3LYRA

Human early b-cell factor 1 (ebf1) dna-binding domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
211
Chain Sequence
GSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determination of Functional Domains in Early B-cell Factor (EBF) Family of Transcription Factors Reveals Similarities to Rel DNA-binding Proteins and a Novel Dimerization Motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator
molecule keywords Transcription factor COE1
total genus 44
structure length 211
sequence length 217
ec nomenclature
pdb deposition date 2010-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16422 COE1_DBD Transcription factor COE1 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3180 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lyrA00
3LYRA
chains in the Genus database with same CATH superfamily
2FBRA 5G4OA 2IIJA 3VFGL 4G11A 5CD5D 4GUCA 4UMSA 4IOFC 4FJZA 4EXPX 2ADFL 3IS1X 5DJ8B 4JFEA 3FTXA 2HJLA 2NCEA 3LEYH 5D72H 5JDJA 4G8GE 1XF4B 4HJUA 2VSCA 3CIQA 2YFNA 3HE6D 4FFYH 4G6AC 2PKDA 3OB0K 1N0XH 4X83A 1RZ7L 4HEPG 1I1AC 2QPEB 5I0WA 4L29B 4ADJA 3S5LB 2ICWI 1ZLVK 2IWFA 2QGBA 4CC0A 3QJZA 3LZFH 4H1LG 3LQMA 1X3DA 1FAKT 3V4UL 2ARJA 1E9OB 1D5ZA 1UWXK 2GJZB 1WFOA 4HIJB 4P4RB 4QRQB 5T1LB 2FEEI 5KBMA 4X0NA 4B3VA 2E74C 3OMZA 3SDAC 1Q72H 1TVDA 1M9WA 1QABA 4HIQA 4TUKH 4FFVC 4W9JC 1EAPA 1LILA 2JJSC 4XWOC 3KVPA 2J1ZA 5JHLL 3MBXH 1RJYB 4PLJC 1IBZA 1U4EA 3D85A 4KXZH 1Q0XH 2AEWA 3F62A 3V4PL 3WHE1 1ZVHA 3F6JA 5KVEE 1F58H 2XIIA 2GJ6A 4QKTA 2P44B 2WPGA 1WS7A 1G0YR 3QZMA 2WNGA 4FMKA 2LOEA 3CDZA 3TT3H 1GS6X 1MHEB 1UWFA 2VDOB 4Y4HB 4HBCL 3VFRB 5B1JA 5DRXB 2HP4A 1FO0B 4LDLB 4XHJC 1SN0A 1LK3H 3P77B 1DQDL 3WUZA 5DTFA 1JGLL 2CK2A 3WAKA 1JGDB 2A38A 3QXAB 4K71C 4JKLA 1JGVH 3S5LG 5EZLA 3X14A 1VFOA 3GIVB 4AKOA 4I8DA 4DESA 2KBGA 2AQTA 2EYRB 1G6RL 3KYKL 3MX0B 4G9FD 2CCVA 5HJ3B 3VXOB 4LAQL 2R0LL 1C8QA 1RZKL 4NERA 2UWEE 3ZTNH 4RMBA 1SOXA 3LD8B 4HUCA 3UPAA 2GK2A 4XAKE 4PJ5D 4FNRA 4RZCB 3OWRA 2XQYK 1RQ5A 4PREA 4NNXB 5JPNA 2EE2A 3BDXA 3QEUB 4KQ4H 4OCMC 5DYOB 5IIEB 4ZSOB 1PY9A 3QUZC 4J4PA 3UTPD 1OAYL 1DQMH 1J88A 4YDIH 1FLRH 2VN7A 4H1LH 4BZYA 5LNEA 1GYWA 4FYTA 1A1NB 1I85A 3CZEA 2YPLB 3RUGE 3IDUA 5KBLA 1LEGB 2FSDA 4FC3E 5GQBA 1RCYA 3HS0A 4HIEA 1T1ZB 1QPXA 1GCYA 2VABB 1KGJA 3SD5A 3FO1B 3O4LD 1RULL 5B3NA 1D9KB 1E3XA 5I5JA 2OKMA 1I7TA 1NKRA 1TQBC 3MUJA 1JFHA 3MNWB 4U6VH 1L4IA 4BDVA 5I17B 1RY7B 2HFEB 4WWKA 4LFHD 3TWYA 3LSOA 4E41D 2WVTA 3TH2T 2IF7A 1S7XB 1V3JA 5JW3L 1HU8A 1NBZA 2H2SD 1U30A 1ZMYA 3QQ9C 3QQDB 4Z7QF 1KXVA 1CLYH 5FYKD 2BNUB 5SWZB 3U7AA 5FOBB 1HJBC 4HPOH 3TO2B 3AQYA 4HWZA 2XVBA 4IBSA 5FYKU 3WS3B 4ALAH 5AKRA 2CE6A 4Q6KA 1KACB 1RULH 1LO4L 3MACL 4K3EL 3ZSTA 3FRPG 2Q0ZX 4WUKL 2H7WA 3N85L 2APXA 4ABVA 1LQBC 3HE7C 1BWMA 3UX9B 3U0WL 2QSTA 4JRLA 2ATPA 1CD0A 5CJOL 1KB9K 2EECA 4JGJA 4HBQA 4AEEA 4ELMA 3FB7B 3S6CA 1CD8A 3D5OF 3LNEA 4YXKH 2RAMA 2CRZA 5EUOE 4XC1L 1TVHB 5FB8A 3QARA 4AKPA 2DBLH 2BXYA 3BWUF 4FNLH 3BSZH 3G5XA 3FS9A 1KTDB 3QH3A 1TTFA 2BVOB 1KIQB 1OCOB 2JIXD 3T6XA 2X40A 1VB9A 4AE0A 1C5CL 5TPWL 3TN0B 4ETQB 3DUSA 2FT7A 4N3TA 5J11C 1S7TB 1V3MA 3RTQA 2JV6A 3N1GC 3VH8G 5EF2A 1B2YA 2BP5M 1I8IB 2FDBP 1EK3A 4IRJC 3V0IA 4B0MM 4MJJA 2FL5B 2IPKA 3S2AA 5EZOL 4IDJL 4O2FB 3WUWA 5F7DB 5K59F 1KWGA 5E94A 1CB4A 2YRZA 3BP5A 1JS4A 2OCCB 3H42L 3PDOA 1ZA6B 4P2CG 4YGVB 1IC1A 2AAVA 3V5DA 4NQED 2IC2A 4CW1A 4F3FA 1F8TH 2VZUA 5GISH 4JFOA 1WYJA 4J27A 4GW5B 3S35X 3BD3A 1Z3GH 3GMMB 1MI5A 1SJXA 3EH2A 3WN5A 5C0GB 2GIYA 3Q8CA 2NUTA 3FOMA 1MVFA 5AVYB 3L4VA 1A9VA 1HXMB 3FQRA 1RZ7H 1A9EB 3E2HB 3OKLB 1U93A 5J1AB 2VDLH 2E27L 3GXTA 4QRRA 5DS8B 4XOEA 4TV3A 4MMXB 1T1ZA 3WGVB 1F3DH 1A2YA 4UZUA 3AGVA 4N5EC 2Y2WA 2VDMH 4LIQE 3FU7B 3PJSB 4YQXH 3KWUA 4WI7A 4R7XA 2NCMA 3O4OC 4WENB 1SGKA 4N86A 2DQIL 3OGOE 1ASOA 4PJDA 4LNVA 4HH9B 1EFQA 3S5YA 1GS7A 1CWVA 4LE8A 1KBKA 2SODB 2VDPL 4OUOA 3IJ8A 3L3IA 3Q2VA 4I0PC 4W93A 1J5HA 3GLZA 2BOLA 3LZOA 4BA0A 1IBGH 2E75C 2VMDA 4UB0H 1NCBH 3RVXD 4LVHC 4PRPD 4Q7DA 5EO0B 4ZPVA 4H8QA 1XF3B 3WIIL 3PHQB 4PAZA 3VWJC 2ATKA 4IRSB 5CBEA 4DKTA 1HCFX 3NAAL 3NPSB 4JFEB 3KLSA 4W4OC 5IW1A 4K7FA 5D1XA 5EU6D 2VXVL 2O72A 1F18A 4F20A 3CSPA 1K5NB 3WE1A 4AIOA 2FJGB 5T1KD 3C60C 5IT2L 5C9KA 1JWSB 3AMKA 2E6QA 2O61A 4HUXB 4NM4H 3ME0A 3SY0A 3QUXB 4POZC 1XAKA 3MLRL 1M2VA 3VFVA 3IDXH 3CE1A 3EGXB 3FU0A 3IF1B 4JL1A 1Z9PA 1YNTB 1HXKA 1D7DA 1HHHA 3LIZA 4ZTOH 4FEMA 4N0UB 4XNBA 1JV2A 4P2OD 1UASA 5AKSA 2NY6D 4F15C 5HHQB 2VERA 3B3BA 2PW1B 4G6AD 1L0XA 2Z9TA 5AQ0A 5DYFA 2XWBA 4TUOA 3RB7A 3DDGA 3K2UL 4JZJA 5IESL 3TWCL 2OYPA 1J5OH 3C60A 3MJ9A 1KDJA 1XSKA 1KN2L 4X5RA 3Q7JA 1F5WA 3KLHC 4P46D 2B1HL 2X41A 3D85B 1UM4H 3KZ8A 4MXQD 2DQTH 4L1LA 3L3JA 4Z23A 1KIUA 4L8SC 1NL0H 1AGCA 5L7XL 2YXWA 3QIWA 1HAWA 4WHTA 4RRPM 1TUPA 5KN5B 2I5YL 2FHFA 1N6UA 2IV8A 2MMXA 1KCUH 3MA7A 3RPIA 4Y2LA 4AYFA 3HS8A 4QRPE 3LKRB 1VEMA 3O8XA 3NBNA 2VC2L 2DDQL 5AALA 2G2PA 1E5ZA 3V5HA 4QRBA 2H1LM 5FLUA 4OIFA 4KZ0A 5TGBB 2O5ZL 1JPST 3NZUA 4I0CC 3P9LA 1RLBA 2JSFA 4JCLA 5I8EA 4K94L 1RFDH 2FAUA 3DHJA 3IFLH 3Q5YA 4HG4J 4MNHB 2X3CA 3ASNB 4PHZA 5C0CE 1VJSA 3E1F1 5H2BA 1CGSL 