3LYRA

Human early b-cell factor 1 (ebf1) dna-binding domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
211
Chain Sequence
b'GSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor COE1
publication title Structural Determination of Functional Domains in Early B-cell Factor (EBF) Family of Transcription Factors Reveals Similarities to Rel DNA-binding Proteins and a Novel Dimerization Motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator
total genus 44
structure length 211
sequence length 217
ec nomenclature
pdb deposition date 2010-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16422 COE1_DBD Transcription factor COE1 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3180 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lyrA00
3LYRA
chains in the Genus database with same CATH superfamily
5F7NC 4JO4L 3V55A 1GSMA 2ARJB 3BVNB 1ITBB 4FD0A 4LSUL 3QUZC 2UV3A 1KDJA 1U8LA 3FUDA 2QLVB 3FPXA 4ZFFA 5DVNA 3S5ZA 2X4RB 2V4LA 4DAGL 4PRPB 5FAAA 2FNBA 4RFEA 3QDGB 1JZEA 3MJ9L 3SGKA 4OIFA 2IWGA 3UYPB 3SE4C 3GTNA 5AB9A 3F12A 3L4ZA 4OV5A 3X3FL 1C5DB 1HS6A 1EFQA 2R69H 2CD0A 4K8RC 4Q6YA 5KW9H 5E24E 3FT3B 3F58H 1TZ8A 4N2BA 5DC0A 2VXQH 3QUZD 2D0GA 1RPUA 4NNPH 3QRFM 3MCG1 5HHVH 4QXUH 1XH2A 2OMUA 1HKLH 2Y0SA 4JO3H 1NGQH 3KYOA 4JPWH 3BLPX 2H45A 4ELMA 2G60H 4KKAC 2V33A 3PDGA 3VU2A 4EUPA 2HLFC 1KGUA 1TCRA 2MKWA 1MFAH 3GK8H 5E2WL 3D25B 4TL4A 1KTRL 2AJVH 1H3GA 4K8RD 1UB6B 3LKOB 4ZMOA 3EH3B 3KPRB 4WTZG 5D93C 1A9EA 1JF1B 1QWUA 3CMGA 4YDMA 1OVZA 3BPNB 4KXDA 2IJ0C 1BF5A 1YYLH 1Q1PA 5IVZA 4FCAA 4LRIC 1UXMA 2VC2B 3UZEA 5DZJA 4IKNA 2QPFA 2V9QA 4LCVA 5FS5A 5T1KB 1BFTA 4N8VA 4KKAD 4F58L 3BKCL 3TTYA 4PB9H 3RKPA 2HLFD 3FOMB 5DFVC 1A7PL 2Q76B 3F2LA 3AQDA 3HIZA 4GH7B 5BQ7B 3QIUB 5HVHC 1HILB 2Y7LA 4LPUA 5AYUH 3N42B 4GT0A 3WEMA 4E9XA 3IJYA 1XB3A 2DQTL 2ENPA 3ET9F 4HBCL 4NRXA 3A6BH 3DOSB 1A0QL 1OOWA 3CFKB 4LCUA 4MDJA 5EA0H 3Q3GB 3RIAK 3T1FB 3CZSA 4H0HB 4GRWF 1KGCE 1UA7A 3LH8A 1L9QA 4X0KA 4GRLA 3FRPA 1QTSA 5KBMA 4GKOA 4P2OA 4X5RA 4FABH 4FYSA 5DFVD 4LSVH 2BVEA 5DVOA 4PH8A 3WBDA 2ENQA 2NR6C 1ADQH 2OXHB 1B90A 1PKQE 1R3LB 3RWCA 4Z3JA 3QUHA 4G8FA 4H8PA 1KIUB 3PNRB 4HIXL 1YPZA 3WD5H 5DI8B 4ZAKB 4ONHA 4XMWA 2WQ8A 3WJMB 4Y2NA 1JK9A 2VN4A 5BJTA 2OPCA 3LZQA 3ESOA 3NFPB 3EHBC 1K85A 1U9KA 1H8SA 4M9PA 3OR6A 2Q5BA 2OQJB 5L6YH 1F4XL 2PO6A 3RZWA 4HEMA 2O5YL 4UTAA 4UINH 2NR6D 1NBYB 3GLDA 2V37A 5F3BB 2H1PH 3D0LA 4NKMA 3H4FA 1V3LA 4EVNA 1MAJA 5BXFB 4DF9A 2E4FA 3ZGHA 4JFXB 3QRGL 2BSEA 3JT2A 5EZJA 2I9TA 3NCJL 1XVSA 5A6LA 4OT1H 5EEWA 1M1SA 3L48A 3EHBD 2OYMA 4G6FD 3ZW3A 1ZT7A 3DO4A 4Y4HA 5CBEA 4Q4IA 3RTLA 1HDMA 1MVFA 1F1GA 4QYAA 4N90D 1TETH 3OZ9H 3F6JA 3LVTA 5KZCB 4JFEA 1FIGL 4PJEA 4F7MA 3NMEA 2DIAA 4UOZA 4PUBL 2YHGA 1RHHB 3WNMA 1J0KA 1H5BB 2A2QT 1BMGA 4X7SH 3L7EB 3LXBA 5JR1H 5FUCC 3ZRCC 3MXWH 4F80A 3VQ2C 3GIZL 3D69B 3GBEA 5GRVL 2GJ6B 1JRHH 3C5ZA 5FHBH 2XJKA 4JQVC 1MCDA 2NW3B 1HZHL 1IAIM 4V11A 2WKGA 1IEHA 3WJLA 1NCHA 2V3EA 1A5FH 2X5PA 3WENA 3O3EB 1OWWA 3KGTA 1COBA 1T89C 4PGCA 2BNUA 3G5ZB 3D52A 4EIZC 3HOGA 4Q97A 3MX0A 3T0EA 3OKKB 3WY2A 3AGWA 2DWDB 1NCCH 4J4PA 2G2PA 2FAUA 3ROOB 4IGBA 5F7AA 4EN2A 1G9ML 1UXSB 8FABA 4AIZA 1W72A 2XZAL 2EDHA 3ATFA 5C0FB 2YD1A 3BD5A 5FA3B 3T2OA 3P9LA 2XZZA 4YAQB 1NDTA 1PKQB 2J57A 5KN5B 4FEMA 2G2RA 3ZKXB 1GL4B 2HH0H 4MMZB 2QT6A 4HK3J 3MQIA 4QEGA 3VG9B 1XGQB 1Z32X 3SY6A 1JHTA 2EINB 4NFDA 4CN1A 1EGJA 3NG5A 1ID5I 1BV8A 1RUAL 3HMXH 4PJDE 1WAEA 4MA7H 2ZX7A 1TCMA 4Q9BA 1GAFH 4A66A 1NUGA 3MRJA 1GVIA 2WXGA 5FO7B 5EEXA 2XKNA 2VXUL 2IDCA 2KZKA 4A2DA 2P80A 3ULSA 5GRJH 3EOAA 3VGAC 3IMBA 3ILEA 1NCNA 1UXLA 4R90H 1JWSA 4FQXA 3FTVA 2W95A 1FDLH 4M4PA 3FQWB 4L9LB 4JFZH 4LVNC 1JPFA 1TPXB 2OR7A 1A9BB 4OCRH 2YBRB 3QS2A 2R4SH 3CVIH 1IGYA 4MD5B 1YN6B 3MVSA 3QA3A 4LEOA 4LPYA 2CNZA 4ZTOH 2VDNL 3TPUB 4U2YA 5DJCB 4JFPB 2A9CA 4PJFA 4I0PA 2APXA 2Z31A 4I48B 1HSBA 4TYUA 1DQDL 3I6GA 4JFFA 4N8CL 1LE9A 2D9QB 4MWFA 1OAUL 5DMIL 4NRYB 4JKWA 4M03A 1JXGA 2OW7A 3EJZC 4YXLH 4KVCH 4QHMB 1Z9OA 3S4SB 4Q2ZA 3UACA 2BNRD 5I0VA 1CD1B 4L8BA 2ZCLL 3PUUA 3G6JE 4QRPB 2ZKHH 3OLIA 4QLWA 1QTYT 2DLTA 2Y07L 5BRZD 3CQPA 3VVWA 4Z7WB 4IKLA 2NQ3A 2YLHA 3WV0A 3GNMH 3D3VA 3O9WC 3IDXH 2HSIA 1N4XH 1PLBA 1VFMA 4HHAA 3ZPDA 1MFEL 2X4UB 4AZUA 3WTTA 1I31A 2IDFA 3E9UA 4TNWF 5TE7L 2IPTH 4U4IA 3EJZD 1DE4B 2VR3A 3NESA 3KLDA 2YFNA 3RL1A 3QI9C 1DVFA 4XPGL 3CFJA 2A3TA 4LO9A 4JRXB 1BGXH 2VIRB 3OR7B 4AWJC 3VRJB 5CCJA 1JTTA 5AKSA 3FTGB 1VDGA 4BCXA 1HK6A 1BVKA 3O9WD 5DA0B 1BVLA 3U0WL 3QDMD 4S0TD 3DIVA 4GKSB 3KWWA 4XB7A 3V52H 5IB5A 1MNUH 3LMJH 1FL3A 4XNXH 1MCCA 4R6UA 3TYGL 2OKMA 1NMCC 3RJQB 3QI9D 4I3SH 4NM4H 2BP8A 1C8QA 4J3OC 2VLRD 4UQ2B 1TF4A 3O0LA 3HS0A 4KFMA 3VFPA 3LEVH 4FFZA 5FOBB 3VWJA 5JPNB 5MENA 1A7OL 4NZUL 4L3AA 1HL4A 4B41A 2H4EA 3ZHDA 4W93A 1F97A 3QNYB 2O1AA 1Q0YL 3OBAA 4X4YA 2ETWA 4JPVL 2AEWA 3ZVVA 4HH9A 4JG9A 3VH8A 1YQVH 4MAYA 4JZNB 1AS8A 2E9JA 5JIIA 1BHGA 1AGBB 1W91A 5C97A 2XN9A 4ZJ9A 3WIHA 3OKOA 2ZIDA 1YEDA 1KG0A 4J6IA 2IOIA 1A6ZA 1T5WB 2X6BA 4LL4A 4OKVB 2M2DA 4J3OD 4PRHD 1URIA 5AW5B 4YSDA 2FH8A 3BE1L 4GMTL 1DEEA 3NJIA 4JAMB 5E6SB 4XN8A 5I6MA 