5IHZA

Crystal structure of anti-gliadin 1002-1e01 fab fragment
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
223
structure length
208
Chain Sequence
VQLLESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVSGISGSGGSTYYADSVKGRFTTSRDNSKNTLYLQMNSLRAEDTAVYYCAKFSRDYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stereotyped antibody responses target posttranslationally modified gluten in celiac disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords 1E01 Fab fragment heavy chain
total genus 44
structure length 208
sequence length 223
chains with identical sequence C, E, H
ec nomenclature
pdb deposition date 2016-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ihzA02
4W4NA 3T0BA 3LS5H 1F42A 4XWOD 2NY1B 1UJ3B 1HHKA 3V6BR 1AJ7L 5IT2L 2DJ4A 5JXEC 1UYWL 2VE6B 1FL5A 3ARVA 4L4TD 2H1PH 3S96B 3M8OL 1M6OB 3CSGA 3BIBX 1BFTA 2EC9U 4U1MA 4XXCC 4QRQB 5CKGA 1FBIL 1I3VA 4TOYL 4NO3B 4PJ7B 1JTOA 3VFTB 1T20A 2P44B 4FQHA 3J8F7 2XPGA 5I16A 1NANH 2H1PL 3G08B 3ESUF 1EK3A 4I0CC 5DGRA 4R4BB 4HFWB 4MNGB 4MA7L 4ODXB 4MLIA 3ZT6A 1I9IH 5JORA 4PGCB 1XIWC 4HK0A 2F54E 3WIFA 4FXLA 2B8OT 4OD1L 2PYED 3FB5A 2XWTB 5JXAL 4JPVH 1L9NA 2VQTA 4IOIA 4JCLA 3MRNB 2F54A 1FP5A 5IB5A 3PE9A 2I9LB 4JY5H 4WW2B 5FGRA 2Q7NA 3RDTD 5J0BA 2FJGB 1KLGB 3SGEH 1LO0H 1JNJA 4K3DH 3BAEH 2DBJA 3WNOA 2K9UA 1OTSC 5T1DL 4KRPB 1IAKA 2D7QA 3MJ9H 1MCWM 3C9NB 5IROA 3S3PA 4HBCH 3MUGA 4E5XB 1GGCH 5D7KD 4NQDD 4QWWD 4JN1H 1IL1A 3RIAK 3RVWC 4ZFZB 1J0HA 4E41D 3FRPA 1OAZL 5ANMB 3O3AA 4HIXH 3VU2A 5HYSB 4PLJC 3OKEB 2J5LC 2QV2A 3OL2A 2GW5A 4D9LL 4LHUG 5DJZA 3CZFA 5IM7A 3B9KD 1NEZA 4L4TE 1M7XA 3NAAH 5KSBF 1L6ZA 2I60L 1N59B 1QBAA 4HT1L 1SYSB 3GBNL 4R2GB 4FZEH 4MS8C 4NRXB 2KUTA 5TGBA 1Q9OB 1EVTC 3UO1L 4QGYA 3MOAH 3GIVA 1G9NC 3IDNB 4O00A 1CTOA 4F9LA 5CUSL 1UA6H 5C0EA 5EBMA 4GLRH 1GGIL 1X4XA 5CBEA 4LSUH 5H35B 3EJYD 1HWHB 2XTLA 3PL6C 1U8IA 3CDGB 5IK3A 3KAAA 3UZQA 4LLDB 1P7HL 1OT1A 2WNGA 4M3KB 2BSED 2N4IA 1B2WL 4WHTA 4YXKH 3UJIL 4LCWB 1Q72H 4NHCH 1OB1A 3D87B 1CF8H 4C56E 1T03H 4YDLC 1S9VB 1MFAH 4FTVD 3UX9B 2H45A 4V1DB 1D5ZB 1EZVY 5TF1L 1QSEA 3K0WA 1H5BA 5IQ7H 3HNSL 1HH9B 1F3JA 3GMPA 1MQKH 4OGYH 1A3LL 3ARFA 3I6LE 4MHHI 1RZKL 4WO4B 1A7NL 2N56A 1NEUA 4ODUB 1MCQA 1UM5H 1MCPL 4LEOB 4RDQG 1VGKA 5GGUA 1A6WH 4LLVB 3D2UD 4N8CH 2X10A 1H3WM 4LHUA 5EZJB 1OAUL 4L29A 1I8IB 3LSOB 5EU7C 2YRPA 1WJ3A 2Y36L 4ZFOA 4LSSL 5DD6B 1EAJA 2IH1A 1XIWA 1OAQL 5C08A 4JQVC 3WNNA 2X89D 3D9AL 3BP4A 5F9JA 1T1WA 1RIVH 5SX4I 2CUHA 1ZEAL 1G7MB 3FO2B 3LRHA 4YGVA 1WUNT 3FO2A 4HF5H 1UFUA 1CR9L 3QHFH 4IHOB 3VMOA 1ZLWH 1G9NH 1WT5C 2IC2A 2R1XB 2ATKB 2DMKA 2BXZA 3WS6A 2YD5A 2H8PB 4UTBH 1R3IL 1T89A 3D85D 3NCCB 4O2FA 1NCTA 2GK0A 3RWGA 1SY6A 1Z0NA 5IVXB 4PBXA 1NCCL 4H1LA 3A67H 2G5BA 5F89B 2Z31D 1BF2A 2FYYB 2OJZL 3A6CH 2X1QA 3O2VH 2B4CH 2CK0L 5B39G 3MJ7A 1VKXA 1CFNA 1WFTA 1GOGA 3A0OA 3BYTA 5E6IA 4YNYA 4CMHB 5JIPA 5GS1B 3P0VL 5F7WC 1D5ZA 5BZDB 1NMAH 5I1IH 2DL2A 1DUZA 1RUMH 4ELMF 2F58H 3BKMH 5J13C 1MAML 1GC1C 3P0GB 4WUKL 3RPKA 2RJMA 1DEDA 5BRZE 3UTSA 1C7TA 2CDEB 3W39B 4OCSH 2VLKB 5GZND 3EYSL 2W0LA 2DAVA 1D5IH 3TJEL 3HE7A 4DN3H 3GMQB 4HWBH 4K8RH 2X7LB 1QP1A 1LK2B 4QTIL 3CMOH 2VAAA 4Z6AT 5SX5H 5SWZB 3VD7A 1AFVL 4FTVA 2NY3B 1FCCA 4CGTA 2VC2L 1J8HD 1NCAL 2FZ3B 3AFLA 3PWUB 4HS3A 2MMXA 1MCNA 5IR1B 5JW3L 2X2YA 2UY7A 2VZTA 3VFOB 4F33A 1P4BL 1I1FB 5HHXH 1NKOA 3MFFA 4TVPL 3SJVE 3RWEB 3MA9H 3G6AB 1CZ8L 3Q1SL 1Q9LA 1I7TB 5JW5A 3NIFF 1I1YB 1MFEL 4JFFD 5FXCH 5KSUA 4NQXA 2B7DT 1WC7A 3VWKA 3EIFA 5BVJA 1PGRB 3NFSL 1PG7H 5DVKA 1CL7I 1XR8A 5C70A 4ODVL 2FECL 4H25A 4O51A 2Y06L 3GIZH 2E6JA 4G9FA 4UDUA 4WVRA 5I30L 3RA7L 2VR9A 4YX2L 3U7WH 3F12A 1J5OH 3TN0A 1MFBH 4FQ2L 2AJYL 1LVEA 4H0IA 3AREB 2NCMA 4R7DA 4GBXB 2ADFL 2DD8L 4TQEH 4LCIL 3SDCB 2MCPL 4LKCB 2OMBA 3S36X 1HNFA 2A6JA 3U4EB 3KG5A 4MCZB 4TNWK 4I0PB 4Y0GA 4ZXBC 5C0RH 4D0DB 2EICA 3OR6B 4YBLB 4CW1A 2Y1VA 4Q58C 3RL2A 1AXIB 2CDGB 4QHMB 3W0WE 1K6QL 1JFQL 5HGAA 3ALPA 2JB6A 1S5IH 3PWPE 3SKJH 2UY6A 3O8XB 4WNQA 4KDTA 2YXFA 2Z4QA 4P23A 4JO2H 4MVBC 4EUPB 4I2XE 3G6JF 3I3DA 2NY2D 3OKLB 4FS0A 5GZOC 3UTZA 2BOBB 5T1LD 1M7DA 4S2SA 1QLRB 1I85C 2QSTA 4CKVX 1RJLB 5I74B 5E08L 4N90E 2IPUK 4OSUH 2X5PA 2W1NA 1PX4A 3JWDH 4QF1B 3BZFA 3IKCA 4P59L 1QD0A 5TDOB 3ZTNL 4XNXL 3ROLB 1PZ5A 3BJ91 3OKEA 4HJGA 1ZT1B 2HJKB 4DTGH 5J13B 3EBAA 1U91A 3VXME 2X05A 5BXFA 5JOPD 4JPWH 2IAMB 4Z0XA 2CD0A 3QDGE 1AC0A 4PJIE 1UVQB 3GJEB 1ITBB 3KJ4B 1TIUA 2DMCA 4F37F 1DQTA 4UIMA 2G5RA 4M7LT 2PCPB 2FNBA 4NKIL 3GMNB 3UJTH 1FFPB 1YYLL 4RRPA 1L7IH 3S98A 1LE9B 3TN0B 3B5GA 4AEIH 1SM3H 2PYEB 3WO3B 1LDPL 1YYLH 3RKDD 1NDMB 3BGFB 1H15A 4EN3A 3MBEA 5L2JB 4ZQKB 3UPRB 4X5LA 4JFFA 5E2JA 1BZ7B 1K8DA 5DC0A 5ITBL 4MNQD 1KCRH 4OQTA 5GGTH 3PWLA 1QR1B 2VDKH 1PSKH 1G7PA 5CMAB 1N8ZB 4NQDE 3LV3B 3FZUC 3K81A 2X41A 4N5EC 1J11A 2X9XA 5DZNA 4JHBA 1MCDA 4QRUB 1UWXK 4G9FD 5AZ2H 1WSST 1J1OL 1KBGL 3JV6A 3S5LG 1KXVC 2DLFH 4WW1A 2HA1A 2Z92A 1IE5A 4BSWB 3JVGA 4C54A 3HG1E 3AU1B 4KJPC 3U7YH 2EDKA 2BVPA 3VXOA 4RGOH 1JGUL 1CE1L 1D6EA 1TZHA 2H32A 3Q3GA 4HD9A 3GBMH 4TUJA 1ZLSL 1AH1A 3TN0C 4J4PD 4JR9L 1YN7B 2NY6B 5AYUH 1F4XH 