2WBWB

Ad37 fibre head in complex with car d1 and sialic acid
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
SLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBER PROTEIN
publication title The Cell Adhesion Molecule "Car" and Sialic Acid on Human Erythrocytes Influence Adenovirus in Vivo Biodistribution.
pubmed doi rcsb
source organism Human adenovirus 37
molecule tags Structural protein
total genus 31
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2009-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wbwB00
4RGND 3S37L 4R0LC 3REWB 1CXLA 3L3KA 4FP8H 4I0CC 2EDYA 5M94B 4JZNA 4NM8H 1NCCH 4KK6D 4LGPB 4M8QB 4WEBL 9CGTA 4PJCB 4X5XA 1XF5A 2EH8H 5E4EB 3TT3H 2R0KH 3O3UN 4U6HB 5DSCB 5IMOA 3VGAC 5B38B 2VDKL 3ZSTA 2NY0C 1UC6A 3HG1E 5ACMA 5HHOA 3HMXH 5IVXB 2Z93B 3QUMB 2Q76B 1G6VK 3TBWA 1IGJA 5ESVA 3RX8A 4P4KA 1OPGH 2NMSA 1TZGH 3EFDL 3HE6D 4RFEB 4KQ4L 4L8BB 4G80A 3QULB 2ZCLL 3U4BH 5LGHL 2F5AH 4FZ8L 2H2SC 5EIQA 1JRHI 2H6PB 3TBYA 4KI5D 2BXZA 1QLEH 5E2TL 5C07E 5JA8B 1AD9A 3VWKD 5GISL 1FYTA 2ITCA 4XPFH 4F9PC 4XBEL 3OMZA 4K94L 3MUJA 2RCSH 1KG0B 3ULVD 4LIQL 1MFDH 4HC1H 5ALBH 5IVOA 4ELKB 1C7SA 5HTSA 1HXMA 2ZG2A 1ZXQA 4IRJD 3HC4L 3V7AG 2E6QA 1EBAA 1MQKL 4F7TA 4E41D 3FN0H 4HV8B 1S9KC 4WW2B 1ZLUH 3V52H 1YPZF 2VR9A 3IAQA 2P5EE 3O4OC 2FBOJ 3G5XA 4Q6IB 4FXGB 1YQVL 1CZ8L 3TBTA 2ENSA 4OSUL 3GBNH 4LDEB 1M71A 4DKFH 5CLTA 3PGDB 3LPWA 2AV7B 2MJWA 1I8LA 1ZVHA 1SQ2N 1MCPL 1VKXB 2QR0B 4MNQA 5ID0B 4JRYE 5EZLA 1DQQB 4DGYH 2AV1A 2DYPA 4DEPC 4EUPB 3W2DH 5FO8B 3FQNB 4KHXH 1F11A 3N0PB 3EKCA 2KBGA 1ZHLB 2HT2C 5FECB 3MV8D 4L4VA 3IF1B 2QQQA 5F7YC 3BKYL 1KLUB 1ZVSA 4PGBA 1KLGB 4QCIA 4HULB 1OQXA 2PW1A 4LHUD 4FZEH 4MHHI 3FFDA 1BVLB 1T83A 1U8JB 5KVEL 5GS1B 4IRZH 1A7QL 4G6KL 3Q1SL 2F8OA 4YHYC 3TNMA 1W2KT 2EDLA 4F57L 4OKDA 1S7VA 2Z92B 4YWGH 2GHWB 3MRMA 4I0PC 2F9BT 4NO0B 3RWJB 4AM0A 2WBKA 3VGDA 1JNLH 3G5YB 3O2VH 1JGEA 4LFHD 3OJ2C 4U1GC 1ED3B 1RY7B 4QRPE 4XCCL 4MWFB 1XGQB 2ZCHL 5FYJH 3UYRL 3BUTA 4RWYH 5I76B 3D3VB 4QWWC 5CINL 3UJJH 4Z77A 5GS0C 3C08L 4XVUC 2HFFA 3ISWA 4XBPA 1IRAY 5DTFB 3ZKND 1SY6L 2GSIA 4PJ5E 5K9JL 1J8HD 4ODVL 2AJZB 4XCNA 5LXGL 3UP1A 1QZ1A 4WVRA 4Y5VC 3FKUS 3ZL4H 1K6QL 2XTLA 1S7XB 3C8DA 5D2NA 4PRHA 2NY1B 5HYQB 1NDMA 3GKWH 3PP3H 2HFGH 4MDIB 3WFCH 4HWUA 5E6YA 5CGTA 1MEXH 3I6GA 2E7BA 2FO1A 1AXTH 4NKMA 5IMLB 4F9LC 3OXRB 3MZTA 3UTTA 3BHBA 2ADIB 3GJFH 1MFNA 1MIEL 4KDWA 4Z7WF 1QUNA 4ZFZA 4JFFB 2FWOB 1NJ9A 2DLFH 4RISH 4GFTB 2X89D 1J87A 2BRRL 3B2VL 4LCCA 4EIGB 4KVNH 1FLTX 4YDLC 5E2WH 3X12A 1DEEA 1EEZA 3PG2A 4XC3H 2H1PH 3MLZL 5DJ2B 5GSRB 3IDGB 4W68A 3G6JE 1JHTB 3BPNB 4XNUH 4KDTC 1VCAA 2QKIB 1S8DA 1AHWB 5SWSD 5EIIA 1KFAH 4NSKB 2A6JA 2AK1H 3RGVD 1HIML 4DUWA 4LLWB 3I3EA 1PG7X 2BSTB 4LCWD 4LSTL 1R3IH 1QBML 4QHKJ 1AKJA 1A6ZA 3CSPA 4DWHA 5HXMA 2BDNL 1CDYA 3K4AA 3HG1A 5ADOL 2NZ9D 1CXFA 1R5WA 1JYVA 5IHZB 4G8FB 2DQUH 1AO7D 3ROLB 1BD2E 1RZJC 4GW5A 1K4CA 3RX5A 1NGZA 3O3DB 5DHVB 4YHZL 3OV6A 5J9PB 1F3RB 4U1KA 1CU4H 1T3FA 5FCUL 2UWEB 5A16A 4MD4B 1YY8A 1DN0B 5DMKB 3QRFM 4PJXF 2R2EA 4QRRE 5IWLA 4AT6A 2X42A 3SCMC 3T0XA 2VL5B 2OBGA 1RIUL 3CDYA 1G1YA 1BM3L 2FJGB 2X4PB 1NGYB 4PTTB 3KPMB 1BBJB 3NFPA 3NBNA 5DI8B 4MA7H 4GXVH 2PTVA 4G3YL 1WBYA 2XWBB 3LEYH 2NQCA 2ORBH 5C70A 3R0NA 3RZCA 3P77A 1OGAD 1HWHB 3MACL 4IHOB 4Z7VF 5CS7A 3CVIH 1FGVL 1FFNA 4M7JL 1FO0L 2P5EA 3AVEA 4P3DB 3ALXA 1YC7A 5A2KH 3MV01 1FNGB 4IDLA 4LCIL 5C09D 1LEKA 2KH2B 3UTPE 1OAUL 4BUGA 1X5YA 4XPTH 1T03H 4GMSL 3WJLA 4KZEL 4HGMA 2O5YH 1OP3K 3MTRA 1XGYH 1KTLA 5HSFA 1VENA 2HFEB 1RZGB 5HHXL 4Z78A 4JRYA 1WISA 4WTZG 5I6XB 5T5NG 4CW1B 1KTKE 4XX1E 2DQTL 4LSRL 4C54A 3GMOB 3S98A 1R5IB 2J5LC 4WWKA 1PDKA 5DD0H 4ZXBD 2P5WB 3P4OB 3X14B 2K3TA 4UU9B 4GRMB 4KHTL 4XNMB 5I8EA 2A1WL 5D2LB 5BZDA 4G9FB 3VXSB 3D39E 5GRUH 4S11A 3MJ7A 4GQ9H 4Q58C 2ZOKA 5CEYB 2EDRA 1EO5A 1GXEA 3QI9D 3AGVA 1CE1L 5I2IA 4Q2ZA 3DO7B 4OLEA 2FYYA 2KZWA 4JKWA 2OR8A 3GRWH 2DQGL 1I8IB 1U93B 2R69L 4OBRA 5IB3B 1A5FH 1H3PH 3D25B 5EBWB 2P24B 4J1UA 2OTUB 5LGKA 1FYHB 5DC4B 1IM3A 3VFMB 2A0LD 3N9GL 5FA4B 3RWIB 1BX2A 4QRPA 1U92B 5I1EH 4MA1B 1R3KA 4PB0L 3MRPB 1LK3L 1IAII 4TSAH 1E4XL 1WEJH 2AEPL 4KV5E 1A1NA 4ERSL 5BRZB 1S7RA 4P46C 4ONFL 2ATKB 3MV7B 4G5ZL 4QRTB 4X7SH 2RQ8A 1HHKA 1ZMYA 2DOCA 1EEUA 4YQXH 1I1FA 1KJMB 2F19L 1EZVX 4S1DD 2YD9A 4OLWH 5HYJD 5DUBB 1I1AC 1WT5C 2KQMA 4JG1L 5SWQB 1DQDH 5LG1A 3L3DA 2NXYD 3TA3D 2NY6D 3WEXB 3T0ED 3I3BA 1OP5K 5M7QA 5EUOE 5HGHA 3ZYJA 5C8JB 2ZNXA 1WBZB 1H15B 4NCC1 5AG9A 5E00B 4F58H 5ICYA 1GHFL 3O3EB 4I4WB 4NZTH 4R4BB 4R7DB 3CZJA 5E4EC 2PYEB 4LHJB 3GHEH 1ZHNA 3ARGD 1U8NA 5DK2A 5KVFL 5B3JF 1RZ7H 5AYQA 2GITB 2PCPB 4P23D 3FCTA 3T77B 1E4WH 3QG6B 2RBLA 1FIGH 3G6JA 4NWUL 1LO5B 5EZIL 1IBGH 5DJ6B 5D5ME 2VLKD 4DTGL 1MFBL 3IDJA 4K9EH 3JTTA 3U0TA 4Y4KA 3GI8H 1IQWL 4JANA 2ZSVB 4KI5E 3FTGA 4OZGF 5ADPH 4TQEL 1NBVL 1P6AB 1Q9KB 2GFBA 1E4KA 5GIRA 3ES6B 3P9LA 1N2RB 1YEJH 3D69A 5DJDB 3ULVE 3B6SB 5E9DB 3AY4A 5J12B 3PWUA 4APQD 4YGVB 3RWCB 1TZHB 4JLRA 3V5DB 2FSEB 3BP5B 1EVUA 4E41E 3RWHB 4S2SA 1GGUA 4IOIA 4UTBL 5EORL 1BD2A 5E24E 3HNSH 5K59E 2APBA 3MRGB 1WFTA 5MEPB 