3B43A 3EDJA 3QZWG 2KLTA 3TZVC 2OXGA 3JWNC 1SGKA 5D2LF 1CN4A 1QEWA 1VFUA 3N1QC 3QO0B 5AW9B 3ULUC 1KWGA 2QKSA 3KLSA 4IK7A 2NX5E 1B6DA 4NLHA 3TO4D 3GSNL 1FORL 4NBXB 4P04A 4QKTA 3B2MA 5AVQB 1ZS8B 3VXUA 1AS7A 1CGTA 3QWRA 4UIMA 1DQJA 3H3PL 1B88A 2YPLD 3RILA 1O6SA 5FKAB 5FYLE 3U4AA 3NEOA 5FHAL 2YRPA 3VXRE 3WFBH 3TZVD 5ADOL 4AK2A 2EYSA 3ARRA 7PCYA 3F7PC 3ESVF 4XVSH 2XT1B 3ULUD 2DYSB 3MR9B 3V4PA 4M4RB 5CIPB 3H3BC 2OMTA 2YKKA 2H6OA 4P2QD 5DRZA 1NMBL 4G2AA 4GW1B 2BRRL 1DJGA 3T8MA 3SPVB 2NCEA 5AYTA 3KPLA 4UDTB 2X2YA 5JNYB 3MBEA 1QPPA 4NENA 3HPJB 1JGEB 4QOKE 1SOSA 4NUPA 2G3NA 4GI9A 5B1KA 2ZICA 5BV7B 3EYSL 3VX1A 1MVUA 3NSDA 3DI3B 2R2HA 2R29A 1F18A 4KMTH 5I17A 2H2SC 2O6CA 3KHOA 3QULA 2YPVL 5DYOB 5EO1B 1FL6B 1RZIB 3BEVB 5C6TL 2LR4A 4HUNB 4JZJA 5DJDB 4PCKA 2UUDK 3FKUS 3ARGA 5F9JA 3V5KB 1I7ZB 5B3JF 1E4XH 3POCA 4UCFA 1AQ8A 4L8CB 4DVRH 4EJ1C 2EIKB 1YNKH 3WG7B 1E5YA 4NZRH 2AW2A 4IRZH 4Y88A 3DGGA 1JFHA 5JIDA 3D05A 1H0DB 1JK8A 3FF8A 4LBEA 2H2SD 4XCCL 1N64H 3QH3A 2MCMA 3K2KA 3GGWB 2VQTA 2M26A 2NYZA 2VWEC 3FU7A 4AJYV 3V6OC 1FE8H 4HJ1A 3RE0A 4RMWA 3O6LH 5BZZA 4PJHE 4A7QA 4CW1B 4LASL 3VI3E 3GSNB 4B0MM 1ZJAA 5IB2B 1RJLB 1IQDB 5ITBH 3ELQA 3APFA 5C0JB 4GG8B 5F96H 1HOCB 1IVLA 3N1MC 3STLB 1D5XA 2YMXH 5J56B 2WB1A 2C1OB 3CZJA 3RFZB 1F86A 4AGQA 3ELAT 4TVPH 5AOZA 1KT2A 1FYTA 4OM1H 3VFNB 4H7VA 3ISYA 4RLDA 2VISA 3MODL 5LCVA 2Y2TA 3UAAA 2NX5B 3WFZA 4DW2H 1E9PA 4E5XB 3HNTL 1ZSDB 1HE8A 1A6AA 3HZMB 3QORD 5LDSA 3C6LC 2DV6A 4GW4B 2WN3A 2QBWA 3ALPA 4R4FL 4LCWD 2RB8A 3NCYS 3O6KH 3U79A 1WAAA 1MDTA 3IU4L 3PHAA 4G83A 1TU2A 3AU1B 1PL3A 5EOQH 1N3NA 5EPMB 1WPCA 3GMLA 2LAGB 1OM3H 1BFOB 5E2VH 2A6KA 5FYKL 2AXFB 1KIQB 1S9VA 3SKMA 2E6QA 3VD5A 4DTGH 1D5IL 3C6LD 3O6MH 5D7IE 4Z7AA 3LZFH 3KPMA 1JD7A 3FQ1A 1Q4NX 1PVHA 2ZP9A 1CXHA 3ECWA 1QRNB 4P2RB 1VRSA 3A4FA 3NIGB 2J8HA 3EGDA 3PHOA 3MC0A 3T0VA 4QXGH 3ZMEA 1URLA 2AABH 4KQ4L 4S10A 4Z7OF 5JXEA 3DYOA 3PDOB 4AZ8A 4YBHA 3CFIC 2VKXA 2ZCHH 5DD3H 4ICWA 4IDJL 3X12B 1NLBH 3F7YA 3LV3B 1G1CA 2CGRL 3FTWA 4R7LA 1BQHA 2VZ3A 1LDPL 2HJKB 2XXFA 5CU9A 2NZIA 2E74C 1L9SA 1OTTD 4X8JA 1MHCB 1ZE3H 2H6PA 4ODXA 5IB3A 3RUGA 3MGOA 2X2JA 1EAJA 4JREB 3Q8BA 3WN5A 1NCGA 1E3FA 2Z92B 3VRIA 1GC1C 5HHPA 1I1CA 1MPAH 1XH0A 1V10A 2UZPA 1ORSA 3NIFF 3IU3B 1T1YA 2NY5C 1LMKA 2PW1A 3II1A 4EEEA 4N0CC 1MCWW 5D1XD 5D1XC 3U2SB 1WBZA 4NN6B 5DC2A 4MXQD 5JMOC 1DANU 3CFDA 3VI3B 4B27A 1ULVA 1J8HA 1OIOA 3FT2A 2YXVA 2GQHA 3LKPB 1KN4L 3BVVA 1OLZA 2PYFB 5DZOA 5TGBA 5E00A 5EORL 5SWQA 1OSYA 1TQSA 4W9IC 3TV3L 4H1LG 3IFPA 3JWOL 1DSFH 4JPKH 4N0CD 2ISDA 2IQ9L 4G6MH 2K6WA 2G4EA 4HAFA 1HQ4B 1SYVB 1YJDL 1JXKA 3EBHA 5BRQA 1E2WA 2C8NA 4JFHE 2BPBA 1P7KB 3F65A 5KVDE 4NJ9H 1OCOB 4NZ8A 3REVA 1BEYH 4XCEB 4AT6B 4JM2A 4P8QA 3VWKB 3O4LB 3O2WH 2PETA 2DAVA 4TQEH 2DQIH 2IG2H 5GHWH 5DUMH 2IBGA 2DQGH 2J8UE 4HK0B 3QZLA 3ULVL 1H9VA 2GTZA 2CG9X 2Z0UA 5T1DL 1UD5A 1EEZA 4YQXH 2ATAA 3LIZH 1MRDH 3RX7A 4APQA 1F45A 1AH1A 3RY4A 5D7IB 4HULB 3IVKA 5EN2A 1RK7A 1IZKA 1B0RB 4YHYC 3GFUA 1KJVB 2F8VA 4RSYA 3U2IA 4XO5A 1JNHB 4AEIL 1SXNA 1HAUA 1I75A 4M3KB 4DUVA 1FO0L 5I1DB 3ARXA 35C8H 1JG9A 4UQ3A 2XWTB 1WZMA 5CN1A 2C3XA 4FQ1H 4X6DA 5CNHA 4YHIA 3NTCH 2BIMA 3WMPA 1AZVA 1XHHA 3T4AB 2VDKL 2K8QA 3M8OH 2XTJC 2C7UB 5C0DB 1K8DA 4OCYH 4YHPB 1KEGL 1PIGA 4PJIA 1NOLA 1YEGL 3DVGB 3LHAA 3JTTB 3MV8D 2FEDC 4X83A 5DJ2A 5EC2A 1ETZB 1WFIA 2N7AA 3TJEH 4JO4H 5IM7A 5E51A 2BHFA 4X6BA 5FCSH 2WXIA 5DO2C 4G8IB 4LSUH 3OL2A 4WW2B 2WP3O 2IGFL 1NOFA 2D9CA 1A1OA 1YECL 2K4AA 2ZWSA 4YK4C 3KEHA 1CK0L 3QJTB 4N28A 2PCXA 5D9SB 5E6YA 4KKPA 1AIZA 3MJ9H 1HINL 4K7PL 4GG6B 2XTJD 1HCYA 1OCWL 4L4TD 2WC7A 5E8OA 4NWTH 5JW3H 4N87A 4AIEA 2ICWB 1ZA6B 4G42A 3I6KB 5IEHA 2HVJB 1SN0A 1MRFL 1XCQB 5DO2D 1DBKL 1KTDB 3WNPA 1CDBA 4HD5A 2PCPA 2XN0A 1RZPA 1R5WA 1H19A 1R6VA 2LFEA 2VSCA 4L2LA 3HNVH 3HR5B 5IWLA 5DJYA 1PCXA 1NGPH 1AC6A 3JQOB 3DC0A 2AMUA 1U8IB 3CVHL 2AP2A 1CB4A 2EE0A 5CJXC 4BFNA 4HC1L 3H9HB 3IPEA 4JFVA 4B9KC 4PW9A 4U1GC 5DEZA 3SYCA 1RUKL 2GUYA 1YYML 2WKLA 1NIFA 1TT6A 1ZEAL 1QLRB 3GJFK 1A14H 4LHUD 3GZOA 3BPCA 3F01A 5EU3A 5F21B 2ICWI 3FQUB 1GR7A 4OGXL 3FCSA 1HTYA 3MLYL 2AI0L 4F58H 3BKCH 3Q2CA 4F7CA 4G82A 2NY3C 4RGMC 2N4IA 4CVZB 3BD4A 4ZG1A 2OL3L 2VKWA 4M5TA 3UBHA 3ATEA 1EA9C 4JZOB 2Z8RA 4WK0B 4YO0A 2JKWA 2VZUA 3H9SD 5L88H 1DO6A 2G75B 4BZ1L 2DQTH 4HBCH 1A0QH 3ARBC 1QFHA 3S5LG 4XN7A 5TDNA 1IAMA 5JPMB 4TSCL 4M43L 4UT6H 3APMA 3QCVL 1KXHA 4MA8L 4PJAE 4WWKB 5J89A 3BVDB 4WUUD 2PR4L 1MHEB 4HX1A 1JTPA 2XC8A 1ND0A 4G9FB 1DBBL 1GW0A 1PZ5B 1Q94A 2RD0A 1KCUL 1QFWM 5T1LD 4LAJH 4ZMPA 4GSRA 2Z34A 4X4KA 3RNKB 4Y7MA 5B1JC 4I8DA 1RHFA 2ESVD 2VXTL 3WHE1 4PGDB 4HIXH 1TQUA 3PNWA 1BM3L 2X9YA 2ZXCA 3FU9A 4E41B 5ESAA 4UAOC 4OAWA 3BP5B 2P24A 3ARBD 4JO2H 5HHMD 2A74C 3LQZB 4BWTA 3WL9B 1OP4A 2B59B 2NNRA 1TQCC 1X7QA 3Q05A 4KHXL 2YARA 1ROCA 1CL7I 3S9DB 1F4XH 4FTVB 3P4MB 2DQEL 2A1WL 2X4NB 1IGML 2PW2A 2V2WA 3HUJB 4LOFA 1L9NA 1RZGB 2ICEC 1YNTA 4A2EA 1AR1B 3CZEA 3CVHB 3H7BB 1NPJA 2EC9U 3EJJX 3VXQA 3WIFA 5IG7A 3RL2B 3QRGH 3NCJH 3MRPB 3BAWA 4ZMTA 3D2UA 5TDPA 5KSBF 3EOYG 3WY4A 4NUJB 5E4OA 4MS8C 4TKWA 4R3SA 4U31A 5BNXD 2GUOB 3FSOA 3JV5A 4WV1A 2B4CL 4OZIA 