5IHZA

Crystal structure of anti-gliadin 1002-1e01 fab fragment
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
223
structure length
208
Chain Sequence
VQLLESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVSGISGSGGSTYYADSVKGRFTTSRDNSKNTLYLQMNSLRAEDTAVYYCAKFSRDYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1E01 Fab fragment heavy chain
publication title Stereotyped antibody responses target posttranslationally modified gluten in celiac disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 208
sequence length 223
chains with identical sequence C, E, H
ec nomenclature
pdb deposition date 2016-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ihzA02
5T1MB 4U1GC 5KTEH 1OTTD 3WIFA 4UT9L 2BCKA 3JV0A 1MEXH 3BPCB 2W0FA 1QPXA 2WBJD 3FQWA 1K4DA 3SQOH 3TCLA 3ZE2E 1IJ9A 1XGUB 3K4AA 1KGCE 2PCPB 3DROA 5IHUH 4GMSH 1JIBA 2WP3T 4LP4A 3PQYB 4POUB 3OL2A 1MIMH 3ULUC 4Z7UF 1MY5A 1QR4A 5FHAL 4FTVA 5EFIB 2J3SA 4GAYA 5ADPL 4ONHB 4EVNA 2FH6A 3HI1B 1BZ7B 4JLRB 2HJFB 5E56A 4ACPA 4ELMF 3SDXB 1U8IA 5AAMA 4RFNC 4IHOA 4Z7VE 3MFGB 5D1QB 1H9VA 3OKLA 3RY6A 4ZNEE 3AY4C 5HPMA 2CIKA 3V5HB 1LEIA 3PNWB 4R0LA 3TBTA 5SWSA 5FKPB 4NZRH 4MYWB 3UDWA 4PGZA 4JFED 4PRAA 4Y4FC 1OSZB 2DQUH 4XPGH 4UDUB 1IAKB 1E6OL 1CL7L 3QAZC 4FTVD 5DD1H 3S35X 1IT9H 3HAEB 4X5WA 5E9DA 1XIWA 5IOPA 4L8DA 1NMBH 1RJLB 5L6YL 1L0XA 1OAYL 3DUUB 5B22A 2FIKB 1KNOA 3O4LE 2IG2H 2XY2A 3ZE1F 1NCDL 4LAJH 5CJBA 3DO7B 3EBAA 1WCBB 1XGRA 3LS5H 1S7QB 1TQCB 2B1AH 4MNQE 2OX5A 4ZFZB 2XN9B 4HXAL 2E27H 2HKHL 1M1SA 1YPZB 3VJ6B 1KV3A 1Z2KA 3CSGA 4TSCH 4NUGH 4M62H 1CFTB 3SO3B 3C9NB 1KCRH 1JWSA 2D4DA 1WFUA 4FQ2L 1TCRA 3MCG1 4BYHA 3S88H 1MJ8H 3QDJD 1OCWH 3ARBA 2DKMA 5DHXB 4XAWL 1FGVL 3GM8A 4YGVA 5ESAA 1T1WA 4ZXBA 1ZTXH 2YWYA 2AEIT 1FNGB 4JM2B 1IGCL 4BH7A 3PE9A 2Q7YB 3CGTA 2FR4A 3FQXB 4FQIL 1XH3A 3RBSA 4K71B 1AGBB 3O2WH 3GUTB 4P23C 4M5ZL 4ZOEA 5I17A 3MRJB 1BQLH 3TJEH 2OCFD 3DTXB 4ODUB 4XPFL 2PR4L 4JFFA 3X14B 3VH8G 4QXGH 4BQ8A 3NFSL 4N9GB 4ZPVB 2XKSA 1DCLA 2NY0B 2P24A 4BQCA 3OX8A 1X5AA 5HYIA 4DN4H 1DUZA 5FA4B 3H42H 4DKEL 4R96A 3H9HA 4IM8A 1MHEB 1U8OA 3V5DB 4A2MA 5C6TL 1L9NA 3BMVA 1CDUA 4U1KB 4RRPA 4X4ZA 2D7TL 4XP5H 1H8SA 4HS8L 4XVUD 3RVXC 3MXVH 4PJFE 1VCAA 2DQEH 5EO9B 2YA2A 3TZVD 1NBVL 1P4LB 1YC8A 3RWEB 1ES0A 4UZGA 1GXEA 3QDMD 5I1HH 4WV1B 4N8VA 5HDBE 2AJSL 4PJXA 5HVHC 2IAMA 3H7LA 4JRXA 4X4XB 2OI9B 2I5YH 5EIQA 2EE9A 5GS0H 4HFWB 4LOUC 5I8CB 4KPHL 4E0RA 1H3TA 2YXMA 5EBGA 1MJ7H 1L7TH 4MSWB 1JNJA 3VFUA 3UAJD 3AMKA 3C08H 3X13A 4PGJA 1ZGLB 1CGXA 5DEZA 3K8KA 5JZ7C 5MERB 2P46B 1YEJH 4MX7B 5IMLA 1DSFH 4U49A 4R90L 3BO8A 4W70A 1B4JH 2C1OA 1HILB 5K9JL 3T0EB 2XQBH 4IS6A 4M7JL 1IEBB 1Y6NR 2VN7A 3O6FC 1INDL 4UAOB 3PGCA 4PGEB 2AJYL 5FKAA 5GSRA 2W65B 4RAUB 1J8HB 5DWUH 3LPWA 5L0QC 1EA9C 3VXMA 4LRIA 3U4EB 1BIIA 2CUMA 5KN5B 2Z8WC 4RGNC 2EYTB 1KT2B 3O8XC 4JFEE 4H1LA 4RX4A 1IGIH 2AJVL 4OZGF 2JELH 1OM3H 4NQEA 5F93C 4FQCL 3OPZL 3F62A 2MCG1 1A1OB 2FDBP 2GJJA 4FTVE 1N59A 1CQYA 1UH3A 2H6PB 4LCUB 1IGTA 1J1PH 4YNYB 4JRWA 2DJ4A 5FUZL 3JXAA 3VFPB 4NM4H 1HHGB 2H2PD 1AXIB 3WXWH 2ORBH 2D7QA 1NANI 3DUHA 2IALB 3UTSD 1ACYH 2EXYD 4PP1D 1H5BA 1MY7A 2OR8A 4GXVL 4GFTB 2VISA 4Y5VB 3AREA 1WV7T 3VXMD 5GGUB 1D5ZA 4P5KA 3GM0A 5C7XL 1XMWA 5FM5O 2GY7B 2OZ4H 4JQXA 4PUBH 3WIIL 4W6XB 1O7SA 2FD6L 4KK6D 3MLZH 3GO1L 5BW7A 3HG1A 1QSEB 5A43C 1MJUH 3QDJE 5D1QC 4KROB 1S9KC 1D6VH 1ORSB 1Q0XH 5FYKD 3DPBA 1JHKH 5GGVY 1I7UA 2YBRB 2GEEA 4FZEH 4D8PA 2DICA 3LKPB 4OF0A 4PRHD 4MS8D 4NQTA 3A6BH 1MCCA 1FLRH 4PJ5B 3SKMB 4F7PB 3QR2A 5CAYB 1IAIL 3I6KA 3OGCA 3PWVA 4C56A 2JE8A 2Z8SA 4LNRB 1DE4B 4HK3N 1GHFH 2Z92B 3BP6B 3ARDD 5TDOA 4CBPA 1I1CA 5DQJB 2GFBA 1CLYH 4RMRA 2OL3A 5DD6A 1H3PL 5IIEA 5LGJB 4WUKH 5MI0B 3ARTA 1WZMA 3T3PF 4HHAA 3FFCA 3MOAH 4HX1A 4NQCB 3RX7A 5GS0C 1Y0LA 1SEQL 3QIWD 3FB7B 1U8NB 5D70H 1MFDL 2IBGA 1T4KA 1JK8B 3KYMB 1QVOB 2W9EH 2YUVA 4L4TA 4PYGA 3SO3C 2GJ6A 4X4ME 3AAZB 4KI1A 5ACZA 1T1ZB 4N5EC 3QB7C 3RGHA 2EEAA 3PWPB 4YFEA 3QDME 1OAUH 5ANMA 1P7QB 1GC1H 2VLKA 3WLWC 1MFBH 2HT4D 1JYXA 3TJHC 5C3TA 3L3KA 4U3XA 3KWWA 2D31A 2NZ9D 4JM2C 4Z8FH 4FXKB 4TUJB 1HEZA 1Q9OA 4WI9A 3UBXG 1FCCA 1OCWL 3C09C 1AE6H 4X99A 4DQOH 1PZUB 4IEFB 4MQXC 5E6IA 4LLDA 4XI5C 5HDOA 5B38B 3SDXF 5FAAA 2ADIA 3MCLH 1H8OA 4JFOB 4R9HA 5DMGD 3SCMA 1KJ2B 2UY6A 4YDJA 1P4BH 1IARB 4P9HH 3U4AA 4GLRI 2IBBA 3VWKB 5FO8B 4PPTA 4PRID 4GW5A 3ULVH 5BVJA 3NCYS 5FYLD 2VLKD 3O3UN 1F3DH 5IB3B 5KSVB 3RZCC 3NIDE 1RI8A 4OGYL 1ZLUK 1CZ8L 3PL6C 1ZSDA 3MA7A 2AJUL 2CH8A 1YJDL 2NPLX 3EDFA 3L7EB 3H42L 3QG6B 5MP6L 4B0MM 4GQ9H 4Q6IB 5E0QA 5FDWA 3C5SB 4MHHG 3DGGB 2HVKA 4F9PC 2V7NB 1EHXA 3L5JA 4WV1C 1YA5A 3ZE0F 5F44A 1NBYA 4D9QD 4JRYD 4S0SD 1XGQA 2OM5A 1CK0H 2A83B 3PP4H 1CF8L 1IGFL 4OI7A 4QXUH 3RVUC 4RGMC 1QFWM 3R4DA 1UXWA 5DMKA 1CXKA 1YPZF 3UTSE 4LMQI 4MJ6B 2BOBB 3N0PB 4PD4J 3VXME 4NCC2 3VA6A 1X9QA 2IH3B 3WLBB 2XT1B 2X4QA 3NCMA 2XIDA 2R0KL 3C08L 3GI8L 1FZJA 5FFLA 4KDTC 3IGAB 5H35B 1F4HA 3SBWA 1YEJL 3CFKB 2RJMA 1DSFL 4XNXL 5AZEL 1FVCA 1FIEA 4HH8A 5FYKE 4XHQA 3ARGC 1FGNL 2Y36H 4LCWA 4NFDA 1SJVA 1A14L 4PRHE 3RI5K 4P46D 1FZKA 5KW9H 2VYRE 2KQMA 3H6JA 