3VFWA 5IOPA 1KV3A 1U8KA 2G9HA 5IWLC 3VXNB 2BY2A 3C8KB 3P4MB 5J1SC 3UTQB 4L8CA 1KJVB 4OV5A 4OQ1A 3GSNA 3S96A 3VXMD 4EDXB 1U91B 2DQJH 2OI9C 3ARWA 1PD6A 4OI8A 5GS2D 1RZ7H 4I0PC 1TPXB 3QG6B 3RBSA 3TBSB 1REIA 3QG6A 3VRIB 4ODBD 5JO5B 1XGRA 1NBYB 3AROA 4WIQA 4NRZA 2E7LA 4JHAL 3D3VD 3L7FB 2ADFH 3PXJA 3D69B 4HULB 2IMNA 4LCUB 3RKDC 3CAFA 1DLFL 3QO0B 4KKNA 4XVTL 1J5OL 4Q97A 1WBYA 4WEMB 3S3SA 3WUWG 3RA7H 4K23H 2Q20A 3QNYA 1TCRB 4P23B 4RBPH 5EU4A 5DEFB 4YPGB 3BO8B 3M1BB 4DFHA 3BO8A 1KIQA 3EOAA 1OP3H 2YA1A 1CFSB 2VZUA 1NLBL 1KACB 5DVLA 3STZB 5L7XL 5BZWA 1CGYA 3OGCA 3GGWA 3MRDB 2GT9A 3TCLB 2BSRA 3AY4C 4N0UB 4U3CA 4EIZC 4ZUVA 3O0RL 1LEGB 3BH8B 4H8WC 3FQNB 1MFEH 4APQB 3FQNA 2NY3D 2NZ9C 1KULA 4RAUA 1BIIB 1EHAA 4L8DB 4X6FA 2IADB 2J7LA 1KPRA 2XA3A 3FN3A 4JFED 4R8WL 4WV1B 5FO7B 3DVFA 4OCMC 4PG2A 1KCSL 1CXIA 4L8BB 1A9EA 43C9B 4JEGB 3VFMB 1X6NA 1S7QB 2EXWC 2E7BA 4NZUL 1NGPH 5F7LB 3RL1B 4E42A 4XNQA 1IGFH 3LZFH 5ILTH 2Z93A 1F00I 1KXQE 2VXQH 4S0SD 1W0WA 3QO0A 2OQJB 4J12A 4KDTC 3OX8B 4HS8L 2DOCA 4RX4D 1KJ2H 1X5ZA 3WSQL 3QPXH 1A6TB 5CHNB 5HYQA 2V2TA 1NCDL 2WWKT 4IOIB 4N1EA 5HI3D 5KSVB 4LAJH 4WWKC 5BRZB 5C2UB 1CGUA 3C87A 4LLWB 1QRNE 2PTUA 1CBVH 2OR9H 3L6FA 4N1HB 1T5WA 3MRQA 2A6DA 2VR5A 3BDBA 1AP2A 1QVOB 4OD2B 3WS6C 4QKXB 3LS4L 3AMLA 3GUTA 1BX2B 1ZLVH 5FUOH 2LQRA 2DLGA 2FZ3A 1R5VA 4NP4H 1F4YL 1UZ8A 4OLWL 1S78D 2FYYA 3T1FA 2JK5A 5FB8A 1YEGL 2HTLD 1BFSA 3PHOA 2BVPB 1I7UA 1KIPB 4WHYG 1IKNC 4GMTL 3HZVB 4NWUH 3RTQB 4E0RB 3ES6B 1KYOK 2XV6B 1F4HA 3BP7A 5F8QC 5GS1C 4QTHA 4AL8H 2O61B 4R26H 2B1AH 4JG0L 4Z5RA 5TQ0H 4C56A 1S78C 4RISL 4F7TB 2FX9L 2NY7L 1FAIH 1A7PL 3O41A 2H3NA 5ICYA 3LKQB 4CU8A 2B2XH 3HUJB 3HZMB 2CLZB 2RCSL 5INCA 4HUXB 4O02H 4NRXA 4FNLL 1T1WB 3FN0H 4UTAH 2NY4B 4R0LB 5JLZA 5I19H 3CVHH 4DAGH 1AGDB 4FQQA 5ETUA 2A77L 5T33L 1IKFH 2HFEB 3O2WL 3KYMB 2GJZB 5E8PA 3KYMA 3HMWH 4M7KL 1EO5A 1OWWA 1KJ3L 4G5ZL 1TZGL 1BBJB 5DRNA 2P48B 3QUXA 4OAWB 3QUXB 4O2FB 4LVHC 2VZOA 4IOFD 1CK0L 1MI5E 4HIJA 4KKCD 3CVHA 1BIHA 3LEVL 2P24A 3G9VA 1DUYA 1T2QH 1P69B 3AXLA 4PJ8A 3V6OE 2NW2A 3AXLB 4PJ8B 2PXYA 1FVDB 2IBZY 4J3VA 2J5LB 1OCWL 4L9LC 1N7ML 3UJJL 3U6RA 3DXAD 4G7VL 2UUDH 3U4BL 4KXZH 1PKQB 4H26A 5D6DC 32C2A 1EHXA 4YDVA 2FHCA 2J6EA 3FQUA 1BD2E 1F3DH 5EFIA 1DCLA 5T3ZE 5JOEA 5FB8B 4G8GE 3S4SB 4XPGL 3VRLF 5F1NB 5C86A 2HYMA 4YXKL 3UJIH 1AR1D 8FABA 2Z8RA 5HDQH 3D25B 2X4RA 1JE6A 4HDIA 1S9WA 2PN5A 3PL6D 4YEEA 5LJYH 1AHWA 1S8DA 1GGIH 4D3CL 2QSCL 4OZIB 1DBJL 5L8KB 3H9SE 2J3SA 4LKXB 1A4JA 3RI5K 2OQJA 1YEGH 1BEYL 2J88L 3NZHL 3EYQD 4P2RE 1RIUL 3OKNA 2WZPD 3MOAL 4MDIA 2YPLA 2R0KL 2FHFA 25C8L 4D3CH 3QDGB 3OR6A 5ERWB 1Q94A 4TSAH 5DFVC 1VACB 2VDLL 2I60H 1MF2H 3DI2B 4R0LC 3S6CA 2ESVB 4JFPB 3HR5A 4ZYKB 4PG9A 4JKPL 3VGAC 4MYWB 4AG4H 3BDYH 1GIGH 2PW1A 4ZUSB 3ZE1E 5ADOH 1JZ4A 3VD3A 1QFWH 4ETQB 2IG2L 2UUDK 4XMKH 3IU4H 1MFCL 2CMRL 2WIIA 4XCYA 4XC3H 4Y4KA 5KVEL 2EC9T 1AGFB 1IAIH 2DBLH 3R0NA 3B43A 3GFUA 3SGDI 4XVSH 5BV7H 2LTQB 1JGEB 3RWJA 2R29L 4V1DE 2GKIA 2X4QA 3EW3B 3VRJA 3INUH 3MLZL 2O61A 1DDHB 2VDRH 5JHDB 4KQ3L 5T1MB 3KWWB 2AW2A 4F7MB 2QHRH 3KXFA 1KIRA 5EUOF 4MAUH 1YY9C 3SCMC 4YHNB 4KVNH 3UTPD 4HWBA 4P2OB 5CILH 4MXVF 5DJ8B 1ZA6B 3MPCA 3ZKSD 6FABL 3S4SA 1Q94B 2DWDB 4N68A 4NQED 1CGXA 1H0DB 4OGAC 3WCYA 5JXAH 2IPTH 4BFIA 3P73B 3HI5H 3O3BA 1OGAD 5LGJB 1GJIA 2UVFA 1FO0A 1EVUA 4NQVA 3RNQA 5BZDA 2QKIB 3WLWD 3GSXB 4I9WD 2A83A 5B39B 1ND0B 3K8LA 1NLBH 4HFWA 5CZKA 1LE5A 2FX9H 2HH0H 1C16B 4MDJA 2JK5B 3RWIA 3U2SB 4PBVC 4GMSH 2NYYD 5L6YH 3OPZH 1H3UA 2W0FB 4XNUH 3WLBA 4KKLC 2ZSWA 3JTTA 5JXED 4M8QA 3ROOA 4NT6A 3T2OA 4L5FH 3WFDH 3E0GA 2DKUA 5JUEL 1R3LB 15C8H 5C8JA 4OCLC 1YJDH 3BN3B 5I0DA 4GW1B 3VMPA 32C2B 5J11B 2V5RA 5D71L 3C6SA 2DQHL 1K3ZA 5FUOL 2GITB 1T5XA 4ERSH 5HD8D 4U6XB 2IAMD 1U8OB 4GW5B 2R8SH 2X4PA 4PPTA 2YPLD 3AS0A 4WI7A 1BVZA 5EG6C 4CADA 5TDPA 3PP4H 4YHKL 4N0UE 1E0OB 1QSEE 3T3MF 4P23C 3OJDA 2ESVE 4ODWB 2NY5L 1H3PL 2PYEA 2X4NB 3MREB 4U7KA 2CIIA 5GSVB 3BJLA 1NUFA 3DV4B 3O4OB 4ZPVB 3HCVB 3GJFK 3VWKD 4RWYH 2FWOA 2ZG1A 1WEJH 1JNHA 4LCCB 4Z7WA 5FHAH 2VUYA 1R0AH 4NCC2 4OLUL 5IB5B 3I6KA 2AQ1A 4LFHD 1MWAB 1AP2B 1QVOA 2W9EL 3DGGB 4UU9B 5B3NA 3VFPB 5C07A 3V6OC 5K9QG 2APWA 4PJIF 3TPUA 3MBEB 5ITBH 2WP3O 5IVNA 2Q3ZA 5DD5L 1CICC 3BW9A 5IW1B 4MJ5A 4Y88A 2X09A 5DHXB 3UXFA 2BRRL 4PJIB 1RUAH 3SDDA 4NNPL 2BRRH 5LWYL 1L7IL 4R2GC 3WD5H 2FRGP 4FP8L 3E2HB 4P5TD 4QHUA 3CFIC 4PJCF 2A74A 3CCHB 3BKJH 5IKCA 5A2JH 4XB8A 1MJ8H 4XWOC 2JCCE 4F9LC 1H5BB 2PETA 3CU7A 3LRGA 4S1QL 4HZLA 3WJJC 4PJ5D 3S34L 5IFHL 3EHBC 3GMRB 1I8LA 3DRTB 4HKXB 4JPWL 5C0GA 3U0TA 3G6JE 1GVIA 1D6EB 4V2CB 4Q6IA 4XVTH 3IJHA 5K33A 3OAZK 5FHAL 5C0BE 3EJZD 3QAZB 2R1YA 1EXUB 4Y4HC 4Q0XH 5BOZG 1SVZA 3TO2A 3FFDB 3OHXB 3MR9A 3MXWL 5CD5D 4YHPB 4Q7DA 1BJ1J 3AS3A 4N0RA 3DGGA 3QUMB 4Z76B 4W4OC 4AT6B 3BKCH 1TTFA 4NKDA 5JDSA 2PTTB 5D7IB 1JMXA 2E6PA 1XCTB 1G6RL 1WZ1L 4PB9H 5C0JA 3HE6B 3U4EA 3E2HC 4LVEA 3U48A 2VDQL 2SEBB 3MV8D 2P5EB 2VDQH 4YDKH 1JNNL 5KW9H 4J3UA 4PB9L 3S88L 1YNKL 4LCUA 4PJAB 4CDGC 3MJ9A 1J18A 1T21B 3ZKNC 1F90H 1J8HB 1E4WL 1YMMB 3E6FA 3QUYC 5E8OA 1UWXH 2NR6D 3EAKA 4IDJH 3IAQA 3ARBD 2MQ3A 4R96B 