5IHZA

Crystal structure of anti-gliadin 1002-1e01 fab fragment
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
223
structure length
208
Chain Sequence
b'VQLLESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVSGISGSGGSTYYADSVKGRFTTSRDNSKNTLYLQMNSLRAEDTAVYYCAKFSRDYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1E01 Fab fragment heavy chain
molecule tags Immune system
source organism Homo sapiens
publication title Stereotyped antibody responses target posttranslationally modified gluten in celiac disease.
pubmed doi rcsb
total genus 44
structure length 208
sequence length 223
chains with identical sequence C, E, H
ec nomenclature
pdb deposition date 2016-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ihzA02
3N0PB 3H9SD 4NN7B 1U58B 3BH9A 1MI5A 2F5AL 3KYNA 3PF2A 3FB5B 5CMAA 3QDME 2R2EA 3HE7D 2B4CH 1J87A 1UQSB 1U93A 3NMEA 2HN7A 1S9VB 2CDFA 2IQ9L 1P84K 2ED9A 3RWFB 2FL5A 4M6ML 2XZAH 1HI6B 2D0HA 2DWEA 1OCWL 3AAZA 2Y06H 1H3GA 3TA3C 3BSZL 5CZKA 1Q9LB 5IEKA 3FQXA 3W0WE 4WCYL 1GRWA 4MJIB 1CLZL 1I3RA 4JM4H 1FRGH 2AJUH 3PHOB 2KQNA 2OL3H 4Z7WB 1PKOA 1DDHB 1IC5L 1KPRB 3P30H 1NCAH 1U42A 4RMQA 4ZUVA 2Y6SC 4UOW1 3RIFF 4Q9QL 5F21B 5JR1H 1YMMD 1JF5A 1KIQA 1I7ZA 5I9QC 1DE4A 2FHFA 4ZODA 1JRHL 4R96A 3BHBB 4OKDA 1TQCB 4S0SD 5F7NC 1YMHA 43CAB 1CICC 1RUAL 2OLDA 4MXWH 5EN2A 4TULL 1MVUA 2V5TA 3BKCL 2F53A 4FQ2H 4QRSA 4G8EA 4XBPA 1W0WB 5SWSA 1OHQA 1X4XA 1HWGB 1OF2A 3VXMD 5I1KH 3O8XC 3SE8L 2AEQL 2HLFC 3GKZA 4LLVA 3VCLA 3BZ4A 3MYZA 5BW7C 1KFAH 4PJAE 3FT3B 1R6VA 1XIWC 4MDIA 5FUCC 4XAKE 4WWKD 1U2HA 2AJUL 1QYGH 1RHHA 1OWRM 1D6EB 5F89A 4CJ0A 3QAZB 5SWZB 1DCLA 4PJ8B 5EUOA 4UB0L 4P2CG 5JOPD 1YN7A 2XTJE 5FK9A 3QFJA 4BSVA 3S3SA 1RURH 4KU1A 4YXLL 4TTGA 1EEUA 3SE3A 4N8VG 1UJ3A 1YEFL 1CICA 1VKXA 1WFNA 3OKMA 4Q0XL 5GRJL 1TCMA 2FECI 4J1UB 1Z5LA 1DANU 4NQXA 5BMFL 4IHOA 5HHQB 2CMRH 3BUYB 4RGOH 2NNAA 5AG8A 3VFVA 4HC1L 4MA1B 1F90H 4NKIL 1IGJA 4TULH 5F9AC 4P49A 1WBYB 3SE3C 1GZPA 3MR9B 3MLYL 1GC1L 1KJ2H 5D7LB 1G9NC 2IMMA 2KKQA 3EOBB 4WWKC 5EG6C 2P45B 1A21A 4G43B 2DRUA 4HJ0C 2VR9A 1XR8A 3S37H 2PNDA 5E0QA 3RVUC 4OD3L 4LNRA 1VGKA 4GS7B 4GRWE 4PJHF 3TA3A 4F80A 1K5NB 4FQ1L 2NXZD 3QZWG 4PGDB 5C8JB 2GYSA 2NY1D 1CLOL 3BIKB 4P9HH 1TETH 2OSLB 3OGOE 1LDSA 4IDJL 1EX0A 1P53A 3O2DH 5EUKB 5BXFA 1RZKH 2CK2A 1VEMA 2DD8L 5GRJH 3UTSD 4U1HA 5T1MA 1G7JA 4JRXE 4Z76B 3MYJB 1RZIB 2R2CA 4Z77A 4WTWA 1KTLB 4GXVH 4OTXL 4NHUA 1DP0A 4FTVD 2OMNA 3RDTC 4G5ZL 4R2GC 3C8KA 4FOMA 5I16B 2VZ3A 3M8OH 1WJ3A 1FVEB 1MQKH 5DJ0A 3UC0H 1A1OB 3X3FH 2BVTA 5CUSL 1GAFH 1MFAL 1T7VA 2JIXB 4YNYA 5IV2B 1U92B 3OR6B 2WQRA 4HS3B 3FTGB 3V5HA 1P4IL 2V9TA 4LLWB 1N2RB 3FQNB 4HPYL 4UINH 4ZPTA 4O2CA 4ODXB 3QXWA 3T77B 1V3LA 5J13C 4XCCH 4G6AC 4YH6A 4HPOH 2VLKD 1F58H 5J57B 5F88B 5JUEL 4MVBC 3G6JE 3VGHA 3DROA 3K8KA 4JN1L 1CU4L 3DO7B 3QEGL 1RK0B 2VDQL 1PZUB 2W9DH 3WIFA 1RUKL 5A43C 3T0EE 4NQTA 1QFWI 1IVLA 3NZHL 3BN9C 1KIPB 3T3PE 4OAWA 5F97E 3JV4A 3RU8L 3MLXL 1IAOA 3RL1A 1QA9A 2V9QA 4MD4A 3RZCA 4YPJA 1FVDB 1MELA 3KYAA 4WY7L 5EC1A 3STZA 1K3ZA 3HMXH 4RFOL 5IQ7L 5HVHC 3VD7A 4BSWA 3ZTNL 1YEIL 2NXZC 4WWID 2QL1A 4YGVB 3TN0B 1XGUB 4NM4H 2PW2B 4PJ9D 3KLSA 2NY1C 1JWUA 3U82B 3VI3F 1T89A 4QTIH 4D9RD 3TNMB 5T3ZE 3DUUA 3QDJB 1A1NB 3FQTA 4RQQB 2GK0B 1WEJL 4QHNA 5I8OH 4ALAH 5E99H 4IRJC 3D25A 1H0DA 4XVJH 1GPOL 4NRXA 3X3GL 5J1TC 3UTQB 3ZT5A 1R0AL 1S5IL 1LE9A 1MWAL 1UM4H 5BV7B 3PABA 2X4PB 3SKNB 4D9LH 1EHXA 1S9WB 3ZYJA 5LGJB 4ZSOB 1BGXL 2HT2D 3QIBB 1CZ8H 4LSTH 5I1CL 2ZPKH 4GRWH 1N5AA 3QDMB 4ZDHA 3MGOA 4KXZH 4X7DC 3T0ED 2DQEL 3E6FA 3GZKA 3VGAC 4YIQA 3BGMA 4ZUUA 3VWKA 1IM9D 3G6DH 4LLUA 5C0BA 4JDZA 5EPMB 1GJIA 5DHVB 4P59H 4I0PA 2BSRB 4G9DA 3DTXB 2KDGA 3QEQB 3CXHK 5JW4R 4JFOA 5F3BA 3EFDL 3QI9D 5IG7A 4ZFGL 1N0XH 1Q1JH 2ZUVA 4K8RD 2Z31B 2FX7L 4NUGL 1AY1H 3EJZC 5F6HJ 4PGCB 5J12B 3ZDXF 4ODBD 4OCSL 4XVJL 3QQ4B 2HFTA 5HPMA 5DRXB 4XPBL 2EKSB 1GXEA 5CCKH 2DYPB 4YDJA 3I50H 3SQBA 2BVOB 3PHSA 2Z0BA 1G6RL 3Q0HA 4O5LL 1ETZB 2DLFH 3MO1B 4GAYB 5L2KA 5E8PA 1CFSB 3GMRA 4KHXL 5D5MA 1QEWB 1DLHB 5BVJB 1F42A 1WSST 4K3EL 5KZCB 3UTSE 2NXYD 4KRPD 4QTHB 3KYKH 4P2QA 1SJEA 4R3SB 3RWGA 3CK0L 5T1DL 1OAQH 5B39B 3MO1A 1ETZA 4P5MA 5E1HB 3O6LL 3PWVB 3ZKND 1NFKA 4F3FB 1Q1JL 1BQHA 4RA3A 3ELAT 1T2JA 4OCWL 4FFYH 3RUGA 5KSBF 1XF4A 5TJWK 3MRRA 4J3VA 5FGSA 1I3UA 4GJTB 4MHHG 5I1JH 4PP2A 3QEHB 4RA0C 1FNEA 1QHOA 4OI7A 4APQB 4XP5H 4JVWA 2YD6A 3QFDB 1RZJC 2COQA 5TE7L 2D7QA 4J4PD 1FH5L 2MHAA 1CDYA 2JJVA 4XWOC 4YQXL 1KEMH 1I8MB 3QZWB 5DURB 3ARRA 1CIUA 4KHXH 4WGWB 5JOPE 3MV7D 1FPTL 2QTEA 4YJZL 4X6CF 1N5AB 1EJOH 2XY2A 2LFGA 4XAWH 4WUKH 4QT5A 5HGHA 2JK5B 3QB7C 1FGVL 5FCUL 3GSUA 4L29A 2XY1A 4NNPH 5GGVH 1KLUA 1TJIH 1NANI 3H3PH 2EE6A 5KSUA 4UV7H 4YXHH 1EXUB 3NPSC 1J0HA 1G7QB 4KDTA 4NRXB 5E7FA 2VR5A 4HIJB 5B21A 1R3LA 4W4OC 4F9PC 4LCWE 3SBWC 4Y1AA 1GGTA 3MCLL 4LMQI 5HHMB 4XNUL 5L2KE 3P4MA 4EI5D 4JAMA 5D6CA 4XB8A 4KTYA 1DBAH 4PRAA 3SDYH 4YGVA 3B2VL 3O6KL 1U8OB 4XBGA 3SGKC 3K8MA 2BSED 1N7MH 4X9FA 5K9QI 4N0FA 5BQ7A 1WCQA 2FRGP 3RHWF 2DQDL 2HJKB 1NEZB 2X42A 1FVDA 2K7QA 5L88H 5HYJD 4ZSOE 5K9QG 4OAWB 3HZMB 3H7BB 4TSCH 4LPVA 8CGTA 