3BRDA 4GXFA 3UC2A 2JCWA 5IHUH 2Z31C 1ZT1B 1TQTA 5C6TL 2ZUVA 5LHDA 3WJLC 1HHGA 3T9WA 3VXRA 2A2QT 5M95B 4LZKA 5HTSA 4EKXA 2QHRH 3T0EB 4QMEA 5C0BA 1LO5B 5I18L 4HZLB 3GSRB 1D5XB 3HI1A 2WBXA 3II2A 4K55A 4BRVA 3ZQXA 1PD1A 2NNAB 3L48A 3GSVA 4PB9H 3VXME 1NOLA 5HI3D 3G6JA 3F5WB 5F9JA 4H8WH 4QHKI 1JPFB 4KPHL 1QFUL 4JRXE 4MBOA 4M03A 4X7TB 5J89A 1EV2E 4MNGA 4AVKA 3CFCH 5BQDA 5CR1A 3Q43A 3FUIA 1ZIAA 1F3JB 4FL4C 1JWMB 2EYTA 2HFEA 3JT0A 5EH1A 4GBXC 5AKTA 1KN4L 5C08B 1JPTL 1AQKH 2X6VA 1N59A 4CSZA 5ENWB 3OXRB 4JPQA 3MO1B 4RISH 4X6BB 1R3IL 1HAUA 3QCTH 4E36A 4W9EC 1Z32X 5IW1B 3GMRB 2I9LA 2DDQH 3U6XA 2V7HA 2DD8H 2VDLB 2AGJH 2DQFB 1K5NA 1C5DB 2AF2A 5E08H 1J86A 2CKBH 2WXRA 3V4PA 2W0KA 3D4GA 4HIXH 5K9JL 3CFEA 1Q1JH 4OI9A 3DX9B 3C5ZB 3SDAD 3G6DL 3O9WD 1ZLDA 5D2NA 1LDSA 4QRTB 2ODHA 2R2EA 3VWJB 2V6HA 4FQLH 3NPSC 1XT5A 1TETH 1QLRB 4ZUWA 4PU2A 3QCTL 3BH8A 2P28B 4AH2A 4D7PA 3S8WA 1HZHH 4TUOB 3M1BA 1UOLA 5DURD 5KJ7E 1SEQL 1JZHA 5ITFA 3AG2B 2HN7B 5T3ZD 4ODHH 3CK0H 2NY4B 4XP5L 4XO9A 1YUKB 1ZGLA 4PRIE 2ZUUA 1JNNL 2VCOA 5I6OA 1KPUB 1Z0NA 3FJTA 2XVKA 3VTTA 1AOHA 3JWDH 5KG9A 1YEFL 4M61A 1D6VL 4MQXC 1IAMA 2Q8AH 1SMAA 1TNNA 2AEIT 5EU5B 4M6NL 2VNCA 2XPYA 3NOIA 2NLJB 3SE3C 4JFDD 3BDBA 1KMGA 3LJ3A 4V2BA 2Y0SA 2F74B 2BIQA 3KH3A 5B1JC 5JHDA 3M8OH 4HWBA 1X5IA 2EINB 1MHCB 2J72A 1HOEA 3HPJA 3ULVC 1ZV9A 4RMSA 3VRJA 2AQPA 5MEPA 4MWFA 5AW9B 2XV3A 3GFUA 1Q1JL 4NQCB 4FQJH 4ZUSA 2Q2LA 2WLYA 3N55A 5I1AB 3OKYA 2Y5TA 2Z7WA 2OPCA 4YH6A 1G7MB 5E8DH 3VXRD 2A73A 3X11A 2DD8L 1S5IH 5F9OH 4L4TE 1ZT7A 2H1XA 3ALWA 4TSBH 5CCHE 2BSCA 5T3XE 4MJHA 3CZLA 3ES6B 1VZHA 3AREB 4Z7NE 1K9TA 5DHXB 2B7DT 2ZG2A 5DMIL 4UT9H 3VE0A 5DRZB 2E7BA 2JLLA 4Y9FA 5E2TL 4MBRA 4Z0BL 2CO2A 5JPNC 4OD2A 3NN8B 4DO4A 1H8SA 4UQ2A 4HIHB 1BG1A 4I4WB 4EZLA 1NA8A 2PTUA 4Z78A 1QP1A 1JWMA 5FS5A 5IEKA 5GRXG 4QOKB 2APWA 2VDQB 2MJWA 3UO8B 3MLTA 3C6SA 1ZS2A 3VI3E 5BW7C 4BSVA 1LO2H 3Q8FA 1NZRA 1P7QA 5IB4B 3G7TA 3LNFA 5DUBB 3PUUA 3WFEL 3DURB 5IVOA 4BK8A 3CSBA 4GB9A 1FZKB 1PAMA 1IM9A 3GSRA 3PWPD 1ZLSL 2J5WA 4GG6F 4PV9A 3CFJB 4YDLC 2DLGA 2NNAA 4JG9A 4BH8A 4RNRB 4XAWL 3RKDD 3G9VA 4XP9H 2R51A 3I9GL 4GRLC 5DRWB 2DJ4A 3T3PB 3O2VL 4F80A 1LEIB 2EUZA 4PBDA 3VRLF 1LNUA 3AM8A 3DGGB 2H32H 4LCWA 1BAWA 3ARDA 1FSKB 1SLUA 4X99A 4XCYA 3VTMA 5IK3B 1F4YH 1UQSB 2XXCB 3D3VB 5I74C 1GCFA 1ETZB 2J4WH 2DBLL 1QFWL 1V10A 3FHQA 4YWGH 3KLAA 4B9FA 1AAJA 2V9TA 2DWTA 2GABA 1MFCH 3H2WA 5H35B 4IRZH 5FO7A 5HPOA 3HE6A 3OHXB 4Z7WF 4O00A 3NZSA 3UZEA 1TQWA 5DRNA 3WU1A 4GO8A 2ENQA 5D4JA 1H3XA 2JMRA 4OGYL 4KRPD 5CEZD 3SDDD 3ARDD 3LMJH 1RKRA 1NBYB 5AW8B 3KL0A 5BMFH 2D7MA 1TQCC 2TAAA 3ZKXB 1S7SB 3MCKA 3HE6C 3MRLB 2OSWA 4JFFE 5I1IL 3NP4A 4YSOA 1WZ1L 1I1AD 4LEOA 3S7GA 2PW1A 5FGRA 1KF9B 3PFUA 5GGVY 4NPYA 1AZUA 3ROLB 3BEVB 1DN0A 3WELA 2I27N 1JOIA 2J6EH 2R0KL 4NYLB 3MLZL 2APVA 4RFOH 4OZIB 1R5VA 2C1PA 4TUJB 3SZKC 2KT6A 2E9IA 2BY0A 1F6FB 3V7AG 4PY7A 5E00B 4WV1A 3I6GB 5EN3A 5E2WL 5KSBB 4XXCA 1OAYH 3OKMA 1ILSA 2AQ1A 3ARFD 4UQ2B 4ZODA 3KWWB 5J13C 3ARGA 1WCQA 5I5IA 2IQAA 4PG2A 4PJDF 4BXVA 2EVFA 2VDKB 5CU5A 1NCOA 1RUML 3QEQA 1ZXKA 3CVHA 3PUCA 1IBYA 3QNYA 3B4NA 1MJ8L 1BD2E 4LESA 4PLKD 1KELL 1KGCE 1XXDC 2KYIA 4GG8B 4QRFA 1UXSB 1YEEH 3LIZL 1J1XL 1EO5A 1PLBA 2I26N 4LIQH 2WGXA 3VAEA 4RWYL 2OTWB 3QG6A 5C0RH 1Q4NX 4OCNC 1E65A 2VDOL 4ODSH 5L8KB 3BT2H 1CICB 4CRPA 1T0MB 5EEVA 5EBWB 5BJTA 4A38A 4EI5B 5DRXA 3EOTH 1CVRA 3AM8C 1KJVA 2Q1EA 3KLDA 4L23A 5BQ7B 3A6CH 5F6HJ 4WUKH 5C6PB 4NUQA 4M6OL 3HI1B 1BQSA 2IOOA 1JRHL 2DQCL 4AIXA 3II3A 4X99B 2DW5A 2EEBA 3DV4A 1XGRA 2KKQA 3KLHD 4HPOL 3OPUA 2DQCH 1Q0XL 3CN0A 4E5XB 1MW1A 2NY5C 1E4XL 4S0SD 4X7TA 2GEEA 3I6KA 3AAZA 5AVZB 1AHWA 2F54A 3ZMRA 3US1A 3T2QA 1SBSH 3V4VA 5KSUB 4OLXH 3FONB 1W8OA 2MIZA 4PLJD 1BLNB 1S9YB 1FI8C 4WTQA 3OHXA 4AITA 3VGEA 3RA7H 3U25A 3MROB 1IGML 1M71B 1QUNB 1R3JB 1ITCA 2HYMA 2XUWA 1C5CH 4WI3A 1SJMA 5TPWH 3VDBA 4NHUB 2V7HB 2WMPA 1EWHA 4QOKD 1GGBH 1KXHA 2PN5A 4XCCL 1PCSA 1XL6A 1G84A 3ULUL 1TTCA 3KJ4C 3RI5F 1LNUB 3DGGA 1KCRL 4R8WH 3PDGA 2AXHA 4U6YA 5EDSA 5D2NB 2DRUA 2LW3A 1CCZA 5I5MA 3DDFA 4XPTL 3MRHA 3OHXC 4NENA 2DJSA 4FERA 3UYOD 4C54A 5DEGA 3FTUA 4W6XB 5E8NB 8PAZA 4A7SA 3EJZC 2E7LC 2W9EH 3PPEA 5T8IA 1KC5L 5I0VA 5J1SC 2JJSA 4UU9B 1MCHA 1GGBL 2AXGB 5ALBH 2C3WA 1ZTXE 5GGSA 3WKMH 2VXSH 1JK8B 4U1SB 1K2DA 5I66A 2CNZA 4FFWD 5IHHA 4KO6A 3CHOA 3RWGA 2CBQA 2HPTA 3ECWA 5IVXB 2JELL 3GLAA 4DP6X 3KMDA 4JANA 2LR4A 3TU6A 4ZOCA 4AV4A 4RFNC 2I07B 4MKMA 3MKKA 3MOBH 3WHE0 3S35L 2CG9X 3ARGD 1Z3GL 2R7EB 3SZ6A 4PCYA 4MMZC 2ISDA 1BXXA 4ATTA 1FYTB 1U8CB 2BS8A 2OMZA 5C2BL 1A7QH 3THMH 4O51A 4M48L 2AERT 4HH8A 1FN4B 5F3BA 3FUKA 4L8CA 3L1OL 2XTJD 2J1YA 2WQAA 4XH2A 3U1SL 3HTLX 1M1XB 3GMNA 1GY1A 1PBYA 1XCXA 1E8YA 4PJBB 5J13B 2BDNL 2COVD 4ONHB 1PPIA 2N0KA 2LU5A 4DGVL 1N8OE 3H0TB 1G7HB 3BUIA 5F0MB 2DYPD 1S9XB 5C0AA 2EH7H 3RX7A 3VJ6A 4APXB 2YKLL 4J4PC 1F86A 2G60H 1OO2A 1WTGT 3F64A 3EO9L 4P9ML 4NC0B 3V4LA 3KPQA 2B3IA 4UDTA 5T1DL 1SLVA 4HWEH 4Q56A 3KL5A 1H3PL 2VDQH 2CHDA 4ZMNA 3F04A 4LVNB 3GRWH 2H0FA 4HWEL 3HHRB 1RMFH 3KVQA 1X5KA 4KI5D 3WHXB 4N2NA 3GMOB 4G80A 3ZE2E 4W4NA 4WW2C 4XRCA 4OZIE 3IMSA 4KVCL 4XN5A 5F97E 