1FZOB 1INQB 5D7SL 5DWUL 2XI9A 3S34H 1E27B 4C4KO 2DDQL 4JY6B 4X8JA 2F8XC 2MJWA 3TWCL 2A73A 2QHRL 2W1NA 3IYLW 5GRVL 4JJHA 1VKXB 3HHRB 2Q6WA 1MAKA 4HUWB 2GITB 3KYOA 3RHWK 3EGSB 3G6AB 1FQ9C 1GC1C 4NSKB 3P9WB 5KSUB 1Z6JT 1FNEA 1YYMH 1J1PL 4NQVB 3HZVA 1KLUB 5DC4B 1JTTA 1CDYA 2NQCA 4JG1L 2VDNL 4V1DA 2Y4SA 1AGFB 1U3HB 5FOBA 1CICB 3BGMB 4F37F 1LEGA 3EOYG 1JPTL 4Y4KB 2NXYB 5EZIL 3LKOA 3HMWL 5TDPB 2H32H 5F1NA 1D5IH 1F8TH 4I0PA 5CSBA 2XOTA 3B2UC 5IHZB 3VCLA 3KXFD 2J2ZA 1MH5B 4XB8A 3S7GA 4RIRA 5GGSY 4L9DA 4OF7A 3ULVC 3BD5A 1XZ0B 1UJ3A 3MLZL 4Z7WB 1ZGLM 4AIOA 4GRLA 2W60A 2H8PA 5TQ2H 5ICYA 4FNLH 5J4MA 4JO2H 3RTQC 1I7TB 1KUMA 4IMLB 4OSUL 1SEBB 3HUJB 2R0LL 4JZJA 2CLZA 4YK4B 4CRPA 4IOFD 1CVSC 2AEQL 1MCKA 3CFDA 4UB0H 1IKNA 2QKIA 4HUMB 1WICA 5ID0B 3EFDH 4OUUB 3QI9C 1G7MB 3QZWB 1ADQH 3MRRB 2F53D 5MI0C 1RK0A 4KQ4H 3T4AA 5CJOL 3JSSA 4HGMA 3QULA 1AC0A 5IBLD 4PRIE 1CLOH 4AM0A 4I18B 5FYLE 4BZYA 2VLKE 1NGPH 1RV6X 4NUJA 5DYOA 2XXMB 3VMNA 4OI8A 1I1YA 4QTHA 4UQ3B 4HF5H 4P9ML 4WTWA 4MA7H 4GKZA 4U6YB 4LHUB 2X44D 1UWEL 4MA3A 2ICWB 4Q0XH 5FIEA 4ONFH 3CFJA 4HPOL 4MJ2A 5J57B 3KYKH 3U0PB 1KCUL 2YPLD 3O9WA 1KTKE 2W9EL 1E4KA 4MQ7A 5FDYA 1QLRA 4OIBA 4KUZH 4XCNA 4YHOL 1MI5A 4JRYE 4D9QE 3B9EA 4OFVA 1E4XI 2NCMA 2NNAB 2PKDA 5F7FA 4U1JB 1KCSH 2OQJB 3QNXB 4MAUH 1NCWH 3ZT7A 2BJMH 5DEFB 1JMZA 3KPMA 4G6AD 4XCEA 5KJRL 2P5WB 3FT2A 3MJ7B 5EH1A 4EDWL 4AL8H 4NNXB 1BOGB 4H0GA 1RFDL 4NJ9H 2OMNA 2EIDA 3MBEA 1U0QA 1S7UB 4I9WD 1UZ8B 2W91A 3D9AL 4OGXL 1UJTA 4HH9B 1MIEL 2ED9A 5IB2B 2HKFH 3SDCB 3EYFA 3BIKA 3DBXB 5I1GL 1S7TA 3VWKC 3DOSA 3BPLC 3GMNB 3K8LA 4J23A 3ZKMC 1S7WA 3BD3A 4JFQB 1UACL 3MCLL 1BZQK 2DQDH 1KPVB 5F21B 2C1PB 3CSPA 4PIRF 4OCXH 1MAMH 5C9KA 1FFPA 1CD1B 4Q6IC 3RWFB 1A9BB 1ZLUH 1NUFA 2HN7B 2ZKHL 1S7XA 1U8KB 2WIIB 2HLFD 2G60H 2L4OA 3INUL 5IVXF 1HHKA 3BMWA 4XTRC 1QFPA 4WI6A 3I2CL 1MNUH 1AKJA 4N8VG 4GQ9L 5C07A 3PHOA 2O61A 3MRQA 2BXZA 2VJXA 2WWMD 2ERJC 2VDLH 3WO4C 5BV7H 5FO7B 2NY5L 1V7ML 1JGUH 3WIHL 1I9IH 5FUOH 3WHE1 2HFGH 1UM5H 2CLRA 1MVUB 2YD4A 3J7HA 1LD9B 1UWGH 1OAQH 3VFGH 3B5HA 1TJHL 4C55A 5CWSA 5DO2C 1AXTH 4NQDB 3E6HA 5KSBA 1FO0B 1RZJL 5JHLH 2XPGA 3GSRB 3KXFE 3IDIA 3OJMB 4D0BB 5L9DH 4LCYA 1A6ZA 4HGKC 2HLAB 2NY1B 1WEJL 4OLYH 5D7LA 5FYKL 3QCUH 4JDZB 5DD0H 1QQDA 1F2XK 3OB8A 2FCBA 2LU7A 3W0WB 3O2DL 4PJEE 4XP6L 4H25A 5JIKA 4OD3L 4DEPB 3EYSL 3JWNC 4PY8I 4WGWB 5DJYA 5C0DB 3TESA 3ZHKA 2X4PB 5DJDB 4H1LG 4Y5YB 1DQQB 5E8NA 2E9BA 3PWJA 5JNYB 4MDIB 1KJVB 4EBQH 2F53E 4L3ED 32C2B 3MRMA 1S9VA 1D6EB 5JORB 4GRMB 4L4VA 5D5MB 4W68A 4Y7MA 2DYPB 4DKDC 1VPOH 2X42A 1DLFL 4LQFH 2BVPA 1B0RB 1JZ2A 3L3IA 1GOFA 5GS1B 3G5YB 4NNYA 1YNKL 3P9LA 1SBSL 1U2CA 5K9KB 4E5XB 3OKNA 1YYML 3UC0H 2X4RB 2DIJA 2CKBB 1NDGA 5C0IB 2KL6A 2YPLE 1CXIA 3CLFH 5IG7B 5JLZB 4OBSA 3G5ZA 2V2XA 1PKQA 5KBNC 4K7PH 3S36X 4O02H 3E3QE 3V79C 5CEYB 1NCTA 1D5IL 3QXDA 5CSZA 1NL0L 1XR8B 4XP1H 2P8LB 3UYOD 3T2NH 4N0RA 4NGHH 2E9IA 5CIPH 3P4MB 3S96B 1YNTB 2EIEA 4GXUN 5TQ2L 2Q87A 2X9XA 4JO2L 4Y4FA 1KENH 4LSVH 4I9WE 3X3GL 1YY8A 2ZUYA 1DQLL 3ULUD 4YBLC 4YXHL 3BE1H 3BFOA 4DW2L 3HA0A 1N6QH 3O3EA 3FT3B 4UILH 3TH4T 1FVDB 3GSNB 1YECL 3PXJA 2F5BH 4XNMB 4EQ2A 3E6FB 5BV7C 5CD5C 5FYLL 3LKQB 4EN3C 1GZQB 4G6KH 2VDOL 1Q72L 4YIQA 1CGYA 5BCAA 3U4BL 5SWQA 1G7JA 4NHUA 3T4YB 1AY1H 2NY6C 4DTGL 4WI7A 1JGEB 4N0UA 4N8CL 2EE3A 3QJFA 2VZOA 8FABA 3QCVH 3VXOA 3V4PH 3BP4A 4HK0A 1CLZH 1CTNA 2VDKH 1INEH 4LGSB 4X6BB 1D5MA 1CN4A 2FYYB 5J6GA 5KVGH 2WUBH 5DHVH 2R1YA 4L8BB 5GJSH 1TZIA 5IKCB 2NY7H 5GS2D 2VLLB 3HLAB 5J89A 3H9SB 1X5LA 4RZCB 1N7MH 2ZUSA 4HKJB 1FZMB 2BJML 4P23A 4KJWD 4W4NA 5BS0B 1T7WA 1E4JA 3L6FA 2F54B 3FO0L 1CXLA 4OQTL 2Y6SC 3ORJA 4YWGL 4GRWB 3KJ4B 5ICZB 4Z7UE 1RAMA 4UDTA 3FMGH 1E28A 1MHHA 2CPCA 3EOAB 3IJYB 3MQIA 3PWLA 3I84A 3HUJF 3DMMC 1N0LA 4ZSOE 4UIKL 2DQIH 3B9KC 3DRTA 4XGZA 4E42B 3VXSB 3CX5K 5ALCL 2WLYA 4F7TB 1WSST 3GI9L 5HY9B 3V8OA 5GGRA 4HUXB 2BRQA 3B9AA 5JTWA 5D7JC 2IJ0C 5TE6L 2XZCH 5HHOD 4M93B 4FQ1H 3CVHL 4P23D 3VU2A 2YD2A 4OCXL 2B4CL 1DBAH 4L3EE 3VFTA 3GJFK 3TBVB 3UCRA 1NCBH 2E7MA 1FVEA 1HQ4B 3MGAA 4E41D 3P0YH 4KJYB 4RSVA 4X7SH 3N1GC 5MEPB 1MNUL 2V2WA 2E6JA 5KS9F 4BZ1H 3I85A 3A6CL 4YDVB 4ZUSA 4FFYH 1ZT7A 2BSRA 2MHAA 4HAGA 4XNQB 3MLUH 4HUKB 2VSCA 5ESQA 5FUOL 3UBXI 3UTQA 1BJMA 1UEMA 2HFGL 2HH0H 3OZ9L 5HGDB 1RZFH 3RVXD 1PG7X 4F7CB 1OAQL 1T66C 4R7NA 1DQJA 3VGEA 4XNZB 4U2ZA 2HRPH 3B9DA 2G2RA 3O6FA 5CSGA 4POYA 3HPJB 1A02N 3JV6B 4NDMB 1F11A 3V6ZA 4P2OC 1WK0A 3MGOB 5D93C 3IDGA 4JG0H 5DA0B 5L9DL 2XWBB 4RNRB 3CK0L 3FO9A 3QXWA 1OWRM 4KTYA 4GG6B 1PEZA 2HT3C 2B20A 4Y5YC 1P2CA 2NY4B 1CE1H 5JZ7D 3B6SB 2OMBA 2D0HA 5B3JF 4Z7NF 3ULUE 2YN5A 3ARWA 2DWDA 4ZTOL 3GSXA 3HPLA 3MACH 2YMXH 2A1WL 3U6RB 3MV7B 2CIIB 1GJIA 3BH9B 4MNGA 4Z76A 1BAFH 1F58L 4MHHI 4DUXA 3THML 2R4SL 3PV6B 4NN7B 2AK4A 4X6CE 1NC2A 4TVPH 4M61A 3MUY1 3C6LB 2DQCH 1CE6A 5DJAB 5F7DA 2PXYC 4JKMA 1S5IH 3MRNB 3SGEI 4XBPB 3X12B 1RUAH 4A6YH 4RGND 5IQ7L 2R29L 4LSRL 2AV1A 3O8XD 5GRUH 5F3HA 2YZ1A 4HUVA 4JZNA 4O2CB 2I9TB 4OZHB 5E24E 2FLBT 1KPRB 5MENA 3CDFA 5H94B 4F3FA 1PQZA 4DZBB 1I8KA 4K7PL 3VFVA 3RWGB 3W9DA 4HWBH 1KCKA 4U0RC 3QUXB 4F7EA 3PQYD 1B4RA 