3LYRA

Human early b-cell factor 1 (ebf1) dna-binding domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
211
Chain Sequence
GSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription activator
molecule keywords Transcription factor COE1
publication title Structural Determination of Functional Domains in Early B-cell Factor (EBF) Family of Transcription Factors Reveals Similarities to Rel DNA-binding Proteins and a Novel Dimerization Motif.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 211
sequence length 217
ec nomenclature
pdb deposition date 2010-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16422 COE1_DBD Transcription factor COE1 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3180 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lyrA00
3LYRA
chains in the Genus database with same CATH superfamily
2FBOJ 3BWAB 2FEEI 3C9NA 1FYHB 4LP8A 1CE1L 3MRJA 3QXVA 1CLYL 4FG2A 5D7JA 1KLGA 4XH2A 5C8JA 3A67H 2XQYK 4I3SL 5AKRA 2MCPL 3RL2B 1E8YA 4TUJA 2FD6H 3P73A 4BIKA 5IW1B 4NP4H 1AHWA 3NJMA 5LN8A 5CD3B 1DZ0A 1F4HA 6PAZA 2OKMA 2GBVA 4PGBB 2R0WL 1MVFA 1CL7I 5CHNB 5B1KA 1CBVL 3NDYE 2RAMA 4OI9A 2Z93B 5JW5B 1KACB 3JUYA 1PZ2A 1OAJA 4LLMB 5D96B 3PAUA 4L1HA 5B1JA 5ADOH 4Z7NB 2NY2D 3GM8A 3TEZA 3ORJA 1WFTA 4N0UB 1C5DA 2CUAA 3HHMA 4PJ5D 2GTWB 4HCGA 5EWIH 4BFOA 5IFJA 3QUZB 1FZKB 3CFKA 1KPVA 2WKOA 3M46A 4P48A 4Z7WF 1F8TL 2J1YA 2YUZA 4F15B 1HQRB 2AV7B 1AGCA 4JHAL 4D8PA 3MJWA 3QQ4B 4AYDC 3QWOA 4ZPTB 1UVQA 2VR7A 1C7TA 3FFCA 4FADA 4ZJ9A 1HL4A 1XCTA 2X6MA 3ATBA 1WBYA 3MGAA 4UILL 3UX9B 1TSRA 5E8PB 4JDEB 4KXCA 3L7FB 4DVRH 1TO5A 1T66C 3QG7L 4GAGH 3KL5A 2VC2H 1FH5H 4Z77A 3VTTA 4HOXA 3HPLA 3UXFA 4FTVB 2ADGB 1ZA3B 3OHXA 2LFGA 3EGDB 1L9NA 3DWTA 1T1YA 3PWUB 3W0WA 3PPEA 3BPNB 3L9BA 3VI4F 3O0LA 4BDVB 4MCYA 1IJNA 5EN2A 3QEQB 4K4KA 3RIFK 5ICYB 5AW1B 2W07B 3G04A 3O6FC 3LSOA 4NYLA 2R1WA 1O6SB 5MENA 3D7PA 2GK0A 2X1XR 1QFPA 4PVNA 3CFUA 5C0CE 3U9UB 4PJ9C 3F05A 3I6KA 3PXJA 1A65A 1HS6A 5DT1L 4P2RD 2BNRE 3AY2A 1LO5B 1W8NA 2J4WH 2DYPB 4TLSA 2ZSVB 4KHXH 5AALA 4JFYB 5FDYA 4JAMB 4OD3L 3BSHA 4CMHC 2LLNA 1LO4H 1CD9B 3Q7JA 1HXMB 3IFPB 4HIXL 4P46C 2AZAA 2DQDL 3FSZA 3LKPA 3WFEL 3HB3D 4HA1A 3H9SB 1EXUB 5GHWH 4XCNA 4QRUB 4Y0GA 2V2TA 3CFCH 3V6OE 4KROC 3GSWA 4IW4C 1FFOA 2V6HA 3GSQB 1XMWA 2VLKA 3QI9A 3IETB 4GAYB 1KYOK 1DE4A 1MDAA 5BRPA 1CYXA 4HBCH 4OCRL 1G6RL 2WY3B 1YEGL 2WGXA 1TVDA 3NTCH 1MJ8L 3NIGE 5IMMB 2C4FU 1Z5YD 4TSCL 2MTAA 4H25B 4ADGA 3KPMB 2AXGB 5DFWH 5FW8A 4JG1H 1R33A 3SDAC 3PWPD 4PJFA 1OCWH 2R4RL 3T8MA 2OMVB 4WEBH 5EBLB 4JRWA 3GXMA 2G3XA 1S7XB 3MV8A 3C60C 1BXVA 3RVTC 1HH9B 3GRGA 1G0DA 3X11B 1XSKA 4MJHA 3E3QE 1R3HA 3BAIA 4IDLA 1KB5B 5AUMB 1T66D 3G5XA 3IFLL 4F80A 1CFTB 4JEGB 5DS8B 1YPZF 2KYIA 1U91B 4LSSL 4HXBL 3LYRA 5ILTL 4W9HC 3VSQA 3QDMA 5DRNB 4IJ3C 2CHNA 3QORB 3ARGB 4LGRB 4OFDA 3QFJA 3VXRA 3FO0L 1W6LA 3BP4B 4W93A 2FSDA 4K94H 5L4IA 4Z7OE 1D6VL 1MRCH 3CHRA 4FQQA 4LCCB 4C83A 5BQ7B 5B3JE 1KIUA 1DL7L 3EYUH 5INDA 5EU6B 3BH4A 3O6FD 1BQ5A 3AB0B 2AP2A 5F6HI 4XO3A 2Z91B 3ARPA 4HIIA 4KQ3H 3UBXI 4B9CA 1C5BH 1FV1B 4PJ9D 3QWNA 2RQ8A 4JANA 4DH2A 1YY9C 2WVSA 2XUWA 3BEVA 4UV4L 2EDTA 5IEKB 4N1CA 3ZRCC 1KBGL 4MJ5B 4PJGF 3CH1B 1Z9SB 1UM4H 3JTBA 4YMPA 2YD6A 4P46D 4AYMC 2GEEA 3B5HA 4UYQA 4X9IA 2EDRA 4PJ5A 1H15B 4OGYL 1AGFB 3GZPA 3REWB 1AP2B 1U8MA 3M86A 5CFHA 4JZNA 4KROD 1MHPH 2IAMB 2VDRH 2MCG1 2F19L 1YNKL 2BSRB 1E28B 1DBKH 1PKQE 1WS8A 4JO4L 3HE6B 3PIQB 3P0GB 5C97A 2UZXB 3ZX1A 4PW3A 2BP3A 4G8EA 1VAHA 1JRHL 3B1TA 4U1HA 4FQIH 1T20A 4LLQA 3NPZB 1UB5B 5E1AB 2YBGA 3MJGX 5DU7A 5IVXB 4MQXC 1H3PH 2OYLA 4PQXA 3LTVA 4J3BA 1CICC 3SDAD 4KKPA 2A74C 1BM3H 3CSTA 2ZWYA 1E27A 5I74B 2XXGA 4UF7C 2AK1L 4MD4B 1JPSH 2R1YA 1HIML 1MCOL 2YA0A 2JELH 3RVTD 3C60D 1ZOXA 3I6LE 3IDYB 4ODXA 3RWDA 3KS0J 1IAKB 3FSOA 5A7EA 2AXFB 3NK4A 1LDSA 4PJHE 4DPBX 2EE3A 4JJHA 2XV6B 4GW4A 5GRVK 1OK8A 1ACCA 4P2OB 3RURA 5GGRA 1RFDL 2EC9U 5K69A 3BT0A 2IOIA 1OARL 1YG9A 4O2EA 3BI9X 2VW4A 2PW1B 1BLIA 4P2RA 3R18A 3FL7A 3MV7D 3WFDL 1N7MH 3A23A 4Q4IA 3VM5A 4FERA 4XP5H 1CURA 2E74C 5HHMB 1BQLH 4HWEL 4S1DC 3VRJA 4YEFA 3O4LE 5M94B 2XSKA 5F7DA 2IH3B 3GSRA 3OZLA 4HWNA 1IBGH 1U3JA 4TUUA 1YN6B 2AJSL 3QO0A 2R29L 3UTSA 4ZAKC 2GK2A 3MV9B 3QYNA 2A9AA 2Q1EA 2KERA 2HTKC 1S78C 3VWJB 4LSPL 2NY3C 4DO5A 2ZAIA 5HTSA 3X13B 4G3YL 1I82A 3LNIA 4P5TC 3WMPA 1X9QA 1CC3A 5EF0A 4Z3GA 3GD1C 2R69L 4QXTA 3LQAL 5TH2A 3SDXE 5CGYD 1WUZA 2EDOA 3OAWA 5IQLA 4P9HL 2BY2A 3QXDA 5KSAC 3Q1SH 5DJ8B 5EBMB 5ALCH 5CBEB 4DSYA 1KEMH 4EVNA 3AT8A 2V2WB 3MGOB 2D3LA 5JIPA 3D8MA 2HLEB 4G5AA 3PWPA 4WK2B 5HHXH 1SEBA 2XPYA 1RK1B 4HUKB 3UIYA 5IB5A 1KIRB 1CGWA 5FA3A 2ZUSA 3WSQH 4EUPB 4OFQA 4Z9KB 5I0YA 2IQ9L 1OZTG 1D6EB 3BYYA 3HA0A 4W9JC 4YDVB 1PY4A 1TQUA 3J27A 4X6FA 1YVLA 5DEFA 1MCWM 4HCFA 7TAAA 3QNZA 1HEZB 4TM9A 4CC0A 3H3BC 3MRRA 1XGQA 4XP6L 4I48B 4PG9B 4FFZA 2LTQC 4MQXD 9PCYA 1FL6B 3L5WA 3CSFA 4P04A 1M9WA 1CICD 3UH8A 2JIXD 1G5GA 1QWUA 4TUOB 1PVHA 2FHBA 3D30A 1QAWA 3TIEB 3P9MB 5IBUG 5HI4C 2FLBT 3H8NA 2HN7A 2PF6A 5IBTL 2A9NH 5DHDA 4QTIH 4Z7NE 2H6UA 3JWDC 3QUXC 4N0UE 4XX5A 5GQBA 5KANG 1CD1B 2VW6A 1KG0B 3T0BA 3Q5YA 