1B0GB 4RCAA 2GTZB 3RVWC 2JELL 1QQDB 5F7KC 4PB9L 4WW2C 1AGCA 3RTQB 1KPUB 2XQYK 1YEHL 2WQRA 4CVXB 4FTVD 5E08L 4QNPF 3MLSH 1L7TH 3OZ9L 1OAQL 4Q6IC 3RUGE 4O51A 5I1HH 1NL0H 4LBEB 3ZTNH 5HHME 4OI8A 3H0TA 3V6OE 1I85C 4B7IA 1FZJA 3LQZA 1ZT1A 1KEGH 3SKJL 3FL7A 1DTUA 3F7RA 1YEEL 3HUJE 3MV8E 5J1AA 4HG4K 1RJLA 2JB5H 4P2RD 1NEZA 1HSBB 1KYOK 1I1RA 5HHNB 3TJHC 4FQIL 3MCLL 3TC9A 4AENB 4OM1L 4N0YH 4F7PB 2G75B 1RUML 4JO2L 4ZFGH 5JXAH 1I75A 5F9WC 2GJZA 1QBLL 4N8CH 3V0WH 3KPRB 5GS3A 4LAQL 4FABH 2VDOL 3MJ8A 5DEGA 1YYLH 5IEHB 1FVCB 4MLSA 5DDHA 5K9KB 4L1HA 4X7FC 1E4JA 2WMPA 1OT2A 4ZTOH 1HQRA 3KAAA 5T3XL 3SKOB 1N8ZB 3O4LE 3M8OL 5GS1C 2BVYA 2XN9D 4QGTA 4DZ8A 1RHHB 4LKXA 4CN6A 5C2UB 2R0WL 4S1QH 4Q74A 1Z9OA 2FB4L 4U3HA 1T5XA 2QBWA 3QDGB 1QHOA 5MEOB 4YFLF 3FQRA 3EOTH 4PJAF 1SYVA 2PO6A 1M4KA 3QPQD 2DQHH 1DLHB 3QXAB 3KLHD 4OF5A 1MRFL 3D39A 4HUWB 2Y06L 2YR3A 4NYLA 4R3SB 2FL5A 1HHIB 4ISVA 2QSCH 3GUTA 2HWZH 2IALA 1J8HE 3MBED 3RDTB 3BEVB 2EDHA 4H8WL 4HGKC 3V5HA 3HC3L 4OBSA 4NQSA 3ABZA 4WI8A 1NMAH 4JDZA 2P1YA 1DQMH 2VB5A 5J3HC 1YEDB 5CP7B 5FB8A 12E8L 2GT9B 2B4CH 1MF2L 1JF6A 3C5ZB 1VGEL 2XKSA 2NY1C 2V2XB 5TGBA 4JN1L 4JFOA 4NO3A 4WCYL 1E6JL 3SE8H 2OL3H 2XIDA 5E56A 3PNWA 5GGSY 1I3RB 3NABH 1CVSC 1FFRA 3AS0A 4NRZB 1G6RB 4OD3L 1MPAH 4OD1H 3UPAA 5BXFA 4J3WA 3DRQB 2YD4A 4OFYD 1PG7W 2P47B 3X13A 3DURA 2G5BB 2MWCA 1CL7H 4HX1B 5JUEL 3E2HB 5D1ZC 3A0OA 5EUOA 1FL5B 3WUWG 5FM4A 1YYMH 3BPNC 5MP6L 4GW4A 3SDYH 4H25A 5F7DA 4DK6A 1L6XA 4OFKA 3NCMA 1AO7E 1T0MB 3A67H 4HDIA 4TNWF 3H9SB 5EBGA 1F3JB 4K23H 4JHAH 4NQDB 1CICA 2ZUSA 2CO7B 4GRWF 3VFWB 5FIEA 4JVPA 3VXRB 4U7MA 3SKNA 3LS4L 2F8XC 4BQ9A 5I16B 3WBDA 3GIVB 2EECA 3EHBC 4YBLB 2C7UB 5L2JB 3MGAA 1CLOL 3I84A 4Y2DB 3WN5B 4IRJA 2R29H 4PGZA 1OGAE 4Y88A 3O41B 4E41A 1NCBH 2H2PC 2VLMD 3UTSB 4LSQL 3ULSA 4ZTPH 1IGIL 2E27H 4HIHB 1VFOA 1AGDB 4U1SB 3HI6H 1IKNC 5IBTH 3MBXH 4OZIE 1XR9B 5C09E 1C7TA 1HCVA 3VFNA 4ZO7A 4U1IA 2V5MA 4KKNA 4XP6L 2LFGA 4PGDA 1J86A 2DQDH 5E6IA 1NCUA 5EZJA 5LCVH 1XAUA 4C56D 4Q9RH 3RUGA 2F74A 3WUWB 4MJID 3EYQD 3L3GA 3TGXA 5FHAL 4LU5L 1MAMH 5JHLL 2XTJD 2ZZUT 1ZLWK 3HZVB 3V6OA 4HUXA 2D9CA 5JIHA 1CG9A 1EXUB 1TIUA 4G6AD 5LVEA 3H3PH 3HUJA 3MV8A 5D7SH 3I9GL 1MCEA 4Z5RA 3VDAA 5I6XC 4DCQB 4WJ5A 2Y5TB 5FUCC 1FL6A 1IGTA 4O2EB 3CUPA 2YRPA 5EO0B 2VABA 5JW4N 1XF3B 3BN9C 1WWWX 4J23A 4WUUB 4QHKI 3B9VA 3ZLQC 1HQ4A 5BV7B 5I1DB 2X4QA 4DVRH 4MQ7A 4WU5A 1JMXA 4OJFH 4OCYH 1QSED 1EGJA 4PJ9D 1ONQB 4J3OC 4MCZA 3O4LA 3VRJB 4YPGB 1OAZH 5DRXB 1S9WA 1ZLSH 2B1AH 4XCEB 1U6AL 1GZPB 5SX5H 2E9WA 3BKJH 4GSDH 2QQLL 3QQ3B 3STZA 3AB0B 4ZOBA 3RVVC 2V5SA 2QQKH 3OXSB 2IFGA 3WFEL 3ARVA 3PWNB 3OPZL 1WZLA 5DURD 5F44A 5KS9B 5F9JA 3MREA 3TZVB 4Y4HB 2XOTA 1UVQB 4ETQB 1YNTA 2YN3A 1WFNA 5BVJB 1XF4B 5CEXB 3GMLB 3NCYS 1J8HA 3NFNA 4LIQE 3L5WA 1BGXL 5LBSH 2J8UF 5C0EB 3DWTA 5JLZA 5DJYB 1RUKH 2XA8L 1HYSD 1FNSL 1KV3A 1U42A 1WC7A 3EO1A 1MSPA 5HYJE 4HFWB 2A83A 5HI4D 5DVOA 2CKBL 4CBPA 1FN4A 3ARBB 3WSQH 3BGFC 1N5AB 1AGBB 4A6YL 1F4WH 1RJYA 5HGAA 5T5FH 4YBQC 4P2OA 3KXFD 4XRCA 5I8OH 4LEOB 3FT4A 4ODWA 1DE4A 3RIFF 5I1GH 3F7YB 3G08B 4QRSB 2MKLC 4TUOB 4NNXA 1T21B 2X89A 4JPKH 3T65A 1F4YL 3VRIA 5C08D 3HNTL 1J0ZA 4P2CG 1QSFB 3E8UH 3I2CL 2V17H 4LGRB 1HXYB 1U8KB 3LN4B 1TVDA 4N0CD 5GRJH 2BHYA 2HFTA 4DGIL 2GYSA 4NDMA 4NC0B 3I50H 2VLKE 3HPJA 4IMLA 5F21B 1DZBA 2CPCA 3MYZA 3RGVA 4UB0H 1N59A 3DGGA 1M6OB 3W82A 1YEKL 3QT2A 4OGXH 5E5UB 4J6RH 3WFZA 4NHCH 1TQCB 4ONGH 1I8MB 5K9QG 3H7BB 1S9VB 2OQJA 5CJOL 3LDBB 5F9OL 4YUEH 5DUPL 2XRAH 5CILL 3V5KA 5ENWB 4ZNCD 1L7IL 3NCBB 1NBZA 4NIKB 3U48A 4PV9A 1AO7A 1C16A 2FIRT 3LMJH 5L0QB 2EE9A 3MSPA 5J12C 5T3XD 2FNBA 2GY7B 4JGUA 3VMNA 4O9HH 3OKEB 3BIAX 4G42B 1IAKB 1VFAB 5JNYA 3S3SA 1CXEA 5E99H 2J6EA 5DS8B 3DVNA 4ZUVB 3S6CA 2DD8L 4PJFF 4ZS6C 4PPTA 2R8SH 1M7IB 5D7IE 2ICWB 5J0BA 3X3FL 2DQCH 1JZ7A 5E2VL 3ULUF 4Y5YA 2EDOA 1OGAA 3K2MC 2VRAA 4UT6L 5I71C 2DQIH 1CF8H 3Q5OA 4HZLB 2W0PA 3KPQB 1FBIH 2OXHA 4QXTA 2AJVL 4P2RE 3BYTA 4OZIA 3LRSA 2D7TL 5TE7L 5C09A 1RJCA 4OKVA 2DIJA 4TUKH 1DBJH 1OARL 1U3YA 1I9JH 1UWXK 4ODHH 5GXBB 1UM4L 3IT8D 3PGCB 4G7VH 2PUQT 4NN5B 2CK0L 2HLAB 2WANA 2AJ3A 5C0FB 4KVCH 1MCDA 4LCUB 1ZV5A 1A6UL 3UZQA 3JWDH 4LLVA 2DM4A 2YKLL 2R9HD 4NO2A 4XH2A 3L1OL 3WNKA 3LB6C 3R06B 5DRZA 4TTDD 2G9HB 1NAMH 4LLDB 4ODSL 1LDPL 2M26A 3ARFB 3HKFA 1S7TB 1IQDA 3PIQB 2C26A 2L0DA 4Z7QF 2EYRB 4M03A 3KNBB 3M17B 1FNHA 3WJLC 4P2QB 1QFWL 4ENEC 1KBGL 4GMTH 3BIBX 3DX6A 1MNUL 4QT5A 5D71H 3TN0A 5KSAA 2IGFH 3MRLB 5T3ZH 5T1KA 2CRMA 2Z4QA 4XVSH 3RDTC 3GJFB 2Z91B 5ELIA 5IHBA 3CXDH 3B9DA 3U1SL 2X41A 1TJGH 1X5GA 3BDYH 2J1KA 1JF1B 3JV6B 4MCYB 5J6GA 5DVLA 5GRVK 5C0GB 3FQWA 3O6LH 4N5EC 2YXMA 2YC1B 4JM2D 3C5ZC 3CVHA 2C1PA 4CMMA 1HH9A 4PRNA 3VFGH 3W0WD 1TENA 2BFVH 1J7VR 5DJAB 1AGFA 4Z7WE 3CH8A 4NFBA 1DUZA 5GZNC 3EO9H 4AIZA 1QKZL 2J4WL 5HYJA 2EXWC 2D7NA 4F7MB 2BC4B 3KPPA 3DVGB 1N0XL 3T8XB 2MOVA 1U3HC 3TA3A 4L4TA 3H42L 4NQVA 4D0DA 2H32H 4HH9B 1BJMA 1YJDH 4FQJH 4QHNB 3QZWG 4WV1B 1BZ7B 1U58B 1JVKA 4L3EE 5C2BL 4QRQA 5I66B 4TSBH 1P84K 3D18B 5DYOA 3SBWC 3O9WB 3UBXA 5D7JB 2Q8AH 4GKSB 4QHUA 4D8PB 5FUOL 4XVJH 2F58L 