2WBWB

Ad37 fibre head in complex with car d1 and sialic acid
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
SLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords FIBER PROTEIN
publication title The Cell Adhesion Molecule "Car" and Sialic Acid on Human Erythrocytes Influence Adenovirus in Vivo Biodistribution.
pubmed doi rcsb
source organism Human adenovirus 37
total genus 31
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2009-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wbwB00
4KK9C 4ZPTA 4ODTH 5JOFB 4XNYH 4Y4HB 5E2VL 1FSKB 5CEZL 3LN5B 2XA8L 4WTZG 1AY1H 4LARH 4MNGB 1RK1A 2HJKB 4JANA 1SEQH 1MCHA 3VXPA 3PL6D 2X5PA 4HXAH 4Q0XH 3MJ8A 4HZLB 1YPZE 2R2CA 1INQB 2UWEF 2PN5A 1KN2H 4YO0A 2C26A 2PO6C 1U58B 4OFYD 3X3FL 3MBXL 4ZTOH 1KXVC 1AKJB 2DQGH 3UZQA 1HCFX 3QCVL 4ZUWA 1FN4B 3OKYA 4P5MA 5JHDA 2V5RA 25C8L 3OKLB 4OCYL 3DETD 1EFQA 4ZS6C 3T0DA 1NEZA 3BGAA 5E2WL 2YHGA 2R29L 4MQXC 2GSIB 5J1AA 3H0TA 3V95A 4XNZB 4Z0BL 4X7CC 3TNMA 4YDLB 2ZUQB 3GHEH 1CGYA 4ETQA 1YEFL 2LVCA 2VZ3A 1M4KA 4OLYH 4ZPVB 3FQTA 2QKIB 2X4RB 5C0JB 1JGVL 2QEJA 3CFBA 4XCCH 4AYFA 4YDIL 1FL3A 3TFKD 3DXAA 3IDIA 2D7NA 3OXSB 3KPQA 3B9KC 1AH1A 1FV1B 3MRHB 3QUZA 3IGAB 3PHQA 4KVNL 4ZAKB 1KV3A 5HHNA 4Y4FC 3BEVA 1OTUD 3KPLA 5TDOB 2YPVL 1ZT7A 3T3MF 4PJEF 1CLZH 2I07B 3KNBB 4WO4D 1JZ3A 1DQLH 1FNFA 3ARYA 4F8TA 5D1QB 3VFGL 4X0KB 1QPPA 4RNRA 1OP5K 2APBA 1A14L 1KIUA 5I0ZA 4D0CA 4FQQB 3VFRA 2I26N 1CFNA 2E7CA 2BHYA 1P84J 1W8OA 5I71C 3EDFA 4QNPF 3GMMA 1YNLL 3B8YA 5DYOA 1BZ7B 3U9UB 5KG9B 1FAKT 4NN5C 2WUCH 7CGTA 2BVOA 3S96B 3OAZH 4ZG1A 1ZHNB 3H9SE 4EDWL 3RAJH 3BKMH 5JW4M 4MXWH 2GK2A 1BQSA 5AYQA 1G6RA 1AGBA 3TNNB 4UIMB 1UB5A 4FQXD 4YHNA 5KANI 3FQWB 4WUKL 1FNHA 5L2KA 3RTQA 1C08B 4P2OD 2GTWA 1K6QH 4S2SB 5JW5B 3BKCH 3ET9F 4XP9H 3L7FA 3C6SA 4WFFE 5EFIB 1TZIB 5KSVA 4JPKL 4LLWB 1T22B 5TE7H 4CVUA 5BVJA 3MJ9H 3QFJA 4KJQC 4F7MB 2DMKA 2C3VA 5FO9B 4LU5L 1N4XH 3CC5A 5BOPA 3P11H 1DLFH 1ZHKA 1A8JH 5J6GA 3TBYA 2K9UA 5FFLA 3VXME 3UJIL 1RJLB 1BWMA 1FL6A 1WBYB 4YUEL 1BMGA 3CX5J 2F53A 3RPIA 1UZ8A 3VXSE 2P8LB 1NFDA 1YDPB 4Y89A 2Z4QA 4Y5XC 4I0PC 2J8HA 3SBWA 5IVZA 1BFOB 3I6KB 3N1FC 4Z77A 5TH2A 5I1IL 4ZDHA 4HFWB 2CK0L 4LASL 5F1NB 3CMGA 3MPCA 1OGAA 3BQUD 3GMRA 2GUOB 4KHTH 4HF5L 4OZGA 4QYOA 1D5XB 1IQWL 5DK2B 4UQ3B 2KZ1B 1JHLL 3MLYH 3MRCA 4HC1L 2EDEA 1EAPB 3BUYB 1XF5B 1CICB 3QIWA 4ZTPH 5C0DA 4TVPL 3SDCC 4JY6B 3WUWG 1G9EA 4M5ZH 1VGEL 3QDGB 4R26L 1FFNA 4MAUH 5DVMA 1TZGH 2J88H 3GKWL 3SO3C 1ORQB 2D0HA 1XZ0A 1IM3A 3MYJB 4N8CH 5M95B 1EA9C 3VFVA 5I1LA 3PGFH 1YUHB 5FGCE 4NQEB 5C0IB 2AS5M 1QSEA 2BOCB 4HJ0C 4YXKH 4LSQH 4YHZL 1MFAL 2Q86A 1MCJA 5JDJA 3W9DA 4PJ7B 4JANB 4UOJA 1JPST 5ICXA 1HHHB 1T4KA 3VXPB 3DVGA 4FTVA 2E7LC 1FZJA 1Z9LA 1SYSA 3MJ8B 3OGCA 5LWYL 4M6AA 1K85A 4PJ7F 5L88H 5DUMH 5HHMD 3ZSTA 1YYMH 4YO0B 3U1SL 1OAXH 4M43H 4LHJB 2DIJA 2PR4L 2XKNB 5ESAB 3QQ4A 5EU7C 5IK3A 5CZVH 2YPLA 1RPQA 1NL0L 5JHDB 1E6OL 1V3JA 3TGXA 4ZO9A 3HAEG 4PP2A 4NQSB 3LEYH 3VRIB 4WIQA 1UCTA 4HUXA 2MTPA 1MQ8A 4YXLH 1N0XL 4EDXB 1PVHA 1B0RB 4S1DC 3TNMB 4OCLC 5DJDA 3ARGC 2W91A 3THML 3IFLH 3DX8A 3BX7C 3BJLA 3FQTB 4QRPD 3WDHA 2OQJA 3ZTNH 3O6KL 4MCYB 3S35L 3KPSE 2F15A 4CRPA 3ZKMD 5L2JA 1DTUA 4WEMB 1MFDH 5FM8A 3ZKND 1AXIB 3KPQB 1MI5A 2HT3D 1CGVA 1D9KB 2NY2D 4NM8L 5T1LB 1U92B 4KJPC 3V6FA 3MRLA 1UJ3A 1RZ8A 2V2WA 1ZT7B 4NHCH 4WFHE 3VCLA 4Q97A 5DD0L 4UAOB 3QDMD 4PGEB 4FXGB 2RGSA 5F71A 3ZL4L 2DQHL 3EBAA 4WTXA 4BSWA 4D0CB 4Y2DA 2LAAA 3MRMA 1UA6H 4I5BA 1YEKH 1ULVA 2YWZA 1UWGL 1QHPA 3IDUA 2DLIA 3H42L 1B2WL 3LEVH 3JWOC 3Q5TA 1AJ7H 4ONOA 1RZIA 3BPCA 4NPYA 3DSFL 2Y5EA 1CIUA 3OKOA 4PIRF 1URLA 3VA2C 1IMHC 2BVOB 1K4DB 4JDZB 2PF6A 3V2AR 4MJ6B 4X9GA 3ZDZF 3QQ9D 5TE6H 1G6RB 4PY7A 1GGBH 2PXYB 4N0YH 1AGBB 4YHNB 2AEIT 3C6LA 3RTQB 4Z7VB 2GTWB 4EOWL 1IILE 4ONHA 1ZEAH 3FCTB 3L7FB 1PKOA 5C0AD 3C6SB 4HMEA 1S7VA 4P5TC 2IALA 4BSJA 3K8KA 1KCSL 2GTZA 3BO8A 4LSDA 4K3EL 5FYLL 4XPAL 3KPRA 4OLXL 4Z7VF 3VG9C 4CU6A 4R90L 2NY4D 3CC5B 4U3XA 1IC4L 4PJDE 4P59H 5GSVB 1MCNA 4ZXBB 5HYJB 4DN4L 5F9OH 3F8UB 4ERSL 4NZUH 1FL6B 5DHXB 4BUGA 2F53B 4PJXE 3MV8E 2EDBA 1D3CA 2C1PA 4QLRA 5IJVB 2A73B 2VR5A 4G8IA 2IAMA 5D71L 4MD5A 4UINL 3O2VL 5FKPB 2I5YH 5E2TL 3MLTA 3TWCL 3STBA 2DLEA 5TH2B 1WGOA 3MRKB 4G8GE 5KSAA 5DURD 3W9EB 5C08D 1OGAB 2VJXA 4JZJC 4YHYC 3FZUC 3GMRB 3L3KB 2V7HB 2VH5H 3EDKA 1ZLSL 4OZGB 4P46D 4ZO6A 1U3HB 1TQBC 4NZTH 4YC2C 3M8OL 3MRCB 3SJVB 3QIWB 3HS0B 3WN5C 4J6RL 1I8KA 4FQCH 4S1SL 4L1HA 4OZGF 1P7KA 5J12B 2EDXA 1U8IB 1WK0A 1YNKH 5TDPA 5CINL 5I75C 5HI3C 5CEXA 1QSEB 2E9BA 2EDRA 1FZMA 3W0WD 4RFEB 3O2DA 3C87A 2Q86B 5D7SH 3W9DB 3V4PH 5C70A 1JPGA 3GRWL 5C6TL 1T4KB 2OLDA 1OTTD 4P4KD 1IC7H 3MNWB 1SM3L 5MERA 1GZPB 1MCSA 3LKNA 3PGDB 1SYSB 3QEUB 5EDXA 4K07A 4DUWA 4NQDA 5C7XL 3PNWA 4OBRA 3MLVL 2VL5A 3G04A 1K4CA 4WFGE 1I1YA 1WCBA 5E7BA 4DGYL 2XA3A 2V9QA 3QQ4B 3SOBL 5MENB 3V0WH 2YZ8A 4OIIH 2YPLB 1BJ8A 5A43C 4XMPH 3KPNA 2UY7A 2V6HA 4P5KA 2V2XA 1Z5LA 5ITFA 1TJIL 4U0RB 1WIOA 2CDGA 4ACPA 1A6UH 4GRLB 3WIHL 2R2BA 3C8DA 4RWHA 5GZOC 4WY7H 4WWKD 4RFNB 1EGJL 5DJDB 4IRJA 4FN0A 1UT9A 1TIUA 3DX8B 1UADC 