3O6FA 4L8SC 2FL5A 3PHSA 1SYVA 3FPYA 2CLZA 1AE6H 5DTFB 4KVNL 5IUSA 4M1DH 1OGAD 1NCAH 4M6OH 4PJ9A 5HHQB 4N2MA 3ZGIA 4Q6IC 5C08B 5LNEA 1BGXH 4KI1A 5AVZB 3E38A 4PGEA 1FJ1B 2E3VA 4FQ1H 2YK1H 3LCYA 1M1XB 3UPCA 2J8UB 3BWZA 4UQIM 1SOXA 2VXTH 3KYMB 4S1DD 1EFXD 4P46A 4F37F 1XGTB 1HZHL 1A8ZA 4NZUH 3QNXB 4FTVE 4P06A 3WIIH 3UTQB 3ZTNL 4ODBD 1LE9A 3CVHB 4ZAKD 5EU7C 2C34A 4XZUA 5C07B 1WAAA 2UZYA 1S78D 2BNQD 2HTKD 2YAMA 4G6ML 4QDGA 5TE6L 2NY3D 1N4XH 5A6IA 3QEQE 4RRPG 1CE6A 4P5TD 1WAEA 4LNRA 3RNKB 3MNDA 3WNPA 1WAPA 5HJDA 1G84A 4LCWB 4S0HA 1EEZA 1ZV2A 5FK9B 1KWKA 4KK6C 3HHRB 1K8DA 2DQJH 3SZKC 3EOBB 5KSAD 2DIAA 4DEWA 1XH0A 3PP3K 2HP4A 3PFQA 3ZZQA 3EJPA 4B9FA 5JR1L 1NEZB 2SODB 1F11A 3SDDC 2I60L 3SDAA 4HUWA 5IF0B 4N8VA 1NICA 3O6ML 2FX8H 1PZ5A 1NL0L 1Y6KR 1TETH 3BHBB 3I9PA 3LAFA 2OMYA 5DZPA 5CIPB 1NBYB 3QQ9C 4Q9QH 2YQBA 1OF2B 3CCHB 3ZDXF 2C1PA 1LWJA 4J3TA 4GP8B 4K3DL 4IRSC 1JK8B 5GS3A 3EGSB 3H9SE 1F97A 1K3IA 3O8XB 5A43C 4HXAL 4IK7A 2IC2A 4LPUA 4NWUH 2VQ1A 3DURA 3HI5H 2OYPA 2B59B 1WFUA 4FULA 1X5JA 4NCDA 3FU9A 4GP5B 1F6LL 2GCYA 3UCRA 2QSVA 3LEVL 4FQHA 1E9PB 4M8RA 1O7VA 2UYLB 4YHOL 4J7RA 3MV7A 4I4WA 5HI4D 3QEGH 3B2XA 2H3NA 4YUEH 2JXMB 3WG7B 4YO0A 5C7ZA 4LVOB 4G8FA 4G9FD 1IEAA 3KLAA 3JWNC 5BO1H 1EJOH 1EO8H 5EC2B 4RGNB 4PRHB 3T65A 3X3GL 2JTDA 4WTZA 3B9KB 2QSTA 3WO3B 4QRQA 1L9QA 3CLFL 2DF3A 2APSA 4O4YH 1QD0A 5ID0B 2NZIA 5GISL 4A2HA 3KCPA 5KVEE 5ERWA 4YQXL 1QRKA 3DVGB 4TLKA 4HKXB 2KMWA 3FTZA 1G9MH 2XKNA 3U0PB 1QR1A 4YZFE 3S3CB 3GGWB 4GRWB 5LXVA 1P84K 1QR4A 4JM2C 1R3KB 2FEJA 4U4BA 4GKZB 3PAYA 5D1XC 1JFQH 4G72B 1ERNA 1QFHA 3VFWA 2ZPKH 2YUVA 5C6TH 1OW0C 2EO7A 1R46A 4I0CC 3VRLE 1YRKA 2Y2TA 3KS0H 5IK3A 2WQWA 2Y72A 2CIKB 5EOQH 2P44B 4WSGA 4HLZH 3TWCL 1TFPA 2IALB 3WNNA 4A2FA 2EIZA 4WVRA 5EU6E 6FABL 3RWHA 1OE1A 2G75B 1OT1A 4CC1A 4KK6D 3TO2A 2H45A 3ARBB 1Y07A 2F7RA 2XY1A 4QRSA 1NM4A 4CC4C 2EYRB 1BZDA 5K93A 2VXSH 3FOLB 5FCUL 1A4JA 1CICA 1A7NH 3SDDD 2A74A 2JIXA 4FJZA 3UC0H 1AZCA 5FGBC 4HPOL 1AANA 1OM3H 5JPNB 2CK0H 4AYEC 1M3IA 3QDAA 4AH2B 1IMHC 3QQ9D 2D0HA 3FTXA 5KW9H 5HJ3A 2VERA 3NCJL 3GHPA 1G7JA 5E6RB 3EF7A 1DANT 2DJ4A 1EBPA 2NNAB 5C0BD 1UZ6F 4OZGA 1OO2A 4XE5B 3NJNA 1OGSA 4PG2C 3CVIH 5E1QA 1FPTL 4GLRI 1OGAA 1NC4D 1WZ1L 3AS3A 3MR9B 1MI5D 1FDLL 3WJJC 3VW3L 2ZYHA 3ZL2A 4XBGB 1PD0A 5KYWA 4Z3JA 1U8QB 4PAZA 3U2SB 3RWEA 2ADIA 5T1LD 3FN0H 1KELL 2BJML 5IJBC 2KLTA 5IVXE 1KXVA 4S1QH 1EFXA 5JDSB 1DQIA 2QPSA 3FUMA 1A7RL 5D2NA 3D0AA 3HNVH 3QVAA 3ZL4H 4LLYA 4MSWB 5FOJA 2BOCB 2DQEH 4QRFA 3MUJA 3M17B 1CFSB 2VXQH 2F53B 4ZAKA 3ML9A 2Y9RT 2F08A 4RFOL 1GIGH 2F5BL 4YC2B 3PE9A 4JO3H 4O02B 3GSXA 4MHHI 3QFDA 5E2TH 4BSWA 2O5XL 4P5TA 2YC1A 2ZICA 2D31A 4UWQB 1KXQE 2QGCA 3S34L 4HAGA 4NFBA 1KTRL 3NCMA 4M03A 1QLFA 2E4FA 1S9YA 3GB7A 4JM2D 5KSAA 1DJZA 3GMRA 5D1XD 3RNQA 2CNYA 4KO7A 1INDL 4R7XA 5MERA 2OTPA 1R5VA 1ZCRA 2EZ0C 3BH9A 5EC1A 3VFVB 1XO8A 3IVKB 3DK2A 1CFQA 3S88L 4MXWH 4QOKD 5CLWA 1PY9A 1UXLA 4U1LB 1MKFA 2WNWA 2ZP8A 3JTTB 2PO6C 5HHME 5IV2B 4QHUB 4XXDB 4IRZA 5B7EA 2J5LC 2H6PA 4F8LA 4HG4J 4L0PB 3CXHK 2QVTA 1MFDH 1XMEB 2BDNH 2W59A 3TT1L 5CCKH 1JXKA 2WUCL 3MV9E 1K6QL 1ZT4B 4JVUA 4JREC 5F7AA 4KHTL 5L88L 3PNWA 4MA1C 1RSYA 3JZYA 4NQCD 2A6DB 4WFFE 3FTSA 4IHOB 3GI9L 4UT6A 1AFVL 3PGCA 1R47A 4NNXB 5H2BA 3RU8L 3G5ZA 4GKLA 1JIBA 2DMBA 1QA9A 3KYNB 4AYFA 4EOWL 1FIEA 1T83C 1DHKA 5DUBA 2EDWA 1SJHB 1UWEL 1WZLA 1N19A 3JV4A 1EERB 5INCB 1AS6A 3MCKB 3ZDZB 3MREA 3LRKA 4X5RA 2DWDB 3PU7A 4XB3A 4B97A 3KWTA 4Q6IA 1UT9A 5TDPA 3QDGB 4AK1A 4ZTPH 4U6HB 4AV4A 4Z7WB 1AZBA 2DI7A 3ARRA 4FFYA 2HFTA 1NGWB 1LMKA 4GO9A 5DMJB 1SFDA 3GSOB 5GJTL 1X6LA 3V0HA 3MLXL 4Z7IA 4FL4C 2WIIB 4BZ2H 1T0NB 1SVCP 1J88A 5F44A 4HUXB 4DJMA 3BVUA 1NAMH 3HC2A 1JV5B 2P1YA 3NACL 3HAEA 1JTTA 2R0KL 1XGYH 5A3IC 2A2QT 4ZUSB 1M7XA 3ZUNC 2CWRA 5JNYB 4JFXA 1BYOA 2R2HA 4GRMA 4TXVB 3QJOA 4X9FA 5CP3H 1HHKB 4DP4X 3VI4B 2XV0A 4JFHD 2B4CL 3U1SH 3O41A 5C0RL 4HVBA 1ZPUA 4B41A 5C08E 1OM9A 4OGXL 5LBGA 2AAAA 1H0DA 1CXLA 4K94C 1QPPA 2GAZB 2J1ZA 4MKTA 5KOMC 8PAZA 1UXWB 1AG0A 4PS7A 2J8UE 1XF4B 4ZFOB 2PO6D 3ZW3A 1CR9H 1MAJA 1PG7L 3HFFA 3OPUA 2BY0A 5B38B 3LEYH 3GRWL 1NBZA 2Y06L 4TNGA 3GUTA 3GKWH 5GSRB 5C0BA 1QBLH 1TJXA 2ORBH 2ZOKB 1JP5A 1CB4A 1YJDL 3CK0H 5C07E 1N70A 4ERSL 4ATTA 1NC4A 3VFSB 2BSDA 2HSIA 1MI5A 3BGFC 4HUUA 3JTSA 4K3EH 2BIQA 1FNFA 4HOZA 3MXWL 3MUGB 4LCWE 5IIEB 1AS7A 1OAXH 1GZQB 4I9XA 4PMEA 3RJOA 5T1LA 1DUZB 5LNGA 1NANI 4HPYL 3ARYA 3WIFB 1BAFL 5HPMB 2DRUA 3HE7D 4QRBA 3CZUB 1PZDA 5DZAA 4LAJH 3WFHB 5CMAA 1ROWA 1FO0A 3KAAA 1JNLL 4K5OA 3WIHA 5F6IB 4M48H 2R4SL 4K3HA 1OF0A 4UUJB 4WO4C 3I6SA 4Z76A 3NIFB 2GSMB 5CKAA 1QO3A 4IEFA 5K9OA 3HNTL 1XR9B 3V6FB 1Q0YL 5AVSB 4JM2A 5JORA 5LBSL 2ATPB 1E30A 5D1XA 3EJCA 4HDIA 2ZUWA 3LIZH 4X80L 3GEWB 3SPGA 4PD4K 3QJHA 3WKML 3UG5A 3IWUA 1WTGT 2WTPA 3BZEB 3FF8A 3LNEA 4QOKA 2YS4A 3Q06A 3MA7A 4PS4L 4OUOA 2IWGA 3GJEB 4HJGB 2GUYA 2DQIH 5EUKA 1YPZB 1YEHL 4YSQA 5A3ID 4G83A 4PWGA 3AMLA 1DQJA 1ECZA 3CSYB 4RGNE 4PRHE 5D6DC 5IB2B 4F57H 3I74A 2MFNA 2DEWX 2PABA 1AGBB 4CC4A 3HN8A 2CR0A 1A6UL 1XL4A 4R26H 4HOWA 1P7QB 4DKDC 1JGVH 1JFHA 1UKQA 1XCQB 3L9RB 5DZVA 1BFOA 2EDXA 2HWZH 4KQ0A 3MLZH 