3LYRA

Human early b-cell factor 1 (ebf1) dna-binding domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
211
Chain Sequence
GSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor COE1
publication title Structural Determination of Functional Domains in Early B-cell Factor (EBF) Family of Transcription Factors Reveals Similarities to Rel DNA-binding Proteins and a Novel Dimerization Motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator
total genus 44
structure length 211
sequence length 217
ec nomenclature
pdb deposition date 2010-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16422 COE1_DBD Transcription factor COE1 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3180 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lyrA00
3LYRA
chains in the Genus database with same CATH superfamily
1HINL 1R4XA 4UV4L 1TZIB 5I17B 4ZMXA 3QEUA 4LAQH 2JJTC 1KJMA 1NC2D 3ZDYF 3VRJA 5EFIA 2D2OA 4DIXA 3W39B 1RK1A 4JJOA 3V4VL 2ALAA 2OZ4A 5CXPA 2EC8A 4UTAL 3OB0K 2HRPH 3VWJC 1UB6A 4PM1A 1UD4A 3MVSA 3AG1B 3FU7B 4GQZA 3HZVA 5GSRB 3DRTA 4ZW8A 3CCHA 5HHXH 1BVNP 3AMLA 2GAZA 1MWOA 4JDZA 4GB9A 2A1WL 4J1UB 1BD2A 1IEBA 5AQ0A 2F8XC 1SDAB 3QUYA 4G11A 4YC2B 1YN7A 2F53B 5AKRA 4HOMA 5D5ME 3E1F1 4B9IA 2C3VB 2PO6B 2A6IB 2NY2D 2Z65C 4KVCH 4R5XA 1H5BA 1MEXL 1MKFA 2XXCB 5JO5B 2OQJA 3K5SA 3KLAB 5AW8B 4NM8L 1H19A 2XWTA 1QO3B 2AZAA 1RIVH 4NI3A 1XDTT 2OP4L 1XCQB 4XE5B 1A7NL 2R0KL 3PS6A 4OM1H 5D7LE 4N9GA 2R2BA 1CE1L 2I9TB 1SPDA 2EH7H 4OZHE 1JGDB 5EMYA 3OTTA 1F97A 4NSKA 5BRZD 1E4XL 4G8FA 5E8DH 4LLVA 5GGRA 2BHFA 2D31A 3BPCA 2VITA 3ABKB 1D5IH 2X4NB 1QSFD 4KNSA 4NQXA 2E74C 2NRDA 3QZWG 4NUQA 4XVJL 3TASA 4NZTL 4JO2H 4OCRL 1JS4A 3CLEH 3ARWA 3WD5H 3FFOA 3QJHA 5J7CC 1YNLH 2OMUB 1A2YA 2WNGA 1P2CB 4QHKI 1T6WA 4XP5H 4N0CD 1AHWB 4P23D 2YD3A 5CP3A 5IMLB 4JO4L 5G4MA 3TZVC 5ICYB 12E8L 2IQ9H 5AOZA 3UROR 4XC3L 3HE6D 2DD8H 1NM4A 2VDPL 4NAMA 4KJYA 2ZWSA 1SHSA 4DVRL 2XFGB 4S0SD 5IB4A 1KB5A 2WNXA 5I5JA 4KRPC 4DAGH 3MI6A 2EDHA 5DLLA 5IVOA 4P48A 4EQ2A 1UZ8A 3NCWA 4MZRA 1CI5A 2IBGA 3IFLL 4HW6A 4PS4L 2FB4L 5HPMB 2PPDA 4HUUA 2MOVA 2NXZC 2HSIA 3SDAD 4PMEA 3NH7L 4JFWA 5I74C 1DN0A 1F11A 2KH2B 2W9EL 2MWCA 3KLDA 3VFNB 5EF3A 4AT6A 4EUPB 5LGKA 5HGDA 2XRAH 4GXUN 3C60B 4Y5XC 3P11L 2AI0L 5D1ZB 3KPQA 2IQAA 3QDGA 4WSKA 2XWXA 3K8MA 5DJAA 3D3VD 4JO1L 2XN9B 1A64A 2YD4A 2E7LC 1XF4A 3FU3A 3ARDD 4GP4B 3EFDH 2Y1ZA 3DTDA 4MXQC 4X5QA 5EV7A 5BZDA 4OSUL 2CKBH 3RVWC 3WENA 3HI5L 1EH9A 2B1AL 1WQVT 1A4JA 1IM9B 1Q1PA 2AQSA 1U6AH 3LEXB 4KQ3H 4UNVA 4ONGH 2CGYA 2ZKHL 1KDJA 4N0YH 3UTSB 3UG3A 3L1GA 2VQUA 4RAUA 1FI8C 1RJCA 5IG7B 1BM3L 2XACC 3CXDH 4QXUL 3KLHC 1A9VA 2IWEA 2XFXA 3KYKH 1MLCA 3O6FD 4G6AD 5TPWH 1WO2A 1AIFB 1I9IH 4HBCH 2NY5H 2CUIA 3QH3B 1A4AA 2F2HA 2VDKL 4ZOEA 4XOEA 3WI9A 2HT3D 1DUZA 3RL1B 5IWLC 2XIDA 3BPOC 4U6HB 1BHGA 4GOSA 5FUZL 4E42B 4OR1A 4Y88A 3WLBA 3GMRB 3T3ME 4IBSA 1D5RA 1ML0A 1W6WA 2B59A 5SX4I 1XTMA 1AQDA 1FGVH 4L9DA 4YXHL 3O3DA 4WV1C 3DX6A 3R1GL 5HD8D 1M6OB 4KNTA 1H3UA 3WIIH 2DQUH 4FDWA 3KJ4B 5KYWB 2D0HA 3BE1L 5D70H 3TONA 3X1EA 4PRBB 5BVJA 2BHZA 5T33L 2X4OA 3QCTL 2BWQA 3F3HA 4YHNB 5LBSH 3WIHH 1Y1DA 2UX6A 3CHQA 4MNHB 5CJBA 2GPZA 5DJYA 1B4JH 2V9RA 3WYRA 3E2HB 3WJMB 3X1NA 1L9MA 5CNHA 4DK5A 5FYLE 1FGNH 4YPJA 2WJ7A 4LSQL 3V7AE 1ZPLA 1KZYA 2DW5A 4F92B 3O11B 5FCSH 4JFFE 2VLLB 4NENA 3TNMB 4N85A 4AGQA 2DQHH 1BQUA 1OTUC 2CNZA 2J8UE 1M1XB 5I1DB 2JH2A 1F1GA 4QHNA 3U1SL 5IB5A 1UYWH 1DQDL 2V5TA 4X6EA 4OF5A 1YECH 2AEWA 1BFSA 4WK0B 3T65A 3FU5A 4M7LL 2PW1A 3L4ZA 3MR9A 1UA7A 5ISZD 1QX1A 1MCKA 2QQLH 4KZ0A 3B9KC 1OSEA 3HZVB 4JPIA 4R4FL 2OTWA 3DRTB 2PP9A 3TF4A 1H6EA 1L3WA 3PWJB 4NHCH 1BWMA 1BD2B 1IEBB 2X4QA 5CLYA 2BSED 3Q13A 3PV6B 3CLFL 3U46A 4L9LA 5DK0A 3QUYB 4XAWH 5DQ9A 2WYHA 1DBMH 1F8TH 3B4NA 4EZLA 2QADD 4QOKE 5HDQL 2DYPA 3ZDZF 1BEYL 4AVIA 3BQVA 2O5XL 2HWZL 1TZGL 2OQJB 4TLSA 4EBQL 3L4VA 1MCSA 1RP8A 1U93A 1AO7E 2OW6A 4S2SB 5BOJA 3QC5X 5CEXA 2JB6A 4O5LH 4WHYH 1JVLA 4PAZA 4DSYA 2IMMA 1XF5A 3CFDA 2WXFA 5D7SH 5DMKB 1HCZA 4HS3B 1VAHA 4R8WH 4G8FB 2CDEA 6FABH 3L8QA 4LASL 4NPYA 4F2ME 2CKNA 5K9OA 4YDZA 1N0LA 1UCBH 3P69A 4YEEA 3GYRA 4NIKB 1IKNA 2JLLA 1CCZA 4EUPH 1FZMA 2COQA 3G08B 3LRSA 3WFEH 1GW6A 4QYOB 5I73C 1E9PA 4W1TA 3FQ4A 1LD9A 1SHWA 3OX8A 2ZIDA 3Q3GB 5E56A 3GSQA 4RFNC 4GQPH 1QFUH 1U92A 3MV9B 1H6UA 4ZFGH 2ILLA 5IEKA 3H6JA 3KR3L 2GVYA 4NQDE 2NW2B 3ZKNC 5F7UA 1CI3M 5CBAB 4OIIH 4NWTL 1R0AL 1I3GH 2FT6A 5E9DD 2Q0ZX 3MJ7A 1SHMA 1EHKB 1TMCB 4LDLB 1KB5B 1NAML 3II2A 1YYLH 5BO1L 4R7DA 3BC9A 2XXMB 5TDPB 3DMMC 3MRLB 1UZ8B 1UZ6F 4AXWB 1PYWB 1NANH 3QDJD 5LXGL 3IKCA 1S7UA 5IF0B 2AP2A 5T3ZL 3GBML 4PG9A 1NIAA 2WUBH 3PDOA 2C3WA 2XQYK 1K5WA 4JHZA 3VXSE 4JREC 3QRLA 2YSSB 3BVTA 5HGDB 3X14A 4YBLC 4IRZL 4PRPE 3IJHA 3HG1D 2VTFA 2G3ZA 1JWMB 3KXFB 3LV3A 2ITCB 1E67A 3QO1A 2VXSL 4UQ9A 5G5DB 2O4EA 3SOBL 1J0YA 4MRCA 4KKAD 3P3TA 2CHZA 2Y22A 2GFBA 3PU7A 1E65A 3NFPB 3EKCA 1MPAH 5D1QC 4A63A 4W9EC 5AVZB 3VQ2C 1ZGLA 5SX5H 2ROYA 3SGJC 3HI6L 2FEDC 3CVCA 4NUJB 1UOWA 2WVTA 2A5UA 3ARBA 5E8PA 2CBTA 3PAZA 1ORSB 2LOEA 4N0FA 5I75B 5DXWA 1HYRC 3B9EA 3F04A 3EJUA 2PXYD 4OJFH 3N0PB 3T2PA 