1NJ9B 5CP7B 1ND0A 4JGMA 2X6MA 5K9OB 4KI5C 1JGDA 4KXZI 2F8OA 3MLSL 2VZ3A 1ZVHA 2XNAB 3WE6A 4F15B 4LSVL 1YMHA 3VXNB 2DM7A 2VQ1A 5IHBA 5D1QD 2LU4A 3UPAA 3IFLH 3VXRA 5DDHA 3AUVA 3KLHC 3RA7L 3O41B 4JDVA 2JF1A 3G6JA 1SJEB 4HKZA 4BK5A 5DZOA 3R06B 1FFQA 3LB6C 3AMLA 2XG4A 4FP8H 5A2IH 4X7TB 3ZYJA 2Z31A 1RUPL 1N2RA 2ENYA 5HHOE 1YEFH 2ADFL 1HCVA 4ISVB 1N64H 3RWDB 3D69A 5J6HB 1A1NB 5EU6A 1RZ7L 3ZT6A 1KIUA 5C0FB 4OZGE 1QBMH 2OSLB 4KJQC 3TT1L 4E41E 2FBJH 5FGRA 1K5NB 1U8LA 1VEMA 3PDOB 4HPYH 4FMFA 4PRNB 3GB7B 4QXTB 1BD2B 4F37K 3ZDZE 3MLYL 4WY7H 5L8JB 4MZ2A 4ZQKA 2J8UA 3PP3K 3MOQA 1P9MC 1A7RH 3DYPA 2Q8AH 1B9ZA 4AYFA 2CUIA 2G75B 4LGPB 4NKOB 3MRCB 3HR5A 4G9FA 1G7PB 2NY7L 4EXPX 3KJ4C 2BNRA 5HI4C 4Y1AA 1X6NA 1O7VA 3V4UH 5I1DB 4HIJB 5EUKA 3NPSB 2LFGA 3WLWD 3PWUA 2C3VB 3TJHD 3RZCA 2W38A 5F3BB 4WTXA 2C3XA 4B5EA 3PL6A 4XPTL 3QUMB 1RIUH 1FNAA 4JM2D 1EVTC 4Z78B 4OLZH 4YPGA 3BI9X 1IEAA 2ATPA 3BHBA 5EU3B 2DQIL 3ROLB 2ARJQ 2OZ4A 1CFNA 1ZHBB 1E4WL 3CCHA 4MQXD 4Y5XA 3UROR 4XI5D 4F9PA 2VDPL 4MA8L 3P73B 4S1QH 1A0QL 1NLDH 4AENB 1ZWIA 4WUUB 4RCAA 2HMIC 3QNYB 4K9EH 1UB5A 4PJIA 1QA9A 1RUKH 2XZCL 4HEME 4M5YH 3VFWA 4LSQL 1A3LH 3FQTB 5IK3A 3O4OC 2HRLA 5JDJA 2DWEA 1DBAL 3GJFH 2OYPA 2Q7NA 5IBUB 2APBA 3HE7B 5J9PA 1NCBL 3RZCD 4YUEH 5C0JA 5T1LB 4U6HA 1RIHL 1IGYA 3SJVB 4YGAB 3T65B 2HYMA 4RGNE 3GSQA 4IRSA 4M6NH 1OQOA 4RMSA 3QHZH 4XNZC 2KDGA 4KDTA 4BZ1L 5C8JA 3HTLX 2RFXA 5FF6A 1FV1B 5IB5A 3CXDH 2LAGB 3M8OH 5I18L 4U1HB 2FO1A 4FXGB 2HWZL 4LF3A 4LVHB 3ARGA 1X5IA 5L2JA 3HI6H 1JPFA 4M7LL 5CILH 4WI8A 3C6SA 4WJ5A 3RVUD 2X89D 3VE0B 4HIEB 5DJ6A 1P84J 2NY4C 5D7IB 4QHUA 4GRWF 3PQYE 1U8JB 4JG0L 1JRHH 3L95A 4RFEB 5CHNA 5HHXH 3RPIB 1X7QA 4AH2B 3TO4B 4HS3B 3T0ED 3D85A 5IEKA 5I1IH 4APQB 4UTAL 2VXUL 1U2HA 4UMGA 1CE1L 1NEUA 2JIXA 2VR5A 1S5HB 1YUHA 4K3EL 5CZVH 3T08A 2EC8A 4NO2A 2YMXL 4NHCL 4PJCA 4D3CL 4RMUA 1J8HD 1VFBB 2MCPH 3Q3GA 2VXVL 4XCFL 1C16B 4YEEA 1HZHL 4I3SL 5I2IA 2NY2C 4P5TC 5M95B 4MJIB 3SY0A 4ZUUB 5E94A 3DVNA 3T8XA 5D8JH 1DQDH 2XRAH 3DRQA 3WV0A 2VL5B 4LLUB 2AAVA 2YWZA 4IIQB 1YEGH 4NC2B 2DKUA 5FB8B 4NBYB 5JUEH 1T5WA 1UQSB 3JTSB 1M6OA 1ZHLB 2IFGA 4LPCA 5GRUL 1XFPA 3DARA 3GSUA 4HQQL 1QFWH 5GRXG 3BW9B 1WBYB 3RTQA 1HDMA 3JWOL 3T77A 3QUXC 5C0CA 3VXPB 4L3CA 5BQ7A 43CAB 4JO4H 3FQUA 2HFFA 1YPZE 2FECI 1OGTB 1WWAX 2DTML 3MYJB 1BGXH 2VABB 4HWBL 3MCKB 2E6PA 4N5UA 3QI9A 5I1LA 2VSDA 4M8QA 4MJ5A 1V8HA 1HINH 4KFZC 3WIHA 5T1KB 3UPRB 3SGJC 1QSED 4O51B 4TUKH 4K9EC 1MQKH 3B2UD 3RGVB 3U1SL 1TIUA 1JHTA 5I71B 7CGTA 3SPVA 2IC2A 5E2UL 3MODL 2ZJSH 4GG6F 1VGEL 4HLZG 3RNQA 2P5EB 3RPKA 3ULVD 3I9GH 5IVOA 1KPUB 4O2FB 2IPKB 1RZIA 1KTLB 3GMRA 5I1KH 2FX9H 2APFA 1OB1B 3MUJA 4YLQT 2MTPA 3C60B 1TPXC 5F6IB 4KDWA 2DQJH 2F58H 5ICXA 3D0VA 4B7LA 3MRFA 5CEXA 2HJLB 4R2GC 2OP4H 1VSCA 4AY0A 2YPVL 4DZ8A 4FP8L 1EJ6A 5EG6C 4PJ7B 2X05A 2YK1L 1H0DA 2A6DA 1OD9A 1N64L 3CDGA 3MRGB 4L29B 3CU7A 4NQCD 3OQ3B 4GUPB 1BZ9A 4OFDA 2NXZB 4OD2B 2W59A 4OF5A 1P84K 3IETB 1YQ2A 2NW3B 2AXFB 5E70A 1AQDA 1JF6A 4GBXB 2V2TB 3L3OA 2W92A 1FYTB 4OT1L 2X1OA 5J1AA 3LH2H 1TVDA 3H9ZA 3PP3H 2P44B 3PWPD 1M7DB 4LAQL 1S7RA 5C3LD 3WHXA 2BVEA 5F7UA 3RP1A 3FB8B 4YXLH 2IFFL 1UENA 2CDGB 1CT8A 2CDFA 4EI6B 3QCTL 2B5IB 4WEBL 5LCVL 3QHTC 1ZT4B 5ITBH 3MC0A 3MRPA 4PTTB 1A6UL 3V4UL 3BKJH 2Q3AA 1NMAL 4Q2ZB 5CBAB 4LQ1A 2AJ3A 2R39A 1J9CT 2XZAH 4ODWB 2EDNA 4HKBB 5DRNB 2R4RH 5J12C 5DI8B 3QA3B 1Q94B 4KZDL 1YMMA 2YSSB 3T0EE 1ZAGA 1T2QL 1QTYT 2G9HA 3KDMB 2X1PA 3IRZA 4LBEB 5AG9A 1A6TA 3QWOB 3OG4B 2FB4H 5C1MB 3O11A 5ISZA 4JANA 1ONQA 4M6ML 4PJBB 3VWKD 3QT2A 4R26L 4P2QB 4J4PC 3ZKMD 2PW1A 4WO4B 3IDJB 2YOCA 3HE7C 5E95B 1J8HE 1KIRA 3QO0B 1UWXK 4FQJL 3GGWA 2ZSWA 3QUZA 3OKYA 1R3HA 4KMTL 4Z0BH 4M5YL 1RUKL 3L3GA 5EBMB 2UVEA 2R1WB 1B3JA 3ABZA 1FG2A 2UWEB 3DYOA 3VH8B 5EN2B 3BGFB 1LK2A 3MA9H 4U1NA 2WSKA 3NTCL 3BXNB 3RNKB 5E08L 5CGYC 3VG9B 1MCPH 2XICA 3B2VH 3VMOA 4GG8A 4LVHC 3Q6FB 1L7IH 3V5KB 3G9VA 3CXDL 4DN3L 1LP9F 1I9RH 4PGCB 4PRBA 4G80A 4TRPH 3KPNB 3RBGA 4QRPA 4PJ9A 5F89B 5CUSL 5D1XB 2I27N 3BH8B 1SYSB 1YEEL 3QXTA 5INCA 2BDNH 4G7YL 4JO1H 4WW1A 4GAFB 5D2NC 5CILL 4AEHL 4X5XB 3GHEL 4FQLH 4Q97A 3TO4C 3QEQB 2YRPA 5DO2D 3NPZB 4PJDE 4Y16B 4APQC 1G9ML 1X5HA 3AM8A 1D3CA 1HWGB 4XVSL 1WISA 4HIXH 3ARFC 1QSEE 2JCCB 1IRAY 1KJ3L 4K3JH 5DLML 2X2YA 4LLAA 4C4KT 4YQXL 3TFKC 3U9PH 3SDYH 2R2BA 1K9TA 1PX4A 2A6KA 3ULVE 4U1MB 5LAXB 5I8OL 5HXMA 1S9WA 3L9RB 1N8ZB 3VFSA 3B43A 2XA8H 5FGBC 1B0GB 4WI3A 4P3CL 1T5XA 4YDIH 1IL1B 4AG4H 2AV7B 1NC4B 4NRZB 4HEPG 4WW2B 2MCPL 2X7LA 1UA6H 2R56H 4NZDA 4HMEA 3IU4H 2J4WH 5J1TC 1EVUA 2ADGA 4G5ZH 4PV9A 5IUSA 3DVIA 1TLKA 1FFNA 4NQCE 1G7IA 3GSOA 5JUEL 3KPQA 5DFWH 1NGWA 4U6XB 1WWCA 1EEZA 2J8OA 3RUGA 3KPOB 5BRZB 5HHPB 1G7LA 3FZUC 3BEVA 3DETC 4GAGH 3V52H 2NXYD 5D9SB 3L3JA 4LFHG 3PWPE 1LNUB 4JFXB 5CLTA 2QADC 1OAKH 4XPAH 4POZC 3DURB 3RGVC 5L88L 3QUKA 1JV5A 2AK1L 3MO1B 5I71C 1RHFA 5I8KH 4Z0XB 3EYOB 5T3XD 1HNGA 1MFAH 1ULVA 4HBQA 4BSWA 1VGKB 4EN3A 3VA2C 5IWLC 1IGJB 3NCBB 4TUKL 4PREB 3STLB 4QRSA 4Y2DC 3HRZA 2Y07H 1LO4H 4UOW0 2ZUWA 5DUMH 1ED3B 4X9IA 1CWVA 4LVNC 5T5NG 4CADA 2BOCB 3S35H 3U82B 5GRJL 2V5SA 2ZUTA 5GXBB 3QH3A 