5FGBA 4GRWE 2P9RA 3UZQA 3CU1A 3S3BB 4K7FA 4F58L 1GOFA 5ISZE 3P1VA 1IT9H 4BE5A 1F58L 1S7RB 1FC1A 2MOVA 2GJPA 5KSBF 5GGTH 5B21A 2D7TL 2B5IB 4FG0A 3MLSH 1PD1A 4PRDA 5LAXB 3A4EA 4OI8A 4PG2A 1FIGL 2HG5B 3D51A 2XWZA 4FMVA 5DJAB 1U95A 4NB7A 2IPUG 2K4WA 3WJJA 1AI1H 2RIKA 4M1GH 4B9KC 1MREH 2EUXA 1GPOH 4NXKA 2YPLD 1G6RB 1W72L 3FN9A 5F7WC 2NLJA 3SBPA 3HW7A 5E5MB 2OZ4H 3QBTB 3TVMB 5IWLC 1IGCH 4BFKA 4XCFH 3EO1A 5EDSA 4DZ8A 2JE8A 5SWSB 4NUJB 4WY7L 5KVEH 4KO9A 5L7XH 2WSKA 4GG6A 3WTYA 2X4RA 2B9BA 2BCMA 4ILDA 4WO4D 4AQEA 1I8KA 2Y7LA 1KB5H 2ERJC 4NJ9H 3G7TA 3SQOL 5I71B 1QSFD 4EIUA 5L8LB 2DWTA 1Q0XL 2XXFA 4XX1G 3MRFA 2YR3A 3VSVA 4QLWA 1T5WA 3GYRA 4OIFA 1F6AA 3K3QA 5KBMA 2K4AA 3PABA 3SEPA 4PB0L 4ZW8A 3N41F 1T6BX 2OW7A 4JKNA 3IEAA 3QJSB 4YK4C 4KRNA 1N5YH 1DVSA 2C7UA 3CFNA 4R7NB 5EO9A 1IAIM 4M43H 5I8KH 4IBLT 4NNYA 3INUL 3VMNA 2PO6A 1G7MA 3BP5B 4UINH 3SOBH 2WJ5A 4YNYB 3DA0A 3F6IA 4W9EC 5I18H 3Q8FA 2X4SB 5E7FA 2F53E 2O93L 1ZJBA 3WCYA 3MRHA 3FU6A 4M1CC 5DHEA 3N40P 1RK0B 3AGVA 3EFOB 2DQCL 1G94A 1MH5A 1FCGA 3FQUB 4UB0H 2F7QA 3ULVE 2P43B 3EXLA 4J3VA 4OV5A 1BEYH 3NJKA 4M6MH 3N0PB 4JY5H 1NGZB 3LJ3A 1T83A 2M8XA 3HE7A 4B7IA 4B60A 1E8WA 2MQ0A 4F8OA 4OD1H 2APXA 4LEOB 4PVBA 4Z5RB 4HWUA 4K55A 2I7SA 1PLGL 4XMUA 5TJWK 1UXMA 2ZCZA 3WY2A 3BVXA 1Y18A 4ZUTB 4A6YA 1F86A 1H5BC 2L7JA 3QDJD 2VR5A 3V0AC 3QRFM 4L8CB 2COQA 4LK4A 3KLKA 3E1ZA 4EI6B 4IGBB 1SYSA 1MWAH 3I6GA 1VCAA 3P69A 2YPKB 3HR5A 2DDQH 2W88A 4BWWA 5E8NB 3MXVH 4Y4HC 3QNYB 3RZCB 4NM8L 2YMOA 4LASH 5DQ9B 2FRGP 4N3TA 2O6FA 5L0QB 2ESVD 4WJ5B 1HHJA 1NMBH 4RA0C 4NQQA 4QHLB 1KCRH 3TJPA 3MROB 3B7YA 4DPRA 3QK0A 4LRNH 2GJZA 3ZDZE 2VT0A 3PUCA 4MMXC 3F7RA 5AVYB 1C1EL 3V4UL 3TF4A 1G7IB 1KT2A 5C0NC 1DQLH 4OD2A 4YSSA 2EDMA 3QDGE 3PF2A 3F2LA 4QRRE 5D55A 3IU4H 4Z7WE 1TQCC 4LPVA 1P69B 3C6LB 4PJIA 4LCVA 2V9UA 4HFUH 1RZGB 3F5WA 3SKMB 4JY4A 1T21B 2X09A 4F5CA 4AGLA 4CJ1A 5DSCA 2Z35A 3CPLA 3OGCA 2GQHA 2FLRT 1FFNA 3ECBA 1HHHB 1L7IL 5FOBA 1JDDA 2W94A 3D39D 2J5WA 1NDTA 1G9MC 2CBQA 2H7WA 1IX2A 4PJ6A 1QFUH 2NW2A 4M1CD 5JXAH 4KOCA 3D0VB 3KLSA 4J3XA 1PCSA 2KLSA 3C8HA 5ID1A 3MAWA 2YPLA 2IH1B 3PCYA 2A6IA 2CALA 3V6OC 1RP9A 2QKSA 4XB7A 5LCVL 3VI4E 4KUCD 4TVPL 1ODUA 3LZFL 4U7SA 4PJEA 5ESQB 5F89A 5JXED 2DWYA 2XIDA 4EUPH 4CSZA 3B9AA 3WXWH 5ABDE 1F4WL 4I0PB 3SKJH 1ZA6B 5F3HA 1TQSA 4WO4A 4GOSA 1CT8A 1WWAX 3QAZC 3FCSB 4K9EH 1MEXL 3F7PC 5EZLA 3GSUB 3OPZH 3X2QB 1QSFA 5E2WL 3QZWG 1ZT1A 3H2PA 2CIIB 4KXZH 2JB6B 3FFOA 3O2DH 1L0QA 2LLLA 2XFXB 1KN4H 5KYYB 3ZDXB 4HS8L 2NQ3A 4MNQB 4Y1AD 2VTFA 3HZYB 3F8UB 4Y4HD 4QYOA 3V5HB 3QC6X 1FN4B 3B3IA 2EUZA 1UA6L 3Q5TA 1SQMA 2Q2EB 4UQCA 1K2DA 1U8JA 4UNVA 3DRTB 1NSNL 5LAPA 3L1OL 2VO5A 2EQDA 5D6DA 4AL8H 3UGXA 1OZUA 2RQEA 2F1BA 1QRND 4Y19B 2AQPA 2XN2A 2PR4L 5C0ND 3WFBH 3NIFE 1GRWA 1I9IH 5JHMA 1U21A 1INEH 5LGKA 3AVEA 2NY1B 3V6BR 2DM3A 1KXTB 1BZ7B 1GGCH 1YNLL 4ZQKA 4L37B 5C0CD 2EXWC 5HGAB 4I3RH 4NRXA 4CBZA 4TYUA 2BNRD 3QIBB 5D7KE 3KM1A 2XCMC 1MNUH 4S1RH 4GQRA 5EUOB 4NN6B 3ZKXB 1UB6B 1L9SA 2VO8A 3GMOB 3N43F 5FYLL 5ICUA 1U2CA 4EZLA 4QAWA 5KBLA 4R7DB 2ZX7A 2AEPL 4S2SA 1I3GL 1YPZE 2VRKA 4LCYA 1KGCE 3QDJA 3FRPA 1U92B 7PCYA 5HHPB 2X3CA 1TEYA 3GSNL 1X44A 3NPSC 2QDWA 5DEGB 4NFDA 4RMTA 3GHEH 3SY0B 5BVJA 5IWLA 2GBUA 3U0TA 3DX1A 3VRIB 3WFCL 4EIGB 2PWGA 1Z3RA 3D18B 1KBKA 3CMOH 3S9DB 1XZ0B 3EFDL 2VXVL 1J1OH 2IQAB 3FQNB 5CIPH 3W9EA 5GXBB 1T7VA 2W0LA 1JNHB 4G11A 2IFGA 1BWWA 4HZ1A 5D5MB 3UOAB 3DJTA 2WXJA 3DYPA 5FO2A 1GYUA 4YPJA 2FJHA 5HGDA 2ESVA 3ISRA 1DJYA 3BPOB 3NCWA 5DA4A 2YUWA 2O6DA 3CFDA 2DQTH 5EO1B 3OKNA 1U2YA 3TP4A 4X8GA 3U2IA 1UZ8B 2AJZA 4OJDH 3ROOA 3U0WH 3FUDA 3L4WA 5DS2A 1HWHB 2AMGA 5TE7H 4X6CF 3SBQA 3VG9B 3VG0H 1AR1B 4M8UA 4L1BA 2HFFB 5EOCJ 2VLJB 3VFMB 4ZUVA 3VXOA 4HKBA 3L3IB 3IMRA 3ZQWA 1KPRB 2CKBH 2UVFA 3D08A 4PI0A 5D7SL 4F2MA 4AYID 3UPAA 3WAJA 3QCUL 2NUTB 4U6XB 5HGGS 3T4YA 5DJDA 1AZNA 1PW3A 3EOAA 3FCTB 3L5IA 5IM7B 4UMSA 2OMTB 1T89A 1I7UA 2P5EE 4X9HA 3ZO0A 4CGTA 5I0VA 1NLDH 4MB4A 1A4CA 2IAAC 3SZ6A 5EBWB 3D39A 3G08B 4YFDB 1G9HA 5CFAA 1C08B 4ZTOL 4GRWH 2GI0A 1DO6A 2UVEA 4Q52A 4EN3A 4APXB 5MEOB 2B7DT 4X6BA 2BPBA 3OKLB 2BVOB 2BHUA 5D7EA 1N64H 5HYJB 2FHFA 2H0EA 4XVJH 3ESUF 3QZNA 3UZVB 1N6QH 1IVTA 3D06A 2EXWD 5T1DL 4PR5A 4UM8B 1F4YL 1XGRA 3CIAA 4WEMB 4JFWA 4I1PA 4R6UA 2HRGA 1KCWA 5JXEA 2H1LM 3AU1A 4JG0H 3W81A 4X5LA 5DK0B 1IQDA 4A37A 2JMRA 1E4WH 4F7CA 35C8L 4WFHE 5D93C 1CIUA 2DQUL 2R0ZL 1H5BA 1QSEB 3FYEB 3ZN6A 4AOFA 1K8IA 4G6FB 5EOTB 5HGBB 3H42H 3SB3A 3SO3C 1R4XA 5KYXB 1U8IB 4JFPA 1UA7A 2QGBA 3VXMB 3WLBA 5TQ0L 4OM0L 1XGZA 4X0KB 5ACMA 1E4XI 4XC1H 2BNUA 3DTUB 1TXKA 4ODSH 1GTNA 4Y4HA 2R2CA 3DSNB 1IILE 2E7MA 3FH7A 3IDIB 1WC7B 3FB7A 3FAXA 2J6WA 4TQIA 2QVMA 2EIMB 2OR9L 4MX7A 2HKFL 3WHXA 4F8PA 3GLDA 1XHHA 1CLVA 3MRLB 2EICA 2F9BT 4MMXA 5D96C 2CDGA 1WA2X 1NAKL 1EEYA 1VACB 4HAKA 3I6LD 4JPWH 1CQYA 3LKRB 3MX0B 5CEXB 4GAFB 4AQ1B 2X1PA 4AYGA 4F9LC 1EPFA 2WBKA 2X1WL 3MLUH 4G59C 5AVXB 4D2NA 3QUZC 3FCUB 1I1AB 1OALA 4ZZKA 3LQMA 5HI5C 4F15C 1YECH 4TPRL 1E2ZA 1W8OA 4FXTA 4AE1A 4D0CB 15C8L 5C0CA 4ZZFA 1OGTA 4JZJA 3HVNA 3I50L 1MW0A 4BFIB 4MMYB 1D9KB 5DZLA 2BNRA 3GLZA 4O02H 1QBAA 4JFOB 4RAVB 1T1ZB 