3LYRA

Human early b-cell factor 1 (ebf1) dna-binding domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
211
Chain Sequence
b'GSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor COE1
publication title Structural Determination of Functional Domains in Early B-cell Factor (EBF) Family of Transcription Factors Reveals Similarities to Rel DNA-binding Proteins and a Novel Dimerization Motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator
total genus 44
structure length 211
sequence length 217
ec nomenclature
pdb deposition date 2010-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16422 COE1_DBD Transcription factor COE1 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3180 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lyrA00
3LYRA
chains in the Genus database with same CATH superfamily
1U8PA 5I75C 2YC1B 3HFFA 2DYSB 3KPNA 2X10A 4I4WB 3VQ2C 2CDEB 2DQFB 4B9JA 4BFFA 5L4JA 2OZ4A 1N18A 2BZDA 1UWGL 2NY2D 3OJVC 1UH3A 3EGSA 5HYJB 2ARJA 3O6FC 5IOPB 1GPOH 3WD5L 3EYSL 3EFFA 1J9CT 2BRRH 1DJYA 3F04A 1EXGA 1ZJAA 2EDQA 3U7WL 4N1EA 3WY4A 2ZWSA 2K70A 4EUPB 4EUPH 1C8PA 1P53A 2NY7L 2QVTA 5FXCH 4BFEA 2HT4D 4U2YA 4U33A 1E5UI 4Z8FH 2P47B 4NHUB 1ORQB 2VXVL 4ZYKA 3MCKB 4XNXL 1MH5B 1W9XA 1U8HB 3HHSB 1E27A 4P57B 4KQ3L 5DD5H 5IJCC 4C55A 4L3CB 4X8JB 4XE0A 4BUHA 3WJJA 3GSUA 1ORSB 2GBVA 2GCYA 3VFNB 4AK1A 4HAFA 1L6ZA 1T1ZA 2CLVB 2ZOLA 3R8QA 2D7PA 4PJAE 1H3VA 4R97B 4QXTB 2WANA 3AWEA 2ICWJ 2B1HH 3PNWB 4WFFD 4ZOBA 5JDSB 5D4JA 3KPSB 1JCVA 3ZDXE 3LD8C 5E08H 3KPMA 4P2RA 3OPZL 1AGEA 1OKEA 3MRDA 2A9NH 3VG9B 1ZT4A 3FAWA 1VPOL 1JYXA 4NIYE 3WMQA 2Z31A 1DN0B 1WZAA 1HIML 1MIEL 4X80L 3NIDF 2E9WA 1H15A 4A55A 3JWNH 1WV7T 1R0AH 2B5IB 4CVXB 3ULSB 2D3NA 4M4PA 2ZQKA 1D7BA 1KB5B 3THMH 2NY4D 2WM0A 2KZ1B 5CJOL 3G5WA 5D6DC 3IF1B 3IYLW 3L4VA 2BSEA 2P42B 4Z7UE 4POUB 1A9BA 3B5TA 1BXXA 4HJTA 1BA9A 5AOMA 4IEFA 4A7SA 5JTWA 4Z3FA 4MZRA 3R1GL 1HE8A 4OCMC 1C08A 2WK2A 4XNMA 1P9MC 1PEZA 4H4NA 1BVNP 3VXSA 3CE1A 1ZVSB 3FB6A 1QR4A 3OKOB 2YKLL 1FZOA 3P2BA 4LVOC 5D1ZC 1DBJH 5T3XH 2ENYA 1FZJB 3RZWA 3AWFA 3VD7A 2P8MB 1BF2A 3C08H 4GFTB 2HX8A 4FG6C 4M8UA 4DK3A 3M46A 5JMRA 4ALAC 1N6UA 5DJZB 3VB9A 2RALA 4JLRB 4OIFA 4XC1H 2EEAA 4FQXB 2ROYA 1CXFA 1KBBA 1QNZL 3EYUH 4I77H 4E9XA 2YXVA 3TNNA 4JFDE 3X1FA 3P9WB 3T65A 4Q0XH 1LEGB 3P02A 3P73A 4HZAA 3JZYA 3KPOB 5FF6A 2IALB 4N2GA 3WJMA 3APMA 1GGCH 1BD2D 4PJBA 1DUYA 1QFWI 3P0VL 2DDQL 4AT6A 1ID5I 3CG8A 3O3DB 4UIMB 4WUUA 1CTNA 1AQKL 1DVSA 4PLNC 2VR7A 4P5TB 4WKZA 4I1PA 4GIOA 2BY2A 3P2TA 43C9A 4R83A 4OJFH 4WEMB 4ADJA 1B3JA 1KTDA 2IWGA 4L1TA 5AVVB 5C9KA 1WDAA 4WW2C 3RKDD 4U0QB 2HCZX 3ULUD 1J1OL 1WK0A 1QKZH 1IM3A 3W0WB 5ICZA 2FX7H 4I13B 1YPZE 3V6OE 2WXMA 2WB1A 2EILB 2JELH 4YOKA 2MSPA 1TZHA 1A7PH 4BFIB 4ZW7A 4TSCH 5CIPA 1I3VA 3D0LB 3FQUB 2UZPA 5SWSB 5GHWH 1A64A 4G6KH 2G3XA 4JDVB 5F6IB 1M6OB 5FUZL 4DEPC 2GQHA 2GTZA 5SWQA 1B2YA 3GHBL 2WZ6A 5DK2B 4M7LL 4ETYA 1MG3C 1N2RB 5B8CB 5C8JB 1VGEL 3CIQA 4QXVA 3Q8BA 1XGQA 3TH2T 3L5HA 5JW4M 4Y7MA 4G5ZL 4FD0A 4EOWL 4UQEA 3L1GA 1K8IA 4G9DA 4D0BA 2VITB 2CAKA 1INDL 1ASQA 1RJYB 3IRCA 1INQB 2GC4C 2WNWA 2YPLA 2WP3T 3EW3B 1MW3A 2DY2A 4I2XA 1VKXB 1EEYB 4AYBA 5JQIB 4PJIA 3W5NA 5GS3A 4L18A 3QB7C 4BZ2H 4N0CD 2OSWA 4EKXA 5CLZA 1OE1A 5FK9A 1I85A 3LV3A 4TQEL 3C60C 1UQSA 3WNKA 1NCDH 4ZAKA 2YWYA 5BVJB 5L6YL 3FH8A 5F9AC 4BEIA 3CMGA 3U4KA 2QV2A 1Z5YD 2F2HA 2AV1A 1X9UA 2EZ0C 3CSTA 3LH8A 1S9XA 4ONGL 4L4TD 1MRDL 5E2UH 1JV2B 5JW4N 3ARDD 3CLWA 4KHTH 3NIDE 4YHIA 1S5IL 3DO3A 3HZ3A 5C0GA 2R8SL 4LPTA 2NLJB 3PQYD 1ONQB 3LRKA 2BIPA 4H40A 3FTSA 1XSJA 1A7QH 1MCNA 2KZBA 5GGQL 3DARA 2E5EA 3DX6A 1SXZA 1T04B 2QSCL 3FN9A 1WA1X 5EZLB 3RBSA 1N59B 2DN7A 5TPWH 4A7GF 3T0DA 1B2WL 1ZA3B 3PAZA 2G3NA 4G8GB 4I9WD 2APXA 4PJHF 2IC2A 4WNJA 2WV3A 1KEML 2ZG1A 4EI6A 1PNDA 3GBEA 3JXAA 1VFUA 3NFNA 2IDFA 1KGXA 3VXTB 4UBDC 4L37B 3T1FB 5CEZD 1H9VA 1NOAA 4YZFF 3O2DL 4PRDA 1I1FA 5E2VL 4KROD 3DX1A 3LH2L 4XPBH 4ZMPA 4KY1H 4P07A 4KPHH 3ARFA 2M83A 1RZJH 4P2OA 3W3BA 1AGCA 5D5MF 2G5BA 4WZ9A 3TA3D 3BXNB 2NYYD 1JNLL 2P8PB 4ZZFA 5JR1L 5L8JB 5F1NA 1ZSHA 4FEMA 1YEDA 3PABB 1MFAL 2J1WA 3KWWB 3E3QE 2WWMC 4ZMNA 5KBLA 3WHE0 1KCKA 2YUXA 3QJOA 1C16A 4I18C 3ECQA 3H55A 4EXPX 1NC4A 2F19L 2UXGA 3GRWL 1ZHBA 4F15B 3OKMB 3FB5A 3GMMB 2D7OA 4LKCB 4NERA 2WXQA 3UOAB 1KPUA 3E8VA 3QNYB 1G6VK 4IOSA 3QH3B 1BCIA 4DP4X 5IV2A 4OV5B 1IC7H 1J0JA 2UX6A 4OZHA 5I1CH 3ULVD 4FYSA 5MEPA 1BD2E 1D5MB 4IKKA 2XWRA 2QZQA 3BZFA 4C83A 1E5CA 5C9JB 5IW6B 1UHVA 4PRPE 1AXTL 1IAOB 4F33A 4AENB 3DX0A 1E6JL 1Q9LA 2Y1YA 5BZDA 3CDGB 3NSYA 3ULVF 1JWUA 1XR8A 3SE9H 4BXSV 1YMME 2YGVA 1QFOA 2HUEA 2YD0A 3BEVB 4OLYL 3NJJA 4DW2L 1IEBB 1QTSA 4U7MA 5EFIB 2MQGA 2YKKA 2YAQA 2ALWA 4WU5A 5MP6H 3BAYA 1A3RL 4LOFA 4KH9A 1NIFA 1NOLA 2YRLA 3DV4A 3FSOA 1L9MA 1KULA 4E5XA 4ANKA 2V3EA 3UG4A 2COQA 1WZLA 4LLQB 3UJIL 4D2NA 4YZWA 3HLAA 2NXYC 4EO5A 3QA3A 1JV5B 3QR1A 4EZKA 4PP1C 4ZFOB 3DK0A 4AIOA 1X7SA 2IH1A 3J2PA 2C3VB 1OP3H 2DQIL 3CFJB 4NP4H 2VMJA 3MGTB 1R5WB 2K1MA 5GGRB 4EZLA 2NUTA 5INCB 1YLBB 1G9ML 5CSGA 2WWKT 2NPLX 1AS7A 5AALA 5E4EB 1A4KB 2C26A 4JPVH 2VR6A 4QOKD 4YE0A 4Z3TA 5KJRL 