3LYRA

Human early b-cell factor 1 (ebf1) dna-binding domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
211
Chain Sequence
GSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determination of Functional Domains in Early B-cell Factor (EBF) Family of Transcription Factors Reveals Similarities to Rel DNA-binding Proteins and a Novel Dimerization Motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator
molecule keywords Transcription factor COE1
total genus 44
structure length 211
sequence length 217
ec nomenclature
pdb deposition date 2010-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16422 COE1_DBD Transcription factor COE1 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3180 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lyrA00
3LYRA
chains in the Genus database with same CATH superfamily
5B3NA 2FJFB 1BZOA 1UACL 4PJ5E 2NDFA 5KSVA 4P2CG 4KVCH 1I3GH 2X6MA 1DJHA 1OAQL 3DXAE 5DUPH 3TH4T 2VSKB 5EOQL 4N5UA 4IMLB 5H37G 4PJDE 4U3HA 4K7FB 4FULA 3FB7A 3FQRB 1BOYA 1NEZA 1X44A 4U1JA 5H37H 3T8VA 4ALAC 3BVXA 1N70A 2RMNA 2OMVA 3KVPA 3DJRA 2PPAA 4IU3A 4PJGB 4XN4A 4B0MB 5E6UB 1MFDH 3VFWB 1IGFH 5KJ4A 3L2MA 3E6FB 3NZSA 2VN7A 1PY9A 1G7JB 1QRND 2WXHA 2Y22A 3GSXA 3W9DA 3ARWA 1D5XA 4LNVA 2OXGA 3LKNA 1RHHA 1NCIA 1BIHA 5DS8B 5DR5L 3W9DB 4OFDA 5A6LA 2HRGA 1VIWA 3QDGD 2A4ZA 1NSNH 5C08B 3A6CL 1BF2A 3MLWH 4PJGA 3PAUA 1JDDA 2OMYA 4BA0A 4DUXA 5B39B 2YOAA 3ILDA 5DJ6A 2QQLL 4Q74A 4BD4A 5AW7B 1YJDL 2PYFB 4UU9A 2Z65C 4PGDA 3SJVB 3OKOB 1A3ZA 2VB5A 4KKNA 2HKAA 1KACB 1KGCD 3FQWB 5IHWA 1IAOA 3MUGB 3H7BB 3IS1X 4KZCA 4Y16B 3ARTA 4N3TA 3VU1A 1SHSA 2EJ1A 2EIMB 3BT0A 1QMUA 4AQEA 3F2LA 2APFA 3FPXA 2VO5A 4PJDA 4JFXA 5JW5B 4JE4B 4ZD3H 1FN4A 2YPKA 3GMNA 3QAZB 4JFEE 1KTJA 1BVLA 1KTCA 3Q48A 1YNKH 4K3EL 4XO4A 1CGXA 4J3OF 2QKSA 3UMTA 2GCYA 5KBDA 1R33A 4HUMB 1M71B 3KH3A 2R39A 1S7XA 2V9RA 5IVNA 2E9GA 2IOOA 4N2GA 4OGZA 4PJ5B 5I2IB 4JRYD 4OF6A 1BQLH 1JD7A 4OJCA 4A7GF 2XG4B 3H1ZA 4E9XA 3HG1E 4KI5C 4LVNB 4LGSB 1VZGA 1QSEE 5JW4R 3N5AA 2Z34A 3M17A 2EDEA 2B14A 2ZXEB 4JZJC 1ZSDA 5C09B 1U33A 1NGZB 4DOHB 5FHBL 4JFPB 4Z6AT 3WFEL 4MLIA 4GFTB 4C56A 3CUPA 4MJ2A 1EIBA 1J5HA 1BM3H 3LPWA 5JO5A 2IQAA 4JL1A 5DVLA 4L1TA 5CF3A 5FA3A 3G5XB 4ECNA 3NFPA 1BM3L 3L1FA 4TNFA 1ED3B 4YXHH 2EE3A 2QZQA 3BRGC 1ECYA 2DKUA 4MMZA 3V9EA 5C70A 1DVSA 3FU3A 3RKDC 3RWHB 3VFTA 3EXLA 4RX4D 1HOCB 4J1UA 2G2PA 4Z78A 2R4RL 2JMRA 4XP9H 5DUBA 1HL8A 1C16B 3RL2B 3OAWA 4M93B 1RJLA 1EANA 2Q7NA 1X5AA 1BQUA 3IDMB 4XO8A 1HI6A 2ATAA 3IXAB 3NJHA 1ZT7B 1S5IL 5C07D 2C3XA 1DVFC 4F1SA 5L0QC 3P30H 5FIEA 3SGDH 2Y7OA 3GD1C 3HE6D 4XAWL 1CICD 3BIKA 5G2NA 2HLAB 4L0PB 1BF8A 2Q8AL 1WVZA 2E8YA 3MRCB 5DVMA 5BS0B 5E7BA 4TOYH 4BYHA 4M61A 2WWMC 1D5ZB 5EORL 3KLAB 2R23A 5DVNA 1U3JA 1JFHA 1HQRB 3ATEA 3C5ZB 3IGAB 4HZLB 5D2LF 5TDNA 3ULVH 1P4IH 2VXSH 2EILB 5MENE 5F7DA 4FLHA 1YAIA 3BWAB 5F21B 5IB1B 2HT4D 3LPOA 1A3LL 3X3FH 1M1XB 3UBXI 4Y4FD 1BREA 5JIHA 1XTMA 4PW9A 4XB7A 5DEZA 3A4DA 4JKPH 4S1RL 3Q8AA 2PPFA 3AM8A 3T2OA 1WZLA 2C3VA 3JWNG 3REWB 1QASA 2HFFB 3DTXB 5L2KE 5D2NE 3PWPB 2OV0A 1D7BA 3WN5A 3B7TA 2J88H 2Z8SA 4XPBL 4P49A 2LGNA 4LPVA 1I1YB 4LCCC 1QEXA 3ZJAA 1M2VB 1NAKH 2CSPA 2ZOLB 2A74C 5CJOL 2NY0B 3EO1A 5PCYA 3QDAA 4RMTA 4WU5A 5ERWB 4OJFH 4L0ZA 1LE9A 3FB7B 1KEGL 3L95B 3NSCA 4ZW6A 2ISDA 3WSQL 1YEFH 1TVHA 5TE7L 4L8BB 4WTQA 1BZ7B 4GBXA 3C5JB 4AX3A 1UJ3C 3OF6A 2FJUB 3JTTB 3QJXA 4AYEC 3KWWA 1T83A 1ZTXL 4HZ1A 1BQHG 3BZEA 3T3PE 3V9FA 2JFCA 4WJKB 1W9XA 1T2XA 1W72B 3BC9A 4LARH 2COQA 2X41A 4Q7DA 2Y5QA 5JIIA 5E00B 4LIQL 2QKIA 4HHGA 3GKWL 3EYQC 2X4SB 1UFGA 1IAKB 4P04A 3IT8D 2XN9E 3NCBB 2WV3A 5JIQA 1CPUA 1EEYA 3QO0A 4OFPA 3HR6A 1J9SA 3GJFH 1KGYE 5ILTH 3VI3F 1OW0A 4IMKC 5FEBA 2MNJB 4UQDA 5K1JA 4ZFOL 4JPWL 4ZBJA 3RDTB 1QRNE 2VXSL 4TSBH 3F58H 4P5KB 4GAYB 3H9SB 1MNUH 5JXEC 2DF3A 5E4EC 5HGGS 1MJJB 3S8WA 1K72A 5HI3D 1T5WB 3BZFA 3VD5A 4EZMA 2ADFL 3QZWB 1I9RH 4HHWA 4HLZG 5DHVB 3BQUC 4TSCL 5F72S 5TQ2H 2OJEB 3P54A 4ZOEA 5E2VL 3RIFK 1ITBB 1U8KA 1KCVL 4A7GA 1HINH 1HZHL 1CN4A 4QT5B 1EPFA 1W16A 1AQDA 5C0BA 4UWQB 4LHUG 4BFEA 4LLMB 5IOPA 4JPSA 4Y4HB 2YZ8A 3CH1B 1T0NB 1HZHH 4Y9EA 1P1VA 3B43A 3K0YA 3R19A 4G72B 3HG4A 1N59A 1WZMA 2FATL 3ILPA 1YC7A 3QQDA 3CJJA 1RFDH 5DJZA 1YYLL 2X2UA 3QH3B 5AW2B 2EO9A 1CK0L 4HWZB 3OL2A 5ALCH 1DVZA 3MNWB 4DAGH 5ABZA 2BSBA 3SCMB 3N04A 1X4ZA 3I85A 4LKCA 2CO7B 5EN2B 1GC1H 3SCMA 1ORSB 5D6CB 3SKOB 4PJ9A 3DJSA 4CMMA 3CDFA 3PFUA 4FA8A 4ELKB 1A0QL 1KCRH 4NSKA 4UINH 2C26A 1MW0A 3JT0A 1RHHB 1TTBA 4OLUL 4ANWA 4LGPB 1NAMH 3PGCB 4L9LC 3QUXB 2AK4A 4JHZA 5AAMC 4IBVA 4RDBA 1WHOA 1M6OA 2F5AH 3VFWA 1TQWA 2J8OA 2RB8A 4L4TA 3QEQD 4Y5XB 4F7TA 1XH2A 3KBPA 3NG5A 1MAKA 4U1MB 2JSFA 3DHUA 3N55A 1C5DA 1AH1A 5HJ3B 3GJFA 1GJIA 4QXGL 2OTWB 1NC4A 2QPDB 3G08A 1FRGL 2XY2A 1YY8A 3H9HA 3K2MC 2NY5C 2EINB 4JY5L 3QZWA 1SOKA 4NZUL 5F3HB 2ILLA 3LB6D 3I9IA 4NNYB 2YPLE 4E9VA 3P9MA 2NNAA 2OMUA 2AMUA 3PV6A 1D9KA 5IWLA 4J3OG 3CPUA 4RNRB 2BFVH 2YC1B 2B20A 3BUIA 1WZ1L 2R7EA 5D71H 4UUJB 5EO9B 1BAGA 3MRPB 3V0WH 4OV5A 1WJ3A 3BKYL 1E8XA 4EI5C 1RIUL 4P57B 2NX5E 2R0ZL 1TFPA 5BUPA 4HDIA 4PRHB 4AJVA 4ZS6C 5HPMA 