5LUMA

Alpha-crystallin domain of human hspb6 patched with its n-terminal peptide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
78
structure length
78
Chain Sequence
b'GHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein beta-6
molecule tags Protein/peptide
source organism Homo sapiens
publication title Structural Basis for the Interaction of a Human Small Heat Shock Protein with the 14-3-3 Universal Signaling Regulator.
pubmed doi rcsb
total genus 12
structure length 78
sequence length 78
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lumA01
2WJ7A 1GMEA 4M5SA 1WH0A 3W1ZA 1RL1A 2WJ5A 4YLBA 1WFIA 2N3JA 4ZJ9A 4YL9A 3L1GA 2BOLA 2RH0A 3QORB 2N0KA 2Y1ZA 3L1FA 3GT6A 4I88A 1WGVA 3AACA 4M5TA 5DS2A 1EJFA 4YE0A 4MJHA 3VQMA 2Y1YA 3AABA 5DS1A 2Y22A 2XCMC 4JUSA 4FEIA 4YDZA 4PBDA 2K8QA 4RZKA 2CG9X 2JKIS 2CR0A 3Q9PA 3EUDA 3GLAA 3QORC 5LUMA 1X5MA 2KLRA 2KMWA 3VQLA 3QORA 2O30A 4JUTA 3J07A 3L1EA 3GUFA 3N3EA 1SHSA 4PCKA 3Q9QA 4ELDA 3IGFA 3QORD 2MNWA 4YLCA
chains in the Genus database with same CATH superfamily
3UC2A 3HZMA 3ARGB 1F11B 2C4FT 1N5AB 1KTDB 1FDLH 1VRSA 1U3YA 4R8WL 5J13B 5IM7A 1KUMA 1WS7A 1B0IA 5HYJA 3WKNA 1VZGA 1KT2A 5I19L 2A73B 1W91A 5DZLA 4QXWA 4PPTA 3WIIL 3MUUA 2GJJA 3SGEH 2HB0A 4F7PB 3SDCA 3UAFA 3OLGA 1GYVA 4LEEA 4OVVA 1LP9B 1MCNA 4L5FH 2WZAA 2MJWA 3EH4B 4FI6A 2H9GA 1SHMA 4MAYD 5JA8B 3NDYE 4JDVA 2P28B 1MCOL 2VDPH 3KPTA 1T0MB 2W0FB 1IAIH 5JQ6L 2VDQL 3ILQD 4QUOA 3RURA 2YGOA 3BHBA 4WZ9A 1HU8A 3B9AA 3CFKB 4KOBA 4LO9A 4N0YH 4EKXA 3RZCD 2ADIB 2JJSC 1ZEAL 3ZKQD 1DJSA 4OBRA 4ZK8A 1K8DA 1KNOA 2EDOA 3ARRA 3RZCA 1GHFL 4U1LA 3G6DH 4X6EB 4HCIA 3ZUNC 2C3XA 3QUKB 2YN3A 3CFEB 4FULA 1JI1A 3SDDB 3MRIB 4ODWB 4JE4B 4X4XA 4JCLA 4OJCA 5JW5B 4J2QA 3T0EE 4JDVB 5I8OL 3HBQA 3IM1A 5DJ8B 5DVNA 4ABWA 5C0EB 1INEH 3TOPA 2HJKB 2IH3A 5JO5A 4G7SB 4Y19D 3UJJL 4FNPA 1AACA 1T04B 1V7NH 1A7QL 1OKEA 3B2UD 3KYNB 5D2NC 2VXVL 1XCXA 3FRUA 1PF3A 5DJAA 3VWJB 4YDNA 4ES8A 2YAMA 3AWFA 1A3RH 1JTTA 3IMVA 1DSWA 3E6FA 1OL0A 5D72L 1NH6A 1AI1H 3G5YA 3H3PL 4J12A 4JDTL 5CNHA 4Q9QL 3VFRA 5BJTA 4ZUWA 5BPPA 4JAMA 4M6OH 1G4MA 4PFEA 2ZAHA 1YEHL 2WINB 2ENYA 1R3JB 3UYRH 1N6VA 4QHMA 2WAQA 5ENWB 2D4FA 3I6SA 4NBZB 4JZNA 4L0YA 2X2UA 3CC5A 4GRWF 4X6DE 5DD5L 2EP6A 1EO8L 4O58H 2M2DA 3TBCA 4ZUSA 1T0OA 4KNSA 3ERXA 1OE3A 1NWOA 3ZVVA 2DJMA 3G04B 4M6OL 1GY2A 3MJ9H 3Q9PA 1D7DA 4UT7H 4GMTL 1PZ2A 3KYOA 3G5ZA 2WTRA 3EFDL 3D12B 2DY2A 3CC1A 4Z7QB 3MZTA 3QWNA 3BP7A 4WI6A 4PJ8B 5A6MA 1SMDA 4MCYB 1NANH 1S3RA 4RGOL 3I75A 4NO2A 2QHRL 2AJ3B 5GGVL 1AS8A 4AZ8A 3HG1E 3OJMB 3TEWA 3LS5H 1PEZA 1CDGA 3CXDH 1ZCRA 3C5ZB 1KNOB 4PJ5D 4ELMF 1KTLB 1U9KA 4HKBB 3MRDB 3NIDF 2F54D 5SWSA 1LNUB 1KV3A 4I48A 2XNAA 1M2VB 1VFOA 2ORBH 4OSUH 4B9ZA 1KJMB 4YSRA 4AQAA 2ARWA 5EO0B 2VUKA 3S8GB 4C56B 2N56A 2VZOA 2VJXA 3BAJA 3IDIA 3P11L 4HFWB 4I0PA 5AG9A 4OZFB 2DQEL 4QRSA 5EBMA 4LF3B 4HT1H 4S1RH 5HVHC 1FZJB 4NKDB 3RWEB 3A4FA 4CMMA 4MXVF 4S10A 1KELL 3K91A 3SPCA 4O2FB 1TCMA 3B3IA 3FL7A 3TNNA 3GLAA 5H35A 1U92B 2P48B 2C9AA 3DNKA 2IDFA 4ORZC 3L4UA 2DEWX 3EDJA 1IBHA 1SEQH 3IU3B 2JCWA 1HZHL 5E6IB 1ZSDA 4TRPH 1U42A 2XTJE 4NN5B 4E9XA 4IIQB 3BKML 5MEND 5FO8A 3VXMA 4JO2H 4DKFH 3ULUF 1HHHA 4A55A 1T21A 4MA3A 5C0ND 4ZSOA 3FUNA 1F3JA 1UEMA 1LQBC 1NUNB 1MN4A 4D9QE 5ICZB 3OB0K 5GJSL 1ZLWK 1C08B 2DWTA 4JRWA 1IGIL 1FFPB 4WCYL 4DAGL 1FZOA 2MCMA 2VLKD 1E5BA 3L8QA 4G8GA 5JXED 1HOEA 2B39A 4LPXA 4NYLB 1ZK9A 3BPOC 4FZ8H 3VWJC 1OZUA 3PAZA 5GZOD 5DEFA 1NFIB 3S7GA 1GA2A 3ZL4L 1OOWA 3CD4A 4K9EL 3U4KA 3S9DB 2FJGB 4HUKB 3BXNB 2G0KA 3ARXA 5D1XB 3IJSB 2VN3A 2BHZA 4AM0A 2QHRH 2Y1YA 3MOAL 4PJ5B 5JIHA 5F7EH 3VO0A 4FFWC 2XWCA 4JFWA 