4I0PB 5DT1L 5AVRB 4RAUB 4DEUA 2X1QA 4APXA 4FQ1L 3AAZA 4LSVH 3AJ7A 4Y9EA 3Q0HA 4B50A 4HIJA 1A6ZA 2V5MA 1EMTH 1MI5B 3GKWL 1J5IA 3KL0A 3TESA 1EFXA 3G5ZB 3V10A 1ZT1A 3TJHD 4YHPB 3U83A 1IQWL 4E9YA 3MRPB 3GSNA 1YVLA 1BVKA 1TCRA 4L29B 3WNJA 4DO5A 1G1YA 5C6TL 1E5AA 1TQTA 4HD5A 4PHZA 3LQZB 1EHAA 2OYPA 3TCTA 1IB5A 2WKLA 2CGZA 4K8RH 3SGKC 3RKPA 4U1MA 4ES8A 5IROD 3PWPD 5LLIC 3BPNB 3O3DB 2PWHA 1P69B 1WLHA 3DX6B 4BRJA 1LE5A 1E7VA 4UCFA 1ETB1 1CXHA 3PP3H 4X6BA 1INQB 1J1PL 3FAXA 4LSTH 3L4XA 3VAEA 2V5RA 3GIZL 2EACA 3BT0A 1JGUL 1JMZA 5ITFA 4X4YA 2FGZA 4DO4A 5IB2B 4KKPA 5KS9E 4H5SB 4OCMC 5DJYB 1L7IH 3KG5A 2QHRL 3QGVA 3BI9X 5IQ7H 3LX9A 2HMIC 3FW6A 2MKLC 4ZXBD 1JCVA 4FTVA 1W15A 1CFVH 3GO1H 4X98A 1E4WH 4Z7VE 5I6MA 2YPLD 3WHE1 1P7BA 4NN6C 3N41B 3C09C 4BFBD 4XP1L 1I9JL 2Y0SA 2KL6A 1AD9A 4MB3A 2CJUH 5IGXL 1P7QB 4QHNB 3KPNB 3PHQA 4AYID 4IHOA 5EOTB 2W95A 5TFSL 5EBGA 4X6EB 3I3BA 1F18A 4FZ8H 4GKLA 2VAAA 3X1BA 3MR9B 4WFHD 5I23A 5F7WC 1UM6L 4NUPA 4NQSA 4WWKB 2EKJA 1B0WA 4GEJA 4ZNEA 1KXQA 5T1KA 3KHQA 1E4JA 2OTWB 1PJ9A 1Q1JH 5FYKH 2NQCA 2WYIA 4R3SA 5FO8A 1TQWA 4B53A 1ZIBA 3OMZA 3CNKA 2DTSA 3UGEA 4S1RH 1TKWA 2HN7B 3U46B 2F8VA 1MCPH 4LFHD 5IB1B 1JRHL 2VLRE 1Q0YL 3RX5A 5DHEA 4RFEB 5DSCB 1PBYA 4GAFB 2ZCKL 4DN3H 4FFYH 2DYPB 4XMLH 2E4TA 4CC4C 5IHWA 3HNSL 3GFUA 1PLCA 3G6JB 1OAYL 1WC7A 3P30H 5KVDL 2AJXL 1JIBA 1TUPA 2BSCA 1KB5H 1QI3A 4N24A 4JQVA 4ODWB 4X7FC 4K4KA 4NZ8A 1S7TA 5FKPA 3K4AA 4WJKB 2OMWB 3N40F 4DTGH 4WUUA 4ZZFA 1Q9LB 1S7SA 4NPYB 3RA7H 3VI3E 5SV4A 5K9OB 4FQXA 4Y16D 3VFRB 3MBED 5EC1A 3TT3H 1T22A 1FZMB 4RA0C 5E99H 3QG7L 5I66A 3LRSB 5F6IC 4CGUB 2BVYA 1JZFA 1E9PB 3BKJL 1LD9B 1BZEA 4X50A 3F00A 3UBGA 4Y2DD 4LZKA 1T1XB 1U92B 2F74B 1TQVA 1ZXQA 4N0RA 2D3NA 1E28A 1YMME 2HVKA 4YHKL 5K59F 3DX1A 1HEHC 3TEUA 3UBXB 4EZKA 1TO4A 5IB3B 3PQYD 5KBLA 1KT2A 1LO5B 5EH1A 3RILA 4U6XA 3BEWB 4L3EE 2AF2A 1CFSB 3I9GL 5JUEH 2HTLD 1SVBA 2B4CH 1U3HC 3QJVB 4Y8DC 3QI9B 5CU9A 3RY6A 4C55A 1TYRA 3IMVA 4BQBA 3HI1B 3MA7B 1QI4A 3ZRCC 4IOIA 4C56D 4DNLA 3G3LA 3S8WA 5JR1H 1KTDA 4G42A 4IBVA 4P2OC 4QYAA 1DSYA 4WO4A 1WV7T 3I6GB 4X80L 1FE8L 4AJVA 3HB3D 1F2QA 4Y2NA 2YAEA 1K4CA 5IVXA 1GGUA 2X6AA 1CE6A 2Z64C 1JGLH 3NSXA 1WS7A 4NKMB 2BC4B 2QPSA 4D9QE 2N0MA 3W9EB 5IQMA 1IL1A 3VACA 1DJIA 1T1YA 4L8DB 4HKXB 2Y9RT 1RHFA 1N5AA 3LPGA 3VH8A 2YGVA 3LNGA 1W8EA 4B3EA 4WI3A 1BXAA 3TT1H 2Q76A 4WUKH 2F5BL 2VZVA 3ATFA 4EIZC 3B9AA 2IPTL 4JG0L 3WN5A 1GAFL 3BAJA 1S8DA 5E9NA 5F96L 3ARBB 2A9AA 5C0RH 4ABVA 3T0VA 5DYFA 2V8MA 2UYLB 1Z5HA 4JRXE 3SDCC 3ARUA 1KTCA 1QBAA 1S3KL 4HA1A 1CG9A 1QLRA 3FU6A 3NIGE 4AIXA 3F8UB 1AOZA 1E6OL 4NOBA 1PFOA 1EBAA 3C08H 3HMXA 4PS3A 3KW8A 5KSBA 3W5MA 3AQZA 1OB1B 3U4AA 2WXNA 2RH0A 3ML8A 1M57B 3HUJA 1WWBX 4PGBA 4XO4A 1FL5A 1JZ2A 4Z7QB 2DYRB 1A6ZB 4P2CG 5E7BA 4GMTH 4MGXA 3AWFA 2X05A 3HS0C 3GBNH 2VN5A 3QCUL 35C8L 4G7VH 3IU4H 1E40A 5HBBA 3K72B 5DVNA 1BVKB 3AXIA 4U1SA 2NQ3A 4FP8H 2AEPH 2ZYRA 3GMNB 1VIWA 3L4WA 1EO5A 2YD8A 4PJCF 2XKUA 1QLFA 3BQUD 3RY4A 5FHBH 2D7TH 4FG6D 2PKDA 4MJIA 4EE2A 5GZOC 1Q9KA 2VB5A 4ANKA 2YQBA 3QNYB 4YIQB 5BUAA 2ICWJ 3ILPA 1UA6H 5IMKA 2H5UA 1DCEA 1BYPA 2R1XA 3TC9A 1H3PL 3VSVA 4M8RA 1F90L 1OOWA 4PJ9A 4X4YB 4N2GA 2X88A 4JRYE 2I07A 1KPUA 2VWEC 4PV9B 1DQQA 3WE6A 1BOYA 4TOYL 5FO2A 1WZLA 3F7RA 4KUCD 4FFVD 5I18H 4S1DD 5TQ2H 4JFOA 4JN2A 2GBVA 1GS8A 4WHTB 4A2EA 1PQZA 2OMXB 2X4TA 4FTVB 2NY4C 5HJGA 4PGJA 3L4UA 3VE0A 1J5HA 5C09B 4PRHA 2XG5B 2X4SA 4M6NH 1J05A 5B38A 5JTWA 2HVBA 2Q20A 4MJHA 2X87A 5FC9A 1DLFH 3CN4A 4RRPG 2VR8A 3QUXD 1PZ3A 3BVXA 1ZLVK 4PRIE 1IGYA 2PMZA 1YY8B 3RDTB 4PLKD 5AENA 4P4RB 1UASA 4FS0A 5FHAL 1QFOA 3KPRB 1HSBB 3CBKB 2C9SA 3MSPA 3WJLC 4EN3D 1ODAA 1XQ4A 3NCJL 2X1WL 1KBPA 4I89A 3KGTA 3ECUA 3X17A 1RJLA 2BIOA 2LTQC 3ATBA 3WTTA 1IZKA 4BWTA 3FQXB 4ODUA 3IBOA 3VFMA 2APWA 3FT2B 2VDRH 2JJVA 4OM0L 4YZWA 5MENB 1XEUA 3CPLA 4JPVH 3A3YB 2YA1A 1AHMA 4OGAD 3KGRA 4LCYB 1WC7B 3QEHB 2ZAHA 4YDLC 2CM5A 4DPAX 4UQAA 4AEHL 2CSPA 4C4KO 3FC8A 4FN0A 1UWFA 1S7TB 1SXBA 4HWUA 4TNWK 5FKPB 5EU4B 3S8FB 2W0PA 1OHQA 1J1OL 2ATKB 5EUKB 3QC6X 1XO8A 3BDYH 3QT2A 3N85L 4QGYA 1S7SB 1OAXH 1OZUA 2IAMA 4JM2A 1MRFL 3WNKA 2Y36H 4FQXB 3CWGA 2Z35A 4URTB 1WBYB 3CFNA 5EC1B 1TYEB 4DW2H 4V11A 5DMJB 2K7QA 1S5HA 1GKOA 5AAWA 3MRRB 4KJQC 3KPSD 1I75A 2HX8A 1HQRA 1JI2A 2X38A 4HWBH 4KFMA 2D7PA 4Z0BL 5IR1A 5F7EH 4Y4KA 1N6QH 3D52A 15C8L 3EHBC 4XX1G 5FXCH 2ERJB 3SDXA 1CD0A 1CD8A 4NS0A 3P2BA 1UD2A 3K6IA 1KT2B 4X9YA 4S0TD 1C5CL 2BXYA 3VW3L 4YSEA 3A6BH 2IANB 5IQOA 3KLKA 3UERA 2V7NB 4TVPL 2FE0A 2V9QA 4MDJA 3TO4C 5J9PB 5LCVL 1HXKA 4YBQC 4IOIB 2FJHA 3UJJL 2FR4A 4P2QB 4H88L 3PXHA 1KTDB 5AYTA 4AGNA 2GC7C 5IJCC 1PY9A 1RIHH 2Z31A 4MAYB 1ACXA 1I3RA 4WO4B 1ETZA 2VMJA 1PS3A 5IVXB 2G5BA 1MXDA 1CE6B 5J13C 3EYQC 1M7XA 2PWEA 2YAMA 5BRZE 1T1YB 1A9BA 3REVA 1G1KA 2FT7A 1KGXA 2AGJH 4NBZB 5KSAD 1EK3A 2WLYA 1MH5B 3UJIH 5C07B 3FSZA 3QQ9C 5L6YL 3I84A 5CEZE 2VWEE 2J20A 4ZW6A 3NACL 1KFGA 2UXVA 3LIZH 4PFEA 4E41A 2PPFA 3MGTB 1VKXB 1ADQL 2B1HH 4WW2A 5JW4Q 2PYEE 4X4ZA 2JKSA 4ZPVB 5HVHC 1YEDA 1FO0L 4PGCA 5KSUA 1QWNA 1VFOA 3EGSA 4XNDA 1HSAB 3D5OF 3AS3A 1RUQL 4KJWC 4PJDE 1R1CA 3POHA 4BFIA 1F58H 3B37A 3EYFB 