3EH1A 4ZMPA 1FVCA 3V79C 4WFHD 4IS6B 4UQEA 3LY6A 4KKPA 2AC0A 4HUXA 1XIWA 1E6JH 1KZYA 2HT4C 3MZTA 4XBPA 1WBZA 1QACA 2R8SH 5FHAL 2VR8A 1AFVH 3BZEB 1ZJAA 1L6PA 1XF4A 4GXVL 3S3PA 5DQDL 1VFAB 1BYNA 4IBQA 3D4CA 2A77L 1LDPL 4O58H 3RVVC 1DUYA 5E08H 2P5ED 2YSSA 4PJEA 5SWZE 4Z3FA 3C5ZD 3DVFA 3W5MA 1JHKH 3LQZB 4JJ5B 4X6FA 4YMPA 9PCYA 2IH8A 3JWNC 5EB9A 2NXZD 4QY8A 4CN4A 2W38A 3L13A 1UWYA 3TEXA 1KN2L 5KVEH 4KVPA 1NBZB 1F6AB 4KUZL 3TNNB 1IQDB 1NGWB 1NPNA 2ZYIA 3TA4D 3FOMB 2HG5A 5LQBH 1OAZL 2DZEA 4ZTEA 3IWVA 3ELAT 3U6XA 3T4YB 25C8H 4G8EA 1FLRL 4G11A 4TV3A 4L4TE 2HX9A 3VXRD 5JYMA 1JI1A 1NIBA 2L8AA 3L7FA 3V4PH 1MIEH 2VN6A 3FFCB 5L8JB 4TQPA 3MLUL 4ERSL 1F4WH 1MFDL 1FE8H 4NGHL 4F2MA 4FYTA 4MNHA 4OI7A 4IOSD 4WI8A 4KHTH 3B9DA 1EZVX 2OK0H 4K7PH 1F4WL 3F7RA 4MA8L 2ZWZA 4UBDC 3LZLA 2FX7H 3D06A 1JV5A 5MHSD 3BQVA 3LNEA 4X5WB 5K59E 2P24B 4ZAKA 2X4TB 4AYFB 2EADA 4BDVA 1UURA 4NT6A 3RFRA 2NDGA 1KBVA 2HTKC 3E7JA 2WXJA 4IIQA 1EGJL 4DQOH 5LGJA 1U3HA 1CF8H 4QXUH 1Q1PA 1T7WA 3WIIL 3KGUA 1NLBH 4NNPH 1ZEAL 4L48A 3CLWA 4MQXC 1DVXA 3O3BB 3U9UA 5JR1H 3MNZA 4MA3B 3T0AA 5I1JL 2M2DA 2EYTA 2EDMA 3SIKA 3CH1A 1NGPH 4MX7A 4LOFA 2K3HA 4NKIH 4GO6B 4OBRA 4IK6A 1K5NB 5E9DE 3F65A 3O9WD 1VA9A 8CGTA 4ES9A 2X4RA 3H0TA 3KLLA 4H5SA 4U1NA 3WGUB 2E86A 1UA7A 5EMYA 3CFBA 5EH1A 3RNQA 1J0YA 1SJEA 3MYJB 4JRXD 5E2JA 4E68A 4KVCL 5IF0B 5E94A 4M1CC 4L1SA 2VISB 3UIZA 3STZA 1DYZA 4C59B 3LKOA 2ZXWB 3ZZLA 3TYFA 2DQJH 1DUYB 1MAJA 5JPNB 1JPSH 1PCXA 2A6DA 3D69B 4PJXA 4RIRB 3SY6A 3BJLA 5LN4A 4PR5A 1NKRA 2EXWC 3MMEB 4AEHL 4KU1A 2G3ZA 3BXNB 4I3GA 3CK0L 4AJ0A 5KSVB 3IGUA 2E75C 3WAKA 4PJ8A 2Z4TA 2HT3D 4YNYA 1ZLWH 1GZPB 4P46D 4Z7AA 2YOCA 3LRHA 4PYHA 2G5BB 1RZKL 5HHQB 1D6VL 1N18A 2VXUL 1H8LA 2HT2D 1IBFA 1NMCB 2W59A 2W91A 3OZ9L 4OVVA 1ZV2A 1S4IA 5EBMB 3DV4B 3U1PA 2YMXH 1U42A 3BDXA 1U4EA 3VXRB 4EXKA 1IBHA 1UM5L 5CJQL 4FNSA 3P0YH 3HAEH 4E36A 5DZAA 4DQAA 4E0RB 4O02A 3FT0A 3SB3A 2CHNA 4A2LA 3S35X 4EDWH 3VU2A 4ZOAA 4O51B 3T3PF 3L4ZA 3B8YA 1XCTA 3ARBB 4G59C 4AENB 3CFUA 5C0IB 4XXDB 5DJXA 1A8JH 2XX1A 4LASL 3DV6B 5KS9F 1UM6H 3QNYA 2P8LA 1TUPA 2Z93B 3GSVB 4W9GC 5FGRA 4OFIA 3SGKC 3UZEA 4GXUM 3IFPA 1G7MA 4FABL 4GQPH 4YSUA 4ZMQA 2CCVA 3DSNA 5DJ8B 1SDDB 1XH0A 4XODA 2EIEA 3N9GL 3HE7B 4Y1AE 2PKDA 5BVPL 4YHNB 3K6FA 3DRTB 3RX5A 4WGVB 2Y5TA 1BQ5A 3EBGA 5F7EH 3SQOH 3KR3H 1BV8A 4PUBH 1QFPA 5FGSA 4PLNC 1IFHH 3CHOA 4JN1L 1B9ZA 1FL5A 2AI0H 3B1TA 2VDKH 3GO1H 1YNLL 4FHJA 4RDQG 2JB5L 3T6QC 4C47A 4ES8A 3GMPA 4JANB 4LKCB 4TLSA 4JFFA 5HPOA 4CVZB 1CDJA 4WWKC 1PEWA 3T2PA 2ZUQC 4AG4L 2RD0A 5KOMC 3I6KA 1Q90A 2P47B 2WYTA 5HTSA 1LK2B 3MNWA 3ZPDA 1QNIA 1SGKA 4JN2A 4R3SB 4XO3A 3EOTL 2ZJSH 4QCIB 1OTSD 2ADGA 1CFTA 4KZEL 4HQQL 4PJIF 4ZYKB 2WQUA 4XCCH 1N3NB 2WCGA 4XN2A 3T8MA 3NIDE 32C2B 3MHZA 4MCMA 3VFSA 1D6EB 2YD0A 5G4NA 2AJYL 3RY4A 4YVUA 1RVFH 5E4EB 2WTRB 3BP5B 4ABVA 4MSWB 4UM9A 1JHTB 1JRHH 1KCBA 4M00A 4P5TD 2Z7YA 4YC2C 3V6OA 2R7EB 2F68X 3I3DA 4LBEB 3IN0A 5GRVK 3MR9B 4AGPA 1H0DB 5EIIA 5I1EL 5D1QD 4FFYL 2HJLA 5D1XE 4MDIA 5EZJA 3BGMA 2LHAA 5FYKU 3TIEB 1U95A 3QFDB 3EGXA 1F6FB 2Z91A 3H42H 1O9VA 3S37H 1WUNT 4MJIE 4QRBA 3ULVL 4PSPA 1PZAA 4TUOA 1AGBB 3EJZD 5C09A 1KIQB 4AITA 4XXCA 3RHWK 3UO1L 1G9EA 4FC3E 1WFMA 4JPWH 2FH8A 5EO1B 3TH3T 5F1OB 5I71B 1EHLL 5DC2A 1T66C 4K3DH 1U3HC 4N2CA 3TV8A 5I8CA 2QQKH 1WA1X 1LK3L 2O93L 4J3OH 4P05A 4GKZB 2DDQL 2GG1A 4JKKA 1NDTA 4NOFA 2C1OA 1P7KA 3BEVA 1VFOA 2JCCA 2QGCA 4MJ5B 3T8XA 1MLCA 1U8NA 5GGVY 1OM3H 3MCYA 3SE4C 1F3JB 5I9QB 2OP4L 2WLMA 1E2VA 4P8QA 5T3ZD 3QIWA 1XFPA 4XVJH 5EN2A 3F6JA 3QWOB 3GXTA 3EG9B 2UXFA 4NYLA 1YN7A 1FIGL 1P5VB 3MJ9H 5FYKD 2ZPKH 3AAZA 4Y2DD 4I0CC 2FEDD 5J1AA 2AEIT 1XR9B 2VN4A 5BUGA 2UV3A 2CMRH 3MRHA 1JNNL 4FFVD 2ID5A 4F33B 3BAXA 2SODB 4JFZH 5TE6H 2CAKA 1Y0LA 1RFDL 2OJZL 3FHAA 3FFDA 4PJCA 4XCFH 2H26A 1Q0XH 3QXDB 3UCQA 4FI7A 3S35L 3X1NA 2ZOOA 4LT7A 1EDHA 1F2XK 1IKFL 1SDYA 5K59F 4U1MA 5E2WL 2ZKXA 3G5ZA 3E9TA 1KIRA 5TF1H 5E1AB 2X53A 1M7IA 3IK2A 4HJGB 4X6CE 5HHOE 3WIAA 3FC8A 1AO7D 2EUXA 1IQDA 3OMIB 5JOPD 3MOAH 1BMZA 3GXFA 1L9TA 3QNYB 5BJTB 2CM6A 4NDMA 3VD9A 4J4PA 3STLB 4FHKA 3WN5C 1MCOL 1XB8A 3I74A 3ARBA 3FB5A 4LSVL 5FCUL 1FFNB 5DJDB 4MJIB 4NQTA 2H3NB 3MA9L 3GRBA 4GS7C 4AUYA 4DP0X 4PCKA 2E59A 4HWBH 3WXVH 2AXJA 3MA9H 3RWEB 1TYJA 3SDXF 4OB5L 1U8OA 2ZX5A 3A4EA 3O3UN 5AWNH 4W93A 2FJFA 2R29H 5DLML 2QDVA 1UWXK 2GW5A 4N9GA 2X4PA 2XT1B 3QAZC 1YEDA 2WHVA 1N59B 2BRRH 2EC9T 1QHQA 2F5BH 3QG7H 1Z3GL 3GIZH 4YFLI 5A43C 1JV2B 4JFYB 3HE7D 5H35A 5DFVC 1ZVYA 1G7HA 1T1YB 4EQ3A 4Y8AA 1IC1A 1OSZA 2UZPA 2YAHA 3WIHH 4LIQE 1EJ6A 4WQOA 5L4FA 4MQ7A 4LVNC 3HZYB 3LH2L 4XPHL 2AJXH 4KK6D 5GS2D 3GHEL 4I1NB 4MNQD 4YIQA 5J0BA 1ED3A 2CDEB 1RJYA 3WIHL 2R0ZH 1M7DB 4QHUB 2AQSA 3FRPG 3Q6GH 1E67A 1GGBL 1SY6H 2I26N 4Z7NE 1SDAB 4OLXL 4TQEL 3EAKA 1WFTA 4TMPA 1QSEB 1N4XL 3EDFA 4J39A 5I5RA 1QD0A 5AUMA 4I3SL 4A2DA 3QUYD 1BAFL 1BVKA 1OD7A 3X1FA 3H2QA 2AAVA 4YHIB 4YHML 4D3CL 5CGYD 2CGYA 4MD0B 5C0BE 1XXFC 3GTNA 1HCVA 1J87A 4F7TB 5AVSB 3TURA 4JHWL 2P80D 5JHDA 3RGBA 3QUKB 1NAML 4PJ7F 3VQ1C 2XWXA 4R8WL 2YGPA 2DTML 1Z1WA 2NNFA 2WUBH 5KG9A 5KSUA 1QUNA 3KYKH 2CDGB 4H7VA 1CD9B 2CRYA 4GH7B 4QHPA 