6FABH 3V7AG 4ODTL 4HGWA 3BPNB 2DQJL 1LO3H 2I07A 1MPAL 1OT2A 3O3AB 1OAZL 4OLUL 4Y4HA 3D39D 2J5LC 4X4YB 3L3DB 4EUPH 1I4FB 3U46B 5CD5D 4UV7L 5DQDL 5DJ2B 4GBXC 1X5GA 3MLRL 2HG5A 5HYSA 3PGDB 4LHUD 5JHDA 3P4OA 1I3UA 5EC2B 5EOQL 2FSEA 2VAAA 2DQGH 2NW2A 2H2SC 1K8IB 3MJ8B 4P3DA 3GIVB 3Q6GL 3VXQB 4X6DB 2BY0A 3R8QA 3CMOH 1A6VH 4XWGH 5DSCB 1AGCA 4FMKA 1MF2H 3Q5OA 3DMMA 1LE5A 2PO6B 5JW3L 1AIFA 1U93B 1F3RB 3B9KA 4D0DA 4RWYH 1AP2B 1J7VR 4J2XA 4GKSA 4ZOCA 2OTPA 4OIIH 3NCJH 2CDEB 3VXTB 2NX5A 2P5WD 2DS4A 1J0ZA 1FL5B 4JGJA 1Z0NA 5D7JA 2F8VA 3BKJL 4J3VA 4JEGB 4D9LH 3O4LB 4ZPTB 2VXTH 4HV8A 5I73C 1DQML 5E8EA 1J12A 3SDCD 1CU4H 2Y6SD 3UBXB 4WO4C 3L3HB 4LSDA 3CH1B 2J7LA 2C4FU 1T2XA 5J0BA 1OP5H 1OF2A 1B0WA 1EPFA 4PJAA 5H37H 3TPUA 4Y89A 2H41A 2VB5A 1QBLH 1SMOA 3VRLE 1RUML 2YPKA 5CIPA 1NAMB 5DJ0B 1RULL 4OFIA 4KY1H 1UWXH 1VADB 4XHJD 2L7UA 3WS3A 3B8SA 3TYGH 2BVOB 4PJ7F 3HNSL 4PTUA 1YZZA 4WENB 1K3ZA 2BVTA 4L8SA 4WHYH 1PSKH 1OL0A 2BSTA 3BSZH 4KKCD 1QUNA 3TP4A 5ADOH 1W0YT 3HNTL 3OBAA 4LLVB 1F3JA 4KAQH 4G6MH 3F5WB 4BQ9A 3FONB 3BP7B 1R5WB 5F1KC 2A77H 4NFBA 3QFDA 2K3TA 5AWNH 4DCQB 1P6AB 1G6RB 4YZFF 2JK5A 2F5AH 3CFCH 1TVHB 3D18B 1C5BH 4KVCL 2WQRA 1A4JA 4NQDD 4P57A 2YEZB 1JUFA 4TNVF 2DLHA 4JFHD 2CO6B 3ARRA 3MOBL 5FO9A 1MRDL 4QT5A 2M1KA 4U1LB 4MCZA 4JE4B 1T66D 3JWDH 4FQLL 2EYRA 1RHHA 2YA1A 3AU1B 3QNZA 4IRJA 1RJZA 5T3XE 1QR1A 2NY1D 3ZZ1A 2DOCA 5DK3A 3WFDL 4Z7WE 2H26A 4LPVA 3NGBB 3QQ4A 1MRFL 5DHVA 4YE4L 4P2OD 3SKNB 3W0WD 4K3JL 2FL5B 2PXYA 4P2YA 3U9PL 3L1OL 4O2EA 3HUJE 2JB5L 1QEWB 2APTA 3WUWA 3I3EA 1I1FA 3RUGE 4ORGA 1WBZB 1VACA 4PJBF 4OZ4A 4X9GA 2FJHA 3LN4B 1G7QB 4FFVC 2AXHA 5IMMA 1H15B 3LKRB 3U83A 2GSIA 1JWMA 1T2JA 3LDBB 4AG4L 1C5DB 5EBLA 3MRDB 3WSQL 4LSTL 4ELMA 3WYRA 1CFVH 4JPKH 1XF5B 3D39E 5F7EH 1HXMB 3C5ZB 1AD9A 4NIKB 5C0GB 4G5ZL 4QRRA 3BKCL 1MWAH 5D2LF 3PV7A 3D2UA 5JO5A 4JHAL 2RCSH 3UZVB 4Y19A 3LV3A 4WWKC 1ZHKA 1TJGH 1PLGH 5AG8A 2BCKB 3H0TA 2W0FB 4N0CD 3FQWB 4OCMC 5EORH 1NFIA 4XCCL 1K4DB 3QWQB 3TCLB 2AP2A 4KMLB 3GZKA 3DROB 4YHZH 5KVFL 5TQ0L 3NZHH 1A6AA 2C5DC 7FABH 4IDLA 1KXQE 5TF1H 3KLAA 3KYAA 1EJOL 1J10A 4FTVB 2P5WE 4JQIH 4YXKL 4J8RA 4GAYB 4FZ8L 4EVNB 1GPOH 4C59B 4BK4A 1GL4B 1F6AA 1NMCB 1QRNA 2P47B 3R1GL 3EOBA 3N06B 2JCCF 1R3KA 5HVFB 1U8IB 4HT1L 4IHOB 4M43H 5JR1L 5DUML 5IR1A 1JPST 1Z3GL 4GJTB 3OKLB 1JPGA 3BPNC 3X3FH 5HPMB 2CIKB 1KELH 3LAFA 3SE4A 4WU5A 3NA9H 5HDQL 1H3UA 3IB4A 1N4XL 1LEIB 2O26U 4R0LB 3TBTB 4X9FA 3VWJC 3RU8H 5SWSB 3ARYA 1JTOA 1YEKH 6FABL 2BHUA 1IM3A 3KLHD 4B41A 4YHYB 4PRAB 4IDJL 1P9MA 1YEIL 4Z18A 4Y8AA 2VWEC 4IOSD 5B38G 4RA3A 4GSDL 1U58A 3LQMA 3WDHA 1JNNL 3LB6D 4X5WB 5E9DB 4R3SA 1XIWB 1PG7W 2DQHH 1HYRC 5IOPB 4L8DB 3O6LH 2FEEI 4MD4A 3OKMA 3QQ9C 1KNOB 3FFDB 3JWDC 4PBVC 4F33A 5HDLA 4I4WA 1OGAA 1KEMH 4K7FA 2ZNWA 4DK3A 5HHNA 3LZFL 3UTTA 1A6VL 2VR4A 5DZLA 1NLBL 4CNIA 3ECBA 4BFBD 1T89C 3NOIA 5TFSL 3REVA 2C9AA 1MHCA 5E4IA 5IM7B 12E8H 1JWSB 3DIFA 4A6YA 1TCRB 1T3FA 4NQDE 2F54D 1EFXA 3ARBB 4JFHE 4X80H 5BZWA 4YGVB 1Q1JL 5ESAB 5CEZH 5DJXA 1T1WB 3RDTC 4ZXBB 5HI4D 4PV8A 3CSYA 2CR6A 4BH7B 3U7YH 4ELKB 4JKPL 4NO3A 4CJ1A 2FR4B 3K8MA 3LKNA 3O6MH 5DGRA 3EJZC 4OLVH 1XH3B 1RPQA 2QEJA 3UZEA 2IPTH 3W0WE 3VXSD 1J0YA 3MV8D 4HWBA 2GTZA 5I76A 3ZYOA 3QDMB 5I17B 1RIVH 2ZCHH 5E2VL 4JFFB 5I8EB 5DRWA 3JVGA 3ZE2F 1QBLL 5JXEC 2P24B 3OX8B 3TA3C 5A16A 5J3HC 4H0IA 3RQ3A 2VXSL 4R96B 3H9HB 5D5ME 3TYGL 1U8OB 4OZFH 2HMID 2QQLL 3FT4A 4IJ3B 5EA0L 1BM3L 2JB6A 3PHQA 4MCYA 3MREA 5KVMC 3BRGC 4D0CA 4OFKA 5DR5L 1Q9WA 3IU3A 2F19L 1ES0B 1DQTA 4GKNA 1UC6A 4JVPA 3M45A 2VE6A 4N8VB 4UOJA 2IAMB 4JRXB 2BNQA 1DANU 1IAIM 5TE7H 4ZUWA 2VDQH 4MAYC 3L5IA 3HE6A 3UTZA 4E0RB 4JM4H 5JOFA 3NMEA 3X13B 2V6HA 1D9KC 5T3XL 3BYYA 1BLNA 4N8PA 2EDFA 1U42A 4OGAD 1OP9A 4MMXC 2EXWC 3VFMA 3S5LA 3BO8B 2I24N 4FQQA 4P5TA 4CN4A 2C1OB 1IC7L 4ZAKC 4OCYH 3V0WL 1IQDB 4IS6B 2NY4D 2PF6A 5E8PA 1DVFC 2EH7L 1KSRA 3PGCB 1QLEL 1UM6H 1X3DA 2I60L 4UINL 3UTSB 2IANA 2W0LA 4M1CC 5FKAB 1LILA 3EKCA 4GH7B 5GSRB 1A2YA 4KKNA 2EH8L 3MV7D 3VGHA 2C3HA 1IBGL 1DBBH 5D96B 3VXMB 1BIIB 4KVNL 1W8NA 1RZ8A 5DD3H 3C5ZC 5F6HI 1MCBA 2B0SL 1T1XA 4DFIA 1AJ7H 4LDLB 1FH5L 4WI5A 2XQYK 4H1LB 3C6LD 2FWOA 4NQEB 5IW6A 4ORZC 1LO0H 1FFOA 4PS4H 2ZUQC 1A1MA 1N59B 2NY2D 5JPNA 4KQ3L 4XP4H 1IGTB 1A47A 3P3YA 4OLWH 3PJSA 3V4VH 3W39A 3UJTH 4NP4L 4S1DD 3SGJA 2ZPKL 3HR6A 3G5VA 4H20L 1X4XA 2X9YA 1H5BB 3BKML 4TPRH 1PLGL 3GMQA 3AREB 1UH2A 4G6FB 5A2KH 3GJFA 4P5KB 1DZBA 2V5TA 3T2QA 2DTSA 4K3DL 4HKXB 2VL4A 4LDOB 3U0WH 2YC1A 3QUXD 1OLZA 2F9BT 4AIXA 1C08A 4K8RC 4NJAH 7FABL 5BO1H 5TF1L 5HYQA 1MREH 1KC5L 3MR9A 3N50A 4ZG1A 5F97E 4P4KC 2F54E 4N68A 2CGRL 3RY6C 4JQIL 1M05B 1OSPL 3MNZA 3PWNA 4GRWE 4U6VL 3QIWB 5SX4I 5T1MA 1I7UB 5IJVA 2XWTA 4JFDA 1NKOA 1KEGH 2VLJA 4M43L 5E00A 2WW8A 1XGUA 3UDWC 5HDBF 3OGCB 3I6KB 3PWVB 4YHYC 4C56B 3O0RH 2Y06L 2R2EB 3VXSE 3MV8E 4I2XE 4AEEA 5JIPA 2M8XA 4OZIE 5HYSG 5EFIA 5TDOB 2Z8VC 4ONHA 2GFBB 4F58L 3GNMH 1DFBH 3HI1A 2OL3B 5DD6B 5IIEB 1NAKH 5E2TH 1KCVL 4RGOH 4Y0GA 4M1GH 4TSBH 3FFCB 4HX1B 4XC1H 1Y0LB 4K3HA 4X7CC 5EOCL 3DHJA 3P11L 1T4KB 1W72B 1I7RA 4L4TB 3HB3C 2IF7A 4LU5H 5CCKH 1JZ5A 5I16A 