4K23H 4YDMA 3FYIB 3KW8A 4KK6C 4JHUA 4HLZH 3UADA 4MYWB 5BS0B 1VEPA 3K6IA 4YC2C 4Z3JA 2VC2B 2R2CA 2IV8A 3DUHA 4NRZA 2OMXA 5J12C 1GJIA 1U2HA 2NY5H 1OB1B 5MP6H 4G8IB 4NQUA 3FSZA 3L08A 5K59F 3X1FA 1KCSL 3BWZA 5ERWB 1QKZH 4FQQA 4MAYC 2Y7LA 4JFFE 4BKSC 1HIML 3ISWA 3GKZA 4IKIA 2L8AA 4MNGB 4WI7A 3U7YH 1CGSH 3AY4A 3BKMH 2DWXA 3NIFF 1E3XA 3PWPE 3IEAA 3QEHB 2P80D 5EZIH 3CFMA 3R06B 2N01B 3TF7C 3N3EA 3DRQB 3ZBMA 1IQDA 3D3VA 3QFJB 5TDNB 3UYPA 5I17A 3PP4L 4G80B 1CPUA 1E50A 4ZTOH 5E4AA 1G6VK 4N9GB 1AS7A 5T33L 4FQCH 1XV8A 4IRJA 2WXPA 4G3YH 4U6HB 5J8OA 1GGIH 1E4XL 2FJUB 2YPKB 3LRSB 5LGJB 1K3IA 3PCYA 3QQ4B 2G5BA 3H9SA 4YE0A 3V0AC 2O5YL 1FYTD 4FQXA 4KVCH 2V2XA 1JV5A 3RU8H 5DQJB 5AAWA 2AFNA 4KC3B 4O2CB 5KAQF 3SE3C 3FJTA 1C1EL 3ECQA 3U48A 2ORBL 4ZXBD 1UUNA 4A6YA 2FT6A 4ZUUA 1B6DA 1DANU 4A39A 5HI3C 1TU2B 4DUVA 4R7XA 4OLVL 5MEPA 3MRRB 1U8HB 2BHUA 4N0CD 5ID1B 2YD2A 4A37A 3BIBX 1BVLA 1B2WL 3F2LA 4PTUA 4JL1A 3ULAB 5J7CC 4PRPE 4QXUH 1TNNA 4NUMA 1UWYA 2AEOA 4KV5E 3RE0A 3WIAA 3A24A 3IPFA 2BRRH 2QDVA 2D3NA 3V9FA 1A6WL 4KWUA 1F4XH 3BESR 2WMPB 2E6PA 1WZAA 3QJSB 4ZOAA 4ZMAT 5BS0D 1XGRB 3IFPB 5FWQA 1MRFL 4F8PA 5B3NA 1COBA 3TBWB 4WIQA 5AENA 5F7LB 2QGEA 3SKJH 1DO6A 1KENL 2JLPA 4XBEH 1OP3K 1U30A 1WCBA 2VLKA 1JCVA 2PXYA 2EDQA 4RX4A 1P1ZA 2FQEA 3II1A 4JHAH 3CVHL 3OAZH 1HKLH 3WGVB 1NCWH 2WUCL 3B83A 4GUPA 3VD9A 5C07E 5FAAA 2MRYA 4W9DC 2DLGA 3DGDA 3IGUA 3LN5A 3U0TA 5CIPB 2YK1L 3QISA 3BGMB 5LJYH 1SN2A 1XCWA 1R24A 5BZDA 5KG9B 3JVGA 3MLSL 1X44A 3T0ED 1EMTH 1SY6A 3LSOA 1IU1A 3GSRA 4H8WC 4TPRL 5HJDA 3FULA 3F5WB 3QDGB 3MRKA 3KWXA 4M7KL 4QXTA 4WGVB 3RPIB 3ZZLA 2WD0A 5F21B 3AG2B 3HG1A 4WUKH 2JKJA 5J3HC 5DHEA 3U2IA 4HOMA 5I16A 4WW2B 1U8NA 3MLUL 2B9BA 3WTVA 2BSBA 1XQ4A 1CFMA 2OI9C 4J3UA 3TJEH 4BELD 2CE6A 3F7PC 4LF3A 4JLRA 4PY8I 1XR8B 5TQ2H 5AYUL 3WNOA 4LSUL 3NOIA 2DICA 5J5EA 2G75B 2ZSWB 3VYOA 1NBCA 3J27A 2HTKC 5EEVA 3BJ91 1MFDL 4ZDHB 1GHFH 2FGWL 1VFAB 2ZWNA 1L9TA 3PHQA 1HXKA 4WW2F 4U1IA 2NX5B 3HPLB 3MLRH 1GGTA 1MNUH 1MI5B 4TM9A 1QA9A 2YD3A 2ZP9A 4M3HA 1QPPA 1S8DB 4Q7DA 1UYWL 3O41A 2UZYB 1LILA 1AE6L 4JFTA 1B2WH 2ATPA 3QJVB 3MRBB 1UA7A 4G6AD 2DLHA 3OQ3B 3SYOA 1HNFA 1TZHA 2QV2A 1QTPA 3HBPA 1DL7L 2F53B 4XWOC 2ENQA 4G6KH 5KBKA 3ZYIA 1PY4A 3WXVH 3LOWA 1A2YB 1Q90A 2Y1ZA 5CEYA 5L6YL 5GGRY 1EZVY 1XX9C 3EFFB 4KROB 2QKIA 3VGHA 1M7IA 3CFIC 5IT2H 1OHQA 2EABA 2NXZD 1NOLA 2JB6A 2Z3FA 1E30A 3DRTA 1P4IL 3UPAA 2VABA 1PBYA 4P9HL 4YFDB 2J5WA 1CDBA 2H26B 4PP2A 4OD3H 5EOCL 3WXVL 4AM0B 1F4YL 1INDL 3GMMA 4GIPD 4EUPB 5ANHA 3MLTA 2WYIA 4YX2L 1MZZA 2IBZY 1D2PA 3IXTB 4H26A 3ES6A 2IAMC 4FFWD 4HWEL 4GO6B 4KH2A 4QRTA 3E6FB 2J88L 4HH9B 1ETA1 4KY1L 1CXHA 1JGIA 1A0QH 3AMKA 3VJ6A 1G9MC 2EC9U 3H6JA 3EJUA 4UUJA 1FZOB 4DETA 4KDTC 3BGAA 1PKQA 2W60A 3MOBH 2QGCA 4LNVA 4IJTA 2SEBB 1W0VA 1F3JB 3SKJL 4M5ZL 3ZE0E 5EZJA 5HGHA 3POHA 4BH8B 1C7TA 1TJXA 5HDWA 3RL1A 1N26A 1G1CA 3BP4A 5GGQH 4QY8B 1F4WH 4LRIC 3KLAA 5C70A 3UEZA 5C9KA 4BSWA 1CBJA 3QUKA 1R3IL 3HS8A 1GC1C 5CAYB 5AAMA 1MI5D 3GD1C 3VI3E 3FQUA 3WFHB 5SX5K 1E4WL 2JH2A 4G8FA 1LEIB 4AQEB 2OMZB 4HIXH 4UZSA 3CFKA 5DDHB 2BC4A 2YA2A 4OLXH 3ZL4H 3RVVD 1KPUA 4YDIL 1QI4A 2XV0A 1MVUA 2IEPA 4P4KA 4NB7A 1FFQA 1TITA 3H3BC 3G08A 3MV7A 5CFHA 1ES0B 3KD4A 4TL5A 5DC2A 2R2HA 5DJ2A 3SDDA 1CBVL 4DESA 2CLZA 1FGVL 2VLRA 3FS9A 3KJ6L 4PLJD 2A4ZA 2EC8A 5EG6C 4NOBA 4ODVH 3SB3A 3ETBJ 1CFNB 3QO1A 2EE0A 4PWJA 5E8NB 3TASA 4X98A 2HKAA 1VZHA 3FOLA 3BP6B 3GZOA 4I48B 3ZDZF 1TZIB 4J4PC 1E4XH 1NL0L 3ULVC 4FG6C 2FECL 1YMHA 2K0RA 2V8MA 4PY8J 3QFJE 5KVDL 4ZX6A 1DR9A 4LP8A 1HZHH 2OTUA 2YXFA 2ZG2A 3DMMC 4P2RE 3T0VA 5CGMA 4OLWL 2WNGA 2DIBA 1MH5A 3BCDA 5DFAA 3V4UH 1XTMA 5FUCC 1PJWA 