2KL6A 5MP6H 5C6WH 4G8AC 3DI2B 4A7GA 4NO2A 4XNYL 4KZ0A 4Z7QF 3WYRA 3B7SA 3ULVH 4KKNA 3O4LD 4EZKA 5IFAL 5K1VA 3P2DA 4NT6A 3FO2A 4Z3TA 4NDMA 3P02A 3BUYA 4GRLB 1QX1A 2VUKA 1ZHBA 3MRCB 3V6OA 2X88A 4R5XA 4RAUB 3BPNC 3IPEA 1MCWW 3KLDA 5K39A 2W65A 5B22A 5F0LB 3M07A 2WQUA 1I9JH 1UWFA 2BFGA 4FYSA 1F45A 4QPEA 1B2YA 2ZKHL 5SWZB 3KWXA 1INQA 1MUJA 3MYJB 1LEGB 4ZPVB 5IMLA 1FL5B 1DQKA 4JKPL 3TLRA 2HVBA 2XJKA 3RKDC 3MV11 2OJEB 4KQ4H 4HKZA 4EE2A 3E6FA 5A2CA 3Q05A 5DRZB 1SLUA 3IFOA 2F1EA 5EIIB 3LNGA 2X4OB 3VFNB 4RAHA 1UD8A 4QNPF 4YBQC 3W9DB 3MLWH 2YSSB 2D9QB 3HLAB 5KYUA 4ZD3H 3B37A 3GO1L 4N0YH 5EZJA 1N3NA 2O6EA 3A0OA 4LKXB 4CADA 4U7MA 1CJYA 3X1EA 4AIZA 1GYVA 1QBML 4HIPA 3T0AA 4NZTL 2WLIB 4W9CC 2R27A 3TA3B 4IMLA 2WWOA 4OLZL 2PXYC 3O6KH 5PAZA 4U2ZA 5ACLA 1I75A 1I7TB 2YD9A 4N8UA 1GGBL 4XTRC 3F58H 1TVBA 3E80A 4JRFA 1GGIH 3O4OB 2R2BB 4I9WE 3PRZA 1U3YA 2FB4L 4AI7A 5HYEA 4JKLA 3FO9B 2MKWA 4PS8A 4R3SB 2Z9TA 3FU7B 5GIRB 4K2UL 1TJIL 2YMTA 2MRYA 1S7TA 3BPCB 3QUZD 1RJLA 1LWHA 3IN0A 5I1CL 3ESOA 5HI5D 1D7BA 5KJRH 1IKOP 1J48A 4XNQA 2CRIA 3D0LA 1IAMA 2UXFA 2WOBA 2VXQA 3ZDXE 1JGEA 4KNUA 4LEXL 1V55B 2Y0SA 4MNQE 4JDZA 1E90A 2FX7H 4ZQTA 4LSUH 5EO0B 3FTGB 1E9QB 3D85B 4DO4A 1OAYL 3UO1H 1LEKA 4Y4KB 4FD0A 4N2FA 1KJ3L 2Q7NA 4FTVD 1QKZH 3PS6A 3OXSB 1O7DE 4JDVB 4Z6AT 5C2BL 1HYSC 3TT3H 5IB1A 4HKJA 3AAZB 5FHAL 3QORC 3ARGC 4Y19E 1DDTA 2AZUA 4HEPA 4LCCC 1IC7L 3QEQD 3P0YL 1PKQA 4BSJA 3QJFB 3ZKND 4MNHB 3FQTA 3O11B 4JG9A 4HV8A 3AB0C 1CE1H 4DUWA 1BXUA 5LWYL 1CLYH 4OY9A 3DX9B 3QO1A 4PREB 3RILA 1M4KA 4I18B 2MCPH 4I3SH 1MFCH 2BY1A 2HH0H 3ZK0A 3RPIB 1RUML 3RKDD 4NUPA 1AYOA 4HJIA 5FAAA 2XICA 2R0WH 2YRZA 5EUOE 4A04A 2DYPD 3MRPA 1CBVH 3DHJA 3LDBB 3SJVB 2I07A 4YBQD 3SYAA 3MHZA 3H0TA 3DROB 4FFZL 3SQBA 4PJHA 1BECA 1T7XA 2GABA 2ODHA 3H9SD 2BY3A 4PVLA 3H9HA 4LFHD 4R97B 5IR1A 4U33A 3IJSB 1CZ8L 4MMZB 1SLXA 1J9CT 1JK9A 4E68A 1RSFA 2LABA 5E1GA 3X1NA 1WA0X 2K6YA 1F8TH 3ECQA 4WRLA 5F9WB 2PXYD 1ZS2A 4KXDA 4JHAH 4HWZB 3HE6C 2XWBA 1EZLA 4PSRA 4XTRD 3S6CA 2OLDA 2J20A 4WCYL 5D5ME 4XP9L 4O2FB 3CHQA 5CP7A 4UILH 3ARVA 4LL4A 3KPQA 5CBAB 2FVNA 3O4LA 4N24A 1AXSA 5GGSA 2GSGB 3WI9A 3QG7H 4XO9A 3D48R 4BQCA 3OB8A 1LNUA 3WE6A 4XPAL 5D2LF 3HC0A 3I75B 5I74C 1EWHA 2CBOA 5KVGE 3VTAA 1KLUB 5DVMA 4X7TA 2D7MA 3BH8B 3MRKB 4HG4K 1F1DA 1VZGA 2WNGA 5DZOA 4BZ2A 3IDYC 2R23B 1IC1A 3HPJB 2IWKA 4XCCL 1SY6L 3LRLA 2VLJE 1NAMA 2WTOA 1AIFB 2N1KA 3SDXA 1UZ6E 5CD5C 4P2OC 4W70A 2J8HA 3CVDA 4ODUB 5KBKA 1B9ZA 3RGHA 3U6RB 5FF6A 1SBBA 5IOPA 2WLNA 3B5GA 3N41B 2DIJA 4MD0A 1JD9A 1TZHB 3B7RL 1HYSD 4PRIB 2Y36L 4HFWB 5E70A 3QORD 3ARGD 1OP3H 1ZLVK 3FQRA 5I76A 4ZMAT 1UJ3B 5DT1H 3EW3B 5F21B 5PCYA 4LF3A 2BSCA 2ENPA 2YN5A 1DQVA 1BM7A 2NW3B 2NY7L 5EU6D 2O5YL 4OD3H 5HY9B 3DO7B 4LGSB 5LGHL 2LU7A 5HDOA 4HIXH 3RL2A 5KBPA 5HYJE 3K8LA 2DQDH 5DEZA 4APQB 3KJ4B 5IW1A 3ATEA 1Z6JT 1UD6A 4OIIL 5JUEL 3NN8A 5CD3A 3T6QC 1OT2A 1UYWL 4WI3A 2ITDB 4JMNA 4PGBA 1B0WA 5CHNA 5C3LD 2JKSA 4OZIF 4H1LB 2Z93A 43C9B 4LLMA 2VABB 1DVFB 1LXMA 4OCRH 1G6RH 3S5LG 1YEGH 3IJYB 2CU9A 4N0UA 5GRVL 2UY6B 1ZE3H 3G5VB 1QSEE 4YBHA 4F9LA 4CAGA 1OANA 2GTWA 1YEEL 3QUZA 2ARJB 4TSCH 2VR3A 1NOFA 1FZKA 1YEKL 2ZXDA 2XX1A 1EZSA 1HQRA 1UEMA 2AV7A 2EH8L 2ICEB 3KEHA 2R4RH 1QI4A 3OZ9L 1L9TA 3VFPB 4ZPTA 2C7FA 3HE6D 4JKWA 4ODVL 1P7KB 5CJXC 2EC8A 4HH8A 5E8PA 4JDEA 3N1QC 2FAUA 3AUWB 3L7FA 4B9ZA 4K9EC 2CRZA 2F7PA 1PYWA 4OGZA 3OKDA 4UQ2B 1GSKA 1PCXA 3WS6C 3U36B 3WNJA 3IFLH 4FTVA 4PJDF 2UZIL 2ADGA 1ZA3A 1HHIB 4OVVA 4LSSH 4BK8A 5ILTH 4HXBH 3EGDA 3SDYH 3PWUA 2KZWA 1J8HB 4Y5VB 1LVEA 4PJCB 4TTGA 4JO2L 4BDVA 4CVWA 2NRDA 1TR7A 2WOYA 3FO0H 1S9VB 3QEQA 5ICYA 1D6VH 2AXJA 2W07A 4HC1A 5GPRA 2GHWB 2EIEA 2WYZA 1SF3A 5CD5D 3ENEA 4MA7L 2YKLL 5E6IC 1DL7H 4P2OD 4F1SA 3FUIA 4AL8C 2YD5A 4TMPA 4J3WA 3RI5K 3U9UA 4A39A 4KMTL 5FFLA 4IK6A 1CPUA 1ZTXL 3OAZH 4IBUA 4LHUB 4XWOC 3M1CA 1LO5A 2HKAA 2CHWA 1LWRA 2DYPA 3GHBL 2ZSVA 3O45B 3ZYOA 1KCSL 1B0IA 4RWYL 4QLRA 5HHMD 1ACZA 5BOJA 5AYQA 5ESAB 1KBGH 1HXMA 3IFPA 1P4BL 2WYTA 4F7KA 4OF5A 3H9SA 4WI2A 5IROC 1EXUA 4K5MA 1ZIBA 4AVIA 4KDTC 3MV9D 4QRUA 5DJYB 5GGTA 3GSQA 3VWJD 4WFFD 3BN3B 3IETA 3X12B 3KPTA 1NLBL 3VYOA 3GJFK 3FPXA 2PYFB 2F19H 1YNKH 2OM5A 3N50A 3QUKB 4U6YB 3T6XA 2VXUH 4JO4H 4C58B 3OHMB 4PBDA 4MAYA 5IMMA 3EYOB 3VH8G 2IFFL 2LAAA 1JRHH 4BUGA 4H25A 3KPMA 2AXGA 4HK3N 2OZ4A 4KV5F 5IG7B 3STLB 3RY5A 2D7QA 3S37L 2AJXL 1B0RB 3TH3T 2OMVA 5E95B 1ZK9A 2MQ3A 2W9DL 2YRBA 5EBLA 1OB1B 2AK1H 5F1IB 1HH9A 2HUHA 1U33A 1HIMH 3X11A 4DOHB 1MCOH 3GXUB 4L3FA 4JM4L 3Q8AA 2YXVA 1U8NB 4KJWC 4XMPL 2OL3L 1E4HA 3O8XC 3KHOA 4TNVK 1CFTA 2Q6WB 1CFMA 5DS8A 1U91A 3KLLA 1RFDH 4WF7A 3V6ZB 2E6JA 5DRNA 1S7WB 3QORA 3ARGA 4PLJC 1OARH 3BP4A 3FB6B 5I5RA 2WN2A 4LCCA 5ITBL 4MXVF 4XBEL 4LVOC 5BQ7A 1SRDA 2VDML 3LNDA 3QT2A 5EU6A 4RGNC 3PUUA 4HWEH 2HXAA 3B9KC 5E6ID 1YEWA 2QHRH 4ZK8A 2VJXA 3UEQA 4KWUA 2AJSH 2R29H 1FV1A 2MPAL 3WKPA 1QATA 1FF5A 4LT7A 3GSVB 5C08D 4MS6A 4XWOD 1GC1L 5IEKA 4IRZL 4LSPH 3TBYB 5A40E 4JJOA 1NTDA 4MJ5A 2BK8A 3CH1A 1Z9SA 2R69H 3LQAH 2BSBA 3AXLB 3FUHA 1B6UA 2G30A 4P9HH 5D7IF 5IROD 2F8VA 3HBQA 4KJYB 1H15A 1AGFA 3REWA 3D4GA 5C07D 4GP4B 5DWUL 3UYRL 1GXEA 