1W0WA 2E7MA 2OQJB 3IDXH 1QFUL 4L4VA 1YEJH 1QEWB 4OLZL 3TN0B 5D8JH 5SWZD 3TO4C 4F3FA 5DRXB 5L2JB 3OKMA 3LOWA 2JCCE 4ODWA 5FYJH 2FEDD 2UZIH 3CJJA 2NY0B 4R9HA 4WJ5A 3WS6C 3U7YH 4EUPB 2IADB 3MRLB 3MBEB 2VDML 4WNQB 3JV5A 2V2WB 3GSXA 4TSCL 4D9RD 5CEYA 2OSLA 2Q3AA 1X5GA 3ARDA 3U7WH 1QR1B 3U9PH 1GZQA 1OARL 4OLWH 3PUCA 3OJVC 1U2HA 3X13A 4EI5C 3GMLA 4BSWB 4PJIA 4Y2DB 1G0XA 3RIAF 3T77A 3HAEH 2JE8A 4GT7A 1CXHA 4P57B 5E8OB 4GQ9H 1BQLL 1FQ9C 1IEAA 4DKFL 5HHQB 2ADIB 1NAMH 1OTSD 2FH8A 4TUJA 5LCVL 2IEPA 3EDDA 4Y4KD 3PG2A 3BPCB 4AEIH 3RA7H 3JWOL 5EH1A 3WIIL 1HCVA 2ZCHH 4JJHA 5TPWH 1QFWM 2KZWA 2ZCLH 4NP4H 5K9QG 4BZYA 5J1SC 4PY7B 5CUSH 3W2DL 4U1JA 1NKOA 5HHXH 5JMRA 3H9HA 5E99L 1J0IA 2WK2A 5D2NB 2BNRD 4LVNB 4CU7A 1KSRA 1YPZA 4FZ8L 3AREA 1G84A 5FGBA 3WFDL 1T03L 3GJFA 3D6GA 3IFNL 1EDQA 1LK3H 1RK0A 2FL5A 2MKLC 4MD4B 3KS0J 1XGTA 5DMIH 4F7CA 5FCSH 4I3SL 2ITDA 3ZKSD 3SDAB 1GJIA 3HRZA 3DBXA 5FHAH 3WLBA 4AENB 1VPOL 4DQOL 4KXZI 1NSNL 1GCFA 2C1PB 1OF2A 3V6ZA 2RCSL 4G8IB 1CLYH 4ZFGL 2IAMB 4MD5B 4R3SA 4UBDD 1ACYH 2Z8WC 4FQPA 3TA3C 4ODTL 3E2HC 1A6ZB 4GW1B 1FLTX 3LAFA 5DK3A 1RV6X 1IAIH 1C5BH 4LARL 2H6PB 5DJYB 3W82A 3WDJA 2IPUG 5T5NF 3FOMB 3FQRA 4MXVF 5JZ7C 4FHBD 1CL7L 3UAJD 3BI9X 1VA9A 4PY8J 3UXFA 1IQDB 1MCQA 2EIEA 4ZTOL 3Q1SH 1YN6B 1I8KB 2DQGL 3ALXA 1P7KB 1WWCA 3KPTA 1Q72H 2MQ3A 3RGVD 3HPLA 1H3TA 5C3LD 1YY9D 1ERNA 4M9OA 1HH6A 5D7JB 3S37X 5I66A 3OAZK 2VKXA 3IU3A 5DR5L 2WV3A 5CEXB 3CH1A 2GAZB 2FR4A 2B1AH 1FZMB 2W0KA 4HWBA 4OI8A 5GRYA 4JFEE 3RVXC 5I15H 4X7TB 2NW2B 3UTTE 3ROOA 3CH8A 3GHEL 1CFBA 1PDKA 1X6LA 3ILQC 3K7UA 5MERB 3LKNB 2P1YA 2AV7A 3DUSB 1U95A 2WWMD 4NQDB 5F6IC 2VL5B 4M1DL 1K4CB 1KXTB 1WCBB 2F9BT 5D1XA 3FB7A 3CCHA 5C2UB 2FIKB 2Q6WA 3DRTB 1T2XA 5I1DA 1DN0A 4XBPB 2HFTA 4GKOA 3TT3H 2CDGB 1DQLL 4MZ3A 2P5EB 4DVRL 1KJMB 4K3HA 1JGDA 1HQRA 2BVYA 1WBXA 4X9HA 1HQ4A 4QT5B 1LD9A 2VDPL 4NJ9L 1NGWB 1W0WB 3K0WA 1XR8A 4YDVA 3I84A 2EZ0D 4F3FB 4X98B 1J0JA 5H37H 5IJKC 3OKMB 3GIZH 2Q7NA 4ODWB 2EO1A 1JV5A 4QHKJ 1DL7H 1RSFA 3EYQC 3WFCL 3AB0C 1CVSC 3NFPA 3KLSA 3T09A 3RAJL 3BKML 3GSXB 7FABL 1KYOJ 5CEYB 1R3IL 4MXWL 4RGND 1MJ7H 3ARDB 4JFQB 1GZQB 3DTXB 5DJXA 3X13B 2ZOKA 4HKJB 3OMZA 2WBJC 3ZDYE 1JCKA 4PR5B 1MJ8L 4G43B 1K6QL 3T77B 1GAFL 3BP4A 3MREB 3BKCL 3ABZA 4XP9L 5I73B 1OD9A 4FQLH 4KRMB 4WI9A 3TPUA 4GLRI 3IF1A 3DIFA 3D25B 2ARJA 3AMKA 4H1LG 1IGJB 4TUJB 5C0GB 3MJ9L 4Y1AA 5IFHH 1QG3A 2YXFA 5IQ9A 4ODXA 5GS3A 1N4XL 4MJIB 4UQ2B 3P11L 3ZHKA 1DLFL 2HT2D 1U8JA 3KDMA 2RAMA 4GRMB 1JTTA 1BQUA 1LO0H 1OSPH 1LO3L 3UDWA 4NN7C 1JZ5A 1YMHB 4L4TB 4N8PA 5GGTA 4U1JB 5IBUB 3H9HB 1EUTA 3S5LB 5J4MA 3FHAA 1NCBL 2G60H 3VJ6A 2JJSA 4IRSB 3RL2A 4P48A 4WUUE 1KJ3L 1P84K 5EZIH 2XN9E 1HH9B 3QEGH 2GJZA 4MZ2A 5I76A 4KHTL 3WE6B 1U8OB 3VFOA 2DL2A 1CXEA 3HRZB 1T7WA 3S37H 1ES0B 3MLYL 3PDGA 3KLHD 1KC5L 1WV7T 3DBXB 5TDNB 4WGVB 3MRPB 2FJGA 3ECBA 1MIEH 4M5ZL 1H3GA 4JHZA 4MAUL 4Y5YB 1TZGL 2J88L 3SCMA 4NZRH 3TEUA 1OF2B 4N8CL 5C0RH 1FORH 3QI9A 4GKSA 4JM4H 4L8BB 1GH7A 1OCWH 1WWBX 4KI5E 1CG9A 4IM8A 5DUBA 1S5HA 3NCJH 3KPSA 4LSQL 3GSQA 1OY3B 2GY7B 3OBAA 3SDYL 5B3NA 1MWAB 3U46A 1BHGA 2W0FA 5D7IE 5H2BB 3H3PH 1G7IA 4XXCC 1NCTA 4L9LC 4IBLT 4AQ1B 2XG5A 4N68A 5DUML 1A5FL 3HCVB 4K9EH 3U4AA 2Q76B 1OAXL 4M43L 3MODH 2WAHA 4Q9QH 5JPMA 2DBJA 3SKNA 4Y8AA 3FB8A 3NA4A 4RAVA 2VE6B 5CZVL 3L5XH 1HXMB 4O51B 2BNQE 1H3XA 3V6OC 3CX5K 3QCTL 1HH6B 4NN6C 5DD1H 4DEPB 5FGRA 1T1YA 5E8DL 4HUUB 3CH1B 2FR4B 4BKLA 3LEYL 5KVGL 1B9ZA 4UUJA 2JB6B 3VWJD 1MCCA 1GHFL 1S78C 3ROOB 4U6VH 4R0LA 3IFLL 1FYTB 2YSSA 3RVWD 4HJGA 2QADB 3ZTNL 2XNAB 4RQQA 4AM0B 3VWKA 4YHIB 3LN4A 1MFDL 4JO3H 4I77L 1F4AA 4LPYA 4PJBE 5E1HB 3LB6C 1N8ZA 1U8QA 5JIKA 3C5ZD 2Q6WB 3QHFH 4JG1L 4XBEH 3UTSA 2BOBA 1WFOA 1NC2B 3FO0L 4WENB 4KU1A 2JELL 1Y18A 4XBGB 1CR9L 5F88A 2NYYD 2WNGA 3UC0H 1IKNC 4LCCC 2CJUL 4TVSa 1JGDB 4KKLD 1SY6H 4RMTA 4JRXA 1HQ4B 1J87A 1LD9B 1YEKL 4PJDA 3MXWL 5E70A 4BZ2L 2B1HH 3RGHA 3QWQB 2VXUH 4FMFA 4YDVB 3NFSH 3B4NA 4NJAH 2LU3A 2J8OA 2YS4A 3MV8A 1AJ7L 2DLTA 1CFSA 2FEEL 3CDFA 1D6VL 3GBMH 5DMYA 5JLZB 3HZKA 4R8WH 3WS3A 4ZODA 4NZJA 3NFPB 1I1AC 2ZZUT 1MAKA 2NY7H 4LPUA 3L5JA 4QWWD 4P2QB 2Z8SA 3D39B 2CSPA 1G7HA 1JJUA 1YECH 5JR1H 4JY5H 5DJXB 2X4NB 1GGBL 3EFFA 4M62L 1A1OA 2ZOKB 2Z91A 2ZUTA 2VLKB 5H35A 2YD5A 3O6FD 3QIBB 4Z0XA 5I17A 3B9EA 1ZEAL 3D2UD 4JFFD 2ESVA 1XF2A 3L1OH 1S3KL 4TSBH 1IM9D 1KTLB 5GRWA 4KFZC 3LD8C 1XF4A 3QUMB 2ARJB 1PY9A 5F7EL 4UMGA 4Y1AB 3RHWK 5IQ9B 1J1XH 1XCQB 5F8QC 4LVHB 3OF6A 2W92A 2MQ0A 1CGSL 1HYSC 2Z8RA 4KK8D 4P59L 5D1ZC 5E08H 1IAOA 1CT8B 1J0HA 4NZUL 2QV2A 1BZ9A 3RDTA 1UB6A 3G6JB 2HKFH 1FRGH 3RX7A 3L6FA 1OB1A 1KG0A 4P2YA 3QT2A 1KGCD 3V5DA 3MRJA 2AQ2A 3OAUL 4KH2A 5FO7A 5ESQA 3VJ6B 4X4YA 1NLDH 2HVJA 4PB9L 3GGWB 2XZCL 2VC2H 4RISL 4MNQD 3G6JF 5IB1A 1N3NA 4P9HH 5ALCH 1I1FB 4WV1B 3W5NA 1JWUB 2VH5L 4IJ3B 3TESA 5I76B 4HMDA 1U0QA 4HKZB 1R5IB 3LMJH 4MAYC 3BKJH 4GFTB 4NZTL 4OAWB 4WTZA 1I3RA 4BZ1H 1MVUA 1KPRA 3RWGB 3HE7C 1T5WB 4FQCL 4DUVA 3MOQA 3QA3A 3MLUL 4L3AA 3RWIB 1YNKL 3O9WB 4GKSB 4M7KH 3QUYA 2YUWA 1BPVA 4Q6IC 4JN2A 1ZA3A 2VDRL 4MVBC 4YZFF 3F62A 2KPNA 4YK4C 3SDDD 1CG9B 