1PZ2A 2AJYH 3QJXA 1G4RA 2J2ZA 4H5SA 4LMQE 1KXQE 3P4OB 5B3NA 5EBWA 1UM4L 2N3JA 1W8EA 3TEWA 4ODVL 2OL3B 5B7MA 2BDNL 3DV4A 3LZPA 2ZKXA 2E6PA 2KPNA 3W9EA 2WPGA 4LNRB 1ZV5A 1ZT4B 3RVUC 3HPLA 5SX4I 2EVJA 2YMTA 4MS8D 1KCLA 3GIZH 1C08B 2JCCE 3F6IA 5ANME 1BFVL 1TQBB 4F1SA 2BWQA 2PP9A 1WLHA 4DP9X 1U92A 3FRUB 3FO9B 3JV4A 1HZHH 1BX2A 1DVUA 1PPIA 4BQ8A 1YEJH 4X4XA 5IJVB 3WKYA 5GJTL 5D1QE 5KS9E 1G7QB 5DLML 5DZAA 4KY2A 4E9VA 3FB7B 3TA3C 4BD4A 1QBAA 3ROLB 1LMIA 4PD4J 3BEWA 3NIDF 3W81A 4AGPA 3RVUD 2GEQA 3TPKA 5LUMA 4NM8H 4CNIA 4AVKA 1XF3A 1HL5A 1BCIA 3MCKA 4QRRD 2XA8H 2Y3AA 3P4NA 3E6FB 4H1LB 3O41B 3TXAA 2ARJA 1YYCA 1BF2A 3PPSA 1H6EA 4XBPB 2JCWA 5D2NC 2VGLM 3O2DL 4KOCA 3WEXA 2R2BB 3LRGA 4RFNB 3AWEA 3IDNB 1Y0LB 3TA3D 3QDGA 1BVNP 4QWWC 4Y9EA 1KNOB 3GMMB 1UB5B 3BH8B 1NZRA 1RUAH 2IANE 5E4EC 3PLYA 4ESKA 1S3RA 2VJXA 1N59B 3K46A 4XBMA 1VFBB 1C5DA 2VXUH 3HI5L 1R3IL 2MQ3A 2ZE0A 3FT3A 3GIVA 3KM1A 4G3YH 5GQBA 1MJ8H 4RESB 1CG9B 2JB6B 4Q9QL 1LWRA 1J0ZA 4QWWD 3TWCL 2GFBB 5DZ9A 1OAQL 4ZDHB 1KLGB 4NXSA 4HW6A 4ABWA 4KRPB 4Y1AD 4YL4A 3D25A 2VDNH 1J1PH 2XNAB 5ILTL 3UJTL 2ZJSL 5EO9B 1UB6A 2JTYA 3LKOA 3NP3A 3KPRA 5KBLA 4LAQL 5T33H 1PZ3A 1DQDH 3P9MB 1TZGH 1MIEH 2NDFA 1BYPA 3FQNB 1T5XB 4N8CH 3VXMD 5DMIH 4RVBA 43C9B 4J3VA 5CJ8A 4CL7A 2FWSA 2GC7C 5IR1B 4BGDA 3DETC 2ZCLH 5T1KA 3JVGA 2ZSVB 3AG2B 1JZ6A 3SGDI 3FOMA 3IDIA 3WTWA 1EAPB 2Q76A 4C83A 4M62H 2FATL 4G8GA 3QIUA 5BQ7A 4GAAA 1HILA 1YY8B 1HVXA 4IK6A 1R33A 3CXDL 4B3VA 1PEWA 2Z4TA 5JO5A 2JCCB 3I9PA 5ANMB 3ZYIA 2OMVB 3GZQA 3DOSA 5LKNA 3T1FA 2I60L 1J12A 3Q3GA 1MFEH 1MF2L 4PAZA 5TE7H 4KI5E 3WEAA 2Q8BL 2PPFA 3SGJA 2VDLH 5BOJA 5D1QB 1OTUD 3MNDA 3DETD 2YEQA 3L5JA 4BA8A 3BIBX 4JO5A 2VLKE 1E8YA 4UANA 4MZRA 4ORGA 5MERB 3T3MF 2OXHA 1R3LA 1L3NA 4BXSV 4DPBX 4MYWB 4PJXE 5HJBA 1SNRA 3X1FA 1ACXA 4LMQI 4YHLH 1KIUA 3OJ2C 1EAQA 3SGEH 2J6EL 4ZAKA 4AGMA 1YHPA 4FQQB 3WJMA 4KDVA 3U0WH 1U6AL 1HL8A 4NO5B 4CILA 1KC5H 4FULA 1IQWL 2DLGA 3LAFA 3QG6A 2HKFH 1ET8A 4BH8B 3SE3C 3TYGH 3SQOL 3ZU8A 1TXKA 4YL9A 2OQJA 5HVWA 3AITA 1FFRA 1GIGL 2P43B 1INDL 3NOIA 1NBYA 2NT1A 2VE6B 4GEJA 2X28A 3AC0A 4NZUH 2JXMB 5F3BA 4RH4A 1PLCA 2QSTA 5DD5H 3GRBA 3G04B 3QUXA 2GBTA 1GZPB 4JPVH 4YUEL 4PHXA 5BXFA 3O3DB 2YGOA 4Q74A 1OAKL 4JFXA 3H53A 3ZE2F 4D2NA 2XICA 1C9SA 1IBHA 4LRNL 1HE7A 2P47B 1SFDA 4CC4C 1ET7A 2Q3AA 3K5SA 1RIUH 3NEEA 1RJCA 1VERA 3BE1H 4GMTH 5F97E 5GS0C 1UEMA 3UTPE 3UPAA 3MLUL 1UA3A 1KCVL 2I9LB 3UTTD 3QC5X 5ALCL 1VEOA 3W1ZA 3CDYA 3L4XA 3CXHK 2EDNA 3NJLA 1KIRB 1RHHA 4PCYA 5DK3A 3UG4A 4F2ME 1FORH 1VIWA 1H5BA 2WLKA 3FUHA 4KY1L 1ILUA 3NABL 1JGIA 3H3PH 3GMRB 2VYRE 1B2YA 3D69A 4QAWA 2ENSA 3HC4L 4ZD3L 5GS0D 5IUCA 4LIQH 2UZYB 5FHAH 4QRSB 2CGYA 2WJ5A 3LKNB 4G7YH 3U4BL 4FG0A 3SBQA 4FXKB 1YCSA 3UP1A 3ARFD 3SD5A 4A38A 2YSSB 5AAMA 3THML 3QDJE 2WXKA 1NMBH 1X5KA 3OKKA 3PFUA 4N1EA 3RPIA 2WZ0A 4QGTA 4ZXBB 1CBVL 2DWDA 2BRRH 3CPUA 5IMLB 1A3ZA 4G11A 4NB7A 3ROOA 1MCQA 2CCVA 2MSPA 1XAUA 2IQAB 3G6AB 5E1IA 4DP4X 2P8PB 2ADFL 4QXTB 3UTSD 3NCBB 4ENEC 4KKZA 2CR3A 5C0FA 2VLKB 1HT6A 2Q6WB 3EYSH 4AW7A 4YAQA 2P5ED 5HSFA 3VB9A 1N5YH 3IFLL 1PKQA 2WQWA 1I3UA 3O8XC 2E7MA 4K5PA 2EXYC 1EVTC 4ACPA 25C8L 2VM9A 2YPVH 4MNHB 5KYUB 5IJKC 4CDHA 3ZR5A 2DQFB 1XGQA 4ZMZA 2BP0B 5CEZL 1WRFA 4UTAH 3BLBA 3IKKA 3FTSA 4NKOB 3DSFH 2YEVB 5C6TH 1KULA 3L13A 4L1TA 3OGCB 4FOMA 2VUOA 4P07A 4HJIA 1H6FA 3WS6C 1F90L 3ZDYB 2WTRB 3UFIA 1PGRB 2FZ3B 3LVEA 2WGNB 4ONOA 4ENED 2AQSA 4P23C 3MRDB 4DPCX 3HBZA 5E9DD 3O8XD 4N2KA 4R84A 2VN7A 1QUPA 1XGPB 2EXYD 1A1MA 3FQWA 4L9LA 4XCCH 1CDGA 3CN1A 2ZF9A 1S7UB 4V1DE 4D7PA 1G5AA 3MV11 3DECA 1IRAY 1A9BA 4ZMVA 2YBRA 1JFQH 1LD9B 4O9HH 1XF1A 3CBKB 4PSRA 1CGYA 3AABA 4MD5A 4L5FE 4TMPA 4XMPL 5EIIA 1S3KH 4JG5A 3EADA 2DEXX 2YQ3A 3TPUA 3G3LA 3QXVA 4JCLA 4Z77A 3K2IA 4Y16D 5DJCA 4P23D 1KZYA 1JF6A 2P7TB 2BXYA 2ZQKA 5ELIA 1FZOA 4PJBB 4FJYA 2XQYK 3QCTL 1H9DA 4WDIB 3W0WE 2X09A 3AROA 4C57C 4NRYA 3HHSB 3N06B 3NYKA 4WHYG 3KGRA 1NGYA 2E8ZA 4QHMA 2B1AL 3MODH 3QNXB 4HUXA 3TT3H 1CD1A 1P9MC 5E4IA 5DMGC 3HNTH 4QRPA 2HPTA 2EUXA 2AVGA 3HMWL 2NLJB 4XPBL 3F7RA 2J4WL 5GGQH 2COQA 2XVLA 4R4FH 5CKGA 4TLSA 3V4LA 5K9QI 3GLAA 3IU4H 4M61B 2CBMA 2D3LA 4JMXA 1ZA3B 4TNWK 5H35B 1U91B 1J9QA 2X4UA 2IEPA 2XY2A 2YA2A 4JE0A 1IM3A 5BS0B 1DE4A 2F53B 2XX1A 2H3XC 3FUKA 2DBLH 5FYKH 1OCRB 1S9WB 5DMGD 3OV6A 1GPOL 5AKRA 3G5XA 32C2B 3QDJB 5J5EA 3OR7A 3PGFL 1IE4A 3SCMC 4X9IA 2VDRL 3VRJA 5GS2H 1TEFA 3FTGA 1HYSC 1KCRL 2CLVA 2H9GB 3PREA 1ZTMA 3TVMA 3NA9L 5I16B 4KTGA 3A6CL 3OF6A 4KZEL 1ZDSA 3NT0A 4GKSA 5JW4R 3P0YL 4X9HA 3EGXB 2VO5A 2NY2C 3OHXC 2Z3FA 5C86A 4HIEA 3SO3C 3OJMB 4UQ2A 1UTDA 2BVTA 5HYQA 1L4IA 3NQIA 3SCMD 3COOA 1EH9A 1LDPH 2J44A 5JPNA 5L2KE 1S6NA 4PJDA 4XO8A 3QNYA 1NFDE 2DIEA 4K8RL 2AERT 2D31B 2GT9B 1KTCA 4JZNA 3P0GB 1AGBA 3F04A 1WC7B 4UOW1 4JY6B 3FB5B 2AZAA 2NY2D 3KH3A 5I1KL 3NEXA 1T5WA 4LSRH 4NWUL 3QJZA 4OM0H 4NHCL 2FBRA 1Y6MR 5HGDA 3RGVC 2PNDA 2YD4A 4HWBA 3PABB 4QMEA 2IBZX 2ID5A 2VNCA 2H32B 4UT7L 4YHZL 3CHPA 3CVBA 2OSXA 1PIFA 4UM9B 4YOKA 4Q9RL 4IRSC 4CSTA 3HCVB 4TQIA 1I7UB 2E6JA 2G3ZA 2ADIB 3TV3H 4YHNB 4YE4L 4HDIB 1Q9LB 2WLIA 5FKAA 3B5HA 4JK0D 1IC1A 3PXLA 4FZ8L 3RGVD 4PJ8B 