3ASOB 3LKOB 2Q86B 1U0QA 4XO3A 3STZB 5F3BB 4I89A 3UP1A 4X7EC 4M4RB 4Y4FC 4NCDA 3O4LD 4HT1L 5D1ZC 4UOW1 4H0LC 2IADB 4GRWE 4X9IA 3RWDA 2Z34A 3E1F1 2CLRA 1YYCA 4DGYL 15C8L 5DR5H 4F8QA 2PWFA 1MCLA 4LASH 4TQ8A 2VQ1A 3EJZC 1XH2A 3MXWL 4AYBA 3GEFA 5E1IA 2VO5A 3JZ7A 1OO2A 1VGKA 2QEJA 3SEPA 4Y4KA 4F7TB 3ARSA 3L3GB 4KKCD 2HKFL 4BFJA 3FB7A 3DOIA 3TTYA 1AJ7H 1RJZB 1W2KT 3A5VA 1W0WB 2CHDA 4LASL 4BFIA 1Q94A 5A2LH 4BWWA 3LS5L 1QVOA 4LLVA 2OFQA 1IKOP 5GRXG 3SCMD 3NQIA 5IB5B 5DYOB 3Q6GH 2W92A 4HCRL 2WIMA 4UU9A 3QR2A 5F89B 1HYSC 3GS7A 2R0ZL 4TSAL 4NZFA 2X4NB 2VDRH 3D0VA 4IIQC 3OV6A 1XIWA 3BN9C 1XXDC 1UQSA 1BG1A 4GAYA 3MZGB 4LLQB 2PTTA 1Q1JL 5DC4B 2AJVH 4NENA 4PJGF 3H9HA 1RHHB 4OLWH 4GJTB 5DUJA 4RX4D 4JE0A 3QDMD 1DJGA 3CCHB 2OMUB 3CFUA 2OCCB 4BHUA 2AK4B 3FT3A 4ZXBA 2X6CA 1IEBA 3DX9B 2YJLA 1NL0H 2DL9A 4K5PA 2OQJA 2IBBA 4OJEH 1IRAY 1GY1A 1JTOA 3D05A 3MX0B 4FAAB 4X6EA 2OZNA 1TLKA 5C0FA 1OP9A 3QHZL 4WWID 2AC0A 3RKDC 4TRPL 1S7VB 2QZ5A 5DMIH 2WWMC 2R29L 4TULL 4IEFA 1FVDA 5D72H 5KS9F 3RY5A 2OYKA 3L5JA 1U95B 4K73A 4I77H 1T6WA 2R51A 5C0IB 1QR1A 1BZ9A 1GGCL 3MRHB 1G6RL 3PWJB 4HIJB 2ZAGA 4IOIB 4J3OD 3LQZB 4XP6L 3HE7B 3TBTA 1OGAA 2YSTA 1AZNA 2GSIA 3PU7A 2EQDA 3O6FD 4FTDA 1U8PB 4GINA 1TLMA 3FU5A 4RGND 3DO7A 4GXVH 4N90D 5FGRA 2GC7C 1P6FA 2AJSL 1Z32X 4LBEA 3O11B 4MZ2A 1T66D 2WP3O 1AXSA 3DV6B 3OGCB 3FBKA 5D7SH 1RUPH 2OQJB 4PB0H 1WA2X 2WZ6A 3FN0L 1AKPA 5JZ7D 3FQWB 2WP3T 1IBBA 2HN7A 1WIPA 2LLLA 2XPYA 4JVUA 3K71A 1OXYA 3QDME 1QBAA 1D7BA 4JKPH 2X4RA 8FABB 5CU9A 1BBJA 5GIRB 2E6JA 2MOGA 1VGKB 1J1XH 3E9TA 4WFEE 1A3ZA 1DVFA 2A2QT 3F64A 4Y4HC 1MOEA 4LLQA 3UIZA 3DHJA 4JB9H 1U58A 1AZZC 4K5NA 2LGNA 5AOKA 1CDHA 1FNSH 4Y4FB 1HDMB 4UM9B 2GJ6B 4X7SL 1QNIA 2VC2H 3V10A 4IKNA 2Y6SC 3WEBA 2TRHA 3IN2A 3NFNA 5KBDA 3FRPB 4MDJA 4AQ8A 3II3A 3UG3A 5K9OB 3ZKMC 5BV7L 1BVNP 4LAQH 1QHOA 5LAXA 5IQ7L 5C09B 3MACL 2YXWA 4MMZC 5DJ0B 3MUJA 1P4IH 3SDDD 7TAAA 1F90H 1WICA 2N7BA 3QULA 4LQFH 3GSVA 3KBPA 4CSZA 2Z35A 5DJZB 5L9DL 4TTDD 1AOZA 2L4OA 1FIGH 2XQBL 4NM4L 2F19L 4XE5B 3QXUA 5IBLC 5DVOA 1QFWI 2NPLX 2VM4A 1IJ9A 5AB0A 4U1SA 1AI1L 5I8KL 4FLOA 1JGVH 3W0WD 1CU4L 3JWOC 1EWHA 4DQAA 1X5ZA 1YQ2A 1EEZA 3A67H 1XGPB 3RAJL 2NNFA 4XVUC 5EPMB 3MLZL 4NWTH 2OP4L 1BAFH 1KYOK 4ZFFA 1K2DA 4R4ND 3EZJB 3DIVA 1FGNL 1BD2A 3A6CH 1UA3A 3P73B 4Q0XL 5F1SA 1PLGH 1WH0A 2FWOB 2KZKA 3WDHA 3IRCA 3UTTB 4M1DL 4LPCA 1IE5A 4Y16D 5I6LA 3HG2A 5D7JD 2YS4A 1OSZA 4PJFA 5GGQL 1OTTC 1EAPB 3QXDA 1MFDH 4TVPL 4FXKC 1OGTA 1EHNA 4K4KA 2DQUH 2YPVL 1MCSA 2H4EA 2OA9A 4N24A 1U8OA 5GS3A 3ZK0A 5DMKA 1FSKB 4X7CC 2CBOA 5JR1L 1IZKA 2JELL 4Y9FA 5F8RC 4PRNA 2M1KA 1IT9H 3FH5A 5JUEH 4JPWH 4PV9B 3LXBA 1OT1A 2RR3A 4GNKB 3GJFH 3V6BR 1D5XB 3DI3B 3LD8B 4P3DB 4P2QA 1TJHL 4EI0A 2BNRD 4U2ZA 1IEAA 3VXRD 3DVFA 4LCIL 4PGDA 1DTUA 4O00A 5DK2B 5AAMC 1TETL 5LQBL 5TFSL 4UM9D 3IBOA 2VLJB 1DSFH 2W80C 4IBZA 4OGZA 1E0OB 4OIFA 3V6OC 4U4BA 4N0CC 4ZSOE 4AGPA 4ZPTB 3MLYL 3L95A 4YZWA 2OI9B 5FHBL 3LCYA 1H6UA 4IBYA 5TK2A 4XMLH 3VFTA 1OGAE 3JT2A 4L3CA 3VNYA 5EUOB 3NZHL 3GMPA 4PY7B 1V7NL 3DROA 2ZT9C 2ZKYA 1N5YL 1R3JA 4H2AA 4WWNA 3P9MB 2P4AB 2PR4L 4H1LG 4JFZH 1UXSB 5HGHB 3HN5A 4XNXL 3MLVL 4OLUL 2FR4B 3W2DL 4C83A 2XPZA 2P8PA 4ZJ9A 1HXMA 2KT6A 3U9UB 2YMTA 1Y18B 4F15C 4D0DB 5HHMD 1CFTB 4HGKC 5PAZA 1Q9OA 2FE0A 3C60C 2MPVA 3F01A 5ECJE 3UC0H 4IW4C 3HG4A 3P77A 2ISDA 4EZKA 4PJEA 4JFOB 1IL1B 3AS0A 6FABL 5F71A 3O2VH 4HKXA 1A7RL 1RPKA 1FCCA 4TLSA 4XGZA 1CCZA 4NZRH 3THML 2HJKA 1JG9A 4ZNEA 1YUKB 3P9MA 2EKSA 1AMXA 1TCRB 1BFVH 1EEYA 1S3KH 4MMZB 5DWPA 4UTBA 4PJBB 2JKTM 2XI9A 1AD0A 3E8VA 3U6XA 3RUGE 2ICES 4UANA 3GMNA 4HJIA 1G9NH 5K9QG 3U1SL 2IQ9L 4ETQA 1KOAA 2DQFA 2GPZA 