2P45B 2IPUG 3HHMA 3K81A 4PJDB 1JGVL 4FE9A 3IJYA 3HE6B 2WUBL 3RUGF 3TN0A 4PCTA 3KG5A 4RGNE 1DLHA 1IBGL 4HZLA 3GUTB 2OULB 2ZKMX 3BP7B 3A4AA 5SX5K 1JXFA 1AR1B 3NTCL 4K2UH 2WXMA 3QEUB 3IKCB 1J5DA 4HBQA 3SKJL 4UQ9A 2J2ZA 4NP9A 3DGGB 2W0FA 2A9AA 4LLDB 4TF4A 3K72B 3WV0A 5E99H 4AK1A 1MRCL 2H6PB 1O75A 2DMBA 5H2BA 3ILPB 2XZCH 1MFBH 5G5DA 1VFBA 2HJKB 2H4EA 3UTTD 2OK0L 2R0LL 1XT5A 1S6NA 4OZGE 2K3TA 1DQJB 1ROCA 2E7BA 1PZDA 3D48R 3IYLW 1JTOA 3CHSA 3ECBB 3HUJE 3NPSB 3Q2VA 4NUGH 3WUWG 5IHBA 2Z9TA 5D7IA 4LDEB 1HOCA 2CD0A 4Z78B 1WZ1H 3D2UB 4PP2A 4W70A 4OGAD 2YBGA 2ADJA 3IDIA 1E8WA 1NCCH 5ESVA 3O2VH 2N56A 1N64L 3BGFC 5CHNA 4YAQB 3CDZA 4RMBA 3QQ3B 3AM8C 4F91B 1JNJA 1AC0A 2PABA 1N6UA 3LQZA 1G7PA 4N2IA 4GG8B 1S7SB 4MS6A 3T0VA 2YGOA 3O6MH 3S48A 4D9RD 5DD0L 3ECUA 4EUPH 5C0JB 5K9KA 1CT8A 1W0VB 2RQEA 4RWYH 3QFJE 1OLLA 2DLTA 2NZ9C 4DKTA 3LRKA 1D5ZA 4PW3A 2PCPA 2XWJA 3ARYA 2VABA 3CH8A 3UAFA 4QRFA 3C08L 1CU4H 4JGNA 2HLAA 3BGFB 1VJSA 3FU7A 4F2ME 5E08L 3BKMH 2H45A 4UM8B 4DN3L 1VADB 4OCRL 3TJEL 4JFQB 5E8EB 5IFJA 1CFBA 1AHWB 4OLEA 4OSUL 4MB5A 4HDIB 2CGZA 2WINB 1EEZB 4F3FA 2CO1A 3BI9X 3KBHE 5J11B 3UTPE 3FHQA 5AAWA 3B9KC 1JK8A 4MCNA 5A1AA 2GK0A 2HFEA 2D7TL 1Q38A 4YUEH 1Q1JL 3JWOC 3JWOL 4U6XB 4Y16A 4PI0A 3K8KA 2DLIA 5D1XA 3Q6FA 3HJ0A 3BRDA 1XTLA 4F1ZA 2DQCH 2PETA 1YPZF 3AQDA 4XI5D 3ZDXF 3HNSL 1MCKA 5B7MA 4YSQA 4HWUA 4AGQA 2LAAA 1S9XB 1QRNB 1KENH 4V1DB 4CAGA 1EFXA 1FPTL 3PUUA 2X87A 1L7TH 2OR8A 5ERWA 3RX9A 3RGVA 4HV8A 5MEOB 1A7QL 4IEFA 1CICB 3C60B 3NGBB 4O02H 4XNQA 1WFJA 1XGTB 2NY5H 1SJMA 4FKHA 1NFIA 4H1LG 4JR9H 2XJLA 4R4FH 5I1IH 1NGQH 4H40A 3BUPA 4FGMA 3D33A 4GBXD 1FO0L 4YR6B 3WUWB 2X4NA 3H4FA 1LEKA 2JJUA 2F8XC 5CBAB 1OGAB 1RK0A 3QXDA 4PJEF 3D08A 5HHPB 3P2BA 5FYJE 2FE0A 1N6QH 3GLDA 4N0YL 3VVVA 4FDWA 2A3TA 4QHLB 4NS0A 3BQUD 2V4LA 3NBNA 4KDVA 4LCYB 4C8XA 1B4LA 2AEWA 1KGXA 1DQML 1J9RA 2KERA 1GC1C 3BVTA 3ZDYB 3DIFB 2BO0A 2DQMA 3RB7A 1KPVB 1UZ8B 2O30A 3CXDH 4KH2A 3L4TA 43CAB 2V17L 3KPMA 3EDJA 3JTBA 4ZUTA 3C87A 4DTGH 4HX1B 2XXFA 1S7TA 4NQDB 2C3HA 4PHXA 5F3BA 2Y2YA 5DUBB 3CDGA 4IIQC 4K5OA 3A6BH 4CU6A 2B15A 2EAEA 4KKLD 2NUPA 2ZYSA 3MNVA 4NHCL 1RY7B 1XGUA 4ZNCD 2MPAH 3T71A 3GINA 1C1EH 1NANI 2IDQA 5M95B 1UXSA 1JDAA 1NDGA 3VFPB 4RZKA 3FO1A 1KXVC 2C3WA 2IFFL 5A7BA 1LL1A 1QO3A 3FQ1A 4DW2H 5CILH 2FBJH 4ZO9A 5IBTH 3MRBA 3OX8B 4L1BA 1AGBA 2FO8A 3VXOA 4QR7A 3FUNA 1WIOA 4W1TA 5FYKH 4PHZA 5C07A 3RWIA 1MCQA 2FGWL 4FAAB 1FIEA 4CKQA 4UQBA 3EGXB 4WWOA 3UYOD 3ZQ9A 2JTDA 3HZVB 4KI5F 2D7OA 3C6SA 2IH9A 3SDYL 1JVKA 2EKJA 3KBEA 4N0UB 3V5HA 1A5FH 2HVBA 3RJDA 1OWRM 4PG9A 2GJ6E 1JPFA 1V3KA 2LLNA 1DVUA 2VLMD 3RG1C 1ZLVH 1GKOA 2DIEA 3ZL2A 2B2XH 1MJ8H 4LCCA 2V3DA 4LL9A 4OZGF 1XAKA 3QDMA 4PJHB 2FT7A 4MQTB 5KVDH 1YMMB 4FCHA 1BQKA 1F2QA 3QFJD 4IM8A 5E51A 3FYEB 3M1OA 4TOYL 4ESKA 3FUHA 1PLBA 2GSIB 1IM9A 2IGFL 4YWGL 5B1CA 5HJGA 3W0WE 1NUNB 1WS8A 3MRRA 1TVBA 2IFGA 4BIKA 1LILA 2J20A 3L3IA 3T65B 4I18C 4N6RA 2EDXA 2RALA 3IJHA 3W82A 3STZB 4PRPD 3CBRA 4TLTA 2EP6A 4NENA 3MXWH 4ZPTB 2VDOH 3EO0B 4N8VG 1KB5B 4X7EC 5IQNA 3VI3E 4R4BA 3WFDH 5K9KB 2O61A 4UOJA 4YSAA 4S0HA 3QFJB 5MEND 3MBED 5B39A 3BW9A 1S78D 3V6ZB 1CL7I 3QUYA 4RMVA 5HI3C 2X42A 2XFGB 3HCVB 4CGUB 2ZUTA 4K23H 1JGLH 1SYVA 4R4NC 2E9BA 1JUFA 3ZSTA 3S3SA 4GW4A 4AM0A 2DEXX 3VD1A 4NQED 1SYVB 1ZLSL 3E1ZA 3LNIA 4L8SA 4GAAA 1FFQA 4M8VA 4QRRD 4WV1B 2P42B 4KVNL 3V6ZA 5JHBA 1IAIH 1GKEA 1N0XL 3FONA 2P24A 1JGIA 1KLGB 1PD6A 3FQTB 4G6AC 1CD0A 3QUXC 5A2BA 4J3WA 4K7FA 4MA1C 1SXAA 1I8UA 2W80C 4KJPD 3WS6A 1CXHA 4Y4FC 3G6JB 4N0FA 2ZX7A 2BOBA 3S8GB 5LLIC 3EYUH 4PG2A 1IGYB 2PP8A 3AROA 3G6DL 2VDPB 4K94L 4APQD 1FV1A 1RZJH 4P99A 5ETUB 1BWWA 3GUTA 1LEIA 1FF5A 2OYMA 3ULVC 2QSVA 5CSZA 3VG0L 4RMRA 3K71B 3EH3B 5FDYA 2WOYA 3C8KA 2MCG1 1FNSL 3WYRA 1QABA 1M42A 4Y9FA 4Z76A 3VFMB 2AS5M 4HPOH 1UOKA 1YQVL 4FXGC 3MGAA 2CA3A 4OCNC 3KGTA 4R0LC 1JF1A 3HPLA 2QQNL 1E90A 2QVFB 4MA7H 3LCYA 4HG4K 4U0RC 3V7AG 1J10A 2ZNWA 5DZLA 3VTAA 4G2AA 4GKSA 4OCWH 4BGLA 1O9ZA 2E7MA 3NFPB 3IBEA 8FABB 3X11A 5B1AB 5LNGA 4M3HA 4PCYA 1MJUH 5TGBA 3BKCH 2FD6H 2J72A 3PP4H 3Q2LA 4LO9A 3LQAL 4NBYB 4GRLB 4PJIA 2EXYC 4TVPD 3WJJA 2X1XR 1H6UA 2NY4B 4IQHA 2FD6L 4RFNC 2HTKD 3O4LD 1BF5A 3RDTA 3APDA 5DWPA 1AYOA 3AXLB 4XCNB 3QJFA 3RWFA 3KPSD 2EDDA 2D0FA 3F7YA 2AV7A 4ICWA 2DEWX 3BPCA 1F90H 2BVYA 2M26A 3F12A 3MLRL 5HGAB 1B4TA 1EHNA 5DJ0B 5F89A 2GFBB 4TQIA 5LCVH 2IDUA 2PW2A 3KDPB 4NZRL 4WWKD 3VWKD 3MJ8B 4UM9B 6CGTA 4QRTA 1K3ZA 5C2UB 2XBTA 2IEPA 3O2DL 3Q0HA 4JFQA 1XF3B 1QFUH 2P8PA 5SWZB 3SD2A 2MCPL 1A7PH 4BQBA 1QQDA 1T20A 4JO4H 2VDRB 1MRDL 1G6RL 3BVDB 2QVTA 1XZ0A 1J0ZA 3NZ8A 4JHWH 2OL3A 2AFNA 5I8OL 2YA0A 3DGGA 5IK3B 4ZAKB 5J12C 4XBGB 4OZFH 4DPBX 1IO4C 1OGTB 4NZ8A 4FTDA 2G75B 3TF7C 4LHUA 2MFNA 2CKBL 1DQLL 4OLUH 4A7QA 1FVDA 3FHEA 3N42F 1JZHA 2EUZA 1TCRA 4X9YA 5E6ID 1JGVH 5TDPB 4PYGA 3U2IA 4DEPB 3F00A 2UZYB 3ARUA 3NRPA 4FA6A 1B4JL 3JV0A 3GSWA 2GTWA 1MQKH 5F9OH 2CA4A 1T1WA 2VDKB 4HULB 3JWDH 5EF3A 3S5LG 4OJDH 4KK5D 4YHNA 4PG2C 1D5XB 1MCRA 1EWHA 1MCPH 4FQ1L 5CCKH 1BXXA 3VI4E 5E1AA 4JFSA 3SKMB 3WS6C 4QRQA 1H9DA 1BWMA 5T5FA 5DTFB 4PM1A 2R83A 1FNAA 4YJZL 1INDH 1NEZB 2LLGA 3FAXA 1MUJB 