3C5ZC 1ZXQA 4LNVA 4OF3A 5HYJD 2GTWA 3DURA 1JPFB 5EORL 3AAZB 2I25N 4OI9A 2ZOLA 3CDFA 2AQ2A 3FOMA 5B38A 1QQDB 3IFNL 4PRIA 3G04A 2FB4H 3F7VB 2E9WA 1OAYH 1XIWD 4PJGE 4PJEE 4MXQC 3L3DA 3VGEA 1N5YH 1OARH 1PSKL 1BZQK 5IFHH 1QKZH 5IKCB 5C08D 3FQRA 2Y06H 5MEND 4OZIF 2HH0L 3IKCB 1CLCA 3HMXL 3LHPH 3H2WA 4M7ZC 2L7UA 1T89C 4JDVB 1LO4H 3BKJL 4HW6A 3QDMA 3BVNA 2KQNA 3MACL 5D7SH 1IFHL 1SM3L 4W70A 1KN2L 5IBUB 2Q86A 3OGOE 4UOW1 2I27N 4JFEB 4OZGF 3KHQA 3QDME 4P46D 4F8QA 3UTSB 2XTJE 2X70A 3KGRA 5CJOH 1SY6L 5HGHB 3WDJA 2I26N 2XY2A 1NFDE 4M8QB 3IXTB 3MUJA 1BPVA 2OR8A 2FGZA 1IGYB 3TF7C 1TZIB 1U8NA 4GBXC 2D7NA 5CWSB 4OLYL 3FT4B 3NCEB 4F80A 4XHJD 2G2RA 3KJ6H 4WJ5B 5E99H 4J1UB 4LVHB 1ZLWK 4A6YA 4LPTA 4NM8H 4WWID 2QEJA 1A3QA 3EJJX 4LPVA 5GRUH 3RX5A 1Q9KA 4R7NB 4RWYL 4RMTA 4ZUTA 1OP9A 3HNVH 1MRFL 3MJ7B 3OAUH 5IIEA 1VKXB 4K8RL 5D4QA 3SDDB 1P6AB 1NMBL 7FABL 4OCXH 2EXWD 1XGQA 4M6NH 3QI9B 3U9UA 2NY5H 4FFYH 4PR5B 3MSPA 3IYLW 2HFGH 2WP3T 5EPMA 3SDAD 2GHWB 2VN7A 4X7FC 4JKPH 3VXUD 3ARDB 4XPHH 5DLMH 2ZOKA 2WK2A 4HGWA 3D25A 4PJEB 4PV8A 2VLKA 1NMAL 5I1IL 3EYQC 3KJ4C 3LQZB 1QUNA 4TSAL 5C0AB 1YA5A 4YJZL 5DD3L 5GS0L 1IGCH 5JQ6L 2A2QT 5DJDA 2ZCKH 5ESVA 1NGXB 3JBG7 4LEXH 4MZ3A 3WFDL 1JNLL 2VABA 5C6TH 3VXRE 1MIEL 4OF7A 1JV5A 5L2JA 3UPRA 5HDBE 3EYUH 2DD8H 4TQEL 4HUXA 2NY1D 5I0ZA 1G7QB 2FBOJ 1AR1C 4XNUL 5IR1A 4H88H 4YBLC 3FJTA 3KPRA 2XTJD 4CMMA 1RSFA 2P24B 3W9DA 2BY1A 1MUJB 2ATKA 3VDAA 3IT8D 3LN5B 2ZJSH 4TYUA 4X4XB 4OAWA 1LP9E 5I66A 1T3FA 1JF1A 1CGSH 4AM0B 1LO3L 3HNTL 3QNZB 1OSZB 5C8JB 3QWQB 3TCXA 5JA8B 4YWGH 4U6VH 2FBJL 2BY3A 2X4SB 4HCRL 3VXQA 1D6VL 2X4SA 4DGVH 4NQCA 1OAQH 5F93C 2R1XA 1WCBA 2MQCA 5E94B 1HE7A 1CLOH 2J4WH 3EDDA 2OTWA 4KDVA 1T66D 2NXYC 1XGUA 4RNRB 3N9GH 2VLJB 1CXLA 1OAUH 1A4KA 3VFSA 1TJGH 1R5WA 4WW2C 4B50A 1INDH 1HXYA 1KIRB 1TZGH 1A6VL 3L95A 5ICXA 2VUOA 3HAEA 2AK4D 3N1MC 3VFUB 4NNYA 3JUYA 1Z9LA 3QIWB 3W0WB 4XP9L 4R6UA 1RZGB 1TVBB 5HHNA 1MAKA 4JQXA 1AGCA 8FABB 2M1KA 4S1SL 5CP7B 3C5SA 4MXQD 4LSTL 2CDFA 3WFBH 3QHZH 4P4KA 4FNLH 2YEZB 5EU6D 4RZCB 1CFTB 4X99A 3HR5B 4ZYKA 2AJSH 3DBXB 1RUPH 3MRGA 3DIFB 3CPLB 3LB6D 3DIFA 4P5KA 1MAMH 4IIQB 2MHAB 4OUUA 3BKML 4K07A 2Q8AH 2O93L 5ERWA 1N59A 1YPZF 1HZHL 4K9EL 4Z77B 4I0KA 3HC3H 3MGTA 1D7FA 2HVKB 1JPSL 2YPLE 4GRWF 1K4DB 1HWGB 2EXYC 2VLJD 3CFDB 4NJ9H 1K4DA 3OKOB 1RZ8A 2GJZA 1C1EH 5E8PB 3EKCA 4HUUB 4PJCE 4DGIH 1F8TH 1Q9LB 2VJXA 3RWHA 1OY3B 1YN6A 3ULUL 3Q2CA 1KOAA 4HK3J 1EFXA 1MOEA 3L3GA 1U8QB 5I71C 2C1OB 5TPWH 1J1XH 1CFQA 4YE4H 3L5WB 3MFGB 1C08A 4H1LG 4OFYA 1JK8A 4QRTA 3P0YL 2YC1B 4DVRH 3BN9C 4JZNB 1JGVH 1UCBH 2BNUB 5FOBA 4PJ8D 1T7ZA 4WHDA 4DZBB 4CVWA 4LL9A 1MREH 2XI9A 4HF5L 3QJHA 4WFGE 3MBED 4LFHG 4OQTL 1WBZB 2IWGA 2XRAL 1GGCL 2P5WB 2Y6SD 5HHOA 1E6OL 2AK4E 4HZAA 3VG9C 1GYAA 5JIIA 4LPXA 4MQXD 5EBWA 4HEPG 1XCQA 1Z2KA 5E00A 1HH6B 3FB5B 1QZ1A 1U8PB 4J1UA 1KT2B 5E00B 3O6KH 4RGND 5F1NA 4J23A 1T2QL 5EIVA 5HHOE 4XVJH 5D2LF 2FLRT 3LN9A 4QRQA 5D1XA 3LKRB 4RMRA 3HE7B 2X4RB 1KB5H 1AD0B 3EGSB 2DQIH 1M71A 3T3ME 1BHGA 1NGQL 2C3XA 3D0VB 1T20B 2WBKA 1ES0B 1WIOA 5DJ2A 4MNGE 1MHEB 1ZTXL 4EOWL 2ATPA 3VH8G 3BPCB 1JZ8A 2Z9TA 4L4TA 5C0IA 3TT1L 2I24N 1V3KA 4P5TC 3GSOB 5AG8A 5BCAA 1WITA 4PJFA 4K3GA 1U8QA 4M6OL 1A6AA 5C0BD 5DR5L 1MFAL 1T1YA 4O02L 2HKFH 4PD4J 1IBGL 4X9GA 3HLAB 3KPMA 3FKUS 2L7JA 3VXTB 2GI7A 4RISH 4Y2DA 4JKKA 1TLKA 4HSQA 1G6RA 4AL8L 5E6YA 4UV4L 1JV5B 5AG9A 3MLYL 1MHHA 4K3HA 4QOKA 2QSQA 1F13A 4L4VE 1KNOA 5EZOL 2D7MA 4GKNA 1LEIA 4JO3L 4N0FB 1MHCA 4PYHA 4YO0B 2F9BT 1WAAF 2NY2B 5L0QB 2BVQB 3HB3D 4U1SA 4U1HA 2P45B 1YQ2A 5C0DA 4PTUB 1ZHLA 1T7YA 4QYOB 3IB4A 5JMOC 1NDGB 4NKOA 1CU4L 4OKDA 1L0YA 3BHBB 2AV1A 5B3JF 1VGEH 4MHHG 5MHSE 1AY1H 3QEQA 1Z3GH 3WIFB 1KTLA 2NXZD 3DVGA 4JDTH 4PJ7F 3ZDZE 5IB2B 2IALB 2F74A 2Q86B 4ORZC 4NN7B 1MQ8A 4PJFB 4Y16B 5BO1L 2AJXH 3RWDA 1FO0H 3H9HA 5HYQB 4YPGA 4CMHC 3RWCB 3IDUA 1OTUC 3LEYH 1FRGH 1CD1A 1S7RA 2V2WA 4WI4A 3L5JA 4LLWA 3SE9L 2KL6A 3BQUA 2ARJA 2GJJA 3NPSB 4Y5YC 2P4AB 3QPXL 4YR6A 5IFJA 1ETZB 3V2AR 1QG3A 2VLRB 5K59E 3WFEH 1FYTE 5MERB 4EI5D 4NBYB 3QNYB 4WEUD 3STBA 4BM7A 4NUGH 4MX7A 4WTWA 4IRZL 2VE6A 3FMGH 5TFSH 1IGFL 2F53B 5ILTL 1PX3A 2GTWB 1JTTA 1MI5A 3ULUC 1H3VA 1P7KA 2CJUH 3MRPB 5KOVC 4KK6C 5F6IB 1FN4B 1RJCA 2YZ1A 3P3YA 4HUWA 1WFOA 4PRIB 5D7KE 3WLWC 5AAWA 5BV7B 2MOVA 5C9KA 4M3JA 1IQWH 2HWZL 2VXTL 4R8WH 3TBWB 2HVJA 1YPZA 3CIQA 3QHTC 3V0VA 5HYSA 2Z93B 1X5FA 3W2DH 3OKYA 3UTQA 2AK1H 1BD2A 4LLQA 3B9KC 1OHQA 4OGAD 4NWTL 2X4TB 3UJTL 5C0JB 3OZ9L 3DSFH 5DC9B 2F53D 4OFKA 1BJ8A 1P7QD 5DDHB 1CD1B 5HGDB 1U3HA 3H7BA 5IG7B 3S35X 2D7OA 5DURD 4EI5B 3TH2T 3WDIA 2FD6L 4KRMB 5C0BA 2ERJB 1IGJA 1OSPL 4F9PC 5CP3A 4ODWA 2AEPL 4NO2A 1DEEB 5E6ZA 3AM8A 5J12B 1IEAA 5EIIB 3QUKA 3WFCL 3O4LB 3ARGB 4OT1H 3RNKB 1E4XL 3QUKB 3CSBA 1PG7X 4KMTH 4KTDH 2OCFD 3MCKB 5GHWL 4WFFE 1B90A 3LS5L 2B5IB 3VXUE 5GRJL 2E8YA 4MJIE 5GRZA 4LP5A 3WIIL 1QFWI 3AS2A 1ZK9A 1TTUA 3IFPB 4CU6A 4L9LB 2ZUTA 5EN2B 5A3ID 4HGMA 1ZMYA 1OD7A 4FTVE 1NAML 3CVIH 4XRCB 3VFNB 3DV6A 4JO2L 4DUWA 3E1F1 1WBXB 3EO9L 4H8WL 4QXGH 4LHQB 2XKSA 1U8LA 1J0YA 1MHHB 4QOKB 4P46C 4B7LA 3ILQC 4YUEH 3WXWL 3DYOA 3TYFA 1MCRA 