2NX5D 5FGCB 2Y2TA 5TQ2L 3VFOA 3W37A 4HUCA 4M93C 4N0FB 1FG2B 2WXNA 5A2IH 2WCGA 1EXUA 3F12A 1ODAA 3MV11 2WXOA 3EF4A 2CHNA 4M1CD 3GUTA 1F2QA 4V1DD 1P69B 1D5XA 1H5BC 1JTPA 3BEWB 3SQBA 1BZOA 1X3DA 2D31B 5EF3A 1VACB 5DMJB 3TEXA 3C6LC 2DQ6A 2VUYA 5EA0L 2ZXBA 1Y1DA 4EIUA 2LU7A 4WW2A 1RZJC 4P23B 4ZTOL 4O02H 2NYYC 4D2NA 5FUZH 4XZUA 3GJEB 2QHLA 3JTSA 5F1NB 3NJGA 5H8DA 4BA8A 4F2MB 2XVKA 3KPLB 1T0NA 5EU6E 5IGXL 4HK0B 4LMQI 4EDWL 1FVCB 5HBBA 4LEXL 1DQKA 2R7EB 3KPQA 3EBAA 4QRFA 5FOBA 2NY7H 2YUVA 2GG1A 2CO2A 1LD9B 3V7MA 2OZ4A 3VD7A 4O51A 1BDYA 1N0XH 1GKEA 35C8H 2X88A 2G2RA 4OCSL 3QC6X 4ZPVA 1XR8A 2OULB 1JVLA 1MW2A 2CIIA 4DW2L 5JTWA 1F13A 1KXVA 5C08D 3SKUD 2LU3A 4ATTA 5ICYA 2RQ8A 4MKMA 3ESOA 2C8NA 2DWEA 2X3CA 3L6FB 3V4LA 4QKTA 3ARWA 2Y25A 4NQCB 1PL3A 3AG3B 1WCBB 5E1GA 1BFVL 2A6DB 5FLUA 3U1QA 4NQCD 3RJOA 3BUPA 3O0LA 3GO1H 3H53A 4P8QA 1U8MA 3GXNA 3VFUB 4BZ2L 2IV9A 1EDQA 3B2UC 4Z7OF 3K6NA 1P9MA 5DVMA 3FFCE 2W88A 4K3DL 3QAQA 5E5MB 1HFUA 2HLFC 1BV8A 3EJYD 2A83B 6FABH 1HCVA 4N8VB 2CD0A 2V7NB 3IB4A 4OT1L 3QDJD 2E9IA 4JPVH 4NQTA 5E08L 3EOYG 4FZ8L 3X14B 4NAQA 2A4CA 1S9XB 3P9LB 3ZYZA 5GRJL 3RI5K 3DVNA 1E5YA 3TFKC 1PX4A 2FDBP 1KJ3L 1ZA6B 2Q8AL 2XWJA 1NFDB 1C5DA 2A6DA 2EYRA 2HRPL 3FU7B 5G4NA 1TU2A 1R5VB 2ZCLL 2DAVA 2H0FA 2DWEB 5FK9B 3SGJA 4L0ZA 2CGZA 3CV5A 4X80L 3I3EA 4JHVA 5JMRA 1XWVA 3H0TA 5HYJE 2DOCA 3P4OB 5D6DC 3EG9B 3MXVH 1ZHLA 3MRFA 2R69H 2NYZA 2Q3ZA 4RAVB 3QIWA 1I8KA 2FJHA 2ZZUT 1FRGH 5IEHB 3EJCA 5JHDE 4B9YA 3FU8A 3QIWD 5B3SB 4B97A 1CGSL 1OLZA 5KSAA 3WXWH 1E43A 4H13C 5LAPA 4YFLF 4P4RB 5ID0A 4OLEA 2YN5A 1JRHL 1E28B 1KN4L 5I6XC 2W0LA 3EH5B 4YDKL 1CD1A 4PHZA 4UQCA 3GBMH 4YO0B 3CTTA 4XZ4A 1RPQA 4GW1B 4ODTH 4BIKA 1ZHBA 3OLDA 1UJ3B 3C5SA 2UWEE 4JM2C 1QX1A 2LHAA 5DQJA 5JHBA 4OM0H 5DQDH 1WAEA 1OZTG 4PREB 1Q72L 4WI5A 4XPTH 4KHXL 1SN0A 4M7ZC 4M1DH 2P5WB 2Z31D 4OF8A 1TVBA 7PCYA 5I73B 4DFHA 4N1EA 3CHQA 2QPFA 2EDKA 2OYLA 5C6TL 3B2PA 3QJHB 4J4PD 4Y2OA 4OVUA 1A65A 2C1PA 5CP3A 2DKMA 2X0VA 5IJDC 4PJHF 1QRNE 3G6JE 5HVFB 5IFJA 1ROCA 3CVCA 3BCFA 3CSTA 2BM3A 1T89A 4KTDL 2WWKT 4X6CB 3WLWC 1N4XL 3MROA 3LZQA 1CICA 1V05A 1CE1H 4HBCH 4C58B 4F5CA 1KEMH 4J3OG 4N8PA 1RQ5A 1OTUD 3KWTA 4L8CB 4XMPH 1F8TH 3OKOA 4K3HA 1KTBA 3FYEB 5FK9A 1A21A 5C0BA 2CDEB 2HH0L 3LPPA 4JFPB 2VMDA 4WQOA 5DD5H 2IBZX 3HC2A 2H1XA 5IFAH 1A6TB 4H8VA 2Y7MA 4L3AA 3VXUB 3C5JB 5D7IB 3WN5A 1ET7A 1JCKA 1YEHH 4GQZA 4ZQKB 3QPQC 2FLMA 5IJCC 4F37F 1QTSA 3BEVB 2HG5A 4RISL 4U1KA 4W9EC 3WUZA 1MJ7L 3AB0B 3CMOL 4EEEA 4PJ9D 4KKAD 4BBWA 2FJGA 3B2VL 4GG6E 2J4WH 3ZHDA 2DMHA 4NJ9H 5TF0A 2WZ0A 1MHHA 1AC6A 3QS2A 2VAJA 5DZJA 3LIZH 2DWSA 4KKNA 3RVTD 3BLBA 3AGWA 3HZYA 4E9YA 1XBRA 1SDDA 3AWEA 4WHYH 3RWDB 3DX7A 2NZ9C 1ZS2A 4YDJA 3X1GA 3Q0HA 2OL3B 4Z7VA 4BUGA 2J44A 3TT3H 4G42A 5CHNA 3QEQB 3NP4A 5AOMA 1LO0H 4K7PH 1OP4A 3QZMA 2F7OA 3GBLA 5K1VA 3WL9A 5JHLL 3ZZSA 3T4AC 4CU8A 2W07B 1UB5B 2OS7A 2YR3A 4LZKA 1YEGH 4RBPH 5DHVH 1A6ZA 3FTGB 3RLSA 5EEUA 2BWDA 2ED7A 3FFDB 3KXFB 1BJ1J 4FNUA 1QBMH 1RVFL 4PQXA 2IMMA 3OLEA 3QRGL 4LOVA 4TNVK 2WBJC 1X9UA 3K74B 5F6HJ 3TWCH 5HHXL 3OZKA 3Q6FA 2XZQH 4DP8X 3QJRB 2H32A 3JUZA 4KKLD 1JJUA 5C0CD 3QUYC 4P5TD 1RZQA 5B8CB 4Y2DB 3GGWA 1IGML 1NCTA 2B5IB 2J5LC 4ONFH 3OB0H 3ZIYA 1NFKA 2ZX5A 4LCCA 2E7HA 1L7TH 4JRXD 1DVFC 1KGCD 3RIFK 3UROR 2OL3L 5GRZA 2TRYA 5E51A 4JRXA 2MCG1 1GZQB 1THCA 1U91B 5KJRH 2Z92A 3V0DA 5AD0B 3LKRB 1TVHB 3T6ZA 1MRDL 3BUTA 2W95A 2F1AA 4FNRA 4AQEA 5IV2B 4M4PA 1UM6H 1AGFA 5K9KA 3QXWA 2YC1A 2AQ2A 2QSTA 4KTEL 2XWBB 3VXNA 4QOKB 3QNZB 1BW8A 4AE0A 1MFBH 3IDYC 4JDTH 4Q9QH 4D0BA 4KXBA 4XAWH 3V5KA 2NR6A 4X6FA 2FO8A 3MV7D 3ZKXC 1V3JA 3NCFB 4JAMB 5CJQL 3TV3H 1SYVB 3VGDA 