5GGVL 4POZC 2ARWA 3MRKA 4HFUL 1TVBA 4NQSA 1REIA 3EOTH 4ONFL 4PLKC 4BSJA 4UV7L 1M7DA 4ONHB 2AJYL 4BA8A 2EDNA 2DJSA 3QUXC 4Z7UF 4LVOB 3A6CH 1R5VB 3K1DA 5E00A 5I74C 1R3KB 1YEEH 4LPWA 4HD9A 4XP6H 5E6ID 3BD5A 2H32A 4LQFL 5MI0C 4ZPTB 1R24B 2C3XA 2PF6A 3BQUC 2VNCA 3V5HB 3FTGA 5JW4N 2JIXA 1LHZA 3IDJA 2L0DA 4YHZH 4L5FL 2PTVA 2QBWA 1VA9A 4PS4L 5C0FA 3H8NA 4OGYH 2FJFB 1FVEA 3MRDB 3KS0J 3P77A 2IPTH 4LLQA 3ROOA 4F58L 4LHUB 3HE6A 3MXVL 3C8KB 1F3RB 5DJ8B 2VZTA 5AZ2L 3RTQC 4P2RB 2YD2A 1U8QA 1RZIA 1VACA 3I6LD 2B1AH 1G7JB 1IARB 4J12A 5CZVL 4FQLL 3KJ6H 4Z7WE 4OUUA 5E70A 3UZEA 4W6WB 1G84A 3MUY1 1MLCA 3VGEA 4QF1A 4QY8B 5J6HA 2WV3A 3LKNA 1NC2A 1EVUA 5IW1B 5GSRA 1VSCA 3VFOA 1U8MA 2VDLH 3SKJL 2CIKA 3JVGC 1VFAB 4UQ2B 1VGKB 2LTQB 2NY6B 3LS5L 4FXLA 3ZT6A 2G5RA 5D93C 2A9NH 1OL0A 5F7YC 3QWQB 2VERN 1N0LA 4P9HC 4JFFD 4NBYB 4F58H 1OCWH 1G7LB 3S4SG 1E6OL 5MEQA 1CFVH 4PJCF 5DEGB 3MPCA 1L7IL 2YS4A 4LLAA 3S97C 2KBGA 4PLJC 1MCOL 1KEGH 1HH6B 4B5EA 3IF1B 4K7PL 2CUMA 3QQ9D 4G8FB 3QO0A 3P0VH 5HHXH 5C2BL 5CBAB 2EYRB 2DBLH 1RZ7L 4GW5B 1A64A 3DX8B 2VUYA 5DRNA 1NBVL 4GS7C 5KS9A 2GEEA 4ODTH 1MFDL 3F62A 5D2LF 3WL9B 1WAAA 2I26N 2FSEB 4ZYKA 1LEKB 1A9BB 2VDLL 3D3VA 2CIKB 5E2VH 2YPVL 3O8XB 4MXWL 4NSKA 3P4LA 1AGEA 4X80H 3E2HC 1NC2B 2E7CA 3BKCH 5D1QA 3BZ4B 3ZE2F 1SYSA 1NDMB 1X3DA 4KVNH 5D1ZD 5DGRA 4PJDA 1NGZB 3HUJA 1T0PB 4AH2B 1P7QB 4XPFL 1IC7H 2AEQH 3BUTA 4G8EB 4KY1L 5D7LE 2FEDD 4DK6A 2YMXH 4HCRH 2BNUA 5C0RL 1MCOH 3G5ZB 4PR5B 4MAYA 4U3XA 1RJCA 1D5MA 3BHBA 3FN9A 1PSKH 1V3KA 4GRWB 1S7RB 4N8CH 2RCSL 3EUUA 1UADC 1EMTH 4LLQB 5JA9A 5C0CA 3L9RB 2PXYA 4Y16D 1CGSL 4C56D 2ADGA 3UBXG 2N4IA 3MRLB 5A2JH 2PXYB 3L9RA 3Q5OA 2PO6B 3IJYA 3P9MA 1BEYH 3TF7C 1S7RA 4MCZB 4EXPX 2NR6C 1S9YB 3O6MH 1I3RB 3O6FA 4JM2A 4YUEL 1YNKL 2OJZH 4HF5H 1Q9LA 4LASH 4XX1G 2FNBA 2BVPB 2ARJQ 3HUJB 3MRMA 3D39D 3QIUC 3ZTJH 1IGIL 4HV8B 4QRUA 2HN7B 5DJ6B 3CX5K 1UQSA 1YEHL 3LH2L 4M5YL 1RY7B 4WEBH 2R2EB 4QOKA 3WUZA 4NSKB 4U1MB 1QSFB 4M7LH 1INEL 1JGEB 3FB6B 3O6FD 4X0KA 2C7UA 4HUUA 1HXYB 4FQIH 5E8EB 5D1ZC 3SPVA 3MUHL 5HBBA 3GDBA 1CE6B 3NVQA 4N1HB 1U3ZA 5H35A 1XEDA 5EZIH 5E5UB 2EYRA 4XBGB 2IC2A 4JB9L 2A74A 4J3WA 1NGQL 4PRAB 3QXVA 4WWKA 4EJ1C 4RAVB 1R3HA 3NFSL 5C09E 1HH6A 1E28B 4KDTC 2VWEE 4PRIE 4BQBA 4OGXL 4MLSA 4HIJA 2LV4A 1UXWB 2ZCHH 4XNMB 3KXFE 5HGAB 2J6EA 1JGDA 2IALB 1AIFB 1I1AD 3BAEH 1MCLA 1BD2B 3H42H 4PTTA 3RWJB 2XA3A 1RJYA 4OLZH 2YN5A 3ECBB 4Z7VF 3Q5YA 4QHLA 1J8HD 5JMOC 1FE8L 1OM3L 2DJUA 2VLLA 5D2NE 2VXQH 5DJYB 1LO0H 1QP1A 2RJMA 1CFTB 5GSRB 3O2WH 3CC5B 4KK5D 5F3HB 4NKQB 4Y4KD 5I17B 4HWBL 1R3JA 3UYOD 3OKOB 3WJJC 3IDYC 3U7WL 1OB1B 3PL6A 1YQ2A 1Q9OA 2CIIB 3O3EB 1DBJL 2FD6L 4X7FC 3SCMA 1XIWA 1H3PH 35C8H 3VXQA 4LCCB 3NBNA 4JY5L 3VFWB 4CMMA 3EBAA 1QFWL 5D7IB 3ZKNC 3NCJL 5ANME 1F90L 3DVIA 1GGBL 2YA0A 3MRNB 4JY6A 4LHUA 4TOYL 3D85D 3UO1L 1XF4B 4NQDD 4XWOD 2QQQA 5FA3B 2UY7A 1P5VA 2XA8H 4K8RL 2OM5A 2VDPH 3ARDD 1IQWH 3TCLB 3OAYK 5GJSH 1KC5H 3QEQE 4F7EB 1TIUA 5KSVA 5EBMB 2DYPD 4RISH 3MJ9A 4UUJA 4RBPH 3AUVA 2G60L 3TO2A 2EZ0D 3L3JA 4Z7OE 3NCEB 1B3JA 4QTHA 5F7EH 3FB7A 3AS3A 1PW3A 1VGEH 1W0VA 4M4RA 1S3KL 1RZ8B 2G9HA 1S5IH 1F13A 1TVBB 3QSKB 5I1LA 2H1PL 4XC1H 1JN6B 2PCPB 4MMZC 4D9LL 3V6OC 5IESL 2MCPH 3H7BA 4JFDA 1PZ5A 3CFIC 2P8LA 1NC4D 4JQXA 1KXVC 4GRLD 1I7RB 3WE6B 3PWLA 1OAYL 1JYXA 1JYNA 1NFDF 4LSRL 3WKMH 4TOYH 3AGVA 1UA6H 4Z7VB 3V5KA 3TFKD 4J3UA 4RZCB 5IFJA 5FYJU 3IJHB 4P4KC 3QDMD 2XA8L 2J2ZA 2NTFB 4DN3H 5JW5B 3MV8A 1MREL 3QIBD 3FZUD 3HMXA 2FGWH 1OD7A 2EH7H 3BW9A 1IKFL 1P6AB 3ARVA 4JAMB 1F4YH 2WBJC 1KPUA 1KUMA 4JZNB 3JTSA 4JFQB 4YHYC 4KPHH 4WI4A 2KQMA 3QHTC 1NGPH 5CP7B 2VITA 1WTLA 4WHDA 5FYJL 1E6JL 1HHHA 4Z0BH 1FC1A 4YEEA 1YY9C 3MA9H 4EZMA 4ZUTA 4ZTOH 2HMID 5FHBL 1OSPH 1T83C 3I50L 1HYSC 2VABA 1N8ZA 2H9GA 2GJ6E 4QT5B 5F8QC 4RAUA 5FKPB 5LG1A 3VWJC 2A77H 2YR3A 2E27L 4IBLT 1CGYA 2R56L 3VD4A 3MJ9H 3P0YH 2P1YA 5C6TH 3KPTA 1X44A 4QHUB 1IL1B 4I1NB 5LJYH 4KGLA 1KJ2A 5J3HC 1LP9B 4AEIL 1I8MA 1N4XH 2GK0A 4XI5C 4ZFOA 4JFQA 1JPFB 1SM3L 1XGPB 5T1DH 3TNMA 1YC8A 4HWEH 3L3GB 3WCYA 4NM4L 5I30H 4PRPD 4E9LA 4XPGL 4TVPE 4BSWB 1E4KC 3N1FC 3FOLB 4MNGE 4NZRH 1UC6A 4PP2B 2C3HA 1NGPL 4KAQL 4R6UA 4AM0A 2CDGA 2OZ4H 4KUCF 1D5BB 1ZV5A 1ZGLB 3V5KB 4R90L 3WS6A 3VDCA 5DWUL 5CKAA 3LEXA 4OIIL 1F45A 5IIEA 1WFTA 4J3TA 3FZUC 4S1QH 1PZ5B 1DBBH 4QHKJ 1LP9E 3PWVA 3LKPB 3WNLA 1RZFH 5HHVL 5DC4B 3EYQC 1JRHI 4V1DD 2W9EH 5C6PB 1CD9B 1RZ8A 3ESUF 4U6XA 2QLVB 3MACH 3SJVD 3T0BA 4U7MA 1W0VB 5DVKA 5F88A 4FABH 5C6TL 2YKLL 5M95B 2V7NA 5E56A 4LK4A 1IE5A 1SBSL 4HK3N 4X4YB 4JG1L 1B4JH 3OTTA 5E8PB 3SGEH 4YFLI 4UUJB 4I3SL 1NCWH 2EDHA 5C07D 3PIQB 5LBSL 3L5JA 1LE5A 3EO0A 4HS3A 4TQEH 3HHRB 4LVNB 3AREC 1N6UA 5EU6D 1UKSA 2FBJH 4HEPG 1I75A 4FNLL 2E7LC 1FDLL 5DRXA 2ORBH 2HJFB 2VXTL 4JKLA 5DJ2B 2PYFB 5EOCL 1U3HD 4DGYL 5CGTA 1EJ6A 5F7LB 4U1KA 4N68A 4U7KA 1IC4H 2H6PB 4FZEL 4QRPD 5IBUB 1NH6A 2Z31A 4NGHL 3NH7L 4YHOL 5JQHC 4DW2H 2YC1A 2F58H 2HRPL 3OX8A 3D0LA 4LP5A 5IVZB 1FNSL 4IMKA 1Q9OB 2BFVL 2CIIA 3F12B 4LSPL 4NYLB 4LLUB 4JFFA 5C0BB 4XVSH 3WIIL 4YIQB 1G9NH 2X7LB 5I17A 1W72B 2QHLA 5EZLB 1UH3A 3CC5A 1EERB 4JHWL 2OZ4A 3VFPA 1B9ZA 