1UB6B 1AI1L 5J3HD 4N5ED 3LH2H 1NC2A 2EECA 1FQ9C 3W39A 3TWCL 2K7QA 3FFDA 4X9FA 1EA9C 5LBSL 5SWQB 1A7RL 4HMDA 4LK4A 1WIPA 3RJQB 1H8SA 5I1JL 1HHJB 2EE3A 5B39A 4E41B 5D5MA 5CIPA 3ILQD 3PGFL 5D7JA 1TVHA 5J4MA 2YPKB 3BHBA 1WWAX 3DRTA 3QEHB 3VRLE 3RVTC 5JORB 2VIRB 2OZ4H 5J3HC 4RAVB 4M5ZH 4ZPVA 4RBPK 4D0DA 5I74C 2AXJA 3DYMA 4GAGH 4RIRB 1CLYL 1OVZA 3R1GH 3WLBB 2EYRA 4YXHL 3VGGA 4UZGA 2Q87A 5A2FA 3BQUB 4NO5B 1PG7L 1X5AA 2EIBA 2RAMA 1GGUA 4HLZH 3MX0A 4LARH 4I3GA 4HUUA 2OMNA 1FFQA 5HVFB 1D9KB 2ADGB 4ODTH 5IVZB 1CD0A 2R9HC 2GSIB 1CZ8H 3QQ9D 3S35L 4PY8J 1XR8B 3MA9L 4U0RC 2CR3A 5AWNL 3GMLB 4PRBA 4N0YL 3IRZA 1FH5L 4HH8A 3LVEA 2UZYB 2Y7QA 3RAJL 2V2XB 4QRPA 2O5ZH 2ZPKL 1E6JL 4XCFH 2YC1A 5DQDH 1OGTB 5T5FH 5JW5B 4DTGL 2VLLA 2R2BA 3CFJA 3QIWD 3ZTNH 4I2XA 1F2XK 2NY1C 3KWWA 4J7RA 4G6MH 2BSSB 3V79C 3PHSA 5EBLB 3DARA 4KTEH 3MJ8A 4YK4B 3ZDXE 1MPAH 1OT2A 2NX5A 3HUJA 5T5NG 1KIUA 4KTYA 5IESH 2AJZA 3KR3L 1K2DA 1S7VB 2XQBL 2Q6WA 5TE7H 4PJAF 1FYTB 4LHUB 1FVEB 3IJSB 5BRZD 2NX5E 4XBEL 1YMHA 2IGFL 4KRPC 2FIKA 4JM2B 1JL8A 3F5WA 4NYLB 3WL9A 2VOTA 3D39D 3L3OB 3ZHLA 6CGTA 2DQCL 5HGAB 1MAJA 2ESVA 2VAAB 2VLKE 3GB7B 3K2UH 5ISZB 4RSVA 3KLAA 3Q6FB 4XP6H 3TA3B 3TVMC 3IJYA 2F58L 1IAIM 2EDQA 3SE8L 5C92A 5CCKL 4X6CB 5IMKA 3QDGA 4B5EA 2B5IC 1L9MA 3GSOA 1DLHA 3PWUA 4XAWH 3D0LB 5D93C 4YFEA 3HC0B 3P0VH 5D2NA 3SE3A 3ULSA 4D0CB 4OZHE 2OJEB 1M71B 5E2UL 2YPVH 2QR0A 3E8UH 2QR0B 3O2VL 2N7AA 1FGVH 3SJVD 3HZKB 1LO2H 5IBUG 3KXFD 3U6RB 2EH7H 5FHBL 4XMPH 4FQ2H 4YFLI 5CSGA 2EYSB 3T2NH 4JFFE 1EJOL 1S9XA 5EC2A 4WTXA 1FSKB 3FFCA 3JVGC 2VH5L 4Y4FB 4LSPH 5MP6L 3MUZ1 3KS0J 4RGNE 1I3RA 4YEFA 1Q1JL 2W9DL 2EDYA 3N85H 2QHLA 4PJ7E 1KB9J 3H9ZA 2V5SA 2JELL 3CSPA 4LNRB 4XP5H 3QPQD 1NGZA 4MZ2A 1RIVL 4DCQB 5KZCB 4P23D 1LEKB 5HDLA 2ICES 4JFZL 4PD4K 2VXUH 4Q9RL 3DETC 4P2OA 3FQWB 4OTXH 1EBPA 1LP9B 1W72H 3HG1A 3C6LD 3VXRB 1KENL 2UWEA 2XTJC 1DLHB 4PLKC 5IFAL 1HNGA 4HJ0D 1EO7A 1MFNA 2YPLB 5FYKE 2A6IA 5CP7A 5CINH 2ARWA 4LRIA 2Q6WB 1NGYB 1NCUA 2UWEE 2XOTA 4K9EC 5HTSA 3MRLB 1Y0LB 5C6WH 1A5FL 1CFTA 1Y0LA 2W9LA 4KHTL 3TVMD 1AQDA 1W72B 3P11H 2VLKD 3NN8A 2MPAH 4R9HA 5DRNB 4HG4K 3NFPB 2LFGA 4TULH 4KK5D 2MHAA 4KJWD 3HNSH 5CLWA 1G7QA 1T5XB 3MV8B 3QJFA 5MEOB 1ERNA 4O2EB 1BQHG 2BVEA 4OLZL 5IP4A 5E7FA 5FFLA 3B8YA 1T7WA 3BPOC 5HVHC 3ZMRA 4BQ8A 4PUBL 3GMLA 5KN5B 2XZQH 2XQYK 4O2CB 1Q72L 3O6FA 4IBLT 4W4OA 5IFAH 5CD3A 1ORSA 2DLEA 5KOMC 4JN2B 3QIBC 3SKOB 4OB5H 4TUOB 2GJ6E 2JB5L 4PJGB 2F5AL 3MO1B 3PDDA 1YC7A 1CLZH 3REWB 4D9RD 3HAEB 4IJ3B 4NNYB 4W6XB 1ZLUK 1MY5A 4FFVC 5JOPE 2GJ6A 3KYOB 1GGBH 3IRPX 1M05A 5E6IB 5KS9F 4TVPD 4ZFZA 3QDGD 3WN5C 4KY1L 2AXGB 2V6HA 3BN9D 3MUY1 4LVOC 3X11A 1WTGT 5IMOB 2DM3A 5FOBB 1GCFA 1O0VA 4JM2A 3OQ3B 1OTUD 2DQUH 3JZ7A 3WKMH 1S3KL 4GJTB 5JZ7C 1UXWA 5DD0H 1JI1A 4DK6A 3EDEA 3V5DB 2H2SD 2UYLB 1KYOJ 3BPOB 5HVHB 2DQFB 3IAPA 1YEFL 5ALBH 1UH3A 2H2PC 3ARED 1A3RH 1TCMA 5INCB 1G9NL 1E4KC 3EYVA 5HHVL 5CJBA 2AK4A 3SDDD 2EEDA 2ICEB 4GQPH 1KB5B 4HXBL 3TWCH 2V17L 4PBWD 2R1WA 4JFDB 4JPIB 2NY4C 4U1KA 5JOFA 1INEH 4R4NC 2AVGA 2DQEL 2H26A 5FKAB 3VA2C 4EN3C 5E9DE 4ODXA 3WO4B 1C5CL 3O4LE 5IB4B 3SPVA 5AD0B 1K9TA 3C2SA 3TO4D 3IGAA 3CFEA 2DWEB 3T65B 5DFVD 2AABH 3U36B 3EFFB 3HG1D 3N0PB 1JHTA 4ZTOL 3UYOD 1IKNA 2XQBH 3L3IB 1IAMA 5BV7C 2FEDC 1T83A 4JPKH 4U1IA 1SEQH 4HJJH 5C0AA 4JPVL 3WIIH 1RZIB 5FK9B 2BFVL 3SE4A 4Q6YA 1RZKH 1TMCB 4KTEL 4LNRA 2MJWA 3SKNA 4G3YH 2A9ML 1JPST 4NKDB 1XIWB 3K4AA 3CZFB 5C0AE 4KMTL 4L8DA 1DN0A 1H5BC 3KNBA 2BHZA 4F57H 3TIDB 3KS0H 3EOBB 2GITA 3ELAT 1I9EA 1CIUA 1RURH 1UQSA 2R1YB 3PGCB 3TBSA 3VRIA 1A64A 1FNLA 1U3HB 2VN4A 1AD9A 4JRYD 4XX1E 3K4ZA 3MMEA 4KUCD 3T09A 1QEWB 2VDML 1TVDA 5KZCD 4L1HA 2YWZA 1J8KA 2Y9RT 3CXDL 2CSPA 3OZ9H 4ODTL 4OLXH 3B9EA 4NWTH 3TBYA 1AJ7H 1XEDA 5D7LE 1R24B 1FNEB 2PNDA 5EC1A 4PLOB 5KANG 2ZUWA 5DJ0A 3RZCC 3U0PB 4NQTA 4AQ1B 4X0KA 1GHFL 4XNYH 3IDMA 3JTSA 5DGQA 3MRNA 2IBBA 1HQ4B 3BIAX 4EXPX 3DSNA 2CKBL 1V7MH 4ZUVB 2I9TA 5LG1A 5HSFA 4QRUA 5E9DD 3BGMA 5GGRA 5GGSA 1XF2A 1BIIA 3O2DH 4IOSD 1IC7H 2VYRE 1RUQH 1M6OA 4JY6A 4BSWA 4KKBC 3PNWB 5DSCB 4YO0A 1I9RH 3MRHA 3FB7B 2PR4L 4F7EB 2ADJA 4Y1AA 1B0WA 1RZFH 3ARDD 1IT9H 1JHLL 3HFML 2X4QB 3MLVL 4WI6A 1A1OA 2NPLX 4GRWE 4A6YL 4DW2L 4P5TB 1TVHB 3GSWB 3S36L 1HEZA 2COQA 3BPLB 2E27L 1IEBA 3EDFA 1AY1L 4OM0L 3KPSE 1GAFL 2RIKA 2CLZA 2WBJC 1VPOH 3QH3A 4IRJB 1KELL 4IRJA 2ZSVA 2YD9A 5F7HA 2DICA 4NBZB 3LKOA 2VL4A 1LE9A 1MWAA 1GOFA 3P9LB 4C56D 5D8JH 4HH9B 4S10A 4M48H 2Q7YB 1E4XH 2WUBL 2JJTC 4Y5XC 3WFCH 4EN3B 3V7AE 5J12C 2AEPH 3VFNA 3ARFC 4OBRA 2R56H 1PJ9A 4PGEA 1I7ZB 2I5YL 3O45A 1FNEA 5EC1B 4DWHA 3G5YB 2NXZB 4PJFF 3VG0L 1ZT7A 4PREB 5I8EB 2MKLC 4KV5F 4LDEB 5I8EA 3ULUF 3PF2A 2GUOB 2XXCB 3X11B 5KG9A 5F88B 5IB1B 1IC1A 4FHBD 4HQQL 2Z91B 5A16B 1TQBC 5IBLC 1MNUL 1NFDF 2FSEB 4LRNH 1JZ6A 2FDBP 1MCOL 5EOQH 1SQ2N 4WGWB 3RGVC 3Q6GH 4ONGH 2DMBA 5CEYB 4KV5E 5ENWA 2AERT 1NSNL 2HRPL 5EFIB 2YOCA 3BP6A 2QQQA 4JGJA 3SKUD 4ZTOH 5JPMA 5HGDA 1HKFA 1U6AL 4P0DA 5F8RC 4D9QE 3QAZC 1S7WB 4Z7OF 4Z7UB 3PWNA 2RGSA 1UB5B 3V0WH 4LF3A 4GKZA 3VGFA 3D0VA 3UC0L 4A6YH 1J0IA 3SDYH 5F3BA 4NKMA 4PTUA 2QQNH 3I6LD 3X12B 4R7DB 