3BVNB 2EDKA 2XWBA 3FUEA 3OSVA 2EDYA 1FAIH 4HS8L 4W4OA 5JYLA 2APWA 4OGYH 1HHGB 1I7RB 2OXHB 3I6LD 2PW1B 2K3HA 4CU8A 1CFVH 4HAKA 4BDVA 1IX2A 1VZIA 1JXKA 1YCSA 4NQEB 5JXEC 4AV5A 3GPSA 4XPGH 5E6SB 1LE5A 3ABLB 1G9NL 4KOCA 5FM5M 1FG2B 3AQDA 4QKXB 5IKCA 3R4DA 4MNQD 5C71A 1O5DT 3GT6A 3O6MH 2XXMB 2X3BA 3NQIA 1PY4A 1GY1A 4Q58C 3NCCB 2CKBB 2CKBH 1X9QA 2AI0H 4HZ1A 5BZWA 4BFRA 4ISVA 3CDFA 3CUPB 4U1JA 5FO8A 1UZ8A 5D2LF 3F62A 1TR7A 3CTTA 3HVNA 4HIIA 4K15A 2GFBA 4YK4C 3VI3A 5A6IA 5A2JH 2MKWA 4NO5B 1QZ1A 4WWID 2Y5TB 1T6VN 4HEMA 4PB9L 4UQAA 4L4TE 1HQRA 3N06B 1F3RB 5E2TH 4A63A 1F13A 4F93B 2XA3A 5HI4D 5CHNA 3VXRB 5T5FH 3NZ8B 3VG9C 3EO9L 3V5DA 3GUTA 4HK0B 4UOW1 1CDYA 1NKGA 4RISL 1EZVY 1U8MB 4WO4D 2BNRE 1Q94A 2I9LB 5HDQH 3T09A 4LL1A 3JWNC 4PJHE 1PD6A 2B5IC 4OCNC 1FYTD 1MREL 5FYJH 4X98A 1GZQB 3OG6B 3D6GA 1X5AA 2FWOA 4LSQL 1KXTA 2P5ED 2LTQC 2XU9A 5DHYA 3LQZB 5K9JL 4MDIA 4YZFE 3WFEL 4WO0A 3ARQA 4UDUA 3IGFA 4PV8B 3V5KA 5I1EH 2WOBA 3ETBF 5LBGA 4UU9A 5D5ME 1EHAA 3TBSB 4QF1B 1JK8B 3Q13A 5CEZE 4JW3A 5H37G 4PPTA 1CC3A 4X0NA 3C5SB 1PZ5A 3DIFB 3Q5TA 5JIKA 3FTZA 2CIKA 1ZLUK 2E0PA 5GZNC 2QPEB 5I1HH 1WTGT 2DQHH 3D08A 2IFFH 1T7VA 4J2XA 4FA8A 4QYOA 3ML9A 3TXAA 1KCUH 4JHVA 4RRPM 4FQXC 5AB0A 2WOYA 2VDLL 1M4KA 4YAQB 2PN5A 2V4LA 3GI9H 3JWDH 2QZ5A 4P9HH 3ZSTA 3LZNA 4LHUD 1A7RH 1J8HA 1KZYA 1BVNT 1T0MA 4IK7A 5EU6D 2Z34A 4JZJA 1FPTL 3T77B 1TOXA 3MRJB 3VFVB 2BC4B 1A65A 4C56B 1VFAA 3REWB 1GGYA 2X4RA 3BCFA 4ZUUB 1T2JA 2LU7A 4POZD 3ULVE 2IGLA 3AROA 1DVFD 4ONHB 1YNLH 1HCZA 2OX5B 4LSPH 1CE6B 5E0QA 3RTLA 1L9QA 1OGAB 2L7UA 2JK5B 3S35H 3WFCL 4C59B 3TNMB 2BY3A 1OXYA 1KGYE 5FO9A 3U82B 4HPHA 1RUKH 3M1OA 2VM4A 5LXVA 3KPPB 1UURA 1AQ8A 1Z3GL 2BLFA 1JHTB 3EADA 3MXWH 2WNKA 4PJGF 1NUNB 4MYWB 4PI2A 3DPBA 2X4TB 4G9FD 3ZZ1A 3LRLA 5L2KB 5GISL 2EIDA 2K45A 4F7KA 3T6ZA 3PV6B 1LE9A 4M4RB 1X5GA 5IHWA 1AH1A 1PIGA 4UT9H 3RX9A 4GQPH 1S7QA 2VRQA 4QMEA 1RURH 5DSCA 4XX1E 5DVKA 2QQKH 3X13B 3SCMA 4GAJH 4LSRL 2WMPB 4IU2B 3WLWD 2C3HA 3VG0L 1R9FA 3RUGA 1EHKB 2MEJB 1QFPA 5B4MD 5LGKA 2B3IA 4DNLA 4LGRB 3TWCL 4WK2B 1JN6B 1MJ8H 3K91A 4FNQA 4LLYB 1G6RL 3M7OA 3I50H 2CPUA 1KEGL 2ZX9A 2YZ8A 4LVHB 2E9BA 4YGVA 5T1LB 1T7XA 4Y2DA 3R06A 1LMKA 3NJFA 5E9DD 2P5WA 3F7LA 4DEUA 1WCBA 2ZKHH 5IVXA 1XAUA 2VDNB 3LEXB 5D7KD 3C2AH 3I6LE 5AW7B 1P7HL 1E8WA 1NCBL 3NSCA 4BKLA 5E1GA 5EPMA 5HHXL 5HHVH 4PG9B 2YZ1A 2DI9A 4PMEA 5SWZD 1BHGA 3TEWA 1ZLWK 5C2BL 1T4KA 2ATKA 1A6AA 4MMZC 4EVNB 4X6DA 1DVTA 3S8FB 1IIIA 2HB0A 1A4BA 4JL1A 4P5MA 2K4WA 3L3HB 1XF5A 3TZVD 1UEMA 4DAGH 1KN4L 4QHKI 3L8QA 4MNQE 3BAIA 4FXKB 4TF4A 3CDCA 3G08B 4A6YH 1XGYL 4KK6C 3P54A 1CL7H 1EQWA 3DDFA 1Q38A 4OVUA 5IHHA 2E7LC 4E9SA 1PKQE 2GEQA 3RFZA 3IKCB 4LBAA 3Q6GH 4ENZA 2Q76A 2XUWA 3QRGH 3RVXD 4ZPTA 1AG0A 4AM0A 3V0EA 1P5UB 4GRLC 4G80B 3HI1B 5A2AA 4L4VE 5FV1L 4OT1H 2NX5B 3GXPA 4MCYA 2B59A 5EOQL 3VXOA 3MRFB 4FA7B 3ELQA 1CICB 2X09A 1WEJL 4B9CA 2OA9A 1A5FL 1ZHNA 2W92A 2OSYA 3IMUA 4GAFB 5GS2H 4MCNA 4ELMF 5C0BB 4CBPA 5CCKH 4KTDL 2Z6FA 3FUDA 4KJQD 3II2A 2UZYA 4NT6B 3U9UB 1NPUA 5D7SL 3T3MB 3HRZA 2CO6A 2GC7C 3MV9A 1DFBL 2A77L 2P5EE 5EZPA 2Z0UA 4QHUA 3T0AA 5ACLA 5D4HA 1F4YH 3TX4A 3MBEA 1QRNB 1WISA 3EJTA 3VXUA 3FO9B 1NMCB 1F2XK 1T1YB 1W0WA 3QXDA 2WBWB 3BVWA 1DQDH 1G1YA 2G75B 5C0EB 2ED9A 3FRUB 1RZJC 4C4KO 3S36H 3ETTA 4XR8C 4ZQKA 2EYSA 1LEIA 3WFHB 3QAQA 5DFVC 5I1AA 3TN0A 2NR6A 5A2BA 2B9BA 2Y7LA 1P0SE 3GHEL 4MQXD 1WWWX 4M62H 2DWSA 2Y1AA 5JHDD 3NVQA 1ET7A 2ATAA 4LE8A 4OCWH 1BAFL 1LP9A 1RCYA 1YY9D 2EH8H 4KKAC 4YO0B 3ABKB 3B1UA 4OZ4B 1ZLVH 3OZKA 3CLFH 2H8PA 2XOTA 4F15C 4RMRA 4UCFA 5I0WA 3H9SD 4KXCA 5IBLC 1HKLL 1YG9A 5KAQF 2X0VA 4CJ1A 4GKSA 5FYKE 4UYPA 5GSRA 1UA6H 2VDRL 1VESA 5EU6E 1T3FA 1NOFA 3AG1B 3WENA 1QSVA 5BQ7A 4L1LA 5GS1B 2OYKA 3HG3A 1RZFL 4I3RH 4YIQA 1O7VA 5TD4A 2X44D 3DHUA 2H47C 3VW3H 2JI1A 3RBGA 2AEWA 3LQAC 4FQLH 2BSSB 5EOCJ 2XPGB 3HZMA 2FX9H 1MFCH 4TVPH 5CR8A 12E8L 4I89A 3U7AA 5DYOA 5IBUB 2X4OA 1L0PA 3Q1SL 2ADIB 2OTUB 2R69A 1QACA 2WSDA 1A7NH 4HHGA 2VE6A 3VO0A 2QDVA 4NKDB 5AZUA 4DP2X 3RHWF 4XWGH 2C9VA 5E0FA 4A38A 1S9VA 4OQTH 5IGXL 4G9FE 3MNZA 2VLRA 1N67A 4H20L 4M7KH 4ORGB 2WZPA 4BGDA 5DRXB 2G3MA 5A6MA 1IL1B 2CRYA 4F20A 3LEYL 2C7FA 4J3OC 4J8RA 4JFZL 3VFMB 1XX9C 3L45A 5IB1B 1IT9L 1F02I 4Q9CA 1KTRL 3KLKA 3DSFL 3B2MA 1TLKA 3X3FH 5LWYH 4O2FA 1E3ZA 1U6AH 2H41A 1WICA 5KN5B 2GT9A 4ZTEA 1KYFA 1MAJA 5LAXB 3MRKA 4FQCH 1YEGH 4W6WB 4FTVA 4H2AA 3SD5A 4MJ6A 2CJTA 2IPTL 1FBIL 4U6YB 2ED6A 3LRHA 2J88H 1N7MH 1M53A 1BFOB 4YSEA 3STLB 1NUGA 2FT8A 5GRXG 4F7EB 3PHQA 5E9DE 3LKRA 4NKIL 5H2BB 1TJMA 5GRJL 2ZAGA 5I26A 2F8OA 1UCBL 1J5DA 3T2PA 5D2NE 1NC2D 2AJYL 3VQMA 3WDJA 1KTLA 3WNMA 2WXNA 3ROLB 1PKOA 2C3WA 3HR5B 4HCFA 2H2SC 2IVFC 4KI1A 5AAWA 1BXAA 4HHWA 2EE3A 3CH1B 1AZNA 2DV6A 3BAJA 1CGVA 4XXDA 5DO2D 5SWZE 3Q5YA 5KYUB 2XV6B 4OB5H 5ID1A 2FJGA 3KEHA 2QHRH 5FGBC 1NLDH 3ZT6A 1OE3A 4HS6B 3MLYL 5TFSL 3TCTA 1EAJA 1VADA 4PS8A 5DVNA 4ZOAA 5TJWK 4HIHA 5IQ9A 2V2TA 3OVUB 1MFMA 4FQHA 1I53A 2QPUA 3FO0H 5E5RB 2AJZA 4U4IA 5EO9B 3RRQA 5DEFB 3UIYA 4S0HA 3LMJL 3QPQD 4LLUA 2JKRM 2WWOA 4NAJA 5D1ZD 4HUWA 1IM9D 3AXLA 4KZDH 5IB5B 5L0QB 4F9LA 2A1WH 4F7MB 3NSJA 1F58H 1BPLB 