2F15A 5DJYA 2VXVL 4NO5B 2XWBA 2R2BA 1AXTL 4E42A 4X6CE 3H3KA 2APWA 1M6OA 1I8LA 1PKQE 5D96B 4G43A 2EXWD 3MX0A 3WXWH 3EOBA 3L3KA 3MCKB 4MB5A 1JGDB 4AEHH 4OTXH 4OLVL 4WTXA 3N50A 3UTSA 4XNMA 1UXWA 2DLTA 2XQYK 5HJ3A 2HT2C 1E28A 3BFOA 3HE6C 3HNVH 3R0MA 1MJ8L 4RQQA 1MQKL 1MJ7L 1RD6A 4H20L 3DVGA 4NN6C 4RAVA 2X41A 1JWUB 3RY4A 3BDYL 4WWKB 1U6AL 2PW2A 1BIHA 3AXLA 3F5WA 3QIWC 4J1UA 5GRXG 3HNSL 5D7IE 3WFBL 1Q94B 5FM4A 5JLZA 1UJ3B 5FK9B 3P9LA 4HPYH 5EC1B 3HAEB 3MUZ1 3QWRA 12E8H 1PYWA 4XCCL 5EIIB 3UTPE 3O9WA 3HE7A 4YE4H 3WNPA 5EUOE 1CF8L 5SX4I 1AXTH 5CIPA 2EXWC 2LQRA 3ZDZE 3WIFB 1ZLSL 3NN8A 3KJ6L 4OLWL 5ITBL 5E6YA 3MODL 1ZANH 5EH1A 5IVNA 1WZKA 4YR6B 1W0WA 3MBXL 4YHKL 2W91A 2F53B 4NNXB 5F93C 3T77A 3QA3B 3FQNA 4Z7UE 5IMLA 3BP5A 4XNYH 1ZA3A 4U0RC 1G0DA 1HSBA 4PV9B 5J7CC 4MJID 4R96B 5JZ7C 5D7SL 4IRSC 1I7ZB 4C56B 1RUQH 1TVHA 2Q87A 3LS5H 2BHYA 2PO6A 3IJYB 3OB0H 3OKDA 3D39A 4HS8L 1V8HA 5IGXL 5I16A 3K3QA 4PRHD 2G75A 4K3JH 1BJ1H 1D5MB 4MD0A 5FUZL 5F1OB 4L8BA 2GW5A 3H9SB 4P23D 3FQUA 2OR9H 2ZZUT 4Z76A 3FQXB 3OAUL 3TVMC 2Y4SA 4MQTB 2AJYH 4IOIB 4U1SB 2FL5B 1QPPA 1KYOJ 4GQ9H 4PJDB 4R8WL 2DJ4A 2H3NB 1AGFA 5MEND 1SYSB 1KB9J 2J8UB 5IROA 3QIWD 1MI5B 5D1XD 3VXRD 1A4KA 2NY2C 3TA3B 4P57B 5IKCB 4LNRB 1DFBL 4JM2F 4XI5D 3QDHA 4PREA 5IB2A 1UB5B 4PS4H 1ZHNA 4YLQT 3FCTA 1XCTB 4GW5A 2VDNH 1VFBA 2BSTA 1BBDH 1YUHA 1MCNA 5K9KB 4YHMH 5FGRA 1NMBL 1OLZA 5D6DC 2IEPA 4PJBB 4ZD3H 4G6JH 1OGAA 1CLZH 5KSBA 2D7OA 2N7AA 4G6FB 2X4OB 2B7DT 1P69B 4KI5E 4IHOB 2WQ8A 4NQXB 4X8XA 5CCKL 5HHQA 3KR3L 1YYLH 4CN4A 1G7LA 1CICB 4GBXA 1IKNA 2HTLD 4OZFA 1G7IB 1TQCC 4JDVA 5A40E 1N59A 2J6EL 2X1PA 5LKNA 3QFJB 4BSVB 1O7SA 1SJXA 4OJFH 4JO2L 2HFEA 3AS2A 1NCBH 4RSVA 4OD1H 1RHHB 4M1DH 2WWKO 5BS0D 1PEZA 4JM2D 4PGJA 3FT3A 3EYVA 4FZ8H 3J8F7 4XMPH 5DD0L 4PJ5E 1Q0YL 5F6HI 4MCYA 2I07B 3SDCD 5DJZA 3F58L 1G9ML 3A6BL 5SWSB 3ES6A 4EIGB 3MMEB 3GHBL 1FL5A 2CKNA 3LKSA 3MROA 2CLZB 3RWIB 1I4FA 1OP9A 1U8NB 2B0SL 5MERB 4XAKD 1ZLUH 4M7KL 4M03A 1MAKA 2ATPA 4FQJH 3FO0L 5DGQA 1ROWA 3ZHKA 2ZUYA 5DJ8A 2FCBA 3S5LB 3GBNL 5HDBF 3KDMB 3MRDA 3GSWB 1MY7A 4RGNE 4X5XA 5IW6A 1V3MA 2NW3B 1IJ9A 1INQA 4K3DH 1CVSC 1U41A 4UIKL 3CGTA 1KPRA 1BBJB 5IP4A 2ZKHL 3OB0K 2R0LH 1WIUA 2E9IA 1YNLL 3BRDA 3PWJA 4Z7WA 1SY6A 3OF6D 4ETYA 2VLKA 4BELD 5L6YL 1OP3H 1BIIA 3DSFL 3L5WB 1Q8MA 4K7PY 2VXSH 4RBPK 5K9JH 3MOBL 2HWZH 1A3RH 1TZHB 1R5VA 2A38A 4PP1D 5C7XL 3QG6A 5HY9B 4M6MH 5ESVB 1T7ZA 1M7DB 2JJUA 4ONHA 3TO4D 3RX5A 2ADFH 3LIZL 2Y06L 1LVEA 1S7TA 4LCWD 1I9IL 1TPXC 5BOPA 3SOBH 1N3NB 5I1DA 5HYJB 2OI9C 3IFNH 2OK0L 3MLZH 1QLRA 4XXCA 3FB5A 1QQDB 5CMAB 3O4LD 1P7KA 4OGAD 3HZMA 3QJHB 5DEZA 1RJZA 4LF3A 4M93C 4KK6C 2Y5TB 3CUPB 5IMOB 1U8JB 1GIGH 2D03L 4MA7H 4CVXB 3OKEB 3HMWL 4OV6F 4G6ML 3ARFC 5E2UL 4N0FB 4XZUA 1N5YH 5ACZA 1PVHA 3MRQB 1DTUA 3G6AB 4G9FD 5J3HD 2FD6H 2F5BH 1RIHH 1CVRA 4CAGA 3W5NA 1CDJA 5DD5H 5I1EH 4ZNCD 3EO9H 1LD9A 1DQJA 1NJ9B 4HXAH 3SDDD 4XP1L 5C0IA 4JO1L 5L88L 5KSAC 2AJZB 1S8DB 2KPNA 1HYSD 4DUVA 2Q8AL 3MXWL 1WLHA 3UJJL 4AIOA 1A3RL 1IILE 1M4KA 1V05A 4Y1AE 5EZJB 3LV3A 3MUGA 1P1ZA 4YX2L 1KLFA 1A7OL 5C0AB 1FZMB 4H25A 1JFQH 4L8SA 3LQAC 5KSUB 1FC2D 4R7DA 4I2XE 3OGCB 2VYRE 3GSUB 4M7LL 4PTUB 1CXIA 3OJ2C 4QGTA 1UZ6F 2GQHA 1W8OA 5FOBA 4X8JB 4Z5RA 2B39A 1G7MA 2MOVA 1GOGA 3B9DA 3IDMA 4NDMA 3FFCD 3S35H 1F58L 3V7AE 1QKZH 3TH3T 3NIGE 2V2TB 4HKZB 5C0GB 3DVNB 5GGUA 1AGCA 1YPZF 4JB9H 2OTWA 2H1PH 5D7JC 5DYOB 4PJXF 5E94A 4L1DA 1A47A 3LB6C 3ULUD 1JNLL 4I2XB 3D85A 3RZWA 2O5YL 1R5WB 2X4SB 3G5VA 2VLMD 1FNEB 4LARH 4NQDA 5BS0A 1GGCH 3MLXH 2Q8AH 5CLWA 3BI9X 5I8KL 1OTTC 3RTQB 1JWSA 2ID5A 1A5FL 3KHOA 2X4UA 4I4WA 1NSNL 3MRRB 1LK3L 4DN4H 1NFDE 1A7OH 4F15C 4UOJA 4JHZA 4Q58C 1DQQA 2E7HA 5IK3A 1BQHB 2FEEI 4NCC1 3G5XA 1Q9KA 3VFNB 2F9BT 4NO2B 2CLVB 3LHPH 2FGWL 4G6AD 1RUPL 3RVWD 5KZCD 4PJCB 2NY3B 5EU5B 5SWSD 3DXAA 3GSXA 3SDCB 1SJEB 4N0RA 4K2UL 4OZIA 4HUVB 3GK8H 3V9FA 1AGBB 1Y0LA 3D69A 3MJ7A 5C07A 4DGVH 2VAJA 1EK3A 3U7WH 5JPNA 1DQDL 1BFVH 1MUJA 5D5ME 3SDAA 3BJ91 5GHWL 1NLBL 4L9LA 2IQAB 3S34L 35C8L 4MXQD 1ZSDA 1J5OL 4JY5H 3I75B 4XGZB 4G9FB 1F4XL 1G6VK 3MBED 2HVKA 3L7EA 4GXVL 3NCJH 4F7TA 3TPUB 4LSTL 3CVHB 2R2HA 5D7KD 4G5ZH 3IETA 2YRZA 3IU3A 4UZGA 2C5DC 2DQEH 3LVEA 4HGKC 4HJGA 4GG8A 2A6IA 2GSGB 1T1ZA 4KJYB 1K4CA 2FZ3B 4G6FD 2EC8A 1RPQA 1G7HA 4JLRB 4LCWB 4V2BA 3W39B 2R23B 4JDTH 1IM9B 4HH9B 2VIRB 2VC2H 4GAJL 5DJXA 5IROC 4LLYB 3T0EB 3ISWA 2BSRA 5FV2A 5FECA 3F7YB 2GK2A 4D9RE 5EPMA 5IW3A 3WHXA 4M9PA 3VWKB 4HCRA 1HZHH 5B38A 3QI9C 3VG0L 2E6JA 2X4RA 2AJSH 4CNIA 3QG7L 1X5LA 2H8PB 2VDQH 4MA8L 1NGWB 3EDJA 2DQHL 3VWKC 5LGJA 3BT2L 4Y5VB 4PB0L 1H15A 4ERSH 2X4PA 5KG9A 3SDDA 4GAFB 5IBLD 2FJHB 1F6LL 3W11D 3MJ8A 4U4BA 4KKNA 3GIZH 4RIRA 1YEDB 1LEIA 2CJUH 4XVUD 3GKWH 4P23B 5L0QB 3NPSB 4Z18A 3KPSA 3O45A 1WCBB 1IC1A 3BEWA 3HUJF 3O2DL 3ULSB 4LFHG 1YECL 1BVKB 1ZHBB 2DD8H 2JELH 4WFGD 5E4IA 2GJ6A 4OLYL 4URTB 3QH3A 4TRPL 1BX2A 1OOAA 3FO1B 5K9OA 3CFEA 3LQZB 3ARYA 3T3ME 4CW1B 4X4ZA 1FFNA 3LRSB 4XXDB 3LN4A 1IAOB 2IGFH 5IUSA 3VGFA 3MA9L 3JV4B 4HZAA 4MA8H 3MRIA 5KANI 5DI8B 2HVJB 5FO9A 1PY4A 4M4PA 2Q7NA 3EZ8A 1FYTB 3VMPA 4E41D 2A1WL 4JE4B 5IBLC 3FO9B 2F53D 