2IAMA 3RKPA 4ZMLA 4IRJB 2BSRA 1OCZB 1E28A 1CS6A 4LQ1A 2NNRA 3HE6A 1B3JA 3PIQA 3LVTA 1QZ1A 4LCWD 4C55A 3ARBC 2ICES 4HD9A 4WHCA 3LRHA 1UB5A 1X5XA 5E1AA 5IVXA 2OA9A 4PGJA 1JXDA 4MLIA 2UV3A 4WTQA 5I73B 4XP6H 2PWHA 1DBJL 4YDKL 5FV1L 3WGVB 5L8KB 1WFJA 3GC3A 4OU3A 4UNIA 3C75A 4MD4A 5JPNC 1PPIA 4OV6F 3U7YL 2A6KB 2FYVA 1U41A 3SJVE 4ZMYA 2JTYA 3UAEA 4R4BB 3WAKA 1HTYA 4FS0A 4N5EC 1IAKA 4S11A 5IBTH 2AXFA 1Y7VA 5I1HL 1KXQA 4JPQA 3R8BB 4GMTL 1CGUA 4KJWD 2BXZA 3L16A 2PCYA 4H88L 4ZX4A 3O8XD 1SXNA 3ALPA 4PH8A 3KYKL 1C9SA 5E03A 3TXAA 3TBWB 1E7UA 4KVNH 4JKMA 5DK3A 2RH0A 2PW1A 1YYCA 1N6VA 4PLJD 1JPGB 1N26A 2CDFA 2F58L 1GJUA 1XD1A 3F04A 1E7VA 5J1AB 2LU4A 1AVAA 1I3VA 1UACH 6PCYA 3UCQA 4U1KB 4RGND 4PRHD 2IH3A 1U9KA 3TPKA 1A4AA 3B9KD 1YN6A 2NNCA 1HZHH 2ZYIA 1OD9A 1IC4L 3MV9A 1SDYA 1SHXA 3ZTNH 4YC2C 4L3CB 4QKTA 3VWJA 5L9DL 3X13A 4G6MH 4D9QE 3ULVC 2FQEA 2OK0L 2P7TB 3HBZA 5E6UB 1P4UA 2Y2WA 1P2CB 2FDBP 5DJ8A 1E4KC 5EBMA 4TULL 2Y7SA 3NQIA 2YGVA 5CBEA 4Y2OB 2V2WA 3MGOA 3OAYH 1CDJA 4Y1TA 4DPAX 4PRIE 4G43A 3WLWD 5JR1H 1RK1A 3GSNB 2W91A 4U05A 4MS8C 4DUXA 2I60H 1A6WL 3VO0A 1XXDC 2QSCL 1TCMA 4EUPA 3O6MH 5G2NA 1ZWIB 3MRDA 1NL0H 3T04D 4JN1L 1D6EA 2KQMA 3MTXA 1PFCA 5AL8A 4XNDA 4YDVA 2WPGA 5L4MA 2NNFA 3ARBD 1HEZA 5DHYB 4K3DH 3S4SG 2MIZA 3E6HB 4I48A 1BCIA 4PG9A 4YBLB 4KZDL 1FL6A 1BXAA 1Y6MR 2A3TA 4PY7B 3WS6A 2C9AA 3WIHL 1A3QA 2YA1A 4HXAH 1OP5K 3O2DA 4JRYB 3TYGL 3TIEA 4ZMWA 2ALWA 1UVQB 1EBAA 3P9MA 3LEVH 1EAQA 1NMAL 1JZ2A 3DHUA 3PL6C 2BVYA 4PB9L 3N1PC 4N5ED 3ASOB 1CD1A 4PHZA 1KG0A 4LSRL 3CLEL 1UENA 4JQVC 3MKGA 2E75C 2CJSA 5F7UA 1Q9WB 5F0PB 3DUSB 1A4KB 2HFEB 1CI5A 3X3GH 2QQLL 5DTFA 1GAFL 2H0PA 2QZQA 2CLRB 3CLFH 4WI0B 5HHQA 3WUWG 3H4FA 4Z95L 3UL4A 1HYRC 1TZ8A 5GISH 1DLHB 5CSZB 5C08A 3U2JA 4YQXH 2N0KA 1FJ1A 1O75A 1UWYA 4XHQA 1FFPB 3LQZB 4KZCA 3RWIB 4KO5A 1M1XA 2J8UA 2QVFB 3CE1A 1RZ7H 4OQTL 3KYMA 4TNWK 4ADIA 4X7SL 1T1WB 1XB6A 1XGTA 4WFEE 3DBXA 5IROA 3CVHA 2X6BA 4KDTA 2F53D 3IT8D 5C07A 1J8HE 4Z7QB 4ANVA 4PJCE 3L4TA 4HJSA 2J25A 5DQJB 4RCAA 1IM3B 3TWCH 4NUGL 4GQ9H 3CDGB 3MBXH 3RNKA 2EVJA 3V9FA 3ULVD 2Q86B 1U8HB 2OW6A 5FK9A 5C0AB 3EOBA 4EZMA 5F7NC 1V7NL 3X14A 6FABH 3D2TA 5EEVA 4XOCA 4RFEB 1NEZA 3KLQA 4WWPA 4XNAA 5FCUH 3EBHA 5IF0A 1H6FA 1TNNA 3EUDA 3L7EB 4MS8D 1KJ2B 1G43A 3BHBA 2GB2A 5KJ7E 4BXSV 1X3DA 2LAGB 1Y1DA 4HPOH 5CIPA 1NBYA 1QVOB 3NJLA 1OF2A 1WFOA 3CCHA 3UEZA 4HK3J 1NKOA 5F1SA 1JK8A 1WIOA 4LVHB 4WV1B 3NRQA 4YGAB 3EGSA 3NCJH 1VEMA 4DFHA 5TFSH 1TQWA 4PJFB 4QXWA 2B59A 3U4BL 2VSMB 2W8CA 1OQXA 3B43A 1E9PA 3N06B 1WZ1H 1DBML 2UYLA 3MSPA 1FDLH 5HXMA 3VW3H 3GWJA 3KJ6L 3GMQB 4NN7B 4NXSA 2JJUA 2JXMA 4ETQB 1KTJA 1REIA 5ICXB 4AVHA 5C0JB 1KELH 3LRSB 5EC2A 3TA4D 4PRHA 4N0FB 1GH7A 1P1VA 2P45B 3B9KA 1A7RH 1RHHB 5EEXA 5DJCB 4LPTA 2GJRA 3RWJB 5F6IC 5ID0A 3HOGA 3CZFB 4MWFB 3DVGA 4RFOH 3RFZC 4HKXA 2F5BH 3QDGD 3U0PA 1A1NB 2E9JA 5I1IL 3GGWA 1MG2C 2DV6A 2O5XH 3S34H 2C9RA 1R3KA 3VU1A 2E7HA 4GKZA 5ISZA 1JHKL 1DEDA 1JZHA 4FMFA 1FFTB 2CHZA 1RHFA 2J4WL 3B2PA 2CIKA 4C4KO 5JMOC 3V5DB 3BEVB 3SYCA 2WCPA 2YRPA 3B9EA 2VMJA 1L3NA 2IALA 3S88H 2ICWB 3CJJA 4YDZA 2DH3A 2IGFL 1QFWI 1FNGB 4OF7A 4PI2A 2WVVB 2CGZA 4DGYL 3LD8B 1CD0A 1XSJA 2G75A 3NEXA 3UO8B 3TC9A 3CFCL 3ARBA 4UI2A 3G6DL 1T3FB 2EYRA 8FABB 2ZJSL 3FOLA 4YE4L 2O5ZH 3TT1H 4FA6A 1AQ8A 1X7SA 2WUCH 1K6QH 4J3OH 3TONA 4KHTH 3ZHFA 1NUFA 5L88H 3D9AL 3WJLA 4A6YL 3U6XS 3VMOA 1W16A 1N68A 4GT7A 5JPNA 2FUQA 3GI9H 1XBRA 1H9DA 4AH2A 1AFVH 1ODAA 3RU8H 4Q9RL 4JG1L 1MFVA 1M42A 3DIFB 2NNAA 4EOWH 2G5RA 2Y7OA 3COOA 5AW4B 4BA8A 1ZLWH 1OWRM 4WKXA 4U1MB 4M7ZC 1UWEH 4U3XA 3T09A 2Y07L 3MR9A 4TVPE 3OJDB 1CLCA 3L5XH 4MZIA 3IDMB 2Z64C 4XBGA 3HMXL 2L4OA 1U8QA 4YVUA 4NKDB 3U2SA 5D9SB 1ZE3C 1M57B 2CJUH 3TVMC 4MB3A 4PRBB 5JDSA 3U82B 3QEUB 4Y1SA 3WN6A 1I1RA 3ETBF 2C9UA 1PS3A 1ML0A 4MSWA 3MPCA 5GJTH 3U83A 4BGDA 4YLQT 3B2MA 3MLXH 1E9OB 1CFSA 3B4NA 2F53A 3M17A 4GBXB 4ELMB 2UWEF 4MZ3A 3Q44A 1UH3A 2OSLB 4O02A 4Z7VF 1CDHA 2JKNA 3CN4A 5I71C 2D0GA 2IVFC 2YJQA 3NACH 2R0KH 1H6TA 5D2LB 4O51A 1TLMA 2N01B 1E3FA 1C5BL 2J12B 4ZT1A 3UTSB 2WB1A 1HXYB 4X50A 4AV0A 5KS9F 3AQZA 1FC2D 4TTDC 5D7KD 3VFVA 3OTTA 3IVKA 2B4CH 5C0RH 2F2HA 2OJZL 4UIMB 1HFUA 4G82A 2E7DA 4OGXH 2EAEA 4U1LA 3FB8B 4Z3EA 3BQUC 1KDJA 4DEPB 5M7QA 1KGCD 4JO8A 4QHUA 4XXDA 4X99B 4MJ2A 4N2LA 1PG7H 2Y4SA 3BX7C 4XVTH 2JJSC 5DJXB 1ZT4A 2Y06H 1P7QD 4RMWA 3RIKA 3NBNA 1OP3K 3HR6A 2ILLA 4LDOB 1DBKL 1YJDH 4IOSD 2A6DA 2ZSWB 4ERSH 4IHOA 1PJ9A 3CC5B 1CK0L 5C09B 2O26U 4NNXA 2AGJL 2BIPA 1DVTA 3MXWH 2ZUQB 5FYLE 1Z5HA 1XV8A 5CS7A 4IBSA 3KYNA 5IBUB 4BBWA 5LJYH 4JQVA 2FSEB 2EDNA 2VR6A 4HPYH 1IC5L 5INCA 2WXRA 1BAFH 3MCKA 1JPSL 1M6OB 5FYJU 2IPKB 3WNMA 5F6HJ 4PTTB 5A6MA 2DWDA 1V3LA 4B3EA 1W0WA 1JNLH 3Q8EA 2R4SH 1YYLL 2WQSA 2G0LA 3QDGA 1MCNA 3REVB 4AIXA 1Z5LB 4U6HA 3WNKA 4QRRA 4Z7WA 1R3LB 1FP5A 2CO6B 2EE6A 3TVMD 3HNTH 4MCZB 2A5UA 1NGWA 1Q0YH 1RK7A 3DO3A 4IGBC 3GSOA 5AOMA 5SWSD 4ZODA 3V4PL 2G2RB 4LOVA 5LBSH 4JRYE 2YGOA 1YHPA 2WIIA 4JHWH 1T0NA 3TWYA 4IBQA 3RZCC 1XH1A 2YZ1A 5CCGE 2GJ6B 4PCTA 4LPWA 3NCXA 1WCBB 3MBEB 5L0QC 1JV5A 3AREB 4XWGL 4PS4H 3UJJL 4ZUSA 2Q3XA 3VQLA 5JNYA 1YEHH 4PJXF 4WWOA 2H9GB 