2DJMA 1V7ML 2ESVD 2F54B 4PJ5E 4Y7MA 3U0TB 2F8VA 1XFPA 4WAFA 1R33A 1OAQL 1Y18B 1TSHA 3P30L 3IRCA 2V9UA 3MLSH 2BDNH 1F42A 4MQXD 2J8OA 1QZNA 1U8PA 4H8VA 4I0PB 3MUY1 3HCVB 4JDTL 4WK4B 2P7TB 1KJ2H 2PCFB 1FNGA 2W65B 1IAIH 1NPNA 3MV8E 5EOQH 5AYUH 4EI5A 3ARYA 2HA1A 3V0WL 1TKWA 4HKBB 3UAEA 3UYRL 4LASH 4MMXA 3B1TA 3A6OA 5CZXC 5E8PB 3ML9A 5GRVK 3QZBA 5EORL 1WFJA 3VXTB 2WTPA 2X4QA 3EZJB 4X7CC 4Z7UB 3E9TA 4NZUH 4R4BA 3TA4D 5E2UH 3WSQL 1BD2D 1S78D 3BN9C 32C2B 4ZUVA 1UM5L 2AQRA 1A1MA 3KM1A 1KBVA 4ODTH 5CIPA 2NY1C 5DDHB 4M5ZL 5TD4A 2EDWA 2HLFC 2WOYA 4FQ2H 5KYUA 4RLDA 1HOCA 1TG8A 2GCYB 1S7UA 3D39D 3I2CH 4I18A 4P3CL 2J71A 5HHME 1G6RA 3W82A 5D1QA 4PFEA 1OZUA 1H5BC 2WXFA 1J9SA 2FSEA 3D69A 4TF4A 3TOPA 5D7LD 1R3KA 4PUBH 4OV6F 4KRPC 5GSVB 3V6FB 3MLVL 4GOSA 5FWRA 2Y1YA 2YARA 4J8RB 4RRPG 2WVUA 4GQRA 1KTKE 4JANB 2HTKD 5FM8A 1GKOA 1UZ8B 1MCOH 4PCTA 4UAOB 3P3SA 5D8JH 1E2ZA 1P1VA 2C34A 4ZO7A 2BWIA 3T2OA 3ZT5A 3Q0HA 3Q9QA 5DJYA 1EXUB 4IEFB 2BNRB 4ICXA 4JFFD 4Q52A 1BAFL 3ATBA 1JPGB 2WYHA 3K46A 4HVBA 2D9QB 4MD4A 3S2CA 2VYRE 5D6CB 3N9GL 2AEOA 4WFHD 2C4XA 3HZYB 4PJCE 1TTBA 4GRMA 5KANG 5I75B 3Q3GB 2H41A 3NIDB 1SDDB 3F7YB 4MA3B 4R26H 2DYRB 1MELA 2FD6L 4YNYB 5BV7B 2B59A 4LCCB 4MJ5A 3T0AA 4HUVA 3CG8A 3CDFA 2RJMA 2JXMA 3MSPA 3WEMA 4DFHA 3DRQA 1VPOH 3QJSB 1EQWA 1JNNH 1T21B 2C3VA 4M00A 4E9LA 3R18A 5CLZA 3KPSB 5GGQL 2CR0A 5E6YA 3N0PB 4ERSH 5BW7A 2XV2A 4ZNEE 2MCPH 3O3EB 3OKKB 5D71H 3ZSSA 2I9TB 2WINB 4LLMA 1FIGH 1OEZW 3L4UA 4Y4HA 2X53A 43C9A 2R4SH 1FGVL 2XWXA 3ZHLA 4FCAA 1J11A 4Y8DC 1H8OA 1DBJL 3TA3A 3TV3H 4BHUI 5FKAB 3JV0A 3SDCD 1MFBL 4JQVC 4LVEA 1JD7A 3L54A 2OQJA 4X8XA 3DV6A 3MRCA 4F8LA 2YSSB 3LRSA 4Y16A 1AGFA 2XG4B 1WUZA 3OJDB 4N20A 4HUUB 4X0KB 5H2BB 3INOA 4LSUL 4WVRA 4XAKD 3UDWC 4UTAL 1ZT4B 3OSVA 5C0JA 3MA9H 1B4TA 4HMEA 4MAYA 3G5ZB 3OAUH 1A7RL 2PCPA 2H3KA 4ZFFA 4E0RB 4YOKA 5B7MA 5DVKA 2DQJH 4YSUA 2YMXH 1JHTA 2TRHA 4QT5B 5DYOA 4M7JH 3N2JA 1MFBH 3HZMA 4ZD3L 1QLFA 2BOCA 4YHPB 5IVNA 3WHXA 1EJ6A 2X6UA 4X6FB 4IJTA 3WIHH 5E5UB 3QCVL 3C5ZC 4IBVA 3ZDXF 3C09B 1KCBA 2Y6TE 3D0LA 1J9CT 3GKWL 1RP9A 2Y07H 1QTSA 4FQ1H 5DJAA 2RCSL 2H3XC 1R17A 4L5FE 1JGIA 3VB8A 4URTB 3ZYIA 1RZGA 4HCGA 1QLEL 3SDCA 2AKRB 3AAZB 3MGOA 1WT5A 3EYQD 1AR1D 3S0PA 4G7SB 3MLPA 3LKNA 1AGDA 2APTA 3DX8B 1SYVB 2MCMA 3NA9L 2ED9A 5IBTH 2ZUTA 2VZSA 2QBWA 5CCJA 1VA9A 5HDQL 1R3LB 3BW9B 4I89A 3EYUL 2HVKB 4ZQKB 4B0MB 2RCSH 7TAAA 4WJG3 3VXUD 3GMQA 4DK3A 1VCAA 2BRRL 3MRQB 4WO4A 1KSRA 3SOBL 1CZ8L 2E56A 2G75A 1L9MA 4R0LA 4J12A 2A9MH 4KDVA 4ZNCD 2AK4E 3G5YB 1EHAA 3N1QC 4K71B 5GJSH 4I77H 3KPOA 4ZUUA 1HJCA 1BZ9A 2FB4L 2R69L 3D2UB 4IIQC 4P4KD 2AXFB 2YLHA 3CBRA 1EXHA 3FU6A 2ZZUT 1QI3A 1JCKA 5D1QB 1JXJA 1DVFB 1XWVA 2XPGB 4MDIB 5FWQA 3ECBB 2PUQT 1UUSA 5DVMA 4QTIH 3INUL 4QJ3B 3RL1A 2IH8A 3FPYA 3ARGC 4G1EB 4LSVH 5KUMA 3RU8L 1U8MA 2DLEA 4NKOA 1H3WM 2CKBB 2FRGP 2PPEA 4I9WE 4M61B 3BUPA 1FGVH 5K9KA 2Z8RA 4UYPA 4AQ8A 2M26A 5L88H 2CM5A 2IDQA 3NSCA 1L6ZA 4E9WA 1CDHA 3L1GA 3DJSA 1P84J 4P5KB 1B0GB 3DTXB 3PNRB 5TDPB 3T4AB 3S36H 2CHXA 3GGWA 3U7WL 3W57A 1EGJL 3UJIH 1DLFH 3EYOA 2XOTA 3GYRA 3ZTJH 4ECNA 4WSJA 1G1OA 3C6SB 3KYNB 2AV7A 3DOIA 2EE9A 5E9DA 4GG6E 1XHHA 1HFUA 3UFIA 3Q9PA 2BOBB 3LZQA 3IYLW 2IPTH 3ZYZA 1MFEL 2FATH 3H9YA 4WW1A 1GY2A 4K5MA 3Q6GH 3SYQA 4MNHA 2K7PA 4IKJA 2VAJA 4G1MA 1IM9B 4QI3A 3KPSE 3V95A 3RY6A 3DHMA 1U4FA 4EDWH 1G6VK 4PSRA 1Q0YH 3P2BA 3UC0L 4B5EA 2OYKA 3RI5K 3EJQA 2ATAA 3SJVD 1BQ5A 4DPAX 3VU2A 3CQFA 1PYWA 2A6KB 4NJAL 4PR5B 5DUPL 5FYKE 5EN2B 3UXFA 2B2XH 5ETUB 4CMMA 3HI6L 4LP8A 5L4FA 2XQYG 3LN4B 1NLBL 3UJTH 4I4WA 1GMIA 5H94B 3ARDB 1U91B 5IMLA 5JZ7C 1I1RA 4X9BA 1HL9A 3WO4C 3WAJA 4H25A 4M8VA 3FTWA 2YBRB 3MRPB 4ZTPH 5EU6A 2C7FA 5E8DL 2DQDH 5KAQF 3D0AA 4U3HA 3DVIA 3T2LA 1ZT4A 2VWEC 2D0HA 1AGDB 4HZAA 3RNKA 1J5DA 4GSXA 3QEUA 2PCPB 3BQVA 4PLOB 4RGOH 3VACA 5IIEA 3KWTA 4KJQD 2AJUH 4M5YL 1N59B 2NW2A 2ENPA 2J1XA 4L4VA 2PCXA 4UQEA 1KIRB 1X5ZA 4KVNH 2YAOA 4UNUA 1G1KA 4OD1H 5FV1L 2YO3A 7PCYA 1I9JH 3MUZ1 3FTYA 4NZFA 2CPUA 2QHLA 3FCUB 2XTJC 3N40P 5TTRA 1RSFA 3AB0B 4H8PA 1JZGA 3BISA 4OGXH 1OANA 1ITBB 2AJXH 4OLVH 1SY6H 4IEFA 3EOBB 3UMTA 2NX5D 5SV3A 3LPGA 4EKJA 4Y4KB 4WEEA 3A67L 4BRJA 3WXWL 5TE6H 1N8ZB 3ZKXC 4F7PB 1FZOB 2IGFH 1IKFH 3ZJAA 3RURA 1OE3A 5FOBA 5AKVA 1DN0B 1FDLL 4G6JH 4EN3B 3CSGA 1EX0A 3OG4B 4FQXD 4F2EA 4J8QA 3LKOA 5TFSL 1HHKB 1WBXA 3QNZA 5SX4H 3ZDZF 4HUVB 1URLA 2VLRA 3CWGA 1FH5L 2EKSB 4N0YH 2DM4A 1U95A 2NX5E 2W81C 4MA1C 5D1QC 2VDKL 5BZXA 3F2LA 5IMKB 1T6BX 1NGXA 2M8XA 2WTRA 3BP7A 2NXZB 3C6LD 5L2KE 2OCFD 5DJDB 1KIUB 3ABGA 5T1DH 1ZHBA 4GKNB 2N1KA 3CSYB 4JN1H 2XIDA 2V37A 4PJIA 1IL1A 1EXUA 1SVCP 4DOHE 3LNDA 5FF6B 3HG3A 3RPIB 1DVFA 3O4OB 5B3JE 2H6PA 3D1MC 4N25A 2V3FA 5C3IA 4YZFF 2VIRB 3EH4B 5FIEA 4Z7VE 1GW6A 5F7LB 4RIRB 4XMUA 2I5YH 4NNYB 1NANH 3FQ2A 4IM8A 4I2XE 1EHLH 3WMPA 4N8VG 3N85H 5HJDA 1AGFB 2XG4A 3OJDA 5F9DC 1F3DJ 1QNZL 1QMUA 3FT3A 1OGPA 5C0JB 1GH7A 3THML 3QDGB 4EUPB 3EDDA 3M17A 3STZA 2ZCHH 1YEDB 1SXZA 3BIKA 3O41B 3UPRA 2ZXGA 3L5HA 4TRPL 5MERB 1U6AL 3V9CA 1E6OH 2MOVA 4HMDA 3ATFA 4EI5C 2ZONA 1E3FA 1HHGB 1QUPA 1P2CA 3DMMB 4Y5XA 1DUYB 2BOCB 4NZJA 4YHPA 5B8CC 1VFUA 4IBUA 2EYSA 