4JFDE 5CUSH 1BAFL 5GZOC 2F58L 2HRPH 2A73A 3DNKA 5I1CH 3UTTB 5F96L 1BM3H 3DROB 5MHSE 3MTRA 2BZDA 1XT5A 3UYRL 3GO1H 4WI6A 4XVSL 4IRSB 3ARBA 4IDLA 2CJUL 3GSNH 2P49B 4YXLH 1EUTA 1U95B 1FCGA 5I1IH 2YPLE 1XH3A 1NAMH 3D0VA 2YUXA 2BOBA 4GKZA 2XI9A 5DJCB 1AY1L 1I9JL 2YBRA 5K59E 5GGSA 3QCTL 3O2VL 2E6QA 1A6ZA 1PFCA 3TA3D 4WDIA 1KELL 3JWDH 3QIWB 3V6OE 1P2CB 3VFGH 5L2JB 4UAOB 3HMXL 3N1QC 2QKIA 3RIFK 3D6GA 2R4SL 4M48L 3W2DL 3MYJA 3QT2A 1G6RA 5TFSL 2P5WA 4U49A 1WWAX 3S37L 1JF6A 1T1WB 4PJEF 4G7VH 1T5XB 2IBZX 5EUKA 3E2HB 2YD7A 3EO1B 5DTFB 2W07A 1JMXA 4A2MA 4R26H 1A1MA 5ITFB 1SBSH 4YDIH 4PJ8C 4OIBA 2Z91B 5DHVH 1XF2A 4PJ5D 1OPGH 4KKAD 2HT4D 3GSNL 1QSEE 3B9KB 2CRYA 1CF8H 1DLFL 3DSNA 3F7PC 3FQRA 1MAJA 3ULUE 3KNBA 1BFOA 3Q6FA 5EO0B 2Y1VA 5CWSB 5GGSY 4OLWH 1ND0B 5ITBH 1UG9A 5HSFA 2DTML 1NKRA 4YFEA 3QUMB 1WBYA 1I7TB 4XP6L 1IGJB 3FFCE 1RI8A 3M8OL 2CO6B 3KGRA 2F74B 1F11B 1OTTD 2ITCB 5LXGL 4AL8L 2R4SH 2NNAB 4DZBA 1KLGA 2YD1A 4MAYD 4YO0A 1QSEB 2X05A 1EUUA 4JRYA 3C6LA 1GAFL 1MFAH 2CO7B 2HYMA 4RCAA 1L0YA 4PJ8D 1K9TA 2WAHA 4ODSH 4I77H 3QUXB 1MLBB 4OGYL 1IRAY 2HKHL 1CDBA 2XG5A 3MC0A 4R0LC 5SWZA 3AMKA 1D6EA 5F89B 4DFIA 1FNAA 2Z93B 1IEAB 4ELMA 2EIZB 2ZP0T 3VXMB 5KVEL 2B1AL 4NQEA 1DBKH 5SWQB 2AXGA 4YC2C 3WS6C 4LAQL 3MOAH 2ZUQC 1OF2B 4UI2A 4FN0A 3HKFA 1NBQA 4AEHL 4K7FA 4DQOL 1TTFA 5I1GL 5MENE 5I71B 5MENA 4U3CA 5EOQH 1U36A 5EO1A 4GG6F 2VTFA 4BKLA 3BKYL 3MLVH 3JXAA 3WUWA 3UP1A 2ZUQB 4YBHA 1NCCL 2IMNA 3WO3B 5CP3A 4UNUA 4FQPA 5C1MB 3PWPA 2YRPA 3TIDA 3IDNA 1DE4B 4MNHB 5E8OB 4JQVC 1QVOB 5KVDL 1CI5A 1XCQA 2WBJD 3X13A 3O6KH 1FZJA 2WANA 3GI8L 3ZL4L 4XH2B 5F1KC 1FAIL 3EDKA 4JREC 3ROLA 2PETA 5IFAL 1HK6A 4PRPB 4ALAL 1FV1B 4KUCD 3FOMB 4JREB 4CVZA 3TFKC 4OBSA 3ARSA 3RY6C 4M8QB 5TF0A 3QUZD 4Z0BL 5DQJB 3MRBA 3REVB 2VLJA 3GMLA 1OSPL 5EU4A 4P3DA 2ARJA 4R2GD 1Y18A 1XF5A 4X5WB 4AY0A 4P48A 1Q9WB 4LEOB 4D0BA 1ES0B 4RWYL 1CBVH 5JHDB 3FHQA 3MV8E 2C1OA 4PRIB 2CDFB 3D2UB 4WUUE 1FH5H 1WBXB 4IM8A 2ZPKL 1KEML 2F54E 5DD6A 3WYRA 2OP4H 3MJGX 4KJPC 3RVVD 4NNYB 1CQKA 1ZT7B 3RPIB 5E95B 5J9PA 1FPTH 3NCYP 4QRPB 2ZNWA 3RJDA 1RFDH 2NY7H 4L8DA 3EOAA 4GW4A 1AGDB 2AV1A 1S7XB 2Q76A 3N06B 5TH2A 3RRQA 3ARDA 1DN0A 3GMQA 5EU6B 3GSVA 2P7TB 1V7MH 2XZAL 4R4FL 4EOWH 3HPLA 3SE9H 4EI5A 5E9DE 3MXVH 4KY1H 4U1IA 5D72H 2AKRB 4Y2OA 4D2NA 3RVTC 4OCSH 1TZGH 3U9PH 1U8IA 1N64L 3INUH 2Y07L 1A7RL 1HDMB 2IAMB 2DI8A 5ACLA 1XR9B 1HIMH 4Y5XA 1DBBL 3QDGE 2E3VA 1OQXA 1JHKH 4O58H 5JMRA 3CD4A 4KMQA 4UAOC 2BRRH 3U1SL 2DLFL 1K85A 5GJTH 1NC4B 5HDBE 4U6VH 1NFDA 1NFIB 3NGBC 1H5BA 4HMCA 1KCSH 1P84J 3CDFA 1AKJB 3OB8A 2BVYA 3N9GH 4AYFA 1J1XH 2GT9A 3WS3B 3ZKSD 2O61B 4AENB 4QO1A 3DX9B 1N6QH 4MQ7B 3G5YA 2W60B 2ZUWA 1S7QB 5JHLL 2E6PA 4S2SA 1NAKH 4U1IB 2W92A 1PGRB 2IAMD 4GFTB 1BZ9A 1ZKAA 3WJLC 2GUOA 4NUJA 5D4QA 5IB1B 1U8LA 4DGYH 3TP4A 4LQ1A 3ARDB 4TUOB 4XMLH 3UBXI 4PRDB 1S7XA 1K8DB 2Q76B 3WD5L 1T0MA 4GKOA 1PQZB 5FOJA 3VFSB 4I18B 4Y4FC 5DUPL 3UPRA 4NFBA 4C4KO 5KSAB 4B0MM 4Y19D 4JKWA 1Z9SA 1JCKA 4GKNA 1NCUA 1GSMA 1MI5E 1Z9OA 4BUHA 1FO0A 1YJDC 1SMAA 1WBXA 4HG4K 1KB5A 2C1OB 4PRIA 3RL2A 4M1DL 4KKLD 4LEOA 3PGDB 4QWWD 2DLGA 2ARJB 3HCVB 4KDWA 1FJ1B 4ZTPL 4XAWL 3IGAB 4PRID 4NJ9H 2DICA 1UEYA 3QUMH 4Y19A 2XZCL 2A6DB 4ETQB 2GTZA 3HS0B 4PGBB 3IAGC 1YA5A 3K7UA 3QUZB 4PJBE 2B0SH 1NAMB 3TWCL 5C2UB 4NQEE 3QYCA 3DRQB 1YEKL 3FQWA 4G3YH 1LO0L 4XH2A 3S98A 5EBWA 5AD0B 2VE6A 3HZVA 4HZLA 1ED3B 5E7BA 4NPYA 5I18L 4NN6B 3FRPG 5IVXB 2P24A 4GKSA 4XCEB 4H26B 5HYIA 5EZOL 2IPUK 5GS2H 4GRLB 3CFCL 4WFFD 4JFZH 3T2OA 5E2TL 2ZJSL 2XICA 5TPWL 2CR3A 4L3CB 4LLDA 5DLMH 3DHJA 4FXGA 1MFBH 2JB5L 5D2NB 5F1IB 5TGBA 4WJ5A 5HD8D 4HIEB 4ODHH 1HQ4A 2HLAB 3RWEB 2CR6A 4ZUSB 1JBJA 1MAML 1JNLH 1A9EA 5F9DC 4LCIL 3GB7B 5SWQA 4UQ3B 4I3RH 1TMCB 1GH7A 4ZOCA 3PV7A 5FYKU 3UDWA 3VXMA 5T1LB 1HINH 2XTJD 3CFDB 3VG9B 1FAKT 2Z93A 4PJAF 4YBLC 3T8XA 5IB3B 5EUOF 5DSCB 4YDLC 5BJTB 4EDWH 5T5FL 4MA3A 3OL2A 1QSFD 4LSDA 5DMGD 4X6FB 1MLBA 3MLZL 4KI5C 1JGLL 5FB8A 1FL3B 3F8UB 3VE0B 1F2XK 3I6KB 3QNZB 5CINL 4L4VB 3OXRB 4G80B 3QRFM 3MLWH 2YOCA 4JRYB 3DX6A 5C70A 3IDGB 3GSNB 4ODWB 4H0GA 1FN4B 4HW6A 2OCFD 3QQ3B 3T0DA 1AC6A 4H5SA 3BVNB 3SKUD 4BFBD 5DC0A 1F00I 4O4YH 3VXOB 1FVCA 3BOVA 4ISVB 2QEJA 4KVNL 5GS1A 1BD2E 4MJ5A 1IC7L 4MZ3A 4M7JL 2PO6D 1RAMA 1ZLVK 3QQ9C 4M8VA 1EZVY 1BFOB 1HILB 5FM8A 4F7PB 2DL2A 4WY7H 3WN5C 4EDXB 2X6MA 4XT1C 3QHZH 1RZJH 1HXMB 3FRUA 3GJFB 4OLEA 3P30L 4KTDH 3B9KD 4PJHE 4PY8I 3L3IB 1WGOA 3O11B 2DMCA 4XCFH 3EO1A 1V3JA 4PLKD 1XGQB 1T5XA 4JQIH 1YPZA 3TJEL 2P5WE 1OGAE 5D1ZB 5HYSB 5FF6A 4YPGB 2GJZB 1S5HA 2ESVE 1AQKH 2EDFA 4NP4L 1DFBH 1NC2D 4KXZI 4LBEA 3RA7H 3ZKXC 4D0DA 2VKXA 3IU4L 2NY4B 3VXSB 4Y5XC 3S4SB 2N7BA 1QZ1A 2A2QT 4ZXBC 3OZ9L 2ZSVB 4J23A 4X83A 1MCKA 4EUPA 4JFYB 3LH2H 4X99A 4WEBL 1GGBH 1FP5A 4A6YL 4JR9H 4RFEA 4UB0H 3DGGB 2VISB 1A2YA 1X9QA 1CGUA 1W2KT 1MEXH 3ARBB 1GCFA 1L4IA 1MNUH 4MNGA 3ZDYE 1WBZB 4D8PA 4R4ND 1MHCA 1NBVH 4LAJH 1P4IH 5D1ZA 5HYSA 4CN1A 4MQXD 3PWNA 4TUJA 5D71H 4P5TA 4GG6E 1EHNA 2YPVH 5IEHB 4OF8A 4DGIH 4Z7WF 2VAAA 4MJ6A 2R1WB 2VQ1B 2I9TA 5DI8A 2ICWJ 1KBGL 4U1JA 4X7CC 4XBEH 5FV1L 4JN1H 3T3MF 4IRJD 1X4YA 2ZCHL 3GMNB 