3J8F7 5DUBB 3LV3B 1NQBA 3QHZH 4WW1A 5HDOA 2JCCA 1X5YA 4LOUD 1MCOL 3V4PL 5DMKA 3U46B 2Z31A 2ORBH 2PW2A 4Z7WA 2IPTH 2W0FB 1IC7L 1VSCA 4L3CB 2I9TB 4EN3C 3SGJA 1HI6A 1XIWC 2P5WD 4LLUA 5EO0A 4HUMB 1F4YH 1I1CA 2CH8A 2Q8BL 2KH2B 1D6EB 5JPMB 5I74B 3B5GA 3PHOA 4JM2B 3V0WL 3F7RA 4HPYH 5E8PA 2A0LC 2VOTA 1TCMA 3MXVL 4GG8A 2AW2A 1KEGH 1X3DA 1T1YB 1A6UL 4JM2F 3OXRA 1HKLL 4JFDE 4MS8D 4OTXH 4WY7L 4DVBB 1HILA 4OKDA 1IL1B 2JKXA 4KTEH 2VMFA 2BSSB 2YSSB 5IM7A 3X14A 4HJGB 2VKWA 3HZMB 3IDXL 1LEIB 1A21A 4J3OC 1YEJL 4RQQB 3MRNB 5D8JL 15C8H 2V5SA 3OL2A 5FYJL 2CD0A 4S10A 1LO2H 2VLRA 3U7YL 4L8SC 3MGAA 1FGNH 3UTSB 4JVPA 1BVZA 3PL6C 1QRND 4PP1D 4XCFH 4HMCA 4H5SA 3U9PL 4OLWL 2YD2A 3DURA 3SKOA 4RAUA 4JRXB 1KN4L 1MFCH 4A6YB 1H3VA 1YMME 2E9IA 1DN2A 4U3HA 1TNMA 4GQ9L 4OB5H 3DETC 1NGYA 1NAML 1PAMA 2ZNXA 1EV2E 3FFDB 5F3HA 3R8BB 4JO2H 2J8UA 1LNUB 3FL7A 4JO4L 3GJEA 5J06A 3MQIA 4AEIL 5BO1H 3RA7L 2YPKB 5B8CC 5TPWL 2ZCHL 5C0BE 3FO2A 3KYMA 2D7PA 2BY2A 2ZCLL 3ZO0A 4NP4L 3IAPA 3DI2B 3FB6A 3PWPE 3TFKC 3ULUD 5CUSL 2IFGA 1A7BA 3ARRA 3H7BA 2Z91B 3LKPA 4RWYH 5H35B 3QISA 1GGIL 1XF2B 2ESVB 5L9DH 4LBEA 1OTUC 5IOPA 3LPFA 1XF4B 1LK3L 1I8MB 4WO4C 5I0DA 1I8LA 5DMIL 2GQHA 1CXKA 1KIQA 4HAFA 4W81A 5ICYA 1EJOH 1TZHB 4GBXB 1ORSA 3MA7A 4K23H 5CKGA 5I8OH 3ARFD 3UTQA 3HFML 4U0QB 4PRHB 4QTIL 1AKJD 1N5YH 4HIJA 5GRVK 2AXGB 3GMQB 4JFEA 4KTDL 1BBJB 1BEYH 4NKIH 3VXUA 4WI7A 1XR9B 2KBGA 5AZEH 3ULVD 5I1CH 1UB6B 1CLYL 1FNGA 3JSSA 3L6FB 4RA0C 5EC1A 5MEQB 4DKEH 1OB1B 5CIPA 1KG0B 3V5DB 3MRJB 1F90H 2CMRH 1B4JH 3WUWA 1IAIL 4K3GA 2HVJB 1YYLH 2DL9A 1N3NB 2DJSA 4LIQL 5JXAL 2YN5A 4K9EC 1ND0B 3QDME 4Z7QF 4KRPB 4FQXC 4JRWA 4GXVH 4U3CA 4P2OC 2Q87A 4HSQA 1I3RB 2CDFA 3O4OB 2VABA 2OMNA 5EWIL 4ZAKD 2WBWB 3EDEA 2VISA 4KUZL 3LS4L 3OTTA 5EBLA 1U8NB 3QA3B 5F1OB 5F3BA 4G5ZL 4QHMA 1ZXQA 1D5IL 1HHIB 3ZE1F 2BC4B 2DQJH 5D72L 2Q20A 3QUYB 3EYOA 4JN2B 1ZA3B 4I2XA 1W72H 4TPRH 3QUKA 5D1QD 2PYFB 4GXUN 1OW0C 4H26A 3MCKA 2B1AL 2EC9T 2Q3ZA 3QPXH 5FUCE 2D3VA 5I15L 4V2BA 3VFTA 2VZSA 4LSUH 4CBPA 3IDMA 4AL8L 3BD3A 4Z7WB 1HSBA 4OUOA 3TIDB 1KXQE 4FFWD 1HI6B 3S8WA 4LLUB 3HAEA 3JZ7A 1CGWA 5TF1H 5GRVL 1H8NA 4XAKE 5E2JA 3TP4A 1T6WA 3L5WA 2V5TA 1EH9A 1ZA6B 1GGTA 3V5KA 5IHBA 3BQUC 3QG6A 3EJJX 5JQ6H 2W65A 1WAAE 1WFUA 1WCQA 2IH3A 2J12B 4U1HB 3UBXG 1CDBA 1E4KA 1I7RA 3UX9B 4AMKH 3FRPG 4HXBH 4YEFA 3OHXB 3D87B 4HS3A 2K7QA 2ZG2A 1FZKB 3VA6A 1X4ZA 4RZCA 2EEBA 4N5UA 5DQ9A 3VXRD 4C56D 2W1NA 5I1EH 1X5IA 3T2NH 3X14B 4YDKL 3IS1X 2IQ9H 1NMBH 1Z3GH 5BS0E 4YFLI 3TJHC 2FX8H 4GRWB 3GIZL 5C08E 2DQDH 4I18A 5LGJB 1DL7L 3MV01 1WWAX 2G9HB 2VLRB 5DT1H 4YAQA 2KL6A 2W9LA 4Y5VC 3GBNH 5DI8A 4GRWF 2W38A 4JN1H 3L5HA 4W6YB 1MJ7L 4H5SB 1I8IB 1LP9B 3QIUA 4Z7UE 5JA9A 5EZLA 3UYRH 4AK1A 3NZHH 3DURB 5CJ8A 1WIPA 1MHHA 4JFZH 1S7QA 1LP9F 1DE4A 1JPFB 5DQJB 1NCDL 1C12A 3FB5B 3ZTJH 5T1MB 2CDEB 3FHQA 5IFHL 4N90D 4LEOB 2XKUA 4ELKB 2J8UB 5FKAB 2G5RA 43CAA 1CU4L 1RZ7H 4LP4A 3V0VB 3BWUC 1TMCB 1J10A 2DQCH 1OSPL 4JKPH 1XGQA 1NLBH 4DGIH 2MJWA 5D93C 3KGRA 2J8UF 1F13A 2ZP0T 3ZKMC 3MROB 5HVGB 4DK3A 3FTGA 5D7IA 3ZKNC 2HT3C 4MDJA 4P9HC 5D7LB 2NY2C 2I25N 2C3HA 4EI6A 2C7UA 2G60L 2HH0H 1MHEB 2R9HD 3OKKB 3QWOB 2DRUA 4OI9A 4LLQB 3CFDA 5EZIL 1LO4H 1CTOA 1H5BB 1KIQB 3QEGL 5ICYB 5IMLA 2BNQA 1ORSB 1W0VB 1RUMH 3GI9L 4CU8A 3WEXA 1VENA 3T0AA 3WBDA 4NT6A 3PV7A 1HOCA 4FQJH 3VXUB 4KGJA 5LG1A 3WFBH 5JHDD 4NZRL 2QHRH 3BIAX 5C0RL 2B5IB 1FORL 5DLMH 4JM4L 1FNGB 5EC1B 2ILLA 5CIPB 2R1YA 4KY1L 5EUKA 3LRGA 5JO5A 2B2XH 1KPVA 4WTWA 3NCJL 3F7PC 3IKCA 3HI1A 2D7MA 3GIVB 4G6ML 3GO1H 1I9RH 5HHPA 1ZANH 1MVFA 2VN7A 1N26A 2W07A 4PJBA 3O8XA 4ISVB 3QQ9C 2F54E 3ZHDA 1MH5B 3H3PL 3CLFH 4LL9A 2HWZH 3AC0A 1UM6H 3DXAD 4K9EL 3ZE2E 4PRNB 4E0RB 1ZVYA 1J86A 3QUZD 5E8NA 4Y2OA 1CTNA 3MODL 5HXMA 2VISB 4Q9QL 1B6UA 2FWOA 4M7ZB 4PREA 5EBLB 5CD3B 3L5XL 2C4FT 4LK4A 4QHMB 1ZS8A 5HVHC 5CHNB 2NY4C 4MGXA 5DD1L 4I2XB 4JLRA 3QUKB 5I1KH 4X5WA 3MCKB 1UVQA 2YEZA 4KUCD 5D70H 5E94A 2D03H 4U6VL 3S3JA 2N7AA 3K80A 2BNRE 5DHYB 3BXNA 4KKCD 4QRRE 3EOBA 3T0EA 5K9OB 2XY1A 2YA0A 4X4ME 5IKCA 1YEDA 2QQLH 1OPGH 4CMHC 1FHGA 4B7IA 2P8PB 2W65B 4XBEL 1J8HE 3FMGH 3MFFA 4N0CD 4M6OH 2ZSWB 5HGBB 4KRNA 2YD4A 5L2KD 1LK2B 3RTQD 5FDWA 4WWID 1NCNA 1SY6L 4D0BB 1BFSA 4RZCB 3PWVB 2NQCA 3VXQA 2B1HL 3QFJD 2VXUL 4L29A 3NFSL 1JTPA 2AJSL 3OJMB 5I8KH 3CXDH 2JB5L 4NJAL 4BA8A 1Q1JH 5EU3A 5IEKA 1BQHG 5KSBE 3QEQE 4PJCB 1JZ4A 4ZXBD 1OTTC 4P4KC 5HYJD 4I3RL 1NJ9A 4NWUH 2UYLA 4HAGA 1I75A 2WINA 2F19H 2NY7L 2F53D 4EEEA 1WVZA 3T0XA 1PEZA 1YECL 5JR1L 1JF1B 4JY5L 2HVKB 4PJCF 5DJ6A 3QIUB 2PTUA 1BLNB 1O0VA 2D31B 3I50H 4U6HB 1S7QB 2RJMA 3WL9A 4TSBL 2AXFA 1H3WM 3DX9A 1OGAD 4FOMA 3LH2H 1KTKE 2HP4A 3HA0A 2FJHB 2FX7L 5GS0D 4N8VG 1J1XL 1T20A 4WWKC 1Y6MR 4JKWA 3SJVD 2V9TA 43CAB 3QIWD 3UTPD 5E08L 2J4WH 1HINL 2EICA 4W70A 1MREL 3RWDA 2Q1EA 3VI4E 2EIDA 2Q7YB 5DHVB 2HKFL 3FTGB 1FRGL 2FEDC 4P2RA 1MCIA 2ICWA 4G3YL 4MDJB 3K4DA 2VDLH 3QFDA 3RWCA 1G7PA 1QSED 1XEDA 4IMLA 4NO0A 2C7UB 5SWSB 1DQQA 2VC2L 4LSVH 1PYWB 4P9HL 1F8TH 3UTZA 3IVKA 1MJUL 4FTVD 3VGDA 3NA9H 4XNQA 2JTDA 1JMZA 1VADB 2VXQL 3MGOA 2HJFA 4U7KA 5IMLB 2VLLA 1H8OA 