2QADC 3H1ZA 2LT9A 1MHHB 4AWJC 4QWWC 4YUEH 1IGFH 2D7QA 1QP1A 2BSSB 2VZSA 3ET9F 1TQCB 2JMRA 4HUVB 2CKNA 3SD5A 1P84K 2XPGA 3QDAA 1BF5A 1RZ8B 2BOCA 5DS1A 2Y22A 2IAAC 2QQKH 2V33A 3VJ6B 2PYFB 4BJLA 4LPWA 2GBTA 5HDBE 3QUMA 3LPGA 4ODUA 3QT2A 1MPAH 4ZW7A 2FNBA 4HIHA 3HB3B 4LLUB 2COQA 2GEQA 4NP4H 3WUWA 2FR4A 1KGIA 3PWVB 1BBJB 1JSYA 4PIRF 4WFFE 2F74B 1KCVL 3CZGA 3RDTB 3TTSA 2DF3A 4AYID 4ZXBC 5FB8B 1RZGA 3K71B 1UKQA 4YHNB 1ASPA 1QLRB 3H42H 1OTSC 2GIYA 3NCYS 4KPHH 3KPSE 3T08A 5KSUB 2DQIH 2VSDA 4G9DB 3PGCA 3UTQB 3G5YB 1JK9A 2CZNA 2VDPL 1M7IB 3BWUF 3CLFH 2Q8BL 4FTVA 1PPIA 3PQYE 1WITA 4EN3A 5JOFA 1E4KC 4NBXB 1QUNA 4YGAB 3EYQD 1FH5L 3ZDYF 2Y07L 2ZKHL 5B1KA 1U8CB 2AF2A 3GIVA 4JRXB 3OKKA 4JPSA 2VDRB 3L16A 3B6SA 1GJUA 3MRHA 3NA4A 3PWJA 4W4OA 4X7FC 4YEFA 2AZAA 2AEQH 5C0IA 2VR7A 2P8MB 1QZNA 4AK2A 5LGYA 5J3HD 3MV7E 4R4NC 4QT5A 3IT8D 4B9JA 3HI5H 4UDTB 3BDYL 4LLWB 3AVEA 3ELQA 2L04A 2X7LA 3IJEB 1OGSA 2ZWYA 1S8DA 1E9QA 2WQWA 2HJLB 4L4TB 3S4SA 5KN5A 1NCNA 1OAXL 3FUKA 3RGHA 5F6IC 1G84A 1H3GA 1CJYA 3BO8B 2GTWA 3CSFA 4FF9A 4A2EA 1CBVH 1QFWL 3ZDYE 1QFPA 1P5UB 3SJVA 5TF1L 4AMKL 1T4KB 2Q7NA 4HHAA 4MFHA 1G7MA 3O3UN 1B3JA 4N85A 4DKDC 1H3UA 4YDIH 2DZEA 2W0PA 3HIZA 4PLNC 1RZKL 4RAVA 3MRNB 2W9EH 2CBTA 5F7KC 3RWJA 3EHBD 1I8MA 3AUWB 5G2NA 1HQRA 1OTUC 3G6JA 2QVFB 4URTB 2IQAA 5B1JA 3G6AA 3ILQC 5FDYA 3U9PL 2XZCH 4JO1H 4JG0H 1PSKH 1VCBC 4M8QA 4XNYH 3I3DA 3CH1B 4OAWA 4CUCA 5IJVB 1GPOH 1BCIA 1OSPL 2XN9B 4PCYA 4NUPA 5BO0D 5FFLA 3S37H 4G7VH 4F58H 3E8UH 3QAZB 1KN2L 3ARVA 1T2JA 2ITFA 2X4OA 4XO4A 5F9JB 2WLJA 2ZUTA 1UD3A 3QWRA 5I75C 5DEGA 4OLZL 2RJMA 3FB7B 4RFEA 2X4SA 1SXAA 3GLEA 4OCXL 5C0DB 5E1HB 3L2LA 3MCG1 1OE2A 4G9FB 2XRAL 1QO3A 3GNML 3OKEA 2OR9H 2XYBA 4NJAL 5E2TL 5I71B 1JPGB 4WTWA 4OU3A 3VFUA 9CGTA 4BK5A 4ZO8A 4X5PA 4AE1A 2B7DT 2XTJC 2BW4A 4HGMA 2IANA 4N6QA 4WKZA 5ESQB 2XN9A 3QI9D 2DTML 3O4OC 2VITA 2PCFA 1Z7JA 3HB3D 2ZYHA 1HJBC 5F72S 1BLNA 1BZ7B 5DRXB 1SDAB 4EZMA 3GSNL 2A4EA 4RFOH 4YDVA 1RSFA 5IMKA 1E7VA 4FI7A 4JQVC 5D55A 1KEGL 5F9WC 1W72A 4JX0A 2NUTA 1DFBL 3N85L 3UTZA 3GC3A 4AGMA 2Z7ZA 5G4MA 3KVQA 3S5LG 4R96B 3I9GL 3KPPB 3R8QA 3RIAK 5JNYA 4YXLH 4JM4L 3L3OA 4IRSD 3B9VA 3BO8A 3VFPB 3L4CA 1RJYA 3MA9L 3MYJA 2AXJA 4AJWA 4XP4H 5AAWC 3EGSA 4R2GC 1RZIA 2J71A 4JM4H 3KPMB 5J56B 1IIIA 5AW5B 2B14A 3VI4E 1R5WB 1SOQA 4K71C 5ABDE 35C8L 1UKSA 3EOAA 4P4KC 1MCKA 2A74C 2CO4A 1UCTA 2A6IA 4WRLA 4L4TE 3N9GL 3HNSL 2XXMB 3WL9B 2I9TA 4R3SA 1E4KA 2Z4QA 4P23C 5AW9B 3T3PB 5A6LA 2ETWA 1YQVH 2ESVB 2APBA 2AABH 3X12A 3HAEA 2AITA 2OL3A 4PAZA 4XPAL 5EWIL 1P7QD 1Y07A 2ZCHH 1LEIA 4OM1H 5I18H 3VRJA 5GGUA 4WU5B 1CO1A 3BZ5A 1MRCH 4ZRGA 4HV8A 4ETQB 4UTAL 2BVQA 4BFFA 3L3OC 2G5UA 1SYSA 3C75A 5F0JB 1KLGB 5BZZA 3TJEL 5I1LA 2A9NH 4LRNH 2BMKA 2X89D 3N41B 4K5MA 1XGUA 1ZMYA 5JW3L 3PQYB 4LNRA 3MV8A 3NSXA 3WKML 4LB8A 3GXUB 1AHWB 5EZJB 5F7NC 5T1JA 4FJ6A 5E8DH 2Z7WA 3CK0L 2L7EA 3GTTA 1XR9B 2ZCZA 2BNRB 3VXRB 1LE9B 1E6JL 5FO9B 3IFNH 1J8RA 3KDMA 5J4MA 1VB9A 3RB7A 3R4RA 2PYFA 1LO3L 4ADJA 3ZMEA 3QXAB 5LXGL 1P4BH 3RVVC 3MGOB 2X4NA 3D0VB 4WSJA 3QUYA 1AQ8A 4HKXB 2BWIA 5D1QC 3VWKC 5FX3A 2I07A 4DUWA 1TMQA 2A9CA 1HKLL 4AH2A 3TL5A 5MEOB 4BFIB 5AZ2L 4JQIA 2FLBT 5DGQA 4OZ4A 5D7LE 2D7NA 5EB9A 2WVVA 1NMBH 1YC7A 1RU9H 2J1XA 1ORSB 2R29A 3NUKA 4Y4KB 3TFBA 4TL4A 3CVDA 3N1MC 3W81A 1KIUA 4OZGE 3UC0L 3W39B 3ABZA 4KJPC 3SDCD 1MFUA 3WFDL 1W15A 2CLRB 4OV6F 1G9ML 1I7UB 1HHJA 3UMNA 2K1MA 1PFCA 4Z6AT 3K6SB 4XN1A 5IUSA 1ZV5A 1YECL 5BUGA 4NDMA 3OM3B 5I1DA 4FG0A 4ELKA 3H8NA 3EXLA 2CK0L 3CZFB 3W0WA 4YAQB 4PTTA 2HVBA 2HZHA 3HAEB 3AG1B 3PHSA 4P9ML 5D1QA 2AGJL 4DFIA 2H3NB 4ZTPH 4YO0A 3GZKA 4XPHH 1WT5C 1IILE 2UWEF 3NABH 2A6IB 