4HUCA 1HHKA 2FCBA 4BXVA 3VI4A 4NQVB 2ADJB 4EN2A 3OSKA 1A6UH 3IAPA 4RMVA 2GAZA 1FBIH 2A99A 2K1MA 5DJ0B 4P5MB 4ZUWB 1UXWA 3D87B 1EEZB 3L8QA 3C6LC 4AQAB 4ZFOA 2OS7A 4WFHD 3TCTA 2DS4A 4Y89A 3IE4A 4MQ7B 1QW8A 5E2VL 5B38A 4ZNCD 4F58H 3UABA 2X1QA 3WE1A 5EU4B 5E94B 5GSRA 3VU2A 1F58H 1YDPB 4G7QB 1IZJA 2ZOKA 3C09B 2J2ZB 4ZNEE 1MG3C 2C4FT 2D7TH 1FSKB 4H1LH 4Z7QE 4W81A 5J12B 5JW4M 4WHDA 5JHAA 3US9A 5EIQA 2D7PA 3VFSA 1FIGH 2H4EA 1KEGL 4PJAF 2WINB 2ZONA 3MFFB 2ZKWA 3MUGA 5IIEA 3LQAC 1MCRA 1GZQA 3UZEA 5IGXL 5C0AE 1BQHG 4P9HC 1M7DB 3FT3B 4PGCB 1H3TA 3WIFA 5CNHA 4MZRA 5HPMA 1XAKA 2WLYA 3WFHA 1KULA 2H32B 4FQHB 4I0PC 4WY7H 1U93B 1HT6A 4UUJA 2BC4B 4FA7B 4X83A 3Q2LA 2BS8A 4NP9A 5IJDC 2XETA 4XAKE 2BHZA 1O9ZA 3KLAB 3WDHA 1XR9A 3V6FA 4AUYA 2A73B 1KTBA 3SQOH 4X8JB 1ZLUK 1J0HA 4CKQA 1Q0XH 3BXNB 4JFFB 2ATPA 4IGBD 4HUNB 2JKTM 2X44D 4WWKC 3ZBMA 4G7RB 3UC2A 4W9LC 4PB0H 1A9VA 4AW4A 2YK1L 3RZCD 2XKNB 4XNZB 5GSVB 1OSEA 2VXTL 3QH3B 2VISA 5CINL 3GJEA 3MUY1 4HJGA 1T2JA 1YPZA 4AKPA 5DHMC 2CR3A 2PYEA 1MF2H 1KN2L 1O7DC 3CSYA 3INUH 3VGDA 5IB2A 1XVSA 4OKDA 1ZVNA 3TIDB 1P0SE 2FNBA 1AGBA 5HHOB 3K8KA 5JZ7C 1IJ9A 2Z31B 1P7QA 4LP5A 4PRAB 1XCQA 3L9RA 4U0RB 4HZAA 1J5OL 4QJ4B 4NERA 4IOSA 1YLBB 4PVMA 3KVQA 5SX4I 1JPEA 1JGUL 2NY1C 4FFVC 3TBTB 3C6LD 3KHQA 3FTWA 1VKXB 1BW8A 4X7EC 1RUKL 2DYRB 3T5WA 1S7RA 1C12A 4K7PX 4KTGA 3HI1B 2ENQA 1EO5A 2WXIA 3QIBC 2LFEA 3BIKB 5LAXA 1BAGA 4NN6C 3ZKXC 2HG5A 3RJQB 4F37K 2V5YA 5DJAA 2P5WB 3BOVA 3HS0B 2DL9A 2KHAA 4XNBA 5F3FA 1PLGH 4B9JA 1KV7A 3NVQA 4DGVL 1G6RA 2YWZA 5E5MA 1PZCA 4NWUL 2K45A 1GGUA 4FYTA 4U6VL 3TVMA 2K6ZA 3CIQA 3FBQA 2Y1YA 2V5TA 1KGYE 4NUJA 2P5EA 3ABKB 3RX9A 1MRFL 2NNXA 2QQKL 3ULUL 4I0PD 1BVKB 1LE5B 3E0GA 3RWFB 4M02A 2DJUA 3VA6A 2EC9T 3S96B 3RWEB 3BPOC 4NM8H 2DEYX 4BEIA 3R1GL 1JMZA 4HCIA 1G1OA 1L7TL 1NKRA 2V3EA 2OL3B 3MJ9L 3ZRFC 1B90A 2VZUA 1DBBL 1MJJB 3IKKA 2R2EB 4NWTL 2VM3A 1RP8A 1YSOA 1FHGA 4WWKD 1C1EH 2C9XA 2H2PD 3V4UH 3VG9C 4MNQD 1AR1C 2IMNA 2ZWKA 4YPGB 4N90D 2Y5EA 4P2QB 2YC1B 4R7NA 5FGCB 3VXTB 1QPKA 1JFQL 3PWJB 3DPBB 3OLDA 4G6JL 3BP5A 4D7BA 2VDMB 2GG1A 1PEWA 4YNYA 1CGYA 5IFAH 3KPSB 2X4SA 3QCVL 4ELME 4Y19D 5C3TA 1ESOA 5DC0A 2V17L 3FO1B 1L7IH 4JO1L 4N9GB 2YD8A 3FONB 4JJ5A 3C5XA 3DJRA 2WXLA 4MJ4A 1RK0A 4AIOA 3EFOA 2Y5TB 2IBZX 2NY1D 3FQUA 4FFVD 1BJMA 5D2LE 3QRLA 2XTJB 3MNZB 4FLSA 3KD4A 4E9QA 5ACZA 1NGZA 2AJYH 3I02B 2H5UA 1T0MB 1TLKA 5LCVH 1QOKA 3QIBD 3T4AB 1BDYA 3FRPG 4TVPH 3S36L 1A66A 3LZFH 2R0LL 4LEOA 1MXDA 4Z5RA 3AT9A 4DGWC 5FB8B 1A14L 2EEFA 1F02I 1F4WH 3DSFL 4ZUTA 4WJG3 3VD7A 4QHKI 1FA4A 1MEXH 5AKVA 1HILB 5TDOA 5E2WH 4L8CA 4EI6A 2FECI 3SKOB 5JW4R 1C16B 1A22B 2AXHA 1TENA 5H8DA 4YHLL 5E8NA 2ZOWA 4FX5A 3BRDA 3QNYA 5C09E 3RZCA 2VDKB 4HS8H 4XHJC 2XOTA 4WAFA 3WTXA 1HN1A 4NAJA 5DQ9A 4UQ9A 1M2OA 4WJ5A 3RGVB 4WEUD 1UA6H 3MODL 4QHLA 5I8OL 3MROA 5AW2B 4M00A 1NSNH 3L1OH 3FJTA 3PDGA 2VR9A 3IGFA 3WV0A 3DIDA 1OAUL 4NGHL 4QRAA 5E2TL 1QI5A 3ZPDA 2Q20A 1JDAA 1XGPB 1WGVA 4Z7UB 4AQ1C 1AR1D 4LSDA 2PR4H 4XVUC 2VLJD 4BQ6A 3ZE0F 5CZKA 1I1AC 2OBGA 2AJ3B 3CQPA 3VFUB 2VR4A 3FT1A 1EJ8A 3C6LA 3OKKB 1RZGA 2TSBA 5IEHB 3SKMA 2OR8A 4HBQA 3A6OA 1T21A 2C3WA 1YNLH 1D9KC 3KE0A 4FQJL 1BPLB 4ACPA 1HHHA 4MXWL 5F9DC 2R29A 4C47A 4MKMA 3RX5A 2GJ6E 2IPTH 2H26B 4BQ9A 1WFIA 4WW2F 2VN7A 2Q7YB 2MQGA 3D0VA 4AMXA 3JVFC 3BAXA 4P2CG 5FYLH 4PWIA 2AEPH 2R69A 1I3GH 2IH1A 3K6OA 3VGAB 4GRLC 5HYJD 2CO1A 1E50A 5EEZA 3GSNH 25C8L 3Q6GL 4AJYV 4UT9H 2WKOF 5ESQA 3HUJB 2XACC 2FZ3B 4AVJA 4I77H 4F1ZA 1D3CA 3F00A 4I0PA 4I7ZC 1ZA6A 3QQNA 3D2UB 3EFDH 2VXVH 4J6IA 4XR8C 3FT0A 3QFGA 1E40A 1KUMA 1OHQA 3APDA 5CN2A 3FCSA 1QSED 2DY2A 3KGRA 3GSUA 1BIIB 4G6FD 2E6QA 3OMNB 4KMQA 2CIIA 4KXBA 4RNRB 2JB6A 3AT0A 5K59F 5CMAB 4J3OC 1WIUA 3VXMD 2XFXA 5KYYA 3ZZSA 5CJ5A 3VX1A 1JTOA 4MNQA 3B8SA 3HZYA 4G9DB 1ANUA 3CN0A 4XHJD 4IEFB 3V5HA 1FN4A 2HX8A 2EACA 1HXKA 5C0DB 3DYOA 3DRTA 5D7SH 3DTDA 2VDPL 5DJZB 3QCUH 3QXAB 2Q87A 3TA3C 4HIHB 4AT6B 4CN6A 2PR9A 3BW9B 5BVPH 3D69A 1CXHA 2FT8A 2I27N 4Y19A 1EGJA 3PGFL 1D2PA 4U3CA 4DGUA 2Z6FA 1XGYL 3NFPB 1PU0A 3F12B 4AK2A 4XVUD 2WVUA 4ZTOH 3IS1X 5EUKB 5TPWL 4KKBC 1SOQA 2XA3A 5BPPA 1I1AD 1B2WL 1KXTA 1BZ7A 4JFFE 1H6UA 4L37A 2BP5M 5HGAA 1DJGA 1KGWA 1SHSA 2X9XA 1D9KD 1SN2A 2L8AA 1QPXA 5T1DH 3QIBA 4ZFGH 1F4YH 3EBGA 5AAWC 4I3GA 5EUOA 1RKRA 4X9BA 1RZIB 1P9MC 1UB6A 3JQOB 2Y6TE 3GMOA 3FC8A 2B2XL 3QJXA 1SVZA 4R7DA 1TTUA 4UIKL 2UZPA 3VGGA 4Y4KC 5JA9A 4RETB 4MCNA 1NGYA 1U92A 2DQUH 3EJZC 1UXSB 4GRLD 5HHPA 2GSIB 4FXKB 5D4QA 5DEGA 3VFGL 3DDFA 4JM0A 3SY0A 5DJ2A 5HHOE 2AERT 1A1MA 5F8RC 3VRIA 1UWGL 5JOFB 3K91A 2B4CC 1KJ2H 4LIQE 5EA0L 4MXVE 3D18A 4ODWB 1XZ0A 1EANA 1OP4A 1ZTXE 3FQNA 4OM0H 1XF2B 3BUBA 1SMAA 1JNHA 1L3WA 4PV9B 5F7KC 3IWVA 5D5MA 5SWZD 4BFNA 2PNDA 1X6NA 1MNNA 4G7SB 4I18C 3RAJL 5DLML 1JZ8A 2UXVA 2R15A 5E0QA 4N2DA 5AVTB 2UX7A 1A64A 4P4KB 5EO1A 2CAKA 1CGSL 2EO1A 1T7WA 2MH4A 1UZ8A 3SIKA 2QQNL 1YJDC 3P3TA 4J3OD 5I6LA 4CN4A 4JCWA 2P5WE 2X4RB 2IH9A 3L2LA 1J1PL 1UHVA 3ZU8A 4DZBB 1G1YA 1NAKH 1O6TA 5E5LA 5D7IE 5HP5A 4BFBD 2HFFA 2VLJA 1JGDB 1UOWA 4JHZA 2G0KA 3VFMA 4R97C 3L3IA 4ZOCA 2YRLA 1KPRA 2V9RA 1P5VB 4YFLF 4MMZC 2VKXA 4TLTA 1THAA 