5L8KB 2GJ6B 1BD2D 2B39A 5T3ZH 5ACZB 3DI3B 4S1RL 5ECJE 4RAVA 5DMYA 1JGVH 5BJTA 2K7PA 1IM9A 4R4FH 5ANMB 4OCRL 3ARBC 5I9QC 2VLKB 2VZVA 5F1IA 5LKNA 4UV4L 1JBJA 4WHTA 2N56A 4XBEH 2NY3B 3L3KB 4HWUA 4ZXBC 3KWWB 2D31B 1TVBB 1YQVH 3DO3A 3DUUA 3RIAK 1HEZB 4ZFGH 2Q76A 1X4ZA 3HRPA 1T22A 4J4PA 2YRLA 3SGDH 4X99B 5C0AA 4LIQE 2XN9A 2YZ8A 4TSAH 5E6IB 2BX5A 1D5XA 4WVRA 4L5FL 4QRTA 2ADIB 4F7MA 5EUOE 2KZWA 3SCMB 4GG6E 3C9NA 4YAQA 5CZXD 2E5EA 4G8FA 4L3AA 2IPTL 4YDJB 4MXQC 2AEPL 1A6PA 1K8DA 4RMTA 5HBBA 1Z5LA 1A22B 4GW5B 4LASL 5BVJB 1MCOL 4G6JH 3B5TA 3MROA 4NWUH 4WUUD 3MV7E 1LO2L 2B2XH 2VDRL 1BX2A 4QXWA 1ZSDB 3MA7B 1ORQB 3O6KL 1O5DT 2QLVB 3EOTH 1ODAA 3ZYZA 4J4PD 3HE7D 5JOPD 5FDWB 4P48A 1SVCP 5T1LD 2HVKB 3IAPA 4XXCA 3SJVD 2IH1A 1NBYB 3O2VL 2BXYA 2O5ZL 1AD0A 3MNWA 3RL1A 2CKBL 1XGQB 2EDOA 3MJ9L 4HIIA 3ARFA 1UXWB 5DMKB 5F9OH 4OZHE 3VGAC 3HFML 5HYJA 2BRRH 4NKIH 4ONGH 3LQAC 1DR9A 4R6UA 4Z5RA 5CZKA 1CIUA 4FHBD 4XMKL 3H7BA 2X4QB 5FGBA 1EFQA 4OF3A 1FZJB 5DT1H 2XACC 4HAFA 1IGML 2FX8L 3N85L 4YDKL 3WUWG 1P4LA 1G1YA 2VOTA 2O5XH 4C83A 3IKCA 1FVCB 3TO4D 4TQEL 4H88H 2O5YL 1A6WH 2W9DL 4JDTL 4APQD 2B8OT 4M7KL 4LCWB 3DV6A 1UCBL 3TM6A 1MRCL 2PYEA 3MV11 4NZUL 2QSVA 1QNZH 5T5FH 3GSNL 3MRIA 1OLLA 5HYJD 4K23H 1LMKA 4ODBD 1JNLL 1JMXA 5DA4A 3V6OC 2CXKA 4X8JB 5D1ZC 3VXUD 2A73B 4HIHA 3UP1A 4MJID 2Q6WB 5GIRA 3QWRA 4YO0A 3KYOB 4QOKA 3S36H 2K9UA 4X9BA 1S8DA 3O3BA 4R8WH 5C0RH 3SE3C 1FNEB 3AFLA 4NYLA 1H5BC 3OJ2C 3AREC 3HZVB 4CVXA 3CH8A 2QQNH 1SJHA 2E6QA 4V1DB 2Q8BL 1R3JA 4ERSH 5IESL 1LEGB 4Y2DA 2EYTA 1BD2E 3QG7H 3LKOB 5IHLB 1R0AH 5F1NB 3ESUF 4I0PB 5L2KA 5E7FA 4QO1A 1KLGA 2V17H 3LN5A 3GK8H 1WCQA 4PLKC 3SDDC 1A1OA 3VCLB 3FZUD 2FATL 3DETD 4RIRB 4JGUA 3K3QA 1UJ3B 5J8OA 4GRLB 2W60B 5ICYB 4PG9A 1KB5H 4POZD 3RGVD 5I15L 3KAAA 4OLXH 4NO0A 5F8RC 4JZJB 2CLZB 1EH9A 2P5ED 4JPVL 2QHLA 4CKVX 3CFDB 4ZO6A 2QKIB 5E99L 1X44A 1U95A 4ODHH 5D71H 3C60D 2EO9A 1Q9LA 1RK0B 4QYOA 3VDCA 4DJMA 3T4AB 3KYNA 1T03L 1GAFL 4R97B 3QULB 3TBSA 3EYQC 1KN2H 1OARH 2ICEA 5I75B 4XRCA 4WUUE 3STBA 4NUJB 1JJUA 5DYOB 2BVQA 5E8OA 3DX6A 4ZO8A 1R3LA 4QTHB 3KPLB 5EULV 4AT6A 4GKZB 4WDIA 1D5BA 4PJ5A 3PGFL 4RGOL 4MA3B 15C8L 2NXZD 5I19H 3IF1A 5JOPE 4H26B 4HMCA 3FB6A 2EDDA 3TV3L 4ZODA 3BVNA 1I3GL 3IFNH 3O9WB 2E7HA 1HWHB 4HDIA 3SJVE 4WI2A 4GBXD 1QLRB 4XCNB 5CCKL 1MI5B 5DQJA 1HQRB 1DL7H 1RSFA 2NY3C 5IVXA 2H2SD 4NM8H 1NGXA 5JMRA 3KPMB 4XCEB 3OAYK 3FT2B 3MLXL 5E6IC 3WN5A 1KIPA 1HOCA 4U1IA 4W81A 4LIQL 4DKFH 3U79A 1FORH 5FYJH 3MBEB 1CFSA 5D7IE 5HGBA 1NSNH 4GXUM 1X5KA 1QFUL 3BIKB 3EYFB 1S7TB 4TSAL 5D2NE 2KPNA 1G6VK 1HXYA 3HI5H 3NFNB 3DWTA 4HJGA 2YS4A 5IB1A 3P30L 5EIVA 1ZVYA 1EO8H 5IW1A 2EE6A 1NGQH 4P2QD 4W6WB 3RL2A 5F6HJ 4YHPB 4WO4D 1FFPB 1A5FH 5DQ9A 5HYJE 4LSSL 4YR6A 1TCMA 2B2XL 5ID1A 3OGOE 1S7XB 2BC4A 1UADC 2RHEA 5TH2A 2GTWA 2B1HL 3VXUE 4U0QB 1XEDA 1PG7H 4MVBC 1HHKB 4JFOA 4MJIE 3NN8A 1BFVH 4N1EA 3DX8A 5C07B 2O61B 3MRQB 4I77H 1AHWC 5IFJA 4LLWA 5HI5C 1BECA 3GSWA 2QSCL 2CSPA 1RZKH 5EO1A 2W07A 2CLRB 2EE2A 1Z9OA 2D7NA 2IGFH 4S1SL 3DI2B 5CWSB 1I9JH 4HJJH 4ODSL 5JXAH 4LCIL 3S5LG 5LQBL 1JGLL 5TPWL 3E6HB 4LARH 5D1XD 1ZKAA 5KSBB 4NKIL 4LSPL 3SBWC 2X10A 1ZK9A 1BJ8A 2XPGB 3MRBA 4OV6F 1CGUA 3BN9C 3IDIB 3QEQD 4JFZH 2ESVA 5I0DA 3JTTA 1A6ZB 1LDPL 4Y16D 1BMGA 2OK0H 4ALAL 1O0VA 1F00I 2ZCLH 5E8DH 1A7QH 3LIZH 5D7LB 1GGCL 1FL3A 1QQDB 2ZG3A 3SGKA 4Q9QH 4H25B 3BT2H 5DMJB 2BOBA 3W11C 5DJYB 2P5EE 5GGQL 3OHXA 2ZG2A 4UT9H 3ZL4L 2FJFA 5E8NB 4JREB 3PWJB 1Q9KA 4GT7A 3F58H 1XF1A 3F7VA 1EAPA 1RJCA 3HC4L 3WFHB 4WWKA 3MRMB 4JHWL 5GRWA 1S9VB 3TO2A 3FL7A 4L4VB 2IBZY 1ZOXA 2AEWA 3TN0A 4U1GB 4Q74A 1EV2E 1XT5A 5FHAH 2BVPB 3CMGA 4LSUL 3L3IB 2CD0A 3FKUS 4DGIL 4NNYB 3P9LB 5EU4A 1RJYA 3GRWL 1X5FA 3MRKA 5C0RL 1J0IA 3OKNB 3BZDA 1NDGB 4I0PC 1MCHA 2A9NL 5BRZD 5E2WL 3G5ZB 2V2XB 1PKQB 1R5IA 2PTTA 4RFNB 1PEWA 1R0AL 3QXDB 5CSZB 1GGBL 3GK8L 4XP9L 4FA8A 3QPXL 1LK3L 4JZJC 4NQVA 3FCTB 2EDXA 5F7KC 4PGDA 3VWJA 1UKSA 5FUCE 1U3HA 1CICA 3GKWH 1IKNC 4LCCA 1KB5L 4X0KA 5L6YH 3QSKB 4Y4FB 1OAYH 4JO3H 3QUML 1YY8B 1UG9A 1NCDH 3QAZB 2DIAA 4R97C 4BKLA 3H9YA 2OTWA 1EBPA 5CKGA 4B53A 4HXAH 2CRYA 2HKHH 2R1XB 1UYWL 5D71L 4JPWL 5C0ND 4IBLT 1FDLL 2AJZA 4P2RA 3GMMA 1RZKC 4FQ2H 4G3YL 4P2QE 5IT2L 3OF6A 4YIQB 5LBSL 1JFQL 5DFTA 5SWQB 1G7JB 3DX7A 4NHUB 4ZS7H 1JNHB 4DVRL 5D7KD 4XAWH 1M71A 1FGVH 1J1XL 1T89A 1E4KC 3QJFB 8FABB 3VXOB 1IGCH 2UWEE 2RBLA 2FHCA 4PJEF 5I19L 4HK0B 4YEFA 4EKXA 4LEOA 4FQIH 1D5MB 1F97A 3EDDA 1D7FA 2SEBA 4U3HA 4M5ZH 1CR9L 2FO4A 2GK0B 4I18A 5J6GB 3RDTA 2R8SL 2R1YB 1Q8MA 4P59L 4PBXA 4XPFH 1TZIB 2PR4H 4WU7A 2ITCA 3W5MA 3NFSH 2PO6D 5SX5K 3RX5A 1AGDA 4P23B 5C08A 3RWJA 3GHBL 2BVYA 5KS9A 3L6FB 1A7OL 3OAYH 3B8YA 5HHQB 5C6TH 3QEQE 3S3PA 5JXEA 2R9HC 5FYJL 4HS8H 1H8NA 2NNAA 2I9LA 4UDTB 3TA3A 1E28B 2OQJA 1BVZA 1MHHB 5C9JB 3PWLB 3VDAA 2JJUA 3FO1B 1J5OL 1NBVH 5KSAA 4XGZB 3DRTB 2WBWB 5DEFA 2N7BA 5I0ZA 3NABL 2ARWA 4R7DA 3ZDYF 4KKAC 1L6ZA 5GGRB 1FLTX 5I74B 3EJZD 3KPRA 2V5MA 1C5CL 2W0PA 4KPHH 4N1CA 5D6DA 4JJ5A 3VFTB 4FFZL 5HVHB 5MHSD 3F12A 3TYFA 5ETUA 1FVEB 4JFQA 3ES6A 4R90H 3OMZA 5LXGH 4MAYA 3TBWA 3CNKA 3TA3D 3GBMH 5J3HD 2V2WB 3NBNA 5K9JH 