3LN4B 1FYTD 3H9ZA 3MLYH 2W9DL 5D8JL 3CVHH 3QXAA 4EN3C 1UKTA 3T09A 3RNKB 4ODVH 4OCLC 3C6LD 5DJAA 3TZVC 5ID0A 3GUTA 3V4UH 5EWIH 4HCRL 4AG4H 4OD3H 1TTGA 3QUKA 4OT1L 4PD4J 2AK4B 4NC1C 2YK1L 3VU2A 1MEXL 1WQVT 4DTGH 1CGSH 1MNUL 4WNQA 2YUVA 4POYA 4EQ3A 2EH7L 1U2CA 4PJFF 1P7QD 1NAML 1PG7W 4M6OL 4V2CB 3WIHL 1PJ9A 5LAXB 1RIUH 3WO4B 1NUDA 3PJSA 1I9JH 5DRWA 5FB8B 1HN1A 2ED8A 4X6FA 3O8XD 2Q20A 5DSCA 5HD8C 3ARTA 2H8PA 4WFFE 5IB3A 1R0AH 4H88H 2JLLA 4CNIB 1EEQA 4OLUL 4ZTOL 1FORL 1XGYH 2VZVA 2GITB 2A83B 5IEHA 3BP7B 4ODVL 5SV4A 1UXSA 4ZG1A 4BFIB 4LLYA 1IEBB 1QSVA 3T0EA 1MFCL 1S9XB 1JHTB 2EXYC 4CBPA 2LABA 3GRWL 5DS8B 4JZJA 4MNGB 3PG2A 2NY6C 4JPIB 1WICA 3NZ8B 4UINL 1VENA 3MLSL 4S1SL 3JV6B 2DWDA 5F7EL 4UOW0 1AD9A 2VISA 2HG5B 1UZ8B 2VDKH 3QRGH 1BQSA 1UACL 4MQXC 1F3DH 4RFEB 4GRLA 4HWEL 5JPMB 3T2NL 5EZIL 4OQTA 1C1EL 1MCWM 3BPNB 2V9RA 1P4LB 2P8PA 3BZFA 4PLNC 5DD5L 3TPUA 5KTEH 3BKMH 3ULUF 4JFYA 4PRHA 5B8CC 3ZKMC 1NAMA 4NWTH 2DTMH 1H8NA 4WU7A 1OAYH 3ARBD 5F72S 2Q6WB 5C0NC 5DWUH 3SDAB 3KPSE 3HS0A 2VLJD 1SQ2N 1V7NL 1MJ8H 3KYOA 2CRZA 3V6BR 1DL7H 4OZIE 4P3WA 3ZE0F 2Z92A 1AGBA 1Y0LB 3D69B 1FZKA 2EO1A 2ZG1A 1A7NH 1RZFL 2ZUXA 4HDIB 3SQOH 3SDCA 1AE6H 1OW0A 5I19H 3VGBA 3N1PC 3DXAB 5D2LB 1QLFA 4XPHL 1W0YT 1CFBA 4FQ1H 2WP3O 4B7LA 3P4OA 4UIMB 3NA9H 1YZZA 2XN9E 4Y88A 4PJEE 5K93A 2BXZA 4QRTB 3S35L 2NY4D 3FRUB 1B6DA 4PRBA 4CGTA 3FAWA 3P9WB 4ZFFB 3V79C 4I4WB 3MLTA 2X4UB 4JJ5A 3VFSA 1JWSB 1CDUA 5E5MA 3ARGC 3UJTH 5D7KE 5E4EC 4KVCL 1QNZL 4OCWH 2YD3A 3U6RA 5DUML 4KRMB 3HRZA 2GUOB 4MJ5B 1D6VL 4X7TB 5GS1B 4NBXB 4ISVA 3BD4A 3KPOA 3KS0H 3JV0A 2P5ED 4FZEH 2ENSA 1FVCB 1S7QA 4DN4L 4APQD 2W60A 3BE1H 5DT1L 3NH7H 5H94A 5J4MA 4HULB 2QQNL 4B7IA 4M3KB 5DHYA 1Q0XL 4X4XB 5GJSL 4G80A 5BV7H 3BMWA 2E8ZA 5I30L 5F7DA 1FL3A 4JVUA 2M8XA 3SGJC 2OXGA 3HFML 1H5BB 1MY5A 1TCRA 3H0TA 4PY7A 4IS6B 4ODUA 2EEAA 3PP4H 1D5IL 3T8XB 1FZMA 3LPFA 2F8VA 5ESQA 3RIAK 2HAZA 3SO5A 1HCFX 4YHNB 3KLHD 1XR9A 4WRLA 3ULVF 3TBSB 1TJIL 4NT6B 2X1XR 1MIML 1G6RH 4LNVA 4K23H 3ARGA 3KPPA 5SX5H 4WHCA 4F2MB 4EI5B 5DZNA 5LWYH 4JY4B 2JJSA 5A2KH 4H1LG 1CXHA 3CMOH 3MRQA 5HHMD 1OT2A 3ZO0A 2ZCLL 2E9BA 5ETUB 4GKSB 5D9SA 4ZUWB 3MOQA 5I76B 4WVRA 5IB4B 5CJXC 3BQUD 3CMGA 5EBWB 4BZ2H 1ADQH 3E1F1 1O5DT 1IKFH 4DKDC 3O3BA 1F4YL 4QRPA 5C08B 5FGCB 5GS0C 5I1DB 3QUZA 1J0JA 4NNYA 1C8PA 1CXKA 2NX5A 3O4LB 1Q38A 1T21A 1TLKA 2NY0C 1ES0A 3X3GH 3U36A 3TO4B 4Y1AD 1EFXA 3PGDA 2O5XL 1UYWL 3TO4C 2NX5B 4TTDC 3FONB 4RX4A 1HHIB 3B9EA 3I2CL 3MLVL 5C08A 1E4WH 4Y4HA 3NAAH 4K3GA 4X5XB 3LOWA 1D7FA 3W9DA 4LCUB 25C8H 3KDMA 2PKDA 4X6CA 1FZJB 4M9OA 3KPMA 4D3CH 5E8OA 4MNHA 4ZUWA 2YD4A 2PTUA 4QXTA 4BZ2L 2ZCKL 1JYVA 2BVEA 4Y4KA 4P2OC 4PRDA 3SY0A 3N1MC 4TSAL 5EO1B 5TF1H 3HPJB 2FX7H 2CLZA 3LKSB 3MROB 3W11C 3HUJE 3DHMA 1BZ9B 3ARGB 3KPPB 4F2MA 3ES6B 4YK4B 3OQ3B 4S2SB 1J05A 2EKJA 1OP5K 4JPKH 2ED7A 3GSRA 1E27B 4ESKA 1OVZA 4GUPB 1C5BL 3G5YB 3C5SA 3H6JA 1FNHA 4E5XA 2NMSA 3DV4B 3CJJA 4NQEB 2YWYA 3D9AL 4LVHC 3HAEH 1AKJA 4PYHA 3C60A 3DYPA 4NQUA 3Q3GB 5DRZA 5B39G 2W9EL 2QR0A 2BNQA 1CGWA 2EECA 4NQCA 1KIUA 3TVMA 1X4ZA 1BVLA 4WW1A 4MDJA 4HLJA 1NFDB 4G42A 2KL6A 2VQTA 4P4RB 4JDVB 3FFDB 2AI0L 4K3EH 2NTSP 3IDYB 4GBXB 2Z8VC 3HE6D 4S0TD 1T1XB 5GISL 3CSGA 5DHYB 3EOYG 3VXRE 4FTVE 2R39A 2P46B 3HC0B 5K9JL 1AKJD 5EOTB 4GMTL 1F11A 5DMKA 3LKRA 2V6HA 3MRCB 2AKRA 3S8WA 2ZUTA 3LEYL 1KACB 2BX5A 1EEZA 1L7IH 3G6JB 2J12B 3CCHB 3DX7A 5BV7C 1CXEA 5J11B 5FYLD 1F97A 1XCTA 1B0RB 1ND0A 3FRPA 3MJ6A 3TPKA 4LLMB 3KNBB 3EOAB 5FGBA 3KR3H 3OKLA 2X9YA 1ZEAH 3MLTB 4UTBH 3RJQB 5TFSH 3S7GA 4CVUA 3B9KA 1I1CA 3PUCA 4PRBB 1MIEL 1MRFL 4BH8B 4QRTA 3BZDA 1CDCA 1LGVA 2EDOA 3VXNB 4DKFL 1WWBX 3R06B 4JZOB 4WW2A 1AGFB 3WV0A 5BRZD 4DAGL 3BPOC 4IOIA 1T1WA 4Y5VC 1M7IB 4U1NB 2AJ3B 1KB5H 4HQQH 1RK1B 5DQJA 1DLFH 5DD0H 2Z92B 1KENH 4XC3L 4L8BB 2DLIA 2VKWA 3LKQA 5L2JA 2G75B 2IWGA 2NXZB 3QIWA 1DQML 1Y6MR 3C2SA 4GQ9L 4R8WH 4L4JA 4LFHD 2QQKH 4OLVH 3D2UD 3ROLB 4GXUM 4PRHB 1IGTA 5DJCA 4GKZB 1UM5H 3IDXL 2WIMA 4FFWC 1P4LA 4C56A 1I8IA 3QDGA 1UT9A 4OB5H 5CFHA 2X89D 1TETL 1HSBB 2HFGL 3BP5B 4R97B 5IMLB 3KLHC 1AD9B 3KG5A 2PYEB 4U7SA 4NNXA 4LU5H 4ODSL 3C9NB 4R0LB 2QADB 2YEZB 1JHTA 5TDNB 3UTTA 5L6YH 1QFWH 1MCQA 2V5YA 1NMBH 2X4QB 1OSZA 2WBJB 3MOBH 1IGMH 2MPAL 1EO7A 1EBAA 4PJ7A 5KVEH 5CP3H 2HTLC 4Z7VE 1IGIH 1ULVA 2PW1B 5EIIA 2OQJA 5IJVB 4YZFF 5DO2C 1HEZB 5DRWB 3PJSB 4OJFL 3W9EA 2VJXA 1IZKA 1DEEB 4OSUL 3OAYH 5IMKA 1BVKA 1ZHBA 1MH5A 3DRTA 3H7LA 1DVFC 1KLGB 4X9BA 3DVGB 2DQCH 5E2TH 4X80L 1JF1A 2EIEA 1ORQB 1S7SA 4L5FH 3C08H 1YEDA 1LEIB 1ZT1A 1Q0YH 4Q7DA 1JIBA 5C0AE 4WEUD 5CEYB 3UTSB 4XVTL 3MNWB 1YMMB 2R8SL 2J4WH 1X5AA 3RGVA 4G7YL 4HKXA 3MBEA 4WCYH 3P3YA 5KG9B 3I9GL 3IFLL 3S36L 1PG7X 1DUYB 4JM4L 3OPZH 3MA7B 4JGJA 2DKMA 1PSKL 4E41E 4TUKH 3A67L 1KT2A 2XKNA 3RNQA 3CFBA 3EHBD 3I3DA 3MLRL 3MV7E 1HWHB 2VZUA 4OFPA 4DEPC 2WMPA 2FH6A 4I0KA 4QYOA 2P42B 5DTFA 3VXUD 3HZKA 4K3DL 4RMWA 3C09B 3QPQC 3CZJA 2Q1EA 5D7LD 3U48A 4HUWA 2VC2L 4GAJH 1ZS8A 5DJXB 3ZDYF 4YWGL 5JA8B 1FO0H 2AQ1A 3P0GB 1WUNT 3EYUL 2LTQC 2DM2A 4JO3L 4W70A 2QKIB 4YUEH 1XMWA 2WM0A 4F7CB 2A9NL 4GT7A 4WDIB 2A6IB 2GSGA 4HJGB 1BOGA 4AIZB 1LO3H 