3VRIA 2MOQA 2ZUWA 3MV9B 4LLVA 2H9GB 3MLRH 4K4KA 2PO6D 1FZJA 1XH3A 2DMHA 3QDGE 4IMKA 4JRYA 3N1MC 1RPQA 1WISA 3BGAA 3B3IA 1MAJA 3PHAA 5HD8D 4DKEH 1P7BA 3ZE2B 1OAQH 4KK5C 2D7TL 4LKXA 1QTYT 3DIVA 1JPSL 1ZLWH 5IFJB 4OIBA 4ICWA 4FX5A 4Q9RL 2BSRB 4OZFG 2VXSL 2YKKA 4HAGA 4R7DA 5I0YA 1BJ8A 3ILDA 5DS8A 1T1WA 4Z76A 1OAXH 3VM5A 1E27B 1OP4A 6CGTA 2GBVA 4XCCH 1PZDA 3QNXA 4ESKA 2BZDA 5C09A 3BAKA 3IDIB 5F1NB 3TCLB 4X9YA 1E9PA 4S2SA 2BCKB 3CUPA 2YBRA 1MCOL 4LOUC 4BKLB 3W2DL 4OZHA 5HVWA 4XCEB 1RJCA 3ESPA 3OBAA 4P4KA 2JJWA 1NUDA 5FHBL 1CD9B 2XTJB 3X12B 4TN9A 3AB0C 3LNIA 5LBVA 4K07A 2Y7SA 4GYBA 1J5OL 1TEGA 3DVNB 3STBA 5SWZA 2Z92B 3L6FB 2EXYC 4R9HA 4BELD 5I0DA 3QUGA 3FH7A 4M4PA 5DJCA 4DETA 5FKPA 4DK6A 4ZMLA 2WLNA 4DEPB 1LHZA 4ILDA 4JO1H 5CFHA 1DSFH 1NAKL 1XGTB 2B20A 3BZ5A 4GNKB 2XWTA 1C08A 4X4KA 2UY6A 4TPRL 3ZUNC 2B1AH 3RY4A 3ZGIA 3U30B 1E9QA 1YPZA 2A9CA 2WNXA 2WLIB 3CFQA 3CNKA 5CZVL 2MNUA 4P06A 5DD1L 6TAAA 1BZ7B 5ECJE 3VQ2C 3M1OA 2NY0C 5DEJA 2F19H 1B4JH 4I3SH 1DQKA 2ARJB 2NY7H 3QUZD 4U1GC 2PP8A 5DURB 4P48A 3EYVA 3TYGL 1HEZA 3KPMB 1AACA 3VWKB 2XPGA 4Y4HC 2NY4D 3IPFA 1TYEB 5IQ9A 4B9ZA 3TN0A 3V5KA 2WVSA 4KV5E 4P5MB 1DVXA 5HJBA 3BP7B 4LT7A 2VRQA 1OVZA 3GJFA 5TE7L 5K9KB 1BGXL 2JB5L 3MA7B 5I9QB 5MEOB 1JVKA 3CFNA 4L4TB 4M4RA 4H8WC 4XRCB 1GSKA 2C3GA 1C16B 3MCG1 3MV9A 4DOHB 2WBJB 4U6HB 5JOEA 2CBPA 1FPTH 2B14A 4O2EA 5T5NG 2H6PB 3QS2A 3X1EA 3LB6D 5TJWK 4MQ7B 3W39A 2L0DA 3T0XA 5BZZA 4EBQL 4OLUH 5BXFA 3ILPA 2FNBA 4UUJA 5DEZA 1UACH 3T2NL 5CCKH 1JGDA 1PX4A 1F2XK 1KXQE 1X9UA 4KROB 4L05A 1BCIA 4TQ8A 1P7HL 3J2PA 4FQIH 2HRHA 5BRZD 3SEPA 1B3IA 2CK0H 3FT3B 4O9HH 5HGDA 1DLFL 3QZLA 1BVNP 1NCGA 2CU9A 3BH4A 2WQSA 4HC1L 4EUPH 1U8LA 1OK8A 5GS3A 5JPMC 5TK2A 5FR3A 4X2UA 4LCYB 1RZIB 4GKZA 4HKZB 5KS9E 3OPZL 1ETB1 3VB9A 3KDMB 1Z2KA 2CNYA 3LQAH 4OCLC 4ZW5A 5EB9A 1T5KA 3PJSA 2ZCLH 2F58L 3FRPB 3GKZA 4PJDB 4LBAA 4KQ3L 3V4UH 3PAYA 3BUQA 1SXBA 4DVBB 1F41A 5IUCA 1YO4A 5DZOA 5EU6B 4TNWF 3WMSA 3OZ9L 2WJ7A 5IP4A 3JV6A 1I4FB 3QIUB 3UTOA 4ABQA 1AR1B 4IBZA 3WN5C 3LEVL 1BQHA 5DI8A 1TZ8A 3O3AB 2W0LA 4ZOEA 5BUPA 4ZDHA 2V17H 4F2MA 1HL8A 3H9SE 2L7UA 3VXSE 1NGXB 2WTRB 3B34A 1M7IA 4HUWA 3TZVC 1J12A 4DP5X 1IGTB 2FBJL 3DSFL 1MRCH 3MV7D 4Z1PA 2DEWX 3V7MA 2VUYA 3DX4A 3NA9H 1EEQA 1P1ZA 4KOBA 5F44A 5MHSE 2IFFL 5C9JB 5IJVA 1T5XB 3EYVB 1KUMA 3QUYD 1W6LA 3QEGH 1IJNA 3QUMH 3BVXA 3ZQWA 4GUQA 4LCVA 1DVZA 1JNHA 2JI2A 3NZHH 2ZE0A 1KY6A 5HYIA 3WLWC 1DE4B 2AXGA 4HIIA 4FQPA 1EGJH 4R84A 2Y9RT 2NY0B 2IAMD 1K2DB 2EDFA 3EADA 5EFIB 4NQEA 1YRKA 2Z4QA 1S7XA 4X98B 3CVBA 1VF5C 5E2JA 1KPRB 1B0RB 1N10A 1RZ8B 2FHCA 2IMNA 3PHOB 4LQFL 1CT8B 1NDTA 2C9VA 1IKNA 3UTQB 3ZYOA 4LLDA 4QHPA 1RZQA 2HVBA 4S1SH 5TF1L 1NFKA 1M7UA 1GIGL 2GG1A 2KLTA 5EUOA 5DD0H 1H6FA 2BRQA 2CJUL 2UXTA 3IJYA 5FKAA 1PKOA 1JERA 2WVVA 3BWUC 3RUGF 1B9ZA 2DV6A 1XH1A 3STLB 3LRSB 4M8UA 2WBWB 4Y16B 2Q8BH 1UCBL 4MWFB 4HW6A 5I8EB 3T3PF 3EHBC 3MAWA 5IV2B 3FL7A 1A65A 1EAOA 1XH3B 3EYFA 4WHYG 1SPDA 3PWPA 1KELH 1N7MH 1IX2A 4RBPK 3HC3L 4I3GA 1AQDA 3NFSH 1GIGH 3BYYA 2ICEA 2G4GA 3PIQB 4Z7NB 3W0WB 1SJEA 4ANUA 1RUMH 1P9MA 3NJJA 1JZ5A 4FE9A 4JFTA 5DUJA 3CCHB 1YYMH 1GGYA 1OGAD 1QO3B 3ECVA 1GL4B 5J06A 4PLKC 4Z76B 4Q8BA 3BE1H 5FM4A 4K8RH 5AOZA 1I7ZB 5DZPA 1KTCA 2YXFA 2PXYB 4KKNA 1VDGA 4HBCH 4ANKA 2AJVH 2EIZA 3TESA 4Z78B 3SIKA 3ZKSD 1TQCB 3WFEH 1SUHA 1VADA 3TYFA 1K4DA 2Y72A 4PJEE 2AQSA 5T33L 4IRSC 2ODIA 2P45B 5SWSE 1FZJB 3HB3D 2AJZA 4GSRA 1OALA 3W3BA 1GYUA 5A6IA 3FO2A 1GYCA 4YFDB 3WCYA 4DQAA 2YXMA 4H5SB 3EOAA 4ZDHB 2FZ3A 2AJ3A 4AL8C 3CDYA 1NC2D 1DQLL 4M5YH 2NQDA 3RU8H 2NDFA 1GAFL 2B4CL 2XBTA 1TTUA 4XNZB 1HSAB 3RJOA 3OD3A 4B95C 1QRND 3NCCB 4HHWA 4FZEH 4I3RH 3ETBJ 1J1PH 3GXMA 3HS9A 2RIKA 1QAWA 2C3HA 3QJHA 1A6WL 2V4LA 4GSDH 4QKXB 3F58H 2EXYD 2J3SA 3SPVB 1RZKC 2FB4H 2R69H 5F70A 3F58L 3MA9L 1FA4A 1XR8A 1K4CA 5DDHA 4RAVB 2ZWYA 4IIQB 5GRVL 1GPOH 4YHKH 3U4KA 1R4XA 1DVFC 3WBDA 2YD9A 2JKIS 2YUWA 3EJPA 4OD3L 4N85A 1SZNA 4LSPH 3RWDB 3WNKA 4P2QA 4TSCH 3QZOA 4X98A 3CZGA 4P4KC 3GK8L 5IB2B 1S8DB 4ALAC 3UAJA 3DIDA 5T5FL 3V5KB 1HEHC 3K2IA 3LH2H 3FO0H 4UINL 1GJWA 5F9WB 2QVTA 3HNVH 4YZWA 4HALA 1S3KH 4W9IC 3JT2A 1E4JA 2AI0H 1O6VA 1IRAY 2V5MA 2ZXWB 2WNWA 4XN2A 4PJAF 5F7EL 5EOQL 4WJ5B 3X13A 5SWZD 2ERJB 4NP4H 5IJVB 2QZ5A 4Z0XB 2H2PC 3T4AC 3RJDA 1EJFA 4P99A 3Q5OA 5K9QI 2VW7A 2VDRH 3JWOH 4HDIA 5J3HC 4ONGL 4JM2C 1AMYA 4NGHH 1BMZA 1CN4A 3KXFE 5D4IA 5IB1A 2NR6C 4M43L 1A14L 3OLGA 3RIKA 2IH9A 2J56A 2ZNWA 4AOFA 2BXZA 3MYJA 4X8CA 3AG3B 2EICA 4IMKC 2QGEA 1BHGA 3VWJD 4HKXA 1A8JH 1UXLA 4K9JA 4LHUA 1RV6X 1XBDA 3QHFL 4PP2B 4XGZB 4AXWB 5JIIA 1FNSH 3EHBB 1AR2A 2BZCA 2R2BB 1NC2A 2YQBA 1Q9KA 5C0BD 7FABL 5CSBA 4UBDD 1BDYA 1RFDL 1RZJH 3ZL4H 3MRKB 5FDYA 2EO9A 1NGQL 3D0VB 1HHIB 1IIKA 3I3BA 3ABZA 3LN4A 2KZKA 4O5LH 2BSSA 3VGDA 2X88A 4R97B 4ENZA 4CU7A 1AGCB 2DM7A 1OW0A 3V7AE 1AJ7L 3LKQB 5FA4B 4B5ZA 3TBBA 1X7QB 2R2CA 4U6XB 1B88A 3BSGA 1A25A 1QYGH 3JV4A 3NT0A 4HHGA 4KMLB 4OCXL 5ERWA 3U1SH 3TIEB 1JP5A 4NQDE 3VFWB 1ZEAH 3TWCH 3QUKA 5GRUH 5C0CA 1IGIH 1U42A 4WK0B 1FL3B 4AIEA 1CURA 2OQJB 1COBA 4LNRB 3ZKMC 1N6QH 2AJ3B 4UT6A 1BF2A 3TBVA 1A9BB 5J6GA 3LXBA 5HPMA 3DURA 4PD4K 