3G6DH 3LVEA 1U8MA 5IP4A 4UUJA 4OJFL 2QBWA 2GIYA 1D9KA 3I75A 4OAWA 4OKDA 4ZUSB 1ZT7B 2BSRB 5IFHL 2MHAB 4OCWH 1AR1C 2DLFL 2V9TA 2AJYH 5ESQB 3UTQB 5HGAA 1JHLL 4ZAKA 3UX9B 5BRZE 2IGFL 5KVEL 1DQJB 4YHLL 2PN5A 1YN6A 2G2RB 3O6FB 5GRVK 3IFPA 3MXWL 1CXHA 1F11B 3V6ZB 5EB9A 2AJVH 5L0QB 4ETQA 3IDGB 3BN3B 1I7ZA 4FQCH 3OPZH 4MAYD 4LP5A 3FO9B 4RGNB 1ROWA 4ZUTA 5E8DL 1A7QL 4HLJA 3O8XB 5FUZH 1D9KD 1JI2A 1P2CB 4JREC 4QWWC 4X6FA 1E4XL 3TNMA 2BSSA 2DWDB 3GSXB 3HPLB 1T80A 4O58L 3EJYD 3DXAA 2EDYA 3GSRA 4MNGB 3FN0H 4Z76B 1EBAA 3AROA 4XMPH 5C7XH 3CIQA 1DVFD 2YUXA 3F58L 1DUYA 3WIIH 2AK4B 3CZJA 2FD6H 1LEKB 1NC2B 5JQ6H 3D0LB 4RISL 3GO1H 1CE6B 3M17A 5F7DB 4PBWD 2DM4A 3C5ZD 2BY1A 3OJDB 1EAJA 3PHSA 4JFYA 5D7KE 4OUOA 2X4PA 5DJDA 2AV1B 1NH6A 5F3HB 4X5LA 1A3RL 3SEPA 1UT9A 4HUVB 4JZNB 2VWEE 5KANI 1IILE 4P4KA 4Z7OE 1D6EA 5MENB 4GRMA 1GOHA 1IAIH 3JV4A 3VFOA 3OR6A 3DXAD 4F3FB 2DYPA 1PQZB 4XPBH 4X6DE 1I8KB 1X5ZA 1OVZA 1EO7A 3DJ9A 4OZFA 3W9DB 1R5VA 4NT6A 3KR3L 1MUJA 1H3PH 1RZGA 2OR7A 4KUCF 1F6FB 4F7EB 2QQQA 3NZ8A 3RKDC 1JGDB 2P8MB 4FOMA 1QYGL 5C09A 4OTXH 1S78C 1SEQH 5IG7A 2UZIL 1MFDH 1R3IL 3GKWL 4CW1A 4K8RD 5JMOC 3WE6B 5DC0A 4JO3L 1YMHB 2VQ1B 1YEDA 4CVZB 3GDBA 3N1PC 3VXRB 5DDHB 3B4NA 3MV9A 1IFHL 4JDVB 3G6JB 4HKZB 5EPMA 1URLA 5A3IC 2XZQL 1OTSD 5SWSD 1CQKA 5FV2A 2LVEA 2X4SA 1N2RB 4XPHL 1DBKL 1QKZL 2DIBA 2YD5A 3CJJA 4HCRL 2UY7A 2VLRA 3D69B 5FHBL 4ZS7L 2CO7B 5EU6B 5MHSE 1UVQA 5E9DD 1XIWD 1FG9C 1W0WA 3CLEL 1U8LB 3LSOB 1YYLL 5C6PB 3QBTB 1S9XA 3K80A 5LGKA 3ULUF 3C09B 2X9WA 5EC1A 1VFAA 4LLMA 4ZTPL 4ZQKB 2J8UB 1OW0C 3BPOC 4PJGE 3LEYL 4NFCA 3LD8C 2FIRT 4I48A 2JTDA 3HB3D 2M2DA 2Y5EA 3HR5B 4G9FB 2ID5A 1MLCA 2X4OA 4OGYH 4X6CF 2BNRB 4KJPC 4X98A 5SX5H 2VC2L 1CZ8H 3ZSTA 3ARPA 2FX7L 3VRIA 4Y1AB 2AJUH 3RWHB 1YJDH 4AQOA 5EUKB 2DJUA 5MP6H 3ARBD 4NQXA 3PWUB 3RZCB 4PLOB 4GW4A 4M4RA 4ZXBD 4XBGA 3PL6B 1CBVL 1ZLSL 3D25A 4YPGB 1HKLL 1IEAB 1MCDA 5F9WC 5I74C 2D9CA 2VLLA 3BHBB 1CF8H 1FZMA 1IGFH 4UBDC 2BNUB 3CCHB 1I85A 1SM3L 4FG6C 3DX9A 1FAKT 4JFFD 1ZWIB 1QRKA 3IS0X 1UB5B 3DNKA 4MLIA 4PJIB 1QA9B 2W9LA 3VFWB 4RGMB 4TNWK 5IK3B 2DWEB 2R0KH 2P7TA 3GI8H 3K2MC 2VZTA 3IJHA 4EI5A 5J9PB 4EOWL 2D7MA 2XWJA 3ZKQD 3F7YA 5C0JB 1BFTA 1KIQA 4U6HB 4XNXH 5AZEH 5GPRA 5LXGL 1IGYB 5JIHA 3GSQB 3GBML 2HA1A 4IRSB 3MLVL 4EUPG 3G6DL 3FN3A 1FGNH 1A21A 4KGJA 5CKAA 5C8JB 2RFXB 5FF6B 1A14H 5IB5B 3CAFA 5F7WC 2XKNA 4MJ4A 4OCWL 5D6CA 4LEXL 2IWGA 4NCC1 4JAMA 1G0XA 2IAMD 4JRXD 4ZS6C 3SKUD 4LF3B 3QUYA 2QJDA 3ARGB 3DXAE 5D7SH 5L2JB 3BQUC 3QFJA 3N9GL 1WTLA 2P1YA 2DDQH 1JPFB 3TWCH 3KJ6L 3C6SB 3G08A 2QHRH 4WJ5B 1M7IA 4Z77A 1T0MA 2EDQA 2JLLA 2APWA 1RVFL 3IDYB 4QHUB 1U8PA 2MQ3A 3RIFK 3L95B 4OD1L 5CHNB 3V6OA 3WNPA 1WGOA 5D1ZA 2CJUL 1X7QB 2GCYA 1IC5H 1GGTA 3D85B 5IMKA 5IEKB 1F90L 3ZDZF 3A6OA 4JB9L 2VDML 4JG1H 2VDNH 2JIXB 3UJIL 4ZDHA 4GMTL 1JPTH 1YUHB 4MA1C 1GVIA 4NRYA 2VKWA 2I25N 4NO2B 2AVGA 3C2AH 4BUHA 5EZIH 3SE3A 3TPKA 3HMWH 4PJCB 3GBNL 5AD0A 3FN0L 3QFJD 3Q3GB 4XMPL 1J05A 2ZWLT 1FIGH 5I2IB 1ZHNA 1JPSL 5SWSE 5CGMA 1TDQA 1P7HL 1MQ8A 4X8XA 4PJDB 5E94B 5D72L 3DVNB 2YUZA 3T8XB 5JQ6L 4RX4D 5KAQG 3DRQB 5DVMA 1SVZA 4NQED 5CJXC 1MJJA 3FQNA 2GJZA 3SDDA 5T3ZD 1CDBA 1A7NL 4JN2A 2CK0H 3WNOA 4PLJC 4OSUH 2DM3A 5KG9A 2CIIA 2R0LH 2J6EL 1QFHA 3QDAA 5E9DE 1YJDC 2XA3A 1DTUA 1M6OB 1SY6L 3GSUB 5EIIA 3QJHA 3RY5A 3IXTA 2AEQH 4YDLC 4UIMA 5FECB 3PV6A 5JW4R 5BVPH 2WM0A 3RTQB 1HDMB 5F7YC 2PTUA 5AUMA 3T77B 2V9RA 3AS1A 3ARED 4L1DA 2R2CA 4P5MA 5C0CB 5LVEA 5CJOH 4G6FD 4L3CB 5BQ7B 4XPBL 3FQUB 2HFFB 5DS8B 3JUYA 5K93A 1WFOA 3HCVA 3QI9B 5I1LB 4M8QB 1OAXL 4MJ5B 4XH2B 4P9MH 3SKJL 3VI4E 2WBJC 3BUYA 4NZTL 4GO6B 3HG1D 3OKOA 1UWEH 2ZCKL 4OTXL 4HPOH 3SPVB 1P1ZA 1I8IA 4HUUA 5H94A 3RWIB 1KCUH 3RNQB 2MMXA 4DAGL 1RZIB 2D0GA 4YHOH 3GMRB 4HMDA 3SN6N 3TVMA 2Z31C 4C56D 2PYFA 3DHMA 1VESA 4U6TA 5CP7A 5ICXB 3D0VB 3MRFB 5CEXB 4BH8A 3U36A 4JFFE 4LRNL 3AS0A 5AYUL 1NAML 4O4YL 4DZ8B 3FOLA 1L4IA 4G8GA 5KJRH 4EDWH 4H8WL 1J8KA 4WNQA 1H0DB 1RFDH 2A6DB 1J1OL 3CDGB 3IDMA 3OXSA 3K74B 4NNPL 1WC7A 3EYQD 1BBDL 3FFCD 2C7UA 1BZ9B 3D9AH 4OGXH 4RWHA 3RRQA 1MIEH 2VZSA 5I1GH 4G7VL 4Z7QF 3KLSA 4L4TD 1AQDB 1UACH 3L3OB 3CVIL 2GJ6D 1ZE3C 3MFFA 4PG2A 1DEEA 3GIZL 1MCWM 1S7RB 5IV2A 3EHBC 4MD0A 5TDNA 5AAWA 1G6RL 5BZDA 3BPLB 5J6HA 2R0ZL 4PJXE 3S8WA 1CT8B 4JRXE 2CDFB 4TULL 2ZKHH 1X5XA 5ILTL 2NY3D 1T20A 3MRPB 1XF4A 2UVFA 4CMMA 4KGLA 1AO7A 1JRHI 4D9RD 3UTOA 3INUH 1QP1A 3I02A 3IFOB 4M00A 5EU5A 4KTDL 2P49B 3I2CH 2R0WL 2AJ3B 1J11A 5C2UB 1YNLL 2GUOA 1LP9A 4Y5XC 5E6ID 1T7YA 4LPWA 5I6XB 1U8HA 2NY5H 1HH9A 2H32B 1V7MH 2MKLC 1MCSA 1YMMB 1G7PA 2DQTL 4W6YB 3WIHH 1T04A 3SCMD 4PP2A 2G9HB 2Z4QB 1A6TB 2HTLD 5B3NA 1CD0A 3O11B 5ISZB 1TJHH 4JANB 3G6JF 2ERJB 1AHWA 3WO4B 5DUPL 2PW1B 2AQ1A 5C0BA 3RWCA 1KIRB 1KB5A 5T5NF 1HI6B 1RZJH 1WZLA 2ZSWB 3QFJE 2YUWA 1R3HB 2BY3A 4OB5L 3L5WA 1DBJL 3L3GB 4IRSC 5E2JA 4DGYL 2X1XR 1FG2B 3ROLA 1LK2B 4U1NB 1WEJH 2VXQL 1ZHBA 5CLWA 5FYKH 4NQEE 1QFWI 5HVWA 3B83A 2D7PA 5T3ZE 5HD8D 2WUCL 4KKLC 3AXLA 3O2DH 4JM2F 4XP6H 4AENA 2YXFA 4MVBD 2AW2A 4M03A 4OD3H 3P4NA 3EYSH 3UEZA 3DUSA 4XWOC 4I13B 2Z93A 5DC9B 2EC9T 4XVUC 2J8UF 1P7KA 4KHTH 