4PGBB 5EBWB 1FL5B 1KCUL 4PJXA 1CICB 3QZWB 2YJLA 4BYHA 4LL1A 2PF6A 3SQRA 1SHXA 3HKZA 2P4AB 3JTTA 4ALAL 3D12B 1QFPA 3B6SA 1Y7VA 1ZGLP 4NQED 3UTQB 2AQNA 1IBGL 1VGKB 5F6HI 4M5YH 5D4HA 1U8IA 2TSBA 4H40A 4ODXA 4X7SL 1QLFB 4YK4B 4PLJC 5JLZB 1HHHA 2XTJB 2BP0A 2VZOA 2F9BT 2OI9B 1FN4B 1WH0A 4A2MA 4GG8A 3ARXA 1KXHA 3EZ8A 3D3VE 3VG0H 4IRJD 1MF2L 4YHZL 1A1OA 3SODB 1J10A 2A9NL 1H8SA 4FXGB 5IBTH 2FX9L 2R1XB 3VJ6B 2DICA 4FFTA 4X9GA 4PJ9B 2WK2A 1GIGL 2HVJB 1MDAA 3WE6B 5C0BA 4U3HA 1G7IA 3N41F 3IJSB 4JFOB 4JN2B 5I1GH 3K4ZA 4FQCL 4KJPD 3H9ZA 3OBAA 4LNVA 5D6DA 1WBXB 2MPAH 5C0GB 1IFHH 2ADIA 2E76C 3EFOB 4HLZG 1PFCA 1J05B 3H42H 4TF4A 1JOIA 2XPYA 1JHKL 3JUYA 2NNAA 5H2BA 1X5ZA 1ZS2A 4YDNA 5JIIA 4NLAA 4NQQA 5EU7C 3O9WD 2J73A 2GSIB 2ZWYA 3V52H 2CPCA 4HUVA 2NR6D 5KBDA 2NDGA 5C0JB 1AS6A 3QJXA 1RJLB 2HXAA 2FUTA 4B96A 1LO3H 5DRZB 1U8LB 1CC3A 3O3EA 1BFVH 3FO1B 1QNZH 4Z9KB 3G6JF 3ZKXC 4CBZA 4F9PC 3MNWB 4OT1L 4ODUB 3TBWA 3MLVL 4LSSH 4OLWH 3QUML 3HNTH 2XA8L 4WZ9A 5CSBA 5G4NA 1T03H 2YIHA 4E36A 5EBMB 3BXNB 4PVLA 5I8EA 3NCEB 5L4MA 4MCZB 1J1XL 4QRPB 4UDTA 1OGAE 1MFAH 3AREC 1LNUA 4BZ1L 3BESR 4RSYA 4X83A 2WXKA 4G5AA 1XF1A 4YHYC 1QUNA 5CM1A 1KLGA 3HZYA 1BGXL 4UOZA 3CV5A 1LK3H 4UQIM 1GMIA 5KVDE 1MREH 4LBAA 3GSXB 4NT6A 2Q7NA 2DQTH 3PGCA 5ES4B 2X3AA 2AJUH 3K0YA 4L37A 5D7JA 3FUFA 3W5NA 3V4PA 1B0IA 4J27A 4PWHA 3DURA 1R5IB 3LKSA 3VQ1C 1KYOK 2WYZA 4KK6D 1PZDA 3P4NA 4LCWB 2WLKA 2HAZA 1D6VH 4TXVB 4OH2A 4NC1C 2XQBH 5IR1B 1IGIH 2FZ3A 5ADPL 4L4TD 4Y4KB 4F5CA 1X5AA 3VFGL 4IBYA 5I28A 5F7FA 4LBEB 2FGWH 3SDXB 1DZBA 1N7ML 4ZQKA 1P4BH 3ELAT 1S78C 3JSSA 5EUOE 4ERSL 4DKTA 5T3XH 2QPUA 2BNRE 1KPRA 1Z9MA 3J27A 4MDJB 4XMVA 4DGVH 2FJHB 5IMMB 1TEYA 5E5MB 2QQNH 3CVHL 3FF7A 1E30A 2OMYA 3MLWH 5A2LH 3HE7D 4AIZA 4F2FA 4ZMZA 3AG3B 1XCTA 2NTSP 3A4AA 3BOVA 1I3RB 1WUNT 4M93B 1ETZB 4WCYH 4XC1H 5AG9A 5GS1A 3NCYP 5AZEL 3BHBB 3FFCE 5DO2C 4XP6L 5F44A 2EXTA 4ZDHA 3STLB 2IALA 2QPDB 3FUMA 3PCYA 4MNQB 3LDBB 4N0UE 4PPTA 3FPYA 5E0FA 5EDSA 5I26A 1OAQL 1RZJC 1WE5A 4E9WA 2J5WA 1GS7A 2W65A 1YMHA 4PJAE 3QFJD 3FK3A 4BCXA 2FX7H 5EZOL 5F7AA 3FN0H 4MQ7A 1AXTL 5CU5A 5E2UH 3WE1A 1G43A 4ZYKB 1WAEA 1KIUB 2XWEA 1BZ8A 1JPFB 1QTSA 3SPCA 1NJ9A 5A2BA 4IIQA 3VTTA 1P84K 2B9AA 2OPCA 3P2DA 2ITDA 2CO4A 2OA9A 2XU9A 3W38A 4MXVF 1EO8L 2K9FB 4Z7QF 5T1LB 3U6XS 2WAQA 3S6CA 5A6LA 5F89A 3IGAA 1UTDA 1WTGT 1O7SA 2KZKA 4KMTL 4P4KD 4PCTA 1K9TA 2VZ1A 5FA3B 4LEOA 4K7PH 4ONFH 1MFEL 1T20A 1QEWB 5HHOA 1XGRB 3D69B 5EU7E 1JUFA 3DLQR 4JY6B 2PW2A 3QDJE 1O5DT 1BQ5A 3B6SB 5C0FA 4PJHE 1CFBA 2ZSVA 3SE4C 4MASA 3TJEH 3JWNC 3TO2A 4TKWA 2WW8A 3V7AG 3HHRB 1EGJA 1U33A 1JTOA 1JK9B 2OR9L 5FFLA 1ES0A 2YEZA 5J12C 5HYFA 1BP3B 2BP0B 1WCQA 4GQQA 5KJ7E 3HG1E 4X2UA 3NOIA 2P8MA 5D1XD 1MY5A 5DHVA 4BWWA 1Q8MA 4KK5D 1CLYH 2CRYA 3FQNA 1I8LA 1R19A 2WC7A 5AVXB 2DLFH 5IHZB 1TQCB 3MV8D 4G6FD 4PJEE 2C3HA 2G3NA 3NZSA 3FJTA 3FSAA 1NUNB 3E80A 2OX5A 5C08B 3T0XA 1BMWA 1MLBA 2ZX8A 1LO4L 4X99A 3EO1A 3SBWC 2DWSA 2JVUA 4YHOH 5F0PB 1XGTB 2G2PA 3D50A 4XPBH 1QZ1A 3U4EB 1Q9WA 5JDSB 3Q8EA 1CGVA 1N10A 4DGUA 2VW7A 4WY7L 3BWUC 5DURD 5H2BB 5D7EA 1S5IL 1TVDA 4KGJA 5BZWB 2C4FU 4XAKD 1BZ7B 2BFGA 3H9YA 3RWFB 2RACA 4ZUTA 5H4YA 3C6EA 3LNFA 4NC1E 2CR6A 5D1QD 3DYMA 4MLIA 2VJXA 4N2IA 3ZT5A 1MJUL 3IFOA 2GK0A 3SQBA 2NXYC 1DVFD 2QHLA 3ISRA 4DEWA 1U8CA 5A2FA 5C0CB 4G5ZL 1Y6KR 4BM7A 3F64A 2YFOA 4EKJA 5IW6B 1WWAX 3VXTA 2C8NA 2GBAA 2DQJH 3APNA 3W57A 3PWLA 4O2CA 3O3EB 2I60H 3WFZA 2H0PA 3HFML 4PBVC 2CA3A 1RUPL 4KROC 3O8XD 4LLAA 3ZHDA 3TTYA 2CUAA 5SWSD 1AFVH 3TBWB 4NQCD 3ULSA 2KT6A 2APXA 2E9IA 4PB9L 1IM3A 4PJ5A 1AY1H 4JN1H 1OT1A 2KZ1B 1VRSA 5I8EB 5BMFH 1OXYA 4F37F 5DD1H 2D7QA 1OANA 3SZKC 3KHOA 4OF7A 4CKVX 3WFDL 4ZS6C 3RI5F 2DKSA 2HUHA 4LP8A 5EORH 3IJ9A 4LAQL 4NT6B 1MWAA 1RULH 1BZDA 3CVIH 5F7MC 4LDCA 4F3FA 2BSTB 1RZ7H 1JF5A 1TOXA 4R4BA 1XF3A 5E08H 2HRPL 2Y5TB 3CN2A 4MS8C 3LKSB 5HHXL 3D08A 1S9XA 2O1AA 1GGIH 1F1AA 2EDYA 1XZ0A 2N7AA 2Z91A 3FHQA 3P4NB 3QZOA 4KX8A 4P5MB 4RESB 4LEXH 5E2WH 2DEXX 1K4DA 2O6FA 3UYRH 2DQDH 4FL4C 4P46D 5B1JC 3MRKB 4DGYH 3QG6A 4G8GE 4BBWA 3Q05A 3MDJA 3VM7A 3N9GH 4KVCL 4F9LA 3MFFB 4TSCH 4OZIE 3KWTA 4LOEA 3GD1C 1J18A 1JF1A 2X1OA 5ICXA 1RIVL 1M7DB 1E9OB 1U8HB 1EAQA 4XMKH 2HRHA 5LAXA 4OM1L 3K1DA 1Q72H 2Z93A 5IVXF 2OMVB 5GGSA 3E9TA 3RTQD 2X2YA 3QS2A 1DL7H 4FFWD 3ARQA 4PR5A 3FTGA 3W37A 5HDWA 3PWNA 5GS1B 5E8DL 5F1IB 3PYCA 1UOLA 2MPVA 5DJ0B 4RIRB 5J6HA 4P9HC 4PJ8C 3SCMD 4JO2L 4BA0A 4Z7WE 3AG4B 1FVCB 2VJ8A 4R0LC 3WD5L 1YNLL 1KGIA 2AZUA 3CFKB 4XP5L 3CK0H 2VXTH 2RB8A 4PRNA 3CUPB 4OCNC 1H6FA 2EYSB 4MQ7B 2IQ9L 1FFTB 1OT2A 2GBUA 3MUUA 1GCFA 4DGIH 5JA8B 2RJMA 2DD8L 4G9FE 1EJ6A 2GEEA 2RBLA 3B2VH 3IAPA 1NJ9B 1N3NA 4IIQB 3ZU8A 1OPOA 1IU1A 3ARGB 2LLNA 4N5EC 5J06A 4DAGL 3OQRA 3I75A 4JQXA 3VFUB 1WHPA 5CSZB 1YPZA 3FH7A 1IAII 3WUWG 3PQYE 5IJKA 3AQXA 2ATPA 1NOFA 4F7TA 3EGDA 5BS0A 2BCMA 1E8XA 4FMKA 5F7BA 1MRDH 5CJOH 3RUGE 5HHOB 3I6LD 1JUFB 1TPXB 3G6AA 2GJ6A 3AUVA 4ZBJA 1BWWA 4A2FA 2XRAL 5C0FB 5JIQA 1KSRA 5D2LA 2ZSVB 1W72A 2N1TE 1HWHB 4KXZH 1AXSB 5MEPA 3VWKA 1MJ8L 1I85A 4GBXA 1LP9A 5F7DA 5I82A 2XT1B 1I8UA 3OMNB 5B8CA 3EFDL 5JHDE 4JM4H 2VC2B 5CJ5A 4QY8B 3CFBB 