1QA9B 1YZZA 2O5NA 3C6LA 3FFDB 4I9WE 4PJCB 5B22A 5CZXC 3BESR 3HMWL 1U8MB 5EU3A 4IW4C 4NUGL 4ZPTA 4BKTC 3MRHB 2PYEA 3BKYH 5I8EB 4KO5A 4GRWF 2AEOA 4ALAH 4D7BA 4PJCF 5HYFA 3IJHB 3HNVL 5ACZB 3BIKB 4NLHA 1HYSC 3GHEH 2AW2A 4F57L 2HFEB 3SJVD 4M7LT 5D8JL 4LDOB 5D6DC 1JN6A 1OZTG 2GBAA 4ODXA 5CN2A 3UBFA 4UYPA 1MWAB 2R1XA 5HY9A 4R5VA 4GW5B 4WHYH 2KI6A 3OSVA 4JO4L 3V5DB 4R8WH 1P4LB 5DQDH 1XCXA 4ZDHA 4UINL 1INQA 1AD0B 1L0YA 4G6KL 3SE8H 4HOZA 1PLAA 2X4QA 1KYFA 3L5XL 5FCUH 4OV6F 3GMRB 3T4AB 1BAWA 1TG8A 3MRPA 4H0HB 3ET9F 4JM4L 1AD9B 3RA7L 3NEOA 3RWJA 3VYPA 4NCC2 1BZ9A 3RWIB 2ZWYA 1KXQA 3KPTA 1QHOA 3U6XS 2VJ0A 2DLFL 3ZGHA 2XVKA 5D4JA 3U9PH 4R4ND 4R2GD 1BEYH 8FABA 4M03A 1BEXA 2KC0A 3TCTA 3OG4B 1JL8A 3IU4L 3IJ7A 5KUKA 3QEGH 5C0CE 5TQ2L 2NOYA 2W92A 2BRQA 2VLKD 3T2NL 3HNSH 4GG6F 4XP5H 5H35B 1VENA 2BVQB 4ZMWA 2AQTA 1FFTB 4MX7B 2R2BA 2I9TB 3HN8A 4HX1A 2ZONA 1Z2KA 32C2A 4RRPG 2XZCL 2DTSA 3VFOB 5GS0D 4ELMB 2BFVL 2PXYC 1KPVA 2NY0D 2YPVL 3S6CA 3IVKA 1UXWA 2VR7A 1K8DA 4YS4A 1WITA 3IS0X 2DQGH 3X12B 3WTYA 3QWNA 1CZ8H 5DVPA 2E9WA 3SKOA 2P9RA 2AXGA 4YSEA 5T1DH 1TDQA 1LP9E 3KPNB 5BVJA 4Y0GA 2PYFA 4GPVA 3H3PH 4YZWA 1G87A 3HRPA 1KLUA 4RAHA 4UMSA 5I23A 2DJMA 1X5ZA 4WGWB 3KNBA 4OTXL 1OIOA 3EFOA 5ACMA 3OKMA 3CFKB 2AXFB 2R59A 2YQ2A 2FCBA 4LSUH 2H0EA 2WO3B 1J8HA 4XNMA 3D34A 4Z7QF 1WIUA 1IVLA 1J7VR 3LKQA 1N6QL 3INOA 5C6PB 5IQMA 5ISZA 3CDYA 3TBWA 3C9NA 5CCJA 3KPPA 1MVYA 3RWCA 2BDNL 1T6BX 4WFED 3UJJL 1CU4L 3NCYP 1YYML 4ONFH 4I48B 3WEAA 2UXTA 1YDPA 4G5ZL 2BZCA 4BWWA 1MDTA 5IQLA 3PNWB 4NO2A 3UG5A 1B3IA 3WDJA 2XTJD 3FCBA 2CPCA 1WC7A 3ZIMA 4K5LA 1AVAA 1FVDB 3HC2A 2ATKA 4OGQC 1QTSA 5F9JB 1HK6A 1KBGL 3RI5F 3ZYJA 4FA7B 2I07B 2AP2A 3SKJH 3BAYA 2VXQL 1RP9A 3ARGA 4E41E 4QRAA 5L4MA 1XZ0B 3NZ8B 5T3ZH 3HN3A 5EBLA 3P3SA 4I2XE 4YUEL 5C3LD 3RUGB 5CD5D 5JHLH 2EVHA 4U4IA 2FX7L 2I7SA 1NICA 2YSTA 4NM8L 3MU3A 4XBPB 4DW2L 2AJVL 3G5VB 5FDWB 2QQQA 3VNYA 5F70A 1RH8A 3QJHA 1V55B 1PZ2A 1AHWA 1XQ4A 2Q76B 1H3PH 3H85A 3O0RH 2BY0A 4X6DA 5HHME 4BKLB 2ZG3A 4L23A 4K55A 3T3ME 5SWZD 1FGNH 4A2EA 1T22A 3ORJA 3W2DL 4WWKA 1DANU 2MKWA 1E50A 4P5MA 4AV0A 1BVKB 3WJLC 4WTXA 1TJHL 4P5TC 5I1HH 1MW2A 1QSEA 2X9WA 4G6AD 1AFVL 3US0A 3AQXA 5DRNB 1EXUB 2H3NA 2IGFH 2IOMA 3HRZA 2OMUB 2NNAB 4GP5B 3FYIB 1SM3H 4HCFA 4KJYA 4NKIL 1UVQA 5IVZB 3E1F1 1JHKL 4RESB 3H9HB 2FYYB 4L9LB 4FXKC 1UKQA 2BNRD 3OGOE 5ECGA 5F7EL 1EMTL 5I66B 3VXMD 4K8RL 1IBBA 3QEQA 5HVGB 4NO2B 2RFXB 2CIKA 1PKQB 3ZE0F 2AK4D 5I6OA 5AOMA 4GINA 4RGND 1WEJL 1VB9A 2Z3FA 4PGJA 3TBTA 3MX0A 2OW6A 3CZNA 4YK4B 2WM0A 3QZPA 4G1MB 4IIQB 1DBAH 3UC0L 4NQEE 1IAOB 4I9XA 3CVHL 1N68A 1NCOA 3EOTH 1RHFA 2GJ6A 1U8QA 2F1AA 3ECVA 3FTGB 3OLIA 5DSCA 2HPTA 3RUGE 3UC0H 3WNLA 3ZZQA 3IRCA 1A4BA 1H3WM 2GJ6D 3HG5A 2BY3A 3QA3B 4UQCA 4M4PA 2EE0A 2NQDA 3G5YB 2LABA 3LN5B 3O6KH 5DSCB 4BRVA 2WZ5A 4WLCA 2E7CA 3GSOA 2F0CA 5F96H 3GRWH 2WYZA 5T5NF 4XVUC 4TS6A 1OB0A 2COVD 2C5DC 1PZ5A 2JELL 1XGYL 3ZHNA 2AXHA 3ARFB 4M7KL 1DQDH 3KJ6L 4N0CD 1RIVH 2IDCA 3FFOA 3WS3A 1BXUA 1URLA 3PXHA 5DEGB 4JDZA 3OJDB 3LSOA 3TEUA 5SWSB 3BXNA 2DYPD 3C5XA 1JNHA 2I60L 1D5RA 1NCAL 3QDJD 4DPAX 3BT2L 4N6QA 5T1LD 4LEOA 2M83A 2VZSA 5D7LD 3P0GB 1GTNA 4QAWA 4MMZB 3TBBA 3LRLA 4JLRB 5EBWA 3WEMA 2H2PD 2J21A 1RZ7H 3EO0A 4WW1A 3SODB 5A2FA 3BT2H 5FA3B 4MJ6A 2D3LA 4FG0A 1VZHA 1T80A 4WEMB 1Q8MA 4OKDA 1TMCB 4NFCA 3S4SA 4GRWB 1AO7E 5KW9H 3IJSA 3CQQA 5B4MD 1AANA 4JO3H 1A6VH 3MC0A 4TVPH 3BUTA 5H4YA 4YFDB 2NY0C 1MJUL 2APXA 5K9OA 1X5KA 3GMRA 3T4AA 1NZRA 1WH0A 1B0IA 4X4XB 2VW7A 1DQQA 4LLUB 4XPBH 5I0XA 3DWTA 2UXVA 3F84A 3VACA 1R9FA 1CIDA 2AEQH 3LNFA 3ZE2B 2A73B 2C9QA 3FF8A 4NEHB 1PSKL 2VYRE 2ZCZA 2FUTA 5L2JB 2FWUA 3C60C 3NGBC 1OO2A 1AXSB 2CMRL 5MI0C 4TRPL 3LDBC 3JVGC 5EFIA 1YEFL 2VAAB 3FCTA 2QLVB 4NZJA 2WJ7A 4IKNA 4TLUA 1FDLH 5DR5H 1RLWA 4P07A 5DJ2A 5TE4L 4W6WB 5D7JB 2NW2B 4PJXB 3ULUH 4CRPA 3HI1B 2Y7QA 2IG2L 4XC1L 3TBVA 3EGSB 2VR3A 4Q97A 3MV8E 1KBBA 2VISA 3B2VH 2R56L 1KOAA 2GJZB 2VM3A 2VXTL 3EHBB 1TVHB 1BCIA 4MKMA 3RIKA 2I25N 2DYRB 2WO4A 3UGEA 3W0WD 4OF5A 3DX8A 1YEGL 3EH2A 1PKOA 1JK9A 2XTJC 3QO1A 3MOAL 4M48L 1FVEA 4WAFA 3S7GA 4KGJA 2Y24A 1FYTA 5EO0B 5IMKB 1LDSA 1T3FB 3P9LA 3MLZH 1CLVA 1FNSH 3K6NA 3MJ7A 4BQ6A 5DMYA 1J8HD 1XXDC 3SKNA 2WKGA 4TSAL 3PPEA 1SHWA 2WZ0A 3CPLA 2AXFA 4YPGB 4EUPG 4BFIA 5ADPL 3KXFD 3HUJA 4KXZI 3DO4A 1BP3B 3ZIYA 2XWTA 3D52A 3ZRSA 3FOLA 3ZBMA 4Y5VA 1FO0B 2K4AA 3EOAB 2VDRH 3VMNA 2IBBA 4LL4A 3HE6A 1FCCA 4OZHA 1S2EA 1LWRA 2D7QA 1OP4A 5D7LA 5GGUB 3LZPA 5DRXB 5IEHA 1TYEB 3U30C 3HMWH 3NP4A 3DUSB 4OT1H 4M3KB 2HVJB 3L8QA 4HIJA 2P7TB 2SEBB 1KJ2L 5D1QE 4RX4A 1U21A 4Q9QL 2J1XA 4G7VH 4MMYB 2MOGA 2I7OA 3GMMB 3LPFA 4O5LH 3O2WL 1KB3A 4U1IA 2ZF8A 4QRUA 5HHOB 1I1AA 1PLGH 1TJIL 4MRBA 1HILA 1KC5L 2EH7H 4MBRA 5JHDE 1AQMA 4KX9A 4N2KA 4X83A 1KELL 4ZOCA 3KLQA 1I9JH 3W5NA 1A7PL 5F71A 5AKSA 4W81A 1MFAH 2R27A 1AAJA 1EH9A 4OQTL 2Q7YB 4Y2OA 4I5BB 2K9UA 3L5WB 4UT6A 1JIBA 3TA3A 5DC4B 1TQUA 2DWDB 3FQYA 3PQYE 4O4YL 4XX1E 4LSVH 2BIQA 3LHAA 4N0UE 5ALBL 1NKGA 5ADOL 5IBLC 1S9KC 15C8H 4TL5A 1HX0A 4OF0A 3L54A 3I2CL 4FLOA 2NUTA 3NK4A 4S11A 1IEBB 3QULA 5IB4B 3AT0A 5LNDA 5I16A 2HKFH 4BE6A 5DJYB 2HN7A 3VXTA 