4WNQB 3CC5A 4ELME 2AZUA 4IGBB 3QI9B 1D3CA 1VZHA 3RU8L 4H8VA 1IBZA 4AGMA 3PL6B 4PSRA 5ANMA 1CD8A 1SDDA 2BNQB 5JPNA 2VLJA 1R24A 4XMLL 2R0LH 3IAGC 4RAVA 3MNWA 3N44F 2VZ1A 4G8IA 1D6VH 2YD6A 4N1HB 4KV5F 4JY4A 3P3TA 4JG9A 5EORH 4B9KC 3F3HA 5TTRA 4GJTB 4HFUL 2HTLD 2D7NA 3MX0A 4MJ4A 3IM1A 4PGBB 1JZ8A 4WNSA 1CZ8H 3QC5X 5A16B 3FZUD 1QX1A 2F15A 3B5HA 4BHUI 3L2MA 4G1EA 2HMID 3OKEA 1SXBA 3WXWH 5ISZD 3MLXL 4O2EA 4UAOC 4ODVH 4X5XB 5D1XE 1QI5A 2BO0A 2JB5H 3QEQD 3HAEG 5AW9B 4PJEB 2J43A 4GUCA 4XRCB 4ZSOE 3PHSA 1LNUB 1XH1A 2H3NA 1HE7A 4IRJB 4O4YH 1P2CB 4BXVA 2BSBA 4L3EA 4K9EH 4N26A 4JBSA 5DFTA 5GPRA 3SPIA 3G6JA 5A43C 1Z9SA 4HBCH 1A6ZA 2QQLH 4OD2A 5ESQA 3PXJA 4BK8A 5CLWA 1KGCD 1YEKH 3OSKA 4HJIA 5I1JL 1NCWH 2NZ9C 3JWDC 3QUYA 4ICXA 2A4CA 4P9HC 2ZX8A 4WW2F 3A3YB 3MNDA 2OMUA 4KRPD 4KUCD 1X5JA 3H9SE 2F7IA 1C5CH 4N90D 5DD1L 2DQJL 5AW6B 3UZQA 3QJUB 4E41D 3RZCA 1MCEA 2GJ6D 5B39A 5FKPA 4OY9A 3NEOA 4LFHD 4OLWH 1G7PB 3TT3H 1EBAA 3UG3A 4KUCF 2XN2A 3I2CH 3QIBB 3QZLA 3L9YA 4P46D 4DGUA 3B7TA 4GP8B 4GLRH 1VCBC 1BZQK 1KJVA 3NK3A 4DOHE 4XMKL 3PHOB 2MPAL 1G1KA 3QDGE 5AB2A 1EXUA 3GMOA 3C8KA 3TP4A 3MODL 2AEIT 4YHPA 2YSTA 3SDDC 1ZXKA 2MOGA 3JTBA 3K6IA 4ZS7L 5HYSB 4NUJA 2WW8A 3DRTB 1HOCB 2FIKA 3CJJA 4NFDA 3BZDA 1I3GL 2MCAA 1BVKA 2ED7A 1QOKA 4XZUA 5DGQA 1AKJD 5E6IC 3CVHL 2GJZA 2YO3A 3MOBH 3QWQB 4NZUH 4RMBA 5GJSH 3ZOAA 5AW4B 1K8DB 1GCYA 2D3VA 1EFXD 4BGLA 4FJZA 1QUNA 1C1EL 4PJ7B 5DWUL 3PGDA 3W2DL 1HQ4B 4WV1A 1P5VB 1MSPA 3GDBA 2FH6A 3C60D 1V3JA 5IM7A 4Z3EA 4PRHA 3BN3B 3F64A 4URTB 1K4DA 4PBVC 2AGJL 3BP7A 4X99A 4Y4FC 1S7WB 4JPSA 5D96B 4DP7X 2Q7AA 1AZBA 3OHMB 5BS0B 5F3HA 2XKUA 2AANA 1MHHA 4MAYB 4P4KA 2B2XL 4N8VA 3I02A 4XMUA 3BMWA 4MSWA 2FR4B 5FYKU 3BQUD 5ALCL 3UJJH 3SDCB 1P84K 1EEUA 4HPYL 5KUKA 4IHOA 1E5BA 2ADGA 2DYPA 1PBYA 1TENA 2MHAA 4EDXB 1DQIA 1XIWA 5LQBH 5DLML 4WWKD 1RAMA 4J1UA 1A9EB 4YDKH 4HX1B 3T0EA 1ZS8B 5EEXA 2H6PB 5F0PB 2I9TB 4PV9B 4JO1L 1JYWA 4XNDA 1CFNB 4RGMB 1LO4L 3ABZA 3D07A 4MMYA 2OSLA 4N2FA 4JY5H 4JFOB 2CBTA 3X3GH 1A6VL 4R9HA 4M1DH 3X12A 2YD9A 3APDA 3QUZC 4U3XA 4GBXC 1I1YA 4MWFB 4FNLH 1TQTA 4ETQA 5MERA 2XT1B 5EDXA 5JOPD 4NC0B 4MB5A 3RWDA 4AYFB 3TYGH 3WNOA 1OF2B 4BSVB 3W39A 1YDPA 4YHNB 1B4TA 4JRLA 3IU3B 4H1LA 4H0IA 1UOKA 4NUGH 4LSSL 4D9LL 3ARBB 3KXFD 3Q3GB 4XPFH 1SEQL 2ORBL 2ZOUA 4R84A 4Z7WB 2X6MA 2WWMD 1UB6A 2ZCKL 2NY0B 3BEWA 3CU1A 4G8EA 4KUZL 2A6DB 1OQXA 4YXHH 4KV5E 4BV1A 3IU4H 1FJ1A 3TO4B 4JZNB 4PW9A 1U3HB 4MBOA 1WGOA 5I6MA 5IT2H 4Y2OB 3DETD 3FSAA 2MMXA 4QHNA 3FUFA 1SOQA 4XNQB 1MCPH 1BEYH 4QR7A 4Z7VB 4U31A 3RPBA 4ZNEA 3GS0A 3JTSA 3BX7C 4GO6B 2BMKA 2JTYA 1E50A 1QASA 4UDTB 1DZBA 1NMCC 4ZUSB 1X7QB 4ZMXA 2R1XA 1U91B 2H7WA 4JY6A 5BCAA 1PSKH 4KNUA 2R83A 2VZ3A 2AJSH 2VW7A 5F1KC 2J4WL 3ASOB 5ISZE 4Q9QL 1B0RB 3MA7A 3TURA 1A6WH 3BESR 2QKSA 3O2DA 2J8UA 3QEQE 1FO0B 3JYBA 3B43A 4Y4KD 1MAKA 3WG7B 5CEZL 1S8DB 1QLRB 3EOTH 2EE9A 5I2IB 3IFLH 4ENEC 2XN9B 1CGSH 2VH5L 3C5ZB 3N9GH 4NO0B 1AD0A 1VERA 1I1AB 1RFDL 1N5AA 2H5UA 3VI4F 1KGCE 3VA2C 1MJUH 1NGPH 2D3LA 2IQ9H 4FJ6A 2ADJA 3V7MA 1R75A 3CCHA 1NDMA 4NQCA 5HY9A 4N90E 4M93B 4PRBA 5GRVL 5JORA 5CBAA 1T0NA 5GS1C 1TZIA 1K5NA 3GRWA 4PP1D 3E2HC 4U6HB 1JXFA 1H5BB 3FMGL 3IJEB 1H8SA 4F8OA 2FDBP 3CXDH 4I7ZC 1FVDA 1WZKA 2X6UA 4ZMVA 1AIZA 4FN0A 1U8KB 3E6HA 4PJFB 5EBLB 4GPVA 4PWHA 3LEVH 3JSSA 2PPAA 2OL3L 4HU2A 1SF5A 4CVZB 4I0CC 4U1MB 3ULVL 5ID0A 5HYJD 4KHXH 1PYWA 4YNYA 2P1YA 4PWKA 4MDRA 1F11B 4Y1AA 2O5YH 4BA0A 2FVNA 4WJG3 5A3IC 3AXIA 3VVVA 2F53B 3ZK0A 5E5MB 1UVQB 1CXIA 3SKOA 4WTXA 3ZE2B 4AV0A 5I18H 1MHEA 4UQ9A 1O5PA 1JF1A 1P7KA 2PO6B 3OHXB 2V2XB 5DO8A 4HMDA 3UYRH 5F9DC 4OLVH 2NNFA 1KB9J 5IW1A 1G84A 2DQGH 1ZT1B 2FL5B 2IFGA 3LSOB 4YHMH 3EYVB 2WTOA 5FOBB 3NACL 4U2ZA 1OCRB 3N04A 5CZXD 1XF3B 5C08A 5INDB 1T5KA 4L5FE 2OQJA 4J28A 1P84J 1NCTA 35C8L 3BIAX 4H8WL 1MJ7H 2PKDA 5C3LD 1NCAH 1J9RA 3IDIA 1RULH 2YS4A 4Y19E 1OAZL 4L1BA 3H9HA 3L2LA 4Y4HA 1GXEA 4W9KC 3I6GA 1L7IH 2FAUA 1Z6JT 1CIUA 5I19H 1RP9A 3K6NA 1HZLA 4U6XB 2RBLA 3AY2A 5GGUB 4P23B 1HHJB 5HHPB 2NY3B 3AU1A 3UTTB 5DZNA 2ICCA 3V4UL 1HL9A 2XWEA 3FQRB 4MCMA 5E8DH 4L3FA 4QNPF 1DEEB 2WD0A 3UAEA 3U2SA 2FJUB 1A1MB 2QDWA 3KPQA 4O58H 4GS7B 1DQJA 2EDMA 2VABA 3LRSB 3ZYZA 1AGFA 4XPTL 4P04A 1EHLL 3S37L 1B4JL 3IRZA 2XXGA 3V4LA 1DSYA 3WU1A 1GS7A 3QZWA 4Y1TA 2EEXA 1ZOXA 5TF1H 4CW1A 3V0WL 3P11L 3ARWA 4KMLB 1PX8A 2W65B 5JOPE 4Z0BL 2HKFH 5T3XD 4PRIE 3EYOB 4GXVH 4NYLB 3FO1A 4YDIH 3D0AA 3WIIL 3AUWB 3VXQB 4JFPB 3W9EA 5MEOA 1CDIA 5K9OA 5ESVA 5DT1H 4NQDA 1VCAA 3FT4A 3KWUA 1JE6A 3F00A 5LBSL 3ZR5A 4F2MB 1G87A 4U1LA 3V4VB 4FQXD 4DUXA 3V4VH 2V7NB 4HJGA 2VSMB 4PTTA 3ZDYB 3G04B 3QZNA 2MQ0A 3OMIB 4HBQA 3TGXA 3QXAA 5F9WC 5HDWA 2ATPA 2B4CC 3RWFA 2R0ZL 4BE5A 1AE6H 1FI8C 2ZE0A 2Q3AA 4FFZH 1AVAA 1T21B 2R56H 4X4ME 5B21A 4GAGL 3VMPA 1FVCA 2ZF9A 1NEZA 1JHKH 4R4BA 4DPAX 2ZP8A 4P5TD 5AVRB 2YPKB 3LHPL 1FGVH 2FSEB 4ODUB 5IFHL 1HWGB 5AL8A 1HILA 3QEGL 4QRPA 4DHLA 4PRNA 5IMLA 1IKOP 3MBXL 3MJGX 4IRJC 3VI4E 2HSIA 3EOAB 2DF3A 4PY8J 5DQ9B 1R34A 5H94A 3V4PB 4L0PB 5EMYA 2UVEA 5BRQA 4YPGB 1R4XA 4GI8A 2Q7YA 1BOGB 1C12A 3SQBB 3W0WD 1JXDA 4M7ZB 4AG4L 2XLLA 4Q97A 3OGOE 4PGCB 1TTRA 2QMKA 