3WKQA 2X9YA 3ZPDA 3CCHA 1D5IL 1FG2A 1KN2H 5B1BB 4AI7A 2J7LA 5FLVA 4KKBC 3ULUE 3H4HA 2Y7OA 4FQIL 1SHSA 3HC0B 3JYBA 3KCWA 3ULVD 4KHXL 3L8QA 2YPLA 2CHZA 2EDJA 2NR6D 5T33H 3TL5A 5I18H 5DHVA 3G04A 3EGDA 3P77A 2CA3A 4NQCD 4K8RD 1D6EA 1VPOL 3R7QA 2NY4C 2IDSA 4UNTA 4HU2A 4P59L 3K3QA 3ARVA 4APQA 3I6KB 3DSNA 2H1PH 3GK8H 3PL6C 2FGZA 1AY1L 1BMGA 3MLSL 3LPWA 2A4EA 4QXTB 4GAAA 5FM5O 4D8PA 2D4DA 1IT9H 1YLBB 5E56A 3LSOB 3S36X 1QHQA 2YD7A 1PZAA 2V2XB 4KFMA 1NM4A 4PJCB 5ITFB 4B9PA 1J8RA 3WIIH 1CUOA 5D7SL 1I4FA 3QIUA 2F8XC 4HJ1A 4V11A 1OGTA 5CZKA 1BQHB 1R3KB 2VDML 4KAQH 5ALCH 3QWQB 1L9NA 5CKAA 3MZTA 4GFXA 5D55A 4KKQA 3TYGH 3E80A 1FNEB 5D2NE 4FJ6A 3V0EA 3ARFA 4UTAH 2Y5EA 2OZ4H 1WF5A 5LXVA 4HIXL 4LVNC 2O5XL 4BZ2A 4YL4A 1JHLL 3ZHKA 4A6YA 2WIMA 1F97A 2PW2B 4O2CA 4Z3FA 1AG0A 4P23A 2QV2A 4XOCA 4CC1A 2HTKC 2OMWB 2YAHA 4BK5C 4J3OC 2JIXA 3RDTC 4A7VA 4I85A 1VGEL 3KPPA 2PPCA 4R4NC 2NNCA 4WWKB 1GSMA 4BGLA 4Z6AT 2W95A 5FYJE 4MZRA 4AUYA 3VGGA 3C5ZD 2ERJC 4OCSH 1BBDH 1U95B 4C4UA 1MWAH 2D3VA 1A3ZA 4TVPE 5HYFA 1DSWA 2BVTA 3B8YA 3U36B 3NJNA 3VXQB 4W9KC 1FFNA 3FUFA 1MNNA 4N2LA 4C83A 5CLWA 2OULB 4PJ8B 3CDZB 4L18A 2DLTA 2FL5A 2ZP8A 4LASL 1SLWA 3EFDL 2YD8A 5KYXB 1CLVA 3KHOA 4JX0A 4YBLC 5D93B 2RFXB 3BP5B 4PJAB 5I15L 4KVCH 3W0WE 1HC1A 2HG5B 1E4HA 3CVHB 3NIFB 2H47C 1XF5A 3MRMB 5CM1A 3MN8A 3FSAA 3O0RH 1KIPB 3AXLB 2W1NA 2WKOF 3T8MA 1YEKH 2AP2A 2ILLA 3STLA 2Q76B 3JBG7 4WUUB 3SKMB 5HPMB 4P4RA 4QRQA 3MX0A 1H5BB 4JN2A 4OR1A 4XNXL 4HS8L 4MAUH 1HI6A 4JDVB 3CZJA 4JN1L 4OKDA 3KE0A 4TSAL 1OHZA 2ICEB 3PIQA 3R19A 5HHMD 4B96A 3K80A 3O2DA 4Z77B 3KPTA 4W9GC 4X6CE 2OW6A 1T03L 3OZ9H 3CFBA 3DVGA 5HHVL 4A2GA 1QHPA 1YJDC 3LKQA 1F45A 4JPKH 4P3CH 4QD2E 3CUPB 2IH3A 4HHAA 3TTSA 2VGLM 2XFXA 3IEAA 1HDMA 4P04A 2H9GA 5KANI 2VMFA 2H4EA 4DKAA 4U1NA 5FYJD 1E28A 1V3LA 3PDOB 5DD3L 3WTTA 4S0HA 1ZA3A 3JTTA 4Q74A 4R0LC 5GS2H 4V33A 1NAML 3NK3A 3P2DA 1J9RA 3K6OA 4JG5A 4P8QA 4TPRH 1MI5B 4F58H 2D8KA 2G0LA 2NTFA 5EORH 3PFQA 2XYCA 4PN6A 3B9EA 4OFYA 4Z7IA 1N26A 3KPLA 4Z5RA 3V4PH 2QPDB 1BOGB 5IBUB 1W80A 5EIIA 4OSUL 5IQNA 3HC0A 4CMHB 1L9RA 1RUPH 5DUBA 3NQKA 4GQ9H 3TO4C 1Q72L 5EC1B 1MRCL 3C5JB 3SJVB 3HE6B 2ICCA 2W59A 4NSKB 4XNAA 2L7EA 3DMMD 4LCWE 1MCWM 2YD5A 1ACCA 5AOMA 3OKDA 1I9RH 5I1DB 5D7IF 2X4TB 1JGEA 2FO8A 3Q2LA 4PV8B 1IEBA 4HIEB 4Q4EA 3FB7A 4M7LL 2K70A 2HPOA 3BKCH 2OA9A 4MZ2A 1R46A 2D0GA 3QC5X 2VMEA 1SMOA 4Y1TA 1U8IA 5DA4A 3V0JA 5IB1B 4XN7A 3BLPX 5EOTB 1FUNA 5FGCE 4ZPVB 3B2UD 3QFJE 2BNRD 4D9QD 4A2MA 3JWNE 2APBA 4I1PA 3EGSB 3B7TA 3BVNB 1YN7B 1XGQA 2AZAA 3OR6A 1P4UA 4N1HB 3AU1A 4O4YL 3WUWG 4WWKC 1CGTA 4JBSA 3US0A 3VFTA 1KDIA 4W9HC 2VLJE 3F84A 3WL9A 4PW3A 3O2WH 1ZLSH 2J8UF 3TA3D 1UUNA 4FP8L 2BY1A 1EANA 1YSOA 5FUZL 1JYXA 1M2VB 4RFOL 4J3WA 4IIZA 3QEQD 5E0QA 4P5KA 3BUDA 5AB2A 5BO1H 1N18A 5KSBE 1JV2B 5DLLA 4GAYA 3UG4A 1DQQB 1P0SE 4HKJB 1M1XA 3GMNB 5I6MA 1H9VA 1HI6B 3KPRE 4JDVA 4YBLB 4EAEA 4FQXB 5L6YH 4GW1A 4X4ZA 1JXFA 4GW5A 2IV9A 4HGWB 3KM2A 3FQYA 3LKPA 5BMFL 1OCRB 3BPNB 3SDXE 3DGCR 5JQIB 4LLAA 1X6LA 2A0LC 2DKMA 2YEZA 3PQYA 3DX6B 4XCNB 1T7YA 3FT9A 1KZYA 3KPQB 3F7VB 2MTPA 4WUUE 1YEEL 2R2BA 1T0MA 3WNMA 3AITA 5JDSA 5L9DL 2AW2A 3SKUD 5AZEH 3D18A 3HN3A 3I74A 5KVDH 3SPJA 1YC8A 3FRPA 4FNPA 1Q90A 4YHYC 4HC1A 4K3JH 2J21A 2VDOH 3NIFE 1PEZA 4ODSL 4TL5A 3ILPB 4UUJB 1YJDL 3MJ6A 1ZLVH 1M3JA 3V10A 1H3UA 4KQ4L 3ZIYA 5ACZA 2ZXBA 1CG9A 5KZCB 2FT6A 5GGTA 1FFPB 1NBCA 1TFPA 4MCYA 4Z3HA 3ULUH 1J0YA 4JFPA 3FXIC 1D5RA 4AJYV 2VOTA 4PS8A 5BOPA 5FW8A 3F3HA 5EIVA 3TPKA 2YD6A 2AABH 2QSCL 2B0SH 4QLRA 5B4MD 1OF2A 3MXVL 3GTVA 2BZ7A 2G9HB 2HKHL 4JFYB 3MXWH 3O2VH 3WN5B 3P9MB 5LB1A 1Z9LA 3SE9L 3S37L 3TBYA 1IC4L 4PTUB 4U1IA 1UD3A 5IWLA 2VDNL 1UD5A 4PJGF 3OKDB 5I1KH 4P3WA 1AI1L 3TZVB 3MRFB 1YNKL 1G7LB 1EDYA 3ATAA 3GO1L 2J6EL 5F2FA 4CMHC 1T89C 5FUOH 4D9RD 3WFBH 1KB3A 3T0EC 4XCEA 2FJFB 1OTSC 2NY6B 1ZDQA 2V3DA 3NSXA 5DQDL 1N5AA 3SDAB 5C71A 1NCNA 2YN5A 2G0KA 4XHQA 5FYKH 4L8DA 2VQUA 3U4EA 4DW2L 5JORB 2NR6A 2DI7A 2Z92A 4NC2B 4U3SB 3QIBC 1WIUA 3QEHB 1FVCA 1T4KB 3IDMB 1UB6A 5GRUL 4H13C 3QNFA 4XMLL 4JKMA 5L4MA 2VH5H 5F93C 2RTTA 4HJTA 4QHUB 2CO1A 4EZKA 3NEEA 3MROA 2QMJA 5ITBH 3HG1A 1WZKA 3SBQA 4JFUA 3ARDC 5GJSL 1BVKA 1MRFH 4MD4B 1J1PL 3RL2B 1XD0A 1VSCA 4LSUH 4GKNA 3C08H 3PV6A 5D1XC 4JFWA 5HYSG 1Z5HA 3HBPA 2Z0UA 1O7SA 4ZMWA 2C3XA 4U6YB 1R6VA 4KKBD 2IWEA 1MUJA 1QW8A 2FT8A 2K3TA 4P23C 5GIRA 4NGHL 4BK5A 1I7RA 4Y2DC 2ADIA 5HYQA 1IUZA 3FFCE 4QTHA 1QZ1A 2ZOWA 1DZBA 5D1ZB 1CXIA 3I9GH 1JZ3A 5IUSA 4ZXBD 2DWSA 3KH4A 5KG9B 2CRIA 4HMCA 2OX5A 4H88L 3TVMD 3LV3B 4LLDB 3SPIA 2Q7YA 5KBDA 2IANE 5E1QA 3M17B 4WLCA 5AVXB 2WINA 4LLMB 2Y07L 1WZ1H 4OD2B 4JR9H 3SO5A 4NP4L 4BD4A 3QQNA 4M1CD 2AJVL 1NLDL 4HIHA 3BC9A 3LEXB 4EIUA 3MC0A 2GYSA 1MHCA 1NC4A 4CUCA 3B5TA 2OYLA 3L9RA 3C12A 3GBLA 4U49A 4N2BA 5I76A 2UZIH 5AG8A 3PL6A 1MLCB 2IBZY 2Z64C 5HYJA 2GSIA 4TSCL 1CFVH 4XMXA 4LCWD 3SY6A 3QCUL 4XPGL 2NY0D 2OZNA 2K7QA 1FIEA 4U1IB 2C9UA 3ZDXE 4N0RA 4X6EB 1KV3A 2XQ0A 5FFLA 1UWGH 1OP3H 2VRAA 4PJFE 1GGCH 2UWEF 1GGTA 2Y6SD 2ZXAA 1IM3A 3QULB 2GITA 2BERA 4BSWB 2IPUK 1O9VA 1S2EA 2WXJA 4FCHA 1XGYL 5C3LD 1F11A 2GIMA 3QXAA 4RAVA 1CE6B 3MOAL 