3LMJL 3BKJL 4NNPH 3WEXB 3OG6B 1QSFE 3RWHA 5F89A 4OCXH 4NT6B 1BVKA 1DVFB 5IB4A 3FQNB 4JFDA 4RMRA 2YPLD 1DP0A 4JHBA 4QY8B 1OTSC 4PRPB 2K1MA 1JHTA 4EBQH 5J8OA 1UZ6F 2ZSVB 4M7KL 5CILL 4Y4KC 2R1YB 3P4NB 3O11A 3OPZH 5EUKB 5JO5B 1S9XB 2OJZH 1KPVB 3EJZD 1MCBA 4RGNE 3X11B 3CVIH 4NO5B 2FO4A 3F7QA 3HI1B 2CIKA 5HHPB 1P4LA 2CIIB 1XF3A 1UGNA 3MA9H 2AKRB 2ORBL 3BN9D 3O8XB 1P5UA 2IPTL 2YD6A 2FECI 2YRZA 4GH7B 3WV0A 4GKZA 1HSAA 2Z92A 5IW6B 2BK8A 1F4YL 3BW9A 5GS1B 4N9OB 1MI5D 2NY0D 1AFVH 4U1SA 4KKBD 1UENA 3GSVB 4XP5H 3IRZA 3VRLF 1Q9WB 3QG7H 4LLVA 2VZ1A 2ADGA 4OV5A 1QRKA 3OB8A 2HG5B 4L1DA 1YMMA 1KEGL 4KZEL 4X5XB 1QBMH 2XZZA 4X5WB 1DFBH 3NCYS 4QRUA 1UVQB 2A6IA 3QJHB 2X4TA 4IRZL 4TRPL 4Y2DD 5E94B 4M7LT 1ZVSB 5L8LB 1P53A 3BEWA 1QA9A 2W0LA 1Q8MA 2CK2A 2PETA 3BXNB 4UBDC 5C0BA 2QQKL 5TE4H 2GJJA 4HUNB 3T0EB 5K9KB 3PWPA 2FSEB 4HLZG 4OCRH 2AJZA 2DKMA 4PJ5B 5IKCB 2ZUWA 1YEDB 3B2VH 3S3SA 1LO2L 3I6LD 4LSTH 2EDLA 3NIGE 3OQ3B 4LVEA 5SWQB 4OZIE 1FGNL 3P9LA 3UAJC 2Z35A 5KSUA 1U8HB 3O2WH 3K2UL 3IYLW 4GS7C 4OF7A 3VDAA 1TNNA 3MFFB 1XGYL 2PO6B 3DHJA 2FZ3A 3C6LD 4LQ1A 1TVHA 4V1DA 3VDCA 4EXPX 4ZD3H 3RGVC 3KPPB 1YY9C 3T65B 3DO7B 3ZKXB 3Q0HA 4EXKA 1R3LA 1DQMH 3KPRD 4UV7H 1OVZA 4OB5L 5FAAA 4K71B 4ZMAT 1X5AA 5C71A 2X4OA 2OYPA 4JO1H 5IF0A 5EU3B 1R24B 5DRWA 3WO3B 32C2A 3SDXE 1XCTA 3G6DH 3JTTA 3MR9A 5IEKB 4JO2L 1KJ2L 1F42A 3NCMA 5B39A 3I3BA 5BO1L 4MSWA 1JL8A 1NJ9B 2UYLB 2WINB 4D0DA 3LKRB 1JYVA 1XGUA 2WWMC 2D0FA 1NBQA 2IAMD 2AK1L 2X4QA 3B9KB 4G6FB 5L7XH 3SE4C 4RWYL 4OLUL 1UWXH 2B4CC 4YBQD 2BVPA 1DANU 4LFHG 4M1GH 4J4PA 3VD7A 3WNPA 1T1WA 5L9DL 4HWNA 4W4NA 1E4XH 5KSAD 3VGBA 3WL9B 2CKBH 3DX9B 3NFNA 2OXGA 1U93B 2AP2A 3DRQA 4JY4A 3U7AA 3X12A 1A7NL 1AQKH 1FAIH 1EJOL 1T20B 1R3JB 2EE3A 1DBBH 1TETH 3MYZA 4HULB 1BECA 2LU4A 1QO3A 4M7LH 4X83A 5TQ0L 1VGKA 1A3LL 1T83A 3C09C 4HHAB 4PTTB 3RBGA 5I71B 2EZ0C 4MA1C 4LHUB 5AZEL 1AI1H 4ZUTB 3AY4A 3MOAL 3WKNA 3CUPB 3WO4C 4P2RB 2ICWB 3RWCB 5C07A 4NN5B 4IMLB 5D9SA 4YHPB 2CMRL 2CO6B 1RUKH 1B4JL 4HV8B 3TLRA 5JIIA 4ZQKA 1DQQB 4JQXC 4F57H 3PV6A 4RGNC 5KAQG 1S9YA 3SY0A 4XNQB 1XGPA 1V7MH 2FLRT 2HJFB 4Y19E 4IIQA 5C8JB 2VLLB 2M8XA 5DEZA 4NQDD 4H8WH 3LKSB 4GXVL 1HDMA 3REWA 5DSCB 4NQXA 1BVKB 2NXZD 3HE6A 5FA3A 4X9FA 3RNQA 1AE6H 4P0DA 1OAZH 1JHTB 2DQFB 4OF6A 4ODHH 1MFBL 3OB0H 1FZOA 1J12A 2DQJL 4JAMA 1AD9A 3O11B 1YEIL 1BF2A 43C9A 1W72L 4TPRL 3QO1B 3IFPA 2HT2C 4NHUA 5IROC 1A1NB 2P5ED 5BS0A 5HHOB 2FO4B 2WMPA 3QPXL 1C5DA 2CIKB 3CLEH 2XQYG 2FB4L 4IRJD 3WFEL 4Q2ZA 1XF3B 1S7TA 2BY0A 5FUZH 1PG7X 4GKZB 2Z92B 4P46A 4L4VD 1A6VL 1AQDA 4JFFE 4UIKL 4F9PA 5TF1L 1VCAA 2AABH 4NFBA 5E8EA 2XI9A 4MA8H 4Z7UA 3P77A 2ADGB 2IJ0C 4OV5B 2DIAA 5JQ6L 4TULH 3ARDD 1BD2B 4QOKB 4LLMA 4PJGE 1JZ2A 4AMKL 1VDGA 3KLHC 1QFHA 4HXBL 3SDCB 2EDWA 3ARUA 1CQYA 5T1KA 2A6IB 3JBG7 2VZTA 4M5YH 4PJAA 2YK1L 3SO3B 4XGZA 3G9AB 4D8PA 1KCUL 1U41A 3U6RA 5C0BB 4C83A 4R4ND 1G1CA 1NMBL 3V79C 1AGCA 1T21B 3ULVH 4X6DB 2DQDL 2DDQH 4M3KB 4PBXA 4PBVC 4GG6E 1HN1A 4GW4A 1Z9SA 1T0NA 2F74A 1HNGA 2VAAA 1MRFH 3HC0B 3GBNL 3RBSA 2Z35B 1I1RA 4X6DF 4JN1L 1BOGB 4X7FC 1SBSH 4NSKA 1EPFA 3VE0A 2OTUA 2R0WH 3D48R 1A9BB 1G9MH 3NZHL 3RUGB 3UYRL 1NUFA 1RQ5A 4V1DB 4XCEA 1KCLA 3ARED 3QRGH 3MRBA 4CN4A 2FDBP 1AP2A 4K94H 3B8SA 1EO7A 5FYJU 1LO5A 1MHCB 2VSCA 5DVLA 3RUGF 4OF8A 5GGSA 4M61A 3D85B 5FECA 3L3IA 3VWJC 32C2B 1MCWM 4NO2B 4JPIA 5K59E 3JTTB 3MR9B 3U0WH 3P30H 1S8DB 2VLME 1RZ7L 4PRIA 3T3PF 3FT3B 2DTSA 3VXNA 4F2MB 2DQCL 4D0DB 2QHLA 4JKPL 3RVWC 3A6CH 3BZDA 1I4FB 3HR5A 4H1LB 3T4YA 5F44A 4G8EB 5DRZA 1L7IH 9CGTA 4EKXA 1G9NH 2F54A 2Y7QA 1MCDA 5IESL 4W6WB 4HCRA 3IJHB 2ITCA 3TBWA 3C5ZC 5B38G 3HI5H 3LY6A 4IDJL 1G1YA 4G7VH 1QLRA 3RWEA 3RX8A 3NFNB 4GMSH 3PJSA 4XNXH 3P4OA 5BV7B 3BGFC 3DRQB 4G9FE 1VHPA 5I18L 1SHMA 4DFIA 1C16A 2CLVB 4KKLC 4XP1H 4ESKA 4HZAA 2HJLB 4JG0L 1R3KA 1JF5A 4B50A 1L6XA 1QO3B 5K9JL 3NAAH 4FQJL 5F7HA 1N6VA 3P4LA 3MV9B 3WFBL 1IEHA 4LKCA 4FFZL 5DQDH 3ZMRA 3F7YA 5DLML 2XPGA 5CGYD 5C07B 2N4IA 4YXHH 1QLEH 3DARA 5ECJE 3E6HA 5D9SB 1QRNE 2B2XL 4QRRA 1UG9A 4XCNA 4F9LC 5AD0A 4HBCL 4QWWC 3KG5A 1I9RL 3PV6B 5LGKA 1ZANL 2BDNH 1M1SA 1S9YB 3SY0B 3TZVA 5FYKH 1XGPB 3EJYD 5IVXE 1GYAA 1ADQH 4KROD 2HWZL 4NKOA 1J8HA 4AJ0A 1UM6L 1RZKC 3HI6H 3O6FC 3X3GL 3BE1L 5EUOB 5D1XD 5DDHA 2PYEB 3JV6B 3MV7B 4OCSL 2IGFH 3S4SB 1QQDA 1FDLH 4KJWD 1UXWB 4ZFOA 1X5JA 4PG9B 5EUOF 4WFFD 1CE1L 4LCWA 3EGSA 2MCPH 1YC7A 4FQIL 4JAMB 4BK5A 5BRZE 3VDBA 4B41A 3IFPB 1A6PA 1A3RH 2AJUL 4NDMA 5ADOH 4PBWD 2D9QB 2YZ1A 1WBZB 4NZDA 1IEBA 4Q2ZB 2D03L 4UZGA 1S7TB 1BX2A 1MEXH 5KSBA 3QEQA 2YUZA 1SQ2N 3DVIA 1BFVL 1FG2A 1ZTXL 3G5ZA 1AQDB 5DD5H 4MNGE 2X70B 4NNXB 3QSKB 4PV8A 3ISWA 3FFCB 3REVA 4TTDD 1GPOH 5E8EB 2A38A 1T1ZB 3FKUS 4J3WA 1OPGL 3DECA 4YHYB 1ROWA 2DI7A 2EDNA 2O5XL 2R2HB 5DGRA 4LSSH 3SPVA 3A6OA 1AHWA 1EXUA 5J13C 1TQBB 1PKQB 4X6EB 1B6DA 1FVCA 4YC2B 1RULL 5F9JA 2FD6H 4M6OL 3WN5B 3MJ7A 5T1KB 4XPBH 3ULVE 1T0MA 2XT1B 3HRPA 3VW3H 1B0WA 4PJAB 3RL1B 3IDJA 2OR9H 4NGHH 5E9DA 2X7LA 3U6RB 5DXWA 4UDTA 4MJ5A 5I75B 4C83B 1JUFA 4Y1AD 2HTKD 3CXDL 4OGZA 3BH9A 3A67H 3HG1B 3SDDC 4PJAF 2R39A 3VFNA 5HY9B 5CJXC 4LAJH 