5EUOE 4KXCA 4X6FB 2JLLA 4X7CC 3ZL1A 4ZBJA 3E3QC 3L4TA 4XMKL 1T20B 4C8XA 1LO0L 1WDAA 4R97C 3ARDC 1AZUA 1FNSL 4IRSD 4LEEA 3B1UA 4GW1A 4GS7B 1JZ2A 1J0HA 4UQ9A 1XBDA 1PFCA 3BVUA 4UDTA 1T6WA 3KLQA 3ULVH 1DQVA 4LSDA 4F7TB 4M7ZC 3S3CB 1DLFL 3QUZB 3B7RL 2P26A 1JGEA 5T1DH 3AZUA 5F3FA 4C58B 3V5DB 4NSKB 3E0GA 3C8DA 4BCYA 2G5BA 3M1CA 4DN3L 1M71B 3C5XA 4N90E 2E0PA 3ARDD 3QUGA 4BFJA 3S8FB 3TT1L 4LCCC 4OCLC 5EO1A 1FL6A 3BEVA 4AEIH 4FFZH 1FO0H 5DJDA 4KRLB 3VD2A 3V5KA 4HPYL 2D0FA 3D33A 1I7ZA 4L8CA 4JDVB 1CFQB 1CFSB 3BCDA 4JM4L 2P9RA 1OP3H 1F2XK 3C60C 4KXBA 4WI0B 3OPUA 3HC3L 3Q1EA 2VM3A 5AVXB 1H0DA 3BHBB 1YEGH 4OLUH 2M1KA 3GGWA 5F7DB 2R1YA 5T3ZD 4K3EL 2NSMA 5H4YA 2A5UA 1HWHB 3Q6GL 4MLSA 4MXWH 3MOBL 2AXHA 2FECI 4J3OG 5ISZE 1DQLL 2IGFH 1L9MA 2K78A 4XRCA 1YECH 5D93B 1DL7L 4CW1A 3BSHA 3ZTNH 3QIWC 4DK6A 5EOTA 1RJLA 5IB2A 3OMAB 4K9JA 2L8AA 2YPKB 4G6KL 5C0JA 1E9OA 4GG8A 3C60D 2F54D 1HOCA 1OCWH 4XCNB 1Y1UA 3D87B 3CBRA 3STLA 4L05A 3BPOB 4ZUSB 2C1OA 3RFZA 5J06A 3DK0A 3HW7A 4TUKL 2COVD 5J13C 3VFNA 2B1OA 2BOLA 1MRFH 2NX5A 1JS4A 1NUDA 3S6CA 5IFHL 3TBVB 5HVHB 3HG2A 2XPZA 4E5XA 2YZ8A 3HZMA 3V0AC 4OD2B 2F74B 3BKYL 4H88L 3QIWD 2EDTA 2AQ2A 3L4WA 4GW4A 3S96A 1DBJH 1SM3L 4XBEL 3SDXF 3JWNG 2F5AL 3QQ4B 3QXAA 5EUOB 3CWGA 4MNGB 4RMBA 5MP6L 4K7PX 3VXRA 5D5ME 3PWJB 4HC1H 4JMNA 4GKZB 5KSAA 2TRHA 1BFOA 3AREC 5E70A 3EUUA 2UY6B 2AXFA 4ZZFA 4LSSL 1KIQA 1HHKB 1YYMH 2WZPD 5FK9B 1U8PA 2OMWB 4PI2A 1ZEAH 2VDPL 2PCFB 1PBYA 2QJDA 1OP5K 3W2DL 1I8LA 2R29H 4ANXA 4OGXH 5HXMA 1RK1B 5B22A 4P5MA 3CN2A 4OVVA 3MLYH 3U0PB 2AI0H 2YAHA 2YGQA 4QOKA 3CBJB 3EFFB 3EHBB 5CN2A 5FWRA 1B6UA 3U0TA 2Y6TE 3ARED 2N1KA 4QUOA 4ZSOE 4TPRL 3SDCC 4AE0A 1G84A 3OG4B 4BZ1H 2YOCA 3WJJC 5LN4A 1FG9C 1MVYA 1JD9A 3BJ91 4TSCH 2HJKA 4M43H 2PLTA 2BNRE 3QCVH 4WJ5B 2XBDA 4MA8H 4MASA 1MHCA 4AGNA 4ZX3A 5FECB 4S1SL 2PR4H 3B8YA 1AKPA 5K1VA 5IHLB 1AGDB 2ZWKA 1LILA 5KANI 4XMXA 2Z92A 4UYPA 2CH8A 2VITB 4BSVA 4F7PB 2D7NA 2YN3A 3T1WA 1U3ZA 4GXVL 4ELKB 1GOGA 2VXTH 3T9WA 3MV9D 5GGTA 3H2WA 3SDCD 3K1DA 2QVMA 4FKKA 1CIUA 3B6SA 2OULB 2ZXBA 3B2VH 3NCXA 4R7XA 3FO0L 3T0XA 4AQ8A 2D7OA 1ECYA 5G55A 3MGTB 1TFPA 3W82A 1DVXA 4PJHA 2Q7NA 3TONA 3VI3A 3V4UL 5I76A 2BOBB 1MFNA 2O61B 15C8L 1K5NB 3HLKA 4LXFA 4PHZA 1V5JA 4GAYB 4OZHE 3NDZE 4XN2A 4C59B 1ITCA 2CO4A 1WD8A 4PG2A 3AXLB 4IHBA 4EOWL 2CU9A 3BW9B 4NUGL 1UGNA 3MRMB 1WYJA 2VMCA 1FHGA 2WCPA 5AVWB 5JIPA 1XZWA 5BOPA 4L0PB 3NJJA 3MJ6A 2GJRA 2HT4D 1SYVA 3VI4F 5C9JB 3REWB 3IMVA 3WTUA 1WWBX 1GW6A 4EI5C 3SSGA 1P7KA 4WK2B 3Q8AA 5EULV 5ACMA 3V0JA 2FIRT 4TF4A 2VCOA 4XCEA 1JWUB 1EXGA 3N55A 3VWKA 2B4CH 4AT6A 3O4LA 3KYMB 1ZANH 2WUBL 3FN3A 4HUUA 1JZDC 3D50A 3IJEA 4Q7DA 1PTZA 5C0AD 5I6PA 4HK0A 1IE5A 1UM4H 3TFBA 3FC8A 1RZ8A 4Y19E 4BKLB 3ECQA 2X9ZA 3DJSA 1A7BA 4JO8A 4DO4A 2BDNH 4MX7B 3DWTA 1MCPL 2EO9A 4NOBA 4KO7A 2FD6L 5D7IA 1MWAA 4EI5D 4TOYL 5HDLA 4I77L 1U58B 1JE6A 4QXVA 5HVGB 4P06A 1BFVH 3P2TA 1KJVA 5DVKA 3VFRB 2EDEA 4PLKC 1T7YA 4M3JA 5DRWB 2R23B 2KHAA 1HH9A 3I84A 5I1DA 3ZRFC 4DCQB 2Y2YA 4LPCA 5E5LA 3UCRA 3VGAB 3DUHA 3K6SB 4NC1E 1D9KC 3RBSA 2WBWB 4R26L 3T4AA 3LJ3A 5I8CB 4N4YB 4JL2A 3S8GB 1MJUL 2C7UA 4J12A 1HIMH 4YHPA 5BO0D 1KGJA 2BNRB 4NIYE 3DVGA 3JTTA 1I3GL 4PLKD 4U1IA 3D4CA 3QHFL 1I9JL 1HSAB 4G8IA 1XGUA 3PWPE 4JDTH 4GMSL 3ESUF 2CXGA 2HRHA 4WW2A 3O2DH 5DYFA 1J5OL 2DLFL 2KBGA 4XMLL 3VFMB 2C9VA 5DGRA 4MLIA 5J6HB 1D9KD 1NCJA 1OSEA 1OAZL 2D03H 5KJRL 2FWLB 4N2OA 5CLTA 5D9SA 4XPFL 1B4LA 5F8QC 1URZA 3Q6FB 3T71A 4G6JL 1NCUA 3QEUB 5AVYB 4Y4KC 1ZGLA 4IBUA 3GXDA 2G5RA 2ICWA 1ZA6A 5CR1A 1WCQA 3I6KA 3HI5H 2HVJA 1R3IH 1XCQA 1IKNA 3HE7C 1EX0A 3OXRB 4OZHB 4XMUA 1KTDA 4WNQB 5GS1C 2XI9A 5CZVL 4QTHB 5D96C 5EHFA 1IGTB 4ANWA 2XZQL 5CLZA 3O9WB 4Q9QH 3GINA 3ZX1A 4HOXA 4L48A 4HQQL 4JRYE 1IM9B 1U8KB 3QDMB 2AQQA 2WNXA 4PGEB 4QHNB 2HMIC 1OAQH 5JHAA 1ZCRA 1CDYA 1U8IA 1KTBA 4Y4KD 2FBJL 3QI9B 4Y9FA 2LU3A 2Z9TA 3H9HA 4J3XA 2ZJSH 2EDRA 4ELDA 1AZRA 3FYIB 4LAQH 1KB5L 1NIBA 3HE7D 2JH2A 4F8TA 2XKSA 4TXVB 3ZYJA 1RXLA 5D7SL 3PJLA 3C9NB 3Q5YA 1QLRA 5INCB 5DWUL 3FTXA 4DP2X 4HETA 2YA1A 3MAWA 1SLWA 3LSOB 2P3YA 1X44A 1LEIA 2HMID 1A6UL 4MXVF 2J88L 4W4OA 3FCBA 5F7MC 5JOPD 3HI1B 1NGZB 3VXSD 3LN5B 1P1ZB 1NMCB 1Z9PA 3U7WH 3VO0A 4R5VA 2FATH 4BWWA 1UUSA 4YSOA 4C47A 4CVZA 4D0BB 5LGJB 1KGXA 2JQMA 4JZOA 4ODHL 2XQBH 3VG0L 2G75A 1TITA 5E1GA 4WEBH 2G0KA 2I60H 1MF2H 5JPMA 1XF5A 1IGJB 4QJ3B 5KVEL 3MJ8A 2Q8BH 1MHEA 3HG1D 5BW7C 5T1MA 4G9FA 3CHXA 4JANA 1SMOA 2J21A 1PZ5A 3T0BA 3CK0L 2YPLB 2QVKA 4BQCA 1LEGB 3HEIB 3K8KA 4LCWE 1JGLL 1X4YA 3O0RL 3VD7A 2F58L 3MBWB 3K72B 3CCHA 4E41A 2J6EH 3SODB 3TZVB 1N7ML 2J43A 2BIIA 1OZUA 2VLMD 5HY9B 1U6AH 1TEYA 2DQCL 3LQZA 3PWPB 1IQWH 3OKDB 2JK5A 3QR2A 3FUNA 3GM8A 3SQOH 2BM3A 4P2QB 3K7UA 1Q72H 3K71B 3BXNB 3FSVA 3P4MA 1INDH 2C1PA 2X4NA 3M7FB 3MN8A 1JERA 3OKYA 3GBML 4LQ1A 2PN5A 4N1HB 3QZPA 3TWYA 1MH5B 2YAPA 4IRJB 2HTKC 1HWGB 3H7BA 5FYLL 3DSNB 3MMEA 1XR9A 1P4LB 3RL2A 3IGKA 1BFSA 4TNEA 5TK2A 3MRPA 4PJGF 2NZ1A 1R9FA 4LF3A 5J57B 2P8MB 1DQML 4NUJA 5IVXF 1KJMB 2WUCL 2XCMC 4PJCF 3HN5A 4W9HC 2YR3A 2YUVA 3BRGC 2DMBA 2BSSB 2GUOA 1EJ8A 2XUWA 2Y06L 4PRBA 1E4KA 1IEBB 3EDFA 5ALCH 3ARTA 