2BW4A 5EOTA 3VSQA 2F54E 4FFZA 5CJ8A 1HKLH 1ZHKB 5KWYC 2X0WA 2HX7A 4ODTH 3GXPA 3GZPA 4XPGH 1BIIA 3REVA 4AQ1C 2M1KA 1Y6KR 3HAEB 3F83A 2PYED 3PWJA 4HYTB 4YH6A 3ZTDC 1M2OA 2DQEL 3VQMA 3OR6A 1EV2E 3WKPA 4LP5A 4M1GH 1I53A 2OCJA 4S0TD 1EDYA 4UF7C 5L2KB 3PWPE 1MREH 1NC4B 3NZHL 4BZ1H 5IJKA 4NAMA 2CJUH 3WKYA 5IB5B 5CU5A 1G5GA 3ATAA 2ZOLA 2WNXA 4HK0B 4V11A 1U8JB 3ECBA 3OAZH 4YHOL 4YDKL 3WN5B 3D05A 1TSRA 4DF9A 1VFBB 2HJKA 4KTYA 1U30A 4RWYL 2WLLB 3CV5A 3V2AR 1DLFL 2FWLB 3GKWH 3OKLA 5I26A 1LO0H 4UNTA 3F64A 3CFDB 5EDXA 1GVIA 4KK9D 1B6UA 1DLFH 3QHFL 1WZKA 4M7LH 3MUZ1 5F2FA 3US1A 3BKML 2E46A 3F85A 3WO3B 5C0BD 1XF4B 4DO5A 4P46C 2V37A 1F41A 2WQWA 4OUUA 3SPVB 3ZYOA 2PXYD 4NENB 4FOMA 4TNEA 5AVQB 3UBXG 5AW8B 4BUHA 1AJ7L 1F18A 1XIWB 3OPZL 1PX4A 1IRAY 3VA6A 1CR9H 3MV8B 2ENJA 2X1WL 1E4XL 4N6RB 4PGBA 5CLWA 1J9CT 1W6WA 1MZZA 2W5PA 3L9RA 1IGIL 4X5PA 3X3GH 2BSTA 1HWGB 5HDLA 1DJWA 4IRJA 3ISWA 4MZRA 3UYPA 3KPQB 4NO5A 1PY0A 1YHPA 1OSPH 1Q4NX 1MF2L 2W1NA 2BVQA 5CEZD 2YXMA 2DQCL 5F93C 2FR4B 1FE8L 1Z3GH 2VKWA 3PCYA 2J44A 3BD4A 4FMFA 4J1UB 2Y69B 2ED8A 4OCLC 4TYUA 5FOBB 1O9WA 4WI0B 5AZUA 1KENL 3P77A 2X5PA 2D2OA 3QCUH 2W9EL 4OZHF 4YL4A 2X10A 3BE1H 5GS0H 1EERB 2AMGA 4X5LA 4DN4L 3KGSA 1CTNA 4GQQA 4B53A 1U95B 3TBCA 4YSSA 5I71C 3SDXA 1QR4A 2IV8A 3R06A 2Q7AA 3LKRA 3QORB 4HH8A 3OLEA 2XKUA 4JZJA 1KFGA 3EHBC 5B8CA 4QRUB 1YMME 3GM8A 1AD9A 2J1YA 4JFFD 1HIML 4PGCA 3EO1B 4FYSA 1UG9A 4MAYD 1JFQH 4YPJA 3SE6A 2HVKA 2VERA 2X4QB 2F74B 3MXVH 4W4OA 1OEZW 4YHMH 1A1OA 4NIKB 1HJCA 3ATBA 4PJ5A 4BWTA 2P7TA 4ZDHB 4X9BA 1I1FB 4LLQA 4PRHA 4ZS7L 2NUPB 5I5IA 5K9JH 1T04B 4GMTH 5LGYA 3I84A 4G6JL 3MBXL 3BSHA 3THMH 2AVGA 3L5XH 3QRGL 4LLWB 1MH5B 2B1OA 3EZ8A 3JV4B 2FNWA 4EIUA 3H3BC 1ZK5A 1ECZA 2QPSA 3DXAD 5HYJB 1ORSA 2JB6A 3FT1A 5D6CA 1C08B 4ZFGH 4ZAKC 5E9DD 3QFGA 3V0DA 3VSUA 1QSFE 2CR3A 5TK2A 4N2DA 1TFHA 3CFCL 4TM9A 4GMSL 3T6WA 1JZ6A 1KCWA 4N8VA 4FP8H 4J8RA 4KAQL 4DP1X 3FBQA 1U8QB 1G4MA 4LCYA 1NQBA 1E9OB 2VQ1B 3BZDA 4ZZFA 2HA1A 4ERSH 2GPZA 1NFDB 3QQDB 4MXQD 2WBJB 4HS3A 2Q2EB 1MRCH 2YHGA 3DX1A 5J3HC 5IHZA 3D85A 1L3NA 1IGFL 3QIWC 4XE0A 1TPXB 2KPWA 2NTSP 4GXUN 2R0LH 1UKTA 2IDFA 2FL5A 1FNGA 3CMOH 4ZW3A 4KPHH 4P46A 1NFAA 1S78C 5I6PA 1JJUA 3TO4A 5K1VA 5CP7A 3SQBB 4NP4L 1M1XA 5F7MC 2B1HH 1P4UA 5CZRA 3MOBH 1G9ML 5GGTA 2K4WA 1AOZA 3ULAB 4ZTPL 3SGEH 1SOQA 2P1YA 2B2XL 4CNIB 4HT1L 1G7IB 1TEFA 2VUKA 2WXGA 4JR9L 3VXRA 2EEBA 3EJCA 1BW8A 2R23B 5LGHL 5D72H 1GYVA 2FJHB 5DJ2B 3T77A 2IALA 5IJBC 1YN6A 2C7UA 4JFFE 4Z5RB 4FTVE 5I73B 1FBIL 1N26A 5AG8A 7FABH 3KEDA 2NY2C 1DFXA 3TZVC 5F7UA 1P4LA 5FYJU 4L9DA 2LOEA 1YNKL 3HG1B 4HPYL 4L4VA 3K5RA 1L3WA 3MV11 2G3MA 2QV2A 2BC4B 5F88B 3CC1A 5J06A 3F7VA 5ITBH 3QDMB 1JCVA 4POYA 3KL5A 4ENEC 1P9MC 4AKOA 4P23B 2I85A 3UAEA 3NJMA 4JRWA 1ZA3A 2G3NA 1NC2D 2C1PA 2ODHA 1FNLA 4QIRA 1BM7A 5DVKA 5AOJA 3ZHFA 1OPOA 2VUYA 2EE9A 1MCEA 4NO0B 4U1HA 2F6AA 3MGTA 3UPAA 3U0WH 5F9AC 1D6VH 1MHCA 1NCWH 5AW1B 4CC4C 5EU3B 1PSKH 4JVWA 5ICXB 3F7PC 1A1MB 3ZT6A 2DM2A 1VPOL 3TPUA 2GJPA 1FYTD 2Z8VC 3FUDA 4PGEB 4GG8A 4K7PL 3UG3A 1NWOA 2YD2A 2JIXB 1HVXA 1HQ4A 3QUML 3TIDA 1M6OB 3LZFL 3TM6A 4PW4A 5FFLA 2EVGA 5F7WC 4MVBC 1V7ML 2X4SA 3O4LE 3QZNA 3RU8H 1T5XB 1CS6A 2H32H 2ZP0T 4UOW1 5GGRA 4MCZB 2BXZA 4WUKL 4NN6B 1RIVL 1F8TH 5CWSA 3TF4A 3RDTD 4C83B 3IMUA 3MAWA 4OZIA 1QBBA 2IMMA 2XWRA 4H8PA 4H13C 5EORH 3OC5A 3PJSB 1NMAL 4ZUUB 1R34A 1TNNA 1F97A 2ZX9A 2FT6A 5I76A 5IJDC 3RTQC 1XGRA 2C9PA 1MLBB 4HSQA 2IPUK 5I1LB 3FQTA 1LM8V 1XF3A 3L4XA 1U91B 3JV4A 5GIRB 1PPIA 1H19A 1YMHA 4UQIM 1LO5A 4XHJC 4D9LH 2EXWD 4XO9A 1LHZA 1HNYA 2A74A 5IFAH 4HIXL 1AQDB 1NCNA 3AXIA 4A1RA 3B5HA 4Z7NF 2CCWA 3TV3L 5DZJA 5K1NA 1L9SA 4NHCH 5HJDA 2GT9A 3V0VB 1QPPA 1RZFL 4XNQB 1Z0NA 3U0WL 4BUQA 4W9JC 1GOFA 1YEWA 3EBHA 3DDGA 4PRBA 3OXSA 4UV7H 4WI4A 4EN3C 4LQ1A 1RZKH 5DHVH 3WKMH 1PVHA 3CUPB 5DVOA 5LUMA 2ZUSA 3DYMA 3N3EA 5ITFA 2ZE0A 4PCSA 5EU5B 5JTWA 4X8JB 2KH2B 4G80A 4XCCL 3AADB 1HKFA 1ZSDB 2LT9A 4WFGE 4HJIA 3MGTB 3L08A 4KNUA 5DUMH 3VAEA 4K7PY 4ACPA 4L4VE 3IBOA 4Y19B 5HP5A 3BKJH 4MNGA 3ESUF 5F3FA 4X5XA 5CMAB 3KYAA 4NQVA 5E5RB 5DD1L 4ZSOB 5HHQA 1U0QA 3P77B 5ID1B 4XAWH 2BIHA 2VLLB 3KYMA 5GGTH 3D50A 5T3XH 1UOVA 3GRWA 2EYRA 4ETQB 1KWGA 2K8QA 1A9EB 3HR5B 2EIZB 4JHAH 1EZVY 2AZUA 2RCSH 1AKJB 4NOBA 2XXCB 4XMWA 1MCOH 1F4HA 2BZ7A 3RJOA 4L4TD 3VXRE 4JHAL 3WFHA 2BW5A 4F9PA 3D0LA 4EUPB 4LP4A 1P4IL 4R83A 2AV1B 3OMAB 3MA7A 5BRQA 5FKAB 3VG0H 5ID1A 3VXNB 2KPNA 5GRXG 2NY3C 4B6ZA 4PV8B 1YY9D 4ISVA 5LXGL 3BFQG 2A6JB 2BNRE 1EEUA 4MXQC 4XT1C 5C0CB 1DVTA 4XPAL 6PCYA 3P3TA 2DH2A 1JZEA 3AWEA 4NHUB 4Q14A 4LSRL 3CVHB 3T0WA 1TEGA 3T3MF 3AREC 4HGWA 5D6DA 4JY6B 1NIEA 3FONB 4ODTL 2XV2A 2BP5M 3D9AH 4BFNA 2RHEA 4I48A 2AKRA 2LW3A 3QG7L 3MJ9L 2GT9B 3V0VA 4NDMB 4APQA 3ENEA 2H1XA 2GITA 1M71A 2XA3A 2AJZB 2O6DA 4U3CA 3L7EB 3VFNA 1BFVL 2AF2A 2GTWB 2KYIA 1P7QB 1I8LA 4KX8A 4Q6KA 5AENA 1F5WA 2ZUWA 4YHKH 1DEDA 4PJ7E 1U9KA 3HC0B 1SPDA 4OD1L 4DKEL 2CXKA 5E9NA 1YEJL 2YAPA 3IGFA 4PWEA 3ULVE 1TJIH 4GW1A 1CVRA 4JPVH 5F6IB 3BWSA 3BFWA 1M1SA 1MCWW 4POZD 1UA6L 1RCYA 4CGTA 1KGJA 4ODUA 5J1AB 1ZLDA 1GAFL 5DD6B 4EPSA 3J8F7 4Y4KD 5DXWA 5DYOA 1G43A 5AB2A 