4NZUH 1HYRC 3AB0C 2HJFA 1BBDL 5A2FA 2R2HB 2YBRB 3CVHA 4J7RA 4UT6L 5L7XL 1UCBL 4M5ZH 4QCIA 1U3HB 3V4UL 2FWOB 3L7EB 4NN5C 5KAQG 1INEH 1WZ1H 2ZSVA 3MV9B 1XH3B 3I75A 2O26U 1LE5B 3NIFE 3IAQA 4L9LB 4O2EA 4M1GH 3EYQD 3X11B 3RVWC 3HB3C 3V2AR 1QBLH 3VRJB 1GIGL 2D03H 3E8UH 3MLRH 3T0EC 3KXFA 3QPQD 5I9QB 5C07B 3O3AA 3UAJC 2VLRE 5TQ2L 4XCFL 1YEFH 3T0AA 5JZ7D 1RUPH 2JELL 4JQIL 3TJEH 2V2XB 4Q0XH 3NGBB 4CMHB 3GSXB 1B0GA 3HR5B 4PJCA 4R9HA 1FBIH 5EU5A 5E6IC 3ALPA 3QUYD 3LKPA 3D48R 3BN3B 1FLRH 5KVGH 1TENA 4NP4H 2QADC 5FO9B 1UH4A 1I85A 2B4CL 1UWGH 4MB3A 4WHYH 1J1PL 1ZGLA 4P5KA 5GS2D 5JXED 3ULVH 1L6XA 2W9LA 2A6KA 3CFEB 4E41A 1QBMH 3BX7C 4O5LH 5I75B 3BSZH 5DDHB 2BOCB 3UTTD 3FOLA 1I9EA 1ZK9A 3FN3A 1ITCA 3CSPA 4LSRH 3WKML 3S35X 5DYOA 4PY8J 3S9DB 1NLDL 4I8DA 4MQSB 3ULSA 5A2IH 4RMTA 3GBNH 5JDJA 1F6FB 1KJ2B 2CKBB 1I3GL 4I48B 1RULL 2YD9A 4QHUA 1QG3A 3OKKB 3BIAX 2EDEA 5LBSH 5BRZE 1RZKL 3MJ8B 5AYQA 3DX6B 5INCA 4Z5RB 2XWJB 2N56A 3B8SA 4X8JA 5FM5M 3RKDC 2ESVB 1HE7A 3DARA 1DANT 1H15B 1DBMH 1ZHLA 3DSFH 2O5YH 4Y5VA 4DGIL 5GSVA 3WXVL 1A5FH 5EORH 5ISZA 2XZCH 4ZAKD 4UV4H 3WHXB 1PX3A 1IQWL 1X5HA 1A9EB 4CU7A 5C0IB 2HLAA 3RWEA 1HQ4B 2H2PD 3BW9B 4WJ5B 5I73C 2NY5L 3W39A 3MJ9L 3MRJA 3NFNB 1EHAA 4FXGB 3GIZL 1G7HB 4BZ1H 4MA7L 4K2UH 1QD0A 3GKWL 4XZUB 1MHEB 3DO3A 1EJOL 4Q6IB 4GG8B 4KJYA 1T04A 2NYYC 5T1KB 5D1XA 3VXRA 1MHPH 4AZ8A 2X10A 3PHQB 3CUPA 1FFQA 4KDVA 3HZVB 2VE6B 2CPCA 1FYTE 3FQWB 3GRWA 2EYSB 4XPGH 1A7PL 3QJHA 1LDPH 2Q86A 4JFDB 5ID1B 2HVKB 2Y25A 1I8KB 1QACA 4ZS7H 3TBYB 4C58B 4XGZA 5IFHH 2IQAA 1Y6NR 4Z7QE 1T3FA 4KTEL 1JHLL 3V0AC 5IB5A 3ZMRA 2G9HB 3L3HB 3UJJH 3B4NA 2R0KH 3O81A 5GRUL 3VDBA 3QG6B 1IGFL 5HY9A 3SJVE 1MCSA 3MREB 3MRFB 2JCCA 4HUVA 3IGAA 2HKFL 2VZ1A 1ZGLP 1R3IH 3RAJH 3U4BH 4EUPH 4UDUB 3OBAA 4GMSL 3WFBH 3ZE0E 4HG4J 3UBXB 3CDGA 3DI3B 5C9JA 4NO2A 5HYEA 2XYCA 3OG6B 4KPHL 4GKNB 1DQQB 1INQB 1HZHL 4NZJA 2DLEA 5FA3A 1G9EA 5FYJH 2XT1B 4O2FA 3GSWA 3O4LE 1RZKC 1I9RH 2H26B 5ENWB 2ICCA 1C1EH 4IOFC 1MJUH 4NQDB 4B50A 1MCFA 5A16A 1K8DA 4X7SH 3S88H 1LO2L 2ATPB 3D85B 3LY6A 4I2XA 1FDLH 4N0YH 4ZS7L 5E94B 4FFZL 5IFHL 1I4FB 3BKJH 4JG0H 1FL5B 1D9KB 2I60H 2ENYA 4RMRA 2R56H 1AGCB 3PGCA 2MMXA 5CHNB 2EYTA 1QFWM 2I07A 3P40A 4MCYB 15C8H 2IF7A 3ZYZA 3LQMA 3DETC 4AENA 4KI5D 4Y5YB 2GT9B 4JRXB 2FO4A 5BOZG 1CLCA 1Q72H 4PGZA 4XWGH 3GI8H 3DBXA 4GMSH 2F19L 1KC5L 2C4XA 1MFEH 4PTUA 1N0XL 4M6AA 2OTUB 4R7DB 3W81A 4AQ1B 4PTTB 4JM2C 4N0UB 3WNNA 3REWB 1C5CL 1N59B 4HUXB 1S3KH 2RIKA 1DVFA 4TN9A 2X4OA 1S8DA 1QFUL 3T2QA 3L3OB 2BXYA 5J1SC 3BZEA 4PRPE 5T3XE 1TJHL 1CN4A 4YBQD 3EYSL 3RFZC 2GJJA 2FDBP 3DIFB 3QFJE 1DUZA 5H35B 3I2CH 4FABL 1VFBB 1NEUA 3IKKA 1DN0B 5DMJB 1CE6A 5DT1H 3FCTB 1Z2KA 3SPVB 3OKEA 4DWHA 3RGHA 4GW4B 4KJPD 1QSFE 2Y5TA 2G5BB 4HUUB 5IKCA 4S1RH 2LU4A 4P57A 4X0KB 4WUUB 4XX1E 5CKGA 3FB6A 3BJLA 1S9KC 2LU7A 4U1MA 1QLRB 2J8UA 4S10A 5J1AB 3CZFA 4HK3J 3RPIA 3NCBB 2WBWB 1MRDL 3PP4L 2DLHA 4XHQA 4QRUB 1KSRA 5BZWB 2H3NA 5C0CE 3WFZA 3RY5A 2Y7QA 1E6JH 4JFPB 2XZZA 2DI9A 4ZD3L 1T20B 4O9HH 1KXQE 1Y18B 4MJIE 4L3ED 4P5TD 1H3UA 3GMLB 1UVQA 3BPOB 1HIML 4D94A 1SYVB 5FGBC 1QFUH 5C09B 1BIIB 2QJDA 3P0VL 1CG9B 1OGTA 5HHXL 5I75C 3KLDA 5IR1A 3PWJB 4MCZA 4OCMC 4LSPH 4X9HA 1JPST 4ORGB 5M94B 3CLEL 4R26L 3TNNB 3BP4A 4OD1L 4DVBB 1SY6H 3BXNA 5DQ9B 3RVXC 3CXDL 3L6FB 4AMKL 2H2PC 2EDWA 5C0CB 3QEUA 4P23C 1XCQB 3X13B 5J13B 1CYGA 2ADIB 1QRNE 3G9AB 1ZT4A 2XIDA 1NGXA 3ZL4H 4LRIA 5FCUH 1ZA3B 3QA3A 3LCYA 4OD2A 4BKLB 3UPCA 3RWIA 3A6BH 4NUGH 2I27N 2P5EB 1JNNH 3OMZA 4K7FB 1P7QA 1YQVH 4H1LB 2AK1L 3NN8B 3S3PA 5D1QB 2AXGB 2ICWB 2D2OA 1AGEB 3PGFL 5FHAL 3TBVB 2EIZA 1EMTL 1KN2H 2DTSA 3BDYH 4YC2B 1IEAA 4RWYH 1CBVL 3CFKA 2P8MB 4OGZA 4U2ZA 3CSYB 3O9WB 2DKSA 1MFCH 1QUNA 3WL9A 5EU6E 5KS9B 4LPUA 2NLJB 3CH1A 4HKBB 3WUWG 1HHJA 1EH9A 4Z95H 4LDLB 5JLZB 1RFDL 2NY7L 2ZNXA 2ZSWB 3F5WB 1YNKH 2OJZL 1TVDA 1HH9A 1ZTXL 4YO0B 4HQQL 1KGCE 1KG0A 4KRNA 1OGAB 2Z9TA 2VDNL 4QXGH 3VGGA 2DS4A 4KJQC 4RRPG 5HJ3B 2R0WH 1CXFA 3NIGF 4LAQH 3BKML 2ERJC 3QUMA 4DUWA 4LEXL 3T4AA 2ORBL 4DOHB 4WFEE 3K1KC 1BQHG 1MRCL 4P2OB 3VXUE 4RNRB 1U8PB 4C83A 1YQVL 2UUDK 1KELH 5EOQL 2UWEA 1OAZH 2X44D 5BZDA 1K6QH 3IDXH 4QOKD 4KK9C 1DQLL 1MCIA 5JTWA 2Q3AA 3FQRB 2DIBA 4JANA 3TZVA 1VFAA 4UQ2A 2NX5E 3SQOL 3NCYS 5HGGS 1S7UA 1W72A 4JKMA 3MFFB 1C5DA 3JWDC 2W0LA 2ZUUA 2Z8SA 1HSAB 4QF1B 2WWMD 4FQCL 4QY8A 5J6HB 2UWEF 2X4NA 3F12A 1CK0L 1J10A 4HMDA 4OZHA 5IOPB 3D0LB 1T03L 4Y2DD 2J7LA 4LHQB 5GISH 3FMGL 4Q97A 5HXMA 3NABL 5ICZB 4EVNA 2JTDA 3FQUB 3H9SA 3OAUH 1MI5D 2AJVH 4M6NH 3UEZA 1RU9L 1J18A 1JGVH 1WZMA 2R0WL 4P3CH 4U1KB 1VERA 4P2RD 4LEXH 4KMTH 4CRPA 2GJ6D 4NWUH 2FJFA 5GGSB 1IFHH 1LO4H 1UFUA 3MCLH 3IDJB 5J6GA 5LXGH 4Q9RH 5KANG 4TVPL 3LS4H 3O2WL 4UTBL 1B88A 1SVCP 2VB5A 4XNZB 1EAPB 4FMKA 4HJJL 5JDSB 5DK2B 5D70L 2IANE 4GH7B 1NMAH 4F33B 3KYMA 2BC4A 3IVKB 5TDPB 3O4OB 3VRLE 2XN9D 3I6LE 1R3KA 4FQQB 2XRAH 5FO8A 1AHWA 2DQDH 3SGJA 4L8SC 4U31A 1U3YA 3WFDH 3PDOA 4Q9CA 2A73B 4QGYA 4HWUA 3K8LA 1QO3B 4X7EC 3OG4B 1FYTA 4XC3H 3V4PH 1OWWA 2W38A 1RU9H 1AQDA 1QHPA 4XMKH 2QV2A 2ICEA 1FFPB 1T4KB 4M7LT 4P3CL 3SGEI 4P0DA 3TH2T 1NEZA 4EXKA 1D5BA 3LQZA 3SGDH 4ENED 