2VLKA 1IC7H 5I74C 3C9NB 4F2MB 4X99B 3DIFB 4OD2B 2IJ0C 4F7EA 2CLRB 3WHXB 4EI6A 4CL7A 3EYVA 2OMNA 4JREB 3U0PB 4PJXE 1ZT7B 1I7ZA 1CCZA 1X4XA 4MAYA 4I48A 4GAGL 5HHQB 5JW4Q 3RL1B 3OWEA 3U46A 1P69B 4S1RL 1BFOB 4KK8D 5IEKA 4YBLC 1NCWH 3BPCA 5JDSA 1K2DB 4CU6A 1EX0A 4N8PA 2VDMH 5KTEH 5GGUB 3QEQB 4Y2DC 3WN5C 3SKMA 3S8WA 3VD9A 5CUSH 4C4KO 2YRLA 1G7MB 3RAJH 3EZJB 1PAMA 1V7NH 3Q3GB 4Z7VE 3E6HA 1Z5LB 5JPNB 2XZZA 2IBGA 4OUUA 4JZJB 3IKCA 3LRGA 3O0RH 1FFPB 4YDKH 4C56E 1R5VA 1U95A 5FYKL 1KENH 1I9RH 1NGPH 1P4IL 3OQ3B 1SBBA 1T0PB 3B83A 1UKSA 5D7IA 4PV8B 3U30B 3BH8B 5FOBA 3QZWB 1G7IA 5TJWK 1K8DA 1T1ZA 5IFJA 2DTMH 2XTJE 4FQHA 4UMGA 4QYOA 1SY6A 4GKOA 2HN7B 4FQ1H 4JFDD 1NFIA 1JRHL 5D1XC 2JKXA 5H94B 5ILTH 1T0NA 2HJFB 3BQUB 5C0CB 4XPHH 5F7EH 4P2RA 3ARUA 4R97B 4JB9H 1L0XA 3D0LB 5KN5B 4D9LH 3TBVB 4HMCA 3U9UA 4TSCL 5C6WH 1IL1A 3ZTJG 1RQ5A 2DWDA 1HHGA 1H3WM 3C6SA 2M1KA 5E5MA 5IW6B 5EC2B 3MLWL 4MNHA 5JW4M 5FYJU 1PX4A 2D31A 1QSEE 4O5LL 4PYHA 3QIWA 3CC5A 4LQFH 3UTQA 3L3HB 4RMSA 3HTLX 5C0IB 4ZAKD 3VH8G 2BZDA 1QFHA 4P5TB 5FO7A 5HJ3A 1YDPA 5CJ8A 5FGBC 2HG5B 2DI7A 5DJZB 4JZOB 1Q1JH 3ZSSA 3HPLA 2A6KB 3RI5K 4KUCD 4P2YA 3QUKB 4B50A 3HRZB 4J8RA 1D9KB 4WHTB 1E0OB 3CCHB 4L9LB 1EO8H 1DFBH 3OJDA 3O2DH 3LPFA 4U2YA 2CGRL 4XT1C 5BS0E 3ETBF 2R2BA 4HAFA 2R1YA 3TZVC 1FNEA 3KPLB 3K4ZA 4HPYL 1ULVA 5DWUH 3KJ4B 3X3GH 1GGIH 3HNVH 4U3XA 5KVGH 3S4SA 4RRPA 3MRJA 3RNKA 3M1BB 3U4EA 1GJIA 4X7TA 4HWBL 5L9DH 3D85D 2XPGA 2YD7A 1JWUB 4Z95L 4RZCB 4BJLA 5L2KE 3RPIB 1H3UA 2ADJA 1T20A 4XWOC 1JTTA 5E8OA 3ARBC 3ULVH 1MJ8L 1XH3B 5F6IB 2EDDA 1PG7H 1KN4H 3HLAB 4BFIA 5C86A 3VJ6B 2MCPH 4XCFH 1CQKA 4Z7WA 4RX4D 1IILE 3LKPB 3EAKA 1CFNB 1X5JA 3RGHA 3MXWL 3QQ4A 4K3DL 2YPLE 3OAUL 1LO0H 2QADB 1G7HB 1U2HA 3EO0A 4WUKH 1FO0A 5DQ9A 1S9YA 2Y23A 4BK4A 3P4NB 3VH8B 4PJBF 5FO9B 5IOPA 1LP9F 2PXYD 1Z3GL 2CQVA 1T66C 4XBGA 1FH5L 3HB3C 5CJQL 5HPMB 2Q3ZA 4FQQB 4OZGE 1CFVL 4GBXD 4L3EA 4ZQKB 2MHAA 4MXWH 1TQCC 3FO2B 4XNYL 1AE6L 4KK9C 1T89A 5EBMB 5KZCD 5DFWH 4UIKL 4B0MM 1KPVA 1NUNB 3LDBC 5TE4L 4OB5L 2BNUB 5D1QB 4V1DD 4YDVB 3QJHB 3EDDA 5CZXC 5GRZA 1JTPA 3MUY1 4E5XA 3UMTA 2Y7QA 1E28A 4I1NB 4HWNA 1JYXA 5L0QC 2C3VB 4JFEB 5JO5B 1O5DT 5F1OB 5DD6B 2JK5A 1F6FB 2C1OB 3PWVA 4ZNEE 4PJXA 2DN7A 2W0FB 3P4LA 3QXWA 3C2AL 1I8KB 3P3YA 2DQJH 1IKFH 1EGJH 3V0VB 1G7QB 1A02N 1CFTB 1A21A 3E0GA 3SY0A 4EN3A 3BGMB 4C55A 1LD9B 4QNPE 3LD8B 1TFHA 3TIDA 4MA8L 4JE4B 4BFBD 2PR4H 2N56A 3IFPB 3ZYZA 4YXKH 1P7QB 5JOEA 2MPAL 1I1YA 4Z7VA 3W9EA 3G04A 3QO1B 1MVUB 1LE5A 4JFPB 1HINH 2W1NA 5EO1A 1VEMA 1XF1A 3IDUA 4C56A 4CDGC 3RHWK 3BZEB 1U91A 1XFPA 2EC9T 3C60B 4UINH 3WIIL 4NOFA 3OKOB 4H20H 1R0AL 2V2WA 4WFFD 4GKZB 4KC3B 1RZFL 4LASH 1UXWB 2OJZL 2EYTB 3KWWB 4EOWL 2VO5A 4OZHE 4XPGL 1ORSB 3GSXB 2HJKB 4MQSB 4NN5C 4MXVE 3CXHK 3QDMD 4GRLD 1UM5L 5SX4I 4TVSa 4KRLB 5CIPH 5AWNL 1I3UA 2OR9L 1BOGB 3C8KB 5ESQA 4QEGA 1GH7A 3O8XD 4I9WE 5KW9L 4P9MH 5AUMA 2I9TA 1KJ2L 5ESVB 1IC4H 4PJAE 2D2OA 3LQAC 3Q6GH 2ICWI 1QSEA 5DR5L 1X4ZA 4OLUL 4XNQA 3ARFC 4YHLL 3OR6A 1PSKH 4R4FL 3DMMB 3UTZA 3PWJA 3T0DA 4HKBA 2WUBH 1NFDF 1QRND 1MREH 3STLB 2YA1A 2BRQA 3UJIL 1FYTB 2DIAA 2ITCB 4RIRB 5C0AD 3WNLA 2AXFA 5IQ9B 4LMQI 2OL3B 5E8DL 3MUZ1 3CFJB 4PY7A 2PYFA 3CLEH 4HUNB 1BF8A 2FZ3A 5JHDD 4Y19D 4Y5XB 4MDJB 5I8CB 3SDXF 2NZIA 4O02L 5I30H 1JP5A 3ARDA 1TVHB 4NQED 1FE8H 4LF3B 5F96L 5BS0A 4RNRB 5K9QI 4PJEF 1JI2A 2JCCB 3EYFA 2CDEA 5E8NB 3W0WE 2O93L 2BOBB 2Z9TA 1LVEA 3WNNA 2NLJA 3BP6B 4YE4L 4OGZA 4AMKH 4XPBH 1P9MC 3RX7A 5FHBL 5A40E 5ABDE 4YHIA 4HT1L 1JGLH 1R3LA 2CIIA 4TVPE 2BNQD 4EQ2A 1SMOA 1NC2D 2E6PA 2NY2B 5L2KA 3IU3B 4NO5A 1A1OA 4DKDC 3SGEH 2HT4C 3SDCB 1A6WH 4URTB 2AV1B 4J3XA 2Y36L 5FGCB 5LQBH 1UA6L 4PBXA 2HLFD 2NR6D 3B5TA 3MJ6A 5FYKD 1BIIB 2ZPKL 1I9IL 1WBXA 2UUDK 1XIWA 3GMQA 3MXVH 5JA9A 1CLZH 4WV1C 3VDCA 3FO0H 3GMNA 2X9WA 1DBAL 1EJOH 1GGBL 1IARB 1SJVA 2YPLA 5C0BD 3IFNH 2VC2H 1IAIL 1YEGL 1A6TA 5DMGD 3VWJD 4NBZB 3FMGL 4L3AA 1J1OH 3MOAH 1YNKH 4JGMA 2CMRL 1ADQA 2EYSB 3MRDA 5F3BB 1NC4D 4HBCL 5EWIH 1NGQH 4GRWE 3S36H 2CIKA 4OZGA 3TVMB 3CD4A 3DX8A 3AXLA 4P5KB 4PJCF 4IOFD 4XP4L 2BSSA 4JN2A 4JREC 3PDDA 1ZA3A 4JDVA 3EGSA 5JQHC 5TE6L 5KG9A 2BNRD 2NX5B 8FABB 4G6FD 1WLHA 3NCEB 3S37H 1H3TA 4Z77B 2NY0D 4ODXA 1PKQE 2GJ6B 2HFFB 3TV3L 1RI8A 5IVXF 3S88H 3GMRB 4WEBH 4XXCA 4BSVB 4N0FA 5SWZB 4RFNC 4ZNEA 3WJJC 2DMKA 2VITA 2XZCL 3FT3B 4PRHB 4M3KB 1QLRA 4OGAC 3UX9B 1JNHA 1NDMB 5I1AA 5HY9B 2VDKH 4WHYG 4PR5A 3FB5A 5IMKA 1S7WA 2OSLB 1CQYA 4JZJC 4QGYA 1CT8B 3DBXA 1C1EH 4U1HA 4M5ZL 4JFDE 5A2LH 4NKMB 3L3IB 2X4TA 2C4XA 4AQ1B 3U30C 2A77L 1F6AA 3KPOA 3EFDH 4P48A 2Z35A 4G43A 4KQ4H 2GAZA 2ZCLH 5LGHH 4FZ8H 5ANMA 1A0QL 2X4RA 4XWGL 3BQUC 4M62L 3RVXD 4HGWB 5E2TH 5HGBA 3QXDB 4QLRA 1IEAA 5GISH 4XBEH 3F12A 4I8DA 1Q38A 4K94H 1HK6A 3QDAA 2VLJE 4LIQH 3WXVL 5EIIB 2P8MB 3AU1A 3HC4H 4NZRL 4OZHA 4JQXA 1MQKH 3TNNB 3QQ9C 3U2SA 3VA2C 3IJSA 1AKJB 1A6ZB 5E8PA 1UH3A 3NPZB 5CBEA 1XF2B 1EAPB 1YQVH 3AREB 2IPKB 4ODUA 5D93B 4OSUH 3SGKA 1NDGA 2WZPD 4P5TC 4PJ7B 1KNOB 4PJAA 3VU2A 1EK3A 3VFUB 1T3FB 3RL2B 4N9GB 4NQCE 2BSRA 1D9KC 1ZSDB 3CZFA 1MCJA 1M7DA 3O6FB 1MCPH 1QLFA 4L9LC 1HSAB 