2EDXA 3ZHKA 3GSNH 1FVCB 1FZOB 3EUUA 3KPSB 5F9WB 1G7JA 2YRLA 1INEL 5IB3B 4J6RH 3WFHB 4MDJB 4HXBH 3HCVA 5ID0A 4LLYA 1PDKA 3V4UL 2NY6C 4XCEB 3AY4A 7CGTA 3TYGH 3FONA 3ULVL 3B5TA 5ELIA 3IDMB 4FZ8L 2JJVA 4YGAB 1UWGL 3CFDA 5IW3A 1UEYA 2ZKHL 1P7QA 5TPWL 4Y1AD 4HWZB 4J8RA 4PRNA 1VGEL 4Y4FD 2VLME 3MZGB 3ZO0A 2I9TB 2CLVA 2ZG3A 2O5YH 3RWHB 5BS0A 4QO1A 1PZ5B 4L8SB 4GKSB 1VA9A 2X89A 3DX7B 4O2EA 3C60D 4NQEB 4PJFE 3SDAC 2BERA 1ZGLP 2AJ3A 4WFED 3T4AB 4PRPD 1W0VB 1TVBA 1JPGA 5FYKD 1NAMA 1X5YA 3ZE0F 1GGBL 1AD9B 3MGOB 3RDTB 3U1SL 1XGPB 4ODSL 4FQXB 1JPSH 2WMPA 1FZJB 3BP7B 4ZS7H 3QUZA 4GUPB 4OLXL 5D5MF 2JB5H 3FQXA 3VFGL 1FC1A 1UWEL 4X7DC 2WBWB 3BGFC 3CPLA 4LSVL 2HKHL 3OAYH 4FQIH 4KH2A 4JZJB 5GGVH 3QFDA 2WBJB 1ZE3C 2YSSB 3U0PA 4Y5VB 4P9MH 3MLXL 4LRIC 3WFBL 1NLDL 3GJFA 5F21B 5AUMB 1Y18A 2DYPA 2C7UA 5BQ7B 3JTTB 1AD0A 4Y2DC 1LK2A 2VERN 5I2IA 2VLRA 3F12B 4N1CA 3RNQB 4CUCA 5JQHC 4NFDA 3TA3A 5J11C 5IF0A 4X9HA 2BVOB 5L9DL 1A22B 3AMKA 5FKAA 4EOWH 1NFKA 3VDBA 1T04A 1DJSA 1NEZG 3PWVB 4K94L 4PRHD 3PWVA 1HSAB 4FQPA 1DP0A 2XWBB 3QRGL 4AY0A 4LVOB 2Q8BL 3QUML 4BK4A 4YHML 1OWRM 4JZOB 4H0HB 2ICWA 2DWEA 2ZCLL 3O9WD 5DUMH 1CDCA 4Y5VC 2J4WL 1DBAL 1DQML 3LMJH 4WRLA 4R90H 1JK8B 5FECA 4PJGF 4JZJC 1WCQA 1RZIA 3CFJB 1FDLH 1EFXB 1OTTD 2YHGA 3L3GB 4WGVB 2YKLH 3KXFB 2MNUA 1A0QL 2R69L 4DKEH 3G5VB 1JGVL 1UCBL 2G5BB 4X8JB 1ACYH 3K8KA 2HJLA 2ZJSL 3P77B 4IOFC 4KKCC 4NM4H 1OM3H 1ZANH 3MV9A 2G60L 2VXSL 1LO5A 5GJTL 2V2XA 3HA0A 1HCVA 3L3OA 3MNWA 1KCUL 5TE6H 4G6JL 5BMFH 2EH7L 4NPYB 5FHBH 3PWPD 5ICZB 2W60B 5HD8C 4PLJD 2VZ1A 3SCMA 1BM3L 3L7EA 2R2HB 5IB3A 3DUUA 5INDA 3QIWA 4LEXL 4Q9BA 4NN7C 5FYJU 3SBWA 3HRZA 5EU4B 3PQYE 3TT3L 4XPFL 5DD3H 4EI6A 5GS0H 3N1FC 1Q0YL 3H42L 4OCYH 4QT5B 1KLUB 1TETH 4Z7WF 4KAQH 1WT5A 2XA8H 1ORQB 4NQDB 3LKNA 1HZHH 2O26U 3E3QE 4WI2A 3RGHA 4U6HB 1OQXA 1MJJB 4DKDC 4LPWA 3HI6H 3MRBA 3WE6A 3GM0A 2VQ1B 4Q2ZB 3QFJA 4XPTH 3FFCB 4P5MA 1U9KA 3BWAA 3TJHD 4LEOA 2R2EB 3KR3H 4TUKL 2PXYB 3ZKXB 1OPGL 1UZ6E 2DLHA 3NIDF 4QXUH 4AMKL 3QIBB 4GG8B 2EIEA 4MB5A 5C07D 5CD3B 1UT9A 4TUKH 4JFYA 1IARB 4YIQB 4KU1A 1FIGH 1IGML 4GXVH 3KJ6L 4XP1L 2ZPKH 3FAXA 4MA3B 4N9GA 4OJFH 4OZGA 4ONHB 3H8NA 2BNRE 3V6ZB 5J1AA 2D4DA 4I0PA 3ISWA 2RBLA 4HWEL 3T3PE 3ZYZA 5C3LD 1SYSA 5IEHA 2E6QA 3RZCD 3MRJA 4PJEA 5CJOL 1C5BL 5KSVA 1FJ1B 3D18B 4PJ9B 1FV1B 3MRCA 1NBVH 1P7QB 2OL3H 4M03A 3HNTH 1F6FB 1F02I 1LEKA 2FATL 2FX7H 3GB7A 1DQDL 1U41A 4LIQL 5LCVH 1ZLUH 4WENB 3QQ4A 5E56A 4BA8A 1BM3H 4NUJA 1E27A 3GMMA 4KROD 4XBPA 3BE1L 3PQYD 2R4RL 4ELKA 2BP3A 3STZA 1W0VA 2SEBA 1OAKL 4F37K 4YHIA 3UTTD 1I7UB 5ALCH 1NFDA 3IFNH 3K1KC 1JWMA 4ZFFA 2PUQT 3G6AA 3PJSA 3TV3L 3LCYA 1BBDL 1D9KD 1YPZB 1QFUH 3ILPB 3MCLH 3DRQB 3FB8B 3PV7A 3PWPB 3KPSD 2OP4L 1J10A 4PJ5E 2FEDD 3CX5K 3MUGB 4E5XA 4F7TA 3UBXI 1NC4A 1Z9MA 1N0XH 5CEYA 1EAPB 3OXRB 1FN4A 5E2TH 1GC1L 3S88H 3QCTH 4MJ2A 1JRHL 3WUWB 2H32H 3MR9B 3QUYD 4Z7UA 3GI9L 5C0BB 4JFDE 4RNRA 4CN6A 5HHPB 4OGZA 4JANB 4ZUUB 3SKMB 4FQHB 3ARYA 4AJ0A 3CFCH 4OZ4B 3C60B 2VITB 3RY6A 1KFAH 2G2RB 1AE6L 4OZHF 3QEHA 5JIKA 3D0LA 3B4NA 4P99A 4GAYB 4F8TA 5DHYA 4ONFH 5L2KB 2FEEI 3IDNA 3VW3H 4Q0XL 1JCKA 1RU9L 1T5WB 2GCYB 4HH9A 1FZKB 5E99L 4P2QA 4JO1L 4EQ3A 2ID5A 5T1KA 3VXSD 5E4EB 4OLYH 4ZAKB 3ARGC 3MODL 4JAMA 4J3TA 4UILH 1FH5H 1U8LB 5D7JC 4PGBA 4S1QH 2WWKO 4LSVH 4M1CD 4G8IB 5BOPA 4R96A 4YFLF 3QWOB 2ZUXA 4RA0C 1QR1A 4P3CH 4PJIA 3L5XH 3OGCB 4GW4B 5H37G 3UTTE 4D9QD 3H3BC 2GEEA 3RY5A 3U46A 1NFDB 2BNQD 2A0LC 2EIZB 1GL4B 1KN2H 2A74B 5SWZD 1I3GH 1JHKH 5E8DL 1U95B 1F3RB 2OTUA 3Q5TA 4POZD 5I1KH 3OKDB 2NY0C 5TQ2H 3I9GL 4WV1A 1NCBH 1I4FB 35C8L 3NCYP 1XGYH 2QADC 5F7EH 2FL5A 1B4JL 1KCVL 4YFDB 5FO7A 5I1HH 4CVXB 4DN4L 4YGVB 1KEML 4X5XB 2X4PB 1UADC 5JPMB 1A6UH 3BEWA 3X13B 1VEPA 1D5MA 3O3EB 4Y4HA 1NBYA 3AC0A 1YEDB 1R0AL 1EXUA 3HR6A 5KJRH 1YMME 1FJ1A 2GQHA 3S7GA 2HVJB 4QTHB 3KPOA 3GSWA 3QG7L 5D7JB 1KUMA 3WO4C 3LRSB 2BNQB 1CDHA 1G7JB 3O3DB 5I73B 1V8HA 2NLJA 1X7QA 3L3KA 2Z31B 1NGWA 4S0TD 1B0GA 1YYMH 1XCTA 5ID0B 4S11A 5DJ0B 5I9QB 4X6EB 3V52L 1RK1A 2DIJA 5I17B 1GOHA 2OX5A 2B1HL 1IGTB 3WXVL 2AJXL 3UC0H 2NY4D 2BJMH 4G9DB 3H3KA 3JSSA 4DOHB 4ELMB 5DRZA 4JPIA 3BH9A 4WU7B 1R3KB 3G5XB 1T1XB 2AXFB 1J1PL 1PKQE 5I1LA 3I75B 1KTKE 3SJVB 1KEGL 3KPTA 5FYLL 3EDKA 4LCWA 1RZJC 4RX4A 4Z0XB 2IBGA 5IHZA 3TESA 3GK8H 2DQDH 2K7PA 1QYGL 5FCUL 2DTSA 1FNGA 4ZD3L 1RAMA 2ADJB 4KTDL 3MNVA 4PJ9C 4XZUA 5DA0B 3W11D 1F58L 4C57C 4RGMB 3ZZ1A 4PS4H 1LK3H 4GQ9H 2Z91A 5A16A 4UV4H 2H6PA 3P9WB 1BZ9A 4UQ2B 5FDWA 2EDNA 4BSVA 2NLJB 3L3KB 3BEVB 5DJ8A 1MWAH 4AH2A 3ARFD 5I1CL 4WI8A 1U8PA 2R56L 2DN7A 4UAOB 1K8DB 1A9EB 4J3WA 3V5HA 1VFBA 3VH8A 4WO4C 1JUFA 4ODHL 4M48L 5E2WH 3WEXB 4CW1B 4G8EB 5I71B 4XGZA 4HPOL 1J0ZA 1X4YA 4K3EL 3EO0B 5DD1L 2VNCA 3NIGF 1XZ0A 4GXUN 3TT1H 3GSRB 4XXDA 2D0FA 2PW1B 4ZUSA 1I1YA 5C0CB 1IEAB 3TO4B 3PABA 4YH6A 1CFVL 1T21A 2YK1H 5FM4A 1GAFH 4KJWC 3WFHA 4FOMA 2HN7A 4KUZH 1G7MA 4U6YA 43CAA 5C0FA 1GZPB 1N4XH 4JO4H 3S36H 3RZCB 4UINH 3EFFA 3VD5A 4H25B 4P4KD 3OB0K 4P9HL 1SJVA 4S2SB 1WTLA 4X6CF 2KKQA 3ORJA 3TBTB 4JKWA 5EO1A 5KAQF 1I9JL 3CLFH 2FH6A 3RHWK 3U7AA 2PR4H 4G6KH 4WHCA 1YDPB 3WFZA 1H3PH 1HI6B 