3QJTB 3MBEA 1QR1A 1DJIA 4AW4A 3FUEA 2GTZB 4AT6A 3C75A 3V95A 4CVUA 4LPXA 3T4YA 1JD9A 3HVNA 5DD3H 2VLRD 3V52L 3MYZA 5DJYA 2WCPA 5CKAA 3HI5H 3MNDA 3VRJA 4F7KA 3SO5A 5DS8A 1ML0A 4ABWA 2N7BA 2AABH 3DOSB 4GW4B 4HH9A 4P4KA 1F1AA 2P80A 3HZ3A 4J8QA 5F89B 3QUKA 5GS3A 3C8DA 1AE6L 3UJTL 1HWWA 5CSGA 1RUKL 1GOGA 2BNRB 1X3DA 1IQWL 3DROB 4N20A 4R90L 2F53B 5B1BB 3TGXA 5K69A 4Y4KA 4HLZH 4AC4A 4BZ2A 1CYWA 1JZ7A 5AUMB 2VLRB 4DH2A 4DZ8B 4RA3A 4H20L 1S9XA 2ZXQA 4HKJB 1F4AA 1EQWA 3LQAH 1GS6X 1NGZA 5A16B 3UABA 3VFGH 3S5YA 3SDXB 3DVNB 2X89A 5BQ7A 3MRFB 1UXSB 2BVOA 1AS6A 3PYCA 1R0AL 5J12B 2MRYA 4Z7VE 3GMOB 2AQNA 5AQ0A 5LBGA 4GG6E 1VSCA 2XVBA 3RDTC 2EDJA 3TA3C 1KXHA 3B34A 5AG9A 4YHOH 1DSWA 4P9ML 2O5ZH 1JV2A 4RSVA 4HS8H 1EAJA 3MLXH 5DEFB 5ENWA 3ATDA 1FZKA 5DT1H 1EXHA 5DZ9A 3ZDXE 4WI7A 4QO1B 1BMGA 1H6EA 2D7NA 1PLGL 3WCYA 3DI2B 1A6AA 3AVEA 4Y8DC 4AV4A 1E28A 3CBJB 3TO4C 4OU3A 4ZUSA 5BUAA 5EBLB 1CFTB 2ZCKH 1Q9KA 1UUNA 2D3VA 4DGIL 4AKQA 5IJKC 3MRDA 2L04A 3TO2B 4XRCA 3V6OC 3C2SA 3OMNB 2QGBA 3DGDA 2PCPB 4RMWA 3E2HB 1I7ZA 2ZCKL 4G80B 3RX7A 2CCLA 1OPGH 3S36X 1AXIB 4W9IC 5B7FA 1UJ3B 3BPLB 4V33A 4XH2A 3DO7A 1O0VA 4OD3L 5GGRB 3VWKB 2PR4H 4GRLC 2BJMH 2W9DH 5C08A 1X9UA 3MKKA 2VIRA 1SLXA 4HUKB 3FFCE 4CDHA 1NC2B 4M8UA 3V0AC 4Z8FL 1XGUB 2Y36H 3I50L 3MJ7B 4N5EC 2CHWA 1RURL 1GPOH 5IVXB 1WIPA 3SYPA 1RAMA 3TIDB 1D7DA 3FULA 3QDMD 2IGTA 1RIHL 3LJ3A 4PJDF 4QOKE 4HAGA 3VWKA 4BHUI 2TSAA 3KPRA 2VQUA 5T33H 5IWLC 2P8LB 1OP5K 2P5EA 1INDL 2GVYA 2VZUA 1SQMA 4AENA 2Q3XA 3IJ9A 3M07A 2P5WA 1QLRB 3IDNB 4X5RA 5BV7H 2BY1A 3GLZA 2EIDA 4OZIB 3DX7B 3NQKA 3SE9H 3DMMD 1TQSA 4PVNA 1YC8A 4KZDH 4HIIB 4NWTH 3KYNB 4PJXF 2BS9A 2H8PB 2WIIA 4H8WH 4O2EA 4RFEA 4KFZC 3SPIA 5HHXL 4X9IA 4Z7VF 1N2RA 4XN8A 2VITB 3W2DH 3WHXB 2VL5B 2UX7A 3I6GA 5H37A 2MHAB 1KIPA 2FTAA 1WG3A 3L7EA 3VFNB 4CU7A 5I0WA 4H88L 1LDPH 1VCBC 2DWTA 4MZIA 1I1FA 4LLQB 4O58L 5K9JL 4X9FA 4MFHA 5JQIB 3KYOA 1M53A 3P4NB 5I8CB 2XA8L 3U4AA 2RH0A 2WJ5A 2YEQA 3MXVL 1D9KD 4MVBD 1BYPA 1O6SA 3WTXA 2GHZA 4WNQB 1OCOB 4PS3A 4ZXBA 4PWGA 3ZL1A 4JCMA 3FH8A 1HE8A 3ZK0A 2DQTH 4PJIB 4JX0A 3RQ3A 1GRWA 1GJUA 5KVEE 3QGVA 4U6HB 5D1QA 4K3GA 4G7SB 5JMOC 4RZCB 3T0EE 2CR6A 4DO4A 2WGXA 1Q72L 4RDQF 5EIVA 5JNYA 4MD4B 1MIEL 5FKAA 2Z4QA 3QO0B 4WJ5A 4XZUA 4GBXC 2DQUL 3QEGL 4I2XB 5CJBA 1OZUA 2N0MA 4M8RA 2XYBA 4OZHE 3HNTL 2A83B 3RHWF 1EEZA 3CZJA 4C57C 1VKXA 5EU7E 3VFSB 2NXYC 4WSGA 4F9PC 3V4VL 1SEQH 1MFBL 2Y1ZA 4AH2B 3B9KA 2YPLD 3D30A 3BGAA 4F8QA 5JHLL 3CLFH 2OSXA 3ZDXB 5LO7A 1MHHA 1B0GB 3TT3L 1OCZB 2FSEB 2PNDA 3K2UL 4KQ4H 4ODVL 3QQ4A 5C0EA 1F58H 1OWWA 1FGNL 1X5MA 3O3DA 1HSBA 2F54B 4J8RB 4N2BA 1JF5A 4QRSB 2HG0A 2YJQA 3WIFA 1KN4H 1MJ7H 1SXZA 1ZDSA 2EACA 2JJSA 4HHAA 3BZ4B 3HFFA 4OLWH 1OAXH 4HGKC 2R1WB 5SWQB 4P5TA 4E9YA 4MJHA 4LLWA 4HEMA 3OKLB 4RVBA 4FMKA 2PCXA 5LGHH 1V05A 3DX6A 5KSAB 2AJZA 2RJMA 4E42B 1IUZA 1LO2L 4L4VD 4O00A 2XPYA 4HKBB 4EDXA 4AMKL 3D39B 1I7UB 1XF2B 1G1YA 2RQ8A 4W68A 4OLYL 2OQJA 3HZMB 1DBMH 4PJAE 3CSBA 5C07E 1IX2A 1F6AA 2J7LA 3F5WA 2VDLB 3GJEB 3GSQB 4KTEL 3WU1A 2KBGA 2X2JA 3DX8B 5FS5A 4XOBA 5C9JA 2BHUA 3A6BL 3F7QA 5IY5B 1I7ZB 2Y5EA 3SGDI 4NZDA 1SMOA 4IGBC 4U1HB 1GA2A 2D03L 3DVGA 3F7LA 3SDAC 4CC1A 3WE6B 3WMQA 1CDBA 4G1EB 2NYKA 2WXNA 3HJEA 1C8QA 4P3CH 1VPOH 3LAFA 2AEQL 2L4OA 2XIDA 3SBPA 4Y2NA 4URTB 2LAGB 4I85A 4PFEA 1TF4A 4IU2A 4KZEH 2EXYD 2YFNA 3IMWA 3WMPA 1NLDL 3A5VA 1NSNL 2HN7B 5EUKA 4QRTB 1PCSA 6TAAA 3UXFA 3FUFA 2E9JA 3NCYS 3WTWA 2Z35A 2H2PC 3CN0A 2YZ1A 1A9EA 3HR5A 3K3QA 4LFHD 5MP6H 3ALWA 3GXUB 2PCFA 1AR2A 3BVVA 5JHDB 5BS0E 1D5MB 3LZNA 3IFOB 3X13B 1U8IA 5ESQB 3SDAD 3SGJC 1P6WA 3N2JA 4I3RH 5I6LA 2JKNA 2VXTH 3T2LA 2W94A 1FL3A 2JKTM 4PGCB 4XMLH 3CN3A 2QSCH 1FNFA 4YGVA 4OLWL 4NUJB 5TH2B 4Q6YA 4HKJA 4M48H 3RUGA 1IT9L 4PBXA 4K9EC 2QSCL 5AOKA 3H42L 1K6QH 3P73A 5LNEA 3MRGB 4ZD3L 3KDMA 2ZIDA 1WGOA 4GSQA 1HILB 2BVTA 2FSDA 3JBG7 3CFBB 1YPZE 3KYOB 1BGXL 1OCWH 1JZDC 2E47A 2KZBA 2MTPA 2MQ3A 4JGJA 1A21A 3OB0K 4E9QA 4EXPX 5E9DB 4K71C 2BC4A 4UQ2A 1FGVL 1LO5B 3QUXD 2WLIB 4F7MB 5F0LB 1Q9LA 2VM9A 5I6MA 4MHHI 3GK8L 4M7ZC 4EOWL 3UYPB 4JFEB 3NUKA 4ODWA 2CJTA 5FF6A 2Z1PA 3MRKA 1RULL 1IVTA 5DC0A 3EJTA 1CL7H 3QJQB 4M8QA 4HIEB 3GSNL 2ZUVA 4P2OA 1IEAA 1TZAA 4WRLA 4OFYA 1Z9SB 4LVOC 4Z7UE 5D4IA 3MLTA 4O2FB 3FQXA 4RBPK 1L0QA 3O8XD 2Z8RA 2OTPA 1U92A 1J0KA 3C5SA 1NCGA 2BFGA 4PGDB 3SJVA 1YN7B 4Y5VB 3Q8CA 1JE6A 5FHBH 3KPNA 5T1LA 5BVJB 5INDA 5LBSH 4DOHE 1JGLL 3P1VA 4I0PB 4AGOA 3TVMA 4PJXE 2YD1A 1FZMA 2OMZB 2LFEA 3EYOA 1HN1A 4WCYL 5GRUH 4N86A 3EW3B 1RUAL 3MRJA 1A7RL 1OAJA 2GHWB 2R0WH 3NSXA 4KO9A 5KANI 3GUFA 1BPVA 3IFLH 4KY1L 4HOMA 3VGAC 3ABLB 3MRMA 3NT0A 3QJVB 1N10A 1FNGB 2W65B 1AZBA 4G9FE 4XMLL 4ZNEA 4PIRF 5BS0D 5D93B 1TQBC 2FQGA 4ZAKD 4QT5A 2F8IA 2IXQB 3LVEA 3PG2A 1A1NB 5HDWA 3SO3B 1UWXH 5C7XL 5C0DB 5I1EH 4RBPH 4OUOA 1S9VB 2XWDA 2OJEA 3P30L 4E5XG 2FX9L 1WT5C 1X5FA 3DURB 5CGYC 4UAOB 5GGVH 1K5WA 4R7DB 2UUDH 4B97A 4JRYB 4FABH 5F8QC 1SQ2N 1L5GB 1LO4H 1AZCA 2ATPB 4P4KD 2BHFA 2QADC 2NR6D 4TLKA 4K5MA 4DGWC 2ZXBA 1CLZL 4P9HH 1U8PA 1QNZL 4GT0A 2VAAA 1MI5A 2X9ZA 4KKQA 3T8XB 2BK8A 4QAMB 1KCKA 1E4XI 3GI8H 5I30H 4J23A 1R3HB 3WG7B 1UENA 7TAAA 