4LVNC 5E4IA 3HI1B 5FM5M 5C07B 4Z7NF 1LILA 3QIBD 4J3SA 4M61A 3GSUB 4QHMA 3K0WA 1OLZA 3LS5L 2VZTA 3KJ4C 3GHBL 4ZUSB 3SPVB 1HEZA 3Q6FA 3BKYH 1F4XL 1U8OA 4DVBA 4M4RA 2EC9U 4I0PD 3GMPA 3ZE0E 1I1CA 4P59L 5KVEH 4OV5A 1VADA 2YD8A 2LABA 4NKDA 4TULL 1T22A 3W0WA 1A7QH 5INCA 1DBKL 2BHZA 4DUVA 4G6KH 2CD0A 4FQLL 5L8JB 2QHLA 2BK8A 3BIKA 2J2ZA 5F6IC 4F57H 1CD1A 3U7YH 4XHJD 3O6ML 4LEXL 4LRNL 1JWSA 1AR1C 1P2CB 4PJHB 2Q87A 4G8IB 4BH7B 4CN4A 4K9EC 3ZT6A 1MHEB 3QFDA 2BVPB 4Q7DA 3MFGB 4XCCH 5IJKA 2C5DC 3C6LB 1QR1A 5GSVA 3VXTB 2ZCHH 5HYIA 5GHWL 3UYRH 2QADC 5CINH 3H9HB 1AQDA 4YGAB 4R2GD 2VH5L 3C08H 5DRWA 4MAUH 2H8PA 3VI4F 1M1SA 3V8CA 1SY6H 5K9JH 2B39A 4ODVH 5LXGH 4ZOEA 4V1DE 1FPTH 4YHML 1K6QH 1IGYA 1BP3B 2DJ4A 3QCTL 2IQAB 2AJSL 5ETUB 4L3CA 2ZOKB 1OCWH 4G6JL 3FOLA 4JPIB 1NLDL 3EZ8A 2C4FU 5FAAA 4ALAL 3UCRA 5D8JL 3W11C 4M7KL 5D1QC 5EFIB 3G6AB 3BSZL 1JWMA 1H8OA 1MIEH 1YMMD 5I18L 4KFZC 5KBNC 1L0QA 1Y18B 1KF9B 2V7HB 5C0JA 2BRRH 3B2VH 2YSSB 4PJFE 4NQTA 5GRWA 3WLBA 2P7TB 4WO4B 5KSUA 2DLEA 3KPSD 3MLZH 1I7RB 3ULUE 2UZIL 1KC5L 1PKQA 5F7FA 2AVGA 2GSGB 3OKNA 3IFOB 3LD8C 4FQPA 4PJ5B 4JEGB 4LVOB 1BF2A 4RMRA 4KK5C 1HIMH 5ACLA 2K9UA 4LSTH 1QBMH 2ERJB 1XR8A 2J3SA 4NQXA 2EE6A 3F5WB 3HE7A 2BDNH 1LO2L 5C9KA 1DVFD 4W4NA 5ADOH 4WFFE 2AXGB 2RR3A 4RGOL 2YOCA 1F8TL 4JFDA 1HYRC 2HMIC 1NAMB 2GJJA 5HGHB 4OLVL 3C60C 4EZMA 2YD3A 4YHZH 5ICYB 1DSFL 1U8MA 2VE6A 3TF7C 5FCUH 5IVNA 1JFQL 2CKBA 2X4SB 2CJUL 3MNVA 2LU4A 2R2CA 3L5XL 5CMAA 1W72L 2MSPA 4DN3L 3R0MA 3UROR 2XWTA 5DF0A 1OQOA 1RIUH 4I0KA 1BM3H 1UG9A 3QUYB 3FONB 1RVFL 2IBBA 2XXCB 1A8JH 2VLJA 3BFOA 3DYMA 5DRNB 4G3YH 3U0TB 1TTUA 5F9AC 1EEQA 4OZFH 3ZDXE 1T1WB 1A2YB 1QRNE 3RHWF 2PW2A 3MACH 4ZAKA 2B1HL 4UUJA 5C0AE 2AJXL 3BEWA 1FGVH 2G5RA 2ICEA 4M7JH 3VXQA 3D69B 4M6NL 1FO0H 1XGUB 2PTUA 2UZXB 3DMMC 2B4CC 2RAMA 2GTWB 4F15B 4JLRB 4LCIH 4TNVK 3VCLB 1OAUH 4D2NA 3T2PA 4S2SB 4IOIB 3QDJB 2WP3O 4GMSH 1U41A 4KZEH 3X11A 4CADA 3V6ZA 4NQCA 4PJGE 4Y5XC 4ONHA 3LH2L 2AEQL 3QNZA 4FMKA 4QRRB 1J12A 4ZDHA 1U2CA 5HHXH 1A9EB 1YMHA 3QCVL 2H32B 4N90D 3H7LA 5F7UA 3D85A 2DQTH 2FR4A 4LSRH 4NM4H 3I6KB 1NUGA 4PLOB 3QUZA 2CH8A 4KHTH 1RZIA 2A1WH 4PRIA 5D72L 4OT1L 2BVQA 3VG0H 3P30L 2ARJA 5IR1A 1K8IA 4IMKC 4J4PA 3QIUD 1S7SB 2Q86B 2NY2C 3MO1A 4S1SL 1B3JA 5J1AB 2UY6A 1CE1H 3SDCC 4DUXA 3PL6A 1NEZB 3DUSA 3GSNA 5HGDB 3E6FA 4QTIL 4RX4A 2ZUQB 4YX2L 2IH1B 3ALPA 3NFSL 2CDGA 3CSYB 2DQGH 1D5ZB 4KTYA 2R69H 5C0BE 3TPUB 5CLWA 2GJZB 4P46D 4NRYB 5GJSL 3BYYA 3DSNA 1CFSB 3MJ8B 3N9GH 4WU7A 3KYMB 5DEGB 3MYJB 3BP4A 3BRGC 2JJSA 5K33A 4LL9A 3CLFL 5EU7E 1NGXB 3VGGA 4U1LB 4MJ4A 2PXYA 1PVHA 2DWEA 4QXUL 1JHKL 1BVKB 3L6FA 4PB0H 3ZHLA 5E94A 4F3FB 1I1AD 1E4XH 1RZ8B 2AEPH 3EBAA 4KJWC 5DK0B 1ZLUK 5IIEA 2WLYA 1DQJB 4ERSH 4ONFH 4HPOL 4G5ZH 1WZ1L 5KOVC 3GSOB 2Y72A 3MOBL 4V1DA 3MGTA 3TVMC 2BNRE 1PZUB 4NP4L 3HA0A 1W0VA 2F19H 1KGCE 5HI3D 4XGZA 5IROA 4P9HL 4NYLB 1X5XA 3BOVA 4IRSB 3GUTB 1QNZL 1DBML 2IALB 1F90L 3UDWA 4ZODA 1ITCA 2I26N 2EDTA 5DO2D 3LSOA 1UJ3B 3TH3T 5FYLL 1UCTA 5EBLA 3REVA 4HMDA 4KQ3L 3VFTB 4FFYL 1GHFH 5D4QA 2QJDA 5EC1A 2VAJA 3DRTB 5CWSB 2XKNA 5E95B 4X8XA 4MNGB 3LHPL 4NCDA 4JFYB 4MD5A 2Z31D 5FB8B 2ZUUA 3MRNA 2ESVD 3BUYA 1JI1A 3DECA 4PJFA 3TBSB 1M05B 4MQXC 1MJJA 3GNML 4GAYA 5TGBB 5GGQL 4DFHA 3JV4B 5BJTA 3RVTD 4NWUH 3NGBB 4UQ3A 5EZIH 4DTGH 4RDQG 1MFBH 3KYNA 4RSVA 4U1NA 4QOKE 1IQWH 3RFZC 3G5ZB 3EJYC 1J0IA 4UDTA 5FKPA 4RGNB 3QHTC 3RVWD 3TIEB 1ZA6A 3CFDA 3NIDF 1I3GH 4O4YH 4RAVB 2IADB 3HAEA 4M6ML 1QR4A 5DZNA 3V4PL 4WW1A 4XVTL 5I1JL 4UTBH 5EORH 1VEPA 1IGFL 1RUPL 3NCYP 1ES0A 4LK4A 4UT7L 1BOYA 2AGJH 4EI5D 4OCSH 2JELH 3OHXB 2YPKB 1I4FB 4PB9H 5EOCJ 1ZHBB 3I02A 5LAXB 2W38A 3KS0J 1PKOA 4D9QD 5E08H 4FXKA 3HE6B 3F58L 3OZ9H 1OAQH 3PP3K 3AREC 3TJHD 1NLBL 5JOFB 1IVLA 1TZIA 5D93C 2E8ZA 4PGEB 4MSWB 5D5MB 5BQ7B 4PJDE 3TYFA 2F54E 1HKLL 4BZ2L 1QRNA 3VWKB 1WIOA 1V3LA 1G7PA 2ITDA 3P4MA 3GJFK 1FC2D 1TCRA 3NZ8A 1Y0LA 3SKJH 5IUSA 5EU3A 3O6FC 1YEEH 1ZEAL 2R23A 5MEQA 3RA7L 1QEWB 3GSRB 3BXNA 1D5MA 4FQIH 1BQHA 3MCLH 4IIQA 1BPVA 1IFHL 1FAIL 4OM1H 4E41B 2VXVL 4JO2H 1RUMH 4XP1L 1PQZA 4LFHG 1QBLH 1NMCB 3BWAA 4LAQH 4KJYB 2VDOH 4TRPL 1SM3L 5CD3A 2CLZA 1EJ6A 4GW1A 4PJGA 4Y1AD 3OGOE 4NBYB 4ELME 2YBRB 2ADFL 1KIPA 2OJEA 3EYOA 4X0KB 1DQLL 3F7VB 5T3XH 5F89A 3M8OH 4JFQB 2ZUWA 4HXAL 2ZCKL 4LPVA 1MAJA 2Y9RT 32C2B 4AEFA 2R0WH 2FB4H 2B7DT 4FHBD 3D3VD 2VZ3A 3FB6B 3DETC 1BECA 1UB5A 2EXYD 1GCFA 1DUYB 2I27N 4M02A 3MNZA 4HUXB 1MUJA 2CLVB 3RJDA 3U36B 1CG9B 1XGTA 5J3HD 3BZ4B 4HUMB 2DICA 3MJ9L 1EHAA 3ARDC 3C6LC 1HDMA 2C3GA 4WJ5B 4H8WH 3IU4L 3LKNA 3HC3H 1T7XA 4LHUB 5MENE 2BOCA 5EPMB 2J8UB 5C0BA 3LKSA 3VD5A 4ZFOA 1CDGA 1HQ4B 3CDCA 2QV2A 4JJHA 3ILPA 1HOCB 3BO8A 5EG6C 1V3JA 12E8H 4H1LA 2FBJL 1AFVL 1MF2H 2YUVA 3NIFF 2VLRD 1NC4A 3IDXL 1VGEH 4R0LA 1B2WL 1KN2L 1TJHH 4NZJA 4JN1H 5EUKB 1YMME 3FAXA 4WCYH 4HIIA 1E6JH 1WIUA 4K7FA 5IT2L 3GB7A 2NW3B 5D1ZD 3TT1L 5JPMA 5F3HB 2GUOB 4R4ND 4OD3H 2HVJB 3MREB 3KPSE 1FFOA 3NIGE 5HHPA 5CJXC 3WNPA 4UZGA 2ARWA 2D03L 2DL9A 2XV6B 2W59A 4PRPE 3SE4C 3QEGL 3GMMA 4DW2L 2DAVA 5JUEH 2VXQL 5I8KL 5A2IH 4WO4C 1INQA 3HAEG 3QXTA 4HF5L 3PWPD 