3LKSA 1N6UA 1RZJL 5EZIL 4U1NB 3D85A 4FABH 1Y6KR 3TH3T 3VGHA 1HH6A 1MI5B 3RIFF 4YE4L 2NW3B 5I1EH 5BJTB 5BO1H 1G84A 1D5XA 3O3BB 4Z7UF 4JREC 4U7SA 2GK2A 5HY9B 3BXNB 3EYOA 2EDEA 2VDNH 1QSFB 2R8SL 3DXAE 5F88A 5IB1A 1NGZB 1UGNA 1CU4H 3ULUH 1FZKA 5E6ID 3NH7L 4P4KB 3FL7A 5IMLB 3P30H 3FCTB 5EH1A 5DQJA 4DOHE 3SDCA 3L1OL 2C3VB 4LKXA 5KTEL 5DQ9B 5DT1H 5CBAB 3I3EA 4XPAH 5DJYA 4YHYB 3H9HB 3KYKH 4MDIB 4XCNB 5D2LB 4JVUA 4YDIL 4M7ZB 3HC3L 1IM3A 2CDEA 2AKRA 3NZ8A 2ICEA 1BQUA 1ZS8B 1MCFA 4GMSL 3NN8B 1G7HA 4OCWL 4YHIB 1QFWM 3GMQA 2JE8A 3H9SD 3ZYOA 3SN6N 3MOBH 4DGYL 2YN5A 3RGVB 3C2AL 2DI9A 4NUJB 1IBGH 3DX7A 3RUGA 2V5YA 5DR5H 4LSTH 1XH3B 1AGFA 4ZSOA 4TRPL 1A6AB 2IPUG 2P49B 3HI5L 1OW0C 1T6VN 3KPPA 4O5LH 4XP9H 4UUJA 3JV5A 4O51B 4K7PH 4ZSOE 3MJGX 3NFNB 2AJUL 4WFHD 4BQBA 3RY4A 5D7IE 3REWA 1VADA 3R8BB 2PW2A 1A4JB 4ZO6A 2D03L 2JCCB 5J1AB 3KVQA 1JPTL 1IM9D 4JGMA 3HE6C 3BRDA 4Y4FA 4I4WB 4MWFB 1MRDH 1HSBA 3FB6A 4M7KH 1RJZB 3EDJA 5DXWA 1JTPA 4HCRH 4PJBE 4R4ND 2EE6A 5F6HI 2H41A 4U6VL 3ARZA 3NGBB 3DX6B 4AIOA 3V6OA 5JOFB 2EDFA 2HFEA 5DHVH 2MWCA 1P4IH 1CXHA 3UTPE 3V5DA 4PP2A 5FF6B 1MJJA 2W60A 3QUYB 3MOBL 4QOKD 5IUSA 1PVHA 1V05A 1GIGL 5D2LE 4Z7VE 3QFJB 3ECBB 3IKKA 4HBQA 2AI0L 2PO6A 4OCWH 2OI9B 1QNZH 3ARBB 1OSZA 3C09B 1M1SA 1S3KH 4QT5A 3KDMA 4JZOA 5SWSD 1HIML 4EI6B 2VMFA 1EEZA 4U0QB 1CD8A 4PJ8C 3A6BL 2AEQH 4XPBH 2YBRA 4F3FB 1I8MB 3O8XA 4WNQB 2D0GA 2P47B 5J89A 4OCNC 5D1QD 1I8LC 4G7YL 1HINL 1H8OA 1PBYA 4NP4L 3WE6B 1MCKA 4BQ9A 3U9PH 4TUOA 2Y07L 5I1DA 1BECA 2FECI 1OTTC 5F44A 3NH7H 4Y2OA 1J87A 3KYAA 3A6BH 4PJHE 1RFDH 4JRYA 2HJLB 2F19H 5HDQL 1NFIA 2LU7A 3MJ6A 2WANA 4JE4B 4ZG1A 1CBVL 3IDJB 3GKWL 4UQ3B 4XPGH 5JW4M 1OOAA 4ONOA 1VENA 1UKSA 2R0WH 3T0EA 3QWRA 3QHZL 1CQKA 3BP4B 2KDGA 2O5XH 4EUPH 4X80H 2HT4D 4G6KL 1IEBB 2JJSA 2EH8L 5I6XC 1P2CB 4TSBH 4FQJL 1IZKA 1YECL 4LSQH 3U0WH 5I18L 5DJCB 4X6DB 3QCVH 2GT9B 1AQDB 1W72A 4WEBL 1FGNL 4C55A 4PG9B 2YUVA 4MJ4A 5TF0A 3B2VL 1ITCA 1T2XA 1KCSH 3GSVB 5M95B 3IJYB 3CLEH 3ARFB 1KENH 5HVGB 1T04B 1OP5K 1D6VH 3P40A 1FLRL 1ZGLM 5SWSE 1TJHH 4EDWL 5BJTA 1IM9A 2FO1A 3ARDA 3D39B 2DQTH 3CVHL 2ICWB 4JKLA 1DQJB 5ANMA 5HJ3B 2BX5A 4BFGA 4PJXE 4GO6B 4GG6F 1UJ3C 2AXHA 5ESVB 1OARL 2EDHA 2XN9E 4ODUA 5CHNA 4KVCL 3STLA 1N26A 4G80A 2AJZB 4JRXE 3U30C 3BPNB 4XXCA 3QT2A 3IXAB 4HIIB 2PO6D 1EO8H 1Q9OA 5MEQB 1INQA 4WUUD 2VZSA 2ARJB 2J1KA 3DX6A 4KKLD 3V4VL 4JFQA 3MQIA 4D2NA 2VABB 1FPTH 1F90L 2JKXA 4EDXA 2BZDA 2WWMC 2WQ8A 1KN4L 5C2BH 5KVFL 2XG5A 2Z31A 2DQJL 2EO1A 2Z0BA 1XF4B 3LS4H 1MRCL 2VDNL 3L7EB 3CDGA 2XIDA 5KSBA 4GSDH 3R0MA 5TE4H 5I17A 3K2UL 5DZLA 4CMMB 3DUSB 5DK0A 1QSFD 3G5YA 3MXVH 3O6MH 1XZ0B 2P46B 3QUZC 3U30B 4HAGA 5EZLB 3BUYA 2XZAL 4H20L 3D3VA 4N0UA 5E8NA 4FFWC 3U7YL 4PR5A 5HVWA 3BQUC 5ACMA 3BKCL 4HS8H 1CDYA 5E5MA 5IJVB 2X40A 5F9OL 1YC8A 1QRKA 1KIQB 4J4PC 3AU1A 1G6RB 4XTRD 4JHWL 3M1BA 1HILA 3MRIA 1KG0A 4HV8B 2IH3B 5GS3A 3F58H 5DTFB 2BRQA 1HXMB 3S3JA 4XC1H 2BK8A 2VZVA 1NC2B 1NGPL 4OLVL 4PV8B 3BP6B 4X5XA 3ZDYE 3BMWA 3NIFE 2O5ZL 3C8DA 4JFXA 3CFBB 3TCLA 1XGQB 1DFBH 2BY0A 1EEQA 2GTZA 3UTTA 1CVSC 4PGDA 4JFEE 3SCMB 1AKJB 1SY6H 4Z7OE 1MJ8L 4HKBB 5ENWB 5HYJE 4K3EH 4OFVA 5SX4H 5CP3H 4OF0A 1NAKH 1CL7H 1ZOXA 5GSVA 4UAOC 2A9NH 3T4YA 4TTGA 4LARL 2W38A 4GOSA 5D7SL 4X6EA 2WBJD 4HHAA 2XKNB 4HIIA 4LCCC 4RIRA 4HIEA 4KPHL 2OK0H 4KGLA 5C09B 4FQCH 2XPGB 4GAJL 1I75A 3B9AA 1FFPA 1K5NB 3F7YA 4MD5A 2A6DB 3O3DA 4ZOAA 2APBA 2YD6A 1TITA 2HTLC 3EO1B 4XRCA 4FFWD 3N1QC 2BHUA 4PIRF 5MI0B 4K7PX 2W9EH 1YMMA 1SJEB 3E6FB 5MENA 1JZ3A 3ULUE 3C60A 3GRWL 4C59B 3PIQA 3GHEL 4GQ9L 3ARDC 1BQHA 1S5HA 1WEJL 3T08A 3H0TA 4KZDL 5FUZH 1ZS8A 1XF3A 2ILLA 5F9OH 4PB0H 4IDJL 4OM1L 1ETZA 3D39A 3CFBA 4OLEA 4WDIA 4Q9QL 1J1PH 4I5BA 2FGWH 2XZAH 4L3ED 5GGSB 3WS3B 4YUEL 3WXWH 1MCJA 2E5EA 4JB9H 1GZQB 2FL5B 3MJ8B 3QXAB 5FO8A 1J9CT 4YHNA 3WXVH 2YUXA 5T1LB 5TE4L 3L3JA 5AYUL 3MRHB 5T3XD 4MMXC 5EO9A 4HAFA 3V52H 5JMRA 1JRHH 2X4TA 3FOMB 5B38B 3QEUB 5J06A 4DEPC 5D71H 5SX5K 4DZBA 1PQZB 2OP4H 4NQVB 2YA2A 3OJMB 2MFNA 1L7TH 3QUMA 4Z76A 4A2LA 3VG9B 4OZGE 1D5BB 5AZ2L 3TV3H 1MH5A 4KZDH 3HG1B 5F6IC 1MLBA 4NGHH 1CICA 5I8KH 3SY0B 1OAKH 3QQ9C 4OGXH 4J3OC 2P5EA 4JFPA 4HX1B 2R4RH 3Q0HA 1G7LA 1NCBL 2UV3A 3V6FB 4FQCL 4HS6B 1ZHKB 2GFBA 4ZTPH 3D69A 3DGCR 2C3GA 1MVUA 4PJEF 3LRSA 3GNMH 4GRMA 5E8DH 3CX2A 3CK0L 3PABB 3BZEB 1LDPH 3RVUC 4EEEA 3E6HA 2DQTL 3F7QA 5BXFB 1NAKL 4HIHB 2VXVH 1ZSDB 4LQ1A 5C0GB 3C5ZB 3PGDB 5FYLE 1FNGB 1KCKA 3MFFB 4RFOL 5DTFA 1EUUA 3L3IA 5DURB 5IVXE 3WMSA 1ADQA 4MA8H 1F6AA 3OB0H 2YMXH 1DANT 2PXYD 3B2VH 2VDRL 2FO4A 2JJWA 5SV3A 3BEVA 3NABL 4P4RA 4PRHB 5M7QA 3OB8A 3VW3L 3GI8L 3EJYC 1U8JB 4FQLL 4BUHA 4XZUB 1UM6H 4IM8A 4NHUB 5FYKL 2D3VA 1BF8A 4NKQB 1MUJA 2NXYD 4GXUM 1VFMA 3IU4L 4NQUA 1H9VA 3LEYL 4KQ4H 3LQAH 5F70A 3QEQB 5ID1B 2BXYA 4KJPD 5C0IB 1KJ2A 3TNMB 4DFIA 5T3ZH 4U1JB 3ZE2F 3QIUB 1MHPH 1U3YA 4Q2ZA 1FL6A 1Z3GL 4IEFB 4HCRA 1XF1A 5FYJD 3O4OC 3REVA 2R0LH 3IU3A 4LASH 1Z9OA 1N0XL 5D1QB 1G7PB 5C0RL 1RZ8B 3VXPA 15C8L 3NZHH 3SO5A 4HUKB 5JHDE 1UG9A 2IFFH 4C4KO 2CK0H 3VXMA 5FGCB 2OJZH 3A6CL 3BPCA 2P7TB 3N1PC 3RWGB 2GSGB 5HJ3A 4OKVB 3MO1A 3VRJB 4BSJA 3AB0C 2ZUUA 