2X9WA 4PJXA 3LY6A 4I0PA 5I1IL 1M71B 3UADA 4MD4A 1BV8A 1G7JA 2GUOA 4LQ1A 2E46A 1U8LB 2H45A 3E6FB 3IFPB 2C5DC 1H0DA 4GYBA 1U42A 5AVQB 5FWRA 5C92A 5CILH 8CGTA 5SWSD 5FW6A 4OJAA 5I1DB 4XH2A 5CSZA 4NCDA 5E00A 4MDJA 3BHBB 3TCXA 3BAEH 2PTTB 3D39B 4XMZA 1OSPL 4LSTH 3BP6B 3DI3B 5EF3A 3OXRA 4PVMA 5AYUL 1FZMB 1O9WA 3RJQB 4JG5A 4EIUA 2HRGA 1X5LA 3MLWL 4XAKD 5EEYA 1R5IB 1RK1B 5HDBE 3P4NB 3MRLB 3LIZL 2HLFC 4NRZB 5AKVA 4RWHA 1AGBA 2XZAH 3K2KA 5LNDA 3F6JA 1THCA 4S1DD 4ZX5A 5TE4H 4KJWC 3IJYB 4LGSB 3SDAB 4YEEA 2BIMA 2EH7L 1OPOA 2DEXX 1J0KA 3RA7H 5JHMA 5DEGB 3VCLA 4I3SH 3L3OA 1S7RA 1AHMA 3REVB 2O5ZH 1J7VR 4UMGA 4PWJA 3AXHA 1A6UH 4LCWD 4XVSL 4AQAA 1SGKA 5DZJA 2JIXA 1CD1B 2OTWA 4XCYA 4XAWL 3BT2H 5CGBA 5JW5A 4D0DB 4U4BA 3UMTA 1T7YA 2W60A 2XWTA 4MAYC 4HT1L 2FJFA 2DWEA 4BIKA 2L04A 4XWOC 4JN1H 5BO1L 1TETL 4YHOH 3UACA 1AD9A 2VT0A 1D2OA 3GMPB 3SDCC 4HIPA 2BNUB 4AV4A 5IP4A 3P3YA 1G6RA 1FFPB 3WGUB 3MRBA 2YGNA 3FQXB 2ICEC 4YE4L 4X83A 4QNPE 2Z92B 5C6TL 4ZODA 5C0FA 2ODHA 3NSXA 2HJKA 1GAFL 3QCTH 2DMCA 2K0RA 3GZOA 1D6EA 5AD0B 2ZX5A 1ADQH 4FQQB 3AACA 2W9DL 4ZMQA 2BY1A 2EKJA 1NGWA 4HEPG 5KTEL 2XXCB 3MV8B 3TOPA 2L0DA 1TQWA 1TCRA 4G8GD 4KI5D 4I48A 5KVDL 2CJUH 2XV3A 3IFNH 2A6IA 2MIZA 3HVDA 1FE8H 2K7QA 4G1MA 4ABWA 3AREC 3ZBMA 1KIRB 1F5WA 1FFTB 4J5VA 4M6NH 1HEHC 3DTXB 1OCOB 4KI5F 4ZBJA 3VUAA 2F54A 1TG8A 3PE9A 2WTPA 1T1XA 4WI8A 4QRRB 4PRAB 2HG5B 1HH9A 5DJAB 3U1QA 1OAXH 3ARBC 3B2UC 5DD6B 3RE0A 4M9OA 4AQEB 4GLRI 1EERB 2EXWD 3NCJH 2YA1A 4KK5D 1Q9OB 2EDXA 2IQAB 2NY0C 3E7JA 5DTFB 5IF0B 4ZNCD 4N2MA 2BZ7A 2J1ZA 3BFOA 1YNTA 1VA9A 3CZGA 3CDZA 2CM6A 1U93B 3BQVA 2XZQL 3KAAA 3QFJE 2QQNH 5C0JA 1HC1A 4HKXA 4QGYA 3PP4H 4YXKL 1F2QA 1EJ6A 4PJAA 1NL0L 4N2BA 5KBMA 2D7TL 3ROOB 1MPAL 4KKLC 3TCLB 3TVMA 2BHZA 4O02L 5MENE 3QIUA 2AXFB 1NPNA 1X7TA 2PPEA 3ALXA 4QLRA 1RSYA 5E9AA 3RVUC 5IVOA 1QEWB 5DMIL 3BLBA 1FLTX 3HC0B 2AMGA 4WI7A 2RB8A 1AP2A 4YXLH 4X6FB 1KBGH 3CZFB 3OMAB 3U0TB 2F8XC 2HVJA 4QRTB 3VD4A 3HNSH 3FN0L 1U4EA 1SUJA 3AVEA 1J8KA 1GTFA 2OTPA 3NSDA 4Q6YA 3X11B 5B7MA 1PZBA 2Q8AL 1RUPL 2DLIA 3QCVL 4HUCA 4OFVA 3TL5A 3EDJA 4KVCH 4XBEH 1MNUL 4TM9A 3IDJA 4OLXL 1NFKA 1XSIA 1GMIA 2G3ZA 2GJRA 4RSVA 1BVLB 4Z7UA 3EJYC 2I5YH 5T5NG 1JRHH 1XQ4A 3QJFA 3D4ZA 3US1A 3C5ZC 2WLJA 1WS7A 2FEEI 3A6BL 3QQ3A 4JPIB 1I1AC 1O7DC 2W0FB 2VAAB 4X6BA 4MZ2A 5AW3B 5CD3A 2VC2H 2DLFL 5KVFH 2XY1A 2LFGA 2PXYC 3VRIB 2BVQA 4KJPC 4M93C 3SYPA 4N9GB 2BS8A 1WYJA 3SYCA 5F7UA 1UM5H 3P69A 2JMRA 2Y7OA 3SQOL 1SLXA 1M1XB 3DJSA 1D5IH 5KSBF 5TE6L 5GS0L 3LIUA 3L5IA 4H26B 1DJGA 4YLCA 4M02A 1BM3H 2VR5A 2UXTA 1JF6A 3ARSA 1SUHA 1KBVA 2H9GA 4H25B 1WAAA 2FD6H 1YSOA 3BPLB 1G7LA 1V7ML 4OTXH 5EU5B 4K3EH 1NBVH 3OKNA 5HGBA 1ANUA 1JGIA 3Q8FA 4MA8L 3BIKB 4XAKE 2J21A 1BZ9B 4JFDA 5F7HA 1OM3H 1D5ZB 1DBKL 3BP5B 3BKYH 4NQQA 2OR8A 4PM1A 3ZMRA 1OTUD 1NA8A 4R90H 4AI7A 3RI5K 1DQMH 2JF1A 4HDIA 5GGSY 2X89D 4QDGA 5E8NA 4NQED 1IAII 2JCCF 3BJLA 1U8IA 4NBYB 3IWVA 5J0BA 2HRPH 5K1JA 3WKNA 4O5LH 1NSNL 3GXDA 1UGNA 4HZLB 3F7RA 4J3TA 2AKRB 4J6IA 2NUPB 1ZEAH 4QTIH 4R7VA 5C09A 5GGVY 4ERSH 2PWFA 3OHXC 4NO3B 1WPCA 4LCWE 4B50A 1OK0A 1ZK5A 5TE7L 1CK0L 2EYRA 1ZT7B 1DUZB 1TJGL 4NUMA 1LTXA 1RKRA 4KMTL 2VXTH 4M6ML 4PGDB 4WU7A 1XH0A 3VD5A 2N1TE 2P7TB 3NAAL 1YPZA 4HXAL 3V6OA 2BFVL 1IGYB 4MXWH 1QPXA 4FQJH 4UQBA 3CFBB 4P3CL 1A2YA 3CSYA 2AJ3A 3UO1H 5CGYD 4QXWA 5FOJA 1T20A 3VXRD 1AO7E 4OCYL 2CU9A 3DNKA 5DRWA 3ALWA 3RP1A 5BVPH 1JSYA 4P23C 3HUJF 3U83A 2NY3C 3W37A 3KGTA 4HWBL 4R0LB 4ZMZA 1RZPA 3RGHA 1URLA 2Z8SA 1EZSA 4YSRA 5EC2B 3EJUA 1YQ2A 3VXMB 2X5PA 1AXIB 1SLWA 1BIHA 4N0UB 2GSMB 3FF7A 4CDHA 1LYQA 4BKSC 4QHLB 4KI5E 4MAUH 4LLAA 3R4RA 3EAKA 5CMAB 1OAKL 4RFEA 3BH8A 3K71B 2V3FA 5F0LB 5H37H 3DBXA 1F1DA 2E7HA 3HNTH 4NNXB 3NABL 3BSZL 1ZV2A 4YDJB 2WN3A 4M48L 1JPST 5ACZA 4XVUC 3U48A 2BERA 3BZ4B 2VMCA 3QORB 1G43A 4JUSA 4AYID 5E51A 3TJHC 4Y9FA 1VFBA 4NRXB 4FZEH 2J56A 4RGNB 3ULUC 1KIPB 1WIPA 2Y1VA 3RY6A 3EDDA 3P9LA 5DJ8A 2CMRH 4ZOCA 3UEQA 4F8QA 3QW9A 4BCZA 1XMWA 4XXWC 5BQDA 3RL2B 4AIEA 5I73B 3TJEH 4RFOH 5E99H 4KXZI 4AMXA 3IMVA 3OTTA 1BQKA 2PETA 4EBQL 2P5PA 4F37K 3BFQG 1J0HA 1JGEB 2KH2B 1KT2B 2QV4A 1GHFL 4WFEE 1SF3A 5SX4H 1QFUH 2DL9A 2PPDA 4IMLB 1WHOA 1JNNH 1TTCA 5E1HB 3DO4A 4ALAL 5EUKA 4C56D 3D3VE 2GK0A 3GSVA 2CHXA 2APFA 3NK4A 3O8XB 4GG6A 3VWJB 3UGUA 3WKPA 1AI1H 2FLMA 1ETB1 3BPCB 4N2DA 5E6UB 4L9LA 1N5YL 1BGXL 4OF0A 2RJMA 2Y5QA 4AC4A 5J57B 3RWCB 3GXUB 4RBPH 1BX2B 1CG9B 1IIKA 3RY4A 1PLCA 3S97C 4RESB 2FQEA 3HTLX 4ES8A 3VDBA 5GQBA 2ZNXA 3AJ7A 2UV3A 4X9FA 4H1LG 2J6EH 2LVCA 4WAFA 1T2QH 4IU3B 3BW9A 5GIRB 3WN5A 4HOWA 2X1QA 4I85A 3O4LB 4AZ8A 1RLBA 3AADB 5HHQA 5IWLC 4TOYL 4CGUB 1I8MA 4M7ZC 3CAFA 4L2YA 2AQ3A 3OQRA 3VTMA 3GSXB 1RIUH 5KSBE 4JZOB 1DDHB 4XVTL 4NQSB 1ZHLB 1TMQA 4TTDC 1YEFH 5KVEE 4QGTA 1IAIL 1N0LA 2DQTL 3ZTNL 1UKSA 3DROA 3MCLL 2OXGB 2BCKB 4J7RA 2XBDA 3K4AA 2OJZH 2BXYA 4MGXA 5C0IB 1XL6A 3H2PA 4Y9CA 2OMTA 2Y3NA 4V1DE 4NKMA 2Z9TA 3X14B 4CC4C 1XCTB 4JQXA 4CKQA 3SDYH 4XX5A 3L17A 1U8JA 4CSZA 3KW8A 1AHWB 2NY1C 2G2RA 1JOIA 2HLAB 5AAPA 4G6JL 1S78C 2DLHA 3ILPB 5T1LD 4LPYA 1KXVC 3H2WA 2Z8VC 3ECBB 1TEFA 5KYWB 3VGFA 3KLAA 4D3CH 2JCCE 4K7PH 