4AIOA 1D5XB 1JVOA 2CKBL 4TL5A 3ZTEA 3K71B 1IC0A 4GS7C 1U6AL 4KQ3L 2OV0A 4RMRA 1X9QA 4ONGL 3CC1A 1HZLA 4N8VA 3MRFA 1MLBB 1XCWA 4N0YL 4OFDA 5JHLA 3EO1B 5INDB 3GXFA 3K91A 3MRHA 3QWRA 3CXDL 3SDYH 1UD3A 5CEYB 5KN5A 1IEHA 1NCHA 3KYKL 1Q9WB 4JM0A 2YPVA 1HQ4B 1GS6X 2H1XA 4YSTA 1GOHA 5DD3L 5TPWL 5BVPH 1I9IL 1HU8A 4HBCL 2H1PH 2NY5L 3RNQB 3FDWA 2VW6A 2Z7WA 4NQVB 2VQ1A 4OLYH 3QYCA 3T1FB 1MCJA 4M8VA 1CFQB 1IBFA 1YNTB 3DX9A 4A2LA 2GEQA 1GPOH 3PGFH 4OIAA 4FAAB 1PD6A 4RA3A 4OF0A 1IGFH 3T6QC 1HHKB 3L2MA 2FWOA 1OAKH 5F9DC 1FGVL 4ODBD 4Y4HC 4OLUH 3A4FA 4FF9A 1CDUA 1DN2A 4KI1A 4YHLH 4L0PB 1R24A 2ZYSA 32C2A 3MRGB 4PWEA 5F0MB 5TF1L 5AB0A 1NGZB 2DQUL 3RB7A 3WIIL 1WSST 5D70L 4E0RA 1HWWA 3PWLB 4O2CB 5C0AA 4R7XA 5LBSL 3WIHL 1ZMYA 3VTMA 4GP5B 1B4TA 3F6IA 1B4JL 3LNHA 5I5MA 3E9UA 3NG5A 4LU5H 2XOTA 1U2YA 3MROB 3U0TA 1FGNL 5IQ9A 1IM3B 3ZTJH 4CN4A 2BJMH 5CP7B 1FAIH 3PL6C 1T0OA 3S4SG 1KBGH 2HFGH 4UOJA 1CL7I 1ICTA 2DQHL 3OM3B 4FQ2H 2ENYA 2F18A 1UYWL 1FSKB 2AS5M 3NCMA 2WP3T 1PD1A 2NDFA 4R97C 1U3YA 2WUCH 1YECL 3E7JA 2WZ0A 2X2UA 4QRQB 4ZTEA 3BW9A 4EOWH 2AK4A 2HCZX 4OD2B 4URKA 2QQLL 5B4MC 5T3ZD 1YHPA 2DQ6A 1YN6B 4DP0X 2BY2A 4I2XE 3MCKB 1XZ0B 2Z91B 3R06B 2H7WA 4NHCL 1KGCD 2QKIC 3LJ3A 4HUCA 5CZXC 1L3NA 1HNFA 1NDGB 1H3WM 2A4ZA 2Y3NA 3KE0A 4PJ7A 4A6YA 3RGBA 4XAWL 1CXLA 1SYVB 5TQ0H 2GIMA 1DBML 4LCIH 1F8TL 4QTHB 1OQXA 4X6CB 3UYOD 3OZ9H 2B77A 1AAJA 3X1FA 3DUHA 3MLXH 3AADB 5ICXB 2AXGA 4O5LL 2X12A 3TA3C 4B41A 2Z93B 4PJIB 3O2DH 4RCAA 1LWJA 3C5JB 3KVPA 5D7SL 1TTGA 5IOPB 4WKZA 1QPKA 1T6VN 2P5EB 3P40A 4R8WL 4XVUC 4CADA 3VXQB 6FABL 4ZTPH 2WIMA 1UURA 1XX9C 1UCBL 4L8SC 1E5BA 3WKNA 1WAAE 5LB1A 2ZNWA 2J71A 3AU1A 2B7DT 5DD6A 3C6LA 3WFEL 3QWOA 1J86A 2G3MA 3QXUA 4ZO9A 3NJHA 3FZUC 3DK2A 4JFTA 1F4YH 1PGRB 1QFUL 2C9RA 4ONOA 3GSWA 4ZFGL 5K69A 2AV7A 2JKWA 3CX5J 3RVXD 2VLJD 1LEGA 2XV2A 3IETA 4BSJA 2WJ5A 3KPSE 3TFKD 2VC2H 1I3GL 1XFPA 4B7LA 1VEMA 1DEDA 4BHUA 3GZOA 4GRWE 4HU2A 3MJ6A 4DF9A 5D7HA 5F0LB 4GT7A 3I75B 3TH2T 5FLVA 3VI4F 3TBVA 3D4GA 4LIQH 1YPZB 1XR9B 4AYSA 2VDLB 3IB4A 2Y6SC 4PWKA 4NRXA 4WI9A 3AS1A 3VFSB 2O5YH 3TGXA 2IOOA 4LHUG 2EYTB 4YBHA 4F7TB 4WSJA 5BS0B 4MD5A 2D7MA 2ZXGA 3COOA 4LPCA 3FB6A 2MMXA 1ZV9A 2K3HA 2IADA 1B3IA 2WTRB 3B7TA 3QK0A 4J3SA 5A2KH 4OJEH 3QORC 1TLKA 2UZXA 1O5PA 4V1DD 2W60A 3MLUH 3C5SA 5B3NA 4U2ZA 3PABA 5D4QA 2X89D 4QTIH 4NKIH 3T0EA 4HK0A 4XOAA 3ARZA 3UPRA 3EJSA 3VD0A 4WTZG 1F6AB 1WS8A 4OB5H 5ACMA 2EIEA 1LP9B 1HT6A 1MPAL 4FG4A 3L3IA 5IP4A 2VQTA 3LYRA 4NO5A 5T1DH 3HC2A 4A7QA 3RGVB 5I5RA 2W0KA 5FKAB 3K1KC 4GRLD 5HHQA 1I1AB 2D9QB 3ME0A 1MAJA 3C8KA 4JE4B 2UWEE 4RGNB 4PW4A 3IDJA 4ONHB 1U91A 2QKSA 3CVBA 4OJFL 4YFLI 3WFHB 3MRFB 5FS5A 2WOYA 3I6KB 1B0RA 1T0PB 2JLPA 3DIDA 4BXVA 2DLTA 5SWZA 4LSVL 2EDWA 4KQ0A 5EIIG 4WI7A 5HI5D 1IILE 3UXFA 1EMTL 3QHZH 1ZA6B 2QT6A 2YARA 4JY4B 4HYTB 1DE4A 4HKBA 5EZPA 2R8SH 4YPGB 2ZG1A 1W0VB 1L6PA 2YN5A 4CSTA 5F7YC 3ARSA 3L13A 3QCVH 3P54A 1NGPH 4IOSA 4M1CD 1AQHA 4POUB 3VXOA 2O61A 4TUJA 1XIWB 2GT9B 5FCUH 1CT8A 2C9QA 4HIIA 4Y1AA 3VXMD 4O2EB 1F6LL 4K8RL 4NZFA 3V5HB 4HS6B 2H9GB 1RXLA 3VVVA 3HZMA 4X4MA 1R24B 1X5IA 4WJG3 1FYTA 4PIBA 3ORJA 4PBXA 1NCDH 1N0XH 2V33A 1NCOA 1YDPA 3Q8BA 4G6KH 4P5TC 3WDIA 2Z8WC 4LSTL 3VYNA 4O51A 3FCUB 3ZZQA 5I1KH 1OOAA 1TTBA 1L7IL 5IQ7L 1QA9B 1MDTA 2Q6WB 2QZQA 2BNQA 5E6IA 3FPXA 3ES6A 3GHEH 1F4WH 4YX2H 1CFVL 1K2DB 3GO1L 1E4WL 2KLTA 2FBOJ 3S9DB 1JXDA 4F15B 1FAKT 4NUGH 4YAQA 3UTTE 1MVFA 1LDSA 3U2SA 5BOZG 2CJUL 3V0EA 3T3PE 3KH4A 4IDJH 4JFDE 2VABA 2ZKXA 4PSPA 3IRCA 3ERXA 1NBYA 3OF6D 3BZ5A 4UT9A 1YRKA 4FZ8L 2K0RA 3L9BA 2WXMA 2V5YA 3BW9B 1QMUA 2B08A 2VQ4A 4MMZA 5DEFA 3RWGA 2JKIS 2WN3A 5FW6A 4Y4FA 1A3ZA 1A9EA 1KC5L 1GZHC 2HJLA 3GLZA 2ZUYA 4GLRI 4X0NA 3UBFA 3BUTA 1Q1JL 5FYKL 2EE3A 3SE8H 2NY5C 3DETC 1TNNA 3TN0C 4X6DA 3B1TA 2BS71 3GUTB 4K71B 1ORQA 4LSPH 2Q7YB 1MCPL 2R23A 4KPHH 2RA1A 4NZRH 2YGPA 1V8HA 2ZCLH 4I3RH 4NI6A 1KB9K 2JNZA 3HHSA 1A8ZA 2Y07H 5BRQA 4FFYL 3MGAA 4NO0B 4XMLL 3ULVH 5ICUA 1G9MC 4L4VD 4Y5YB 5GJTH 3GTVA 3MREB 4GI6A 3P30L 4B97A 3CC5A 2DWDB 4IKIA 5D5MB 1KB5L 1SQMA 2AXGB 3R8BB 4LOUC 2XQYG 3EGXA 3AXLB 4U1JB 2VDLH 2J7LA 2VDNB 2YS4A 4NBXB 5TGBA 1M2OA 4F7PB 2VW4A 3BVDB 3H2PA 4B9PA 3VTAA 1ZE3C 2P8LB 2RFXB 5B1CA 2FTAA 1DTUA 4DTGL 2JCCE 2X2JA 3LVEA 1U8NA 3RA7L 5D7LB 4I9WD 1PG7H 1JPEA 4OZHB 4IRSD 3TT3L 2GCYA 2PO6C 5E99L 3WNPA 3UAAA 1PZ5A 1E8ZA 3D2UA 4Z1PA 4L5FE 1TITA 4XZUA 1W8OA 2Y7LA 5DRXB 2B20A 1UZ6E 3BIKB 3ZRSA 2A9DA 4XODA 5KUMA 4FXKA 3UZQB 1VLXA 4OJCA 2N0KA 3NA9H 1R33A 4ZD3H 2W9LA 1MRCH 4ZUUA 3ISYA 4RFOH 3L5WB 4GUPB 3MJ8A 1QBBA 1ZA3A 3WJJC 5JUEL 3U7AA 1FNGA 5E8NA 2B4CL 4AZUA 3UCRA 3TBVB 4NJAH 4GW1A 4WQOA 4OI7A 1B6DA 1WT5C 2P3YA 2Z7UA 5JR1L 2X0UA 5HGAB 2OJ1A 3H9SA 4IK6A 4W4OA 5DDHA 5IIEB 2JSFA 1V7MH 1NEZG 1JAEA 1QSZA 1TTAA 5FO7B 2V6HA 2VMFA 4XPAH 1MFDL 1Z66A 2EE6A 3MRNB 4WK4B 1AHWC 2BW4A 2IADB 1U0QA 3WNNA 4NOFA 2V2TB 1JGLL 1PX3A 1NFDF 2DJMA 5CBEB 2MNUA 2OJEB 1YNKH 3VXRA 2QGBA 3PWUA 3CDFA 3T0EB 2CO6A 3FH8A 1K6QH 4LVNC 1I7RA 3BVUA 1NH6A 1VFAA 4CSZA 3U1PA 1MHPH 2E7CA 3NJJA 4WAFA 4UQ2A 1D5BB 1IIIA 2NZ1A 5C0RL 3DXAA 3MJWA 5HHQB 1OWRM 4P2RA 3ME0B 1URLA 1S7VB 2A74C 1WZ1H 