3FO1A 5K9OB 3JUYA 5LWYL 2XWTB 1J0ZA 2IBGA 4LQFH 3ZDXE 4MXVF 1AC0A 4IMLA 3LAFA 3AXLB 1CFNA 3L3DA 4LSVH 2AV7A 1KCUH 2P5EE 4JO3H 1WCBA 4M61B 1XGPA 3TGXA 1JPFA 4DGVL 1LP9A 1AXSA 1BFTA 1GZQA 1EV2E 1IL1A 4JFFE 2V2WB 1R3LB 4RIRB 5KAQF 5FA4A 1MFBL 2XRAL 3VXPB 5MEOB 3BPCB 3MCKA 1EXUA 1SHMA 3LMJH 2VABB 2JJTC 3B9AA 4PJHA 2EE3A 4E42B 2XTLA 2JK5A 5HGHB 3PXJA 4HK0A 3NTCH 3PWPE 1SVZA 4ZUTB 2VQUA 2IPUG 5JO5A 2QSCL 4LSSL 5TE6H 1ONQB 3AU1A 4G6KH 4P4KD 1YEJL 5SX4H 4X98A 2OJEB 4LIQL 3WLBA 1NCDH 1NPUA 3ZT7A 4GG6A 5IVZA 3OX8B 3R8QA 3MCG1 2VSDA 5AAMA 3DVFA 4BH7B 2H2SD 2APXA 5FYLH 3RPKA 1OTSD 1OARH 3MNVA 3QFDA 3VW3L 4G8IB 1OW0C 3QUYA 1IZJA 4APQA 4CVWA 3MV8B 4O4YL 1ZGLM 5FAAA 2O5ZH 2H6PA 1K4CB 4I9WE 4PJXE 4RZCA 3C5ZD 2Q3ZA 4I0CC 3IU3B 4TSAH 5TF1L 1YYML 3LZFL 3CXHJ 1OAXL 2APFA 4DJMA 1IAII 3HG1E 4N0CD 2AXFA 4U6YA 4C57C 1GGCL 4UMGA 1A7RH 5ICYB 1JN6A 1NSNH 4G3YL 1LILA 3WDIA 5K59F 1XGTA 1SJHB 3U0WH 3JTTA 4F37F 1N4XL 5BVJA 3BEVB 4KJWD 2V7NB 1EA9C 3MJ7B 1CCZA 3I84A 4MXQC 3OAZH 4OKVB 3VRIA 1WFOA 4U6XB 3L3JB 5T33H 3O4OC 4HS6A 3AM8A 1NCBL 2W0PA 2DQIH 3QI9A 4R4BA 4EN3B 4LCIH 1Q9KB 2IH3A 3TYGL 2KZWA 1CQYA 3F6LA 1JGUH 3T0VA 5IIEB 2DAVA 2EKSA 1A7QH 4DVRH 3P11H 1JPSH 1YMME 4UILL 4FQXA 4LKXB 3QQ4A 2Z8RA 3SHSA 3RTQA 4PGCA 5T1LD 1VB9A 1PG7H 4GLRI 1DQTA 3G5VB 2OR7A 5HDOA 2C3GA 3EHBC 4JFEE 5F96H 1L0QA 1MCDA 5IG7B 3RZCC 3QCVL 2GY7B 3O2DA 3VXQB 5F3BB 3L3GA 2Z31D 4MNQE 2WUCL 3OF6A 1IC5H 1SEBA 4FQXC 2GSIB 3BWAB 3SJVA 4I0PB 4ZMAT 1ZVSB 3W0WD 4HKZA 4JDZB 5EOCJ 5GQBA 1QPXA 4ZUUB 5B22A 1R3JB 3QEQD 4MSWB 1D9KC 4DKFH 5T33L 3MGOB 3DUSA 3B6SB 1RZGB 3QIBA 3IKCA 4HC1A 5E1AB 43C9B 2GTWA 1P9MC 3ECBA 3VWJA 1HOCA 3OGCA 1YN6A 2NW2B 1C7TA 1K3IA 4HF5L 2NZ9D 1LE9B 4NKDA 4H25B 2BY2A 1C08A 2OI9B 3B9VA 1IGFH 5EZJA 5D6DA 3K4DA 3O3UN 2VITB 3IDIA 2BVQA 3GMMB 1PG7L 5EIVA 2FGZA 4B41A 4TYUA 1KN4H 3DUUB 4Z6AT 4JZNA 1R3HB 1NJ9A 1DQJB 1GOHA 1OAUL 4A6YB 1JWMB 3QDJD 1GHFH 3GI9H 4BFGA 1GGUA 1A8JH 2Z4QB 3GK8L 4MWFA 3TN0D 1CIDA 1XGRB 1RULH 5IFJB 5E2UH 3VFMA 4P4KA 5KSAD 3RZCB 1BFVL 1EGJH 1IT9H 3T2PA 3DXAE 4CVXA 5L9DL 5GHWH 1Z3GL 2C7UB 1DSFH 1F4WH 1EFQA 4ZXBB 4HWNA 2FHBA 1A3LH 1U8HB 3NZHH 1JGEA 1EVTC 2MCPL 1MAMH 1RIVL 1N3NA 3BKJL 4OFDA 2PCPA 1S7TB 1U0QA 2CXGA 3MSPA 1E4JA 3DO7A 3PP3K 1CD0A 4LSQH 1KJ2L 4YX2H 5DMIL 1CE1L 3FB8A 4JVPA 3WNMA 5MHSD 3EJJX 3JWOC 2EC9U 3GMOA 4EKXA 3RVVC 1TNMA 3ZTNH 3L5WA 3UTZA 1KF9B 1LK2B 3V0VB 1JTPA 5E4EB 2VLKB 3UJIL 3V95A 5FDWA 5EBMA 8FABA 4HWZB 1OM3H 4Y4HD 1BQLH 4HXBL 3HFMH 3HC3L 4Z8FL 1FL6A 2VN7A 3P9MB 2VDRH 4OF7A 3BRGC 3QWOB 3OHXB 5DJ0B 4QRRD 4BZYA 2DM4A 4FFVC 2FEDC 5ANMA 1UWXK 5I1IL 1GGIH 3MRNA 1H3PL 3SO3B 4QRRA 4HAGA 4WFGE 4L3AA 5D7IA 4PR5A 5HHME 1MIMH 2AGJL 2CDEA 1F8TH 4MZ2A 4FTVB 4KRLB 4LCCA 4DQOH 1TJHH 3OKNB 3O2VH 2D7PA 3MMEA 3O3EA 3EJZD 3CLFH 5DMGC 2R0KL 4XNQB 1LK3H 2XN9B 1NCCH 3X3FL 3G6DL 5ABDE 4TNWK 4M48H 4LHUG 2VLJE 1A7NL 5I2IB 5C8JA 3ALXA 1B6UA 3O8XA 4ORZC 2D9CA 1LEKA 2YD5A 4OIAA 4LVOC 4TRPH 2ZOKB 1EEYB 3LD8B 4YBLB 1H3WM 1FNFA 1JTTA 5D7LA 1AIFA 2IALA 1ZA6A 3QDGD 2IADA 2OL3B 3MR9A 1GZPB 1T6VN 4H88L 3QEGH 4OLUH 4L3EA 4R2GB 4K9EL 4NZUL 5H2BB 3UJTL 3TZVD 5B8CA 4LPXA 5KSBB 5F9JB 4PJBA 1M7XA 5E8NB 2MQ0A 4J6RH 1YUHB 1T66D 3VJ6A 5K9KA 1BM3L 2A74B 3GMPA 3OKMB 1VKXB 1KJ3L 4RMUA 4GRLC 2BSTB 4LSUL 3E6HA 1UB5A 5IB2B 1UCTA 4PJAB 5E8EA 1WV7T 1LNUB 2VDKL 1HXYA 5HI3D 1JZ6A 1NCWL 3PQYE 1Q0XH 2HH0H 5TQ2H 4J8RB 5C0JA 3UDWC 4WW2F 2X89A 1KTKE 4X6EB 4WI7A 3K2UL 5DEFB 1U8MB 5B4MD 3S96A 5SWZE 3PE9A 2X4TB 2A6JA 4QOKB 1MPAL 1TQBB 3GIVA 3VCLB 1AHWC 5D72L 4NWTL 1MLCB 3HB3D 4ONGH 3IJSA 4P2OD 1TZGL 1GGYA 1KBGH 2X1WL 3FHAA 4OUUB 4N9GB 1ZVYA 5JIPA 1KB9K 2WIIA 2NY0B 4MX7B 3PGFH 5IVXF 3BT2H 3BH8B 4P2RA 3O6FB 4JKPH 4PRNB 1KN2L 5CJOL 1A6WL 2EDXA 3QISA 5GPRA 3RWDA 2J6EH 2DMKA 1QFOA 5F9WC 2EIDA 1FCCA 3D39B 3OKDB 1QOKA 2ADGB 4PJBF 1WWWX 3L5XH 2ERJB 5C0FB 2YK1H 2NCMA 4AEIH 1T0NA 1TVHB 4R7NA 4RFNB 5E03A 5CJ8A 1WITA 3D3VE 3HTLX 4UT7L 3MRHA 4PV9A 4MAYB 1AXIB 3G5ZA 3BH8A 4WTZG 2XQBL 4ZNEA 2BNUB 4ZFZB 4OLYH 1AO7B 2CXKA 5IFAH 1YDPA 3TM6A 5F7KC 1T83A 5E00B 1HI6A 2DWEB 1G0YR 4YR6A 1NGZA 1NL0H 1NDMA 1AFVH 3ZKQD 1I1RA 2CLRA 3R8BB 3M1BA 2A6JB 1LMKA 4H20H 5CIPB 2A1WH 1T66C 4L3EE 1EGJA 3DLQR 5C0JB 3C6SA 1A9BA 3D3VB 5C3LD 3HE7B 2B5IB 3B2VH 1X6LA 5LCVL 4F8TA 3DMMC 5CEZH 1PYWB 5C0CD 1OTSC 3GRWH 4PJAA 5DRNB 4UU9A 3DX8A 4JG1H 4M93B 4HUNB 5CBAA 2CQVA 1T03H 3L95A 3VJ6B 3QRGL 4G8FA 3ARPA 3FMGH 4YE4L 4GSDL 4X5LA 1F2QA 4AEFA 1F3JA 3NIDF 5EO9B 4PD4K 5F9WB 4AEEA 5ADPH 1ODAA 3H9YA 4HFUH 4L3EB 5DEGA 5HYQA 5MEQB 4JO4H 1S7WA 2V7HA 1G7QA 5AYUL 5EOCH 4YHLH 4KZEL 4KHTL 3BO8A 3L3KB 2P48B 5ALBL 1QRND 1LO4L 2EDRA 2RQ8A 5FO7A 3K0WA 3BMVA 2ZOLB 3P4NB 3IRZA 5FHAH 4GXUN 1C16B 4XCNB 1JHKL 4NO5A 5KVMC 1OT1A 1CDGA 4ZO9A 3VGAB 4YXKL 3VFPB 1M05B 4IEFB 1FNSH 5CEZL 5IW1A 1MCPL 5EZLA 2X7LA 4LU5L 1UM6H 5FKAA 3ULVC 4JFFB 2XN9A 3QIBC 3EO9L 4G8GA 1JTOA 1JPTL 3LDBC 2YC1B 1AP2B 4CADB 2HA1A 3RX8A 4FTVA 1VACB 3QXUA 1ADQA 1XIWD 2BK8A 5FYJE 3LEYH 5E8DH 4FFZH 1J0IA 3P77B 3ROOB 2UYLA 3SCMC 1NQBA 3VDAA 4JG0L 5JXEA 1WIOA 3LRHA 3H9HA 4HIHA 3WD5H 1H3VA 4JFHE 4RMSA 3KXFD 3FO2A 2D7TL 3EDEA 5K33A 