4DZ8B 5EDSA 2QGBA 1NAMB 1NAMH 1P7QB 4ZUVB 1CQYA 3HS0B 3SBRA 4XOBA 1QAWA 1GCFA 4TQHA 1BD2A 4FYRA 4UTAH 2WBJD 2E9GA 1SY6H 4NSKB 1M2VA 1F90L 3BOVA 4XMVA 3SIKA 4HISA 4MAZA 5KYXA 4PY7B 3RWGB 3ESOA 4YUEH 5I0DA 1R3IL 1MVUA 1BMZA 1KCSH 4M00A 2X6CA 3CVHA 3IXTA 4K5PA 2H1PL 3UTPD 4UMSA 1WGVA 1Z5LB 2ZPKL 4HGWA 4BM7A 5CCGE 1UZ6F 3LOWA 2VR4A 2ARWA 1G7IB 2QELA 3HPJA 3Q6FA 1IBHA 1U8PB 2HN7A 3FTWA 5DR5H 1RZKH 1QLFA 1Y1UA 2C3GA 4TUJA 1F4XH 3SDXB 4LOEA 2CO7A 3E9TA 3V0VA 3FOLA 1AACA 4G3YH 4HUUA 3R8BB 4J6RH 3HUJE 3FQ1A 4EZJA 1XO8A 5ICUA 4XGZB 4LKXA 3K8KA 1S3KL 2WINB 5IIEA 4TULH 2NX5D 5I28A 1ODAA 1P1ZB 2Q9OA 4DKEH 3QZBA 4L5FL 1CICD 2E7MA 3F65A 5GS2D 3MLZH 5J1SC 2ZOWA 2P3YA 5C0BD 4XVJL 4P5RA 2D4DA 2WLKA 3OGCA 4JQIL 4FP8H 5HGHA 3CZKA 1EAPA 1MFDH 2MTPA 1XGRA 2APTA 5T1KB 1E27B 3IJ8A 5F8QC 3GBML 2G0KA 2DTMH 2HFGL 4KK9D 3RNQA 1QRND 3H0TB 2WUCH 2JQAA 3GSUB 4B3VA 2YA0A 1RXLA 5D7EA 1DSWA 1T1ZB 4JG0L 3H2QA 4XMXA 5FFOA 3U9PL 4WHYG 1FRGH 5C6WH 4BH8A 5KG9B 4JAMA 2ZXGA 4F80A 1UJ3A 1ZV9A 2W0PA 4OH2A 4OLZH 3NZUA 1AC0A 1N4XL 2VDML 1SQMA 1BF5A 3LZQA 2I07A 3OZLA 4IS6B 3ZZLA 1WWBX 5BJTA 3V95A 2WO4A 4HKJA 4MCZA 3ZE0E 3BP4B 1CWVA 4KOBA 1JAEA 1YN6B 4AGLA 1GC1H 4HIJB 1HHKA 3WAKA 4BHUA 2R1YA 2GIMA 4XP6H 2IAMC 2GG1A 4ENED 1FNGB 1FA4A 1ETZA 1L0YA 1DYZA 2ZP0T 1I9JH 3RVTD 3U1SL 2HFFA 2XQ0A 3NIGB 4GIPD 3WNPA 3UCQA 3DUUA 4P4RA 1Q90A 1EHXA 4WTZA 1AFVH 3HNVL 3VD0A 5TDPA 4L4TA 3OAWA 1RJLA 4LEBA 1IGMH 4DN3H 3T3PF 4IEFB 4C56E 4F27A 3ARDA 5IHUH 1PZUB 4NJAL 5IBTL 4R8WL 2IG2L 4Z95H 3R7QA 1BQ5A 1JGUL 3WEOA 3RPIA 1HHHA 3T1WA 4RDBA 2QLYA 3BUYA 4PHXA 3QPXL 4A7GA 3MFGB 2BNRA 4LU5H 4L3AA 1RH8A 3FB6B 3X2QB 3QG7L 1PDKA 1FZOB 1WFTA 4PJHA 2R2EB 2F8IA 1KC5L 4WCYL 4OI7A 3V0JA 3WHXB 5J12C 4ABQA 1E6OH 3Q8EA 2Y06L 1FH5L 3EH2A 1UM4H 5JIPA 1XZ0B 2DRUA 3PS6A 5E6ZA 1UWEL 2D73A 3UGXA 2XIIA 2WB7A 5I1KL 2E74C 3WFBL 3VFUA 3DX8A 4UANA 4U3HA 4N8CH 1ACYL 5D5MA 5GGTH 1JWMB 1P4BL 2NY5L 4OKVA 4BH7A 4LBEA 3HI5L 1ACZA 2D9CA 3BKML 4GT7A 4XPAL 2FLRT 1ZTXH 4FKKA 4IOFC 4JFYB 1KBWA 1UOVA 4ZUTB 3T65B 2ZWNA 1MKFA 2X4PB 5FF6B 5GJTH 5IFJA 3WJMB 1ND0B 3TA3A 3GSNL 3DO7A 1EGJL 4KO9A 2PYFA 3VXNB 2FECL 1FNAA 4YVNA 1TZAA 3O45B 4AT6B 1RIHL 5ESAB 3AAZA 2A74A 4GMSL 4W93A 5BMFH 1ZVNA 5KBPA 1A7OL 1NLBL 4Q4EA 4MNHB 3JV6A 5JW3L 1KTDB 4NDMA 3S3DB 2E59A 2MNWA 4X7TB 1J5CA 4CSSA 4JG1H 3A6CL 3L3GA 1IFHH 2NDGA 4OSUL 3X1GA 3GGWA 4JPKH 4LDOB 1UFGA 2OL3A 1PLAA 1IM3B 4LP8A 2R2BA 1L6PA 1U21A 2IDCA 4TL4A 2K6YA 4UQ3B 2BVPB 4PLOB 2AXWA 5D6CB 5CD5C 1LWRA 3KDMA 1PPIA 4W6XB 3MAWA 3T04D 1U41A 2F7QA 3KWXA 2QR0B 4XCFL 3C6SB 2DQDH 1MHCA 2IH8A 3FU8A 1GSMA 4PJBE 1JHLL 1UUNA 1TU2B 1NM9A 3NBNA 2MOQA 3P0YL 2PNDA 3ZKXB 5L8KB 4EZMA 1ACXA 4P2YA 4NN5C 1GY2A 2CUMA 1EJOL 2B0SL 4LAQH 3UYOD 4RGOL 2HPOA 4GAAA 1M7XA 1QP1A 4IGBD 5KW9L 3QI9D 4K7FA 3PWNA 1K8IB 4Q89A 4R0LC 3PL6D 2NX5E 4JFSA 1BG1A 2BP0B 3TIDB 5I30H 2BNQD 3K2IA 3GSWB 2YPLB 5EEWA 1YQVH 3UAAA 2QPSA 4PJ8B 5FHBL 3OL2A 5C0BE 3ESPA 4L0YA 1DTUA 1JRHI 2VISA 4K5OA 3FCUB 4NGHH 4JM2B 5F3FA 3RILA 3OMNB 4EDWL 3FW6A 3BI9X 5KSAB 3KCWA 1XVSA 3SPVA 5DMGC 1T22A 4LCUA 5I8KH 1F18A 5D70H 4PJ9B 1KB5L 2AV1B 5F21B 3QORC 3HAEB 3MNMA 4LK4A 2CD0A 3HAEH 4AL8H 3IMRA 1G9HA 1QO3A 1XGPA 4OBRA 4RGNC 3WSQH 4XNYL 3HE7D 3UJTL 4P2CG 5D2LA 4P2AA 2Q0ZX 4IRJD 4KDVA 1JERA 1IKNC 2GW5A 4P59H 4MVBC 5I66A 2Z93B 4MNQA 4PSPA 3DPDA 5I73C 4PU2A 1FZKB 4HPOH 2DB8A 1OWWA 3DX6B 3MV11 5DMKA 3QIWB 3RGVC 4PJEF 1PVHA 3DXAB 1DBMH 1NGYA 5BZZA 1RJZA 2A83A 5EOTA 2PP8A 3T3PE 3FC8A 4F3FA 3U4BH 1ASOA 1PKQA 2BP8B 5LBSA 4HIQA 1R3LB 3ECVA 4FXTA 3BAWA 4I2XE 1XL4A 3DWTA 1TSRA 4EI6B 2OSXA 5JNYA 2YOAA 3O8XC 3NFNB 5HD8D 3UYPA 1HFUA 3L3JA 3VWJC 5B38A 3N41B 4GW5A 3GKWL 2DWDA 3QIBD 4F8PA 3GPEA 4GAYA 4NZ8A 4L4VA 3L4YA 5L2JB 4V2BA 4WO4A 3OBAA 3T2OA 4JFFB 3ARFB 5JZ7D 4P2OB 4ODXA 4U05A 2L7QA 3S88L 1FYTA 4AWJC 1GGCL 2Q1EA 4P49A 2HLFD 2WNXA 4PTUB 3WTWA 2UUDH 2O5NA 2P5EA 3D18A 1E4WL 4EN2A 3LS5L 5D1QC 1IC5L 5BOJA 5IJKA 4KDTA 1KF9B 4WHTA 5C07E 1ZHBB 2KI6A 3L4UA 3C09B 3UC2A 5KVGH 2FBJL 2YIHA 3U46A 3PFQA 4W9GC 3N0PB 4PAZA 4PFEA 3BUTA 4IJ3B 2A73A 5JOFB 3AG4B 4UQDA 1CE1L 2YARA 1WFOA 2IGFH 1ZY9A 5HJBA 4BQ9A 5I6KA 1P4IH 2EDDA 1U8CA 4TSBH 2JELL 3TYFB 4JO2L 1XF4A 5JIHA 4OD3H 1CFMA 3BZFB 1AHWC 4JO3L 4AGQA 4F58H 1EIBA 4PJ7F 5ENWB 5BS0D 3OB0K 5AVYB 3D2TA 3OC5A 4N2OA 4I9XA 4XP4H 4TSCL 4MD0A 5BZDB 4XWOD 5ES4B 2XA8L 1J5OL 2HVKB 3HIZA 2XWZA 3OLIA 1MCSA 3SDCD 4G6KL 4AMWA 4HHAA 1S7VA 5EU6A 2AABL 4FG4A 1OB1B 3QULA 3GJEA 4NKQB 5DJXB 3HS0C 5KSUA 3RL1A 2VTFA 4WU5B 4JHWH 2AJUH 3LIZA 4H0LC 1L3WA 1X4ZA 2VERA 2K9FB 2FQFA 3US0A 3V52H 2W07A 4GG8B 4DGIL 4PJGA 5EUOF 2HJFA 3MOQA 2IBZX 3O2VH 4FL4B 5CZRA 5EBMB 4KKCC 3FPYA 4NP9A 2IH1B 5E23A 3NFPB 3V55A 8FABA 3FFDA 4LCCB 5GGVL 4ZTOH 4JVWA 4I5BA 4G5AA 1RZKC 4G9FA 5SV4A 4H5SB 5DRNA 1CFQB 4JKPH 4BZ2L 4FAAB 5DC2A 3VYPA 1T80A 1E8XA 3LN5A 5BV7B 3O4OB 1QBLL 1JPSH 1AZCA 2NCMA 3UTOA 4JDTH 1HX0A 2NRDA 2XV2A 4FTDA 4HU8A 3ARBD 3B2UD 1Z9PA 4NCC2 3H53A 4XI5C 2YD4A 7FABH 2IADA 4Z76A 1B4LA 2NY0D 1XB6A 4XO8A 3NFSH 3C5JA 2V17L 1I7UB 4UTCA 3H7BA 4CN6A 5AZ2H 1MI5B 2PTUA 3TO4D 1VHPA 2BNQE 5IUSA 1LE5B 4KHTL 1U3HD 2D9QB 4ANXA 2PCPB 