2NUTA 1DP0A 3TA3D 4TPRH 2HYMA 1ILUA 3FCTA 1NGXB 5F9WC 5IM7A 15C8H 2OMTA 1J5CA 1NCTA 2XHNA 3I50H 5J06A 4HC1L 5I15L 5EBWA 2R8SH 4WHTB 1C08A 2VQ4A 3OB0H 2DQIL 2K9UA 2OTWB 1XGUB 4APXA 4XNYH 1TYEB 5MEOA 5DMKA 1AD0B 4KKBD 3G9VA 1PZ3A 1X9UA 3KNBB 3OKLA 2BVOA 4HJUA 1CF8L 4K15A 5A16B 4CMMB 1S3RA 4LEEA 4WNSA 5HYJA 4GAAA 4YXKL 4AW7A 3NP4A 4X98A 3UZVA 1NCWL 5IJKC 2W9LA 1WTLA 4UM8A 4Z7VB 4LLWB 4AKQA 3MRHB 4FP8L 3JV6B 3QRBA 4GQQA 3EFFB 4L29B 2F68X 1SQ2N 4P2QE 4XN9A 5DK0A 1WDAA 2G3NA 5FGCE 3S5ZA 1MH5B 1JZFA 2HT2C 3D85D 3RYMA 1NPNA 4HEPG 3ZQXA 3IJ9A 1GJIA 6CGTA 2ZKHH 5A2JH 3RDJA 4Y4KD 5KS9B 1QSEA 4W4OC 2BSED 5EOTA 5D71L 3WLWC 5JHBA 3UJTH 3EJZD 4JKPH 2DH2A 3MLSL 2ADYA 3KPSE 2IJ0C 5KYXA 1U8IA 4HH9B 2XVBA 4JUTA 3IU3B 1UJ3C 3VGFA 3GF8A 4JFVA 1AI1L 4X0KA 4W9KC 1GY1A 2VLRB 2XX0A 5I19L 1X9RA 4G70B 4BCZA 3BE1L 3DSNA 3IDIA 4FQLL 3GO1H 1WC7A 4APQC 3KJ4C 1TITA 2XTJE 4CN1A 2X70B 4GXFA 1OAKL 1NZRA 1M7UA 2IG2L 3D33A 4MTMA 1KYUA 2XNAB 3LOWA 1QBMH 4NZTH 3MRLA 2BLFA 4O00A 1JE6A 4OLZH 1ZGLP 1DVFC 1FYTB 3SJVD 1VACA 3LIUA 5DR5L 3F3HA 1RERA 4WLCA 3MX0A 3LKRA 4O5LL 2PTUA 5CEXA 4AQ1A 2FB4H 3LNHA 3CFMA 4CDHA 4P5KB 1I1AA 2JKLA 3AS0A 4K2UH 1TJIH 2IWEA 1N0XL 1UA3A 3EG9B 3U7WL 4D0CA 2ICEC 2AJVL 1BFSA 3QIUB 4HJ0C 4UDTB 5E2UH 1E3ZA 1EZUA 3VXNB 4BFIA 4MB1A 1BFVL 2A6JB 1D9KA 1N5YL 3ZKMC 2RD0A 3IJHB 2B14A 4JFOA 3UERA 4C8XA 4XPHL 4LEXH 2K6WA 3X1GA 2EE9A 4IBTA 1ZY9A 3HVDA 4WI4A 4PJIB 3QWQB 3M8OL 1OAYH 4QHNB 2Z35B 2CLVB 1KJ3H 3NZSA 3MRCA 5I0XA 2Y7QB 5C2BH 4RAUA 4Y5VC 3MTRA 5FHAH 1VFUA 1W80A 1NEPA 5FM4A 4Q6KA 4Z7UE 3K5SA 2F7IA 1XF1A 2GW5A 3D50A 4D9QD 5FUZH 1IC7H 3P0YH 3UACA 3T71A 2HT2D 3MYJA 1M6UA 1LEGA 4IIQB 4ZPVA 5DFVD 1FL5A 5LWYH 3QE5A 2A9BA 2KUTA 2AVGA 4GT0A 4PRID 2OJEA 1A21A 4WI5A 4OD1L 2OSXA 4XGZB 3IDGB 5DQDL 4MXQC 4Y16A 2EDKA 4MDJB 4N1HB 5DRZA 1SM3L 3WNIA 2WGNB 5EIIA 1XBDA 4XP4L 3VFNA 5C0GB 2RR3A 3W9DA 2YSSA 5I8EB 3HLAA 4G7YL 3KPOB 4LU5L 2VDOL 1CT8B 2VDLB 2XU9A 1ZMYA 5IQOA 1IGML 5DUPL 4LKXA 4FFZH 5AFAA 4APQD 4FZEH 2CO2A 1E6OL 4JRXB 4S10A 5HDRA 4FN0A 3ULSB 1CZ8H 3L6FB 1NOLA 1UM5L 2WLIA 3TA3A 4PM1A 3HUJE 1WA1X 5LN4A 2Y7NA 3VFRB 5IP4A 1DVFD 1C5CL 5CLZA 1SN0A 2R2BA 4QYOB 3GXFA 4OZHB 3FO9A 1NMBL 3WHE1 1G9NL 4YXHL 4WCYH 4XP9H 1I1YB 5GIRA 5DK2B 2JF1A 3S5YA 1FGNL 4LRNL 3WEXB 3BPCA 1ORQB 1E5UI 3BVDB 4HJ0D 1JZEA 3V4PB 1B4JL 1EV2E 4HZLB 1DCLA 4MVBC 3G6JF 3ZKMD 4M3KB 4LSVL 2WB7A 5AAWA 1JF5A 2Z7ZA 3IU4L 1NFDB 3EJSA 5IB3B 1P9MA 3BZ5A 1Q0EA 1SY6H 2YJLA 3CHSA 3FTGA 2MSPA 1E9QA 3D85A 4FFWC 1JF6A 5EO0A 3TV3H 1CO1A 3A47A 4H20L 2KZBA 2WCGA 1MVYA 4WFED 1II4E 1HCFX 3IF1B 1Q9KB 4Y4KA 4ZQKB 4JDVA 3II3A 2BSEA 3OXSA 5CJBA 1DJXA 3AAZA 4DTGH 3VQ1C 3JV5A 3UGUA 1J8HD 2XWTB 2Y36H 3TH4T 4BINA 4NX0A 1RVFL 5JXAL 1BZ9B 4YVNA 2CJ3A 3SGDH 3ARFA 1HE7A 3QJFA 2AK4B 4MNHA 3O11A 3BAEL 3O6LL 5J1TC 1OAZL 2NY7H 3DX9A 4PREA 1CF1A 2O5YH 5BRQA 4I18A 4JW3A 4R0LB 1BZEA 2IDTA 3U0TB 5F96L 3RPIA 1IVLA 1D5BA 4OIIH 1IGTB 4AYSA 4WI6A 4LHUD 4MXQD 1UYWH 2FQFA 2EE0A 1NGQL 4OLXL 1IL1B 5FXCH 1C8PA 3SJVA 4HJEA 1E5YA 4Z0XB 3DROA 4AGMA 3Q8CA 1AGDB 3WL9B 2FTAA 3O2DL 4JHUA 3IJSA 1ECYA 4MMZA 3CBJB 5BZDB 1YEEH 2DMHA 4OLEA 4M7LH 1YEKH 2H32H 3FHAA 3ZDYF 4HHWA 1V8HA 3NAAL 2DQFB 2EH8H 2A4CA 3GZKA 4HWZA 4OF3A 3OZ9H 2WBXA 4JX0A 1HJCA 1V5JA 1FFQA 4I0KA 4HALA 4Z1PA 2GY7B 2N7BA 3DX4A 4ODVH 4JHVA 4O2FA 4F2MB 1DO5A 5CBAA 4G7VH 2GSGA 5I73C 4BRVA 3B9VA 3LPPA 2VLLA 4MCMA 1IBYA 1QP1A 3I75A 1MELA 4J1UB 2UZIH 4FMKA 4TNEA 1KLUA 3ZIMA 2FYYB 4L9LC 5IJKA 3BH8A 4HIEA 4IS6B 5DD1H 2R23A 1INEL 4M29A 4MVBD 3HPJA 1TTBA 4I2XB 1HL5A 4EN3B 4G1MB 3T1WA 1AIFA 3V0EA 3RTQB 1GGCL 1RJYB 4FFWD 1JUFB 4N28A 3VD2A 3CVHL 3U6RA 4I3RL 5ENWB 2ZUTA 4MA7H 2YKLH 4BYHA 3QUYB 3WDIA 1TZHA 3P0VL 4W4OA 1A3RH 4PRIA 1XGRB 1MNUL 2R56H 4HFWA 2GHZA 4KMTH 7FABL 3EF4A 4R96B 1ZTXH 1UJ3A 1KBWA 4D0BB 4P9ML 2HMIC 4CVUA 3GHBH 1MIMH 4HGKC 1KCSH 1JTPA 1VFAA 2NW3A 5IJCC 2OJ1A 2PWEA 5DC2A 4ONOA 3DO7A 3HKZA 2WVTA 1QEXA 4QT5B 2LV4A 3ARSA 3OR6B 2A83B 1P4BH 4UT7L 1NBQA 3RG1C 1D7FA 2N59A 3LS5L 2XZAH 4Z7VE 2RTTA 3CTTA 2ITDA 3II1A 3ETTA 1SUJA 4GJTB 2QPFA 4H1LA 3ZT7A 5FCSH 1X5FA 4BUQA 1DSWA 43C9A 2OMZB 1DVFA 1NLBH 2LHAA 1BFTA 3ES6B 3T3PB 3PAVA 2ROXA 3IJYA 4G6KL 5HBBA 1UCBL 2UY6A 3G5VA 3MOBL 1A9BB 3OZKA 5E6ZA 5KS9E 1PX3A 2IFFH 4X4ZA 1ASQA 2ARJA 5KSUB 1TTAA 1QYGL 2Q3AA 4AIEA 1RULH 2YXFA 3IDNB 2QR0B 3S37H 1EDYA 2ICEA 2AJXH 5TE7L 4KNQA 3BDBA 4IRJD 4TVPD 5IVOA 5DRWB 1A6PA 1DANU 1WJ3A 1BD2D 2W9DH 3VFPA 1J10A 2VLRE 2L3BA 3EYVA 2WLHA 3S8FB 1TQVA 2B20A 3CDZB 3NABL 4KX9A 3AU0A 2VRQA 4KRPC 1QNZL 4YBLC 4XMPH 4JCLA 4UQ2A 2FO4B 2OL3H 4JY6B 3U36A 2JV6A 2VQUA 3NZHL 3LMJL 1R17A 3AITA 1Z9MA 1HHIA 1KBPA 3R0NA 4OJYA 4U49A 4YDJB 5HDBB 3BP7A 1J8HA 1FYTE 3MCYA 4MLSA 4Y5VA 5ANMB 1SOKA 4PJCA 5IZ7A 3SOTA 1RJZB 4EPSA 3BVVA 1S9VA 4JRLA 4BH8B 3ATAA 4EJ1C 1U8CB 3CZEA 5F9OL 1MCPL 2RALA 5ITBH 1N64L 4HWBL 3B3BA 3LX9A 3BSZA 2VDMH 4JVWA 5E8OB 1LL1A 3OHXC 4D0DB 1ZK5A 5D7HA 3PP3H 4GO6B 5ELIA 2IADB 5DVKA 1CXEA 5H35B 4PYGA 2QPUA 3JZ7A 4JG0L 2ZX8A 4LHUA 1JPST 2MPAH 2ED7A 1X5AA 1PD6A 3ROLB 3O45A 1E4WL 1ES0B 1CGXA 3S37X 1GC1H 3DXAB 4IRZH 5LLIC 5ESAA 2WXGA 1RZJL 3H42L 4YHYB 1J0ZA 4BKLB 1KCVL 