2E7DA 4FXLA 4A7VA 1ZHBB 3FTYA 1VPOL 2HTKD 3VFOB 1LO3L 3D6GA 4KY1H 5SWZE 4OJCA 5LVEA 4XOAA 3QNFA 5F7FA 3IDMA 1UCBL 3NABH 2JJWA 3GZPA 3L3OC 1JXDA 1MI5E 4C55A 3RNQB 4I87A 1MFBL 5I9QC 1R75A 2ICWJ 3H0TB 2R0WL 1C08A 3VQMA 1YNLL 3HC4H 2G9HA 1OK8A 3QJHB 3FO9A 3WY3A 3EJUA 2R15A 3U4BH 2V3DA 5IJVA 2P5WD 3RU8L 4Z3GA 3ZDXB 4OI7A 4FFYA 1AACA 1G7QA 3QQXA 4ZZKA 3THMH 4YHML 1ERNA 5DQJA 2F5BH 3FB7A 4R5TA 3ROLA 5KYYB 4CGUB 1KB9J 1M4KA 3BUDA 5IBTL 2MTAA 1AFVL 1Q38A 1YRKA 2GAZB 5GIRA 3RGBA 4HKBB 1UOWA 4PJAA 1AOHA 5DUPH 2EIBA 2KQNA 4K5MA 3L81A 3E6FA 2X12A 4LPVA 4XBPA 1MCFA 1AZZC 2MMXA 3DHMA 4UT9L 1CWVA 4CKVX 4LCWB 1IC7L 2R2BA 2X6CA 4K4KA 25C8H 2X6UA 3IDNA 1Y0LA 2W65B 3PDDA 3PQYD 2NY5L 1X5GA 4BM7A 5F7BA 4KRNA 4WSKA 5C07E 4RWYL 3GMMA 1UB5A 3BH8A 4MJIE 8CGTA 3H9ZA 2V7NB 3SKOB 3Q8FA 1F90H 4NQDD 1WWCA 5F3HB 2DBJA 3TGXA 1VFBA 3AT9A 3C6LB 3IRZA 4PTUB 1U3HC 2F7PA 1CLZH 2FIKB 1UH3A 4NQED 2EIZB 2DN7A 4X42A 2VMFA 4JW3A 4MJ4A 4A67A 5IQ9B 4WWPA 3KGUA 1CG9A 2JB6A 4I5BA 2NY1C 5FM4A 3RVWC 1ZTXL 5CFAA 2HT3C 4JB9H 1J9TA 4JPQA 1HL9A 3L9YA 2A4ZA 3NK4A 4NQCE 2YO3A 4GOSA 4ZDHA 4KGJA 1KLGA 3RB5A 3D51A 4XMPH 1LE5B 5E7BA 4OFDA 3CXFA 5DFWH 1O7DE 2XNAA 4XP1H 3CH1B 2UYLB 3GSOA 2WXJA 1U3HD 1WFTA 1NM9A 2FE0A 3N2JA 1FNAA 2JB5L 4PWHA 3QCTH 3P9MA 3FQNA 3HJEA 4WFGD 4TQHA 4HJ0C 1MWAL 3PFQA 43C9A 2NY1D 3RVWD 1KXQA 1SXAA 4WK4B 2HT3D 2B1AH 5IR1A 2AV7B 3SYQA 3ZHKA 1B3JA 2ZSVA 5SWZB 3ZZQA 5I1CL 3T8VA 2RACA 2VLJD 5PCYA 1E3XA 1EAPA 1F3DJ 3V7AE 3IKCB 3K8MA 4XPBH 2W07B 1MI5B 1YY8A 2YZ1A 3L3DB 3U82B 1UT9A 2J4WH 5D1XB 5I5RA 1XD1A 2JCCA 5ANMA 3U1SH 2OMVA 3TIEA 4YFLI 3DROB 2DI9A 2O30A 2Q8AH 3AVEA 1OL0A 2JJVA 5JW5B 4HJ0D 1MXGA 4P5TC 3WS3B 5AENA 1FNFA 3N41F 1LWJA 2VR4A 4X6EB 2XBZA 5D1QA 5KS9A 4C4KO 4F9LC 2AJZB 1AKJB 2QGCA 5MERA 3PGFH 4ZUTB 2VDRH 1T0MA 5IV2B 4A37A 3BPLC 1H15B 3SDAC 4EI6B 5H4ZA 5BMFL 1RFDL 2R2EB 1KCRH 4H20L 4F37F 1IBDA 3IGLA 1KN2L 4FQQA 5GRYA 4W9CC 2BNQD 4NO5A 4P5TD 1ESOA 1MW3A 3L3IB 4J8RA 7FABL 4KZEH 1NC2A 3VFVB 4X80L 1A3LL 2W0LA 3CTTA 3DTDA 3DXAD 3EDEA 4P4KC 1BIIB 3T04D 4XCYA 1KPUB 1VACB 1DJYA 5DMYA 1J0IA 1JGDB 2VE6A 2IANA 3SDAD 2JXMA 1TZIB 5FB8B 1FH5L 1SUJA 3HRPA 1RULL 1GZPA 5E1HB 4GP8B 4L8SC 4D9QE 3O3DA 3ARWA 2FRGP 4MCYB 1KV3A 1HNFA 3KW7A 5I1KH 2DYPD 1K4CB 4MS6A 3EW3B 4L3EE 4NWUH 4P4KD 4OFYD 1MQKH 4PV1C 2ADGA 4JN1L 3L1GA 3WFDL 4PGZA 4ALAH 5T5FL 2I9LA 4AW4A 4PBWD 2FWOB 4N0YL 3LKSA 4ABUA 1IAOB 2AK4D 4I88A 3U9UB 1G4MA 2CM5A 4UT7H 4YHZH 3T2PA 1BVOA 2EVHA 4GRWB 1XDTT 5EU6D 4M7LL 3AWFA 4HIIB 4O2FB 4YHYB 3N1PC 4M6NL 3MV8B 1A1NA 1ZE3C 1AOZA 3MRNB 4OZGE 3GMRA 1NCIA 4FZ8H 3MV7D 4LPTA 5DR5L 3D39D 4HIQA 2PTVA 4L37B 4RNRB 2UZYA 4KTDL 4QRSA 3APNA 3NIGF 3P0VL 3QZNA 4FXKA 4N3TA 3M86A 4XMKH 1LO0H 1ZLWH 4X9BA 4L4TB 1TTGA 2EEBA 1Q9WA 2YSSA 1Y6KR 4K3JL 1J10A 3NZHH 2Q86B 1Q0EA 2FX9H 5I6NA 4MJ5B 3AM8A 4TSAL 2BOCB 3UDWA 1SBSL 4LDCA 3B5TA 3G6AA 5AVSB 1RU9L 2P45B 4Z7UF 1DLFH 4QXTA 1UCTA 2VLKA 5KYNA 4S1DC 1VENA 2Q6WA 2D8KA 1XCXA 2EDYA 4FERA 4YXHL 3VACA 3LNIA 3S36H 3MRKA 4OZFG 2CR0A 2HJLB 4I9WE 4PJXA 4F9PC 2B5IC 2UUDH 5KYUA 2DQFA 3R7QA 3TT1H 1D5MB 5JDSA 4IMKC 2BP0A 4NKOA 4E42A 3BC9A 3PJNA 2VZVA 3OGCA 4TQPA 1SF5A 2WTRA 1E9QB 4UOJA 3MJ7A 3PJSB 2O4EA 1ZVYA 3KYNA 3MUJA 4JM4H 4LHUB 2X0WA 3MRDA 4S1DD 4MAUH 5A43C 1THCA 2WD0A 3BQVA 3HC3H 3S34L 2B8OT 2LV4A 3QUML 4HEPG 1S7UA 3NJMA 1F4AA 1LVEA 2AQTA 4HGMA 3S36X 4YXKH 3GDBA 4CC0A 3Q6GH 1LD9A 1E40A 2RR3A 3I6LD 1F3JB 4WHYH 4U1GB 4GAFB 5TE4L 2FEJA 2AEQL 3H9SB 4EO5A 3DO7A 3SYOA 3QEQE 3ZHFA 4PJ5E 1T80A 4G6KH 2YAFA 1Q9OB 1GOFA 2P7TA 3EO9L 3UZQB 3K5RA 1T4WA 4PJBA 1XGRB 4TUKH 3US0A 3CZFB 3HHSA 2NY3B 3SPGA 2X70A 3B9VA 4OF8A 3PGDB 4RGMB 2YAQA 3QNXA 3NZUA 1DO5A 2CLRB 2H1LM 2ESVB 2BIPA 1KJ2B 3K74B 4GIOA 2WXOA 4H88H 1PLAA 4E9RA 5LBVA 3TEYA 3QFJE 4XBEH 1XX9C 1QSFD 4DP7X 5HHMB 2F5AH 1U93B 1XL4A 4E9SA 3UPRA 3D1MC 3UYOD 3WO4B 1JSYA 1AIFB 4QYOB 3GD1C 5IVOA 1U91A 3EFDL 5MP6H 2A6JB 1ZMYA 4OD1H 5BS0A 4X98B 3GS7A 4KXZI 3UEQA 4LSSH 3V10A 2GIXA 1S9WA 3WAJA 1UKSA 32C2A 3QDJA 2VDPH 5JQ6L 2ITEA 3ML8A 5AW7B 1QLEH 1QX1A 1TVHB 4UAOB 2O5ZL 2A74B 4DVBB 4M5ZL 4PJFF 3WNIA 1TQCB 2I27N 4BIKA 2WHVA 1G9EA 5KEZA 1UD3A 3Q1SL 2KZ1B 1DFBH 1T1XA 4ZRGA 2VTFA 3EGXA 3KCWA 4P9MH 4XPAL 4EKXA 3B7SA 1NIDA 4TPRH 1J5CA 1QO3A 5E08L 1NBCA 4N0UB 3VGEA 5FX3A 5F0LB 5EU5B 1EO8L 1ZOXA 2MRYA 2YAOA 1DVYA 3P3UA 1L5GB 2ZOKB 3OG6B 3T0AA 2OCJA 2D31A 2R56L 2GT9A 1Z66A 4OJEH 3G6DL 5K9JL 3SYAA 3ZTJG 2AXGB 4XGZB 5HYSA 1W8NA 1WC7A 4MA1C 4GXVH 4FEIA 4H8WL 5AW1B 1N5AA 2WXLA 5D7HA 4WWNA 1OSPL 2QFPA 2WO4A 3HZYB 3G08B 5GPRA 5HYEA 1P84K 4HH8A 2P42B 4S1RL 1DYZA 1KY7A 4UF7C 1U8HB 5DUBB 3WSQL 5ABDE 3ULVF 5FF6B 3B3IA 3V4UH 4GRMA 2CKBL 1NFAA 2GK0B 1UGKA 2H32A 15C8H 1T7XA 2E9GA 2PPAA 3L17A 2TAAA 4K5LA 3DLQR 5K39B 3VYPA 3ZKNC 4K3GA 2WCSA 2J1ZA 5C0CD 4UM9A 2BLFA 1I1AC 3WXWH 1ZWIA 5DDHA 2JKIS 4QRRB 3B1TA 3TS8A 4EOWH 4NUGH 3W0WA 4XXDB 4HDIA 1Q9LA 2ZX8A 2DL9A 4PWGA 4TVSa 4PJ8A 2FQGA 5D4HA 2BVOB 1BVNT 1T3FB 3WUWA 2VSMB 3DX7B 3TA3B 3ZDZB 2ZUYA 3KHQA 4W9DC 1CYWA 3E1ZA 3QFJB 3ZKND 1I1AD 5CF3A 4FS0A 1G7PB 5B7EA 2WUBH 3QVAA 4Z7VF 5I1GL 4G5ZL 1OCZB 4MQXC 2GSGA 5GRUH 3BESR 2NNXA 4F7TA 3QUZA 