5IKCB 4KKLD 1DQLL 4TSAH 1IVLA 4P0DA 4HJ0C 3RTQB 3QDHA 2N0KA 3CHRA 5DLLA 1X6NA 3PWJA 5E9DA 4ZD3L 1NFDA 3WJJC 4ISVB 3EO0A 3FRPA 4U1JB 5D2NA 5D9SA 4IBQA 5TPWL 2AXGB 2CE6A 1Q9KA 4RZKA 3U6RB 3VM5A 3F85A 5AL0A 1ZCRA 6FABL 5AAMC 2Y7QB 3BWZA 4Z7VF 1HNYA 2AITA 1AIFA 4H13C 5SWZA 1E65A 2NTFB 3JWOL 1HQRB 2Q7NA 4RNRA 3AS3A 4JFEE 2UZXA 3OAYH 4PJEE 3QQ9D 4K3JH 43CAB 3V5DB 1GC1C 2WLIB 3O2WH 4LOUC 3KPRD 4M43L 3TZVA 3V0IA 5HVHB 2AQ2A 1I7TA 2EDNA 4XPBL 5HYFA 2XN9D 3K6SA 4G70B 4KPHL 1KTBA 4NO0D 4YC2C 1I1AD 3RQ3A 4WHDA 4X98B 1RZGA 3CBRA 5AOLA 1JFQH 3Q44A 1KXTB 1LD9A 2OMXA 5IVXF 4KJPD 3OR7B 2R23B 5EU7C 5DRZA 4MDIB 1J87A 2EUWA 1Q0EA 1F56A 3G6AA 2G2PA 4UDUB 3NESA 3FB8A 4LIQH 3RDTB 4LRNH 1A6TA 5TDOB 5DJDB 4UQ2B 5DUML 5ICXA 3K2UH 4UU9B 4D7BA 4ELMA 2EE6A 2VDOB 4IJTA 4O02A 3VFRB 4FLRA 3ZVVA 3RWJB 4LDLB 5IB3A 1MFEH 1BIIA 1UM6L 3D0VA 1T66D 3MU3A 3D50A 2BRQA 1WSST 1S7XA 5D72L 1IBDA 4HS3A 4U0RB 1IC7L 3BRGC 4Q14A 2GUYA 4FADA 4ODHH 5I1CL 1RI8A 2LAGB 3G5YB 5F3BA 2CM5A 1N3NB 5CZVL 2VAJA 2ADFH 3ATFA 5EF2A 5T1JA 4S2SA 4QYOB 2V5TA 1TQCB 4PJFF 3K0WA 2XQYA 1SZNA 5FA3B 4A7UA 3IJHB 3QNXB 1DSFL 1WFIA 2VLLA 3OKLA 3MRRA 1AZZC 2W9LA 3CFDB 3M8OH 2BS71 4NN6B 5CP7B 4L8DA 2G5UA 2IANE 1J8HB 1EDHA 4JZJB 4O51A 5CU9A 4R7NA 3WEAA 2GTQA 2E47A 3KGUA 1DEDA 3LN4B 4PJ7E 3GXFA 4ODTL 4K07A 2PO6D 5C0AD 2GHWB 3QC6X 5HHOB 5MP6L 1AR1B 2X4RB 2JJSA 4OIBA 2CO1A 3CFCH 4AQZA 2PYEB 4DTGH 3FXIC 5KVEL 1NBZB 3GMQA 1FN4B 4QKTA 5JHDA 1KCBA 1R17A 5BS0E 5ELIA 2YAMA 5HHMB 1JGLL 3CVIH 3KGRA 2KZKA 3MLUH 2YMTA 4Y0GA 3H9SA 2GSGA 1KB3A 5F7EH 1UCTA 1SN0A 4Z7NF 3BCDA 4MX7B 5ADOH 1K2DA 3UROR 3ZDZF 5EUOE 3J8F7 2BIHA 4P23D 3UTTD 2NY3D 1G7MB 1LE9B 2YD1A 5FA4B 2WVVA 3EYQD 4JFVA 1SMAA 2VDKH 3C9NA 5T33H 1AY1H 3GDCA 4ZFFA 3SCMB 3DYMA 4HG4K 1PFCA 4TL5A 4PHZA 1QSEB 3QHZH 4Q6IB 4UTBL 4WI3A 2RMNA 3RUGB 3V7AE 2VXSH 3QHFL 4LF3B 2X3CA 5EZOL 4A2HA 1LP9F 3EGXB 4P8QA 5LG1A 3QZPA 1V05A 1YYLL 4XP9L 1KCRL 1B90A 1GZPB 1W6WA 4JCLA 4OZGF 2GBUA 2NY6C 2O5XH 3ZKXC 4XVUD 4YGVB 3PAYA 4GINA 3O6ML 4F7TA 1WH0A 4KX9A 1MQ8A 3TJHD 5EZJB 4X42A 2AI0L 5DUPH 1EUTA 1HZHL 4M8QA 3PXLA 3MRCB 5AKTA 2D2OA 4BKLB 4LEXH 5IHLB 5BUAA 3MFFA 2OMYB 1RZ8A 2Z4QA 3HHMA 4PJ8C 5E2TL 2ATKB 3L95B 1OZTG 5H35A 4CU6A 1LO5B 2E4FA 5GRUL 4HWBA 1I85C 4YDLB 1KJ3L 4P5MB 4UZUA 1Y18A 2LFEA 2AV7B 1L9NA 1BAGA 3ASWA 5F9JA 3P9MB 4FMVA 1T5WB 2HTKD 4Z7VE 1CFTB 2NXZB 3MDJA 1HL5A 5J3HD 3AB0B 3VACA 5I1LB 3EGDA 4G71B 3LH9A 4C4KT 2CLZB 4HIXL 5EU4A 4ZDHA 2YUZA 2W8CA 5DVOA 3IE9A 4AL8C 3NIFE 2XG4A 4AM0B 2YFNA 3FQWA 1FL3A 1ZWIB 1SXSA 3KVDD 4K55A 4S0TD 4JB9H 4R7DA 5D71L 1O6SB 2B20A 3ZL4H 5I1EL 3BSZA 4DGVH 5DS8A 3UTQA 2VW4A 2CBPA 2F58H 4BSJA 2P5WE 3AWGA 4MCYB 2B59B 3ETSA 3KPRE 1QTPA 4IKNA 5IVXE 3QUMB 4V2CB 3X1EA 3QUMH 4MXQC 5C6PB 2H1LM 3NP3A 4JHUA 4XB8A 1H9DA 1P9MA 4OZIA 4UB0H 2EDTA 4K2UH 3CPLA 5SX5H 1FC1A 3LKSB 3SSGA 2VMEA 1BVOA 1OT1A 1HEZB 2YRPA 3F7YB 3HRZB 4W4NA 1KXQE 1IM9A 4R3SB 3TV3H 3WXVH 2O26U 5FECA 2ICWB 3GMNB 3S35X 4LPVA 5A2IH 4X4KA 3GI9L 1N8ZB 4JMXA 4XCNA 3P4OA 2KUTA 5FEBA 3D39D 1VDGA 1I31A 1W0WB 3L4ZA 5LGHH 3ARGD 4DP5X 2FX8H 4YX2L 4NN7B 2DAVA 4RLDA 3ARFC 1FCCA 4P2OC 2P24A 4XNAA 4PJFE 2I60L 3NGBC 4ZQKB 3SQRA 2VMFA 1E40A 1NKOA 2CCWA 1OSZA 1F6LL 4N24A 3HFMH 1VGKB 3TN0B 1W0VB 5FPIA 1YNLL 2WPGA 1J1XH 3C5XA 4LSPL 2ZUWA 1B3IA 5M7QA 4I87A 4ZX3A 4JO8A 4J3OG 3SDAD 2NSXA 4LLMA 1RUKL 1SEBA 3DC0A 2H8PB 4YVUA 4ELKB 3O11B 4ZPVA 4FI6A 1JNHA 2UY6B 3L5XH 4IRSB 1OGSA 4RAUA 2EKSB 4GKSB 4N2KA 3FB7A 4C57C 3I6KB 3MXWL 1MLCB 2XFXA 4N0YH 4OJYA 3MLRL 3B2VH 5ISZA 1KELH 4QD2E 2AEQL 2X2HA 2IXQA 4IJ3C 4L1HA 1ZJBA 1M57B 2UZIL 2HH0L 3QEQA 2WGXA 4YIQB 3EDEA 5C0AE 3SYOA 4YL4A 2WYZA 1JZ5A 2ZXWB 1Z2KA 4R5XA 4WW2A 2D03L 4HV8B 4J3UA 3UTSB 3QQ4A 4UT9L 1RURL 3KYKH 2X40A 4DGWC 1FL6A 4GAJL 3HZMB 2W5PA 3VXUE 3H3PL 4Z7NE 2X4OB 2Y7NA 3CZJA 3APCA 2G60H 1RMFH 5FGSA 1DVQA 2ESVB 2R69H 1E28A 2VWEC 3ZDZE 4R4ND 4FHJA 4HUXA 3WE6B 2VE6B 2VO8A 4HOZA 1RVFL 2J2ZB 1MJ8L 2IH3B 5FB8A 1KSRA 1S9VB 3FNKA 4OCSL 2WUBH 4IIZA 2N4IA 2GJ6A 3L3IA 2OCJA 1UA7A 3MNZB 4JKWA 5ADPH 3MJ7A 2WIIA 4QXUH 2R51A 3QUKA 4EI5B 4P46A 1KIUA 3WS3B 1ZDSA 1LP9E 1R47A 2E8YA 3TIEB 3MV8D 4FL4C 4GI6A 1QFWM 4XP1L 1OTSC 2VDNL 3UC0H 1MRFL 4K5LA 3ZUCA 3NH7H 3OX8A 4O2FB 2CDFB 5IROD 2HAZA 1J05A 4OZGE 1EX0A 4R96A 1JNJA 2X4NB 4WEBH 4DP9X 4QY8A 1H6EA 1N0XH 1LWHA 2BH0A 2AEPL 4FTVB 1JI1A 1KMGA 2OYPA 5I23A 1IQWH 2XSKA 3P4MA 4LASL 3CNKA 1ES0A 1AKJA 2JKXA 4W4OC 2WJ5A 3O4OC 1KLFB 3C6LA 2PP7A 4QRRD 3RLSA 3QP3A 4PD4K 4Q9BA 4F2EA 5HGDA 4NO2B 5C7XL 1A1NA 1ZSDA 1CL7L 3ZXAC 3FHAA 3KCPA 3ZRSA 5IK3A 2BJML 3C60A 5IB4A 4L8CA 3ME0A 1UD8A 3ORJA 3PYCA 4WWPA 3IFOA 4F2ME 4XXDB 1OTTC 1LEKA 1T89A 2ZXQA 3WD5H 3EYSH 4WY7L 3LKPA 1LO3L 4R26H 5E8EA 2FZ3A 3RTQC 4OT1L 4G83A 3GJFA 2ICES 3BQUA 1E9PB 3B8SA 5KYYB 1JPGB 1PZ3A 4PQXA 4JQIA 3ARVA 5E6RB 4HH9B 3S36X 2AJZB 4U1IB 4G42B 3RVVD 3II3A 2K4AA 4MJID 5CNHA 2VXVH 3DURA 4XNXH 4WWKA 4KQ3H 2OK0L 3Q8AA 3WTYA 1E2WA 3T08A 1HDMA 3AXLB 2HG0A 3WIFA 1QVOB 1QSFB 1EHNA 4XX1G 2JXMB 1U9KA 1FWXA 1OSYA 4AUUA 1NCCL 1JWSA 4FZ8H 1NPJA 5KS9B 3MO1A 4YBLB 4CL7A 5B22A 1I8AA 5BOZG 5HVHC 5I5IA 3INUH 1UZGA 2DM2A 2VJ8A 3D52A 1TKWB 