1KCVH 1ULVA 1GMEA 3FN3A 3LPPA 4PJ8B 3PP4L 3I6GB 1PW3A 2ITFA 3W0WA 3L2NA 2ZJSL 4P4KC 3TZVA 4PG9B 5LAXA 2ZSWB 1DJGA 3J2PA 4JM2C 1LP9A 3EJZC 3DYPA 3QQ9C 4G71B 3RNKB 4ANKA 4YEFA 1J1OL 4X8JA 1ZANL 2DLHA 3F6LA 4AIZB 4UB0H 2D3JA 5C0JA 4QHMA 4Y7OC 2DPKA 1FI8C 3RLSA 1ZA6B 2OMXA 4PV1C 1D2PA 1N0LB 5LDSA 2B8OT 2R2HB 4CUCA 3QQ3A 2IDTA 2K7QA 4NZRH 1MRDH 4B41A 1G6RH 2Z31B 4B5EA 4J2QA 1NDGB 3CX5K 4X6EA 3C6LB 2P8MB 5I73C 4QUOA 3M7FB 1UCBL 2P5EB 3GIVB 3RI5K 2HT2C 2APSA 1WE5A 4NRXB 1M7IB 1U2YA 5DURD 5TF1L 4MSWA 5HYJE 2W8CA 5FO2A 3GGWA 4IDLA 2AK1H 2XFXB 2UX6A 4FL4C 1UKSA 2J1KA 4HXAH 4YHYB 1MXGA 4JFWA 1WWAX 1KPRB 2Y25A 2NT1A 3IDUA 4LMQI 1YECL 4L2LA 1T7VA 2ZOUA 1T2QH 3DRQA 4XPFH 4JO2H 3S8FB 4LSPL 3T0XA 1HNGA 5AZEL 5EEXA 1MVUA 5GS1B 4EBQL 3MV7B 4OD2A 5IB1A 5B8CC 5L4IA 3GSRB 2ZXAA 2YEZB 4JO2L 2C9VA 2NY7L 4G5AA 4P9HL 5I15L 3MRQB 2Y7QB 2DDQH 2EC8A 2X9XA 2EE2A 1MWOA 4MXVF 5L88L 4GXFA 1YVLA 1ASPA 3AY4C 3DVIA 3TNMB 5I30L 1UB6A 4Y9CA 3MLTB 4O2FA 1Q9OA 2DQEH 3A24A 3U0PB 2WW8A 2JVUA 4KBPA 1CDHA 1CXEA 3L9EA 4M8QB 4LBAA 5L8LB 5F0JB 3L3HB 4M5YH 1MY7A 2CIIA 3NCWA 4OJFL 1PL3A 3NYKA 4UTAL 2DICA 2Q1EA 3AACA 1SDDA 1GGCL 1T3FA 2O26U 3ZO9A 4QTHB 5A2AA 3HEIB 3EYFA 3UTZA 3DETC 1WZAA 4I5BA 1FNEA 5DD5H 2ZKHL 1BBJA 1ILSA 1ZTMA 2CGRH 3P02A 2H32A 2A6DB 4RIRA 5T1DL 2VR4A 4WSJA 3LNGA 4H1LA 3FZUC 2G4EA 1Z3RA 1JZ4A 1HXMA 4U6YA 4XTRC 4A68A 5F7HA 1T03L 4WNJA 1ZDQA 4QD2E 2EDFA 5C3TA 2H3KA 4AIZA 1T6VN 1ZVNA 1T21A 3B7SA 4WWPA 4K8RC 1R19A 3I9GL 2A99A 2V6HA 4IBZA 3ATFA 3X11B 5FCSH 2DWXA 1AKJA 4QTFA 4OGAC 1JPST 3LN4A 5DMKA 4UV4L 2EYTB 1GCYA 1NUDA 3UBHA 5IFJB 4UMGA 2HVJA 3A0OA 2VLJD 1LEGB 3ILQC 3O81A 1BJ1J 1XHHA 4GAFB 4ZSOE 5HD8D 5KVFH 3MLYL 1B2YA 1A7OH 5F1NA 5DRXA 2PYEE 4G42A 1VHPA 3FRUB 3HHSB 5AYTA 2QSQA 2BVPA 1ZGLB 2ERJB 3G6AB 1RURH 3QUYC 4X2UA 2N59A 2WWKT 1R5WA 3GMQB 3V4PL 1JPTH 3BN9D 4AL8H 3CXHK 4LLVB 3FCGA 2ZX6A 3MRIA 1NMBH 3NIDF 4R7NA 1QLEH 2A9BA 2P52A 4PP1D 4AEEA 1NIDA 1S7WA 5DMIL 3NRFA 1AZNA 1K4CB 1MCFA 2ADJB 2FIKB 4PWJA 3ZOAA 3F5WB 3GJEA 3GSQA 3HC4L 3PS6A 2B4CL 4A2GA 1A9BA 4X9HA 2G60H 1J0IA 2F61A 4QXTA 3AS1A 4XHQA 4MXWH 3MODH 3MVSA 4LOUD 5DHMC 4HMEA 1FHGA 3RGVD 3BCDA 3CN1A 3PAYA 4PJFE 1RD6A 2EABA 3M7OA 3D85B 4GO8A 2OXGB 4HAKA 3UZVA 2G9HA 2QVIA 3GNML 3QPKA 4GXVH 2DB8A 2FIKA 4C55A 1DL7H 1AZVA 4Q6IB 4OZ4B 4MNQA 2PXYB 3P2DA 5D7IE 3JWNE 2WLNA 3GI9L 2DJSA 3RAJH 5I1KH 5ID0A 5F97E 1BD2A 1II4E 5JZ7C 4NRZA 2EVIA 2O61B 1SHMA 2VT0A 3ESOA 1BECA 1OK8A 1I8LC 5DZPA 5HGDA 2BWIA 3S36L 4RGOH 5CIPB 2WLKA 4CADB 3WEXA 4F8TA 3MCG1 3RNKA 2FJSA 5ES4B 2WSKA 3FU8A 3JZYA 5I1CH 4NQXB 1KTLA 1TJGL 1SJHB 3N41F 4WWKB 1QHPA 4XVOA 3L3DB 4U3SB 3FMGH 2CPUA 5I19H 3HB3C 2ZAHA 3MLYH 4N1CA 4F37K 4BKLA 2PWHA 5A2JH 4KUCD 2Y36L 1E7VA 2VH5L 2L3BA 3WY3A 5T3ZL 1S7QA 3RTQD 5DJCB 2AQ2A 1I3RA 2F74A 2KT6A 2N1TE 3RVTC 1MF2H 1MN4A 2WVVA 3VNZA 1F4XL 3CZFA 3HMXA 4PVMA 3AQYA 3N44F 4D0CB 4F2EA 1H5BA 1X4XA 4B7LA 5IB3A 2ZWLT 4NKMA 4OAWA 1SEBA 2YC1A 4UQ3A 1AQ8A 4ZMVA 4MAYA 5DHVA 1JPFB 3L5IA 4PI2A 2LFGA 3LMJL 2HKHH 3MRGA 3D4GA 2OM5A 1UWGL 1SXNA 3VQLA 1GCFA 2YSSB 4HISA 1OE2A 3QI9C 1UC6A 2CHDA 2VXVL 3IMBA 3G6JF 3GEFA 1RZQA 4ZXBB 3DARA 2IGLA 4PS4L 3D5OF 2FO4B 4D0BA 5F7YC 2ZSWA 2FIRT 1G7HB 3UTQB 2IC2A 5DJAA 5KSAC 3F01A 3UTTA 4X7CC 3ZZSA 5BV7B 1KCLA 5DFTA 1IT9H 3DMMB 1FORH 1BG1A 3KWXA 1UQSA 2IJ0C 1JF1B 4WFGD 1TJHH 1XMWA 3PJNA 4PN6A 4HALA 3B2PA 3EFDH 5BV7C 1DQVA 2XQ0A 3C08H 2CNYA 1HEHC 4DESA 4JE0A 4B5ZA 4PJ9B 1DBJL 4HUVB 1OD9A 1R3IH 3EOBA 4KTEH 4X5WA 1S9YB 2ROXA 4JDTL 4DGUA 5ACZA 2FECL 4MAZA 4UZSA 3WL9A 4HFUH 4MNQE 4WW2F 1DBML 4WDIA 2VDMB 3AG4B 4QKTA 2GUOA 2XG5B 3X12A 1B6DA 2UY7A 3J7HA 3CWGA 3RWGA 3UBXA 5I6NA 4MJID 4J5VA 1YY8B 3IM1A 4P46B 1MCSA 5F9WC 3B6SA 5EBWB 4KRPC 1YUHA 3TA3D 4DEPC 2R4SH 2L7QA 4U3XA 3QSKB 3KPRB 1X6LA 2JTYA 5HJ3A 2JI2A 3PNWA 4K23L 5D2LB 2XN2A 1FNHA 2KUTA 3GGWB 2WVTA 1KDJA 3GZOA 4R96A 2V9QA 4HKBA 5AKVA 5FGBC 4EI5D 3Q3GA 2FGZA 4Y4KC 3TBSB 4PRNA 1CWVA 1AOHA 2CM5A 4FEMA 4YO0B 2VM4A 2P5WD 2UZYA 3I3EA 4OJAA 4R7VA 1DVFA 1XR8A 3OKEA 4S1DD 4NJAL 4DKAA 4BZ1A 4AK2A 2A9ML 4LVHB 5EZIL 1ZRUA 2F7QA 1P5VA 4JFDB 4RGNC 4K15A 4YFEA 4V1DA 1CFSB 3FQUA 1F8TL 3KJ4B 5D7JA 2W81C 3KLHC 5EZIH 2B7DT 5I0ZA 3P69A 3ME0B 1ET8A 4ATWA 1SLVA 2XKNB 3AMKA 4NO0A 2YD8A 4OI9A 1GYCA 2OL3B 5I5MA 3DETD 1HH6B 2YD9A 3QH3A 3FNKA 4X8XA 1EHXA 4G7RB 4JHBA 4YX2H 3QUHA 3WDIA 1UM6L 1A22B 1AY1L 1ZKAA 2WQVA 4QO1A 4XCEB 5HGBB 2J3SA 5HVWA 3H9YA 3ZL4L 2Q76A 4PD4J 2C4FT 2NNRA 4GI8A 2EDOA 3NIFF 1XGQB 4F7MA 1E6OL 3WFCL 4JJOA 4QLRA 2C9RA 5FDWA 3VTMA 3BIAX 3GEWB 1JYNA 2ZCHH 2ICWJ 3B3IA 3D25B 2ZYRA 5MI0B 1C5BH 4D8OA 1VZIA 3D69A 3K6SA 2ZCHL 2WQRA 4HCRH 3GI8L 2CWRA 4LRIA 1OB1A 4U0RB 5GGSA 3U48A 3PV6B 1IFHL 4F7CA 1ZIAA 5BNXD 7CGTA 2YRZA 5LCVA 5F3HA 3WFDL 1G7IA 1GGIL 2PMZA 1EVTC 1C1EL 4FHBD 4BM7A 1SHXA 4ZFQA 1H5BB 2QPUA 4Z3GA 1MUJA 5IB3B 2OZ4H 3N50A 4NCDA 3RPKA 4MBOA 1MHPH 4UIKH 1OM9A 3LXCA 3L4YA 2MNUA 1I1YA 4YOKA 5HHVH 4B7IA 1INQB 3KAAA 2BH0A 5I1DA 2VRKA 1E9QA 1ZE3H 5MP6L 2GCYB 3DOSA 4P4KB 3DUSA 3NCMA 4Q2ZB 3CG8A 1EO8L 3HN5A 4J3UA 2MHAA 2YUVA 3QG6B 4AIEA 2A9MH 5GJSH 2ICCA 3GMNB 4X6BB 4KTDL 3AT9A 2O6FA 2RCSL 2BPBA 4N1HB 