3US1A 3I02B 4JDEB 3V5DA 4NSKA 4AV0A 1AJ7L 4TOYH 4I77H 1QW8A 5IK3B 1FV1A 3E80A 5E4EB 1G1OA 3WLBB 3INUL 5C71A 1M6OB 1DQQB 1S5HB 4MQXD 2K0RA 5DHYA 1T5KA 2HVBA 3MCLL 5HBBA 4R26H 5FIEA 1KLFA 4JDVA 1CFQA 1CFSA 4MZIA 1FZJB 5D2LB 5LWYL 1O9WA 3AY2A 1MJUH 5DMKB 5IQ7L 1S2EA 1M2VA 2F8IA 5J1AB 4LL9A 1T4KB 3E8UL 3BHBA 3HUJF 1I7TB 5SV3A 4ZFOB 1I3GH 2ZCZA 5G2NA 1H3PH 4XVUC 4BUGA 1IO4C 2MPAL 3QHFH 1JZIA 4BHUI 3ZHLA 2DQJL 2OJ1A 3QJFB 2VAJA 3L5XH 4HWBH 1J5OH 1R34A 2VMEA 3VFWA 2JKLA 2DLFH 1FN4A 4CBPA 1XIWC 1OAZH 3DK2A 3FSAA 5KJRH 5MEOB 4XPFH 2YPKA 3WDJA 1OT1A 3I3EA 5FYKU 3FB8A 3I3DA 5GS0L 5JW4N 4G6JH 5E6IC 4NXKA 1MWOA 4XCNA 1F00I 4PJ9C 4ZUSA 1UD6A 3HHRB 3JWNH 1CFVL 2OMBA 5I0WA 5KVGL 2CRMA 4XVUD 1UM5L 1BLNB 1JIBA 3J27A 1NQBA 4JHUA 4F57L 3TBVA 4R4NC 1A9VA 1RUPL 2XU9A 4OD2A 3GZKA 2MNUA 1GGIL 4BFRA 1AHWC 1XIWD 1U4EA 5FUOL 4HQQH 5EF1A 2P8LB 3I50L 1BXVA 1EAOA 5CP3H 4CSPA 1OAYL 3G5WA 2ZOTA 3QQ4A 5E6ID 4B50A 2B7DT 2I7SA 5EUOA 2C9UA 4PJ9D 4QJ5B 1MREL 1ZDQA 3GJFH 5IHUL 1NH6A 1JV5A 1Z6JT 4RRPG 3PWJA 4CA4A 3VVVA 4GKZA 4ZW6A 3RIKA 3SQBA 2UY6A 1WUNT 4GBXC 1KB5H 5E5RB 5E9DE 1T03H 1MHPL 2VDML 3F84A 4R4ND 2OMWA 5FK9A 3VXTB 4XMTA 5HYJD 5D7SH 3JYCA 2ZSWB 1BJ8A 2PCFA 3BUIA 4BFKA 1XSIA 3BSZL 5IW1B 3NCMA 5HTSA 5KUMA 3U7YH 3GUTB 2CLZA 3C6EA 5H37A 4LLYB 1RK1A 1PZDA 3U0PA 3VGDA 1M7XA 1I8IA 3BP7B 3HE6C 1GA2A 3EFFA 1PW3A 5FDWA 2AKRB 2IPUG 5DEGB 4XOBA 4ODHH 4KV5F 4POUB 4GBXD 3MLVH 3PAVA 3S3PA 3VG0H 4KDWA 5HHOD 5DK0B 2AHIA 4IMLB 3QAQA 4PV8B 2GPZA 3WDHA 1QPXA 3PS6A 3MRBA 1JGUH 6PCYA 3QUYC 4PRAB 5KVEH 4PSPA 4WJ5A 3MTXA 3SKNB 4BRVA 5FECA 4ZO9A 2XPGA 3DARA 3HE6D 4R96B 2LU4A 1WH0A 5GISL 3CK0H 3CD4A 3TJHC 1ED3B 2VITA 2WJ7A 4E9YA 4F7PA 1YUKB 4ELKA 3QGVA 5TDOB 4JFDD 3O0RH 1EZLA 1FVEA 1KFGA 3B56A 3SD2A 3WAKA 1MLCB 4FQ2L 4XC1L 2N59A 3UABA 2D7PA 2DQCH 4OJFL 5HPOA 1EHLH 3QUYD 3HJ0A 2WQSA 2GIMA 1WBYB 4U1HB 3BRDA 1FZMB 2WY3B 2BOBA 3UX9B 1TKWB 2O61A 1N0LB 1K5NA 2TSBA 4GAYA 1YEFL 1EO5A 3RG1C 3I9GH 4IOIB 1FAKT 5C0IA 2A83B 1YSOA 3UTSB 3AXLA 4OUUB 3BRFA 1RZKH 1QUNB 4DKTA 1AG0A 3LCYA 2ZTBA 2XVGA 5FYLH 5TJWK 1U21A 1CU4H 1KTKE 4YDZA 1T89A 4B53A 3DX6B 3KPOB 5D6DC 5IIEB 3EYUL 1UURA 5CZKA 2DTML 1KYFA 1YAIA 4K2UL 1KBBA 4AENB 3N5AA 2WUCH 4I3GA 3WEBA 1NA8A 4AYBA 3B9KA 3SGKC 3MSPA 1MFDH 3TV8A 1LO2L 1JDDA 4Z7OB 1JWUA 4N6QA 4PY8J 2Y06H 4G1MB 4J23A 1TNMA 1NCAL 4MHHG 4KZDH 1V27A 2XVKA 4WFHE 5D5MA 4BZ2L 2FGWL 4OGZA 1CE6B 4YIQB 1PD6A 1LO3H 1ZHKB 1EZSA 3R19A 2HG5B 1M05B 2JJTA 4BKLA 5E9DB 3O8XB 5IZ7A 4U1NB 3QYCA 4MX7A 2OFQA 4AI7A 1UCBH 3JWDL 3ASNB 1U58A 1E28B 2HFEB 1QSVA 4BBWA 3ECBA 3VFRA 3LN4B 1PNCA 5F9AC 4NT6B 3NIFB 2R23A 5DRWA 4B5ZA 4EZMA 1Q0XL 2EEDA 2XXCB 3QJUB 4P23B 1MZYA 5DGQA 3RU8H 4AYMC 5FW8A 3D4ZA 3H6JA 4PWJA 3K6SA 3T4YB 4G43A 3X14B 4ZSOA 4JFEE 2AQNA 4J27A 5F89B 1JZHA 5I8CA 3ATDA 3EO0B 4PJEE 4XN5A 3Q2VA 4DPRA 1AFVH 3M17B 4K3DL 1LQBC 2BNRA 3KLKA 4CBZA 1WZAA 5DJZB 5GGTH 3Q0HA 4UIKH 2LAAA 1KDIA 2NW2A 4RAHA 1DUYB 1T1ZB 1II4E 2ZP0T 5AL0A 2WNKA 3KD4A 2LT9A 4UT9H 2CSPA 4EE2A 4TM9A 1VGKB 4MZ2A 3T08A 1IC7H 4AQAA 2X53A 1MY5A 5AAWA 4QY8B 4L3CB 4RWYH 1J8KA 3Q6FA 3R7RA 43CAB 2MCPL 3FFCD 3VMPA 4AUYA 3QEUA 4IIQC 2GI7A 3LRSA 4ODUA 5CJBA 4N9GB 5LBSA 3WFHB 3NH7L 5A1AA 4IBWA 1UWGL 3KE0A 4GRLC 4V2BA 5CO1A 2OMNA 2QZ5A 4K94L 3OXRA 4OZHA 1GCYA 4WNQA 4GQ9L 3ZTEA 1QBLL 5JMRA 4QTHA 1BXUA 1IGTA 3RIAF 4IM8A 4LQFL 2X87A 5JHMA 3B9EA 3PCYA 3O9WA 3FUIA 3JV6B 1ZTXH 1IM9A 3RWDB 3OAUL 4GW5B 4X5PA 1U8KA 3QDMA 2DY2A 3PWLB 4QHNA 4PGEA 3CSFA 2JI1A 2UXTA 5GRXG 3WIIL 4GRLD 5AW2B 3W37A 4UI2A 4S0HA 1G6RL 2ZCKL 5C0BD 2VQ1A 2GC4C 1LJMA 2DH3A 2PTTB 3C9NA 4WF7A 5INCA 1ACYL 1E50A 3VTTA 3OKNB 4OCWL 1MWAH 2Z7UA 4FQJL 3LSOA 3QRBA 4ZS7L 2V0AA 2VL4A 3UTQB 5BUAA 2NY2B 1NGZA 1A6WL 2IWKA 3LN5A 2APBA 4FQHA 1R5IB 5TFSH 2Z93B 4D0BA 3SO3B 4Y4HC 5LGJA 4NI3A 2F54E 2IALB 2VAAB 4J1UB 1MW2A 3MRHB 4FLSA 5T3ZL 2HX8A 3RDTB 4DHLA 1QR1A 2AQ3A 3R06B 4ONGL 4XVJL 4OR1A 2GG1A 1N6UA 3UBXG 1IGJA 1UADC 3DHPA 2GEEA 1BJ1J 3BZDA 2VW6A 4WZ9A 2YKLL 5H2BB 4K15A 2OAAA 1YQ2A 2BSED 4JLRB 4RCAA 3MCYA 1EHNA 4TSBL 3PXJA 2YPLA 4JDZB 2XV6B 1NCTA 3P54A 3PYCA 4Y4HD 5CCKL 1LEGA 4FJZA 4UQAA 4NNXB 5AVUB 4R8WL 3RGVB 5I8KH 1OGTA 1RFDH 1N19A 3AMLA 3C5ZC 3MBWA 3FBKA 4H20H 5KSBE 1ZHLB 1GKOA 1KN2H 2IMMA 1QATA 1XD0A 4I0KA 3UCQA 5HY9A 3PWPA 4PTTA 7TAAA 3BQUA 2HP4A 5HYFA 1A3LH 4WY7L 3AAZB 4XZ4A 5DZLA 4B96A 3K71A 3HC0A 2IBBA 4J4PC 4XI5C 4N20A 4N26A 5F9OL 1EJOL 1NAML 5DT1L 5KSVB 4AM0Q 1MFVA 2UXVA 3M1BB 4NHUB 1MH5A 1FH5H 3C5ZD 4DO5A 1RULH 4IRJA 3ZE1F 5DU7A 4AJVA 3O6FC 1P4LA 4KMLB 1VADA 5I18L 4WSJA 5CD5C 3GRGA 4R97B 1DR9A 2Z6FA 3ARDB 1J88A 3C87A 1X9LA 4RZCA 1G6RB 3LOWA 4YBLC 3DUSB 2FJGB 2P8MA 2Y3NA 1B4JL 2H8PB 1BZ7A 3CFNA 3LPGA 1EEYB 2DQUH 1INQA 4JN2B 3T0ED 1WFOA 1FNGA 3WFDH 4HLEA 5KVDH 4KWUA 1GTNA 2WWKO 4J4PD 4XI5D 4IGBD 5EBLB 5T5FH 4ODTH 5A16B 4OCNC 1IEBA 5D7JA 1UFUA 4HJEA 1MN4A 2YAEA 4KNTA 3NIDE 1ZHBA 5CSZA 1RZFH 3VFOA 4ENZA 3O6FD 1OM9A 5CD5D 4FQXC 5IW6B 4HZAA 4M6NH 4RFOL 4A7UA 5ID1B 1EBAA 3BWSA 4DERA 2R69L 2FL5B 3H0TA 3FU5A 3UO8B 3B3BA 3QJHA 1HXYB 4KTDH 4ECNA 5HHVL 4FQCL 4EMZA 7PAZA 4UOQA 2QLYA 3P0VH 3PY9A 3RX9A 4JPWL 4QKXB 3C60B 2F54B 