2CBMA 5DJYA 3IMBA 1XH2A 4N8PA 4OFKA 5GGQL 2EECA 5C71A 4WW2B 4UM9B 4FHBD 4XC1L 5DWUH 4JBSA 3UYRH 3X12A 3N40F 1UFGA 2VL4A 1IBBA 2PYFA 2B1HL 4ZX6A 3QUKA 3KCWA 4P4RA 4U6YA 2YAHA 2YD7A 3Q5OA 1L5GB 1NKGA 5FYLD 4V11A 4EUPG 4Q0XL 3EYOA 1QWHA 4CADB 2V3DA 3DOHA 1NFIB 4BK4A 3AY4A 3STLA 5IG7A 3FQ1A 3NT0A 3ETBJ 3RPBA 1B0RA 5HSFA 1KTLB 1DBJH 4YDKH 5AYUL 1M2VB 3CSPA 1AKJB 1OB1A 2VDKH 3AG1B 5F1IA 4AQOA 1M05B 4ONGL 1B4TA 3U7YH 2V2XB 4AYBA 3QULB 3WXVL 2G3ZA 4LVHC 4WV1C 3F7LA 1U8NA 3I85A 4GSUA 2DD8L 1S7TB 5I1HH 4GMTH 4JRXE 5IHBA 2Q6WA 4H88H 1K72A 1I85A 3HG4A 3HI6L 3PWVB 4XP1H 4HLEA 2VZ1A 4JRYD 2NY4B 1F90L 2EDJA 4O02L 1CDCA 4NQSB 5FW7A 3V6ZA 4HJJH 1S7WA 1DJIA 3O0RL 5I28A 3HAEH 4NN7C 3FB6A 2XT1B 4OZHE 1QNIA 1C8QA 5DD6A 2BRQA 4UU9B 2F58H 3FCGA 2FO8A 4KMLB 4IDJL 4NCC1 4HIQA 1NGPH 2D2OA 3NH7L 4QRTA 3F01A 5KVFE 2Z1KA 2GC4C 5KTEL 2PPAA 5CZRA 3JYCA 1IC4H 2AABL 1MHEB 3GSVA 4PTUB 3SPIA 3BISA 2H0FA 5FYKU 3RX8A 4W9ZA 1PZAA 3UBXG 5L9DH 3TBYA 1NFDE 1U8PB 4XN4A 5MHSE 5JOEA 3ATFA 5I6NA 1TF4A 3ZTCC 4YHPB 3QO1B 2OK0H 3AXLA 2YMXH 4JQIL 3N91A 5D1ZB 3CSBA 3BSGA 1CYWA 3BMWA 4TULH 4KJYA 3U1PA 1DTUA 1MHCB 5EORH 1ZGLM 3P4MB 2Y5QA 4E9TA 1AACA 5LCVA 4P3WA 3MLWL 3BIBX 3QYCA 1ONQB 4IRJA 4EZJA 1YQVL 3IBEA 1NEZG 1AHMA 1IM3D 1A6WH 1TFHA 3ECWA 3N1MC 4TUKL 3ZYJA 2QSCH 2AK4E 3H4HA 3NJJA 3LD8C 4XN5A 5GGVY 2CJTA 3VCLB 4JN1H 2ADFL 1A6ZB 2H6OA 5B1BB 5C0AD 4OGQC 3V0IA 4ZRGA 4FRWA 4JM2F 3GBML 1DVUA 3WIHH 2X28A 3OLEA 4XMLL 4LDCA 2DI9A 3FU0A 2XWCA 3TYGH 2A6KA 5CWSB 4M6NL 4Q9CA 4L1TA 4R4BA 4XAKD 5F93C 1BYPA 1RUAL 4GINA 1NMAH 2IGTA 3ARDB 4J3UA 1AXSB 5CEZL 4PB9H 5DDHB 4ZOAA 5KJRL 4WFGE 4LSRH 3CLEH 4RMSA 4N6RB 2ZF8A 4JHBA 5F7EL 3S8GB 4EKJA 3H2WA 3KMDA 3L4VA 4R7LA 2X4PB 2QQQA 2VDPB 4GEJA 3TBWA 2X4NA 5D6CB 1GAFH 5CSGA 2FX7L 4Z95H 1JPGA 5FYJL 3QA3B 3D4CA 5A2IH 1NFAA 2Z3FA 5DRXB 5K9JL 4B95C 2A4ZA 5J1AA 4ZMQA 3ECUA 5FF6B 5IOPB 5JQHC 2YAQA 4U1KA 5EZIL 4OQTH 4AGOA 5EOCL 2Q5BA 4X7SH 3DKHA 1RIHL 3Q13A 5IQNA 3NRFA 4YFEA 4GBXC 5IQMA 4TL5A 4L8DB 3PG2A 3QHFL 4ZOBA 1JAEA 4L3CA 5BJTB 2L0DA 1KYAA 4XPBL 4F2FA 1PX4A 2JI2A 2NY2B 4I2XE 4UQ3B 1Q1PA 2P7TA 4NUGH 3HB3C 2CBTA 5J6GB 2OCFD 1MFCL 1P2CA 2AEQL 2HH0L 5G4NA 1P7HL 4M5SA 4FGMA 4Y2OA 3FH5A 3NN8B 4KUZL 1V7NH 3GSNA 3BKYH 3S5LB 3VXQB 2YGNA 4UT9A 2CHDA 5AVWB 1PY0A 1KBBA 4ZYKB 3VDAA 2P8MB 3U4EB 5CU9A 1R19A 1ZWIA 2WNKA 3WGUB 1S46A 4DEPC 4GG6F 3F7QA 5C0IB 2AF2A 5DUML 3TTYA 1RIVL 4NN5B 1A3LL 1JI2A 3U6XA 2D3NA 2WM0A 5DHYA 1WP6A 4GXUN 1J8SA 3E6HA 2YLHA 1J5IA 1BJ8A 2LQRA 4PY7A 3Q0HA 1DSYA 2LT9A 2P46B 4JRYA 3FQ2A 3MYZA 4GXVL 4HEME 3QUHA 3PQYB 4JR9L 1A6VH 2MTPA 3EZJB 3U4BH 1TEGA 1UWXK 3OKMB 4U1JA 5A2AA 3F62A 5KBNC 4H26B 2Q9OA 4ZFQA 3W57A 1DBMH 3P30L 5FA4B 2ZUQC 3T3PE 4G5ZL 1JZ6A 3KJ6H 1X7QB 1PYWB 4H0IA 3QEHB 3UTTB 43CAB 1KV3A 1BG1A 3OKDB 4B9GA 4ABUA 3AQXA 1Q9WA 3DUSA 1A4KA 2HFEA 5F8QC 2CLRA 1ZPLA 3QUMA 4WI0A 3RZWA 2I5YL 1QZNA 3K4AA 1DLHA 5CSZA 2EEBA 2M2DA 1FFPA 3LQZA 4W9GC 3ULUE 2L7UA 3RWIA 3ZYIA 1RI8A 1NOAA 2XPZA 5I1IH 1RQ5A 2LR4A 1V3JA 3DGCR 1T1WA 2FH8A 3CBKB 3JBG7 1WZAA 3RDTB 3UMNA 1JHKH 5H4YA 3WFZA 4GBXD 5TE4H 1NCJA 3LHAA 2HRPL 4FQXB 4AKOA 4ZNEA 3IAGC 3U25A 2HVJB 5HDBE 5K9QG 4L9DA 5ANME 3HEIB 4PJ7B 1U8KB 3MBEC 5DQJA 2EKSB 3AREC 1IM3A 1LHZA 2E7BA 1SDDB 3CDGA 3ABGA 2Q86A 1U8HA 3Q2CA 2IGFH 4RMUA 2BSSB 5C0AA 4HU2A 4R2GB 4DGYH 1KOAA 3UTSD 5E4EB 3X3FL 3BO8B 1I8IB 3G6DH 4RFEA 4JL2A 3IB4A 2ZJSH 2EADA 4YE4H 2IEPA 3ZE0E 3L7EA 3VH8B 1KJ2A 2EIKB 3D9AH 3CZJA 4A6YH 1TJGL 4W9FC 3DXAE 2EYTA 1TKWB 1BQKA 1QVOA 3MLTB 2NDGA 5JIQA 4MAYB 4LOFA 3L1FA 4C59B 2IBGA 2RB8A 4WV1A 4Q9RH 4YEEA 1GYCA 2ATAA 1K85A 3C09C 2XWJA 2XWXA 4KXZI 3GBEA 2XWEA 5J12C 5C92A 3BGAA 3OC5A 3MI6A 1UOLA 1EJ6A 2PP9A 4J28A 1ZHNB 2Y07H 4YR6A 2DWSA 5IESL 4LLVB 2G5BB 5C09D 5FPIA 2Z8WC 1CFBA 3EH2A 4NO3B 4DIXA 3GMQA 3HMXH 1N59B 3QQ3B 1M9SA 4ETQA 5I0WA 2GKIA 4JPIB 3RWGB 2YEZB 3O3AB 5ICXA 5C0JA 3LRSA 3IMVA 4N0FA 5HGHB 1ORSB 5T33L 3CLWA 3SDYL 1RHHA 4HF5L 5DJCA 1KIPB 4WSJA 3RWJA 2Z0UA 2XLLA 2Z7YA 3CZFA 4MWFA 2D03L 4ABQA 4URTB 3UPRA 4X5XB 3EDKA 1A1NA 2AV1B 5BZWB 1G7HB 3SODB 5K59E 1X5IA 3MCG1 1H3VA 1B3IA 3JYBA 2H8PB 2KPWA 2XQYA 2ZKXA 4QXVA 2ZCLL 1UCTA 5BMFL 3G6JB 5KOVC 3MRNB 4U6TA 3D25B 1YEFL 4XNZC 3V5DA 1XDTT 2M26A 4DKAA 2GJ6D 3AWGA 3T08A 1GMIA 1PFOA 3MBED 2OJZH 2Q10A 5CGYC 2ICWA 3CC1A 3ARED 5E2JA 1A25A 1AOHA 1FNGA 4ANKA 2C8NA 2WVVA 4BQ8A 3GQFA 2BS9A 4AZUA 5HHVL 3QJUB 1S8DB 1T3FA 2MNUA 3OMIB 5GS2H 2Z31C 8FABA 3QPXL 3MV01 2E9IA 2P24B 4G8IB 4U0RC 1SFHA 3KGSA 5EN3A 5B38G 4R8WL 4XO5A 1AC0A 2VXUL 2IOMA 1CK0H 3F7YB 5I2IB 4CL7A 2DQ6A 1DVXA 2AGJH 4XPTH 2QZ5A 2VDOB 1EAPB 4K73A 3TL5A 4PY8J 3DIFA 4J27A 4ZMXA 5AL0A 2EILB 3OJ2C 4U1MA 1IC5H 3DX2A 3HS0C 1TJMA 4XMXA 3OJDA 1ED3B 3A24A 3IDMA 4E42B 1E4JA 5KJ4A 4K71B 4AEIL 3CWGA 5GRJL 4TQEL 4Z7AA 1R24B 1YYLH 4NKDA 5AAMA 5D9SA 5B4MC 4IOIB 4PRBA 3BEWB 2XYBA 5D1QB 2VWEC 3QEUA 3BN9C 2Y25A 4JFTA 1R6VA 2ZOLA 3P2BA 2PETA 1S7UB 1FNHA 3ZR6A 1MSPA 1Z9LA 2V9QA 3V4PH 4XN8A 4UBDC 4GBXA 1E9OA 1GGYA 5FKPB 4ELMA 5CO1A 4IIZA 2CDFB 2OSLA 4TSAL 3RQ3A 1KXVC 1WHOA 5AW9B 2QMKA 4LL9A 4FKEA 1J0JA 1XFPA 5D2NC 1EDHA 2QHRL 3DHPA 4XWGH 2MPVA 5D2LA 4MHHG 3N5AA