3SDYL 5B39A 4D3CL 2D4FA 1R24A 4L9LC 4JJHA 2DBJA 4C59B 5GS0H 4X4YA 1UENA 3CAFA 4LHUD 4L8CA 3FB8B 4XVTH 1P9MA 1HHKB 1QLEL 2RHEA 3V6FA 3MRKB 2PUQT 2HFFA 2ITDA 1CFQB 2RR3A 4NQSB 4PG9B 1L6ZA 4PP1C 3TBTA 5HHOB 5CSZA 3SKOA 5GGTL 3DURB 1J86A 3NOIA 2DYPA 4NM8L 4YDJB 3RUGF 3J7HA 3LEXB 3L1OL 3NACL 1Z9MA 3QUZC 4MAUL 2BRRL 3U1SH 2PYEE 2CDGB 2V17L 4AM0B 5EU3B 3LHPL 2NZIA 5BQ7B 4YHKH 4AT6A 4P46C 4Y4KC 1VDGA 2YHGA 1U8OA 4FQHB 3M17B 4CU6A 1JWMA 1HKLH 2BJML 4LOUC 1KIRA 2DQJL 4I3GA 3P4MB 4WIQA 3CFCH 2AAVA 3RA7L 5GIRB 2ZJSH 3DTXA 4G9DB 2UZIL 4ZFOB 2DQGH 3AREA 5IMMA 1YNTA 4M43H 4OBRA 3MLPA 3E6FB 3AC0A 4A2LA 3VI4E 1OTUC 1K4DA 1YYMH 3LZFH 3QDMA 4ZDHB 1MRDH 2R15A 4RAUB 1KOAA 2VZOA 1T1YB 1KLUB 3UTPD 3SDXB 2H9GB 1N8ZB 2NW2A 1YN6B 4C56E 1CL7I 4L29B 5JOFB 3RGVC 2GTWB 5E1AA 43C9A 3DJ9A 1INDL 1VCAA 4JPWH 1PX4A 4PV8B 3PABB 3KLAA 3U0WL 4QOKE 3DUSB 1K4DB 5T1KD 4X6BB 5KOMC 2X5PA 1MSPA 5CP7A 3B5HA 5MP6H 5CSBA 1ZVSA 2D3VA 1A1NA 4L4TD 3JTSB 4BJLA 4KKAC 2MHAB 3MLWL 3ARFD 1ZHKA 4OF3A 1G9MC 2APTA 4TPRH 3TN0A 4XP4H 4YEFA 5KVGL 3VD5A 4FQHA 4OF0A 5D7JB 4MAYC 1H8OA 5DHXB 2NTFA 5JW5A 4KUZH 1U8KA 3W5MA 1A7QL 3B2UD 4YAQB 3P11L 3QUML 3TLRA 3MV7B 4R4FH 3RL1B 3RUGB 3SE9L 3RTQD 1I7RA 3WE6A 4LOUD 2QQKL 4F3FA 4DKEH 5INDB 3SGDI 4P5MB 3VFUA 3BGAA 5F44A 2XPGA 3NTCL 4GRMB 4OZGA 3VFTB 4ENEC 5I1LB 5ERWB 3WHE1 4N8VA 1HHKA 3EGSA 5E08H 3VRIB 4OKVA 3FFCA 2FYYB 3QAZC 5DD1H 4HFWB 1QEWA 5D5MB 3FFCB 3TJHC 5A3IC 5DA0B 3RVXD 1RV6X 3GMRB 3EGSB 3H3BC 4N8VB 3TO2B 1SJHA 1IBGL 1N2RA 5L2KB 5HVHB 3IS0X 4LLWA 4GAYA 2XPGB 4OZGB 3VFTA 5GGQH 5CGYD 4M02A 4PJ7E 2B1HH 1U92A 2BVOA 3OR6A 4YNYB 1KJMA 4HIHB 2K7PA 2FJGA 3IFOB 1AI1L 4XCYB 5HPMB 3KJ4B 2UYLB 3MV7A 5IHBA 1FGNH 5D7IF 3H42L 1NAKL 3ARBC 1A6UH 5C0ND 4J3OC 4ONOA 3MUJA 3RWHB 4KKBC 4IOSD 1KTLA 2QQLL 3QUYB 4K07A 4G8IA 3PP3H 4HIIB 1FHGA 3FO0H 4AIXA 1UB6A 2JB6B 4U1HB 3QHFH 3CSBA 4Q2ZA 3SCMB 1GHFL 3GI9L 3QEQA 1CLOH 2OJEA 3WLBB 5DHVA 5BXFB 4G8GB 4LVEA 5CD5C 4FRWA 4K8RC 5SWSE 3UX9B 3ZZ1A 3V7MA 2BY0A 1A6VH 1FZOA 5JO5B 1JJUA 2A9MH 1BEYL 1DBJH 1LDPL 2VLLB 4HK0B 1FFRA 4ZSOA 3LD8C 3ARWA 1CK0H 1FLRL 1XR8B 2DM7A 3SDXA 2WINB 4TNWF 3E0GA 1U91A 3Q5TA 3O0RH 1BD2A 1XF1A 5HGAA 3HZYA 5ESAA 3RVUD 4GBXC 2VDPL 3AREB 4LRNL 3X17A 5IMMB 32C2B 3FQTB 1ZWIB 3LQAH 3QPXL 3VFVB 3DYOA 5T3XD 5LVEA 5EBGA 1KIRB 4NN5B 5E2WL 2Y5EA 2X09A 1XGUA 4WO4B 4KKCD 4IMLB 3KPSD 4Q9RL 3NA9L 5CZXD 2J8UF 2XWTA 2P43B 3D18B 4KK8C 4AT6B 2CK0L 2X2YA 1A6TB 3ZTJG 1L7TL 4NOFA 1PDKA 3I3EA 4U1GC 2F8XC 3FN0L 1QA9B 5EUOB 1AO7D 1FFPA 1T4KA 1NGQH 3JWNC 4YFDB 2BNQD 1LO2H 4ELMF 5I8CB 3WFDL 1QSFA 5HHOA 4P46D 2VUOA 1D6VH 4NKIH 3AVEA 1CFQA 2HFFB 2ITDB 3VRLF 5DJ6A 5DQDL 2J88H 4LLVB 4A6YH 1RK0A 3V6FB 4HV8A 1PD6A 5DJDB 3MRMB 3W82A 2Y36H 1FORH 3DMMD 2BVPA 3MV01 1KYOK 1T22A 4AL8H 3ZYIA 2OR8A 4OQTH 1NANH 4ODXA 5EN2B 2VDML 2VDOL 4O2CB 4JM2B 4NQCE 1S9YA 2EDJA 3MRHB 5T5NF 2NYYD 5SX5K 4EEEA 5IV2A 5HI4C 1JK8A 3MLSH 4S1SH 1WEJH 3OJVC 5AWNL 2EDLA 3H9HB 5E24E 4HWBH 3MRLA 1A1OA 4IDJH 3VG0H 2DQCL 4IIQC 4Y8AA 3T2NH 1UWGL 1CICD 3NCCB 4KROB 3NCFB 5D8JH 1DBKL 4NHUB 3PHOA 5DR5L 4PRNA 3G6JF 3IFPB 3PL6C 4EVNB 4ZNEE 3WKNA 5IEKB 3K80A 2WIIB 5DMYA 5T1MB 1J12A 1F02I 5DQDH 3OSKA 2E27H 3VXTA 2AW2A 4AH2A 2AJXL 5F9OL 4TUKL 4C55A 1S9VA 3RBSA 4U05A 1M1SA 1C5DB 2OSLA 3ILPA 5FIEA 5HDQH 3BIKA 2XXCB 2QSCH 1I3GH 2K3TA 4LSSH 5TE6L 3UYPA 1S7VA 4PGDA 4S11A 2PN5A 4KKCC 1U58A 3BH9B 4WFHD 2FO1A 2DM3A 4XCNA 5IBUG 2E7MA 4RGND 2FSEA 4JANB 4ZYKB 3TZVB 2DQFB 1MPAH 2D9QB 1F4HA 2B5IC 3HC4H 4OM0H 2JJSC 3E6HB 4OLXH 4KAQH 3UXFA 2YPLD 4OCRL 5FUCE 2I24N 3HLAA 3DOSA 3DPBA 3OXSA 3BWUC 4YDKL 3UMTA 3GMPB 3QO0B 3T4AB 2EDBA 5HYQB 2C26A 4WENB 2BCKB 5E8NA 3DV6A 3IF1A 3OZ9H 5AUMB 3BUYA 2Y72A 4FS0A 1Z5LB 1CGTA 4GAGH 5F7UA 1ZA6B 2MFNA 3GO1L 4KV5E 3HLAB 3U4EA 5F70A 5M7QA 4LGPB 3E8UL 4PUBH 1YN7B 3KYKL 4FHBD 1A02N 2ZOKA 1KCRH 2DL9A 1QBAA 4PJ8A 3CSYA 5KS9F 2HP4A 3CFKB 1MCHA 2W0KA 2VXUH 3P73A 2ICWI 2ICES 3AY4A 3H9SE 1O7VA 1S7VB 4TNVK 3TBVA 4PFEA 3VFOB 5KTEL 1WK0A 2ICWA 5CD3A 3V7AG 2VR4A 5CJ5A 3LKNB 4OCRH 3O6FC 4XNQA 1P4BH 3GFUA 3S6CA 3BYTA 1N64H 3VXTB 3QXTA 2CGRH 2P5EA 1HHGB 5SWZD 3CVHL 1DL7L 3THMH 4UNVA 1ACYL 4ZFZA 4XP5L 1U8QB 3Q2CA 4POUB 1YMHB 43CAA 3WIHA 4NZTH 5IHLB 1NGXB 4XHJC 1ZT4B 4J6RL 3VI4F 2ADIA 1KIQB 3EYSH 3HE6B 3QEUB 2VL5B 3AROA 2CSPA 5JW4M 3PWPD 3SEPA 4ZUVB 4AJ0A 3UAJD 3OHXA 4Z78A 4L9DA 4Z95L 2R1XB 3T4YB 4WO4C 1JK8B 2EXYD 4D0CA 1DDHA 5EA0H 2EEDA 3RWDB 4IIQA 4Z7NF 8FABB 4UTAH 1FIEA 3ZKMD 5ISZD 4HAFA 4M6OH 1LK2A 1AD0B 2RB8A 4L4TE 4P9MH 5FDWB 3V0VA 5C09A 2D7MA 5DK0B 4MJIA 2H32B 1UVQB 2C1PA 4NZRL 1J8KA 2WBKA 1IAIL 2EH8L 4TTDD 4N9GA 1T22B 3GNML 3U30B 4NJAH 4NRZA 4JFPA 2OX5A 3RWFA 3IJSB 5BZWA 1ZLWK 2IGFL 4N9OB 5KSBE 4S1QL 1XGYL 4QWWC 1IAMA 4ZO6A 3ARXA 3S96B 3I85A 5I8CA 3KYNB 2O5XH 3MV11 5FCSH 1MIEH 1MRFH 5CEXB 3FT4A 3EDFA 5ECJE 3GHEL 1OAKH 1MFEL 2HJKA 5J11C 2BNRB 5H37G 6CGTA 1MCWW 5KJRH 5LQBL 1OAUH 1X5ZA 4FQCH 2Q7YB 1MCCA 5E9DB 4YZFE 4DAGH 4JEGB 3PQYB 1D5IH 4U1LA 5EU7C 3F65A 4A6YA 1OAQL 5BO1H 2WP3T 1QR1A 1K8IA 2JCCF 5D6CB 2ZCKH 3BZEB 4UTAL 3Q6GL 2BVQB 3GMMA 4Y1AB 5H2BA 2E7BA 4FNLH 4RGMB 5ESAB 1JNNL 2OL3A 4K23L 3HZYB