5I0ZA 4Q58C 2FJFA 2FEDC 2ZSWA 5AW6B 3OKOB 3VXOA 2AJZB 2W0FB 4YIQA 1M4KA 3W11C 4QOKA 1A14H 4GEIA 5E5LA 2EUXA 4QNPE 4ZS7L 1FDLH 3HA0A 4R7NA 3JZYA 1E50A 5FYJL 2CJTA 3D6GA 2CLVB 3MV8A 1L6XA 4KJPD 2DWDA 4OZGF 4C56A 1IO4C 4NHCL 5JHAA 3MFFB 5EA0L 2QJDA 3FB6A 4TTDD 1IFHL 3MLYL 2PO6A 3LN5B 4PJBF 2C9RA 1M6UA 4OUUA 5TDNB 5JR1H 2QHRL 2GQHA 4HS6B 3DMMC 2BJML 2PXYD 3RBSA 2PPFA 5BV7C 1QACA 1PCXA 3C5ZA 5EU7E 4DZBA 4PB0H 2AXFA 4AQOA 1MUJB 4QRTA 5IB3A 4L8SA 3MV01 4A66A 4BA8A 5D1QE 2CCWA 1QRNA 4G5ZL 2VJ8A 3IFLL 2WQWA 4H7VA 3PLYA 3QIWC 1JYNA 1KTDA 3QH3B 5IVZA 1VEPA 2OXGB 4YUEL 2G2NA 4GI6A 2F08A 2VN4A 2ZP0T 3LCYA 1ESOA 4XBEL 5EV7A 3T08A 4DP9X 4JDEB 1T2QL 2YEVB 4IU3A 1TETL 4JMNA 2R39A 1UENA 3ESOA 3MCYA 3QEHA 3MLVH 1I1FB 1A6WH 1NGWB 2P5WE 1R3IH 4HQQL 5CZXD 5KJ4A 4JY4A 3LXCA 4P9MH 1TZHA 3BVNA 1QEWA 2R0ZL 3RIFK 1ZJAA 1KPRA 3OXSA 4OCRH 1P6FA 2X9WA 1UXWA 1BVKB 4HFUL 2APFA 3QJFB 4LLQA 1EEZB 3O3EA 2VR5A 3KXFB 3L3OA 1URIA 2F5AH 2X1XR 3OL2A 4PTTB 1NCHA 3V5DB 2QSQA 4WEMB 5ACZB 4N9GB 3O3BA 4JRWA 4PGEB 4Z95H 2WTOA 2IMMA 1MKFA 4M48H 2XXGA 3CFCL 3CC1A 2Q87A 4K5LA 2P8PA 4M8QA 1J5CA 1HQ4B 3SKOB 3O4LE 1TCMA 4G1MB 1IAIL 1SDDA 3CBJB 1RUKH 3T8VA 2CHNA 2PWFA 2WXQA 4KPHH 1AS8A 2JB6A 4L1HA 5CEXB 2DMKA 4JR9L 5DEFB 5DFVD 1HZLA 5JYMA 2X1PA 1EJ8A 4LPTA 2X09A 1CICD 5IMOB 2F53E 2NY2C 3LS4H 2C9QA 3MJWA 1NCUA 1AIZA 3MV11 3HLAA 1L6PA 4XVUD 3BHBB 1ZSDA 1RIUH 4HKZA 1ADQA 1DEEA 1H8NA 3ES6A 3LPPA 1DVTA 2BHZA 3R4RA 4MCMA 3TZVA 1CD1A 2XETA 4A6YH 4N2DA 2CO7B 3IFOA 3H7LA 5D2LB 3GIZH 2GK0B 3B7RL 3D4CA 43C9B 1TJGH 1N70A 2UY7B 3GTTA 4WF7A 4G9FB 4UQCA 4ZS6C 3W38A 2FX8H 2PYEE 1N0LB 2CHWA 1ETA1 3PRZA 4MQSB 5CN2A 5E2VH 1K5WA 3G5VB 5I71C 1C8PA 2OTWA 2W9LA 2Y3NA 1I9RL 3TP4A 3BZEA 2P5EE 3MBED 3T6WA 5JORA 4A2HA 3ARPA 4OZIF 3BI9X 3OKLA 5J1AA 3JV6B 1BQUA 1E27A 4M3JA 3K5RA 4W9DC 4X6DF 5A3IC 3QUMB 4HWZB 3L9EA 4MA8L 5C09B 4JG1L 2OL3L 4I3SL 1RUPL 4JAMA 3NDZE 3I2CL 1UH3A 5FYLH 4JPVH 4FMVA 1MFDH 2Y7QB 3ZMEA 2FWLB 4JVUA 2YPLD 5FA3B 4ODTL 5IJBC 4C8XA 1XL4A 3BQUC 1BX2A 2FWUA 1TEFA 3QW9A 1A7OL 3GS4A 2ETWA 2K45A 5CO1A 2ICES 3GS0A 1ULVA 1OTSD 1S4IA 4LL9A 25C8L 3NACH 3FOLB 2R69A 3LKOB 3DO4A 3M07A 3IDJB 3FN0H 1QFWM 3N04A 1NBQA 2AFNA 4QF1A 3UZQA 5I8OL 4L4VD 1VFMA 3GSQA 5CD5C 3V9EA 2QPUA 5KVFE 1KJ2L 3FBKA 2ADGA 5F7NC 2Y4SA 3J7HA 2G5UA 2D3JA 5KAQG 4UV7L 4EI0A 3AS3A 3O2WL 3L3DB 3APCA 2EEFA 4GO6B 3T6VA 1AFVL 1AHKA 3GF8A 5EZIH 2WCPA 4ZS6D 4G9DB 2EEXA 2AK4A 3OX8A 1HCYA 4PP1D 2WSKA 1URZA 4YDJB 1EFXB 4XWGL 4NI3A 1E8ZA 3MJ7A 4X4XA 3RWIB 4L48A 5IQOA 3EJUA 3OKMB 3MRHB 4NENB 3DYPA 2Q76A 3GZPA 1DHKA 1WO2A 5D93C 2P47B 1HEZB 1ECYA 2VIRA 4BFFA 4JFZH 1YEKL 4KC3B 5DZAA 5H8DA 3TVMC 3ZR5A 1Y6MR 4KJPC 2BIIA 2HJFB 2E7HA 4YO0B 4AYMC 3L9RB 2NY3D 3LPOA 3QI9D 1XIWA 4HF5L 1CFMA 1E5BA 4FNQA 1RVFL 2Z6FA 4PGDB 5C0AB 4G7YH 1AVAA 1O9WA 1Z9SB 3IT8D 2NX5B 2NUTB 4OFDA 4C83B 5F7MC 1MCJA 3RWHB 3O0LA 4G42B 5LBSA 3U1PA 4YS4A 3R06A 1SXSA 5IFAH 2CIIA 1S7QA 2BNQA 3AQXA 4QXUH 4MS6A 3VI4E 1S5HA 2W94A 2WP3T 5LAPA 2LGNA 5EF1A 2DI9A 1INDL 3AWGA 4X5PA 1FYTA 1U8CA 4PR5A 4JO5A 5C7XH 2WXGA 5G4NA 4ISVA 4BQ6A 3QUZA 3BCDA 1LMKA 1TENA 4TLKA 5MENB 1T80A 5IG7B 5JXED 1A4KA 2C7UB 4JZOA 1AD9B 2NUPB 3QHTC 3VFPA 4CVUA 2J6WA 4JO4L 4Y5VA 2E7DA 4BQ9A 6PCYA 4GMTL 3J27A 5AYTA 1RIVL 1SUJA 4N2CA 5FUZH 3QYNA 5GXBB 3OLDA 4M9PA 3VXRB 2V2TB 4LB8A 2BVUA 3C75A 1CFTA 5F7WC 5C0BB 3VI4F 3GWJA 4MMYA 3ZTEA 3UAJC 4JFZL 4EIBA 4YSQA 1FHGA 3FTGB 4PJ8D 4WDIA 4X9GA 1GVIA 5G2NA 3QPQC 3UZVA 3TPUA 3VX0A 1OGAE 2A1WH 3R1GH 3Q44A 5E1GA 1PD0A 2XZCH 2BP0B 3U2SA 1DO5A 3F7QA 2CO7A 3IFOB 1ZA3B 5EU6E 1YMMB 1DZ0A 2XZCL 4WWID 4XNXH 3RGVB 1ASQA 4NKQB 2P42B 4XC3L 4X80H 5BVPH 2GCYA 1M56B 1U8IB 1U8KB 3QAQA 3IS0X 3NCXA 1ORSB 3COOA 5AVSB 3RB5A 4RSYA 1JVOA 2C5DC 2NXZC 3VDCA 4IHOA 3BVWA 4KY1L 2HRLA 4NPKA 4NT6A 3VQMA 4ZYKB 1U8JB 4WW2B 1DQDH 5GSRB 3V4VB 1WGOA 3FFCD 3L4ZA 2KZBA 3WEBA 5EBGA 1BLNA 1L7IL 1IQWH 1S9YA 2IGFL 4NWUL 6FABL 2HZHA 4N0UE 4OLZL 2E9WA 2YWYA 4HX1B 5DC4B 5EBLB 3APFA 3R7RA 1LJMA 1E5CA 1WRFA 4Z8FL 5HHXH 1HH6A 1FNFA 3DHUA 4GPVA 3VMNA 1WT5C 3ZDZB 1DDTA 3ULVE 3HZYA 1PIGA 3W9DB 1D9KC 4C58B 2KUTA 3VA2C 3I3DA 5LXGL 3CHPA 2P8LA 1XBRA 1O6SA 1HHHB 3QDHA 1FLRL 3IU4H 2DKUA 3KEDA 2AJUL 1X5YA 3QZNA 4NB7A 4DHLA 3BAWA 2NX5A 2BP3A 1I1CA 4OFQA 4BKTC 2R29L 1NCIA 2DEYX 4J8RA 4JFFB 1KPUA 2LV4A 3DBXB 5JIPA 3R06B 2SEBA 4JHVA 1MRDH 4YWGL 5DFTA 1T5WA 4PG9B 5TQ2H 4L3EB 4RMTA 3ZE0F 5CU9A 3TBCA 7FABH 4NFBA 1JDAA 1F4YL 2WWKT 2CDEA 1ES0B 3DX1A 1C16A 5D7SH 4X6DE 2F74A 1W0YT 1PZ3A 1ZCRA 3FAWA 1OL0A 2JJUA 3PF2A 4NAMA 3ULAB 3HN5A 2CXGA 1HWHB 4KH9A 4HIJA 5T1LA 1RK0B 5D96B 3CHSA 4HKJA 3GMOA 2OI9B 1A3LH 4NJ9H 5J0BA 1BREA 3QQ3A 4GW4B 5D1ZI 1IL1B 5LJYH 1MCSA 1ETJA 1I8AA 1FSKC 2HXAA 3KYMA 3GI9L 2BC4A 2E9GA 5A1AA 2Z8WC 3EW3B 4AYSA 1Z5LA 5FHAH 3ML8A 4DGWC 2K78A 3V55A 1MQKH 1FZKA 4KKCD 4TVUA 1U8PB 4I0PA 1ONQA 1AO7E 2X9ZA 5ENWA 3RWCA 2V9RA 3TJPA 3TX4A 2WXHA 2YRLA 4G6KH 4FKKA 4HCRA 2P7TA 2PCFA 4V1DB 3T2PA 3UEZA 1K85A 2ZOTA 1U33A 2AV1A 2VISA 4QRUA 4P57A 2N4IA 5CJXC 1SDYA 2PXYA 3EG9A 4UCFA 3ET9F 3I50L 4HAKA 4QNPF 3Q2WA 3VWKD 5C86A 4Y1AB 5CGYD 2QDWA 1SY6L 3H2QA 4KFZC 4H44C 5ESVB 2CMRH 