2XY1A 5ISZE 3DWTA 2EDOA 3S37H 5ALCL 1KCUH 2F54D 4Y19E 4JG1L 4HUMB 3NMEA 5CAYB 4XMLH 4X8JA 1HSBB 1L4IA 4Z7NF 2LAGB 4FRWA 3RDTC 3RTQA 4PJCB 1DQDH 1R6VA 2FJFB 1FV1A 2YKLL 4M9OA 1IC5H 2NYYC 3QXTA 1I3UA 1UXWB 3GSXA 4G7VH 5D9SA 3SGKA 1NL0H 5GGQH 4LVNB 3K4DA 5KS9E 1LP9A 4ZMAT 5EBGA 1BJMA 3T0WA 5DHVA 4U1LA 5H2BA 3K3QA 4LBEA 1VACA 1I1AB 1EFXD 4TVPH 3VDCA 4ELKB 3S8WA 3ARTA 2HVKA 1FG9C 5HY9A 2Q8BH 2QHRL 5DMGD 1ORQA 4MA1B 4IMLA 1FIGL 1IGMH 4FXGA 1QSZA 2CRYA 1U36A 4G5ZH 2VC2H 1L0QA 5I73C 3HMWL 4P3DB 1AFVH 3W82A 1PY4A 1S9YB 3AS1A 4PJBF 1IKFL 4XHJC 2XN9D 4QTIH 3T04D 3W9EA 3DRQA 3FB8A 2XRAH 2CKNA 1WAAA 3TJEH 3DVIA 1CI5A 4MXVE 5TF1H 1EAPA 3JTSB 4KMQA 3GSQB 2QQLL 2R0WL 1CXKA 2DTMH 3W81A 3B5HA 4U1IB 1DVFD 2BNUA 5D7IF 5JHLH 2DKMA 3MA7B 4HFUH 2ADIA 4XMLL 1QSVA 1PKQA 2B1AL 5K9OB 2IANE 4QCIB 3PV6A 3OJ2C 3QQNA 2NY0B 4OZ4A 3H9SA 4CVZB 1R5IA 1EHNA 4MWFA 1EGJA 2LV4A 1NUDA 5DK3A 1I1AA 4XPFH 3FT3A 2B39A 3B6SA 4MB4A 1ZGLB 1QRND 4HX1A 2F8VA 4M4RA 3UO1H 3NFNA 1RK0B 3P30L 5KSAA 1NCCH 1LQSR 1WICA 4LASL 4UOW0 1MVUB 4HT1H 3T0EB 4XPBL 2HFFA 2APVA 2Z31C 4Y2DD 1RVFH 2Q8AL 2QTEA 4QRRD 4LLQB 1IGIH 2R0ZH 1IC4L 1TCRA 3OF6A 2EO9A 4URTB 3T1FB 1T4KB 3D2UB 3O3UN 5C71A 4EIGB 1FCGA 4LLUB 3VXQB 2AJSL 4ZUWB 1YEEL 1OF2B 2NW2B 5HGGS 5HDOA 1F4WH 2R69H 2C7UB 1E4KA 3UP1A 1JZ7A 1KJ2L 4V1DA 2X7LA 1JJUA 1N64H 2BSRB 1FDLL 1NBQA 3UJJH 5EDXA 5MHSD 3F6LA 1TQCC 4OCRH 2UWEF 4FQLH 4PP1D 3PV6B 5DZOA 1G0YR 3PWJB 1Z5LB 2EEAA 2VLLB 1B9ZA 4ZNCD 1DQMH 3HI1B 1S9YA 3DI3B 3SDYL 3LEVH 4N8VG 1MCSA 4UINL 3SGJA 3C9NA 1KJMA 1ZWIB 1CK0H 1RZKC 2Y36H 3NABH 5F7FA 3BAEL 4PJHB 1ZVYA 3N9GL 1M7IB 3CCHA 3ZE1F 2W91A 3RWFB 2D9CA 5SWSA 3SDXE 4JVPA 2YD1A 1UM5L 3OHXA 2VKWA 5A2KH 1BZ9B 3O2WH 4X6CE 2FBJH 4FG6D 4MNGA 2EIDA 5IB2A 1LO3H 1A6TA 4Q6IB 1FL5B 2YSSA 4X4MA 4JFOA 4X6CA 3MLXH 3WJLC 3NCBB 1UB6A 2J8HA 2AXGA 1CF8L 4OD3H 2EYRB 5EZJA 4DGYH 1Q9KB 4R7NA 1MWAL 3QSKB 3DXAA 5C09A 4QHNB 5DK2A 3LV3A 3BP5A 4OF5A 3CFKA 5D7LB 2VRAA 4H88L 4M8VA 3V6FA 4NPYA 3IDIA 4R4FH 2Q7YA 2M26A 3MYJA 1S9KC 3BUTA 3F7RA 1CDGA 4PP2B 5FF6A 5JTWA 4PRAA 1UEMA 3MYJB 4GMTH 1I7ZA 2E7CA 5D93B 1UKQA 1B6DA 3CMGA 1URLA 2Z92B 3NCFB 1U8HB 3HE7D 3L6FB 4FQXD 5CSZB 1F4YH 4M7JH 2R0LL 2O5YL 1DE4B 2OXHA 3OMZA 1J8HA 4OM0H 5EOCL 3B9DA 5IBLD 4APQA 2FSEA 4G42A 4HKZA 3TBVB 1H3XA 2ICWI 5T3ZL 3BGMB 3HAEH 5GGRB 4H1LH 3MLVH 2ZG2A 2PYEE 4HMEA 4HIXL 4JR9H 3ULVH 3V5HB 1JHLH 3HFMH 3QDJD 1BP3B 3GBML 1EDQA 3FT2A 4GS7C 2FGWL 3G04B 5EZIH 3HZVA 1CE1H 2Y72A 4RGOL 4XNZC 1I7RB 1EHLL 4XI5C 2EDJA 3MRKB 4IMKC 2H6PB 5SWQA 2G9HB 2EDWA 4OM1H 3DVNA 5FUCE 1S7TB 1BMGA 3NIGE 4LF3B 2P8PB 3GI8H 1DBKL 2OTUB 1KCLA 3SGEI 5KJRL 4HLJA 3TFKD 2F5BL 4AM0A 1LO0L 5FM5O 4HK0B 3VD4A 3SBWC 5EA0H 2JF1A 4NHUA 3MMEB 2LVEA 4K94C 1XGYL 1OB1B 5F7EL 1NSNH 2HRPH 4MCYB 2R9HD 4Y16D 2GCYA 3UAJD 2CPCA 3HS0B 5IBTL 3LKOB 3QUZD 1HQ4A 4IRSD 3ROOB 3I6KB 5EBMB 3QXDB 1JHKL 5DRZB 3MLRH 4F7PA 1HQRB 2P5WD 4RFEA 5AZEH 2HN7B 2VLMD 1F4AA 4NQEA 1NMCB 3GO1L 1YN6B 4QHKJ 4P2RB 2VDMH 4WCYL 4K2UL 4ZTPL 5C7XH 3SO3B 4J2XA 1HHHA 2MSPA 1I85A 1QQDA 3PNWA 4WFEE 3BZDA 1DQLH 4NQEE 5DSCA 3TC9A 1EEYA 4ISVA 3FHQA 4XH2A 1S7QA 4KFZC 4RAHA 3G9AB 4UDUB 3RWJB 3BH8A 1EX0A 4TVSa 3VFRB 1P5UA 4F2MB 2WSKA 1RU9H 3L9RA 1RULL 4JHAH 4JHWH 2DQDL 3JWDL 4G3YL 3KPLA 4U6TA 3RIFK 5BVJB 4IRJC 3KPLB 1BD2B 5A2IH 2Y4SA 2DQGL 5GGVY 5FYJE 3FT2B 5EO9B 1FVEA 3VXUA 2K1MA 4H20H 4IRSB 3ZLQC 1K2DB 2QJDA 1FFOA 5FV2A 3RGVD 2PKDA 5MEQA 1S7SB 4DZ8A 4MQ7B 5JHDD 1FL3B 2FJGA 4EKXA 2ERJC 3I6GB 2BJML 1T80A 1GXEA 3C8KA 1BFVH 1KTDB 1D5BA 5I1GL 2ICCA 2UYLA 5D1ZB 4KGJA 1IAKB 2C1PB 2BDNH 1SJHA 5GISL 1MRCH 2NXZC 1AGEA 2RFXA 2ED9A 2XFXA 2XT1B 5KVFH 2WIIB 2ZSVB 4XCYB 2ZNWA 3OR7A 5DWUL 5F1IB 3UDWA 1IAOA 4HUWB 1BVKA 3IFLL 3VJ6A 3NTCL 1QFUL 1J1OH 4UMGA 5CZXD 3HLAA 4JHZA 3KPRD 3KLSA 4LHUD 3UBXB 1QA9B 3EO1A 5L88H 3MA7A 5D6DA 1OP3K 2ESVD 4YX2H 3O45B 4WY7H 4OZGB 4M6MH 4DN4H 3U0TB 5K9KB 3QWOA 4M7LH 1TENA 1A1MA 1U42A 4KPHH 1L6XA 1JN6A 1VFAB 1S7XA 4FMFA 3VFVA 2WUCH 3WD5L 2FX7L 4KK9C 2Q1EA 5FEBA 2Z8VC 5F71A 4OIIL 4H5SA 2GY5A 2OLDA 3IVKA 1N0LA 4G9FE 5D5MB 5I76A 1SHMA 1ZA6A 4UT9L 3RVVD 5DD5H 4LAQL 3B3IB 3CLEL 2D2OA 2F74B 4ZFGL 5DUBA 4NZDA 4WO4D 1UVQA 5D1XB 4PUBH 5D1QC 1NGYA 2HLAA 1OF2A 3LKNB 3QA3A 3HAEG 4JFDA 4JO1H 1JYVA 4XC1L 4PJ9A 5K59F 4XNXH 1L0XA 4H0GA 2Q3AA 3CH1A 3K1DA 4AENA 1KXTB 5E9DB 2IQ9L 4XX1G 3PWJA 1ONQB 2AV7A 5K9JL 3EYSH 3OSKA 5EWIH 4LMQE 2W0FA 1O7SA 2JJSC 1G9MC 2LTQC 5GJSH 1MEXH 4NCC1 5HYEA 4YHKH 2XNAA 1KC5L 5B8CB 1C5CH 3D3VE 1AGBA 1HDMB 3NCYS 1F2QA 3B2UC 2F19L 2B20A 3PJSB 2DQEH 4KUCF 2VXUL 5FM5M 3QCTL 1MFDL 1RFDL 1P4LB 2DS4A 3WBDA 5JHDA 4HJGB 1K4CA 1X6LA 1G7IA 1N5AB 3VXRA 5AEAA 4X7TB 3SOBL 1Q0YH 3H42H 5BVPH 2Y07H 4P48A 1Q38A 1JWSA 4X6DE 3V4VH 2ZUVA 3JXAA 2B4CL 4C83A 1A3RL 5CEXA 2MCPH 5IVOA 5DDHA 1YEFH 5ALBL 3A67L 4X6DA 1QEWA 4YPJA 4QRTB 3ZKMD 4OFYD 4U1GC 1GPOH 2ZZUT 1QOKA 4F7PB 4JANA 4WTZG 4TPRH 2BCKB 5I30H 1ACZA 4M1GH 5HYJA 2BCKA 5F9WC 5CGMA 1ZANL 2MCG1 3RVTD 5I6XB 1WGOA 5J6HB 2HT4C 1SBBA 4LBEB 5HHOD 3TPUB 4ZXBB 4GRLA 4ETYA 4MCZA 5DHVB 3PHQA 3JWNC 3DX9B 1DL7H 3ECBA 2A6IB 4HJ0C 3RTQC 4JQIH 2X4UB 5C0EB 4JFHE 4PFEA 4OFPA 