4LOUC 5HGDA 5I2IB 4GW4B 4KQ3H 3WKML 4U6XB 1IGTA 35C8H 1VFAA 2VAAB 3LQAH 4NWUL 4JRYB 3T3ME 5IMMA 4WW2A 3VFWA 4JFXA 4OF3A 1NEUA 5E5MA 1QHOA 3Q6GL 4PRAA 3BZEA 3T0BA 3F7VB 3MRBB 3I50L 4QGYA 4WGWB 2P43B 1R0AH 5DTFB 3FONB 3O3BA 1LO5B 1QSFA 1KB9J 3MSPA 1I9IH 3RY5A 5CFHA 2NX5A 4QNPE 4JVWA 1GVIA 4MS8C 3L3IB 4JPIB 5EG6C 1AXSA 3P0VL 4X6FB 4PRIB 4AQOA 1QSVA 2J4WL 3EZJB 3VXNB 5C6PB 5IWLC 3SCMD 2H9GA 3T4YB 1RZJH 4ORGA 1A64A 2F58H 3QI9D 1DEEA 1A7QH 2Y9RT 4HT1L 5FB8A 5TQ2H 1Y0LA 3CDYA 2Y7QB 2VDLL 1MCPH 1JN6A 5JOPD 4ZUVA 3KPSD 3DX6A 3FN0H 2ITCB 2EXWD 3HKFA 2F8XC 4YIQA 2UUDK 3O41A 5FHBL 3VI3F 4LSVL 3PJSB 4PP1C 3P4OB 3KYNA 1BIIB 4HIXH 5DJAB 2AK4B 1MFNA 3ARZA 3K74B 4EI5B 3TBSA 4A2MA 1G6RH 1ZE3C 4JZNB 4NNPL 2OZ4A 1SJHA 3BPNC 1RAMA 1R3KB 4OCXL 1UCBH 3P3YA 3CSYA 4Z7NF 4LKCB 3O3AB 4PTUA 2I60H 3SO5A 3TT1H 1IAMA 5FYKE 2KDGA 5JPNA 3E6HB 4NRXB 3BHBB 4Y16C 2D0GA 5IV2A 3CVIL 5AG9A 4XCNB 5DD3L 1FFRA 3M1BA 1A6WH 3GMNA 2KKQA 3MA9L 3WFHA 3ULUC 1FVEA 3U0TB 1N5YL 3D9AL 5CP7A 1ODAA 4KDTC 3VWKD 3BYTA 4ONGH 3BPOB 5DDHB 4XHJD 4CVZA 1AFVL 1EO8L 1A2YB 4XAWH 3TYGH 4PGBA 4PJXF 4N90E 1H15B 2X4SB 1KIRA 3QG7L 3UTSD 1NGPH 1RZKL 4DAGH 4JQVC 5IIEB 3RZCA 4UILH 4XB8A 5CS7A 4LCWB 1OAQH 4ORZC 4BH8B 3QDGE 3ARFC 3PWLA 5J11C 2OJEA 3PGCB 4CADA 2EE6A 3RIFK 4KQ4H 2VIRA 1BWWA 4BM7A 3CZJA 4L9DA 4NDMB 6FABL 4JRXD 5GS0H 1WT5C 4LGPB 3OR7A 3S7GA 1Q9KB 4NQEE 3BWAB 3DSNA 5K33A 3ULVC 2YKLH 1UWXK 2D7TH 4UU9B 3UBXA 2WLYA 3C5JA 1FG2B 5M94B 3C8KB 4OFDA 3FRPA 3TA3B 5B22A 5TE4L 4PJ7E 3E2HB 5IFJB 1GIGH 3ARBA 4PV8B 3MV8D 2WWKO 4LRIA 1ZLUK 1S9KC 4XNZC 4OCRL 2ZUQC 3B2VL 3QQ3A 3UYPA 4C59B 3INUH 1JGUL 2EDOA 4PJ9C 3SPVB 1U8KA 3WHXA 1G9MC 4OZ4B 2LQRA 2V7NB 3QXAB 4N0FB 1U8MB 1K8IA 4HFUL 4K94C 3MJ7B 2BSTB 2YD7A 5JHDE 1T2JA 1I3GH 5DRNA 4BFEA 1YN7B 4ZAKC 4JFOA 5I8EA 3JTSB 2ENSA 1T0MB 4ZD3L 2ESVD 3HC3H 5DJ0B 4JHAL 3IDJB 5ID1B 1KNOA 4Z8FH 5E9DB 1Z9MA 2MKWA 3KYKL 4MJ5B 1DQML 5C0EB 1JUFB 3MJGX 2IH1A 3HMWH 4UV7L 3GUTB 4U1KA 5D1QC 3BH9B 2VO5A 4OM1H 3RPKA 4JO1L 3OF6D 3AM8C 3SKJH 4BSVA 5FUOH 4MB5A 5HGDB 1II4E 4NO3A 3C08H 4KHXH 3OZ9H 1UJTA 1R3HA 4FFWC 4YR6A 5AYUH 1VEMA 1FC2D 1N6UA 4L3EB 4NC1C 3RDTD 1TENA 3G5YB 5F6IB 5HD8D 3A0OA 2H1PL 4DZBB 3T8XA 5FF6B 3BZEB 5DZNA 5L7XL 4Y19A 3NTCH 5JUEH 3OB0K 1Q0XL 4HD9A 2BFVL 1JRHH 5F7MC 4BK4A 2HA1A 5GRXG 4NBYB 5EU5A 1E4XL 4WFGD 1VACA 1X4XA 5BVPL 3MV11 1NAKL 1XGRA 4RDQG 2NX5B 2Z0BA 2DICA 1QFWI 4EUPH 1MQKL 4KRPD 1CYGA 3S5LG 3E3QC 1FJ1B 3HZYB 1VFMA 2JJVA 2CUMA 1DBBL 3T2QA 1TETL 1RU9L 5D5MB 3CSGA 5F96H 5I30H 3ZDZE 2IFFH 4D9LH 3QUYD 1IBGH 5D5MF 1CDCA 2V5YA 5I1AA 1JN6B 3AB0B 4ZUVB 2XRAH 4H25A 4YIQB 2F5AL 3O41B 2Z31D 4E41B 4F57L 3KYNB 4Z7VE 1V7ML 1MJJB 1JVKA 3I2CL 3TBSB 4G8FA 3AUVA 4U1MB 3QDAA 1RJCA 1UQSA 1FNAA 2EH8L 3VH8G 5J3HD 2YA1A 4X8JB 2R1XB 1N7ML 4CDHA 1EFXA 3CSYB 1KT2B 4Y8DC 1XMWA 1ZOXA 5ANMA 4K7PL 1HNFA 4O2EA 4ODHL 2X9WA 5HYJE 5JA8B 5JPNB 5FOJA 2BVQA 2F53E 1WSST 5IV2B 3FO9B 2Y1VA 1YEEL 1K2DA 5ACMA 1CZ8H 4HUVA 3D5OF 4GG6A 3WFHB 1VFOA 4L5FL 4PLKD 4LLYA 5FUZL 3E8UL 2BSRA 4WDIB 1U2CA 2J6EA 4QRTA 4JKLA 1V5JA 1NBZA 1J0YA 1OGAE 1GC1C 5IEHA 2AABL 2R9HC 2VLRD 4OZGE 2QSTA 1NC4A 1WC7B 1NFIB 3JVGA 4KGLA 3SJVE 4TULL 3O3EB 5HYFA 2LE9A 5DJ8B 2A77L 3SGDH 4AIOA 2VIRB 1ONQA 1N2RA 3NABL 4N9GA 5L0QC 4LAQH 2VITB 3OR7B 4PG2A 4KDVA 4DGVL 1QSEE 3OSKA 4J3TA 3IXAA 5GPRA 4HPOL 4RGOH 5GGVL 3MNZA 3FQUB 3BP6A 2CKBA 2NW3B 3ULVL 3IDNA 5CGTA 5EO9A 4TQEH 1IFHL 1E6JH 3N0PB 4YGVB 4KK6D 3RHWF 1BVLA 1P1ZA 3O2DH 4LPTA 4K7FA 1MRFL 5IMKA 1DQTA 2YMXH 1A4KA 4JREB 1SBSL 3AXLA 4EQ3A 2X4UB 1S9VA 5MENE 5JMOC 1GRWA 1KBGH 2R0WL 2YPLE 3QNYA 4G9FA 4HIIA 3P2TA 3QUZC 5EC2A 5DRNB 3RWFB 1G9ML 5I8EB 4JFOB 1BQHA 2AQ3A 1X5FA 1T04B 1JI1A 3SQOL 3QRGL 2C5DC 2NY6B 4K94L 5H94B 3V7AG 2P24B 1KNOB 2DQEL 2FHCA 1RJYB 4RMQA 4F80A 4NN6B 4PGCA 2IH1B 2OBGA 4BSVB 2L4OA 3P30L 4Z95H 2BP3A 2EYTA 3DUUA 5GGRB 1CCZA 2DMCA 1CS6A 4AG4H 4YR6B 2NTFA 1CXIA 4JFED 3VXUD 1YY8B 3A6CL 3VRJA 4PY8I 5I6XB 2AGJH 4KKCC 1NBYA 2YA2A 1OM3H 2DTMH 5KS9A 1L7IL 3T8XB 4GMTL 1F3RB 5IVXA 1DQDH 3T08A 3GEWB 5C0ND 1DQJA 3SE3A 4PJ8A 3CFCH 2FGWH 4G7VL 3A6BH 1KJVA 4XNXL 1KPUA 3UPRB 4N0CC 3MFGB 1EVUA 4KKNA 5HYSB 3RTQC 1H8SA 4I8DA 5JW4N 4XP1L 5BRZA 1EX0A 3OJ2C 3KJ6L 3AAZA 1MF2H 5FCUH 4ENED 4IOFD 3TVMA 5DQDL 1NMCB 3V52H 5JOFA 4Y4HA 2ZUVA 3L95B 5ICZA 2ARWA 5EU4A 1QLEL 1DDHB 4MNGA 1AC0A 1CK0H 1I1AB 2UWEA 4U6YA 4R97B 4H25B 2W59A 4DK6A 4XB7A 2ICWI 2ENYA 5D2NE 3D3VB 5FDYA 4LDLB 1X44A 1KELL 1R5VB 2APWA 1CFVH 5ISZB 3SBWC 4G8FB 5IMOB 1HHKB 1U58A 4HIHA 5F1SA 12E8H 1UQSB 4EZMA 3IDYB 4J3UA 2AEQH 5CJQH 3CK0L 1JFQH 4TNWF 3V4UL 1FP5A 1QFPA 1FDLL 1T89A 5ANMB 3BT2H 3OKLA 2NLJB 5INCB 5GS0C 5F7KC 4ODVH 2GSIA 2MCPL 2R0ZH 4BELD 3GMPB 3QIWC 2BVQB 1PW3A 2OI9C 2DAVA 2VB5A 2WIMA 3WJJA 4PV9B 2DQIH 5ADOL 4HUVB 2QKIA 4MXVE 2X4RA 5C0JA 1MEXL 3HC4L 5DD5L 4QRTB 2W9DH 3OXSA 1NBZB 2DBLH 1CN4A 4PJEA 3W39B 3MRHA 1Y6KR 3IGAA 4QTHA 5IEHB 1GPOL 5DO2D 1PLGH 1NC4B 4IDLA 4JDVB 4M48H 4NKMB 5TDOA 3GB7B 2XTJB 3T1WA 1GC1L 3OAYH 2I07A 1X4YA 4MAYB 4RRPA 1MWAH 3EKCA 3QIUD 3JWDH 4XPHH 1ONQB 2FD6L 3FRUA 4GXUM 4N9GB 4WEBH 5FA4B 4QHUA 4XPBL 