4TUKH 4WKXA 2BM3A 2D4DA 1TCRB 1DJXA 4AQEB 3U1SL 3FF7A 3C8KB 2EIJB 4MRCA 3KWWB 3TWCL 3H9ZA 4LAQL 4X80L 4P2OC 3TX4A 4MDJA 3V9CA 1RZJL 3AY2A 1ZCRA 2J43A 5K39B 3VUAA 4JKLA 2BHZA 3N85L 1KLFB 1CDGA 4LOVA 4NLAA 5HVFB 4XMTA 3VCLB 4UT9L 3ML9A 1OCWL 3W11C 5DJ6B 5K9QI 1UZ6E 1ZS8B 4WHDA 5C0AD 3X1GA 4UT7H 4ZMXA 4AV5A 1OTTC 5IW6A 1T7YA 4PB0L 5D2NC 1JWSA 4Q8BA 5FECB 3CZGA 4PRPE 2BRRL 2VUOA 3GBDA 4LSRH 4XVJL 1AO7A 2FLRT 3NIGF 4MD4A 2YXWA 1HQ4B 4X6DF 1WD8A 5EPMA 2A5UA 3DXAB 1Q0EA 2R2EA 1HDMB 3AUVA 3BZFB 2VLJE 5EU6E 1J5OH 3G9VA 3COOA 3HRZB 3R7RA 2Y1YA 4H26A 3O9WA 4PJAB 3UGXA 2GEQA 3NFSH 1A3RL 4KXDA 1HQRA 3C5ZA 3PHQB 5TDNB 3REVB 4CSSA 4NZTH 3G6AA 4OQ1A 3SY0B 4HUNB 1HOEA 1IU1A 1CBVH 3NCEB 3QUGA 5HHVL 5EBMA 2FB4L 4LLYA 1AGCB 4GKNA 2Y3AA 1U8CB 4LARL 2HCZX 4OM1H 2GKIA 2BP0B 5IB4A 2Z92A 4KKBD 4E41D 3VFRA 1JK8B 2B77A 4HJUA 3AB0B 2ZZUT 4NPYB 2MQ0A 1I9JL 3UTSB 3PAZA 5BQDA 1IM3D 3ARED 3KPRE 4K94H 4P57A 2JLLA 1G0YR 1PG7X 2BSRB 2EVFA 4NJ9L 3CDCA 5FM4A 1QG3A 5FWRA 3LXBA 3SE3C 2GIYA 5FGBA 4O2EB 1ZLEA 4N90D 4ZMTA 3UZQB 3VRLF 2BP0A 3SBRA 5BO1H 5I18H 4K71B 4K9EL 1SF5A 4QNPE 5B38B 2Z31C 1RZKC 2IMNA 4FG4A 3LRGA 5KSAD 1BLNB 1ZXQA 1DBKH 2O5XH 3NJJA 5E7FA 4M7JH 4G8IA 5GISH 5C6WH 5J1TC 4N4YB 2RGSA 3MACH 3UPCA 5EU5A 1JNLL 3D4ZA 1QA9A 2VLRE 4H20H 5ECJE 3VFVB 5GSRA 1M7UA 4KI5E 4U1NB 3MACL 2X4UA 4FQHB 3HE6C 4OR1A 4X50A 5FYKE 3NPSC 2XQYG 3O41A 3UH8A 3WAJA 3FB6A 4L3CA 4M5ZH 5IW1B 4R90H 4UOQA 2EUWA 1R3LB 4NPKA 2CBMA 2ENSA 1MCPL 4PJ8C 2FH6A 3PGCA 2CIIB 4CMHB 4X8CA 2BVUA 3JV6A 1KY6A 1P0SE 4PREB 5CUSL 4W9KC 4XMKH 1I1CA 1PZ5B 5CJOH 4NB7A 4HC1L 3QRFM 3B4NA 5FKPB 1KJ3H 3FT4B 4LQFL 3TBYA 4PU2A 2EDKA 4GSDL 4JZOA 1YEKH 3EYVB 1JWMA 5JOFB 3ZN6A 3K46A 1E40A 3QDGE 4XMXA 2E4FA 4TKWA 2CBQA 4X4YA 3TLRA 2YEZA 1XH1A 4ALAL 1F13A 4D9QE 4CMHC 3CFJB 4YXLL 1GGBH 1SY6L 2P28B 3Q1EA 4P9MH 4BFIB 3LKPA 4Z7NB 1B0GA 4NPJA 1KGIA 2X2HA 3SKNB 3BPNC 1MI5D 1JWMB 5IMMB 3M8OL 4P0DA 3BHBB 5JOFA 1ND0A 2VN3A 1KCRL 1IM3B 5HYSB 1JOIA 4P2YA 3P4MA 3RDJA 4TTDC 3P4OA 1KTBA 3CIAA 4PTUA 4WV1A 5E6IB 1FH5L 2CDGA 1SBSL 2X0VA 5GGQH 2A83A 1G6RB 4KK6C 1I3UA 3KS0H 2ETWA 4U1SA 1U58B 2OCCB 2AGJH 4HWEL 4N3UA 1GIGL 2XWCA 4XXWA 3D51A 4WUUB 1AG0A 5MEOA 2PR4L 4N0UA 2AQQA 4OB5H 4UI2A 1PZBA 2IQAB 5GSRB 4JFHD 4YSDA 3FK3A 4AL8L 2D7TH 1J0HA 1IKOP 2EDRA 3RZCD 3V55A 2MMXA 5D5MA 3RWJB 3CX5J 3CZSA 1IFRA 4M29A 4WUUA 3VWJA 1S7UB 1E28B 1AYRA 2D31A 3SE3A 4AZ8A 4IMKA 5HHOA 1CFQB 5D96C 4KNSA 3L81A 5JW4N 3H55A 2DQIL 1ANUA 1FZKB 3GDCA 3ZTCC 3QIBA 1JHTA 1NCBH 4L1LA 1NANH 3QS3A 2EYSA 2V5SA 1G7LA 2EDLA 5HHXH 5CEXB 3CZEA 2WN2A 3CCHB 5A40E 1F11B 2J6WA 1U41A 1R47A 1SXBA 1USZA 2B4CH 2UYLA 2WN3A 4R4FL 5F7FA 1MJ7L 3BPCB 3F12B 3IDYB 5CD3A 3TT1H 2DQ6A 4G9FD 4AQZA 1XH3B 4Y4FA 1CGVA 4LSUL 3FU0A 2ZD0A 2YN5A 4ADIA 3X1BA 4XAKD 4NO3B 3W11D 4NQCA 4UOW0 3QCTH 5FK9A 5I75B 1LO3H 2Y07H 3HS8A 4GT7A 2XV6B 1EHAA 3JT2A 35C8H 2LLLA 2VLKA 3DUHA 2WMPA 5A3ID 4JFDA 3MRBB 3ROLB 5AW4B 3DO3A 3RVUD 5I9QC 4HJEA 4M6ML 2OYLA 1OSEA 3D2TA 3QCVL 4UYQA 1FZJA 2ZWSA 1A6UH 3MUUA 2LU4A 4JG0H 1VERA 3S2AA 3UAJA 5FUOH 4KAQH 2VQ4A 3DGCR 3ZRFC 5D1QC 1E65A 1UEYA 1DHKA 4AM0B 4Z7UB 1ACZA 1ID2A 1JPSL 1M7XA 3FB8A 4N0RA 2Z8WC 4XWGH 1WEJH 4ZUWA 1YMHB 1G7MB 3FAWA 3KPOA 5FO7A 1BD2D 4C56E 1V10A 4DUWA 3WNPA 3RGVB 1K85A 4JY5H 2NCMA 4U1JB 5K93A 1F00I 1CG9A 1RU9H 3AU1A 3DIVA 2H6PA 1U6AH 4XNZC 3B2MA 1DSYA 2XYCA 4F9LC 4IMLA 5JMRA 1WQVT 1T66D 1G1KA 5AB9A 2ZQKA 1YO4A 1PX8A 2G75A 2GJ6B 3FTGA 4R7NB 3RBGA 4M6OL 1B0RB 1PIFA 2VZTA 3MLVH 4NYLB 3GDBA 3O8XC 4ONHA 4Z0BH 4PJHE 2A1WH 3AUWB 3U4BH 3HOGA 2E6JA 4YC2B 3NPZB 3MLSL 4PJGF 3ULUF 2G2RA 1H5BC 4XPTH 3F8UB 4GAJH 5DGQA 1C16A 2YD7A 3L5JA 4N25A 2Q3ZA 5AD0B 2J5WA 4B9CA 1X7QB 2EVJA 1ASOA 3N0AA 1MJ8L 4ETQA 5JIKA 3DX9A 1KN4L 2DH3A 4LASH 4RRPA 2X3CA 1NLBL 4ZTPH 3PWNA 5C1MB 1NCAH 4HEPA 3KJ4C 4S2SA 2ADIA 1YRKA 3PPSA 1U2HA 2C8NA 1NGPL 1YCSA 1ZD6A 4KO7A 5FYLD 4LSQL 1U3YA 3BD5A 3UTPD 1IM9D 1KB5A 1Y1UA 3QB7C 5KUMA 1OP3H 3IU3B 3D0VB 4FLQA 4NQSA 2B1AL 3ESPA 1R3JA 2WXFA 3QFDA 1MOEA 4ORZC 4Y4KB 1HHJB 4E9LA 2YARA 3II1A 5I6XC 2JKWA 5F1IA 1TEYA 1U8IB 5EIIB 4MWFB 3BUBA 3NSFA 4HIHB 1CL7L 1A4JA 1G9NH 1PBYA 2ICEA 3IDJA 4NQCD 4D0CA 3EZJB 4DP5X 2DJ4A 1G1OA 2I5YL 3FDWA 2X2IA 4M4RA 5CJ5A 1XIWD 3U7YL 1U4FA 1Y07A 2VXQH 3ALXA 1S7RA 3S5ZA 1ASQA 2IFFH 4KRPB 2OXHB 4DEUA 2UXGA 2CK0H 1UYWL 3M1BB 3MZGB 4AEHH 5FA4B 3BUQA 3P4MB 3MLUH 1V3LA 1IGTB 3P3YA 1QSFB 3FT2A 4YHLL 2VDNB 3G9AB 4QYAA 1QEWA 1JGUL 2IAMD 1AIFA 2J6EH 4ANVA 5GS2H 3NCJL 3B7UX 1IAII 3QISA 3FU5A 1KLFA 2H2SC 3ARGB 4CJ1A 3P3UA 4ODUB 1FJ1A 3HHRB 1N5AB 1S9WB 4EDWL 3UPRB 1EO8H 1JXGA 1CFSA 3FQUB 3E3QC 2DM4A 2WANA 2YMXL 1KNOA 4GI9A 4WUKH 2ERJC 4NFDA 5CZKA 1TQTA 1XAUA 2I60H 3QC5X 3TBYB 4B9KC 4I3RL 3O6FD 3STBA 3RU8L 3FH7A 1DVFD 3D39A 5D72L 3MV7D 4U1KA 2WK2A 3LYRA 2UWEB 3JV6B 5DZOA 2YAQA 5JW3L 2QVKA 5KANG 1VF5C 2OAAA 4Z95L 1QKZH 4ZXBD 1KG0B 5IVOA 5D2LA 4GSXA 4JKWA 3U7AA 4HLEA 4HWBA 2HJFA 4HA1A 4LAJH 2RIKA 1A6TB 2JI1A 3VE0B 3B6SB 5I74C 1RULH 3Q9QA 3KM2A 2GEEA 2Z31A 1AHMA 1E5CA 1BJMA 2GBUA 4FTVB 4X98A 3U2JA 2X88A 4NO3A 3P9WB 2J2ZB 2IANB 2R9HD 3O3DB 1FGVH 4YSOA 2IWKA 1NPUA 1RZFH 2MWCA 4XCYA 1DZBA