4JFHD 4PY7B 3P3RA 5AW5B 1IT9H 2MJWA 2QZ5A 1D9KA 2XG4B 2V37A 2XPGA 1HI6A 4QRRE 3C60C 1NBQA 5EIQA 3D18A 3EJQA 5D1ZC 1QQDA 3ZYIA 5SWZB 4NYLA 4K5MA 3MV7E 4HV8A 1YNTF 4GMTL 4AMKH 3WTSA 1XD1A 2LR4A 3GBNL 1FZKB 2P42B 1HESA 2F1AA 4G7VL 2NY3C 1XB6A 3IU4L 2GI0A 5DJXB 5EBLB 3QISA 4G3YH 4A7TA 1X5GA 4Q6IC 6TAAA 4FP8L 1K5NA 2VR6A 2W88A 2V2WB 4WK2B 1RZQA 2AEPL 1LK2B 1AKJD 2O61B 2C9XA 4PVMA 2PWDA 4Y1AB 5TJWK 1J9CT 3AY4C 3KM1A 5HGHA 1NGXA 3A6OA 5E4EB 5E03A 5FHBL 2D7TL 4TRPH 3JWDC 4PYGA 1JZHA 4ZW7A 1NC4B 3T3MB 2VN7A 1HHGA 1URZA 1YDPB 1YY9C 4MCYB 5HYEA 1ZS8B 4HHAB 4LL9A 4M5ZL 1UA6L 2VJ0A 1JSYA 3B9VA 1W6LA 3LHPH 2A3TA 2FQGA 3MODH 2IBZY 2MCG1 3MAWA 3VB8A 4XCYA 4AQOA 3TH4T 4YGAB 3SE9H 3RWEA 2MOGA 3MNZA 3GDBA 1PCXA 2XN2A 4HVBA 1CMOA 4JPSA 3KYOA 3MYJA 4HEMA 5TQ2L 3ES6B 2L3BA 4ANXA 2IBBA 3ARPA 4LKCB 1OCWH 1W0YT 4H13C 5AVVB 1I8KA 4JCMA 4M6NL 4HJJL 4P3WA 5F1NB 3QIBA 3U2SB 3BRFA 3J07A 2I69A 3KJ4C 2VDNH 3FFDA 2VABB 4HCRA 2P8PB 4U1NB 3ZO9A 4JFFB 2DS4A 1QRND 5CF3A 3DNKA 4QWWD 4TVPD 1DCLA 1JGIA 4JMXA 5EDXA 2Y1AA 2J8UB 5I8CB 5FM5O 4I3SH 1G7JB 4M62H 1FG2A 1YC8A 3E2HC 4OBRA 2HG5A 5ACZA 4RQQA 4XAKE 3FT0A 3MX0B 4NHUB 3TZVB 3RFZA 4X6CF 4MHHG 1ORQB 3VXPA 1UVQA 1UWXH 3HW7A 5EF2A 1BVNT 2O5ZH 2MCPH 4EKXA 2GSMB 3MOBH 2VDRL 3WY3A 4WLCA 4BH8B 4JPVL 1RZKH 1KB3A 1U8QA 1WISA 1YUHA 2G2RB 4NCC1 5E6ZA 4K8RC 4PJIF 5I1CH 1MFVA 1TF4A 2N4IA 3P73A 1CVSC 4QXTA 2HT2C 2NXZB 4OQTH 4DVBA 5CLXA 5AZ2H 3QBTB 4MKMA 4MJ4A 1Z9NA 3BDYL 1DO5A 1OAXL 2YMXL 4W9IC 3QUYC 4ELME 2Y36L 3UIYA 4KZDH 3DRQB 1UXSB 2GCYB 4DW2L 1H5BC 3CZLA 3IWVA 2YKKA 2NZIA 4Y19A 4F2MB 2VLKA 5AOMA 3DPBA 1QVOA 3CX5K 2AERT 3ULVF 4JUSA 3B7YA 1N2RB 4HWBL 3RLSA 5I6NA 4CMMB 1E8WA 5F7EL 5HHNB 5JW4N 3GEWB 4MJID 2ED8A 2BMKA 1YPZF 2WLLA 4LCUA 3SJVE 3MUY1 5FF6B 3QUZD 3MJ8B 1ZA3B 1JGEA 3NP3A 4GY4A 4NQDB 3A6BL 5E23A 4EIBA 4RGMC 4XN8A 1SLXA 3ZKMC 3AW5A 1EVUA 4PCYA 3H9SB 4FEMA 4A2HA 4MB4A 1RIHL 1H0DB 2LFEA 3QIUA 2XWBB 3DK0A 2WM0A 4MMXA 2CJSA 4JO8A 3OMIB 3E8VA 2QSTA 1ZT4A 3IDIB 2AAVA 1X7TA 4LCCA 4EVNB 5C86A 3UTSE 2OFQA 2MNWA 4UMSA 2X1PA 4XN2A 3ZO0A 1LP9F 5KVGL 2VXQA 2UY7A 2VR3A 4AJ0A 3KD4A 5C71A 2AGJL 1LEKB 3VXSB 4LDEB 1YUKB 5B1BB 4ACTA 3QXWA 3A0OA 3UJIL 4WV1B 3QRBA 3P4MA 2I9LB 4PRPB 3U9UB 4YWGH 3S5ZA 3C6SA 5AUMB 4ZAKA 4QTFA 3LIZL 3U7YH 3TIDB 4UILH 2B1HL 5T5FH 3OKDB 2WN2A 2W92A 2FNBA 3DX3A 5CN2A 5GZNC 3LEYH 4X8GA 3EOBA 2BVOB 1JV5A 3UAJD 5MERA 2VSDA 2XWJA 3SBQA 5HYJA 5L2KD 1BW8A 2YRZA 1VERA 3B5GA 2ROXA 5HYQB 1Y6MR 1F58L 3RVTD 5ABDE 4IOFD 3ALWA 1NDMA 4XVTH 5BQ7B 1JZ6A 2EJ1A 3PXJA 5EN2A 3QEQA 2YUVA 4JHBA 1GYAA 1P53A 3SDDA 1A4CA 3R0NA 2BNUA 2VR9A 2ODIA 5FYLH 3BSGA 1FVEA 3I6LE 3SE3A 2B4CC 4M5YL 4U3SB 4OZ4A 1V3LA 3ZZLA 4N6QA 3AY2A 1NGXB 2BLFA 4BSVB 4JM2D 4X4KA 1QUPA 4HJEA 2FO1A 1E90A 1KNOA 3BGFB 3FQUB 2GUOB 1QBLH 3VG0L 5LGJB 1JXJA 5GS3A 5IBTL 1DQTA 2YJQA 5DWPA 1XGZA 4XCYB 2DLEA 4JZNB 1QG3A 1RFDH 4W9DC 3RWEB 4DP5X 1JHTA 2ZOKB 3S48A 2H0FA 2AJZB 3BLKA 2W0FA 3HJ0A 5I1GL 3GXDA 5D9SB 3VRIB 1BD2E 5KS9B 2MPAL 1IFHL 2SODB 4GFTB 1NPJA 2D4FA 1J88A 1U4FA 3H3KA 3RZCD 3BPNC 2YPKA 3V0GA 4F37K 4I4WB 2EIMB 3MRCB 1LEIA 3FFDB 3MNDA 4YFDB 2AK1H 1QD0A 5FGCE 3BSZH 3UX9B 2NSXA 3ZTCC 4PP1D 3TBBA 3RI5K 2ETWA 3EYOB 2CD0A 3V52L 5DRNA 1WG3A 3CDGA 4G1MA 4YGVB 3ZPDA 1FG2B 1BF5A 4UNIA 1T2XA 3WEXB 43CAA 1U41A 4MSWA 5IBUB 4E9LA 1L0XA 3BUIA 4I87A 1XVSA 3A4EA 3JWNG 4RFNB 1NBCA 4QIRA 4CL7A 2WXPA 2EH8H 4XP4H 4FX5A 4AEIH 1BFVL 1UVQB 4AZ8B 1QNZL 3ARFD 3V7MA 2GITB 4LSDA 3S3BB 5ICZA 4YMPA 5FYKE 4OLWL 4LSSL 5D5MF 1EDHA 2X9WA 3HLAA 3HNTL 4WU5B 1M2VA 4E41D 5GSVA 5CIPA 1T03L 3WXWH 4NLHA 3DMMB 1X5MA 3S35X 3IMUA 3OKMA 4KO7A 4EI5A 1U2HA 5IM7B 1MFAL 4WWKC 1TSRA 4QXTB 5FPIA 2DQEH 1XB3A 2Y1VA 1U30A 4IEFB 4OVUA 4DVBB 1R6VA 1RVFH 4U2YA 4JQIH 3NK4A 2EUZA 4OZHF 1LK3L 1MREL 1NIEA 3T2NH 4AEFA 2DQTL 1NCNA 3EDFA 4LT7A 2AJUL 4YBLB 4UIKH 3N55A 4NIYE 1SUJA 1EDQA 3TM6A 4AOFA 2Z8RA 3VGBA 2FBJH 2UZIL 2EAEA 2Z34A 3VI3B 3L7EA 3RWDA 3FT4A 3MTRA 3UC0H 1TJXA 2VMDA 4XGZA 1D6VL 4HT1L 5AW0B 1ZLSH 5JZ7C 3SYCA 2XQBL 1MCNA 1IGIL 1NC2A 3MV01 2VM4A 4JZJA 1OY3B 5I6OA 3ULUH 3D06A 2A6JA 3AUWB 3QDGE 1UD6A 3DC0A 1ADWA 5T1MB 2WLLB 4LCUB 1OE1A 5JOFA 2JJSA 3O6MH 1P4BL 5DC2A 2K6WA 2NW3B 2ICEA 4Z76A 2OSXA 4X6FA 1RJYA 1YMMB 4GUOA 3VA6A 1JZ8A 1IKNC 2PR4H 4GAGH 1MZYA 4M43H 3QJOA 1R3JA 1QZNA 2QQNL 4ATWA 4RSVA 3MLWL 2PABA 5C0BD 3AQDA 1C8PA 3B43A 4HXAH 4WCYL 4XC1L 5FDWB 4HG4J 3EAKA 3NZUA 3KPOB 5DHYA 3ARVA 3MUHL 2J6EH 5GGUB 2ADFH 2DIBA 1JNHA 5L8LB 1EIBA 4WFED 1NBZB 3C5ZB 3QAQA 2WTOA 1Y18B 5ITBH 3HRPA 2X7LB 3K6NA 1RZFH 3C8DA 5C0DB 3QI9C 4U31A 3NRQA 2Y7MA 2FX7L 2X44D 4LLWA 3FN0L 4ZOBA 5E2UL 4GIPD 1L9OA 3O41B 3B3IA 5EPMA 3V0AC 3BGMA 6PCYA 2WGNB 1QSFA 5ECJE 3H54A 5C0ND 3S97C 4RX4D 1I1YB 1XTLA 2DZEA 1JF6A 3WFBH 3EOBB 4H1LG 3TVMD 4JPQA 1QW8A 2FLRT 4GI8A 5DVKA 4P23A 4JRXB 3GXMA 4BELD 2WBJD 1CVRA 2WGXA 3UZVA 3IU3A 2I32A 3NIGB 1OF2B 4JFED 4K7PL 4ONFL 2YZ1A 3HE6A 1ET5A 3C09B 5FM8A 5IZ7A 4ODHH 1SDDA 3M45A 3QEQB 3C75A 4M7JL 5K33A 3U0WH 4F7CA 1IGJA 4HIXH 4FGMA 3RL2A 2BNUB 4CU6A 2YOAA 4XBEH 3M1BA 3ARBC 3VVWA 3VB9A 5DJ2A 3TJEL 1FVEB 3CH8A 1F3RB 2IH1B 5J56B 4KTEH 4NEHB 3T3MF 3O0RH 