1CS6A 2BSED 4XI5C 5F97E 5MP6H 3MUGB 1S7UB 1WC7B 3EO1B 4MQTB 4LVOC 4ZO8A 1FN4B 3IJHA 5GGSA 3VGFA 2QSVA 5CIPB 4F9PA 2ERJC 3JWDC 4DKEL 3WFDH 2ZUVA 4W6WB 4Z7UF 4ODWB 3WO3B 3B8YA 4Z0BH 3RIAK 3VRIB 3CDGB 3LS4H 3AC0A 5D6DC 2H2PD 4QOKA 5HHOD 4D0CB 5C6TL 3MROA 2VDRL 2YN5A 4QF1B 3K74B 4YPJA 1WCBB 4O2FA 5TH2B 4P4KD 2XWJB 4MMZC 4NDMB 2F8VA 5SWSB 1CLOH 3N85L 2UY7A 1EHXA 3BD5A 3QUYC 4LCWB 4ZPVB 2FECI 4KRMB 1RJZA 4PY8J 3DX7A 3O3AA 4GLRH 4LSQH 1BFTA 2E7LC 4DAGH 1IGIH 4KROB 3HI5L 3MPCA 2OZ4A 3V5KB 1N64L 3FAWA 4Y8DC 4WDIA 1OWRM 3ZT7A 1S3KL 4PV9B 2HT3C 1A3RL 1SMAA 4UIMA 4XP6H 4U6TA 1HCFX 3BW9A 2OS7A 4F15C 1CN4A 4HG4J 3EFFB 4PP2B 2WWKT 4HCRA 5FHAH 4PJDA 3HCVB 1CLYH 3G5VA 4PRDB 4LU5H 2F54A 3BN9D 5JHLH 5F1KC 3VW3L 2ZSWB 3QCUL 4N90E 5I1LB 2R0ZL 2DJSA 3DVNB 4R6UA 3MR9B 1S7QB 3BISA 1S5HA 2R2HA 4P0DA 3I9GH 5FDWA 1ZGLA 4LHQB 3V2AR 3VXSD 4U6YB 4ACPA 3D6GA 4Y5YB 4HUUA 2FX9L 4BZ1L 4MNQD 4X6BB 1MLCB 1YJDC 4I0PA 1OGAB 3OKDB 1VDGA 2DYPD 3I75A 3EDJA 1OTTD 2ZOLB 2DKSA 1AI1L 3LKQB 4OZ4A 3RVVD 5FYLD 3SDDC 4UQ2A 4U7SA 4X6FA 4L4VD 3QXUA 5KS9F 3FB8A 3LRSB 3FO1A 1HHHA 5C09B 2X2YA 3MA9L 3BAEL 3A6CL 1S9XA 3MRQB 1JPGB 1QG3A 1K4DB 2YD2A 4Y5VA 2QQLH 2ZUQC 3MLUL 5EU5A 1A7BA 3KVQA 2AJYL 5GGTL 5GRYA 4PYGA 3BKML 5ICXB 3WFEH 3K4DA 3OPZH 3OJVC 1BFVL 4LLVB 1YY9D 2BY3A 5TF1L 1N6VA 4ZXBB 3WLWC 4HKZB 1NGWA 5DRZB 1X5FA 4YBQD 4L8SB 4F9LA 1P4BL 4NT6B 1BGXH 4I2XB 5MENA 3OX8A 1TVBA 2NW2A 2XA8H 1EMTL 4XCYA 2KZ1B 1A14L 1SJEB 1FNSH 2FGWL 2FJFA 4W6YB 5FF6A 3QI9B 5DEZA 2SEBB 1SJHA 2MFNA 1A3LL 4HS8L 4RAUB 2CKBH 3VD7A 2FLBT 4BH8A 5ACZA 3OKKA 4A6YH 5GS2D 4YFLI 2W60A 1Q94B 3O11A 5IF0B 4GUPA 5TQ0L 4QT5B 2A6IA 1D6EB 4IRSC 4KDTA 1YMMA 3D87B 2C9AA 2W9LA 2YWYA 2Z4QB 1W8NA 1ERNA 2J8OA 4HZAA 3CPLA 2RFXA 3L3OB 4PGCA 1F4YH 1X6LA 3HNTH 4X9IA 1UJ3C 3I2CH 1R3HA 4NPYA 1LE9B 1G9NL 4NJAL 4X5WB 3UTTD 4YHPA 4DGIH 4LVHB 3FQWB 3PP4H 3CX2A 4PRPA 1Q0XL 2P8PB 3H3BC 1YEKH 1JPFB 2Y4SA 4M4PA 4HLJA 1NCCL 1CFBA 5IB1B 1WF5A 1REIA 4AIZB 2HJLB 5IFAL 1VFMA 5CJOH 3SCMA 5F9OH 5DUPH 3KPPB 3TT3L 2R0KL 5CILH 2YPVH 1NFKA 4MJ2A 1LMKA 5HYSG 1L7IH 1PY4A 2NY6B 3T0EB 4RGNC 4ZUTB 4H88L 1MWAA 4ZOCA 4ZS6D 2VDLL 5A1AA 2W0KA 2IH3B 4IJ3C 4RBPH 4TPRL 5IVZA 4MJ6B 5DVNA 3CX5K 4ZFFB 3HG1D 1ZHKB 5E1AA 1CGYA 5B39A 1CDHA 3ARGB 1AIFB 1ZT4A 4DN4L 3UBXB 5C0RL 1OTSD 5D6CA 4P23B 1XEDA 4HIEB 1TNNA 4D9QE 2JTDA 4Y16C 5GQBA 4AZ8A 2DD8H 2YK1H 5KSVA 5IM7B 2WINA 1A3QA 3X3FH 4CGTA 5E2VH 3HE7C 3QFJD 5A43C 6FABL 2XY1A 5HYEA 1NKOA 1WJ3A 3HE6C 1CIDA 2LTQC 3BI9X 1QFWM 2V5TA 4O2CB 5DJCB 2AJVH 1UZ8B 2EIBA 3OR7B 4APQB 2L7UA 3KPRD 4PREA 1D5XB 4Z7NE 2D7TH 4I48B 3VWKC 3LVEA 5EZOL 3RZCD 5IEKB 5DFVD 5H37H 1OARH 5FA3A 5LGJA 1Z9MA 1UM4H 3VD4A 4LKCA 1J05B 4Y1AE 5JORB 1JNNH 2P5ED 5J6HB 3ZMRA 2CK0H 3V7AE 4TTGA 3RJQB 3E6HB 5I15L 1A6UH 3ECBB 3Q48A 2VKXA 1CD0A 3TO2B 4BSWA 5HYSB 4FTVB 4YHNA 2YKLH 4U1MB 1V05A 3L1OH 2DL2A 3P9WB 3D3VE 4ENED 2FRGP 4K2UL 1IEBA 1Q9LB 1HILB 1U8QA 1K8DB 2Y25A 2VDPH 1LDPH 4HK3N 4JRYD 4OAWA 4LPCA 4M1GL 3RDTD 4HW6A 1KIQA 3IDNA 5ERWA 2NTFA 3QEUA 5T1LA 1FVEA 1YN7B 1OF2A 1URLA 2LE9A 1WWAX 1QO3B 2ICES 1PZ5B 1QFWH 1KBGH 1CE6A 3QUXB 1MNUH 2WSKA 2DWDB 4P46A 3QA3A 3VI4E 1KTDA 3C5ZD 5CSBA 3PJSB 4Y8AA 5HVHB 4XXDA 3LZFL 2P8LB 3QNYA 4XAKD 5H35A 4OZFG 3U1SH 1JPTH 4LLUB 1BJ1J 1GGTA 3MLVL 1JNLL 2VLRE 4I18B 5GZND 4XTRD 4Q0XL 4XC1L 2XN9B 1QFOA 5F1NB 3SO3C 1A1MA 2EXWD 1I1AA 1WT5A 2DM7A 2JIXA 4X8JB 2FCBA 4MX7A 1U3HD 5HJ3B 5DMYA 1GZQB 2VIRB 1G7JB 1YDPB 4HKJA 3ZDZE 3WFHB 4Z8FL 3EDFA 3FHAA 2PF6A 1UWGL 4QRPD 3LQAL 4OLZL 3Q0HA 2ED8A 5DT1H 4M8QA 1QKZH 2J4WH 4JR9L 2A74A 1HI6A 3OJDB 4U6HA 5DSCA 3VFRB 1LEIB 1N0XH 4RQQB 3MBEB 1N4XL 1X5HA 3H42H 4RAHA 5B38A 2R1YB 5L88L 2NTSP 4PJBB 2FHBA 1YUHB 1AXTL 3ZKNC 3S4SB 2PNDA 3MRJB 2Z93A 3AM8C 3U4EB 5IKCB 1CBVL 3QUMA 5CSZA 5C2BH 4K7PX 2UWEE 1FZOB 2ADJB 3QULA 1NPUA 1MRDL 2H6PA 3KYAA 2Y1VA 4KVNL 3T3MF 5J11B 4OF7A 5FUOH 2FEDD 2F58H 1NCDH 1J9CT 2VXTL 5AYUL 1U8HB 5CEZL 1Y6KR 4XNUL 4ELKA 4ZOAA 4OZFB 4Y2DD 1T04B 2AK1L 4HLZH 1BAFL 4XAWL 2IANB 3QEHB 5SX5K 1RAMA 4HV8A 4WW2A 3MLTB 1NEUA 1FO0B 1S9YB 2D9QB 4GAGH 4Y4KD 3E3QC 3OB0H 4HBQA 4D9RE 4HEPG 4S1RH 4Q6IA 4FXGA 3W5NA 1GAFL 1OB1B 4WWID 1QPXA 3PGDA 3FO9B 1I85A 3FFCB 5F70A 4M7LT 5D1XD 3D9AL 1FRGL 5IK3B 3THML 4X4XA 4KROC 1VKXA 2QR0A 1BD2D 1RK1B 1DQQA 1UYWL 2NZ9C 1FFQA 5FYKH 4A2LA 5FUCE 1P4IH 3RIAF 3FQNA 4ZD3L 2Y7QB 3K1DA 2BMKB 1Y6MR 1ZHLA 4WI2A 3MRKB 5FECA 2HTKD 2P5WE 1VFBA 3KLDA 1KLUA 1JRHH 1KLGA 5D2LE 1AR2A 1MI5B 1UQSB 2IWGA 2VXUL 5HD8C 4G9FE 1BVLA 3VXSE 4F8TA 1Q8MA 5GS1A 2UV3A 3AAZA 2DLGA 5IBLD 1CD8A 4UNVA 4TSCH 4R8WL 2PTTB 1FVDB 2FEEI 4X9FA 2BVUA 3RKPA 4YDIL 3Q5TA 3MLWH 4XPTL 3CMOL 4Y1AA 5HDBE 1OOAA 1I3VA 4O5LH 4L4VE 1JK8B 4L4JA 4NO0A 3RWJA 1I1YB 1QVOA 4HWZB 3T2QA 3G5YA 4UDUB 3MCG1 3W9EB 4ZUWB 2HAZA 1LE5B 3E1F1 3VXPA 2CUHA 1BEYL 4MWFA 4C56B 1XGQA 3KPNB 1U91B 3NA9L 2ED9A 3D3VA 4M5YL 4MJIB 1ETZA 4KAQL 5L7XL 3HC0A 4I5BB 1BFSA 3DARA 5BRZE 3O2WL 2XTJB 2W9EL 3MV7E 1JZ3A 2AJZA 3SQOL 3NN8B 3SDXB 1DP0A 4IIQC 3INUL 5IB5B 3V8OA 2I07B 4MGXA 1S7XA 2CGRH 1NCTA 4F7CB 5HYQA 4GQ9L 4PJEB 4MDIA 4HPYH 2HVKA 4YC2B 3SGEI 35C8L 