2Q8AL 3CVHB 4OGAD 3VW3L 2HRPH 1MELA 4PYGA 1DLHB 3IXAB 4PRDB 4NGHL 3BDYH 3RKDD 3MNZB 4RX4A 4Q6IB 2DYPA 3BP6B 5DVOA 1BZ7A 3U9UA 5D96C 1GGCH 3A67L 3EJZC 5KG9A 2QR0B 3IDNB 3LN9A 2VLJA 4RFNC 1ZHNA 1BVLB 3KR3H 1T0PB 4KI5D 2D2OA 4KQ3L 5AWNH 1J11A 4HWBH 1F11B 3BN9C 2NY1D 4NQDE 2PKDA 4XCYA 4K7FB 4AT6B 3FN3A 1XIWB 2ZG3A 3AXLB 4UIMA 3TNNA 1S9VB 3FQWA 1EK3A 5DS8B 4WHYH 3H7LA 2NY0C 3QNYB 1G7MB 4KKBC 3NN8A 4S2SA 5JW5A 1BQHB 1Z9OA 3UPCA 5GGRY 4P49A 4LLWA 1T22A 3S88H 1UJ3C 2FCBA 1KTRL 3GNMH 4F7MA 3DV4B 1I9IL 2P5EE 4O4YH 4PGCB 3EIFA 1TXKA 1UC6A 3L3GB 4I9WD 3OJDB 2BNQD 1FBIH 4FS0A 4OI7A 2WLZA 3LDBB 4Y2DC 2CXGA 3IJYA 3MX0A 3VMNA 1RJLA 1ADQA 4JPVH 5MP6L 2NTFB 4XC1H 2P8LA 1KLGB 1YDPA 3C2SA 3DWTA 4PRPD 2F58L 2X1PA 4N8VB 1A7QL 5B3JF 4PB0H 5KS9B 1BFOA 4X80H 4NOBA 1MCPL 5DZOA 1DQJB 1IGYB 5F1NA 4PJ8B 3VGEA 3PL6B 1ED3B 2UZXB 1KJVB 3O8XD 2GUOA 3SGEI 1KPUB 1RIVH 2P48B 2AXHA 4HIXL 2X05A 3RWJB 3VXOB 1F6FB 1JGLH 3MO1A 3BUYA 3C6LC 1CICA 4J8RB 2C3GA 4LVNC 1N6QH 2CLRB 4KMQA 3QDGA 1G6RL 1JNHB 3BMWA 3QEHA 1ORQA 3AAZB 4MDIB 1RURH 1ETZA 2A83B 4MJIE 1YUHA 2KUTA 3TVMB 1VESA 4NQEA 5C0IA 3OX8B 5ICZB 2BOCA 2H8PB 3QUMH 2VDNL 3BSZH 5EU4B 5DZLA 3HNVH 5T33L 3ZT7A 4PJ7A 4L4TE 2UWEB 4U6YB 1HHHA 5D6DA 3NPSB 1RHHA 4JGUA 5F97E 4ZUSA 2EYRB 4XWOD 1KB9K 1B0GB 5J9PB 2RR3A 1L0XA 3QYCA 2IAMC 4KK9D 3QPQD 3V7MA 1WFNA 5ALBH 3FO1B 4HIHB 4ONGL 2W0PA 3T0ED 4YBQC 1LE9A 2XKNA 5ESAA 5GGTH 4JDTH 2QSQA 3KHOA 5KSAC 1HEZA 2VZOA 3CZFB 2RFXB 3DUHA 3TYGL 5EIIB 3I02A 3MACH 1BREA 2E27H 5I16B 5FEBA 1I9JH 4F58H 3F5WB 4MMXC 2LVEA 5BZWA 4NQSA 3VRIA 1OAQL 1KCKA 1MCWW 2E5EA 4OZHA 3IAQA 1X5LA 4EDXA 1B0RA 1I7ZB 3VFSA 5EOTB 4TNVF 3DX7A 3H2WA 5GS0L 5GJTL 1NDMB 5LAXB 4MCYA 4U1IA 2DI9A 3IXTB 5E6IA 4XWGH 1L4IA 1GIGL 3R06B 4PJEB 1D9KA 4QTHB 5DGQA 4FNLH 4YE4H 5T1LA 5EA0H 1U92A 2PTTA 5E95B 4HK3J 3INUL 3ARWA 4FQXB 1NCCH 2AXJA 3R1GH 2X1XR 2D9CA 4L8DB 4FXGA 2LTQC 4PGEA 4G6FD 5I19H 3FRUB 4IMKA 5EBMA 5F21B 8CGTA 2NXZC 4QHUB 4ZSOA 1TJGH 2COQA 3BAEL 4CAGA 2AV1A 3W11D 1NMAH 2VSDA 2DYPB 3VGAC 1RUPL 3WSQH 5HGAB 4NM4H 4OM1L 1RY7B 1FYTE 3SKJL 4OZFB 1K4DA 2VLJB 2ZNWA 4JDZA 5FUOL 2V2TA 4IRJC 4N5ED 4KHXL 5JXEA 1LDPH 4MJ6A 5T1DH 4J1UB 4XCYB 3GSWB 5LGHH 3PQYA 4BFIB 1UM5H 5AYUL 3ZDXF 2PXYA 3CU7A 5IR1B 4OJFH 5ITBH 4M4RA 4P2RD 4OD3L 4Z7VA 1WEJH 4GAJH 5INDB 3NN8B 5CJOL 3FCTA 5GS2D 4NO0D 1HXYA 5E24E 4XNMA 3BQUB 3JV0A 4XPTH 3AFLA 1ZHLB 5BJTB 3N85H 3ARDC 5CCKH 1P7HL 2YD9A 3QUXA 1NEZG 4MA7H 1NCWH 4D94A 4NWTH 5GSVA 3M17A 4ZXBA 2ZKHH 5HYJA 3IJYB 1FGVH 4PJFB 1P4BH 5I73C 3O3DA 4JFDD 3NH7H 2L0DA 1OWRM 1INDH 3VGFA 5IJVA 3ARTA 2A73A 1CDGA 4R4NC 2DKUA 4A6YH 5I30L 4R7NA 5FKPA 2IFFL 2R1WA 4LNRA 3SKMB 4D9LL 4PJFF 3S36X 4ODSL 3ULSA 1J1OL 4KAQH 3RZWA 2BJML 3CAFA 4IS6B 5EIVA 4P2QE 1J88A 1P4IH 3D39E 3MRKA 5HVWA 1KFAH 3WLWD 3W9EA 3LS5H 1JHKH 2HLFD 3L3KA 2V7HA 1KLUB 2HAZA 2VLKE 1R6VA 5HHMB 3IAGC 1U3HA 3RJDA 2NY5H 3MO1B 5ILTH 2XZQH 2W60A 4JFYA 3HS0A 2P7TB 1J18A 5L6YH 3AREC 5FGBC 4UDUB 4CJ0A 4Y1AE 4KZDH 1ZGLM 3NACH 3QEHB 4BH7B 1U8IA 1ETZB 1OGTB 4XMLL 2EDQA 1YMMD 1H3UA 4NBXB 3QNXA 1CQKA 3GDBA 3BZFA 2AEWA 4JGJA 1C1EL 5EOCL 5KAQF 1K8DB 3CFJB 4RFEA 3RQ3A 5SX4H 1RHHB 2FJFB 3G6JE 4QRPB 4ZUSB 3MNWA 1FFOA 1CZ8L 3KPMA 1WISA 5D93B 1GZPA 1KB5A 3PGDA 2OXHA 3QEUA 5E7FA 3QH3B 2GFBB 1A7OL 5C0BD 3B2UD 2NY2B 3SKUD 3MZTA 1LE9B 3PWPD 2LABA 5T3ZD 5MENA 1HEZB 3KYAA 3MLXL 4RGMB 5IW1B 4APQA 3I02B 3JWDC 1S7UB 1J05A 3HNTH 2R0LH 3ILPA 5BZWB 4GRLA 4HGKC 1ZT4A 4YZFE 4OZHB 1OSZA 4BQBA 1TTGA 2X6MA 3VFSB 3DX7B 4XVSH 1F00I 4V1DD 4C54A 4LLDB 4MNHA 4DWHA 4LAQL 1DBJH 4OZHF 4U1IB 1QEWA 5HDQL 2OP4H 3TN0A 4XZUB 5JOPE 1L6ZA 4RGOL 5DRXA 4DEPC 1J0KA 2OL3A 3C2AH 4TUKL 3HTLX 5CGYC 2XKSA 4RAHA 5E6IB 5A16B 3U4BH 5TF0A 4E9LA 1IT9H 3SJVA 4P23A 2NXYB 1SJEB 4HQQL 4EUPA 2IADA 3EDJA 2PTTB 3MBEA 4WNQA 2EKSB 1EVTC 2P45B 3EJYC 3O2DL 1QR1A 1NGXB 2Z8VC 4LQFH 4HS8H 4KROC 2B39A 1Q0YH 1QD0A 3BPLC 3G5XB 4K2UL 2D4FA 2YOCA 4HBQA 1BAFH 4LCIH 5D1XC 3TBTA 4KTYA 4UTAL 4NC2B 5EBMB 4ZSOB 3NOIA 4IOIB 1NANI 4UV4H 4P57A 4J4PD 5E8OA 5CSGA 4KJWC 2BX5A 1DZBA 4ZO8A 2AV1B 4HH9A 1UXSA 5HHQA 2ADIA 1EMTH 5HVHB 3KXFA 2NY4B 5ADPL 3U4EB 4DJMA 5GGQL 4M93B 2ZWLT 4NQVB 1CF8L 1ZAGA 2V2TB 3PE9A 3S36H 4U7MA 1JPSH 2FBJH 5MI0B 1WAAF 4Z95L 5E00A 3AS1A 1IRAY 1BBDH 4AG4L 3PQYB 3SGKC 3TJEL 3UEZA 2AGJL 4LF3B 5KZCD 2PNDA 5D2NA 4TTDC 4UT6L 5C07D 3UTSE 5KW9H 1U8LA 3GJFK 1D5BB 1HXYB 2GKIA 4OCNC 1DQDL 4XNMB 4WFEE 3S97C 4QXUH 4GRWH 4XAKD 4MD4A 3CFCL 4E5XA 4S1QH 3TV3H 2HT4D 1U8PB 3QUXB 4JRXE 1LMKA 3LZFL 5F9WC 3SDAA 3U2SA 5FOBB 1PSKL 3M17B 2X40A 4NRYA 1F97A 4AENA 5EOQH 4FZEH 5B38B 3VG0H 5MEPA 3O3DB 1JYWA 3HE6D 1SVCP 1RIHH 2A9NH 1KJ2B 5HSFA 2EECA 2HTKC 5FCUL 4R7NB 5C86A 2R1WB 4LNRB 2A1WH 3BVNB 3V52L 1PD6A 3W0WB 2BZDA 1A6ZA 4FFYH 4YX2L 4GW1A 3ULSB 4U2ZA 3OAYK 4NUJA 3BP5A 2ID5A 5BS0D 2H6PA 3EFDH 5DJYA 5HDLA 1CK0L 2VDKH 1J5OL 2MPAH 2ZUXA 3FOMA 5GGUB 3UDWC 4GAGH 2GCYA 3J7HA 2XICA 2X9XA 2ESVE 1IQDA 1CFVL 2W60B 4JFYB 2BMKB 2JJSC 1YN6A 1MIMH 3QXTA 1JNJA 2AJYH 2Z93A 2EDTA 3STZA 5CJQL 2DM4A 1JFQL 5D7JA 2PTVA 4PRHE 3QNXB 1TPXC 1IGMH 2VQ1A 1AXTH 5IHUH 2GAZA 4ODVL 