2IOMA 4WFGD 4KHXH 1MVYA 3WTYA 3SDAA 2P5PA 2JELH 5JXED 2NY0D 3UBHA 1E7UA 1CLYL 3CXFA 5DZNA 1LO2H 1KNOB 3UCQA 5EZIH 1LDPH 2DLFL 1IEAA 3RAJH 3SSGA 1WFUA 1DVTA 5T8IA 5KANI 2XV6B 2YEVB 3MN8A 4EO5A 3EDEA 2F61A 2GTZA 2J8HA 1ODUA 2GB2A 5IVZB 4KKZA 1BQHG 1HS6A 2IV8A 3ARDA 4YHOL 2ZWKA 3V4VH 4XPBL 3SGDI 1T7VA 4JX0A 3TCLA 5IKCB 3QJQB 2D0GA 4XHJD 1CF8H 3ZE0B 2YBRB 2YPKB 1WITA 2J8UF 1CD9B 1KCKA 2FVNA 2OL3A 4HIEA 4F2EA 1SJMA 5E00A 3GS0A 5CILL 3HAEA 4H26B 5DRNB 3CDGB 4UMGA 3ILQD 1OTSD 3O6FA 4XB3A 5F6IB 4N6RA 3TBCA 1TMQA 1L9PA 4PRIB 4MSWB 2W1NA 2FL5A 1MQ8A 4MA3A 2DQJL 5KOMC 1S7WB 3BZ4B 3L3OA 3N44B 3BD5A 2I60L 5DJDA 2ZAIA 1MJJA 2ZUUA 2YOCA 3BZFB 5IW3A 1OTTC 1R3HA 5I76A 5EIIB 1HFUA 3UZEA 1AFVL 2VLME 1X4XA 3H53A 3SO5A 4X8XA 4JDTH 5JA9A 5CIPB 4F91B 1AY1L 4QAWA 4JN1L 1QWUA 3GI8H 1A6VH 3HBZA 5BMFL 4HJIA 1IZJA 2G4GA 3L3KA 5DD1L 1HXYA 3ESOA 3PGDA 3QNXB 4FOMA 5H37A 2XPZA 3O6LH 4B3VA 1WRFA 3O4OB 4YOKA 1F86A 4JO4H 5DMGD 5EORL 3DSFH 5BW7A 4AENB 1B88A 3CZEA 1RULL 4K3DH 2YKLH 3CVIL 3U4BH 4Q9QH 3L5XH 4XXWA 4W93A 2A83B 1L5GA 1Z0MA 3QQNA 1Z7JA 1K3IA 1RZ7L 1A22B 2QLYA 3P3YA 4OZGA 2H26B 2WNKA 3OAZH 2X41A 1FJ1B 2FEEI 3CFEA 3CZNA 4KDWA 3DJRA 3EZJB 5J57B 5E08L 1G5AA 5DS8A 4NNPH 3SYPA 4WNQA 3L7EB 4P59H 3TNNA 5E2WL 1N68A 4M61A 4LEXL 3VFVB 4Z5RA 3C9NA 1SFHA 4DP7X 2BVPA 3F58H 3UYRL 2DQDL 4BH7A 2HFFB 4KI5C 1NC2B 4JZJB 4DGYL 5AOJA 3IGLA 1U8JA 5SWQA 1A4BA 3I3EA 3KNBA 4QGTA 1C16A 3N9GL 5ISZA 5FYJU 1RZIB 2DL9A 2QGCA 1OGTA 1P4IH 4P5KB 5JOFB 1DBKH 4TSCL 3L6FA 3I9PA 4YEFA 3V5KA 1BZOA 4FQXC 3UTPE 1JDCA 4NAQA 4ABUA 3RHWF 4XMKL 2BSEA 4YSOA 1R3JB 1Q72L 2XI9A 4OGXH 1V3JA 4XHQA 4O9HH 1DL7L 1JCKA 3HS0B 4XBPA 2H6PB 1VDGA 3FQTB 3CBRA 2ZSWB 1SLVA 1T04B 1HVXA 1IBHA 3IF1A 5TDNB 5C7XH 3ULUF 1IBZA 1JV2B 3IPBA 2YN3A 2K6ZA 1XSIA 4UDUA 1C12B 4F24A 4P57A 3RY6C 1U8KB 3CK0L 2VXTL 1BM3H 1KULA 5BRZB 5KVGE 1WD8A 5I1JL 1G9EA 1ZHBA 1CDIA 1MFBH 4QF1B 4UNUA 4DGIL 4OKVA 1S46A 1UWYA 4PEEA 1L0QA 4PRDA 1JMXA 3B2VL 1QSFB 2C1OA 2PCXA 2R1WA 2DWYA 4WO4C 4HOXA 2LAGB 3EOAA 2V9TA 3VCLA 5J11C 4G8EA 1D3CA 1T66D 4HIQA 4XP9H 5AVQB 2M8XA 4BDVB 2PYEB 4EDWL 2ZAGA 2UY6A 2HT4C 1IJ9A 3UZVB 2BSBA 1MRDL 4HALA 5CJOL 2D8KA 4MAUH 2F53D 5E9DA 1MVUB 4PJDB 3WN5C 1IGJB 2HP4A 3V0HA 5D71H 3LPOA 3OKEA 4FTVE 1K85A 4PMFA 2F19H 4XWOD 3U48A 3GRWA 2QR0A 1F13A 1EO7A 1RU9H 1S4IA 5DC4B 1G9HA 3HMWH 2XQ0A 3NK3A 5D96C 3BO8A 3SYOA 4PS7A 2JKTM 4LRIA 3V5DA 1JXGA 1OLZA 4IGBA 4JM4L 5AKSA 4B60A 5I1LB 1BBJA 1JZEA 3I85A 3IN2A 4JDVA 2C4XA 1CICC 5F88A 2X6BA 2AJYH 4FNLH 1AG6A 2BOBA 5KS9F 3D3VB 4ZNEE 2GTZB 1KXQE 4KX7A 5HDBE 3SDYL 4YDLB 4H0GA 1TVHB 1E27A 4PUBH 3IMBA 5J6GA 3MTXA 3DSNB 4YK4C 5LBVA 2CDFA 4Z7VF 5BVPL 2XTJC 3A47A 2ZKWA 2H1PL 3D25B 1X9RA 2BP3A 2OI9C 1NLBH 3AU0A 1OHZA 2HZHA 1SY6H 4OLYL 5DHXB 4S1SH 3DROA 3HNVH 3QNZA 2X2HA 1S7XB 2JK5A 2PXYA 3CHSA 2CHXA 1GPOL 3PGFL 4ZO8A 4WTXA 2OL3B 4FXGC 1XCXA 1IVLA 2VL5B 2XXFA 1IGFL 1QTPA 1BVLA 4PJ9C 1OAKL 1P7HL 3HAEB 1TNMA 4OLUL 4BK5A 3ILDA 3O6FB 4KI5E 1FNEA 1EEQA 4IMLA 5HHME 4YHLL 3IDYC 4BINA 4YE0A 2OTUA 4WUUE 3DV4B 4XNBA 4MA3B 3GMQB 1PKOA 3EHBB 4HWZA 1MJJB 2Y25A 1OWWA 2EDKA 2YO3A 4ZMTA 1JZGA 1JD7A 3N6YA 1X7SA 5CWSA 2DLHA 1DJWA 4LU5L 3T4AA 5IROA 3PWPA 1CXEA 4MD4B 3KVQA 4KAQH 4APQD 2BJML 5DTFA 1FAIL 2R56H 2PYFB 1U8MB 1KBGL 2HFGL 5KJ4A 3UADA 3L3KB 5B3JE 1QSEA 1NQBA 3OVUB 2XNAB 4JLRA 2XBTA 4LNRA 4FQ2L 5EOCH 4ES9A 4LEBA 5TD4A 1HZHH 3OPZL 2RGSA 4YLQT 2WUCL 4R96B 4ZXBA 4UF7C 1L5GB 3VI3F 1BAFH 1F3JB 4EOWL 4KK8D 3FTUA 4J4PD 5JIMA 2CA4A 1CR9H 4CA4A 2YPLA 5MHSD 3QB7C 4K5LA 2FIKA 4IBLT 1NAMH 5HI3D 4WNQB 5F1KC 2V8LA 1AACA 1PW3A 5EEVA 3CN0A 3TNNB 4M61B 5IVXE 3BJLA 2A6DA 5LXGH 1XH0A 1TQUA 4GBXD 1X6LA 1OP9A 1NGYA 3MLZH 1A7QH 4LCIL 5TQ0L 4EXKA 5CSGA 3L08A 3ZSTA 3CE1A 1IC1A 3MLTB 4FULA 4NXSA 4G43B 5HJ3B 3OZ9L 4MQSB 3V6ZA 2R0ZH 2NSQA 2VE6A 3L6FB 3MLXL 2LU5A 4HK3N 2IAMC 3ASOB 5CEZH 3NIDE 2CO2A 1NCWH 1T7YA 5L8JB 1D5ZB 3K2MC 2F8OA 1PG7X 1RZ8B 4RRPM 2JXMA 4PRAB 4YDMA 1HDMB 3D1MC 3O2DL 4HG4K 4LP4A 2NX5D 5AAWC 2AXFB 1TQSA 5KYUB 3WNIA 2BNRB 2QADB 4PV8A 2Z7YA 4XBPB 3UEQA 4ZTPL 2WKOF 3QIWA 5KSBE 1MHEA 4Y4KC 1UEYA 5CR1A 2B5IC 4R7NB 4Y9GA 3CHPA 1JK8A 4NQTA 1AZUA 3HUJE 3DDFA 5KYYA 3SKUD 4R4NC 3FFCB 1UXWB 3D85A 1CXFA 5I0DA 5E2JA 4AQ1A 1G0YR 1PZSA 4MCMA 4DESA 4P57B 1F4YL 2Q7AA 3MLPA 4Z3EA 1KIQB 4KRNA 4LSUH 4N0UB 5HI4C 4QHPA 2X1XR 4NRZB 1DJYA 1ZHBB 3NGBB 1MJ7H 2CG9X 1J8HD 3P3UA 4ZPTB 3T5WA 3UAFA 2C3GA 2MNJB 1RUMH 2Z31C 2VC2L 4Y9CA 3MBEA 2R1WB 3ET9F 4M93C 2JB5H 3DO3A 3LN4A 3UABA 1OE3A 5C97A 1S9VA 2XTJE 3NIGF 3FSOA 4NKDA 4MJIE 4LIQL 2F08A 1NIBA 3CDCA 3GB7A 4LMQE 4LGPB 3Q6GH 4Y2DA 2O5YL 1KN4H 1KG0A 3WY2A 4QLRA 1RLWA 4K7PY 5CCHE 1KIPA 1QFWM 3PJLA 5CFAA 3LZFH 1THCA 2EDFA 3MLUL 1HEZB 1VA9A 3OKEB 3S36L 5ID0A 2X9ZA 1G4MA 4QTIL 4NKIL 2J12B 3FSVA 4C56A 4GW5A 4DJMA 4ESKA 4I3GA 1HH6B 3QDJB 2B1OA 2OULB 1SMOA 3ARYA 3PLYA 4OB5L 5HYSA 4PRHE 4PJHB 1CLZH 3HLKA 3UDWA 1PLAA 5DI8B 2Q2EB 2YK1H 4OCSH 2HJKB 4AMWA 4L1HA 5FOBA 1BBJB 3U7WH 1GR7A 3Q01A 3HG1B 4V2BA 5ANMA 5F88B 4WEBH 2DWEA 1A47A 4POZC 1T0NB 4Q8BA 3O2WH 2KQMA 4YNYA 3ESUF 4G8IA 2Y2TA 1NICA 2BOBB 2EQDA 5ESVA 1HWGB 3G5VA 4MDRA 3VX1A 4LLUB 4Z7UA 