1SDDB 4QRUA 2FJSA 2R7EB 3T8XB 5JPNB 3S9DB 1R24B 1WC7A 3PWLA 1VPOH 3V10A 3EXLA 2A9CA 5HGGS 2F9BT 1KXHA 2X4UA 3RWEA 1HIMH 4X80H 1ZANL 4BELD 4M62L 4JY4B 1TITA 3L9RB 4NC2B 5F7FA 32C2B 4BWWA 3NZHL 2EIKB 1CGUA 3BKCL 3MX0B 2X4QA 4CN4A 3U30C 2G9HB 1F3JA 1HSBA 4HALA 5BO0D 1BQLL 3D39E 4ZXBB 3VWKB 3MUJA 4O2EB 3I74A 3QO1B 4U0RC 4XOCA 5TGBA 5F89B 3KYOA 4DP6X 2EYTB 2QSQA 3LN9A 1ZGLP 5DDHA 1KCVL 2YKLH 1FDLL 1TQCC 4LLWA 7PAZA 4FQLL 1A6ZB 1YEEL 4OD2B 5ESQB 4PVBA 2L3BA 4X4MA 4PCTA 3BAXA 3D25B 1MWAB 4PLJD 1S9YA 4QO1A 4NQVA 2NCEA 4HSAC 4NN6C 5IHZA 1PAZA 1Z9NA 2OMUB 5J6HA 1A7NL 1YRKA 5HTSA 4JZJC 4G7QB 4K9JA 4KO6A 3RB5A 4OCRL 3UZQB 4DO4A 3ZHNA 5IY5B 5JPMA 1AR1C 5ERWA 4Z7QF 1QNZH 4PLKC 3VI4A 3L7EA 4Z78A 1I75A 5B38G 4HUMB 4Y4KA 5K1VA 4I3GA 2DQCH 5E03A 3VSQA 1I3UA 3B3BA 4WSGA 5HGAB 4ZI8A 3GSNA 5FHAL 1EGJA 1KJ2L 3GMOB 3C8KB 2BOBA 1CLYL 3P0VH 2DDQH 5GSVA 3X3FL 3FUKA 1U6AL 3S3BB 1USZA 3NCBB 1WTLA 2XN0A 1AQKH 3FQ2A 3L4XA 1V5JA 4DN4L 3DVIA 4YSPA 3QUHA 1TVBA 5DC4B 2J88L 3B6SA 1GS6X 2UUDK 2EABA 2DIBA 3JVGA 1J1OH 3K3QA 1CI5A 5HVGB 3SCMC 2RAMA 3VXMD 2FK9A 5BW7A 3ES6B 4JFUA 2P26A 2YC1A 1L9TA 2CNYA 3CMOL 1ODUA 3MV8E 3PGDB 4I4WA 4WV1B 1TPXB 2CDEA 2DQFA 4AQ1B 1HYSD 5IM7B 3T4YB 4PRHB 4TRPL 2KYIA 3PGCA 4NXSA 1ZXQA 3QO0B 4QJ4B 4X99B 3BZEB 5DMGD 2RIKA 3HE6B 2EADA 3VFGL 1GYWA 4J8QA 5F1SA 4OBSA 5IOPA 2RD0A 1GOGA 3ABGA 5F3HB 3VGAB 5HVFB 1NLDL 4PD4J 4FOMA 4P4KB 1OARH 2NNAB 3H6AA 4JKMA 4X7SH 2YJLA 3JTTB 3QORD 4EUPA 4MSWB 3V0DA 1N8OE 1EO5A 2JI2A 4RGND 2D4FA 2ADGB 4IHOB 2DYPB 2VUYA 4RMUA 4LVEA 3GHBH 3U6XA 4NHUA 1ORQA 3G3LA 3WL9B 4YDNA 3MCKA 4ZO9A 1MH5A 4J1UB 1U8HA 4XNUL 3B7SA 1VGEH 4K73A 4P57A 1EA9C 4MA3B 3OWEA 4PJ5B 4FABL 3T0EB 3Q06A 4X8JA 2ZAIA 1FFOA 1ORSA 2A1WL 3MBWB 3VFNA 3OKYA 3FOMB 3DX2A 4XPHL 4EOWH 5K93A 2XTJB 3LZFH 1IKFL 2VN4A 2ZCHL 2JJVA 4YDLC 4AEHL 4DCQA 2YAEA 2OSLB 1INDH 1NIBA 2N3JA 3PNWA 2I85A 5JDSA 3QUGA 2CK2A 1DJXA 2EEBA 2XZZA 4YR6A 4ANWA 3O8XD 3X12B 2O30A 4YFLI 4OAWB 3B7YA 3DMMA 1I8KA 2DBLL 3KPLA 4HUKB 1JS4A 4TVSa 2R0LL 1ET8A 5D7JB 2ZG3A 3VU1A 4MJIE 3RWDB 1DN0A 3RFZC 1KJMA 2UYLA 5F7NC 1D6VL 4M56A 5L6YH 4LCIL 3CSGA 5F6HJ 5FCUL 5FKAB 1TJHH 1YDPB 5I76A 4CVXA 4H1LB 4H1LH 1VJSA 1PS3A 1KB5A 5G4MA 5EG6C 4A7TA 1F6FB 2WVSA 3EUDA 3EBHA 3BWUF 4ONGH 1ZA6B 4DVBA 3O4LD 3Q48A 3BEWB 1MRDH 1UB6B 4ZO8A 1LJMA 4G8EB 1MZZA 4OD1L 1L9SA 1QTYT 2K3TA 3FCTB 3AFLA 4FNTA 4Z7AA 1S5IH 2R8SH 5DZ9A 3BE1L 2JB5L 1BZOA 1IGCH 2QFPA 3NJGA 3QHTC 1H6TA 4Q8BA 3MACH 1KTJA 2VO5A 3HRZC 1U2YA 3OKOA 4O4YL 4AXWA 1XAKA 2QSCH 3ELAT 4K9EL 4QHNB 4M1CC 3SJVE 1HCVA 4FLQA 2W81C 4IW4C 4Z5RB 3MBEC 1FZJA 3TFKC 3JTSB 1DQTA 1I8UA 3FRPG 2EEDA 1KEMH 1P4LA 1C5CL 2EIJB 5DJZA 4NN7C 1MCOH 1YN7A 3QFJA 4R2GB 1HXYB 3FFOA 4ZW5A 1U92B 3DLQR 2YJQA 4WFGD 4WWNA 2NR6C 2X9YA 3TN0C 3TT3L 2JH2A 2V9QA 4W68A 1ADWA 3LAFA 5E2VH 1YC7A 3OQ3B 3LH2H 5I71B 1CFBA 1J18A 1LEGA 4QI3A 1P7QD 3KPOA 2YAFA 1JP5A 2IALA 2HP4A 3OAYK 4OGAD 5JR1H 1JNLH 2DWYA 1N5AB 5IEHA 4Z7QE 1MFAH 3C87A 4XXCA 3O3DA 4UIMA 3CCHB 1MZYA 2UXFA 3G6DL 4FFTA 1EO8L 3LB6C 4NQCB 3VNYA 3M6DA 4AJYV 5HY9B 1J8SA 5CBAB 4P5TA 2F19H 3GRWH 2AC0A 1ZPUA 1F41A 4K3DL 1IO4C 3CHXA 4JO4H 4HYTB 1TQUA 1CF8L 1D5RA 5GJSL 2FSDA 1OCWH 3LHAA 3K81A 1FVDB 3LD8B 1KYOJ 2IAAC 3MA9H 4IOIA 4MMXB 1XF2A 5ABAA 3S0PA 3W0WA 1WFUA 5ETUB 3BVVA 4GRWF 3B3IA 3GB7A 1XXDC 4BFIA 4TMPA 2JWYA 2R1WB 2WLMA 1PYWB 3GLEA 4JFTA 4KJYA 4NPYA 4NUQA 4YNYB 3SDXF 3D0LA 3FQUA 4Y1AB 2MCMA 4WTWA 4EAEA 2J8UE 3OJDB 3QEHB 1K72A 3A47A 5SWSA 2UWEB 2Y2YA 1O75A 4DW2H 3K6DA 1SOSA 4JDVA 3D85B 2EDLA 5AZEH 3ZGIA 5CLXA 1MHEB 3AY4C 5KANI 3VXME 3LKNB 1A3RH 2VGLM 3G5XA 5DK2A 3ZX1A 1QI3A 5GGSA 1N2RA 2P46B 3P3UA 1P7KB 5B8CA 4HJ0D 5T1KD 2IPKB 1K4CB 4F1ZA 2C3XA 1XH2A 4A68A 3U0PA 3ZLQC 1GSKA 4HQQL 4KXAA 3UJIH 4HOXA 4WHYH 4JE4B 3KG5A 5J6SA 3ZY7A 5TQ2H 1FV1B 1JPTL 4PI0A 3PY9A 3SE4A 3VX1A 3CFQA 4JY5L 3V5HB 1RJYA 1INQA 3AMLA 1VKXA 2VM3A 1TQBC 1EEYA 2Y36L 4QPEA 2DLTA 4AMKH 3EO1A 4BZ2A 3RX8A 1SYSB 4LCWA 3GS7A 5KJRH 4HS8H 3RIKA 5AAWC 1U58B 1X5ZA 1UD2A 2C9XA 5BVJA 1BYNA 3IBEA 2JJTA 4N2CA 5L7XL 2Q6WB 2R2CA 3FUHA 4DKTA 3U2SB 5G4NA 3OD3A 4FNRA 4LP4A 1OAYH 1NANI 4XPFL 1DQJB 1L0QA 2BSED 2OMWB 4MJ5B 2NDFA 2ZCLH 1IZKA 1AGFB 5C3IA 1FIGL 1G9NH 4YXHL 3QS2A 2YGPA 1KUMA 5FM5O 3IU4L 2Y69B 3CZEA 2ZYSA 5ALBL 1ONQA 3GSQB 1BYOA 1CR9H 3IPFA 3ZTEA 5IT2L 3SN6N 1PG7X 1X5KA 5HYQB 1G0XA 1WE5A 1MCPL 5EZLA 1BEYL 4F9LC 1RD6A 1N59A 4Y16A 4PUBL 4TNEA 5ESVB 2AXHA 2A9AA 4NQDB 4YBLC 4M5ZL 2FYVA 1PSKL 3EZ8A 2Y07L 4OFQA 4PB9H 4HUNB 3PJNA 2YBRB 5DHVB 5DHVH 2W1NA 3VXTA 5JPNC 4BWTA 4PJCB 3EO9H 3R18A 3TFBA 5FDWB 2ATPB 1BQHB 1F1GA 1FO0L 4RISH 5K69A 3EJZC 1NGQH 5DI8B 1UENA 3RWFB 3TBWB 5A1AA 3HI6L 2AHIA 2VRKA 1M05B 3O6LL 5CJ5A 3MUZ1 2W38A 1HHIB 1JYNA 1CGSL 3B7UX 2HX7A 2P8PA 3D51A 3CU7A 4LSQH 1MJUL 5DK0A 5I16B 3V0AC 3PABA 3KR3L 5K9JH 3WFEH 4ZRGA 3VWKC 5LGJA 1FSKC 5FO7B 1V3MA 2K6ZA 4NFBA 3QARA 1HILB 2VJXA 1S6NA 2VUOA 4FFVD 3IS0X 4QRPB 4PRNB 2H2PD 3GMMA 4PP2B 5EH1A 4WFGE 4LKCA 3QAZC 4NB7A 4IDJL 1OF0A 3QNYA 5H94B 3D3VA 3J07A 3QH3A 5DJ2A 4OV5A 1N19A 4EJ1C 1IM3D 1WBYA 3LEVL 3QUYC 4LQFL 2ENQA 4KKBD 4PJXB 4NRYA 4Z9KB 2CCVA 1CD0A 2UXVA 5C9JA 5CLYA 