4DPRA 3BHBA 3CXFA 2VQ4A 5A2CA 4UM8A 3N6YA 4U0RB 1E4KA 2JELH 2ADJA 5ISZE 4B7IA 4PY8J 4JFED 3TBSA 1TMQA 4OCXH 3SYOA 4AQ1A 3C6LA 4Z7AA 4OZ4A 1MDTA 5C97A 1CFSA 1KC5H 2LLGA 3EJYC 5T5NF 3AVEA 3GMLB 5ILTL 1T1YA 2YD2A 3A0OA 1HYSD 3G5VA 1T2QH 3LHAA 4KVPA 7CGTA 2WLJA 4XB3A 4TUUA 3UYPB 3WXVL 1N4XH 1OT4A 1Z3RA 2B9BA 5GHWL 3EYSL 4O5LL 5C09E 3O6KL 1TVBB 4L9LA 3BXNA 1QLFB 5EC1A 1A6TB 4JPSA 3QXUA 4LAQH 4N9OB 3EFOA 3RGVA 3IU3B 1DCLA 3QNXB 1YPZB 2XPZA 3CLFL 2HFTA 3MCKB 5GZNC 3K8KA 4EN2A 1K8IA 3D85D 5LG6A 4NO2A 1CQYA 2JKNA 3FCBA 1IT9L 4K2UL 4DN4H 2AEQH 2XG5A 1I1YA 2A6IB 3GSUA 4XCFH 5DD5H 4CVXA 1AOZA 5EOCH 3FQWB 2FR4A 4KKAC 1OCZB 4HD9A 1HH9B 4L8DB 3U4EB 3UBHA 5H4YA 5CLXA 4PWHA 3Q3GA 1D2OA 3NIGE 4YHMH 3L7FB 2OMUA 1RHHB 2MQ3A 2XN1A 5D7JB 3CFUA 5K5YA 1FHNA 5CJ5A 5FO7B 2AJXL 3BLBA 4OLVL 3RTQB 3T04D 2KDYA 3CN3A 3NCMA 4ZX6A 2Q3XA 3QJVB 4F7CB 5DVOA 1TZIA 2GC4C 1ZEAL 4AENB 1QSED 1MHHA 1TZOA 1U6AH 2BFGA 3X3FL 1H6EA 3IVKA 1AGEB 4OZFH 3QIUD 1IBBA 5EHFA 4NIKB 2CH8A 4UNIA 2GIXA 2FYVA 2NLJA 4OD3H 3CMOL 4P5SA 3KAAA 5IROC 1F4WH 4BFOA 4K73A 3KGTA 2VZ3A 1ORQA 4E5XG 2R0ZH 2WZAA 5K9JH 2X1WL 3GHBH 3KBPA 3OKNB 4G71B 5CJQL 3NPZB 4IU2B 5HI4C 3ZL4L 3ZQ9A 2IGLA 4UF7C 4GRMB 1XR9A 2OMVA 1CBVH 4O58H 1E8WA 4IKIA 4CSPA 2GVYA 4A67A 2QEJA 1F90L 4GFTB 4I3RL 4NQCA 3E3QC 4ZUSB 3MRKA 1G9EA 5IREA 2FEJA 3MLXL 4B3EA 3D8MA 4PY7B 5E00A 3QUYB 2P24A 5JUEH 1IQDB 1IBDA 3VFGH 3MV9E 3WDIA 5DHDA 1PZ2A 1JHTB 5H94A 2AVFA 3VDAA 4A6YL 3ARGB 3RKPA 3DV4B 3NVQA 1NC4B 3BEWB 3ELQA 5BOJA 4ZW7A 5HHPB 2YPVL 3QEQB 4K9EL 3LIUA 1U8HA 4PJXB 3IGFA 3AWEA 4PRHA 1S9WA 1OK0A 3B6SB 4YGAB 3LS4L 1MLCA 4YBQD 2N7AA 2CUAA 4X50A 3CVHL 1XV8A 1E6JH 1Z5LB 5D2LF 5E6RB 1G7JA 3VTAA 4GXVH 3FOMB 5LCVH 1BSIA 4KBPA 4L9LC 4WI4A 4PP1C 4FQHA 4WKXA 4ZJ9A 1D5IH 1NIFA 5KS9A 4K7PY 1WEJH 2R0WL 1RU9L 4KDTA 4AYID 1P7KB 2YAQA 3S4SA 1V3KA 4YZFE 1PSKL 4PJ8C 1NSNL 3IDGB 1U8OB 1KXTB 4A7TA 1UEMA 4PRIB 1R5IB 4M56A 2ZAGA 4N2IA 4QT5A 5E51A 3D05A 5SX4I 4KNUA 4WO4B 4ZMXA 3JSSA 3W0WD 1I1YB 1NCAL 2A6IA 3GSUB 3O6FB 3QRGH 3QYCA 3TN0D 3EJCA 3ZR6A 3WTXA 3EUDA 4S1RL 3GHBL 4KXDA 4WO0A 1N4XL 4BWTA 2FX7H 4R3SA 3IJEB 1CL7I 5E4EC 1J0ZA 1JK8A 2KLRA 5EU3A 3GC3A 3ZLQC 2VKXA 1J0KA 4V2CB 1JUFB 2R4RH 4JCWA 1FFOA 4P5RA 3RL1B 3ZYJA 3L3JB 3OMNB 4LPCA 4BQBA 1RZGB 3ABLB 5EEZA 5DLML 1WICA 1AQKL 1FNEA 3KJ6H 3TH4T 2GHZA 5DI8B 1SYSA 3B2PA 1UJTA 4NQEB 1NWOA 2QFPA 3MV8D 4FQQB 2FNWA 1FO0H 4XO5A 2HJLB 3W1ZA 3O81A 1I8KB 1CI5A 4QAWA 2X6MA 1G9HA 2HVKA 1KB5A 2JQZA 5ICYB 2EDOA 5IBTL 2PP7A 3GMQB 4PPTA 1XH0A 4NN7C 5E2UL 4IYKA 3RVVD 1MREL 3BVUA 3DXAE 5D7LA 4DTGL 4PGEA 2E47A 1YMHA 2NZ9D 4N87A 4JGMA 1H19A 4ZAKC 3GXIA 1T1XB 1LP9F 2DF3A 4KXZI 4NCC1 5GGQH 5BO1L 4ERSL 1MPAH 1YNTF 2K4WA 3D39B 3QEGL 1TNMA 3UYRH 5CD3B 1KFAL 1NFDF 1QR4A 3TBTA 1SOQA 1VESA 1YHPA 2QQNH 3ZTJG 5D7JA 2Y7NA 3QB7C 4LOEA 2MRYA 1WBYB 4HJ0C 2ADIB 5HYQB 1QEWB 3ESUF 4Y4KC 4WWPA 3QPXL 4HK3N 1I3GH 5LO7A 1KGWA 5TE7H 3RWCB 4QGTA 1JK9A 5C09D 4WTXA 3DIFB 3GXNA 2VXUH 2EVJA 1NEZB 3R8BB 3HPLB 1EHKB 1A6VL 1J05A 3AROA 2OZ4A 5T1MA 1KEMH 1E40A 2C4FU 4RMWA 2OAAA 2HTLD 2J1KA 2HT2C 2EDTA 3K1KC 5D4QA 1OIOA 2GK0A 1DBAH 1EUUA 2NY5H 3QJUB 4U1LA 3BZFB 1LMIA 3QUYC 3TIDB 4B60A 3BKCL 4UM9B 2XU9A 4NUGH 2GJRA 3QBTB 3B3IB 4YL9A 3ZRCC 4LKXB 4XNUL 4ZUTA 2WWKO 2JB6B 1TLKA 1C7SA 1ZGLM 3Q2NA 4AG4H 1IAIM 3GMLA 4MS8D 3T8XB 5I30H 3HMXA 1CGXA 5IEHA 1ND0B 3R4DA 3T0EE 4MTMA 2YGNA 4LQFH 3TCXA 1THAA 3OPZH 1R5IA 5D7HA 4NZDA 1KJMA 3SGKA 1DUZA 1KLUB 1VCBC 2MCPL 2VLKE 3NJVA 3Q6FB 1GR7A 2QKIA 1ZS8A 4JQVA 3DMMA 1IZJA 3HNSH 2XICA 3B83A 5F7YC 1JF1A 1GZHA 1JPFA 3EJYD 3RVWD 3IWVA 3KXFD 3OZKA 4Y1AA 4OZHB 2OM5A 2F1EA 5SWSA 2A74A 3SDDA 4P4KB 6FABH 1M05B 3U48A 2FWOA 2IO5A 3BQUB 5K1NA 4HK0A 5INCA 3K6SA 3BOVA 1F4XH 4Q97A 2NTFB 3NTCL 2LE9A 5B39B 4R26L 3CC5A 3SGKC 5LGHL 4PWFA 1F6AB 3X1BA 4ODHL 5E99L 4FQ1L 5C70A 1K4DB 2CLRB 2ZOOA 4JVWA 3MXWL 4JNXA 2WXMA 4KK8C 4S11A 4BDVB 5I17A 1FNGB 3O3DB 4WI5A 2GPZA 3BCFA 2DEXX 3BPNC 3PWJA 4AGMA 1G7IB 4B50A 3NFNB 1TKWB 1M7XA 4DEUA 1MNUH 2XWTB 1SYSB 2HRGA 4Y2DA 3KCPA 4R90L 4GUOA 1UEYA 4JUSA 4FKHA 2WW8A 3K7UA 4ODVL 5L4JA 1BWWA 2D3NA 1OZTG 4M7LH 4XP1L 1EAQA 4X4XB 3RWIA 3WNLA 2CO3A 4PS4H 1ROCA 4A6YB 2F8IA 4ZUVB 1NIDA 1YJDH 1MN4A 4Q9QL 4PV8A 4BUGA 2VAAA 4U1JA 4DJMA 2ZCLL 5DC2A 2DQ6A 2I7SA 4G72B 4PUBL 4OCWL 2R0LH 4YSTA 2P1YA 2COQA 4YSSA 1KULA 1O7VA 3QJOA 4OQ1A 1N8ZA 1CDCA 3CIAA 3V0VB 1RIVH 5GSVA 2X2HA 5F0JB 1XCQB 3ARQA 1RJLB 4WO4D 3WI9A 5DJ0B 3TS8A 4M62H 4PVLA 1S7QB 3QDGD 4AUUA 4BCZA 3QNZB 1CLCA 2UY6B 2KQMA 5DJ6B 1A64A 4WI6A 3JTSB 4FXKA 2VMCA 4YLCA 5D1ZA 4XMZA 4DH2A 2I9TA 4HXAL 3REWA 1ZHLB 1EGJA 5E24E 4UT6L 3ARFC 5ICYA 2V7NB 4UOW1 3L7EB 3QDME 1MQKL 4LEBA 5E1AB 1YVLA 3OAYK 4Z8FH 1KLGB 2CD0A 3U2IA 3HRPA 4GAYB 1ZRUA 4N2FA 4DEPC 4GY4A 1I8IA 3KXFA 3C87A 3H9HA 3L3OB 3GI9H 4PJIB 4S10A 3MLWH 3EOTL 3SOTA 5CJXA 1QRKA 4PRHB 4GAJH 1IC4H 1UKTA 1Q9WA 4YDNA 4LBEB 2K6YA 5AVQB 3ULSB 3H2PA 1OY3B 5ESQA 3NCYP 3AABA 3F12B 1IU1A 1PKQA 1JVLA 3CVCA 4KK9C 3US9A 4F33B 3BPCB 1A1OA 3T0DA 1J1XH 3P0GB 4XXWA 2HFFA 2W91A 3KDPB 3QO0B 5B1KA 4HJJH 4DZ8B 4NKIL 2W9EL 3PS6A 3ZE1B 3TPUB 4X80L 4ZI8A 1EA9C 3EBAA 2OXHB 4XGZA 4AXWA 