2Y5TA 4PRBB 4G80B 1HHIA 2IMMA 1A7PL 5C0BD 3TZVC 1DBML 3IDYC 4PJ9B 4QRPB 2ITDA 2ATKA 1LWRA 3LPGA 1YEHH 4WW1B 5C86A 1B6DA 2ZP0T 5FK9B 1DLFH 1XGTA 1G9NL 2EC9U 1YNKH 3HG1E 1BFSA 1SBSH 4U1HA 3BN9D 3V0AC 1IC5L 1JZ3A 3RVVC 2R2BB 5E6ZA 2A6KB 1S7VA 4LCWD 3HMXH 5GGVH 4NCDA 1EXUA 5HGHA 5GZOD 3T1FA 5JA9A 3ZKNC 1S9WB 5DK0A 3N1QC 3VFSB 2VH5H 4CDHA 3C2AL 1F4WH 3V9FA 4C56E 1T5XB 1ZMYA 4IMKA 4NKMA 3W11D 3WL9A 1NL0H 3A67L 4HC1L 1U6AH 2X7LB 1FIGL 1K4CB 5DEGA 4AH2A 2IADA 4P9HC 4AEFA 4NKDB 3X17A 3KPSA 2ADGB 4M6OL 4PV9B 1QO3A 3MLWL 5ALBL 3QXAA 1X5JA 1FFNB 5C0EA 2EDRA 1FN4A 3EYUL 4MNHB 3FFCE 3X3GH 2PNDA 1G7IB 2CK0L 1DQLH 3GSOB 4J3SA 4OZFG 4YXHH 3KPQB 1NGWB 4DW2H 3Q1SL 3NCEB 4TN9A 1EEZB 2AI0L 3EDKA 3RUGB 4V1DD 4L4TE 1YECH 2OS7A 2GJ6E 5BVPL 4OCSL 2NY5C 2WWKO 3L3JB 1BJ1H 4YBLB 5FYLH 5DTFA 1BVKA 4I0PD 4X7FC 3WDIA 3LRHA 4UTBH 4IIQA 4XCYA 2VDOH 5ANME 3QUKB 1JV5B 4JFPA 4DGVL 1NCCL 1Q72H 3U4BH 4I3GA 3D39B 4YHIA 3CX2A 3JTSA 1CFQA 1MFEH 2VRAA 5BV7B 4DTGH 1NEZA 2COQA 3NACH 4BSWB 2D3VA 4EN3B 4D9RE 4GRLD 4N8CH 1WBYA 1MLBA 3QO1B 1RZJC 4U1SA 4CVWA 3CDYA 4KK6C 1GCFA 4DVBB 1DLHA 2NY6B 1PFCA 4NN6C 4CADB 3ULSA 3WXVL 3LOWA 3LQZA 3QH3B 4PJCF 5CJ5A 2BZDA 4OCLC 4PJ8A 5T1KA 4HGWB 5DJCA 3ALXA 5BMFL 4CJ0A 2I07B 2Y25A 3FO0H 4PJDF 4OQTH 5FCSH 4YWGH 4O2FA 5FYKU 3ARDC 2HG5B 4HWEL 5HHVL 5HYSB 5JHDB 3P4OB 5DHYA 2DD8H 1F5WA 1OB1A 5IW3A 1RMFL 3QDGA 2FSEB 2VAAB 3L5XL 2R69L 2NW2B 5FEBA 3O9WD 4K55A 4UIKH 2HJKA 2EIZA 4B7IA 3ULVF 4P3DB 1MI5D 5ALCH 5EOTA 1NKRA 1JF1A 3D3VA 5DJ8A 3GI9H 1AGCB 1MCWW 4NBZB 4PJ7A 2WK2A 4R4NC 3DMMB 1CTOA 3TCXA 1LE5B 1AIFB 3BEWA 3GJEA 4GAJL 5TE6H 1I8MA 3B9KB 4RRPG 3CVHH 4D0DB 4RBPK 4OD2A 4GKSB 4WGVB 5C0BE 2B4CH 1KB9K 4S2SA 2NX5B 3OSKA 3T2PA 4HG4K 5I6XC 3H8NA 4LKXA 3ALPA 3CFBA 5D7JB 1U92B 3MBED 1FYTA 2IPUK 3LQAL 1UZ6E 2IQ9L 3MZTA 5E8EB 3A6CH 4YFLI 4OFYA 2C3WA 1YC7A 4FRWA 3T0DA 1PZ5A 2VO5A 1GGIL 1Q38A 1UM4L 1S7SA 3OZ9H 4YHML 3QUZC 4LCWE 5TE4L 1OF2B 5I30L 1WZ1L 5FA3A 4PTTA 4PJAB 1KXTB 3TPUB 5J13C 5HI3C 4O00A 1BREA 3QEGL 2FECL 3VGBA 5CBAA 1TZGL 2JKXA 2YPKB 4QTIH 3NIGE 5CIPB 3NH7L 3HC0A 4ODWA 2FEDC 4KKAD 3WS3B 4HKBA 5FCUL 1G9EA 2WMPA 4PTUB 4YHNA 3FTGA 3S4SA 3CK0H 2ADJB 4XC3L 4I3RL 4KTEL 5CMAA 3BZEA 1AKJD 4BSJA 2BSTB 4UQ2A 5C07D 3QIBA 2OJEA 5FM8A 2OXGA 4P2OB 1F3JB 1XF3A 5D93B 4TOYL 1SJXA 1JZ4A 5ESVB 4JR9L 3QFDB 4PJ9C 4ZTOH 2A1WH 5E1AA 4V1DE 3WNLA 1NFKA 1RK1A 4KHTL 1F58H 4F8TA 2BMKA 2LU3A 3THMH 3VH8A 2R4SH 1KN4L 1E6JL 1AR1D 5B39A 3AM8C 4P57B 3ZTNH 2GK2A 3BXNA 4OM1L 5D2LA 1YEHL 4KUCD 4MCZB 2EYRB 1RHHB 5C71A 1K2DA 4IRJB 1RJZB 1QR1B 4BFIA 5IQ7H 1RY7B 2AS5M 2R29H 4CN6A 2GQHA 4V2BA 4LSRH 5D7LD 1QSFA 3QQ4B 3T0VA 5DHVB 5IGXH 2VITA 3CX5J 2AXJA 2JJSA 2PXYB 1QBAA 4O2EB 4OGZA 5IFAL 1T0NA 3HMXL 5GGVL 3WUWB 3D5OF 3EO0A 3TH2T 1CVRA 1VACB 1NFDA 3BJ91 3ZDYE 4OZ4B 2VH5L 1H3GA 1F4WL 5IMMB 4PY7A 1JWMB 4L4VD 4G8EA 5EBLB 4PGBA 2JCCA 2OL3L 1U6AL 4ELMB 4HWNA 5SWZA 3E1F1 1PDKA 1RU9L 2XTJB 3NFPB 4GOSA 5MEQB 2FLRT 1AD9B 1AXSA 3MLSH 2A2QT 4JZOA 4QRRB 5F7MC 5LAXA 4U0RB 2B4CC 5SV3A 3L9RA 4JHBA 1RUQL 3BP5A 3D2UB 5JO5B 1CGSL 1P4IL 3H3PL 3UJJL 2QR0A 4Y19B 1W72L 1ZVSA 2ED8A 1PVHA 3LV3B 3N1MC 1NC4A 2WINA 4KK8C 1CYGA 5GHWH 5DUBA 1KFAL 3FRUA 3RA7H 3PDDA 5C92A 2Y1VA 4WFFD 1MI5E 5CP3H 3H0TB 3VRLF 3MZGB 5H2BB 1NFIB 3P40A 1JP5A 3BRDA 2NMSA 4O5LL 1RUPH 1REIA 4UTBL 4E9LA 2ADFH 1A6AB 4F2MA 4QLRA 4LHQB 3KLAB 4OCNC 1UGNA 1RZ7H 1MFEL 4J8RB 5ACMA 3NACL 1QRNB 1F6AB 3TT1H 3P2TA 5I1CL 1EZVY 3EOBB 1AQKH 4Y4FD 1R3KB 5IR1B 4XNYL 3MLYH 1S78D 4XX1E 1JPGB 4WU5B 2DI8A 4Y4HC 4Z0XA 1KTDA 2F15A 5DJZA 3MYZA 1KULA 2X4TA 1IM3B 3BDYL 2J88L 4DOHB 1OW0A 4F80A 3EFFA 4OV5B 1XR9A 4NO5A 1TJIL 4FQXA 5A3ID 1QLFA 4LVEA 4Z7WF 4R3SB 4XPTH 4A2LA 2DD8L 1A4KA 4MD4B 5EBWA 5C2BL 3OKMB 4XB7A 2XQYG 4QGTA 5L8LB 4F33B 4MXWH 3TIEA 5C07E 4CU7A 1OGAB 4Q6YA 5GGRY 4NQSB 2DMKA 4K7FB 3RUGF 1E4WH 1FBIL 5HHNB 3MV8B 4I2XB 4QRQA 2QQKL 2VDPH 4MA8H 4OZIB 1A0QH 3R8BB 4CNIB 3MUZ1 3ECBB 1BQHA 3REVB 3PGDA 1MHCB 3CC5A 3DIFB 3VD5A 4A6YB 4AK1A 4LSQH 4RBPH 4J7RA 1LE9A 1T3FB 3E3QC 4F57L 1FRGL 1IQWL 4Z7VA 2R23A 5KSBE 5EZOL 4ZNEA 4BQ6A 1IKFL 1GSMA 2LE9A 5BZWB 2EIBA 4KJPD 3EDJA 1RIHH 1ZS8A 4N0YL 3CSYB 2WNGA 1MCJA 1V5JA 3B9VA 3O4OB 2UUDK 4NO3B 3LKNB 5D7LE 3QIUC 2JJTA 1AI1H 5I18H 1GH7A 4XXDA 2HTKC 4Q7DA 1ZANL 2HWZH 2XG5A 5DRWB 2X5PA 4NPYA 5JDSA 4M7LH 4L8SC 4UBDD 4BUGA 4QTIL 5A16B 4JN1L 1IMHC 4FG6D 4L4VE 3K46A 2EDWA 2DQFA 4MNQA 3UBXA 3TNNA 3BQUA 3BAEL 1HH6A 2X4UA 2MKWA 4PRPA 3QDHA 4LOUD 3W9EA 3CU1A 3MNVA 2AKRA 2JB6B 3PHQB 5CBEA 3MREB 3RI5F 5EUOB 4UTAH 1CG9A 1FPTL 2VXUH 2XY1A 4WEUD 2G5BA 2P48B 5C70A 3D1MC 1NAMA 4HD9A 1BWWA 3LEVL 4GKNB 4K3EH 4M4PA 1FJ1A 4NHCH 1TZHA 4D3CH 1QD0A 2BNQB 2ZOLA 1OT1A 4JY5L 2VXVH 4WFFE 2PETA 3SDAA 4XCFH 1PKQE 4ZUWB 1HZHH 4I3SH 4IRJC 5F9JA 4G42B 3RHWF 3UTZB 4X6EA 2YR3A 3O6FD 3EUUA 4QHKI 5JOFB 2D9QB 2X09A 3ZTNL 4HBCL 1B88A 5F96L 4UNUA 3ILQC 2R15A 3G5XA 3BQUD 3F5WA 1JWUA 1I1AA 1QSZA 3NCYP 4PRPD 3S5LB 1IZKA 3Q0HA 4YX2L 4FQQB 3VG0L 3WD5L 2NY2B 4P5TB 3EO9L 2H1PL 1GGUA 1MELA 1MHPL 1N5YL 5IGXL 4HQQH 4ZOBA 4YHKL 5E8PB 1WFNA 4LLYA 1T0PB 1OTUC 5CJXA 1C1EL 3JWOH 2IANB 4WEMB 3I6GB 