3PF2A 4ORZC 3F8UB 2VSCA 4ZXBC 5AUMB 5IMLA 2I9TB 3D39D 4L8SC 1BWWA 4HWBH 3O6KL 3OXRA 3UYOD 3BP7B 1QSEB 4Z95H 1A5FL 4XNQB 4PJ9B 4JFFA 2FWOA 3QI9C 1XT5A 1N6QH 2PYEE 5HI5D 4D3CL 5IP4A 4ODTL 1EUTA 1MJ8H 4QHLA 1D5BA 5GSRA 1BZQK 3IDGA 1FGNH 2PYFB 1JHTA 1PYWB 3OSKA 5J57B 3WKML 2QKIA 5DURB 1U9KA 3HB3D 1GGCL 4NSKA 2J8HA 2A0LC 4LLWA 3MXWH 4K3DH 2BSTA 3BD3A 1OAXL 4PD4K 2FX7L 3OAUH 4KK9D 4HHAA 1P84J 4NZUL 5E9DE 3S34L 4OLXL 1SEBB 2K7QA 5CZXD 4LVHC 1KJ3L 5IHZA 4G8FA 1Z0MA 1Z3GH 4K94C 5CJQH 1ZLWH 1FH5H 1RURH 2MQ0A 5C0DB 3NH7L 2CIIB 1CFVH 2OTPA 4XP5L 3N1MC 3O3DA 2F5BL 3MRBA 2UWEA 1UM6L 4MD4A 4XNYH 1AE6H 1DN0A 3KXFB 1F4HA 4I3RL 4UIKH 5TE4H 3NIDE 4OB5H 1J1PL 3UPRB 2ZJSL 1Z2KA 2FJGA 2NY6C 1BQSA 2AW2A 2X4PA 3T0EC 1UB6A 3V4VL 4PTTA 4DKAA 3KPMA 2ZG3A 4WGWB 5C08B 4EUPG 1BBJA 1QBAA 1N26A 4OCMC 1ACYL 5EN2B 3GO1L 1IKNA 3ARWA 4IHOA 3C2AH 4OM0L 1CICD 3ARGC 4P4RB 1A6TB 3QFJE 5IW3A 4P3DA 2IAMB 3PV7A 4QY8B 2R15A 4MA3B 1DDHB 5IQ7L 4M6OL 1FNGA 4RGMB 4MA8H 3T4AB 3CVHL 4CVWA 4FFWD 2Y5EA 3JWOH 1T1YB 4AEHL 3KPRE 5B4MD 4KRPC 5AZ2L 4PLJC 3P0YL 2HFEA 1H8SA 1RZGA 3PABB 4PJIB 3T1WA 2VQTA 3U9PL 1QA9B 4APQC 4H5SB 4HJGB 4CW1A 5HBBA 1DL7H 1FNLA 1QBBA 4PJ8B 5HDQL 1YECL 3WIIH 3GMOA 4NFDA 1R5IA 3QDGE 3JTSB 1RZFH 4JHZA 2FH8A 3MFFB 2OJZH 2P5WA 3P11L 3P4OA 3X14A 1EAJA 4EOWH 1N3NB 4GRMA 4XPGH 4TOYL 4XNMA 1BWMA 5D2LA 1A6VL 4MD0B 5E6ID 1ZLVH 3GGWB 4RMQA 4G9FA 1QLRB 3VXSA 5BVPL 1GC1L 1JNHB 5I1AB 2FD6L 1MCFA 4RFOL 3FB5B 5ITFB 4WNQB 4LPXA 2OR9H 4EBQL 5HHMD 3DO7A 2VYRE 4JFZL 1ACZA 2X4TB 5KW9H 3U79A 3C5SB 1BBDL 1KJ2H 4S0TD 1U93A 5DQDL 2GY5A 5DR5H 3D25A 3V0WL 4OLUH 4NFCA 2P24A 2OTUA 2B5IB 4D0BB 3OJMB 4P99A 3VFMA 4R4FH 5HVGB 5FA4A 4LSPL 5EU7C 3RWIA 4K71C 2X4RB 1T2JA 4YHOL 4XNZC 1U92A 5FFLA 1WSST 3DYPA 1QD0A 4P57A 2JCCF 3UJIH 2OMBA 1LNUA 3JXAA 4XAKE 3MRPA 3N1GC 5JTWA 3QUXC 5CZVL 3TJEL 3DPBA 5BRZA 1QHPA 3VXMB 2XY2A 5LWYL 2GK0B 5DHYB 2ATKA 2NY5L 2EO9A 5J13B 3MV7A 4QRTA 3O4LD 1IAIM 4O02H 3T0AA 5HVHC 3QWOB 5CEZD 3EOYG 2AKRA 4M3JA 4PLKC 4YH6A 3U2SB 1KJMA 5DMIL 3NIFE 4I18C 3OKLA 5F96H 3BZDA 2HT4D 4WTZA 2Q7YB 1C08A 5DUBA 1WICA 4YE4H 3ESUF 3R8BB 1AXSB 3S5LG 3GM0A 2V6HA 3LV3B 3NTCH 3DVIA 1DBBL 1Q9OB 5FHBH 3EJZC 4JPWL 4LP5A 5C8JA 1WBZA 1H15A 4NKIL 3GDBA 3QPQC 5E00A 3KLHC 3ORJA 2BSRB 1MQ8A 3RP1A 4NOBA 3O3EA 2X9YA 2CUMA 2HKHL 4R4BA 2JJWA 4R7DA 2PYEA 3CFEB 1X4YA 4M61B 2APFA 2Y36H 2X1QA 3MBEC 1A64A 1UA6H 2GITA 2PCPA 3K8KA 1U0QA 2GCYA 3H6JA 3T77A 4UAOB 3QG6A 2ZPKH 1I9IH 1KEML 3NA4A 3VDBA 1LO5A 3AUVA 1JTOA 4PS4L 4TN9A 4GXUN 5DJ6A 1U8OB 3LPGA 5KJRL 4P2OD 3L95B 2A73B 5JR1H 1DBAH 3GMPB 4TNWK 5TPWL 1EFQA 1GGBH 1KXTB 1Q9KA 3FT2A 3ES6A 4JM2B 1IAIH 1YEGH 3GZKA 1N2RA 3FHQA 3FMGH 3W0WB 2N7AA 3B6SA 5E9DA 4KJPC 5INDB 3GK8L 2CMRH 3OKYA 5TDOB 5DA0B 1F5WA 4YGVA 3RWCA 1TZHA 3V5DA 4HBCH 2FSEA 1RULL 3BP5A 1D7FA 5IB2B 2BY2A 3RWHA 3LKOB 2Y6SD 3UTSE 1YYML 3MRGA 2X1PA 1FNAA 2I9LB 4XP4H 4AY0A 2GTZA 2EDEA 5FK9B 3ZHDA 3MRFB 1O7SA 2APTA 1EHLL 2BCKB 1UWEL 4OGYH 3VMPA 3S5LB 3OAYH 2YZ8A 4KKAC 2EEBA 5I1KL 5DRWB 2H8PB 3TV3H 3ZO0A 2X70B 5CKAA 4HEME 4OLYL 4Z7OF 2VISB 4LBEA 3T3PF 1RUQL 4NC2B 2XZCH 4X6CB 5FGRA 4PFEA 3MRIB 4L3CB 2J88L 2BHUA 3QFJA 3TPKA 3MJ9A 4AK1A 5C0CD 4O00A 4M5ZH 4OCNC 2HH0H 1Q0YL 4F7PA 2KL6A 5DHXB 2G75A 1S5IL 3LN5B 3KPRA 2K1MA 1WFOA 3UC0L 1FCGA 5E0QA 1SYSA 1T1XB 5IEHA 1A0QH 3JV0A 2AK4B 4XWGH 4XZUB 5C6PB 1RMFL 2AP2A 5KSUB 2R1XB 1N8ZA 3SKOA 2R4RL 3CXHJ 1KLFA 5K93A 3PQYD 1NMBL 5KVDL 3OGCB 4JKPL 4E0RA 3VFOB 4BKLB 3QDGA 3WXVH 2IPTL 4PJ7F 5MEOA 4NZRH 1HWGB 1JGUL 4RWHA 4L9DA 4W4OC 1DLHA 3QXAA 4NRXA 5KS9E 1D9KD 4HUWA 5JW5B 2CRIA 2XFXB 4R3SA 1ZTXL 4FG6D 1HHIA 2EDQA 1GL4B 2B2XL 1WZKA 4JFDB 5EA0L 3RDTA 3BEVA 4W6XB 3SGJC 1P1ZB 1PX3A 1ODAA 1D5IL 3EYQC 3DTXB 1ZANL 4NN6B 3VXUB 3PXHA 1NCAL 4F8QA 3TO4C 1U8MB 1X5IA 3T0BA 2CKBB 2YD6A 4HS3A 4A6YB 3BH9B 1YEDA 5CP7A 2GT9A 1NUDA 3C5ZA 2V2XA 4AG4L 4L8DB 1IM9B 2CKNA 3LS5H 2UZYB 1AQKL 5DD1H 3GHBH 3CU7A 2QQNL 4NQUA 3VRLF 4E42A 1F4XH 1EDQA 1W0YT 1I3RA 5KSAD 1KJVB 3TN0D 4NRZA 1QSFE 1G6RA 2PW2B 4PJHF 4ZAKB 1U3HA 5T1KD 3RIFK 4G7YL 4JQIL 4P59H 4PJ9C 1MFCL 3DRQA 4J3UA 4TULH 1GIGL 3DV4B 1DBKH 1A6AB 2WUCL 3WNMA 5CD5D 5TF0A 3O45A 4FQLH 3IB4A 4HX1A 1KELL 1OGTB 4GAFB 4LQ1A 5CHNB 1FL5A 3O6MH 4LEXH 4LRNH 3SBWA 2EKSB 1AJ7L 2WLZA 4ONHB 3FOMB 3WIHA 4M7LL 1T4KB 3VXOB 3ARYA 4KKLC 3MX0A 1E27A 3C87A 2OCFD 1F4WL 4JCLA 5GHWH 1T0MA 2NYYD 1EZVY 5A3IC 2IG2L 2N1KA 2NXZD 5I8OL 4POYA 2VH5H 3QHFL 2WP3T 1MHHA 4L4TD 1HYSC 4XMPH 2R56L 3S35X 3VFWA 3IFLL 3ET9F 2BVQB 3WL9B 4YHMH 2DF3A 4K3HA 2V17L 3MGOA 1YNLH 2YWZA 2YA0A 3QCTH 5I75B 2AJSH 1T5WB 3GIVA 2ZWLT 3IJYB 3MO1B 3N50A 2VQUA 1NLDH 4CN1A 1F6LL 3BKCL 1B0RB 5D8JH 1V3KA 2C7UA 4M7KH 5B8CB 5L2JA 3FRUB 3QWQB 4ZSOB 4Y2DA 1PLGL 3BSZH 3WN5A 1FAKT 2HRLA 3VFVB 4UBDC 1DLFL 1HNFA 5I18H 3DYOA 3UTSA 4KK5D 4WU7B 2X7LB 4HIHA 3WE6B 1KIRB 4U1SA 2XRAL 4LMQE 3LEVL 5FUZL 5F1IB 1XR9A 1RD6A 2MQCA 2R1WB 3NCJL 3HR5A 3RQ3A 3ILQC 5F6HI 4I13B 2UZIH 4GBXB 5K9OB 3EDEA 1KC5H 2IAMC 4GAJL 4PP1C 4D94A 4MXQD 2ICCA 4K3GA 5D1XA 4MAYD 1GYAA 3WUWA 5KZCB 2D4DA 4RGMC 5GGTA 1MIML 3C60D 1UJTA 4V1DB 3MGTB 4NKOB 3DUUB 