5L4FA 4I0PC 3UBFA 5B39B 2Z31C 4K3JH 1U3JA 2NXZC 4NNYB 1JPST 3CQFA 2PXYC 4FQXD 5KYYA 1TJIL 1Q9KA 1MFAL 2Q20A 5E94B 2WVVA 2AJVL 4TSAH 2HX9A 2GAZA 4HKBA 1RU9H 3VE0B 2CJTA 2GW5A 2D4FA 3N85L 4Z6AT 1FNHA 3W11C 4LDLB 2D2CC 1DBML 1Z5HA 3QIWB 4WNJA 5I0XA 1ZLDA 3TP4A 3N0PB 4W68A 4YXHH 5CJ5A 4LCWA 5BVPH 3MROB 5DK2B 4I0PD 3RX8A 2Z31D 5H94B 5I6OA 1NAMB 1SJHB 2NXZD 4MKMA 2Q7AA 2PXYD 5KSBB 1PY9A 4JFFD 4OFPA 4ETQA 3PL6A 5DO8A 4XO3A 5C0AE 2BSRB 1BYNA 1F3DH 2V7NA 3SKOA 4K71C 5AYUL 5E1QA 4BINA 4WEEA 4DP6X 4QHPA 3W11D 1DVFC 5MHSE 4LKCA 4O02A 4PTUA 5EA0L 1QAWA 5D7LD 3EFOA 3H6AA 4DQAA 1KYAA 1NCDL 4QXWA 4U6YA 2EILB 2FIKA 5AVTB 1TMCB 2EIZA 3H8NA 3S34H 3ULVC 2AAVA 3GSWB 5IQ9A 3D3VD 3DPDA 2CCLA 3QUMH 5D71L 2RHEA 2V5YA 1E7VA 4JS7A 1OQOA 4PB0L 3AREB 5TE4H 5FLUA 4HCRL 4WUKH 5CILL 1UYWL 3WD5L 1P4IH 3MRLB 1DVFD 1C5CL 1Q90A 2C4XA 3CH1A 2CXKA 2UYLA 5GJSL 5IROA 3S3JA 2H0FA 3EO9H 3HS0C 1UXWA 3D08A 3TCXA 2FO4B 3KDPB 4PJ7F 2Z8VC 5GGVL 3GYRA 4AKQA 4XVOA 2OTPA 3T3PF 3QP3A 4F2EA 4AQ1A 3T3ME 2IGLA 1AE6L 4MAYC 4UINL 4G5AA 3ZK0A 3P77B 4B9GA 1I85C 5SWZA 1I1RA 3HZKB 3VQ1C 5T8IA 4BK5A 4X9YA 3UAJC 2EZ0C 1MI5A 1QSZA 4NAQA 5IQLA 2Q7YA 5D1XA 2LW3A 4QDGA 5HP5A 4OT1L 3DROA 1RZQA 3EFDH 4P3DB 4U1LB 2WNWA 5FGBA 5JW5A 3WS3A 3X2QB 2YRBA 2PKDA 4RGNE 3WE1A 4UTBL 1QSEE 1QFOA 4X6EA 4DZBA 4MAYD 4XX1E 5TQ2H 2X4QA 1INEL 2XN9D 1VKXB 1AKJA 5DURD 5B38A 1IAKB 3BGAA 3UAJD 4ZUTA 5IEKB 5B1CA 2MCG1 5HD8C 5IV2A 1X5JA 1H15A 3RFRA 2APTA 3ZE2E 2O5ZH 2X10A 2R2EA 4M5ZH 5LJYH 3BVTA 2V8MA 4NO3A 1B4RA 3ZL2A 1MAKA 3AG4B 2J5LC 2F7RA 4KX8A 4ODWA 3LD8B 3VFVA 4TVUA 4WFFD 4JG1L 5HJ3B 1WAAE 4Y1TA 2CHWA 5EUKB 3IAPA 1BIIA 2OSLB 1K8IB 5E08H 4U33A 3QWRD 1VACA 1IBFA 5BUPA 5C07A 1A5FL 2CO6B 1OT4A 1JGDA 5C0AB 3SGDH 3MBEC 3N3EA 1T6BX 5FB8A 4WIQA 3BWUF 5G5DA 1FNLA 1WITA 2AZUA 2R56H 5K9JH 4EI5B 1B9ZA 3BFWA 4MCYA 4L18A 4H8WH 3NCYP 1G94A 1K4CA 1IBYA 1E8XA 1OSPH 1XEDA 3MZGB 4N2GA 3V4VL 2GY5A 3HNSH 1NANH 2Z7WA 4S1RH 4JZJC 3DX9A 4NQCA 4KX7A 3MBED 2BXZA 3SE8H 3R0MA 2FWOA 4Z78B 5ABAA 3FU8A 2CKBH 3BUTA 2YXWA 4U1JB 1JPSL 1WP6A 3R4RA 3RJDA 4H25B 3U9UA 5CBAB 3GRWA 4MJ6B 2W0KA 4IBSA 1UC6A 1V8HA 3PWVA 4MA7L 1X7TA 4HIIA 4O2FA 4A6YL 4AEEA 3ETBJ 3CUPA 5TH2A 1X5HA 2UWEF 3T3MB 5GRJL 2Q1EA 2KQMA 4L37A 2A0LC 1F8TL 4RNRA 5BQDA 4NPYB 1UH2A 3LRHA 1D9KB 2WMPB 2IADB 3NN8B 5BUGA 5DD6B 1T2QL 5I1JL 4MQTB 1LGVA 4EIGB 4GKNB 4OCRL 2NNFA 1F11B 4JY5L 1I8MB 1BZ8A 4OZFH 2A9NL 2WV3A 5I1GH 3P3YA 4NQSB 5DC4B 2NXYC 1J8HE 4NC2B 4MJ5A 2HA1A 1B0WA 4AXWA 3LQAH 2FSDA 4KUZH 3ZOAA 5KBPA 4RGNB 1T66C 3CFCL 2OTUA 1QSEB 1HN1A 2MEJB 4FP8H 3F05A 3GXPA 2A0LD 5HGAB 4PLJC 1BBDH 3IYLW 1AJ7H 4UU9B 3NJNA 4YXLL 2HJLA 1IC5L 3ZE2B 1F0LA 2HLEB 4PI0A 4BUQA 4O58H 3INUH 4HWEL 3PWUB 2R27A 2A9DA 2NXYD 3QXWA 3GI8H 4POZC 5C08E 1RH8A 1T66D 4XNUL 5BZWB 4EDXA 5GS1B 1E9QA 3MCLH 4NO2B 5D96B 2X41A 4GP5B 2B4CC 5LWYH 4LHUA 4PLJD 4KROC 5IQ7H 1JNNL 2IPTL 5F1SA 4TN9A 3NJGA 4PFEA 3E8UH 4YHOL 4Z76B 1G1YA 2F7OA 4YDJB 1OE1A 4ZUUB 3VXSB 2FX7L 3HAEG 2ZF8A 1BGXL 1SQ2N 2E7CA 2ED9A 1W15A 1WT5C 3TBTB 2DQJH 5CJXA 5EU7C 4POZD 2YD5A 1JRHI 1F3JA 4RETB 1EIBA 5JXEC 3L3JA 4YC2B 5BRPA 3L08A 4L3EA 5FM5O 3FZUC 3OAZH 5JDJA 4KROD 3QR1A 1Q9OA 1E43A 1HCVA 2GABA 3UZQA 1ZXKA 5FFLA 1HJCA 2BINA 1XGRA 4H26B 4X6DE 4X5XA 1L9PA 4TNVK 3HG1B 5AEAA 3ECVA 1CFVH 3BDBA 3CZFA 4HU2A 4I3SL 4NM4L 5F7HA 2EABA 3LKRB 3PGDA 1IU1A 1UM5H 1E7UA 2B3IA 4U7SA 5AVZB 2VJ0A 5IB1B 2CLRA 1YUHB 3WFEL 3IXAB 4F57H 4OV6F 1RUPH 2X9WA 3EDKA 2ESVA 1KJ2A 1JYVA 5JXED 4KQ3L 2HZHA 3H85A 3W5NA 3N44F 2WLLA 1HNGA 5FUOH 3FZUD 2YGPA 1YQVL 4AOFA 1T0PB 1D6EB 4P9HL 5FYJD 3OX8B 1MREH 5ID0B 1MG3C 4WNSA 5ITFA 1BZOA 3BAJA 3EBAA 2A6JA 4XE5B 3GEFA 4X98A 1CURA 3DURB 1QACA 3U9PL 2VDMH 5B1JA 5K93A 5JUEH 3DRQA 1C7TA 2EUVA 5L4IA 1JDAA 1TVHA 2KLRA 2CRZA 3LEXB 4G6AD 1TTUA 4DVBA 1CFNA 1F56A 4JFTA 2WAHA 1NWOA 3U4KA 2DQHH 2XXMB 2XWEA 3TF7C 2XG4B 2YAMA 5F0MB 1XT5A 4HJJL 4RA3A 1FUNA 3OKEB 2QADC 4MNQD 1R19A 3ZTJH 1B3IA 5AW6B 3WFBL 1EXUB 4N0UA 2DJ4A 4HISA 1O0VA 4XVSL 5C08B 4YN3A 4PP2B 4U6XA 1E4WL 1BD2E 4Z0XA 1OGAD 4Z5RA 3TNMB 4HCGA 1FLTX 3K6NA 4JG0H 3NFSL 2DD8H 2XQYA 2F18A 3P1VA 2FUQA 2A7BA 2WQUA 2BFGA 2GY7B 4R83A 1XR8B 1DN0B 4JCWA 4W9EC 3MNWA 4KJQC 4OGYH 4DGIH 5KYWB 4FQ2H 4XC1H 3HZYA 4YSRA 5EF3A 3G08A 4M1GH 3ARPA 2P5WB 4IJTA 4OJFH 3FW6A 1RPQA 2Y5TB 1O6TA 4Z7QF 4TUOB 5CSBA 1U8HA 2PPEA 1P2CA 5CSGA 5FF6A 4RIRA 2GK0A 1BMWA 4B7LA 3QG7L 5K39A 4OJYA 1YEFH 4APQD 1E2VA 3D2TA 3QDHA 3L3OB 4TTGA 1ZPUA 2JLPA 3C5JB 1QD0A 4RA0C 4QRRA 4RX4A 2K45A 1M7DA 4KJQD 1UHVA 5I1IL 2DDQL 3FONB 4FXGC 1YNKL 4DVRL 1B0GB 4RGOH 2DWXA 5FR3A 1L0PA 5JQHC 4R0LC 2BVOA 2KZWA 2XLLA 1T3FA 1SEQH 3EYUH 2R39A 2OZ4A 4NUQA 2DTMH 3NACL 4K2UH 3PQYB 3CXHJ 3DX7A 3FYEB 2H0JA 1OP3K 3TA3A 3QFJA 3BAYA 2OP4L 4TVPE 4QRTB 1LO2H 3X3GH 5C3TA 3IETB 3OGOE 4MB5A 2VQUA 4NQDB 3CLFH 1G7PA 4QRQB 5DEFB 1NCAH 4ZOEA 3QCUL 4BZ2H 2L7UA 1G7HB 1T6VN 1UH4A 2DMHA 2CBPA 4KHTH 5F96L 3CSTA 3MGAA 4OFKA 3ZSSA 4NQEB 5HDBF 3I02A 5DHXB 3X11B 2H26A 1KUMA 3JWDH 4XP6L 2WQRA 1KFAL 4IU3B 4OM1L 3VFGL 3ZLQC 4DW2L 2NY7H 1AYRA 5IWLC 5JA8B 1UKTA 3MREB 4J2XA 3WLBA 1QQDB 1NCWL 5M95B 4Z18A 4QHKJ 3LZNA 2P48B 3IDYB 1S5HA 