QCTH 1GOGA 4XX1E 4QRRE 3FT2B 2VIRB 1BHGA 2DOCA 3RVXC 5JHDB 4NRXB 4U1KA