5BW7C 4LAJH 3HZVA 3K81A 1EXUA 3VD3A 3S36X 1LO2H 4X6DB 5CP3H 3KYKL 1F8TH 2X4OA 4OCRL 4HUKB 2DQEL 2Y5TA 4NWTL 3SE9L 4O2EA 4PJ8C 3RWDA 4OLVH 5EO0A 1AP2A 4QKXB 4YEFA 1XF3A 4WUUA 4NN7B 1DSFH 5I1DA 5IV2B 4JY6B 3TH4T 3S37X 1JFQH 1HKFA 2CJUH 3L5XH 1W72H 4DN3H 3BUYB 3OL2A 4P2QE 5FGBA 2WIMA 1MJJB 1ONQA 4GAYB 3C5JA 4MS8D 4JDTL 3DMMD 4LP4A 5DJ8B 3VRJA 1RVFH 4YPGA 2FECL 1WZMA 4XCEA 4UQ3B 1GZPA 1ADQL 3MRRB 5I1CL 3OKMB 4HLZG 3ARQA 3DNKA 4X4YB 5FKPB 4OF8A 4HXBL 3PWNA 2AJXH 5KS9A 5ECJE 3TZVA 4M6NH 4ETQA 1UVQA 3CFDB 1PJ9A 3QIWD 1T7VA 5BVJA 4JFXA 1XF4A 5BOPA 5H2BB 3KLAB 4WW1B 2YEZB 5CEZE 4JM4L 2VZVA 5C0EA 1U36A 3QDMB 4GRLB 5DJYA 4M43L 5GGRB 2X09A 3IDIA 5KAQF 5J13C 1QYGL 2CDFB 3LH2H 1AD0B 4HFWA 2AEQH 3BZFB 2VWEC 5JW4R 2V7NB 3ARBA 2R9HC 3FQUB 3IXTB 3O8XB 4BK5A 5T33L 1N5AA 1AGBA 1DQTA 5HPOA 1K5NA 3QCVH 3DHMA 4TTDC 4WI3A 5EU6B 3QJFB 3HMXA 3QO0B 4R7NB 4LEOA 2E5EA 1UENA 4NNYB 3F7YA 3G08A 4WTXA 4WENB 4QRSA 1VACB 3S7GA 1T21A 3CXDL 4JHWL 4N1EA 3IDMB 4OT1H 3P30H 3L7EB 1QRNB 1QSFA 1JN6B 2IQ9L 2ITDB 4MB5A 5C0AB 1HXYA 4FMFA 5GZOC 2X9XA 3LQMA 4S1SH 2R23B 5EOTB 2YS4A 1OVZA 5JHDB 4Y19B 4QTIH 3OG4B 4YX2H 4BELD 3PE9A 1M6OA 3AS1A 3NFSH 4HC1A 4HK0B 4UAOC 3VFPB 4GXUM 1PQZB 6CGTA 4NQEB 5GJSH 1I8MA 3PV6B 2G60L 5CD3B 3SKUD 3H7BA 4XNXL 1S9VA 5ESAB 4N9OB 4JRWA 2F53D 3ZKXB 3TVMD 3BE1L 3CLFH 5ENWA 4QXUH 5F89B 1JHKH 4JM2C 3B9KB 2V5RA 3GIZL 5IMMA 4DOHB 2BNQB 5BMFL 3RWGB 1KT2B 1NC2B 3VI3F 2NX5D 4EJ1C 1MHPL 4HPOH 3OKEA 1WZ1H 3UO1L 3G6DL 4G42A 1IAKA 3TCLB 1JZ5A 1VFAA 3CIQA 3U7AA 3MOBH 2FATL 3PHOA 5BOZG 4NP4H 1DR9A 1AHWC 4YZFE 3AMLA 2FIKA 5DS8A 4ZUVA 2Q8AL 4P9HH 4L8CA 5SWZD 5ISZD 2D0HA 2EIDA 1VSCA 4YO0B 4L3ED 4LOUC 3H3KA 1QNZH 5I73B 1FNFA 1F90H 5DEFB 1CDJA 4MQXD 4XVJL 3CSGA 1M7IA 2ICWA 1TTGA 4AEIL 4KV5F 2M8XA 4KU1A 5FYLH 4KQ3H 1EERB 1RFDL 3EUUA 4FFYH 3VE0B 3VWJB 25C8L 3KPQA 1WTGT 2NNAB 3LHPH 4XP9L 5C0CE 4IS6B 4FFZL 2I5YL 5IB4A 4FRWA 2VLLB 4G9DB 3GNMH 1CGVA 1AC6A 3WS3A 1DJSA 4LLYA 4Z7UB 3GB7B 1MY7A 1OAKL 5SV3A 4FS0A 3PGCA 5EUOF 3TWCH 4X98B 1KPRB 4EN3D 5C0FA 1V7NL 1ORQB 2BNRB 5C3LD 4G6FB 2DLHA 4LCUA 4TVPL 2NY0B 4GLRI 3PQYE 4KK8C 3SGDH 4M6MH 3V4PH 2RJMA 1INQB 2G9HA 5I1JH 4LLDA 3AFLA 1H5BB 3UZVB 3ARFA 5F72S 5D5MF 1IGFH 4R96B 5FKAB 3PIQA 4KGLA 1RUPH 5GS2H 3QHZL 4ZYKB 4KI5F 4UT7H 2EYRA 3IJHB 4YIQB 3KNBA 3M17A 4Z76A 3V4UL 4P2QA 1JUFA 3ULVF 3O6FD 4UI2A 2OM5A 1MJUL 3OBAA 3UJTL 3F58H 3MRLA 1NLBH 3GJFA 2Z91A 4RDQF 1CFQB 4NN6C 2W0LA 4BZ2H 1JF1A 3P73B 3JV6A 1IZKA 1ZEAH 3DVFA 5C0GA 1NBQA 3RA7H 2XQBL 1MVFA 3B43A 3SDAB 3EYSL 1P9MA 2E7CA 2A9NL 4TYUA 1IFHH 1FAIH 5T1MB 2VXVH 1T6WA 4XP1H 1RJZB 5EH1A 5DJAA 5DK3A 3JV5A 3DX7B 1OAYL 5DD3H 1EHNA 3HZMB 4TRPH 4EIZC 3ZDYF 1JF5A 4YHKL 2BC4A 4X80H 4DEPB 3DVGA 1F42A 2ADFH 3OAZH 3T8XA 3J8F7 1CTOA 2PETA 1DQLH 5D9SB 1JNJA 4HXAH 2ZCKH 2X4UB 3K2UH 4HH9A 4K7PH 3ARDD 3BW9B 4QHNA 3CAFA 5BS0D 4WV1A 4MA1C 5L9DL 3FQXA 4PRAB 3DOSA 5D7LD 4LSUL 5I66A 2IF7A 3ZE1E 3T4YB 3PWLB 3D18A 1A7NH 3QIBB 4JO4L 3UTOA 3U7WL 3O9WA 5D7JA 1C5BL 1C5DB 2KPNA 4GKSA 4R9HA 1S5HB 1WQVT 4YHYB 4D8PA 1CXIA 4UV7L 4L4TE 3D2UB 5TFSL 5L2KD 3MOQA 4U6XB 1JPST 2C3WA 3IU4H 1PG7L 4I0PB 3C9NA 4F2MA 4X99A 3DIFA 1P53A 3IXAB 4OD2A 2CLRA 4JFEE 5EOCL 3DSFL 1FHGA 4YXHL 3KPTA 4U1GB 4OZ4B 3U0PA 1T7ZA 1RIVL 3VFSA 4RMTA 3ARXA 4ELMB 1XIWD 3CFCL 5JMRA 5GPRA 3IVKB 2FBJH 1AFVH 1CTNA 3FO1B 1W0WB 1XCQA 3IDXH 2OP4L 1B2WH 1KN2H 5HHQA 5I75C 3RL1A 1NAKL 2DBJA 4S0SD 1BFOA 2YUXA 3B5HA 2YPLD 4PG9B 1K2DA 5IT2H 5B8CC 4NUJB 2BVOB 3FRPG 1S78D 4YR6B 4X5LA 4H26A 5FYKU 3TT1H 1KB5L 2MKWA 1D3CA 4LVEA 3WJJA 4AJ0A 1G7MA 3Q3GA 1QRKA 3VGBA 4AL8L 1Z5LA 4NJ9L 5JPNA 2WWKO 4NHUB 4DZBA 4JZJA 4R2GB 2JJUA 2Q6WB 2D03H 2ICWJ 1FFPA 3RY4A 2APWA 5CBAB 4DW2H 1PEWA 3RKDC 2VXQH 5I8KH 4PV8A 3BH8A 3QZWA 1TJIL 3K46A 4GBXC 4HF5H 4FOMA 1EFXD 1P7KB 3ME0A 4JAMA 1XCTB 1TVBB 2NW2B 1XGPA 4MVBD 4LDOB 5EO9B 2Z8RA 1JGVL 1SJHB 5DVMA 4YDLB 3BQUA 3IDYB 5C0CA 5ACZB 3OKKB 4Z18A 2DS4A 4OUOA 3D0LA 5JIKA 1YPZE 4DKEH 3H8NA 3TBVA 4GUPB 1BZ9B 5CKGA 3FZUD 4FQ2L 3KLSA 1YMMB 5HDOA 4LCYB 5JQ6L 4C83B 1KJ2B 3BVNB 5IW6A 5EC2A 3GSNL 1FJ1B 3RTQC 5IJVA 3DROB 3BDBA 5C6TH 1V7ML 3VA6A 2VDRH 3RBGA 4NN7C 3KPSB 1IJ9A 2OLDA 4Q97A 3L3HA 3PQYA 4YDJB 4U1JA 1BLNA 5C0IA 5AEAA 4P5TA 3N85H 2HG5A 4JG0L 5DJZA 4JZOA 4YJZL 3MV9B 2A6KA 4MLIA 1UXSB 3QUKA 3RU8L 3MRCB 1D9KA 1LK2B 1X5LA 3PUCA 3HI5H 1OSZB 3W9DB 4OF0A 4WHTA 5C7XL 1DVFB 1Y6NR 3CCHA 4L9LA 4JPVL 4GG6B 4EVNB 1N64H 3QDJD 1N5YH 3TYGL 4RA0C 1UCBL 2JCCE 1S3KH 1A3RH 3KPLA 2L4OA 3DI2B 2EDKA 4Y4FB 5IVZB 4M1DL 3M1BA 4DFIA 3Q2CA 3QG7L 1IC4L 2HP4A 4HS6B 5AZEH 2LVEA 1JWUA 5B39B 1G9ML 3VW3H 4RZCA 1AGEA 5SV4A 3QCUH 2H26B 1ZT4B 4GRLC 3PHSA 3RPIA 3RY5A 1KCRL 4I9WD 1MRCL 3SDDD 1IT9L 1U8IA 5CAYB 2FEEL 4LSDA 3NZHL 4BZYA 4OZIF 5IW1B 5F7LB 1IAOB 4G8EB 5FGCE 3O8XC 1XH3A 1QFWI 4MJ5B 2FX9H 4BZ1H 3RNQA 1FG2B 3HLAA 4G8GB 4CRPA 3VJ6A 3ULUL 1OHQA 4POZD 3B3IB 1AI1H 2DQFB 4JRXD 1OLLA 4B5EA 3SE3C 4K8RL 2X1OA 5LJYH 1A7RL 1N7ML 1WFUA 3B5GA 1G7HA 5EULV 2NY3D 4CVZA 3MA9H 3EDKA 3P4NA 3A6CH 4PBWD 3VH8A 5FO9A 2JJTA 2J5LB 3WLWD 1H3GA 43C9B 1SBSL 1F13A 3K80A 3MLXL 2ZKHL 4LKCB 1ND0B 4M1CD 2F53E 