1A2YB 1GIGH 4U1LA 2APVA 1HSAA 2XTJC 1RZ8B 4S10A 5GS2H 2GHWB 3QEUA 4ZFFB 2DTMH 3K1KC 4PJFA 3WDJA 1T1XB 1TNMA 2AK4D 1NC2D 1BEYL 2FWOB 5IW6B 4TTGA 1FFOB 3U1SH 1A1MB 5JPNB 5E2UH 3MODH 2PW2A 2DLEA 4N0UE 1VGEH 3MUGA 3PJSB 3W39B 2WBJA 4H0HB 2DBLL 1H15A 1WAAA 4MWFA 5MEND 3X11A 3G5VB 4PLJD 5GHWL 3CXHK 3GMQB 4Q9RL 1HCFX 1ETZB 4NRXA 1NEZG 3GJFB 2OTUA 4QHMA 3PF2A 3F7PC 1CDHA 1FNSL 2YPVH 3F6IA 1N5AA 1J88A 2YC1B 5D5MF 1NPUA 1C08B 1TPXB 2YK1H 4V2CB 5HJ3A 3QISA 5HYQB 3MR9B 4PB0L 4LFHD 4ZD3L 1JVKA 1JYVA 4R2GB 1IC4L 3BISA 3TBYA 3MNZB 4BZ2L 1VFUA 1PY4A 3PWNB 3SE4C 3OB0K 3ZLQC 5IJVB 4QNPE 2XWTB 4JFDB 1AQKL 2VLJB 1K85A 1EMTL 1DEDA 5E00B 4OT1H 5GS0D 3VXRD 5IF0A 2VZUA 4JFEA 4PR5A 1V7NL 4LAQH 4WFGD 5EZJA 2AGJH 2IFFH 3EZJB 1PYWA 1LGVA 3QCTH 4PJHA 4WEBH 3DSFL 3IDXL 3BZFA 5LCVH 5FGCB 4N5ED 2Z31D 4KRMB 4XX1G 4I5BA 3A0OA 2A6JA 1A6UH 1NMAH 4Y8DC 1G84A 4O9HL 5EU6D 5GSVA 3G04A 1S3KL 2ZSVA 3WHE0 2GT9A 4N0FA 25C8L 1FC1A 1I7RB 2D03H 3P0VH 4JPIB 4KZDH 5I16B 1T2QH 2WBKA 1K6QL 4KI5F 3EJJX 4MXWL 1C12B 4HC1A 4RAVB 5BJTB 2Y7QB 2BFVL 4M6MH 1IM9B 4K94L 3WFEL 4R26H 4HFUL 5J12B 3QDJA 1VFMA 4G9FD 3AB0C 3RKPA 3EO1A 5F1IB 4EDXA 3MGTA 2RR3A 2UZXB 4WHTB 1WBXA 4FQJH 4M7ZC 2BNRD 4KMTH 3JWOC 1TTUA 2QL1A 1I8LA 4Y1AD 1UKTA 3EHBD 1LDSA 3FFDA 5F7HA 3OV6A 1IZJA 2Q76B 1JI1A 1T22B 1EUTA 4ZYKA 3TC9A 4U05A 3ELAT 5C0AB 3NTCH 1IVLA 4KJWC 5E08H 2ENSA 5BOZG 4PRPE 3QRGL 3PL6D 1M7XA 2RIKA 3F65A 1D5XB 2UUDH 4QRTB 4F7MB 1CS6A 3JVGC 1XGYL 4YAQB 2EEDA 2OR9L 5IM7A 2ZNXA 4G8FB 4LVOB 3CPLA 1AI1L 4DN3H 1K8DB 2NTFA 3ARZA 1U91A 1Z5LB 3BD4A 3S4SG 3MRHA 2Z35B 5HSFA 3MROB 5CUSH 3PDGA 4MNGE 1YEEH 4AEIL 3O45A 4G7YH 1BX2B 4AEHH 3WFBL 3GHEH 4ELKA 4JVWA 4CU6A 3B3IA 4X4MA 3SE8L 2AK4E 5SX4H 3TZVA 1G9MH 4XVSH 4J6RL 3QDMA 4KRLB 4HUNB 1KJ3H 2VAJA 5DLMH 5D2NB 1TQBC 4UT7L 4QHNA 2IH1B 4YQXH 5I8EA 4IRSD 3HS0A 1AD0B 5B39G 1ZA6A 4HS6A 4Z7QE 3ULUL 4MZ3A 3MNWB 3RL1B 5HYFA 5I8OH 2BHZA 4J1UA 3HE6C 4HIIB 3ARFB 3HC3L 1EX0A 4KKLD 5MENE 2Q20A 4GS7C 4XNUL 1KTRL 4OZIF 2IBZX 4P3CH 3MPCA 5HYJB 3ARGD 5IBTL 1I3RA 2VLMD 4XWOD 3S3JA 1N3NA 2ARJA 2H9GA 5HYEA 3FO2A 4DK6A 4Z5RB 1TETH 3VXUB 3H7BB 3OXRA 5I1JL 3LN9A 3WEXA 2YD1A 4JKWA 3HAEH 2FEEL 3E8UL 2AXGA 5FXCH 4C83B 3IKCB 3WS6C 3QHFH 3R0NA 2LTQB 4EIGB 4WHCA 3D85D 1YDPA 4QKXB 4ODXA 2E7CA 3DV6B 3IDNA 2JIXD 2PYEB 5B8CC 4MB3A 3QQ3A 2EYSA 4NC0B 4JY4A 4KHXL 1SHMA 1WAAE 3MRIB 3VXRE 2YD9A 4TUOA 5K33A 3KPPA 3RVVD 1NQBA 1GIGL 3CZFA 5J11C 3UYRL 3G6JE 4WFGE 5L88H 2AK1H 3ZKND 3FJTA 4HIHB 1EHLL 5BXFA 1IQDA 1PY9A 4S11A 1YN7A 5GIRB 4YO0B 2OJZH 1FAIL 2WZPD 4QOKB 3TEUA 5GGTL 4XMLL 1BF8A 4MD5A 2QADB 4ZOAA 1S8DB 3O3BB 3UTSA 1FL6A 5EU6E 4NYLB 3V7AE 3I50L 1ZT1A 5EUOF 5DURD 4CVXB 5E5MA 1U9KA 1W0VA 4JQVC 1SJHB 1EGJL 1R3JB 5GRJH 3RTQD 3HNVL 4Y2DB 1MCQA 4MXVE 2EDBA 4FABH 5C0CD 2J8UE 5ELIA 3UYPA 3ZHDA 4ODTH 1FE8L 4LVNB 5L2KB 3K81A 1KLGB 3LN5B 1MPAH 3CFEB 4G9FE 3P9MA 1KBGL 1OAZH 4OLUH 4PJHE 1P5UA 1SMAA 3SGDI 3QI9D 2BNRE 3O2DA 4ZUVA 4UV7H 5DQDH 4PRHA 4Y1AE 3MLRH 4GW1A 3WBDA 2VIRA 4PG9B 5EOQH 4NO0B 1XF2A 4LGRB 3OB0H 2J5LB 5KTEL 1XGPA 4WFHD 2NLJA 4OKVA 1MEXL 5TGBB 1G9MC 3ARDA 3Q6GH 5GQBA 4HKXA 3SQOL 3SKOA 4OZHF 1U95B 5IHUL 4GMSL 1G7HA 1Q9LB 4QYOB 3NCFB 2DI9A 3KYNB 5JW3H 1XCQA 1NGYA 1MIML 4AMKH 2AGJL 3TBSB 1M05A 2ICEB 4XRCB 5FM5M 3QIWA 1NGZA 2ICWJ 2AJXH 4PJIE 2BVQB 1UEYA 2MNUA 5E8OB 3DX6B 1R3LB 1Y6KR 3QEHB 4AT6B 4WDIB 1D5BB 3HMXA 5IQ9B 4CMHB 4FS0A 2GAZA 2V5RA 3IF1B 4HWZA 1DQMH 3L7FA 2P8PA 2R2EA 3FB6B 1BQHG 3BVNB 4HDIB 5ERWA 4I1NB 3BWAA 8CGTA 2D03L 3P0VL 3V0VA 1WVZA 1KACB 1FNHA 4HW6A 4QY8A 4NZRL 5I73B 4QHLA 5IVXB 3UXFA 2DQUL 4XPGL 1RUMH 1NGXB 5DD1L 1TQCC 1IT9L 1RULH 2DKSA 4QHKJ 3VD7A 2VLME 1NMBL 3WN5B 1KIPB 1HOCB 3HNSH 1W72A 4R4ND 4PB9H 4U1IB 3ARQA 4BFEA 2X70A 2IG2L 2XYCA 2ZUUA 4WRLA 2YKLH 3OAUH 1AFVH 1CFSB 4KK9C 3LS5L 2RQ8A 2B1AL 5GJTH 5HGBB 4FFWC 4LVOC 5KVDH 2E27L 3V7MA 3HNTH 4PRIA 4TSCL 4NUGL 4M62L 2EICA 1YMMD 1HXYB 5KZCB 4XTRD 2FNBA 4L9LA 3SE9H 4Y2OA 3KPTA 4FXLA 4HZAA 1KCRL 1ZGLP 2A6IA 2HVJA 1TVBA 1UXSA 2QSTA 4HJGB 5IB1B 5ISZD 2Q1EA 1F4XH 3F6LA 5IW1B 4WI4A 3S88L 5I1AA 3RL2B 1MJ8L 4KVCH 5DQ9B 4PJCE 1VEOA 2E3VA 4K71C 4YR6B 3SO5A 2A38A 5ID1B 3QUZD 1RQ5A 4MB4A 3MOBH 1ZTXL 2BC4B 3AS2A 1MRDH 4XXCC 5TH2B 5EOCJ 1L0QA 2GTWB 4BSVA 5HI3D 4JRYA 1DP0A 1TXKA 3Q5TA 1BBJA 2V7HB 3NN8B 3WFDH 3DX8B 2FZ3A 2NY0C 4OF6A 2FEDD 3O2WL 3MLPA 1MRFH 2EKSA 4YE4H 4CUCA 5IFJB 4LLWB 1BQLL 3TJEL 4GQPH 3L1OH 4XVJH 4QXGL 2JB5H 3LKSA 3GSWB 3JUZA 4D94A 5EO1B 2DB8A 3VFNA 1WLHA 1ORQA 5E7BA 5F1SA 4DN4L 3HZYA 4OQTA 3LRGA 4XZUA 4PRDA 4EUPB 4G43A 4QRPD 4PJ9D 5C0CE 3WSQH 2UYLA 4XP5L 4LSTH 3OJVC 3MRBB 1TETL 2LTQC 2ESVB 2OI9C 3MXVL 3JTTB 2DQEL 3LRSA 3BKCH 1A7BA 4P46A 5I1HL 1FL3B 1X4YA 1HN1A 4JHAH 1ACZA 1ZLWK 3QHFL 2X1WL 1BQSA 2FGZA 2I5YL 2GSGA 3CVHA 4WFHE 1Y6MR 5GS0L 3MMEA 3OHXB 4ZFOB 3FB5A 3IVKA 1MJ7L 1L7TL 3U2SA 1BVLA 2FJFB 3T0EC 3VDBA 1Q9KB 3F7VB 3U9UA 3ISWA 4XCCH 1EAPB 2CLVA 4WWKB 1CCZA 3TO2B 4MQTB 1N0XH 1N6VA 2Z91A 4UAOC 5KVFH 5TQ0H 1B4JL 4HXBH 3TN0B 4JHZA 1Q0YH 1EJOH 1WJ3A 5M7QA 3U48A 2XQBL 4YXKH 1XCTA 4FZ8H 1DDHA 2OJZL 3D6GA 5D7IF 2O93L 2WWKT 1BP3B 3R1GH 5EU4B 1RJYB 4Y88A 4HZLA