4PJFE 4PS7A 4HK3N 4KROC 3DX8A 3MSPA 3W9EB 2QR0A 2GUYA 1FVCA 2D7TH 1IBZA 1SZNA 3CZEA 5CBEB 3VGAB 4GEIA 4HUXB 4NZTH 4U6VH 5DMKB 3RUGB 4XZUB 3FW6A 1TR7A 1OALA 4ERSL 5B1BB 4LDLB 5FA4B 2HX9A 2ZSVB 1XF2A 1FL3B 4LDOB 4BFNA 5FM5O 5A43C 3BVUA 2EKJA 4NKDA 2VLRD 1NUFA 3OR6B 2B4CH 4JM2B 3MRFB 4XCFL 1U33A 3T04D 4YDVB 4LARH 2HKHH 2DQMA 2VUOA 5E8PB 5D7KE 4TUKH 2Q5BA 2ROXA 3FFDA 3KXFA 4NQDB 4S1SL 1DDTA 2IDUA 4OCRH 4HGWB 2IOIA 4PJFF 4LLAA 2FQGA 2Y0SA 1D9KA 1JI2A 3SGEI 4OJFH 3U7YL 3GMLB 3JWOH 4B41A 4X83A 3CSBA 5HYSA 4XI5D 4KO7A 5TH2A 5IB3B 3QUZA 1KBVA 5FYLD 4H25A 2WO2B 1S9YB 4HUNB 3SDAA 2LABA 1JWUA 4FXGB 4U3CA 4KZEL 2WVVB 1CGXA 3FXIC 1LEGA 2MTAA 1AZUA 1BD2D 4TKWA 4XO9A 3WTTA 4PJDE 1AIFB 2FEDD 2BNQB 2V2WA 1GSMA 2Z31A 2X09A 3T1WA 3FB6A 5I6OA 1H3TA 4QRUA 3NFNB 3C6SB 2JI3A 1QLEB 1QMUA 1NAML 4XNZB 3GMLA 2JQAA 2XQBH 4R7DB 3TLRA 1RP9A 2ED9A 4XVOA 4LQFL 3U1PA 4OAWB 5IJVA 5K1NA 1EJOH 3GLZA 3TONA 1NM4A 1ZHNA 3KPOB 2UY6A 3AB0C 1MFAL 4JDEA 4LIQH 1YNLL 3TCXA 3BGFB 1UACH 3PDGA 4FHKA 4LNRB 3G6AB 3NZUA 1XEDA 1KJ2H 1RJCA 2Y07H 4ORGB 1Z0NA 5JOPE 4TQEH 2BSTA 1IARB 2HKHL 1F56A 3GKWH 1ACXA 4MBOA 4UOQA 5IG7A 4X6CE 1JN6B 4IS6A 2UZPA 4PJAB 3K8KA 3DV6A 3GJFA 4P5KA 5JXAL 1ZXQA 5DUBA 1QRNB 1QBML 2HRLA 4U6VL 4S1DD 3H7BB 4Z7WA 1J1OL 2IH1A 3RX7A 3VFWB 4NO5A 4F27A 1WWCA 1IC5L 3BEWA 3IMTA 5K1JA 5AKVA 1VGEL 1MPAL 5SWQB 1O9WA 2BSED 3KE0A 4ZT1A 3SO5A 2IH8A 3QZWG 1C5BL 4KRLB 2HT2C 4XXWC 1I7ZA 2QQNH 1A1MB 4NUJB 4BKLA 1T20A 3QVAA 3EOTH 1JZ3A 2DQEH 2QVIA 3F05A 4EN3D 4P5KB 2CK0H 3ILPA 3DUUB 4H20H 1AZBA 3R06A 4KUCF 3VD2A 2J6WA 3DTDA 1HTYA 3FQ1A 5SWZA 3SYQA 4R84A 1NGWB 1A1OB 1NC2B 4BFBD 2I32A 3P4MB 3LIUA 4OZHF 1NICA 4N6RB 2YO3A 5IQ9B 2WKGA 4BM7A 1JNHA 3BT2L 1KB5H 5JPNC 3Q2NA 3ZKSD 4BCYA 1DZBA 4OF6A 5HYJB 3VMNA 1S7QB 3UBFA 4UTBL 1IUZA 1I3GH 4XAKD 1JE6A 1G7HA 5AOLA 2NY0C 5HHQB 2IPTL 4OCWL 3U0WH 4PP1C 1G9EA 4XRCB 1CDJA 4FQLL 2G4GA 4XP9L 2OSWA 5DZVA 5HJ3A 4OCRL 1JPTH 1GGUA 3FHEA 1XGUB 4NQEB 1D2OA 2O6EA 4PW3A 3TO4A 1M1XB 3L7FA 4MXWL 2YZ8A 1RJZA 3ABMB 2NY6C 4PCSA 5E00B 5EC1A 5HPOA 4TNFA 3E3QC 3WNIA 3KCWA 2V37A 4QO1A 2YC1B 4ONGL 5E4IA 3Q05A 4BWUA 2J6EH 2CJUH 2GBUA 3U83A 4EVNB 4K9JA 4LP5A 1GZPA 1YEEH 2X70A 1AXIB 4HWNA 3T1FB 2V7HB 2JJVA 2LAGB 5DRNA 3LH8A 2DD8H 4TLUA 4LVHC 1SHXA 2LU4A 4MQSB 3TBVA 4IOSA 5TDPB 4JFQA 1R6VA 4N86A 2QMKA 3R4DA 1D6EA 4NC1C 1HNGA 4X0KA 5C0JA 4CVUA 3SJVB 3WIHL 5DO2D 1H8OA 1BYNA 3PE9A 5D96C 2E8ZA 4DN4L 5H4YA 3HNVL 3O3DA 1DE4A 3BX7C 3LRMA 1KYFA 2QQNL 2JCCB 3CDGB 3OG6B 2YXMA 1UD2A 4LHUB 1IGCH 1JZGA 1RUML 4U0RB 1PIGA 4O4YL 5DD6A 4FQXD 3TBSB 4DK3A 4LCYA 5FOBB 3UZVB 1NIEA 2QGDA 2VDMH 4S1QH 1CF1A 2PPEA 2YZ1A 3TCLB 2LLNA 5EU6B 1BQHB 5E03A 4PGEB 5DURB 1UOWA 5DJXB 4EZJA 2OTWB 2AEWA 4FMFA 1B0RB 2CWRA 2VDQH 4OD1L 3S5LB 3SE8L 5BMFH 1ORQA 1AFVL 4EIBA 5HYEA 4YXKH 3VFOB 2JK5A 5LGHH 3LQAH 4FTVB 4FX5A 1U8CA 4QIRA 1MQKL 1JL8A 2ZOTA 2CU9A 4IS6B 1IKNA 4PLOB 4PJAA 4EI5D 4KH9A 1WZ1L 1CICD 1KJ2L 2VDKB 1QEWA 2YUZA 3IRZA 5HVHB 3BZ4B 3PL6D 2VJ8A 4KTDH 1NMCB 1EBPA 4OZ4B 4JPVL 4ZTPL 1EX0A 3T2LA 3D85D 2YKKA 5E2VL 5E8DL 3ZR5A 2X4OB 3MI6A 1QNZH 3ORJA 4IHOA 3UYOD 5KBNC 4QTHA 2OW7A 1N2RA 2EDBA 4LRNL 1F3DJ 3UBHA 1ODUA 1TZAA 1E4HA 3IF1A 4BZ2H 4YK4C 4Z7IA 5BS0A 4BFRA 4L1BA 4OZIF 3L3DB 5ES4B 4E5XG 3TO4C 3N41F 1FYHB 4W6YB 2P5EB 1GW6A 2F58L 4R26H 4V1DA 5C0BD 2FYVA 5I1GH 1KY6A 3J7HA 2QT6A 2H47C 4QR7A 4JKLA 4IMKA 1AHWA 4MB1A 4KZEH 5I1IL 1NGWA 3IRPX 1SQMA 4KI5E 3E9UA 1NMBL 2QKIC 3OXSB 4XE0A 4F3FB 3IGFA 2CMRH 1KTKE 1PD1A 1BOGB 1RULH 1ZIBA 3BVWA 1D5BB 1EEUA 2X1PA 4WI3A 1KFGA 4J1UA 2DL2A 2VDKL 3ULUC 2R0WL 4EUPA 1U3NA 4ZNEE 2YMOA 2G4EA 2PP8A 4OFDA 4Y4FD 4I88A 1QBBA 1NC2D 1P7KB 2NY4B 