3BZFB 4WWKB 4LRNH 1Q9OA 3UZEA 4F7EA 4X7TA 4XPGL 5T1KD 2NW2A 3KJ4C 4O00A 4X7SH 1FFOB 3SCMC 3KPMB 1BGXH 5SWZB 1KB5B 5EZOH 4Z7QE 3QI9C 5IUSA 3DUSA 2FYYB 3GHBH 5DWUH 4LVOC 4AIZA 1FLRL 2DBLL 1KCVH 2EXWC 2FIKA 4K8RH 3VFMB 5CIPH 2GJ6B 1I85A 3DRTA 1PLGL 4APQB 2FECL 2FGZA 4M48L 4XBPA 1J05B 3N1QC 3ZE1E 3ILPB 2OR8A 4NOFA 1RZGB 2DN7A 1ZT4B 2VDQH 5E6YA 2GI7A 2P5EA 1OP3H 1OSZB 1KJMA 1LHZA 3JWDL 4PS4H 4U6TA 1TDQA 5E2UH 2A6KB 4MNHB 4G7YL 2X89A 4QT5A 3T4AA 1NGWA 1OOAA 1G0DA 4HKXB 2HRPL 4J7RA 4X98A 4PYHA 4WU5B 2OL3B 4Y4KB 3HMXH 2Y07L 4OF0A 1GGCL 4Z7WE 4P23B 3EOTL 3PDOA 3UBXI 4PRID 1OAKH 4R0LC 3L9RB 3SE8L 3KR3L 5AWNL 2YRPA 4HWBL 1KEMH 4G42B 4JFQA 4IHOA 4MCZB 3DTXA 3VWKC 1RVFL 5CEZH 2GHWB 3LCYA 4NKDA 4HKJA 1QLFB 3TBTB 2F54D 4XHJC 4PR5A 3QDJA 4G43A 3MREA 2JJTA 4I3GA 1U91A 2V5MA 3S88L 4HH9B 1UXSB 3VXTA 3D25A 1IGJA 5C0GA 3KXFB 1T5XA 3AROA 5LXGH 5CJ5A 4MJIA 4UQ2A 1U3YA 3KLDA 4G6AD 5IQ7H 4GRMA 3MRIB 1P7QB 3VGHA 1UH2A 3NIDF 5AUMB 5FO8A 25C8H 5E00B 4OCYH 3EYUH 4JPVL 4GRWE 1YMHA 4XC1L 4L4TA 4CDGC 3GSOA 2R29H 2VLRE 4G6JL 3S5LA 4Z0BH 4ONFL 1JI2A 3K3QA 3BJ91 1CBVH 4X80L 5IHLB 4OLVL 1U8LB 4IRSA 5HVFB 2PCPA 1TITA 4QRRD 4HWEH 1MRDL 5IBLD 1JGVH 1LP9E 4P3DB 4E5XB 2E3VA 4GS7B 4LLAA 4YDIH 1HH9A 3TZVD 4LHUG 2VTFA 1U8OA 3WE6A 3NGBB 1ITBB 3TCXA 5DFVD 5KVEL 1J8HD 1ES0A 3U2SB 4JFHE 3MUJA 1JGLL 4NRYB 5TDNA 1E27A 3MRPA 3QXVA 1N6QL 3S3PA 4WHTA 5MEPB 2IMNA 4Y5YA 2ADJB 5F93C 3QO0B 1QFWH 4GUPA 3C9NB 3STLB 5ACLA 3K81A 5FGSA 2J8UE 4L8BA 3VFGH 1KTDB 1EEYB 2OK0H 1ZT1B 2DQTH 3PWJB 4LCWD 4JZOB 1A14H 4XNYL 3BSZL 1AY1L 3HNVL 4NUJB 3BP5B 1DUYB 3VH8A 4X4XA 1MWAA 1SEQL 2WANA 5H2BA 5D7LE 1CDUA 3RDTC 4LGRB 2XXCB 3QEQD 4HXAL 2GCYB 4Q0XL 5HD8C 4JE4B 3HCVA 3PWUA 1KN2L 2Q76A 1OQXA 1CE6A 3S35X 5DHVH 1JWSA 3BDXA 5GGTL 4JDTL 2XIDA 5F1KC 5JDSB 5ABDE 2Z93B 1UKTA 2VE6A 1HXMA 4O51A 3STZB 4Y0GA 3VI4F 2E27L 3D69A 4KRPC 4UTBH 1MCLA 1U9KA 1I9JL 4F58L 2VQ1B 4HUUA 4F33A 1C5CH 5GXBB 1Q9OB 2JB6A 3VXUE 4F7EB 3O4OC 4JPKH 4K3JH 3U48A 3GSNB 3ROLA 4P3CH 1FYTA 4OLYL 1A47A 1X7QB 5AAWA 1YA5A 5E9DD 2N1KA 4XCCL 2XNAA 4AM0A 3WO4B 3QUYC 3I6GB 3MRFA 4YHIA 4URTB 2GT9B 4AIZB 4XWGL 1UYWH 4LPXA 4HEME 3UJIH 5IHZB 4FQ2H 4FNLL 1EO5A 5EA0L 2Z31C 4XXDB 1OP5H 1AR1D 5F70A 1NC2A 5JIHA 3SGJC 2ICWJ 1CLZL 1PEWA 3MLSH 1A1MA 1NCCL 4XBGA 3AU1A 1KENH 3LKOB 3TO2B 3BESR 5J3HC 5IP4A 1FO0B 4X5LA 1TJGL 3O6LH 3OG4B 3T4AB 4GOSA 4I2XE 1KF9B 1X9QA 4O5LH 4HF5H 1QSFD 1NMAL 5ENWB 1IQWH 3SGKA 3WJLA 1JHLH 2NX5D 1QPXA 3TYFB 3WSQL 5CEZE 3RI5K 4NM4L 2WUCL 5JLZA 2RQ8A 3PDOB 4ETYA 5JORB 3Q2CA 2G5BB 3UJJH 4P2QA 3ZZ1A 3D39A 1E4XI 5T1DL 4PLKC 1N64H 4IHOB 4KV5F 5LGHL 5CWSB 1NBVH 3GI8H 2X4NA 3HPJA 4NKDB 5ITBL 5GSRA 4YHZH 2VLKA 3QIBA 3QDJB 2ZCKH 5F7WC 1WEJL 2J5LC 3UPAA 5DUPH 1U91B 4ZFFB 1T2QH 1KTLA 5TE7L 1EHAA 3QUMA 3VXTB 1D7FA 2X1QA 4HUWB 1T5XB 3C60A 4KRLB 1XCQA 3MNVB 5ELIA 3U1SH 1L0QA 2K7PA 3EO0B 5EU6A 3T0WA 3N50A 3JUYA 3L3DB 1CT8A 4HS6B 3O81A 1NL0H 1FGVL 1P4BL 2GYSA 5FO8B 3HR6A 3NH7L 5GRUH 3WNKA 1AO7A 3G6JA 3GSOB 3T0VA 3L3OB 4FMKA 1Q9LB 4PJCE 1I3VA 1N0XH 3QAZB 1YEHH 1CFQB 4KAQL 1DBMH 4JGMA 4KK6C 4RDQF 2PCPB 1KULA 3GGWA 1P4IL 2VERN 1AGDA 1CLOH 1I1FA 2VXSH 4WV1A 3LS5L 1JHKL 1JWUA 1R5WB 3RJQB 2I9LB 3CFKB 4HKZA 1N59B 1R5IA 3WIFB 5HJ3B 8FABB 4OAWA 3OR6A 3G6AA 1PY4A 2XZQL 4ZTPL 3RWGA 1E27B 5L6YL 2DKSA 1T5WA 2O5YH 4WHTB 4I4WA 2ERJC 4GUPB 3RWIA 2NCMA 1A4JB 3PGFL 3O9WA 1I8LC 3RZCD 5DD0H 4HJJH 4OIBA 3CDGB 3VWJB 2DQHH 3ZL4H 3LV3A 1CDIA 4YXKL 1JTOA 3VH8B 3OKDA 3GMOB 3K2MC 4X4XB 3H42H 3NVQA 3S4SG 1HHGA 2OR7A 4WCYH 1JK8B 4L3CA 3P9WB 4Z7OF 2I9TA 5D2LB 2A74B 4PD4J 5L88L 2YR3A 3DSFH 5SWSE 3PWUB 3ARBD 1YYML 4TSAH 4W68A 1CE6B 1FYHB 2NY3D 1D6EA 5C0NC 4RMUA 3C5ZB 2R2EA 1GGUA 1JWSB 4JM2A 5D2LF 4I9WE 3MGTA 1MLCA 2D7QA 4OF5A 5GS2H 1JZ6A 2Y5TB 3BGFB 4GAYB 2DWEA 1EEQA 2IBZX 3D69B 1UZ6E 2R0LL 2M26A 3DMMA 3K1DA 1A6AA 4F33B 4EOWH 3TM6A 3P0GB 4YXLL 4F15B 4DVBA 3VD9A 4PRPE 1KCSH 1IL1A 1SMAA 3ROLB 1V7NH 4M7ZC 2NY6D 5C0CA 2BSSA 4ENEC 4JB9H 4IOFC 3R8QA 3HZMA 1LEIA 2JK5A 2OP4L 3MRNA 2H32A 3MRFB 1P2CB 4MJ4A 4D3CH 3U0PB 4EJ1C 3CGTA 3VRLE 2HTLD 5A40E 1AIFA 5HPMB 3WDIA 3E6FB 3O2VH 3TWCH 4NHCL 1A1MB 4HS8L 4YEEA 1Q0YL 3O6FB 3AU1B 1QR4A 3D2UB 3PF2A 4LCIL 2GITB 4Y19D 4YNYB 4A6YA 1IM9B 1UA6L 3BRDA 4UV4L 4I0CC 2H2PD 3LEVL 2GEEA 4QGTA 1E4KC 4NQCA 2EDDA 5F7NC 3FFDA 1LNUA 4S1SH 1CDJA 1C7TA 2YD3A 4JFPA 5FM4A 2YPKA 1G7LB 3F12B 5CINH 1JPSL 2FBJL 1UH4A 1RUAH 3T0EE 1BBDL 5TE6L 3HPJB 4N0YL 4PJ5E 2QSVA 5GSRB 5I8CA 5F9DC 4I18C 1BP3B 3KLAB 3GRWH 4MNQB 5C6TH 5KW9L 5DO2C 6CGTA 5CJBA 1SM3H 4HGWB 2C3XA 4XI5D 1I8MA 5T3ZH 1W8NA 5J13B 5C7XH 3MJ6A 3C60B 4S1QL 3TV3L 4CVWA 4B53A 1TZHA 4GBXA 2XQBH 3QIUC 4DGYH 5EU6B 4FABH 4PRHA 2RIKA 4NCDA 5F9AC 5E1AA 5EOQL 5BW7A 4OGAC 1MCKA 5F9OL 5I1JH 2AXGA 3GMQA 1BBJA 2UVEA 2XWJA 2YRLA 1EFXD 2JLLA 1RIHL 1XR9A 1AO7B 2A9NL 4NKQB 4OV6F 3RKDC 3WIHH 2GSGA 4H0HB 4M00A 3LQMA 5MEQA 3SE8H 2I5YL 2A1WL 3OGOE 4FFYL 3UJTH 1EGJH 1ZGLA 2DLFH 1AGDB 4WU7B 4KI5C 2NY1C 5AZ2H 2VDKL 4OLZH 1ND0A 2MPAL 5KN5A 1OP3K 1M05B 2P5WB 3IDGA 2AI0H 1JZ7A 3LQZB 1TLKA 5DVNA 4GAGL 4YBLB 4X6CB 3G6AB 3OR6B 4H1LH 1P9MA 4HK0A 