3KDMB 3MLUH 4X7DC 4YNYB 2AJYH 5IG7B 3RPKA 3SJVD 3BKMH 4ZUUB 3FO2A 3MRHB 2VR4A 1AY1L 5EBMA 3T0VA 5F7HA 4UNUA 3CMGA 5EU4B 2BNUA 5D1QA 5TF1H 4YDVA 3QJHA 2NX5E 4TVPD 4GG8B 1P4BH 5FV1L 2JB6B 2GJ6E 3HMWL 3B9KC 2WBJB 3FQTB 5J7CC 2FX8L 1F3DJ 2C3VA 5F88B 1HH6B 3QIUB 2KDGA 1X5ZA 4JFEA 3IDNB 5JO5A 3HS0B 2NTFB 2FGWH 5SWZE 5ISZE 1LEGB 3MUHL 4ORGB 3E2HC 5DD6A 2C1OA 1A3LH 4HS8H 1QFUL 2W0FA 1I8KA 2WQ8A 3DV6B 3WV0A 3V0VA 1HN1A 2HLFC 4GKNB 5TQ0H 4BUHA 3MOAL 1VGKB 3BGMA 1LD9A 5I73C 3CK0L 3CSBA 1NGQL 4Q6YA 1GSMA 4M9PA 5LKNA 2OR7A 4LNRB 1EIBA 4XXDB 3QNYB 4Z7OE 2VAAB 1P7QA 3DUHA 2FHCA 4OF3A 1II4E 3U4AA 1I1AB 3QO1A 1G9NH 4NJAH 3VWJC 1MVUA 3LEXB 1YN6B 4JFPA 3ROOB 3VG9B 1CR9L 1Q0XH 1W8OA 3BRDA 1CGSL 4HUVB 5FCSH 3C60A 1IGCL 3OKOA 1LO4L 3NOIA 2QSTA 4GKZA 1R3JB 3S88L 1UXWA 3MA7B 3K8LA 2EYTA 3KWWA 4IOFC 5IFAH 2FO4B 3GSXA 1NQBA 1ORSA 2A74B 2HJKA 5JXEC 1HI6B 3OB8A 3RWFB 1X5KA 3IETA 5DJXB 4OI9A 4B53A 2DKMA 3I6LD 1YPZA 3UPCA 4PRBA 4Y16D 4R26L 4H88H 1FL3A 4K3EL 1BOGA 2VDLH 1C1EL 3C8KA 4TPRH 4HMEA 3HE7D 1PFCA 2E9JA 4LLQB 4PJ7E 4OIIL 5CSZB 2Z31B 2ESVB 1H5BC 4DN4H 5AD0B 4NC1C 4ZFOL 1CGXA 5C0RH 3DMMA 3CFKA 1WCQA 4KKCC 1SEQL 3STLA 5EOQL 1LWRA 4RIRA 3EIFA 4DK3A 4HIXL 5IQ9A 2OL3A 3FB7B 6FABH 3CFJA 2EDXA 1NKRA 3W39B 5BCAA 1BQLL 4Y5XA 1EEYB 4QXWA 4MDJA 5I8CA 1G1CA 1JGDB 2VLJD 3IGAB 1TVHA 3T2NH 3RVXC 2FGZA 2D0GA 4LF3A 1R24B 1NH6A 4RNRA 5BV7C 3GJEB 5E8NA 2JCCA 2W07A 2BOBA 3BP6A 3QBTB 5EZOH 5F71A 4Q9CA 1INEL 1OY3B 4V2CB 2ADGA 5D7IF 4F37F 3TFKD 1CK0L 4EDXB 3SDAC 1O0VA 3VRLE 3BRFA 4X6EB 4EI5B 5SX4H 4CU8A 4IMKA 4PJHE 4KZDL 4QRUB 5I15H 3SHSA 3IU3A 1P4LA 4UV4L 4X4XB 3AB0C 4N8VG 3SDCA 3RWEB 2AI0H 1Q9WB 1FZKB 3GSQB 2Q7NA 3TCXA 4NQCD 5D7LE 4K2UH 3HZKB 1MHCA 2UYLB 4Y4HC 5C0NC 2H9GB 5F9WB 1BIIA 4NUGL 1VFBB 2VDNL 1F00I 4M1GH 4M8VA 3L7FB 3D0VA 5F7NC 1E6OL 3QIBC 3QUZD 4M9OA 3AAZB 4H0GA 4IOSD 2XG5A 4PRID 2DMCA 4CMHB 2EYSA 5F3BA 4J4PD 2V2TB 2W65B 3QH3B 1J1XL 4Y1AB 5IFHL 3LZFH 4ZPTB 5DGRA 2F53A 5TDPA 3QWRD 4AH2B 3U7YL 3TVMA 2MMXA 3PL6D 3BESR 3MLVH 1QVOB 4MB3A 2CXKA 5J1TC 4P5KA 4Q0XH 4XC1H 3VXPB 2HKFL 4LPUA 2OZ4L 1XGRB 4IEFB 4TUJA 2NX5A 4XPAL 8FABA 5JW3L 5B3JE 1ETZB 4Z8FH 1L6ZA 3N1QC 3HC0B 2H3NB 2GJ6A 1UEMA 1UWGH 2OTWB 4XB7A 3LQAH 4MAUL 4OLZH 4XHJC 3NAAL 3GMRA 1UZ6F 4BSVA 1ZVYA 1A6PA 5ISZA 5SWZA 3JWOC 4JR9H 1FPTL 4HCRL 2O61B 3FT3A 4N8VB 1N4XH 4BFGA 1OCWL 2XZQL 5HY9A 3WIFA 1JV5B 2Q20A 4FQXB 5L88H 2HVKB 2OSLA 4R2GC 4WFGE 1CT8A 2KQNA 3L3IA 1A7OL 1CBVH 1VA9A 5JOPD 1RUAL 4LSSL 2FHFA 3P9MB 1J5OL 1FORL 4LSVL 4HKXB 1BVZA 2VLRB 3P0VH 2YMXL 3EOAA 1W72B 2X4NB 3KGRA 4JY4B 3HR6A 1F2XK 5MI0B 1AC0A 1MRDH 3IDYC 4FNLL 4YAQB 4DGVL 1PEZA 3QYCA 4HGWA 3ZE2F 4AYFA 3QXDA 5KSBB 5D1ZB 4QHLB 1JHLL 1JZ2A 4JJ5B 1D5BB 1VPOL 5T3ZE 5GS0L 2VXTH 5AYUH 3S3JA 1A22B 4J12A 5CEZH 2P8MA 1BAFH 3IKKA 4L29A 1MLBB 4XAWH 3ULUD 3TNNA 3CNKA 2DBLH 3VXNB 3MJGX 1B4JL 1CGUA 2P42B 3CX5J 2I60L 4HHAB 3WHE0 1ZKAA 5ANME 3T08A 4K8RD 4KROD 1A4KB 1XF2A 1NBYB 1EAPA 3PWPB 3AREA 1GAFH 2IPKA 3CH1B 3MZGB 1G9EA 1BMGA 3L3KB 3ARZA 4PJ7A 1C8PA 1MCIA 3BWUC 3QDJE 2P49B 1KNOA 4JZNB 3VFUA 1ZGLP 3K7UA 3MRBB 4N9GA 3RL2A 5DZLA 2DLIA 3D9AH 1FRGH 1ZSDA 4J7RA 4X5XB 3THMH 2XNAA 1XF5B 3O6FA 5HD8D 1DVFC 4N1HB 1UYWH 5IMOB 1HSAA 3HI1A 1GRWA 5C07A 4ZD3H 3N06B 3GSUA 1UB6B 1B9ZA 3LIZL 5HHOB 1KB9K 4OTXL 1JPSL 3OG6B 2R0LH 4ZUSA 3SPVA 4UILL 4Y4FC 1F58L 4EDWL 3TBWB 1IGJB 2VDQL 1NSNL 4P4KB 3RVUC 1F3DH 2VXUH 3QPXL 1B6UA 4G80B 4EXKA 2EH7L 3TBYB 4R8WH 2EE3A 1J11A 2CXGA 1AD9B 4YDIH 4JRXE 2FDBP 3EYUL 3CMOH 4KTDL 2AERT 1I7UA 1RZJL 1P2CA 4PJHA 4BH7A 4G8IA 1HXMB 1MHEA 3PHQA 2BVPA 4F7TB 3MNWA 3C6LA 1BEYH 3CFBA 3VXTA 2DIBA 1MELA 4A2MA 3NA9H 3S35H 4M5YH 3H9HA 1ZE3C 4KAQH 4X7CC 5D7LA 5E8EA 3G5XB 2B20A 5L7XH 4NM4L 3SJVE 5EB9A 1MWAL 4WY7L 3O2WH 3TBTB 2W9EH 3R1GL 1A7PL 4RA3A 3DX9A 3QNXA 4CU7A 3EW3B 4KUZL 1M71B 2YD5A 3SQOH 1D6VL 3INUH 4RBPK 3VG0L 1BQUA 3PDGA 1RZKH 2IQAA 5ETUA 2EDWA 5EDXA 4MNQB 4JPIA 2J6EH 5ICZA 5EZLB 2OK0L 3RY6C 2DYPB 35C8H 5EFIA 3G6AA 3VI3E 1GGYA 1F11B 4DJMA 3O6KH 3DHJA 4P5MA 5HHVL 1BHGA 2HA1A 1R6VA 2WBJC 4L4VB 1FSKB 1ZVSB 2Z8VC 3QIUC 4PGBB 5CJXA 4MNGE 4QCIB 2PW1B 3L3JA 2VSDA 1Y18A 2V7HA 3SE4A 4YXLL 3FFDB 2YSSA 4D3CH 1WK0A 4P57B 4IM8A 4ODTH 2P7TA 4WO4A 1LNUB 3O9WC 5D7JC 1I7RA 2I25N 4HWEH 2A38A 4FFVC 4WI5A 3TNMB 2GSGA 3IFOA 3WKMH 1S7VB 4PJ5A 3TLRA 1GGCH 2VQ1A 2ZP0T 2VTFA 3MRMB 2AKRB 3BGFB 4DQOL 2AEIT 4AM0B 2GIYA 1OAXH 2FX7H 1ZWIA 4RGNE 3WYRA 1JGEB 1MAKA 3OKLB 5L6YL 3F5WA 5DZOA 2L7JA 1C08B 4NZUH 1RU9L 3S34H 2AXGA 4OLXH 4Z6AT 1EFXA 3VG9C 1KJ3H 3UZEA 1NAMA 2LV4A 1KGCD 1IC5L 5D6DA 3NH7H 3BX7C 4XBPB 4XP5H 2QEJA 3I6LE 2F5BH 2GSIB 1UM6H 4XCNB 1UACL 5HI3C 2X4SA 5D96B 4I3RH 2G2RA 4RMVA 1J10A 3IAPA 4WRLA 5D2NB 1BREA 4P3CL 1J1PH 5J06A 2ZJSH 5DO2C 2GCYB 3QUYA 2H2SD 3FONA 3V95A 3V4VH 3ZTJH 3BMWA 5GGRY 5F93C 3I6GB 2JE8A 5DRNA 1ACYH 2E7LA 3GO1H 4V2BA 3UTTB 3BHBB 1X44A 1CWVA 1T1WA 1A2YA 2Z31C 4ZFZB 3FT2B 4Z0XA 5GRVL 4KRPD 4OM0H 1NJ9B 4KTEL 2WV3A 4PLJD 5E2UL 1XGUA 4PJIF 4LCCB 1I3GL 4QOKD 4O4YL 1OW0C 2GTWA 5IQ7H 3RVTC 4M6OH 4R97C 3X12B 1DEEB 1EEZB 3DLQR 3QAZB 3VCLA 2BXYA 3BT2L 2EIEA 3WS6C