3M1BA 4DPRA 1P4BL 3BAXA 4NKOA 1S7SA 4C4KT 3O3AA 2R0LH 1IM3B 5D1XC 1D5IL 2OTWA 1INDH 3HG1D 3JTTB 2BINA 5D6CB 5JPNA 1MH5B 2DLFH 4ZSOB 5GS1C 3X12B 1AQMA 4MA3B 2NTFB 4G8AC 1XZWA 4GBXC 1JV2B 4NN7C 1B0RA 3FH8A 5GHWL 5GGVY 3RWCA 3SDXE 3TCLA 4LSQL 2YBRB 2VDOL 4UIMB 3DMMA 3CFJB 4NZTL 3OAZK 3CDYA 5HYQA 3RTQD 5IBUB 1EAPA 3QXDB 1GC1H 1MRCL 1NZRA 1T1YA 2OZ4L 1DBAL 3IWUA 1L0YA 4JZJC 2UZYA 4ONHB 1LO4H 1U8OB 5EU5A 3U36B 3C09B 3KEDA 1TIUA 2PYEE 1H6EA 1NCCL 2I27N 4NBYB 5I8EB 4RRPG 1OAYL 3GNMH 3T09A 4N2BA 5LWYL 3W56A 3AXIA 4Q2ZB 2FATL 1BZ7A 1X7SA 2F68X 5HXMA 2WUBH 1OAKL 1A1NA 3KL5A 4IBLT 4LESA 4P2QE 2X0UA 3H42L 1JUFA 4HCRA 5B1JC 3IJ8A 2IPUK 4XPBH 4HAFA 2EEFA 1HSAB 5SWSD 2GUOB 3GI8L 5KSAC 5DUMH 3VFGL 4HUWA 1JD9A 4LAJH 1JAEA 3B1TA 5GS0H 1XF4B 3OQRA 4B50A 3O2DA 5I6NA 4WO4B 4D9QD 1J1PL 1N0XL 2K45A 4LGRB 4ZBJA 4Q9CA 2I24N 2FQDA 3P9LA 4IQHA 3TYGL 1YUHA 4JFSA 1HT6A 4WGKA 3VH8G 4G9FA 4YGVB 3GSNH 4PSRA 3TA3B 3O6FA 1YPZF 4MCZA 4X7TA 1K85A 1E65A 4UAHA 1S5HA 1GVIA 4IGBB 1BMGA 4UDUA 5C07D 2HUHA 1C12B 2F7QA 1W80A 4YSUA 3MJ7A 4N2IA 5D1ZI 4N26A 4NN6B 3IGAA 2GCYB 1UC6A 3HE6A 2EYSB 2GUOA 5H94B 4CN1A 1QHQA 5C09E 1XIWD 1WAAF 1LK2A 5KJ4A 1RKRA 3N43B 4ALAL 1JUFB 4AENB 4HQQL 1T7XA 4HSCX 1PVHA 1A3LH 2Y7QB 3VWKB 4AYSA 5KTEH 4N6RA 1G43A 4I87A 1CFSB 2PCPA 3SDXA 3BSZL 5DJYB 1U8KA 2PYEB 3CVHH 3VM5A 5KAQG 1YPZE 2RB8A 3BZDA 5FYJL 5HI3D 4HWZA 2RD0A 1KTRL 3PNRB 3DURB 3LZRA 3M46A 4H0HB 4WAFA 4P2OC 4Y4HD 1T1YB 5ID1A 4JY6A 2OCJA 4N2AA 1GPOL 2R59A 3MRRA 4UF7C 1G9NL 4R0LB 5ALCH 3L5XH 1PSKL 4KRPD 4FQLH 4AX3A 1ID2A 3LQAL 4WW1A 5IQMA 1NGPL 3WLWD 2P44B 3KPLA 3AUVA 1KTJA 1D9KC 3QZWB 4E41A 3A6CL 2EDWA 5JZ7C 4KUCD 3QFGA 5ANMB 2WB7A 1XBDA 2BOLA 3HFML 4TUOA 3CNKA 2YGPA 5E2WH 5GGSY 4PJ7B 2HRHA 4C4KO 2BVOB 3TYFA 2G60L 4K7FA 4X9FA 3HA0A 1F58L 4BH7B 4Y1SA 1USZA 3HLKA 5IG7B 2O72A 5JLZB 1ECZA 3ROLA 3RILA 2WXGA 2NX5A 3HPLA 4WW1B 1BD2E 3B56A 4HFUL 4XNMB 3K6SA 3EADA 1P7KA 3M1BB 3HR5A 4LPUA 2WXJA 1S5IL 3FQ2A 2X89A 4JY6B 1RZGB 2EKSB 5I30L 2H8PB 3LZOA 2ICWI 3V79C 1ZAGA 2BZCA 4EJ1C 4AQ8C 1NKOA 2FX7L 1SEBA 4X5XB 4W9LC 2XG4B 3QWQB 4GIAA 1OP5K 4WWOA 4J28A 1NGZA 3ARTA 3SGDH 2AEPH 4AYDC 4KUZH 1MJ7H 2AK4E 4UUJB 4MXQD 1ZHNB 4XNUH 2PN5A 5DWUL 1ZGLB 2J8UF 3B7YA 4F8TA 4AENA 1M6OB 1A6VH 5FO9A 3HZVA 2QVMA 1NEZG 3K2IA 3QUMB 1RK1A 2XETA 4JB9L 4FMVA 4TSBH 5KVFE 4OCXH 1NPUA 3OG4B 1WQVT 3I6KA 1H8LA 1NJ9B 4MA7L 4UAOC 4DP5X 1BJ1H 1ACYL 3LHAA 2EXSA 1KN2H 1TTUA 5IQLA 4X6FB 5HVWA 4P5MA 4Y16B 2H45A 3FUJA 4X5XA 3X14A 1A7PH 3QUZB 2CUAA 4NLHA 1FPTH 3WIFB 2H8PA 3FN0H 4QJ4B 2XQYK 2F8OA 1YCSA 4KKLC 2QQQA 4PW9A 3FO2B 1VEOA 5E24E 5BRQA 3T3MF 3RY4A 4I0PD 5LKNA 1PX8A 5A3IC 4UTBH 4G7QB 5HHXH 5HYSB 3RBGA 2V17L 2E27L 2L7JA 1OPOA 5BNXD 1YY9D 5EBGA 2JK5B 3CDFA 3QRGH 3CBKB 4WEMB 5CMAB 4QI3A 3GTVA 5TDOA 2CIIB 4K9EH 1CFQA 2EDFA 4YXHH 1E5CA 1FC2D 1VAHA 2OR7A 1A4AA 1FORL 1Z9SB 4Q52A 3RAJH 3VX0A 4PVMA 1RZFH 1SHWA 5HGDB 2XWXA 4G6JL 1U8JA 3QYNA 4KNTA 2DI9A 4YZFE 3GZQA 5T5FL 3H56A 4BGDA 3BISA 4P2RB 3DI2B 3KPMA 3DTXA 1UM6L 4W68A 3EGSB 2ALWA 1F90L 5LCVA 1TTRA 1BD2B 5HYFA 3Q2WA 2G75A 2ZSWA 3D51A 5BV7H 3WXWL 4KJWC 2NY5C 2D4DA 2Q7AA 3B2VH 4XNBA 5I5RA 3RJDA 4APXA 2WKOF 4LSRL 1JV2A 4LCUB 1T0PB 4X7SH 4QT5B 4LPYA 3GSXB 1JS4A 5I6PA 5LNEA 5IVZB 1CFQB 2YUXA 4ZMXA 2X4QB 1KTLA 4HKBA 2VSMB 3LN4B 3RIAF 3W39A 3HZYB 1HHGB 5I5IA 3MRLB 1UVQA 1XD1A 4TSBL 4ERSH 1VFMA 3DX7B 4GAFB 3IMUA 1VA9A 1TCRA 4JW3A 2N4IA 5EMYA 1I7TB 1MUJB 1CZ8L 1FQ9C 3GMOA 3O2DL 2H6PA 1TEGA 4FA6A 4YNYA 3B8SA 5FHAL 4YHNA 5CF3A 3IDJA 4BFOA 5KYUA 5E08H 3FHQA 3EHBC 2NW3B 4PGBA 1MHPL 3V8CA 4ABVA 3VB9A 3GEWB 3IDYB 3MGOA 4LHQB 3IFOA 1IVTA 2IANE 2VCOA 2WVTA 1S2EA 2CDEA 5FYLL 