3G08A 4KKAD 4OFPA 2QQNH 3KYOA 1MIML 4I4WB 3HUJA 2AJYL 2BRRH 1U8NA 1NC4D 1CWVA 3SGEH 1BJMA 1OARH 4X6CF 4QRQB 5A2IH 2XTJD 2P8MA 1HHIA 2BC4A 4YDJA 3VMPA 1L0YA 3N1PC 4KWUA 1WITA 1IGML 2PYFA 1AXTL 4MX7B 2AJ3B 4CNIA 4LRNL 5BV7H 1YZZA 3B9AA 5D7SL 4WI4A 3W5MA 3OKDB 1P6FA 4TN9A 2EDHA 2YC1A 1HHGB 4DKFH 1PQZB 2BCKA 4P2RE 5LCVH 5F7UA 3TIDA 3DOSA 1BGXL 3ZYOA 2VLMD 5C9JA 5TJWK 3H9YA 3MRQA 3GHBL 2Y36H 5F7DB 4M7JH 3L3JB 1D5ZB 1YC8A 1KCVL 3T04D 2R2EB 1ZA6A 2EDFA 4OIIL 3MGTB 1MLCB 4ZOBA 3O8XC 3W2DH 4XMPL 4F37F 4U1HA 2DWEB 3OKNB 4Q9BA 5E99H 3DMMB 3U30B 2X09A 4Q7DA 1A6AB 1FFPA 2IF7A 4FZ8H 3OHXA 1T03H 3GSRB 4G9FD 4JVUA 3TH4T 4N0UB 4ZOAA 1FZKA 3IFNH 3B6SB 5C0CB 1AGEA 2JK5B 2NNAB 5C92A 2H32B 1F58H 5HHOE 3R0NA 2BY3A 2UZIL 4WI8A 5LGJA 1VPOH 4Y16B 5B21A 2G9HA 2RBLA 4Z76B 1VKXA 4BFGA 2ADFH 1NSNH 2EH7H 3BOVA 1OL0A 4XWOC 1AIFB 4ZFGH 4DOHB 1KEML 3U7WL 1U3JA 3K4ZA 1EIBA 1I8IA 1LP9A 3QPQC 1G6VK 5EO1B 5ERWA 3T0EC 1NCAH 5AG8A 3ULUF 2P49B 1FNSH 1CDYA 4OUUA 1M71B 1BD2E 1MAMH 4QOKE 3SN6N 1CL7H 4ZYKB 1JPFA 4PJ8D 5DQJA 2VXVH 3FB5A 4NQCB 3Q5YA 2CDEA 1U3ZA 5FM5M 5T1MA 4WEUD 3ARFB 1MRCH 2DIBA 1J7VR 5J11B 4LEOA 4D9QE 2DS4A 5LXGL 4ELKA 5FKAA 4UNTA 5D6CB 1IGFH 4PJHB 3V0VA 2R15A 5IQ7L 4XX1G 4JFPB 5BRZD 2H41A 3SQBA 2XWTB 4P9MH 2XV6B 3EHBD 4S1RH 3ZKXC 2ED9A 4BYHA 3EYUL 3FT2B 5DEFB 4X6DE 5DR5H 1IGCH 3MROA 4K71C 4PJHF 3TVMD 5T3ZE 2Y4SA 5HHXL 1QBLH 5D7LA 4Y4HD 4YPJA 5I8CB 5IFAH 3ULVF 2CUIA 1CBVL 4CVXA 4PGDB 1MHEA 3OKKA 3QWOA 5DVKA 1JWMA 4HWEL 5BQ7A 4PJ9B 1CGUA 1GOFA 3EO1B 4LLQA 1RD6A 5CMAB 1LGVA 3RUGE 1RIUH 1H5BA 5EU7E 4M1DH 3QJFB 4V1DE 3RY4A 1W0VA 4MA3A 3AS2A 5FHAL 1J0ZA 4J23A 5E1AB 3BGMB 2BRQA 3T3PE 5CKAA 3W11C 2XWJB 1QFWL 4S0SD 2GSGB 4HKBA 2XWBA 4QXTB 5T5FH 2OK0L 2P4AB 1ACYL 4DVRH 2DQTL 1EUUA 1ZGLB 4YGAB 1C5BL 3OKEA 2VDPH 4NJ9H 4Y7MA 3GIVA 4N5EC 5KN5B 4ISVA 3ARVA 3MRRA 4LDEB 1VERA 1MH5A 3IDGB 4YH6A 1F4XH 4P2CG 5GJSH 1JYNA 2P47B 4FQHA 3WFCH 4HK0B 4PRNA 4E0RA 3G08B 2A6DB 1T66D 3Q1SL 1T80A 3KYOB 4MWFB 7FABH 3HUJB 3HMXA 1R3IH 2WSKA 1Q72L 3BIKA 3EOAB 5CD3A 5EN2B 1MLBA 2DD8H 1VFUA 2P8MB 4HCRH 4YDJB 5JTWA 5CHNA 2B0SH 3H3BC 4UTBL 4NYLB 3HUJF 1MJ8H 1C5CL 4CNIB 1EBAA 1GAFH 3HB3D 5C6WH 3MV9E 1HWGB 3VXRB 4C56B 2YC1B 4K3JL 2BCKB 2RHEA 4P3CL 5C07E 1FPTH 5DHYA 4OCWH 5C9JB 1X5KA 1ACZA 1L7TH 5HGHB 4MHHG 4RX4D 1A6TB 2DYPD 5HYEA 4K7PY 3MRQB 4OQTH 5K9OA 3FQXB 4XPFH 1UYWL 3ETBF 4R2GB 2VLJD 3WLWC 4LEXH 4FQ2L 5DJ2A 1LO3H 2HLFC 2XFXB 2P8PA 5IB5B 5BOZG 4KPHH 4XP4H 3TT3L 5EUOE 4ELMB 1JPTH 1NCBH 2PYEE 1CD1A 1WIUA 3MV7E 3MLSL 4XVUD 2ZSWA 1FFPB 5HGBA 1LK2A 1KENL 1KJ3H 4D0BA 3UP1A 2F5BH 2BHZA 4ZFZB 1SEBB 2ZOLA 4ELMF 3PWVA 3O6LL 4XRCB 1AGEB 4O5LL 4HIEB 4YHMH 1KC5H 3QXDB 4CJ1A 4MQ7A 2EXYD 1VKXB 5FYKD 4HDIA 4PJCA 4LFHD 4XH2A 3Q6FB 1JRHI 3UJJL 3FFCE 1N64L 3HN3A 2WP3T 4ZPTB 1DANT 1NBVL 3GI8L 3B2UC 1JF1A 2HVKA 2AVGA 1REIA 3TJHD 5ERWB 1BLNA 4OD2A 5GGVY 4J2XA 2LAGB 2D31A 1RK1B 1JYXA 3SDYH 4PLNC 2ZCKL 4U6HA 2CR6A 3CXHJ 4OUUB 1EERB 2X1OA 5DK0A 2MSPA 5DUPL 1PKQE 4FQLL 1MY7A 1T2QL 5C09A 1KLFA 2XYCA 4PGZA 3FOLA 2FHBA 2FJHA 5TFSH 1A5FH 3EZ8A 1QBAA 4OSUH 4PJAE 1NANH 4QXGH 1CICD 5L0QB 4ZUWB 4P5MB 3QDGD 1CXFA 3DPBA 1LO0L 3QCTH 3HG1E 3VD4A 5GRUL 1WF5A 2Q7YA 5E8DH 2BNUA 1NEZB 4LPWA 5DHVA 3H6JA 4NQED 5J1AB 5KVGH 2R8SH 3H0TB 3TPKA 5HYSG 1GHFH 3ARSA 4M8QA 1QSZA 4JQIH 1YEHL 3QULA 1Z2KA 4CVXB 1DBML 1K3ZA 4ETQB 4JRYE 5SWSA 1V3KA 4QHNA 5J7CC 1JWMB 5BQ7B 4ALAH 1PYWA 2DB8A 1CLOL 3BMVA 3CFBB 4W4OA 2P42B 2VXSL 1F3DJ 1VADA 1FL3B 3DXAB 3IDIB 4I77H 1GOGA 4MA3B 3S37L 3QUZB 3PHQB 5HHNB 3RY6A 4JG1H 1DVFA 1UFUA 2IPUK 3BEVB 4J4PC 3FQNA 1MIEL 2O5YL 3KPLB 3JWNC 3FO0H 1OLLA 4QY8A 5GZND 4PRPA 1KYOK 2JELH 5BV7C 4HKBB 4FFVD 1CR9H 2XWBB 2ZSVA 1J9CT 4PRIE 1OCWL 2CJUH 3P4NA 1U42A 4HJJL 4RNRB 1S9XA 3NCCB 1JMXA 3X11A 3OKEB 3VFRB 1LE5A 4NO5A 1CFNB 4MD0A 2DJUA 3MXWH 4BZ2H 2CIIA 3IRPX 3KWWA 1T83C 3VI3E 2AKRA 5EBWA 4WCYL 1XAUA 2I27N 5FUCC 3MRRB 3GMMB 5IW6A 2R4SH 4KUCF 1CLCA 1UACH 3AY4C 3GM0A 5DYOB 1D6VH 5E6ID 5GS1A 4J3XA 4FQHB 3VD5A 1D9KD 4TSAL 3SGDI 1NPUA 3GSVA 3N06B 5I9QB 2NXYD 1Q9WA 2AK4E 4HC1A 5T1LD 3BIKB 1MLBB 5A2JH 2NZ9D 2HG5A 4XVTH 2HT4C 4Z7NE 5A1AA 4M62H 3RNKA 1UB5B 4IIQC 4X5XA 1TTUA 1RI8A 5L2KB 2XOTA 1GOHA 4J3VA 3DLQR 3QJHA 1S3KH 5KSVB 5HDBE 3HE6C 1ZVSA 5F7EH 1V7NL 5BVJB 3QFJB 2IPKA 2OZ4H 4JB9L 3ZHLA 2C3VB 1F2XK 2IG2H 2QLVB 1EHLH 1CGSH 4D3CL 5K9KA 1ZHKB 5J6GB 2J3SA 5J6HA 3TBYB 2FSEA 4JO3L 2IANA 4PJ5A 3KPOA 1HZHH 3U82B 5KTEH 5DJ2B 3ZYJA 3RPIB 1UZ8B 3QHFL 5SWQA 5JXED 1NFDB 2Z4QB 1U8HA 3PQYD 4P46C 2PXYD 5HTSA 1CD1B 4F7TA 1S7WA 4HH8A 5IVZB 2PO6A 3OAUH 4Z77B 4F9PC 5LKNA 4ZDHB 3UC0L 4PB9H 1NFDF 2XZCH 4RISH 3PDDA 1KUMA 2ZUSA 1JNLH 3EUUA 2ZOLB 1M6OA 3KPPA 2V17H 4QO1A 4LCWE 3T65A 3DO7A 4ZUUA 3GZKA 4QYOB 4OQ1A 3AS3A 3UTOA 3QUXD 1ZVHA 4PD4K 5C0DB 1R24A 4MQ7B 2OI9B 3GBML 1MAJA 1FFNB 4HDIB 4KK5D 4R8WL 4XH2B 3MLUH 1XZ0B 1IM3B 5E0QA 3HHRB 5MHSD 3VFVB 5I1LB 3LKRA 3G5VA 1RUAL 3WXVH 2VDRH 3B9KA 3QQNA 4CW1A 1BIHA 1HKFA 1MCEA 4OD2B 3O6MH 5CBAA 1MCOH 5H37G 4I13B 4LPVA 4Y4FA 5ICXB 3L1OL 3KAAA 1F3DH 5DK0B 4XMKH 3DVGB 4FTVB 4QXWA 5C09B 1FZJB 2OS7A 1U93A 3OGCB 3CU1A