4AYDC 5C1MB 3ZE0F 2R69A 4PJEB 3ILEA 4M9PA 1KXTA 3AREB 1ZSHA 1BQSA 1KTLA 3QHZL 2ICWI 2XYCA 3MV9D 3NAAL 5M94B 4X5PA 2EC9T 3FSWA 4BUHA 3VFWB 4YHYB 4XO9A 3T08A 3DROB 2AMUA 3KYNA 4PQXA 3RX7A 2RIKA 3GBDA 2R8SL 2BW5A 1FZJA 3UL4A 2PXYB 1E43A 3QCVL 3MV11 2H3NA 1NGPL 4QJ4B 1TQCC 2E5EA 3MUGA 4YE4H 5FCUL 5ECGA 3NCCB 3OL2A 4R83A 3VGHA 1TT6A 3UC2A 1G7MA 4N5UA 4IMLB 2Q86A 3FUDA 1EAPB 4JG9A 3N44F 4KDVA 4NUMA 1NCDL 4G6KL 2XTLA 5D6DC 1NDTA 4O02A 4CVZA 4NNXB 5I1KL 3GF8A 4WHYG 1RL1A 3KXFD 4PJBA 3BQUA 4YSRA 5LGHH 5CWSB 4XB7A 3PWPB 4I18A 4PW9A 4QHUA 4ETQB 4AGLA 3GHEL 1F4WL 2CIIA 4QHKJ 4YX2L 1JJUA 4KKCC 3MCLH 5C8JB 2EVGA 5JNYB 4NUGL 4EUPG 3UYPB 1O7DE 1AGFA 2G9HA 4CILA 3GC3A 3SDXE 3T2LA 3WKPA 1OQOA 3F7YB 4IDJL 1IE4A 4X5XA 1J5OL 1M6UA 1CK0H 1QBMH 4DUVA 1AD0A 1GRWA 3E6FA 3GK8H 1IGCH 4ZXBB 4ZUVA 4WJ5A 3G5WA 4I0PD 1IARB 1UADC 4MQXC 1KTKE 4BFOA 7CGTA 3L5HA 1RZGA 3DDGA 2O30A 3VXUD 1IAOB 4KK9C 2APTA 1G7QB 3UTOA 4XNMA 1MI5D 5TH2B 5DFVC 3WMPA 1FUNA 1XEDA 1M71A 2A6DB 3QUXA 2X4RA 4JGJA 4KPHL 1I7UA 4LSPL 4WKXA 5TDOA 4I3RL 2ZCLL 4Z0XB 3S96B 1MCFA 1NGWB 1YSOA 4HC1A 4GSUA 3OGCB 2Y07L 2VERA 3UPCA 4PP2A 3ULVL 2XHNA 5D7IA 3V6ZB 4EN3A 4PSRA 3FO9B 5GJTL 4IU2B 5IV2A 3LPPA 1IC7H 2C9UA 5D7JC 4QXGH 1U8OB 3RVUD 4FKKA 2DYSB 1YCSA 2OCFD 5D6CB 3IJYA 4E41E 2VDLL 4EPSA 3GWJA 4OZIB 2CDGB 1KY7A 3ZW3A 4P99A 4PV8B 2XN1A 1UT2A 3NFSH 3KWWA 4M3HA 4AYBA 1PG7L 4DP6X 4FLSA 3RE0A 4QNPE 4ABWA 2JKRM 3ZX1A 1PNCA 4TNEA 4FI6A 5AVSB 5KYYB 1R3LA 3DX2A 5J12B 4PJXE 4AQ1B 2EO1A 4MZ3A 4DZ8B 1DVUA 1U3ZA 1PEWA 1KTBA 4Z7WB 1P7QD 1VFBA 2JQZA 2J6WA 3EH1A 3V9EA 2GTWA 3NA9L 4MJ5A 4CVXB 2LGNA 4Y16B 3GUFA 4QCIA 4ZD3L 4WSGA 1FYTD 3EJCA 4B9YA 1CFMA 4RFOL 3P0VH 1EXUB 1WA1X 5GS1C 2J44A 3HZKB 1S9VB 1YJDC 2E9GA 2W80C 5K9JH 2IVFC 1THAA 2E6JA 4FQJH 4OF8A 1F4HA 1WFMA 2FH8A 4NJAL 4B5EA 3OKKB 2GSGA 5D7KD 1M7IA 4G9FB 25C8H 5F2FA 5J3HC 4I1PA 3D39D 5DZLA 5ERWA 1I4FA 2D03H 4Y2DB 8PAZA 5C7ZA 2X4PB 4PJDF 2NLJA 1V7ML 3PNWB 5H94A 4XPAL 3G7TA 1V10A 1UB5A 2V2XA 3NZ8B 2D4DA 3PXLA 4KKRA 3PQYB 1KIPB 4OUUA 4IM8A 4FCAA 3OLIA 4F8LA 3FUEA 1EA9C 1N70A 1D2PA 5C0BE 3PDGA 1YNKL 3ZZ1A 5IW1A 5I6LA 1H3PH 3RUGB 1DDHB 1YQ2A 4N28A 3QPQD 1K6QL 4BZYA 4IIQC 1NFIA 4W68A 4GXVL 5GJSH 1FP5A 3QA3A 4D8PB 2VUYA 1NKOA 2XBZA 1M3IA 2NXYB 1SYSA 2H2SC 2VH5H 3GM8A 4JRFA 2BHUA 1C7TA 3T6VA 1MHPL 3HG4A 1T21A 3HB3B 5H35B 3NPZB 2JQMA 3OJVC 4OQ1A 3T9WA 5FOBB 1KCLA 3DWTA 3OR7B 2ZP0T 4PB0H 2QSCH 1FVDB 4G7QB 4A67A 2VR7A 5ANMB 1LE9A 1T0MB 4KROB 5EEZA 2CHNA 1NCBH 1TPXC 1EFQA 1WZ1L 2AQ3A 3HN8A 2HKHH 5JHDB 1RI8A 4G8IB 1IT9L 1D2OA 3TIEA 5KSAA 3LRMA 5ESVB 3G5VB 2YRPA 4PH8A 3DVNB 4N2DA 2X9YA 2PCFA 3CIAA 2WMPA 3LZOA 2A0LD 1J7VR 3GHBH 3MLYH 5AVWB 3D4CA 1GGBH 2HLFC 1N64H 4AMKL 2GK2A 2VM9A 2BVQA 2EDQA 4B6ZA 3P4OA 3PRZA 4ZG1A 1BQRA 1OP3H 4G3YL 4HSCX 4F8PA 2AV1A 2VZSA 2CBPA 1OT4A 2F54D 2BOCA 3VGAB 2X6UA 3BLBA 2ADJA 3EYUH 2WQRA 4PLOB 4TRPL 3SY0B 5DR5H 4NERA 1RH8A 1RZJH 4WFGE 1UA3A 4H1LB 2HFEA 5E0QA 4LLMB 3OG6B 4NQEA 4FL4B 4XR8C 1NCCL 3IRZA 3LHPL 1O7VA 2J1ZA 3IJEB 1YA5A 3MODL 1DDTA 4IYKA 4NPKA 1KYDA 4Q2ZA 4XWGH 3S7GA 1WCBA 4IU3B 4M7ZB 1XL4A 2X09A 3SE9L 5LKNA 1KV3A 1QASA 2FJGA 4ODTH 3MKKA 4X5WB 1A3LH 4QHUB 4L3FA 2KS0A 2CIIB 4DK3A 3HG0A 5HSFA 2P44B 1OCWL 4NM4L 5EO0A 4IRJA 3II3A 2FHBA 3O6KH 2BVEA 2IO5A 3LS4L 4F5CE 3IS1X 1S7RB 3T77B 4MD0B 2G9HB 5TTRA 5KBNC 2LU3A 2I5YH 1JYXA 2VDNL 1RK0A 3KLLA 1KGUA 2WINB 1NCUA 4LPVA 1R5VA 15C8H 3TWCH 4HJ0C 3ROOB 4I3SL 3OHXA 4M62L 4RMQA 2ZPKH 4GXUM 1SOKA 5BQDA 4R0LB 3EYVB 3GINA 2K8MA 4JRWA 2OZNA 2D3JA 1XD0A 5AG8A 5K9QG 3VXRD 1TZHA 1ED3B 1W0WA 3DYOA 3BVNA 3FTXA 1UWXK 2XC8A 4JB9H 1Q94B 3MXVH 5GS0C 2M1KA 2P5WD 3QUXB 3HR5A 3TX4A 1I7UB 4R9HA 1JGVH 2WYTA 3TFBA 2O5ZL 1SJHB 1UQSA 2C1PA 4MA1B 2MCPL 4JFYA 4I2XB 2GI7A 3O9WA 3MOBL 1X5FA 3DX7A 3QUKB 3VMOA 2YD6A 1FSKC 3GBLA 4AM0B 1RZKL 1Z9SA 2ENSA 2NR6A 3EO0A 4PP2B 3B2MA 2VIRB 4BKLB 4HAKA 1GL4B 5I1CL 1X3DA 5EUOF 3U2IA 1PD0A 1AGBB 4OF3A 2CXGA 4RMBA 1TG8A 4HH9B 4OQTL 4AKQA 3BSHA 1X4YA 3FMGL 1I8AA 2FHFA 5AZ2L 1DLHB 2SEBA 4U1HA 2GQHA 2KHAA 1TETH 4J3WA 2CALA 1GZQA 4JL1A 4MNGA 4K55A 1ACYH 4I77H 5E5RB 2QELA 4FTDA 4KZDL 3L54A 4UTBH 1IRAY 4HH8A 4Q6YA 1FO0H 1TR7A 5J1AA 4PJGA 4F9LC 3DHUA 5C09D 2Z4TA 3M46A 3A22A 5HHOE 2NUPA 1ITCA 2CJ3A 5GGTA 2GUYA 5KZCD 2APFA 3JTBA 3CDYA 1INDH 4OV5A 1LMKA 4I88A 4MJ5B 2EO7A 4Q4IA 1VEOA 1AZBA 3NIFE 3RDTD 2Q8BH 1FFOA 3F01A 4GS7B 3VA2C 3V9CA 1A6AA 3U36A 1HCYA 1RQ5A 4ZUWA 3GNMH 3HG3A 1U2CA 4FJ6A 3KPSB 2GSGB 2XZZA 3KWXA 5ERWB 1U58B 1I4FB 1BPLB 4GRWB 4YR6A 2WLMA 3APDA 3Q7JA 4L4TA 2DEWX 1CLCA 3SKOA 4FYRA 3H2WA 4CGTA 1PZBA 1JERA 4NKQB 1WICA 2XJKA 3MJ9A 3KCPB 3FTVA 5MEND 4UT7H 5C3LD 1KEMH 3JVFC 2BZDA 4K9EC 4PJHF 4BFNA 3NMEA 5MEOA 4UM9B 2IDSA 3QIBD 4X8JB 1JZ4A 1NFIB 1NANI 2XSKA 3N42B 3ZOAA 4AV0A 4Y4HB 4C47A 1I9RH 5A3ID 4JQXC 4U3XA 5HGBA 3EG9A 4XPHH 4RMUA 4ZOCA 2CHWA 1OP5H 5IJKC 4RBPH 2NTFB 4YWGL 4L18A 1DBBH 3CSGA 4OKDA 1A4KA 1FIGL 5FFOA 4UILL 5JPNA 5T5FL 3B9KA 5J1TC 1KY6A 4H1LH 2QV4A 1CDBA 4PJEF 3QJTB 1KELH 4KWUA 2BH0A 3EJPA 3LEYL 5AYUH 1HK6A 3FO0H 4XCNB 2EKSA 1BOGB 3FRUA 3QFJA 4YSPA 4AYFB 3LH9A 3S88H 3UAEA 3EJZC 2UWEB 2G60H 3RYMA 3VWKC 2X10A 