3KYKH 4X6CF 3LQAC 2XFXB 1V27A 4LRNL 4DGYH 4N2MA 2A74B 3QDAA 4QWWC 4GMTH 2Q3ZA 2JWYA 1A2YB 5CJOH 1A4KB 1Q8MA 1WFUA 2BCKA 2C7UA 5DT1L 2OTUB 1M6OA 5C8JB 2F1BA 3VRIB 4BSVB 2XT1B 3UBXA 2P3YA 1E4XI 2CAKA 3QO1A 2C26A 3REVA 2VN3A 1JI1A 2DZEA 3L5IA 4NCDA 1T20A 3L5JA 3UTSE 2KZ1B 1IAOA 3H6AA 2BFVL 1DBML 4FZ8H 4KOCA 1NCWL 5JW3H 3RFZB 3B5HA 4UM9D 5AEAA 1EDHA 3WO3B 2EDRA 5M94B 4KROC 4BH8B 2VDNH 1CQKA 5JW4N 3U6RB 5EF3A 1FVEA 2XNAA 4U6VL 3ULUD 2RB8A 1MCEA 4OI8A 2HH0L 5MENE 1JRHH 3KGSA 4G83A 4I1RA 4KK9D 3K8MA 5C9JA 3K6SB 1KJ2A 4WU5A 4L3FA 4B9JA 1S7VA 1JZFA 1WD8A 1WWBX 5EZOH 2DIBA 3RZCB 4IBYA 4BCYA 2R1XA 3LH9A 2YAMA 1UA3A 4IHOB 3UTTB 5J6HB 1NUGA 3TJEH 1UZ6F 3FSVA 1UYWH 3CLEL 4RWHA 2XWDA 5I1CH 4I48A 5EIIG 2OMXB 2WGNB 5IHBA 2RR3A 4G8GA 2JK5B 3LX9A 5C0RL 5IVZB 3HMWH 4N1EA 5F88B 2NYYC 4IBWA 3CDCA 3LIZH 3LHPH 1JPSH 4O02A 1KEGH 3O45B 1AIFB 3K4AA 1MFAL 4EIZC 2CDEB 3H3PH 2XN9D 3UC0H 1GYVA 1JFQL 2L7QA 1UZGA 3RE0A 5JOFA 3CLWA 4R2GC 2AJSL 5ES4B 4BXSV 4OJYA 4PBVC 5IHZA 2VE6B 1WFIA 1B0WA 1MFEH 2FATL 1HHJA 4J3VA 3PP4L 3DUUA 3SQOL 3TNNA 8FABB 3UBXG 3UIYA 1XB6A 1HKLH 2Q7NA 3KPSD 1LE5A 2OI9C 3D51A 3PABB 4AYBA 4OLYH 5J12C 5DJXB 4O02H 2UXFA 1RJLA 4N90D 4HGWA 1JF6A 1P4LA 3X3GH 4BWWA 5GRJH 2ZSVB 4N2GA 4NYLA 1BBDL 5DMJB 3RVUD 1PNCA 3KR3L 4P57B 5E23A 1BP3B 4YC2B 3VNZA 5CF3A 1QSFA 4OD1L 5DEFA 2HB0A 5FDWA 3EH5B 1FAIL 4XTRD 2R4RL 3OKEB 5IF0B 3Q01A 3TEUA 1LD9A 1RIHH 3SPGA 3HZMB 3ZDYE 1A02N 4A7UA 4WNJA 5I1HL 1LO5A 4ZRGA 4YGVA 2AK4D 4NWTL 1BZOA 1AXTH 1W0WB 2H2SC 4U0RC 4UQ3A 1HE8A 4BE5A 1QSVA 1Q0EA 5HHOA 5HHVH 4RAUA 2DLFL 2QGCA 4XBMA 5BXFB 2IPUG 4XPHH 3TO4B 5IEKB 2KI6A 2G3XA 3M1CA 1ZE3H 3FQRB 3UBXI 3ZUCA 5E1IA 4X5XA 4X6CA 5B7EA 1ECZA 1U93B 3LAFA 1HX0A 4LP5A 3V0DA 1IBHA 2XWCA 5AW1B 1KCRH 3O11B 5KSAA 5H37G 4MAYB 1AC0A 3MREB 4WFGE 4KNTA 4Y16C 3QULA 3L95A 1FVEB 2GTWB 1J8HE 2GJ6D 1R3LA 1RH8A 2DLFH 2NY3C 1MFMA 1R3HA 2BSEA 2ZIDA 2GSGA 2QFRA 3QI9C 4OLWL 5DHYA 5I73C 4GKLA 2IJ0C 3WLBB 4PV9B 4XX5A 1L5GA 5I15H 4GLRH 1Q94B 4U1HA 1X5GA 1RUKL 3OSKA 1T0PB 3FCSB 4PLNC 4KMTL 1L9QA 3UIZA 5J6HA 2ZYSA 5EUKA 2PCYA 3PXHA 2NQCA 5I8KH 2DBJA 3UBXB 2CKNA 4K7PL 3J07A 5KBPA 1E28B 1T5XA 1YNLH 1NAMH 4F37K 2R56H 1PW3A 4KVNL 2D73A 5D4HA 4FADA 2BHYA 3FUJA 3NJKA 3VD4A 2BVQA 3RIAK 5J5EA 3IMWA 4E42B 3Q06A 5C0DB 2Q10A 4MYWB 5D7JC 1U8MB 2AEPH 1XTMA 3TFKD 2I07A 5BZDB 4YHNB 4QHUA 4U6TA 3ME0B 3SY0B 5JHBA 1T03H 4DQOH 4Q0XH 1JDCA 2W60A 4JFHD 3IPBA 3F01A 3AU0A 3MTXA 5CGYC 3D7PA 2VXTH 1WP6A 5LGJA 4ZMAT 4L29A 2AQ2A 2V8MA 2O1AA 3MCLL 4AVHA 4RETB 1G1YA 4LMQE 3VFMA 3FCTA 3PWVB 3H9HB 5DSCB 1QTPA 4R4ND 4HQQH 4NNYA 1NH6A 1N0XL 3MRNB 1FNSL 3MRRA 1AGBA 1JRHI 5JQHC 5ESAA 3MRGB 5DD0L 1TF4A 5I71B 2VITB 5B38A 1EEUA 4KRPB 3E8UH 3C2AL 1QVOA 1MHPH 1XZWA 4MHHI 5DJZB 4F33A 2HWZL 5CGTA 3LKPB 1ZSHA 3DKHA 2J25A 1TO4A 2WLKA 3BP6B 4PRBB 3EF7A 3KNBA 3WFHB 4NUJA 3S9DB 4FG6D 2FGWL 2DTMH 5HYSB 4ZG1A 5JQ6H 2DTML 5KSBA 3WDHA 4QYOA 1CK0H 4LLVB 2YEQA 1B0GA 3DTXA 3TN0C 4D8OA 3QIBD 2VZTA 4DP0X 4LOVA 3FN3A 3SCMC 3BIBX 3NACL 2X12A 5I76B 2HLFD 2WXNA 2AV7B 5DK2A 3VD2A 3RLSA 2GBTA 4JFPB 1JYVA 3GBEA 1QSEE 3QQ9D 4TLTA 4UQBA 1DVYA 2BX5A 3LZPA 2MKLC 4HFUH 3STZB 2P24B 5AVTB 1T7WA 3BKYL 1ACZA 1D2PA 1DANU 3F7KA 4R83A 1KNOA 4IGBC 4MJ6B 4DCQA 2PYEB 4RZCA 1RZJC 3BFQG 1IGJA 2RGSA 5E4AA 4NRXB 4OLEA 2FH8A 2WQXA 1YQVL 1A7PL 2P80D 1T83C 2L3BA 4PJFF 4FFYL 2IEPA 4FDWA 1DJWA 1QFWI 3OAUL 4JCMA 1SFDA 2YMTA 1FNHA 5AZ2H 1HQRA 1Q9OA 3AS0A 4UIKH 3FMGL 1DFXA 2CR6A 3QJHB 4BFNA 1S7UB 4WO4C 4ZFQA 3WY1A 4S1RH 4U1KB 1F3JA 4HH9A 2AANA 4FTDA 2EADA 5E4IA 3ABMB 1L0YA 4EI6A 2JH2A 3T3PE 1H6UA 1JG9A 1RUQH 4XB8A 4WFGD 3MLUL 4CVZB 1JZ2A 3L13A 3LXUX 3LQAL 2A9ML 4AK2A 4DKFH 5D1XE 4YJZL 2PWHA 2DQFA 1CDIA 4KK6C 3QZWG 2EDQA 5L2KD 4IK6A 1GC1H 3FO2B 4JVPA 3ZT6A 1IAOB 1B2WH 5E8PA 2JJTC 1MCIA 3KLKA 2EXSA 3PAUA 4G9FE 2X4PA 2FZ3B 5D1XB 1AH1A 2GKIA 1QBLL 2Q8AL 1A47A 2Z1PA 1KB9J 3B2VL 3IDMA 4KKLD 1D6EB 5I1JL 4P23B 5CP3H 1D5BB 3FU5A 5FFOA 2FO4A 3BVTA 1Y1UA 2XQBL 3L2MA 4G7VH 3DSFH 2FO1A 1NFDA 1OP3K 2Z65C 1MLBA 4KUCF 4LDEB 4J3OH 4TYUA 3TBTB 4EEEA 1LP9A 5I1EL 5I23A 2P5PA 5GJTL 4HXAH 3P3RA 3HW7A 4G8IB 4AM0A 4W68A 2IAAC 3FB8A 2JKJA 2UVEA 3GSOA 3P3UA 1PQZA 5C6TH 1ZANH 1S7SA 5F1SA 3WS6C 1MCNA 1FRGH 3P73B 4DKFL 3IJSB 4FYRA 3QVAA 3WKPA 3LEVH 1U41A 3OWEA 4CKVX 1X5AA 4G43A 1T21A 2EH8H 2C9XA 1OGTB 5K39B 4ODUA 2OMUB 3NCJH 3DIFA 1NJ9A 4LEXL 3UOAB 2B8OT 3JYCA 1UB5B 2ZYRA 4U4BA 3S37X 3FFCB 3C8DA 2WXKA 5DF0A 2VLRB 1GPOL 2RBLA 5TQ2L 4OTXH 1AO7D 4L3AA 5IVXA 3MCLH 3BH9A 1XH2A 2Z8SA 4UYQA 2VW6A 4K3JL 4MCZB 4U7MA 1JPGA 1VHPA 3VRLE 5C92A 4I77L 2GUOB 1FBIL 4HXBL 4ADGA 2YS4A 4MD5B 3BJ91 1UVQB 3HG1B 3RGVC 2KHAA 4P05A 5FA4A 4ETYA 5LXGH 4M6ML 4YHIA 3CPLA 1P6AB 3LN9A 1NTDA 2W5PA 1ZJBA 4O51B 4PRHD 4ODVH 3P0YL 4DT2A 2E9JA 3PPSA 3ISWA 1ZA6A 2CUIA 2DMBA 2XWJB 3D12B 4GXUM 4S1DD 1ZHKA 4BBWA 5I1AA 5JIDA 2VTFA 3GO1H 1I1AA 2XWRA 4AK1A 2PETA 4N8VB 2YD4A 1GKEA 4UOZA 1FIGL 5AB0A 1AR1C 2XI9A 3MKGA 2IANA 3CVDA 4OJFL 3P11L 2NDGA 5TK4A 3A21A 3RDTB 3WFBL 1UXMA 4PWJA 3VXMA 5GISL 3QS3A 3N91A 4H88H 1KYOK 1YEDA 3ZVVA 3UPRB 1D5XA 3ZL2A 5KS9F 4WUUD 1LM8V 4RGND 5EBWA 5EEUA 4HCFA 2OL3A 4MNGE