5IW6A 2GUOB 1IAOA 1KNOB 2VSDA 3CSBA 3QJSB 4GQRA 4PJDB 2VDLB 5DS1A 4AENA 2VDLH 3CDGA 1ZLUH 2O93L 1XD0A 2O5YL 4ZMAT 4WI6A 2DI7A 3IVKA 5D55A 3UPRA 3BEVA 2MQ3A 2D31B 5EFIA 3TEXA 3ZW3A 3RDJA 5I18L 2B77A 2KQMA 2HUHA 4GRWE 4NPJA 1QW9A 3OXRB 4LSVL 5KBNC 4ATTA 3CVCA 2WSKA 4L0ZA 3SPHA 3SDXE 3ABMB 1RU9L 3CWGA 4YL9A 4X4ZA 3QJQB 4YHZL 3KBHE 5J7CC 5CP3H 4OLVL 3HZKB 3WFCH 2DQGL 5F70A 4M03A 3L7FB 5EBGA 5F97E 1JV5A 4YSDA 3B2PA 1CDBA 3GTVA 1B6UA 1IU1A 3O81A 2C3VA 1Z3GH 3CFJA 1WLHA 4U1HA 4N20A 1R5WA 1LK3H 4Z7OB 1RL1A 2YPLD 4P5KB 1MJ7L 4X6CB 1UGKA 5INCA 1BZ7B 3VCLB 4PJ8D 4NNYB 5GISH 5JIIA 1KBPA 4Y5XA 1T6WA 2AQRA 1XCXA 4WV1C 4HMCA 1L7IL 1TPXC 4BQ8A 5I19L 4FYQA 4JM2D 4OKDA 3BVNA 4AQ1C 2OTWB 3MRHA 1LXMA 2JCCA 4XCYB 3DVFA 5CLTA 5KSAD 4CILA 3K4ZA 1LL1A 1EJFA 4XHJD 5A7EA 2AXJA 1HHGA 1I7RA 2EO7A 2OXHA 2VR8A 4LSRH 4EQ3A 5E8DL 4MA1C 2PW1A 4UTBA 1YAZA 3VG0H 3ZHLA 1JI2A 2OJEA 4PJ9D 3VGAC 2IIJA 2XWTB 4P4KC 2X89A 4NQUA 4JM2F 3KLLA 4ZX4A 1F4WH 3NMEA 3I9PA 3O41B 2HT2D 1IBFA 5GZOD 3TWCH 1E8ZA 5G2NA 1AD9B 1B9ZA 1CYXA 4I18B 3MJ8B 4F9PC 4NQXB 4WGVB 1FG2A 4WEEA 1G6RH 5AOIA 4OJCA 5FGBA 5H4ZA 3B4NA 4KKZA 1SVCP 1KZQA 5MEQB 5C0FB 2HJKB 3WTSA 2X42A 1WRFA 1LO2H 3T0EC 2JKIS 3DX9B 1OP9A 3GNML 3HPLB 3QIWD 4ICWA 4MXQD 3T6QC 3DXAD 4AEEA 3TC9A 3MRIB 4M3JA 1F42A 1BJMA 4IIQB 3GYRA 2XTJC 2WHVA 1OCCB 1NCBH 4YBQD 5DT1L 2DM4A 3QJHA 5EA0L 4U1KA 1U2HA 4CNIB 4NO5A 1KPVB 1YEIL 1AQHA 3HUJA 2Y5TA 2NW3B 2A6IB 3WN6A 4AYSA 4G1MB 3JBG7 5C2BH 1C8QA 3V4VL 2CR6A 3VXRA 2OCCB 3TTSA 4BQ6A 3NZ8A 3W11D 5T1MB 4K8RL 1KN4H 1U8MA 5J06A 4P06A 2V0AA 1TYJA 3KVPA 3ARFD 3LVEA 4JFFD 2GSIB 4P2OD 1ZLWH 3SGJA 1V10A 1XGYH 4M1GL 1FUNA 4BQBA 3ZSSA 1JZ7A 3MUUA 4A2EA 1SMOA 5KZCB 1KY7A 2R56L 5IFAL 4GXUM 3EJCA 3PDDA 2MNJB 3WEBA 1JHKL 3LQZA 2VXUH 4UINL 1HH6B 1YNTB 3QQDA 1OOAA 1X3DA 2NXYB 3CDZB 5AW0B 4PV8A 2APVA 3BO8B 1FGVL 2FQGA 3SEPA 5C0JB 3CDYA 3TBSA 4ILDA 3FFCD 4NUPA 3D8MA 3BIBX 4MKTA 1JK8A 3APNA 4QF1A 4F5CE 5ITBH 3F01A 5EOQH 1OGTB 3ISYA 3V9FA 2X70B 1EAOA 3V4PL 3QIUB 3DIFA 4K5NA 1BFSA 2CIIB 2XX0A 5AYTA 2HX9A 5AWNH 3F58L 4KTDH 3L1EA 1AP2B 3CHSA 1ZAGA 25C8H 2NYKA 3WUWG 2HVJB 1DFBH 2BX5A 4OFDA 1PF3A 4GXUN 1L6XA 2WYTA 4R2GC 4YPJA 4AH2B 3LQMA 2IOMA 4YAQA 4OFPA 5BZXA 1EV2E 2F54E 2VLKD 3LPGA 1DP0A 4HCGA 4YDMA 5I71C 3PAVA 3MRJA 4RDQG 3VFVA 2XI9A 4C56A 2RGSA 3REWA 4W6YB 4OI8A 3X17A 5CD3B 2A6KB 3GHEH 4ONHA 2OX5A 1CE6A 4GRMA 2XV0A 5E8PB 1OIOA 2LV4A 1W16A 2WLHA 4NQTA 4G2AA 2JK5A 4WJKB 1BAFH 1MWOA 3TNMA 3N91A 1OTSD 2AJVH 2GJJA 4WWOA 3ZTCC 3KPPA 4BFBD 3L3KB 2CXKA 2XX1A 2J6WA 2WZAA 1HKLH 4YK4B 4ZMWA 2WBXA 1G7QB 1NIDA 4W9CC 5IMKA 5J1AB 3M88A 1UWFA 3RA7L 2XBTA 2VDRH 1NBQA 1G7HA 1ZHKB 3C2SA 3GIZL 4MMXC 3L5WA 1UXLA 3C8HA 2BSTA 1A6UL 3PV6A 1DJZA 1KV3A 4LESA 4M4RA 4ESKA 4UT9A 4Z3HA 4AJ0A 3QQXA 4JFDB 1OPGL 5L4MA 1WFNA 3X13A 4GG6F 2QADB 3B34A 2WMPA 12E8H 3EH4B 4IU2A 2X3AA 5LCVL 1SVBA 3Q2VA 1ZGLM 2ZOKB 5BXFA 4ZMLA 1YJDH 5E8NB 3T2LA 2LTQB 4OGQC 4CJ0A 1MJJB 1JN6A 4YHOL 4AYMC 1MI5D 3SZ6A 5EWIH 1OTTD 2KQNA 1QWHA 4LLYA 5E1IA 1T03L 1J11A 4U3SB 4S1SL 1ILSA 2D0FA 4GKLA 3RTQD 4X0KB 1MLBA 4FKHA 4X5QA 1U2CA 1Q0YH 1XBDA 2GPZA 4JFZH 1ADQL 4MA7L 4N87A 3S5LA 1BBJB 1IT9H 2QT6A 3LEXA 5FR3A 4L4JA 4HSQA 4BFNA 1UB5A 3FSWA 1CDJA 3DSFH 4WU7B 3SPJA 2VQ1B 4LLDB 2BVUA 4ANVA 2QPDB 4PG9A 2WBJA 2GEEA 2XJKA 4X7EC 1WAAE 3Q01A 4PN6A 2AJ3B 4Y4HC 1T20B 2IPTH 2EIBA 2CK0L 2OULB 2XPZA 2ZYHA 5C0RL 3K5RA 1AYRA 3LPFA 1CCZA 2VL5B 3L3HA 4NIKB 3L4WA 5IESH 4OLEA 4P2QD 3D2UD 3GM8A 3HJEA 4FXKA 3SPCA 2TAAA 1VENA 4NKIH 3D4CA 3D1MC 3DXAE 1SDYA 1UCBH 4DKAA 2N1KA 2AJYH 1LGVA 1U8QB 2X7LB 4FERA 3K46A 5G55A 4HKZA 3NCJL 5KOMC 2Q5BA 1YY8B 3GSOB 4G7SB 3SO3B 1G9NC 1JCKA 2HFEA 3RDTD 4L48A 1P5UA 5C7ZA 5F96L 3TTYA 3NZSA 3MR9B 4RFEB 3BH8B 5C09E 5CCJA 2P49B 2XCMC 3MLYH 4D0CB 5K39B 2RCSH 2VSKB 2WQWA 1U30A 1QR1B 4BRJA 2NX5A 5HJ3A 1H3PL 2H3KA 1TTAA 3MRFA 1CICA 2YMXL 4QLWA 1HI6B 1RERA 4JFFE 4XNBA 5C0BA 1VFBB 1NFIA 4Z0XB 3LMJH 1V3KA 3KBEA 4GMTL 4NT6A 3U9UA 2ITFA 4YXLL 1XBRA 2Z8RA 3JZ7A 2ERJC 2EC9U 3HNSL 3JV0A 1T1WB 3BN9C 1A3QA 1RHHA 4QRFA 4GW4B 1DJSA 1QRNA 4PW3A 3UDWA 4E9YA 1RY7B 2Y2TA 3GSRA 3HBZA 1UADC 5IQOA 4EKJA 1WT5A 2YHGA 3ZUNC 1J8HD 2GI7A 1GIGH 2BWDA 2C4FU 3FFCE 2DKUA 1BBDL 1MQKH 2AK1L 3IPBA 4XBEL 3S4SG 2G75A 5IR1A 3FRUA 4W9IC 2I5YL 1F00I 1XEDA 2X9XA 5EUKB 2WQAA 4GP5B 3BYYA 1AR1D 2GK0B 3AT9A 3GSVB 5HHOD 4XMLH 3WFHA 5CEXA 4PLKD 3M1BA 5DS2A 3SPGA 3UIZA 5EF0A 1E43A 5T3ZH 2PYED 4APQB 4L9LB 3E38A 2R59A 4CKVX 3VSTA 5HHMD 5IQ7L 3WTVA 4HLZG 3WEXB 1JJUA 1FCGA 1IAKB 2X12A 3AG2B 5SV3A 1NH6A 2MTAA 3KWVA 3QK0A 5I8OL 3N42B 1OE2A 2O6PA 4LNVA 4PEEA 2VLKE 3MLXH 1XHHA 2BHUA 4AZ8B 1QSZA 6PAZA 3GXNA 4MMZB 5GS1A 1CGTA 2FD6L 2F7PA 4JRXB 2J1YA 4K3EL 1L9PA 1TFHA 3FHEA 2IWEA 3PUUA 1JXJA 2EIEA 3MQIA 5FUCC 4I0PC 5JHAA 1HT6A 1G1CA 3CPUA 1MUJB 4PS4L 1QSED 3MV01 4L9DA 5I1JH 4M6OL 5AVWB 4M29A 2ADIA 2EXSA 2OTUA 1QRKA 3ZKND 1OP5K 2UVFA 2OMTB 3AS2A 4QEGA 1LK2B 2PP9A 5CWSA 5AEAA 4WFFE 1ZDQA 1U8JB 2HRPL 4FCAA 4GRLB 4OF8A 4GG6E 2NQ3A 1JD7A 1E9OB 1C5DB 2Y24A 2R29L 3BDYH 5DRXA 2MCG1 1IGIL 5C07A 4BCXA 1IL1A 1J8RA 3MRPB 2DIEA 4U6TA 3VFMA 1WBZB 5IB1A 4XMKH 2MPAH 1KJ2A 1DVYA