1Q0XH 5FOJA 2WBJC 1U3HB 2SEBB 4U49A 4F27A 1AR2A 4MD0B 3WGUB 1QP1A 4RMUA 5MEQB 1R24B 1CXIA 4PQXA 3SKUD 4BKSC 3TF4A 1FZJA 5D2LA 1HNYA 3G6JF 4ODSL 4ODBD 2NY1B 3RHWK 1FCGA 2FHCA 5DD0L 5J1AA 2FEEI 5I74C 1CMOA 4JO1H 5IFJB 5I2IB 1BD2B 1I7TA 2CDGA 2WLZA 4ZFOA 3P2BA 2TSAA 2VLJB 2UZXB 3FO1B 3BT2L 3EF4A 3O6ML 3SDXE 3QJFA 3KMDA 3F7KA 4ZX6A 1T83A 3AQYA 2J8OA 3PAUA 1NEZA 3KNBB 3CDZA 2H32H 4YZFE 4NCC2 2Y7NA 3AADB 1CGSL 1UUNA 4HS8L 4NQUA 4JGJA 2FJHB 2ITCB 2MCPH 2ZUSA 3TIDB 4RBPK 1ZV2A 2YLKA 2UVFA 2O5NA 3W39B 5D4IA 3UG5A 4QIRA 1UWGH 1CXKA 2WXPA 2EYTB 5GZNA 4EF3A 1UZ6E 2N0KA 4W6WB 4FA6A 1NLBL 4K94H 1CI5A 1OD7A 2C3VA 4ZMQA 4GQ9H 2ALWA 3NQKA 4XTRD 2EQDA 4PN6A 3AQZA 2HLAB 1PJ9A 2IDTA 1XGTA 2ZG1A 5C7XL 3OAUH 1MLBB 2BNQB 4NFCA 1AGEA 4I13B 3G5YA 4Q0XL 4L4JA 1BOGB 1PAMA 3ALXA 2JTDA 3GHBH 3K1KC 3DO3A 3DXAB 4PRPE 1G0YR 3CAFA 3QDGE 1TJXA 5DJAA 3NUKA 4LVOB 2IDQA 2ZCKH 5LLIC 4DSYA 3HFMH 5CXPA 1E4XI 3BPLB 3SDAB 4AYID 2EVIA 2ZSWA 4UBDC 3NSXA 3KR3L 4OCWH 5IW1A 1RL1A 3UJIL 1NOAA 4JJ5A 1MJJA 1PDKB 3GUTA 4CAGA 1F4YL 1TJGL 2DI8A 4LLYA 4FI7A 3MNVB 3WHE0 4ZS7H 2OR9H 1W0YT 5EU4B 3I2CL 3BN9C 3T6VA 3AUWB 1A6WH 2E9BA 3CDGB 4P4KB 2GSIB 2NSXA 4O2EB 4ZMNA 2AKRA 3VFUA 5DEGA 4DEUA 4PR5B 1IIKA 1EMTH 2CDEB 4G6ML 4U3SB 2GK2A 4AH2B 3MBXH 4HGKC 4WV1C 5DK0A 4ONGH 4XVJH 1UJ3C 2EE3A 4IMLA 4UBDD 4PV8A 3PV6A 4ATWA 4AY0A 2AK4B 4FLQA 3B8SA 4JHZA 2V5MA 4M48L 4GQZA 3JTSA 3SKNA 2E56A 1CF1A 4XB3A 5EU6B 4R2GC 3ZO0A 3M46A 4GUPB 3BN9D 3IBEA 2DI7A 4R96A 3O2WL 2FYYB 5FWQA 3D2UD 1U3NA 4TQEL 1QSFE 2DQIL 3I9AA 1A8ZA 5GHWL 5CCKH 2DQGL 1MFMA 3C8KB 2W88A 4R8WH 4GUCA 4PS8A 3MV7B 4G7RB 4X7FC 1X6NA 1QWHA 3VI4E 5ALBL 3W38A 1JL8A 1MLCA 1WFJA 5ICZB 3LIZL 4MKTA 2CUHA 1MRDL 1P1VA 1CS6A 5DHVH 1PZAA 5FO8B 3SDXB 3L6FA 4GT7A 4WO4B 5CAYB 3K8LA 5IQOA 5J8OA 1WBYA 3KM2A 4RDQF 4U1HA 5DEJA 4ZPVB 4R2GD 5BZDB 1TKWA 1N0LA 2J25A 1M9SA 3F3HA 4I9XA 3ILDA 4XN4A 3DGCR 4IOIA 1SY6L 3KWVA 3FCGA 2ZXWB 1EJOH 35C8L 4MDIB 5DT1H 2NTFB 4EZKA 2A83A 2VH5L 4FQ1L 4OUUA 1SOXA 3V0IA 1QUNA 4NCDA 3VUAA 4OTXL 4DESA 2DW5A 4U3CA 3FO2A 5IESL 5JHDD 5I18H 3N43B 5E0QA 4E2OA 3I74A 5IIEA 3V0EA 2K70A 3TJEL 1B4JH 2Y1AA 3I3BA 4AG4L 2CE6A 2FNWA 2EXTA 4NZDA 4I1RA 1P7HL 3F00A 1XSOA 1OEZW 1KXVC 4PWFA 4G1MA 4XNMA 4BH7A 5AG9A 2PP8A 1BG1A 5EO0B 2F9BT 1CE6A 4YIQA 4QTIL 3U6XA 1ZHKA 2HG5A 3QO1B 3V0VB 5E9DA 1CD0A 3O8XA 2B5IB 4U1NA 4ZTPL 4NWTL 5JW3L 5AVRB 4PJHF 4RFOH 4GFTB 3K2UL 2AV1B 3AW5A 1M3JA 1E28A 3LH2L 1SDDB 1OPGH 2EADA 1B4TA 3WS6A 5EV7A 2BHYA 4H2CA 4NQXB 3JTBA 2NYKA 4NT6A 4FQCH 3BZFB 1Z3GL 4P23A 2YQ2A 4Y5VC 2JKNA 3HNVL 3S35H 4CN6A 1JPEA 3T4YA 3ZBMA 1NGPL 3BPNC 4ALAC 3NJKA 1PYWB 4WFEE 5F89A 3VD9A 3EO0A 2AJ3A 2YD2A 4KMQA 1TJIH 4LKXB 2EAEA 5J9PA 1RV6X 1OV8A 1F02I 3M17A 1BQ5A 3ZRSA 5KAQG 3K6DA 3MKGA 3N85H 5DJZA 1USQA 2VJ8A 3JVGC 4U6HB 1KB3A 1T1ZA 1DBMH 4M8UA 1A14L 2ERJC 4NQVB 2DLHA 4HFUL 3QIUC 2VM4A 1HQRB 1QSFB 5K59F 5F1IA 3GUFA 1GSKA 1VGKA 2ATKB 1HCFX 2GJ6E 2J1XA 3BWUC 2PABA 4QY8A 4FF9A 5HI3D 4L3CA 3VI4B 1NDMB 2FR4B 1GCFA 4JKNA 43CAA 4JGUA 1QMUA 2BZCA 3VXPB 1WZKA 2BERA 4Q6IB 4N9GA 1FFNB 3IJHA 1Z7JA 3SGJC 3WFHA 4D0DB 5L88L 1HEZB 5IB4B 2GYSA 2BY1A 2MH4A 1NCDH 4G8GD 3QIUD 4UT6L 4YPGA 4JBSA 2HKHL 5FC9A 1BJ1H 1GMEA 5D71H 5AG8A 1MCNA 1C8PA 1SJEB 1WQVT 1UOKA 3JV6A 3RWDA 4HF5L 4URTB 2OJEA 4HYTB 5F71A 5C2BL 2R7EB 3NJFA 4PB0H 5I1EH 2MQGA 4IHOB 4HCRH 3NGBB 5CILH 1HI6B 1UYWH 3F62A 4MSWB 5E8PA 1C5CH 5GJSH 4OLXL 1RPKA 4JO2L 5BPPA 2D7QA 4IEFB 3KXFE 5GGVH 2PTTA 1NMAL 3OKNA 4A7TA 2IH3B 3BYYA 3QUXC 2X7LA 1OALA 2V7HA 1BQLL 1AE6H 1XF4B 3LPPA 2HPOA 1G7LB 1NDGB 3KBFA 3UTQA 2XA3A 1OB1A 1R5IA 2NY4C 2Z93A 3L3HB 3IBOA 3ISRA 4FI6A 2IALA 2VAAA 3UYRL 4ZMLA 4J1UA 2RFXB 2XBTA 4RMTA 4AYGA 3RDTA 4YSCA 3R06A 4R4BB 1MCWM 1EDYA 1GY1A 3ZYOA 1EHAA 1AMXA 3QUXD 4JQXA 4UTBH 1S8DB 3QIBB 2W92A 3VSQA 4PD4K 1G9NH 5H2BA 4JLRA 4JFYB 4MA1B 5ETUA 1INEH 2AJYL 3BX7C 4DKFL 4LSPL 2IDUA 2VERN 2NY4D 4X4ZA 4B9YA 4EUPG 4E9LA 5I82A 3RGVA 1UWEL 2E4TA 5F8RC 1A6TB 1UOLA 4QRPE 3IT8D 1RIHL 5IVXE 1ZHLA 5K1NA 5ICXB 4PJCE 4Z7WE 3A4AA 3MHZA 4HWNA 2A38A 3KL5A 2CIKB 4AGOA 4JG1H 2YQBA 1A02N 2J8UF 1FSKB 4PYGA 3DBXA 2DPKA 4YGAB 4N8VG 1YEJL 5ECGA 3EOBA 3LS4L 1A2YB 4XMVA 4BSWB 1XFPA 2EC9T 2V17H 4E36A 2QVTA 4OLZL 5KSVA 3M1BA 4NHUA 4E9TA 5IMMB 5JOFA 2YUZA 5C0RL 2X6AA 2DWYA 1CD8A 4JRXE 3TBWB 2QTVA 5JHLL 3V0GA 1BAWA 1LDSA 1XXDC 2VQ4A 1GY2A 3WN6A 3Q2WA 4NM8L 1S9XA 1M1XA 3D8MA 5EBMA 4FX5A 3O81A 2XA8L 1EEQA 2XDHA 2ZUWA 4FQPA 4ACTA 3LRMA 2H8PA 4FG4A 5CEXA 4JN2A 1EEYA 2AQRA 1SPDA 2UY7B 3PU7A 3V4VH 4XNYH 1A4KB 1LNUA 1UFGA 3FRPG 3VA2C 5EBLA 3WY1A 1YDPB 4FAAB 1U2YA 1KGCD 3IF1B 5JIQA 2QHRH 5F9WC 4N24A 1RMFL 1D5ZA 1JPSH 4WU7B 4G9DB 3RI5K 1U2HA 1ZS2A 3CFUA 2EEFA 1HHJB 1R4XA 3KXFB 3KH4A 4A6YH 4EQ2A 4L9LC 4WTQA 4M02A 5ID1A 2I07A 1L7IL 1U8OB 2CAKA 4FZEH 4OQTA 1N2RB 4D0CB 1Z9NA 3DPBA 4G3YL 1F8TH 4LESA 3RPBA 1HXYA 1JPGB 3SN6N 1MJ8L 2KS0A 2EE6A 1T2QH 5I1JH 4HFWB 3RZCA 4P0DA 5EEUA 2DWEB 4TQ8A 2WYHA 1AO7E 2F54A 1XMEB 4ABVA 4M00A 5B21A 5B39A 1S7WB 4JY5H 4NNYA 2A9NH 2C9QA 9CGTA 3O45B 2FSEA 1J1PL 3BWAA 1FFPB 2MFNA 3HN3A 4GI6A 4H0IA 2IAMB 4JFSA 4LARL 1SLVA 3CFCH 3A23A 3VE0A 5C8JB 1U4FA 5FGCB