1I85C 4XTRD 3O3UN 4XVTL 5MP6L 4XNZB 4B95C 4CN1A 4WENB 5L88H 3QR2A 5B8CC 3WGUB 5HDRA 5FYLL 2DLGA 5DJ6B 4X0KB 1BIIB 4R97B 4D94A 5DGQA 4PJ5E 3S0PA 1ULVA 2XXGA 2IAND 2O6EA 2YGQA 2BOCB 2R51A 5GRUH 4P4KA 2ADJB 1FWXA 1I7TB 3QXTA 5GRWA 2A99A 3V0VA 2GHWB 4A7GF 3U0PA 4P9HH 4P2QD 7PCYA 4JEGB 5HVWA 3V6OC 4MAYD 1KLFB 4ZMVA 2Y5EA 2QKIB 1QBLL 1T1ZB 1GY2A 1H9DA 1QR4A 3JYBA 5F9JA 2XWCA 3D0VA 5ABAA 4JAMA 3AFLA 1RFDL 1VGEH 5D4JA 5ALBH 2P7TA 3RKDD 5JQ6H 4DP4X 2FJGB 2A73A 2P1YA 2VXUH 2WWMD 5D1XA 3DV6B 5DUBB 4BCZA 3O4LD 2NY6C 4ELKB 5C07D 3NCXA 4HP5A 1IQDA 2WXOA 4IRJB 3DJ9A 2W59A 2EXWD 3X13A 2D7OA 4TTGA 3MV8A 4UTAA 4Z6AT 3WS3B 5IMOA 1JFHA 2FO4A 3PHSA 4Q0XH 1V05A 2XKNB 2ZNXA 3B5HA 2IH3A 2AK1L 1TDQA 3NCBB 3BSZL 4KUZH 5T3XD 5ADPH 3LN5A 1M56B 5IQLA 3UTTB 2Y6TE 4FXTA 1IAIH 1H6TA 3T3PB 2RTTA 4JFDB 5DVPA 5CD5C 4OCXH 4TNWF 5B1AB 2AABH 1TZHB 3WAJA 3VD4A 5LO7A 4AQZA 3L1OL 2HTKC 4LCVA 4XP4L 2EH8L 4AEIL 4LSRH 3HR5B 1DQVA 2DMGA 2KUTA 3N1GC 5D1QA 1M9WA 5CCGE 3S5LB 5D72H 4JY5H 1Z9SB 3EO0B 4HIHB 1DVFA 3WXWL 4NN5C 2H6UA 4OZIF 5CZKA 2YZ8A 3OB8A 4LLDB 4FABH 1T1WB 3TEWA 1CU4H 2EDEA 3IJ8A 3EJJX 3ZL1A 2DQEL 5A16B 4HETA 2J43A 5EOCJ 1ZRUA 1RVFL 3U30C 4JQIL 4GRWH 3O8XA 3RHWK 4U1HB 3GJFB 3NJLA 2WQAA 5HYJD 1MIEH 5SWSA 4NQCA 2L7JA 4RVBA 4MNGB 4ZX3A 1E3FA 5C2BH 1RURH 4OLXH 1YPZE 5TF0A 3WXVH 4AH2A 3E1ZA 3FONA 4LKXB 2AKRB 4ISVA 1RY7B 1QSVA 2FBJL 2JCCB 1DSFH 3MZGB 4UT6A 4Z7WF 5BS0E 5I16B 1GJUA 3POCA 3UC0L 3U6RA 1CDJA 1XGQA 3PUUA 4FHJA 3RX8A 1ZLSL 3VRLE 5JORB 2GJ6E 3ULAB 2H8PB 2AXHA 3CZUB 3J8F7 5DZVA 4JFVA 2Z92A 4WWNA 3EDKA 5D2LE 4ZZKA 3OXSA 3ULUL 4HUWA 1J9QA 4OV5B 3EF4A 2JJWA 5GIRA 3ASWA 4RMVA 4BFKA 1FFOB 3O6ML 4ZQTA 1A6AB 1LP9E 2YXWA 4ZUWB 4OIBA 2I27N 2PR4L 1BLNB 3G5YA 3WTVA 4M43L 3N43B 3C6LC 2EXYD 2OR9H 3BWUF 3CFJA 3CQPA 3WG7B 3RUGF 4B27A 2ZYIA 3BUYB 3T0DA 4GQ9H 1G0XA 2J6EL 1G7PB 3B7UX 1S3RA 1I3UA 2ADFL 3T71A 4JR9H 3T0BA 3KDMA 1Z9OA 5FUOH 2AJSH 5ITBL 4QRPD 5E6YA 1CL7H 4HCFA 1BJMA 1RZFL 3HE7B 3RTQA 1ZT7B 5HGBB 3BFWA 3VU2A 4XI5C 4P5TB 2YLHA 2H2PD 3ZTNH 3RJOA 4FI7A 4R2GC 5JPNB 4AL8C 1ZHNA 2A9CA 1P6AB 3SCMA 3PFUA 2EIZB 3EF7A 4I0KA 3WFBL 4DZBA 1XGPA 2YD5A 1DBJH 4AQEB 2NYYC 1MHHA 5I1EL 4HXBH 1KYFA 2CGRH 3QFJB 3PF2A 4C83A 2UZPA 4M8UA 4LCWD 3T0EC 1AGDB 4XNAA 1WBZB 5E1AB 5DEGA 5C0AE 4ODHL 1SLUA 4QRRB 4QT5A 4UZGA 5E1QA 1EEZA 3U0WL 1SN5A 4XBMA 5CZVL 1JG9A 4WU7A 4HIXL 4ORZC 5FB8B 3QDMA 4NRYB 4HSQA 3SYQA 2BY3A 4N26A 3VFPA 3I9AA 2FQDA 2P45B 3QDHA 1GHFH 5AYQA 1U3NA 4KTEL 2ISDA 4KZEH 3O0RL 4P4KB 4KHXL 4HHWA 4GO9A 4KITB 4PJFA 4M3KB 1TEFA 2JELL 4QRSA 1AZCA 4R5VA 3G04B 3TN0B 1LO2L 2XVLA 3DVIA 1I8IB 3BEVA 3KLQA 4N22A 1G6RB 4RISH 4WNJA 4X7TA 5EZIL 1LDPL 1N6VA 4KTGA 1ONQB 4FJZA 3RAJL 1B6UA 5FLUA 3WFDH 2AK4E 3F7VA 3AQYA 3D0VB 4JAMB 4MNQD 1K3ZA 5ESAA 4BZ2H 3OKOB 2A73B 2PWFA 2WLIB 1N26A 2ADYA 1AP2B 1TZAA 4ELDA 3DIFA 4PJ7E 4FFZH 5E4EC 3LMJH 3CMOH 1OGSA 1O0VA 1CF8L 2ZOUA 2X0VA 1RHHB 4JO3H 2ZQKA 4KUCF 4U7MA 5GGVH 4G6FB 1U3HA 3EDDA 3DO4A 3H3PH 1FYHB 4J2QA 2XV3A 1ZTXE 3REWA 3HC0A 3I50H 5CLWA 3GJFH 3QQDA 1Z3RA 4JKNA 4P2OA 1QP1A 4ZMYA 5T1LD 2V17H 3BD4A 5DFWH 1Q9OB 3KZ8A 4RMWA 1ZLEA 5E6IC 3ZE1E 4QXVA 2A6KB 3D51A 3WLWD 5CS7A 1ROCA 3DUUB 4HX1A 3QW9A 5CJXA 2F8IA 3NFNB 1CD1A 1Y0LA 3TH3T 3LKOA 3LS5H 2V3EA 3K8LA 4L5FH 3ZHNA 4JDTL 4KKNA 3A21A 3NESA 3GI8L 5KBPA 1A6VL 3MKGA 4MMZC 5DCCA 2CCWA 1EEYA 5DRWB 4G1EA 2CLZA 1A1NB 4Y4FC 5JMRA 4AMXA 3DGCR 1JHLH 1ROWA 3O6LL 4J23A 4HIPA 3WY1A 5MEQB 3VDBA 1FV1A 1GSMA 2NY1D 1AMYA 2VSKB 3O3BB 4P06A 3DSFL 5MI0C 2AVGA 3W11D 1INEH 3OAZK 4K3DL 2YKLL 3U4BL 3UBXI 5C08D 3L5XL 5EF1A 4Q9QL 1H8LA 1ZK9A 4D7BA 1H15A 1ZWIB 4Q4EA 1CJYA 3V8CA 4XCEB 3LB6D 3B2DC 4KKBD 3C8HA 4LVNB 1WAAF 4D7PA 5KYXB 4ISVB 4NNPL 2R29H 3B9DA 1VSCA 2IH9A 2XIIA 3I9IA 3LXBA 1PX8A 4P59L 2QBWA 2AQPA 3ZY7A 4ELMB 3U6RB 1HZKA 1DUYA 3F58L 1FBIH 4GW4A 1DQLL 2Z92B 1OPGH 1DJHA 4J7RA 2K9UA 5JOPE 5D93C 2R15A 3T0EE 2A74B 3BVVA 5F6HJ 3D0LB 1P4IL 1DBKL 3CDZA 5E5LA 4GRWF 1CLOH 3Q2VA 4L3CA 4ZS7H 3QZBA 1RPKA 2E59A 4L8BA 1FZOB 1A14H 5B38G 1E2VA 3AROA 1MJ8H 3SJVB 5DK2A 4OGXL 2CO3A 3L45A 5D55A 4P46B 5EO1A 4O9HL 2AXJA 4J28A 4TTDC 4X9IA 4FXKC 5FWQA 3ML9A 4QO1A 4A1RA 4WI0A 1DBAH 2J1XA 2NY3B 2ZWNA 2X42A 1XH3A 4Q6IB 3P77B 3H3BC 2HRLA 4MVBC 3SD2A 2CWRA 3DHMA 5SWZE 3KDMB 5C7XL 4L8CB 2VUKA 1BM7A 1PZAA 3RWJA 3X3FH 5LWYH 3RTQB 5CKGA 3QVAA 2ZXCA 2EDLA 1MFBL 2FWLB 3ELQA 4W4OC 5DD3H 2EDJA 1KUMA 1MW2A 3RQ3A 3SCMB 1G6RH 3Q2WA 4Y1AE 3BP7A 2R0LL 2UWEF 1KJ2B 1XGPB 2Q3XA 3KPPA 4UBDC 3INOA 4X4ME 2YC1B 4XP9L 2H32B 3R7RA 1PY0A 2BVTA 5K9KB 1FYTE 2IDUA 1H9VA 4C83B 5FGBA 1G9MH 3GT6A 2VLJA 3IMRA 1NEZA 3IDXH 4O2FA 5DEGB 3MOQA 3FCTB 4MAUL 3EH4B 2EUVA 5TF1H 3T0AA 2ED9A 3P9LB 2V7HA 3ULUC 4WU7B 2GJRA 5AKVA 3EFFA 3W82A 5GPRA 1AR1C 4OCYL 1ZK5A 4OJYA 5D71L 2BNQE 2QV2A 1ZE3H 3VFPB 3MACH 2F19L 1SM3H 4AM0Q 3ZQXA 3M17B 3QULA 3GS4A 1RU9L 4U1KA 5CCKH 3GJEA 3OKLB 4WGWB 4F8QA 2FJUB 4LPWA 3HMWL 1D9KC 2AJVH 5IBLD 1DVSA 1DANT 1RMFH 3KPLA 4OGQC 5A43C 1ZDQA 4ENEC 2I25N 3EH5B 4V1DA 5IFJA 3I74A 3QFGA 5TE6H 2AJYL 2X89A 3O45A 4FNLL 4UUJA 3SPVA 4HQQH 4JHWL 5F72S 2IIJA 2WIIA 4XN4A 3QEGH 1KYAA 3TJPA 2DKUA 3QEUB 2PR9A 1KJMB 3L2LA