3F7VA 5GS0D 1NBVL 1CLZL 5CCKH 3WV0A 4R90L 3SE8H 5MENE 3OXSB 1ROWA 4EVNB 4QCIA 1U3JA 1P4BH 4LPCA 4WHTB 4WU5B 4JJ5A 1ZAGA 3P4NB 4OJFL 4LQFH 1M05B 4K94H 3U36A 3QCVL 4WUUA 4NQCB 1NCAH 5I18H 2DLTA 1NH6A 1YECH 2WINB 4U0RB 3QYCA 5E5UB 4P2YA 4DKFL 5F7NC 1MPAL 1ZHBA 3VXMB 2HT2C 4G42B 3TBVA 1FE8H 2WLYA 1WF5A 5DVOA 1ZT4A 4G6ML 4JFDD 1A4KB 3VFSB 4P3WA 5LKNA 3P11L 1RHHB 4XVSL 1UKTA 3ZYIA 4L4VD 2A6KB 3HZMA 5C0ND 3BISA 1MFCH 2CMRH 4XC3L 3TIEB 3D5OF 4HC1A 5I8CB 5KVEH 2XTJB 5FA3B 3B3IA 4JDZA 5CS7A 3MRMB 3SDXB 1GGYA 4F33B 3BZ4B 5AWNH 1RV6X 1B2WH 4YHPA 2F8XC 1MJ7H 3L7FA 3IDJA 5HHQB 4ZAKD 3BSZL 1A1NA 2YEZA 1F11A 2WWMD 1LNUA 1KSRA 3DTXB 4R4BA 1JI2A 1SEBB 1J05A 1K3IA 3ALWA 3UTOA 2HJFB 3LN4A 2X42A 3TNMA 3QNZA 1SMOA 4KHXL 1HINH 4RFNC 4X9BA 1SMAA 5ITFB 4CNIB 4UNTA 1DUYB 1IEHA 1T1YB 2P5EE 1WCBB 5E94A 4GAGL 3ZYJA 3EFDH 1AQKL 3TBTA 4JLRA 5TE6L 3NAAL 2CIKA 2XQYG 3L5IA 1R3IH 3HHRB 1KLFA 4CDHA 1VCAA 3GUTB 1HHJA 4LLMA 5DJDB 1OGTA 1PY9A 5D96C 3MV7E 4ZDHA 3NTCH 1G7IB 3VI3F 5C0NC 5J7CC 43C9A 2YPVL 3X14B 3WHE1 4JN1L 2WBJA 1ZEAH 1J0JA 4TN9A 4L29B 5HDBF 2IPKA 4GRLD 3WN5B 3JWOH 1D5MB 1NBZA 1O7VA 3QEGL 3JUZA 3O3EA 4Y4HB 1HHGB 2YUWA 5GISH 2B4CC 2BDNL 4KXZI 1CN4A 3LN5A 5C6PB 2FIKB 3MBEC 3MJ9L 4F15C 1YMMD 4OZFG 4DZ8B 3MLUL 5HGBB 5T1DH 4Z5RB 3QQ3B 5DUML 4HK3N 1HEZB 5DJYB 1DEEA 3ARRA 1U6AH 5E9DA 4AH2B 3IS0X 5E24E 3ALXA 1A6WL 4POUB 2HG5B 1SYVA 5TE7L 2YZ8A 1MLBB 3BKYL 4YK4C 3CSYA 4PY7A 1KJ3H 4Z0BH 3NBNA 5D2NB 1EIBA 5L9DH 3Q6GL 1T1ZA 1YEIH 4OD1H 3VXPB 2AAVA 4X8XA 5DMKA 4L3EA 1TZIA 1U2CA 4O4YH 1YDPA 5T5FL 3FN0L 4UTAL 1E6JH 1AGEB 2RFXB 5KS9B 4WFFD 5KSAD 2M2DA 3QXVA 4WJ5A 3OAZH 5I1CH 5GGSY 3E6HB 2X1OA 2GSIA 3H7LA 1FBIH 2C26A 1BAFL 3LD8B 2NY3C 2NZ9D 2HTKD 5TQ0L 3CUPA 2IH3A 5EULV 3KPPB 3QEUA 1ZA3B 4M43L 3ARBC 2V7NA 5EOTA 1E4JA 1UYWH 4UNUA 4ZNEE 5DJZB 3MV7D 4PTTA 3NA4A 4M5YH 1HYRC 4ZODA 5CBAA 3UAJC 1F5WA 3QXWA 4DVBA 2CGRH 1A1MB 1TXKA 1CLYH 4Y5YB 5HI4D 3BI9X 5TGBB 1WZLA 4POZC 5DMJB 1OAXL 4M5ZL 1IL1B 4NN5C 1SBSH 4I3SL 2QQKL 2ED7A 2OYPA 1VB9A 2IF7A 4HWNA 4QHMA 3TFKC 4OD2A 1RIHH 5HI3C 4IRZH 1DBKH 1UJTA 2V5MA 4XAKE 2BOCA 4FABL 1MH5B 1CG9B 2AV1B 2J8UA 2QLVB 1Y6MR 5D7JD 5LBSH 4NQCE 2IQAB 1HHIB 2HP4A 1B3JA 5CIPH 4F7CB 5F1IA 4X98A 3B9KA 3HMXA 4NOFA 1RUQL 1OGAB 3QG7H 3O2DL 5IGXL 1CFSA 2VXQL 3TZVA 2XKNA 3ZL4L 3TZVB 3AAZA 4TSCH 1FO0L 1H3TA 1J86A 2DIBA 3IFPA 3P9LA 5EU7E 3DUHA 1T3FB 3LKSB 4L8CB 1CFVH 1Z6JT 3SGDH 4RAUB 4MD4B 4Z7VA 3U83A 3WNPA 1H3GA 3KNBB 2ADGA 3LKQA 4M93C 4M02A 3WNMA 5D1XD 4AIZA 1IILE 2DM4A 4ONGL 1QTYT 5I1KL 3ZHDA 3HUJF 1XGPA 5HI4C 1MCOH 1YY8A 1B6UA 3O0RH 5E2WL 2DI8A 4G8GA 4UB0H 2J8UF 4XGZB 4E0RA 4UIMB 3L5XL 3I3BA 3UYRH 2NMSA 1YNTB 3IAGC 4R4FL 5L7XH 1S7SA 2EZ0D 2X9WA 2BSSA 3FRUB 1FZMA 4TOYH 1Q8MA 4LGRB 3ZSSA 3VWJA 2IAMA 4ZO9A 3CDYA 3OKNB 3QXAA 2VIRA 4PGJA 4HKXA 5FO8B 3S9DB 2WAHA 5CJXC 4K23L 3MODH 2C3WA 3B9KB 3REVB 3VGDA 4CRPA 4HXAL 1T83C 4XBPB 2ITDB 4YHZH 1PW3A 4XVUD 3MRCB 4M6OH 5IT2H 3HS0A 4U3HA 2K3TA 4ZD3H 5D8JL 5LXGH 1QO3A 4M1DH 2JCCF 3RHWF 5ID1A 1HQRA 2BFVH 2J12B 1FVCA 3R06A 2VQ1A 1Q9WB 4JPKL 1MIML 5F96L 5C9JB 1RQ5A 2VXTH 4BZYA 5T3XL 2DQIL 1IGTA 5CMAA 4WWKD 1M7DB 4ZUTB 1ZT7B 4PREA 4X7SL 5KN5A 2W92A 1C08B 3L3HB 4NC1C 4ELMA 1TZHB 2H32B 4QNPF 4XTRC 5B21A 1NBZB 1QLEH 3KXFE 4GBXD 5KVMC 4HUVB 1HYSC 4F58L 3QXDA 1FAKT 3QEGH 3QJHB 3SJVA 3WFEL 5F1KC 1B88A 1R3LA 4Z78A 2V17H 4M1CC 2KZWA 2AS5M 2PW2B 5CEZD 3VXOB 2P5WA 3RPIB 3WKNA 4Q6IC 2X1PA 4I18B 3TIDA 1YEEH 3FFCD 4NFCA 1H0DA 1HXMA 4GW5A 2LABA 1S7UB 3B9VA 4GG6E 5JNYA 2FWOB 5DO2D 1B0RA 3SDXA 1P84J 1FO0B 3KLDA 3MV01 4EI5A 2R1WB 4G9FB 5E95B 3ZSTA 4FQQB 5C0DB 1X5XA 1O5DT 4LP4A 1KTDA 2VSCA 1EMTL 1RUKL 1WZKA 2XN9A 4X7CC 3UZVB 2R2HA 4JDZB 3NFPA 3CC5A 1AKJD 4JRXA 5DO2C 4PJHF 4JO3H 1U8HA 3BMVA 2FX8L 2OL3B 3RY6C 3RWCA 2CDGA 2WW8A 2Y23A 3QJFB 3T0AA 5FIEA 4M9PA 2AKRB 1VDGA 5CLTA 5F3HB 5ECJE 3QCUH 2ZSWB 5F72S 3UTSD 1DE4A 5EIQA 3UZEA 3LIZL 4HFUL 3C08L 3RZWA 2HT2D 3VCLA 4HWEH 1VESA 1RUPL 8CGTA 2DTML 3PWPA 5K9OA 1R5WB 2QQLH 3EOTL 4MD4A 5L2KD 5D1ZD 4LSRH 1U3HD 3FO9B 4X6DF 3VWJD 1JHTB 4GW4A 4XP4H 5J8OA 2CKBB 2A9MH 5DF0A 4OSUL 1YEIL 2E3VA 1EBAA 4J3SA 3BZFB 3HTLX 2X1WL 1RY7B 4DJMA 2P8PA 1Q0XL 4GG8A 4D9RE 2YD4A 2VLRE 1MSPA 5E4IA 1TJGL 1P53A 1BJ1H 4YXLH 2GJ6B 5TH2B 3C09C 4WI3A 1U93A 3LPFA 3MLUH 3FO0L 5J6HA 1FG2A 4UBDC 4U4BA 4IJ3C 4Z77A 2R15A 4BFIB 1W72L 4MJID 1FYTA 5C07E 4V1DD 4BELD 5EO0A 1E6OH 4I3RH 1CT8B 1GC1H 4Z7WB 2EYTB 3MROA 4KAQL 4YC2B 4OQTH 5GGTA 5F7UA 3IFOB 5DMKB 4LIQE 4OFIA 5DJ2B 4NIKB 4GBXA 3LOWA 5I8OL 4Y7MA 3TO4C 3P0YH 2W9DH 1J1XL 2C4FT 4ZUWA 2I07B 3BIKA 3KPNA 4DEPB 4M1GL 3KDMB 1FORH 3CFEB 4JG1H 4N5UA 4X6BA 3LQMA 2X4UA 2W65B 3T2NL 4NC1E 3S37L 1ADQL 2HT3C 1CE6B 4KDWA 3O4LD 4KI5E 4PGDB 4FFZH 1ACYL 2MTPA 5C6TL 4RGNC 1JNLH 4DKEL 5FAAA 5EBLA 1JF6A 1XR9A 4I18C 3DYPA 4QRRB 4TTDC 4JY4B 2C1OA 2OL3L 3CD4A 3G5VA 2AJVH 1KGCD 3V5KA 4PJBB 5C09D 3FB6B 5GZOD 3PQYA 4BFEA 2NY2C 3PQYB 3OWEA 5L0QC 4L3CB 2BHYA 4XPHL 3G6JA 5DLML 4XP6L 4ACPA 5IHUL 5DS8A 1FNAA 1KC5H 4K7PY 4WUUE 2DQCH 3QQ3A 2FEEL 1MEXL 4KQ4L 1YEHL 1ES0A 4XBEH 4FTVB 1K4CB 4ONHA 1D9KA 4M6NL 1YZZA 4PGCA 3QFJE 4S1SH 1LE5B 1HSAA<