3MJWA 1ZVSB 4HJJH 4DGIL 5I24A 3D07A 5JIDA 4XCEB 2WTRB 4GO9A 1H6FA 1UEYA 1FAKT 4PUBL 4AIEA 4FEIA 4ZMWA 3ATFA 1J05A 4H7VA 4C83B 4R7NB 3VU2A 2I9LB 1CLCA 1G9MH 5L7XL 1I8MB 1Q0XL 1QSFD 1GXEA 3QCUH 4I18C 5D7IF 4DJMA 4XP1L 5IW3A 3GMPB 2WBJB 4RISH 3BSZA 3C6LD 3P4MA 4KZCA 4JRLA 1YYML 4DVBB 3SJVD 3JV5A 4HK0A 3DV4A 2XIBA 3RL2B 3VD5A 2EUWA 4MB4A 3S3SA 1KLGA 5I1LB 3NA9L 1E90A 4N68A 3SKNA 4OUOA 1OLLA 4KRPC 3OJVC 3LPOA 2YSSA 2V5TA 3EJTA 4L18A 4TYUA 3FQNB 2R4RL 4LK4A 3N40F 4ADIA 4WWKC 4I0PC 5FR3A 5IGXH 5ADOH 1EFQA 3S5LA 1TZHB 2OJEB 3NTCL 4X5RA 5DJ8A 4DN3H 5JIMA 3BMWA 1WWAX 2V8LA 1FLTX 2ZF9A 4ZS6C 2G5BB 3BVVA 5IBUG 5BUPA 2Z4QB 3V6ZA 4UOZA 2R15A 4HXAL 3AXLB 4MGXA 4P3DA 4P2QB 2KLTA 1RZIB 3IS0X 4XXWA 4G1MA 2B16A 3NPSC 5I0DA 2V9TA 2EIZA 1RVFH 2R4SL 3QR1A 1EZLA 3GZPA 5FC9A 4BK4A 2OMBA 2I5YH 1AR2A 3RFZB 2NNXA 4DEWA 2DQHL 3BWAB 5ERWA 1PAZA 2Z1PA 2DKUA 1MREL 2DRUA 3QPXH 2P43B 3VWKA 1RHHA 3OPUA 2AS5M 5TDPA 5BVJB 3TBVB 3ZRSA 3MMEB 4UQ3A 3C9NA 4MWFB 3SDXB 2XLLA 4F7EA 2WAHA 2XTJD 4FNTA 2NOYA 2VO8A 1M2VA 1C5DB 2EEAA 2EYRB 1CURA 3TFKD 1E2WA 1J10A 1A8JH 4YBLB 3JV0A 1J1PH 3MCLL 3QORC 3VSQA 3OC8A 4YSAA 2OMVA 4B7LA 1ROWA 3EYVA 2HVKB 2OX5A 2ZOWA 3FONB 4R7LA 4PYHA 5B4MD 3KGSA 1PGRB 4YX2H 1M3IA 3QZBA 4MX7B 4X6DA 2Z35B 2IF7A 5DJZA 5CILL 2VL4A 4PJ9A 4OUUA 1T6VN 3ZO0A 5IMOB 1OW0C 4XVSH 3L17A 4P9HH 2BRQA 2K6WA 5CIPA 4XNXH 1JWMA 2Q9OA 1DCEA 1MWAL 3IVKA 2IG2H 3P3YA 1JERA 4AXWB 4BRJA 2DH3A 4ES9A 2VDNB 4L23A 4AEIH 3AROA 1RK7A 4GP4B 4A6YL 2FX9L 4NZJA 4WHCA 5E9AA 3LN4A 4NQDE 4B3EA 1JF6A 1XGRA 1SHSA 5EZLB 1PMYA 5J9PA 1BGXL 1UM5H 2P5EE 2Y5TA 3MO1B 1FL6B 3NSJA 1R1CA 4QRAA 1CD9B 4W70A 4LL9A 5I71C 4EN3C 2NY3D 3BUQA 1IBGL 4X0NA 1YDPA 2JI2A 1NGQL 3L4TA 2XJKA 1LM8V 3F6JA 1MFCH 5GSRA 1XDTT 1IEHA 4IJ3C 2IXQB 3HLAA 2ZOLA 3PYCA 4JQXC 2OXHA 2JWYA 4XXCA 5AYQA 2MPAH 3MNVA 5I18L 4YL9A 5T3XL 4ECNA 2Z4TA 1L5GB 4F9LC 2WXLA 4NQSA 3U1SH 3ULVD 1WAAE 2EE3A 2WNKA 3U4BH 1MW1A 1Z5LA 4HVBA 3DHUA 3D6GA 1LP9E 1NKRA 1JHLL 2VDLL 3MOBL 4YAQA 5E1AA 4RLDA 5SWQA 2PO6D 3S35L 1Z9SA 3WNJA 3FU6A 2C9UA 1TJIH 4HW6A 3CFDA 4HEME 1I7UA 1LNUA 2XX1A 5AVQB 4ETYA 1CDUA 4GAJL 4LSTL 4P4KB 1OF0A 4K7PY 4LEXH 4N22A 2HX7A 1KPUB 1OY3B 4RVBA 5J1AB 5DDHA 4BZ1L 1L9QA 2EACA 5MENB 1QFWH 5CJ5A 4MNGA 4PMEA 5DD3H 1MCIA 3PGCB 1EBAA 1NBVL 3D85A 1CS6A 3MLVH 4OLUH 1NTDA 3WUWB 4JHWH 5ESVB 4RMQA 2H1PL 2NSMA 2WGNB 3PWPB 2NUPB 5LNDA 3P69A 5IFHL 3TXAA 1AGBB 3MTRA 4TXVB 4Z7OE 3KYOB 3W38A 1MWAH 5DZ9A 3MLXH 4UOW0 3BAWA 4X4YB 1REIA 3NESA 3VX1A 4R4FH 3NAAH 2OXGB 3TNMA 2VOTA 3MFGB 5ISZD 5I1JH 5HHQA 2DMGA 1WYJA 4LVOC 2MKLC 4I7ZC 1U21A 3OJDB 4K55A 3TBYB 4DZ8B 3L3DA 1EHXA 2W65A 4RH4A 5BS0E 1UGNA 4Z1PA 3FAXA 1BJ8A 1KJVB 4JZOB 4QRUB 5BVPL 2H6UA 1XSOA 3RJQB 4K3DH 1BX2A 1ASOA 6CGTA 2NY2B 5E94A 4U1NA 2JKNA 4UV7L 3OAUL 2XJLA 4U7MA 3APMA 2GJ6D 4AC2A 1GMEA 2FGWH 1NIBA 5CGYD 1NFIA 3OTTA 5TH2B 4NRYA 4CMHC 1SJXA 3ZTNH 5GGUB 3LQZA 3WE6A 2B59B 4OFQA 4D8PB 1AIZA 2AI0L 1C1EH 1IV8A 2QPSA 2WWMD 2DMCA 1AQKL 2GK0A 3L6FA 2AV1A 3EDEA 2PO6B 2X41A 3MLUH 3MV01 4UT9L 5C08A 1OWWA 3VXSE 4JRYA 1VIWA 5HHPB 4BQCA 2W59A 1IEAB 1EHAA 4KVCL 4F1SA 5C92A 1G0YR 1BAFL 3EO9L 2B1AL 2OMTA 1XL6A 4FQIH 3EGXA 1EAOA 4Q89A 2Q10A 4U1LB 3OKNA 1IE4A 4O5LL 3MYJB 4R0LC 4P59H 5HHMB 3L3OB 3ZL1A 4KDVA 2C3GA 5FA4A 2R23B 3K6OA 4KJYB 5I8KH 4LCYB 5CUSH 5EEXA 3L1OL 3TBSA 1J7VR 3LZNA 1MFBL 3PFUA 2PNDA 5C3LD 3T8MA 5LQBH 3G9AB 2D7MA 4WWPA 1TUPA 3HS0C 1FIGL 4NM4H 3OMAB 5FDWB 5EV7A 3RVUD 5LO7A 3EG9A 3QUZC 1NCWL 3TO4D 5CGYC 5FM8A 4FQ1H 4JN1L 1QKZL 3VTMA 2MQCA 2UWEA 2BNUB 3WDJA 1IM9A 4S0HA 3DJTA 2PYEA 3QG7H 4PCKA 5E6IC 5GJTH 3DK2A 3OWRA 1E9OA 3C5ZD 4LAQL 4Y4HA 5EU4B 3DO4A 3WD5L 4EVNA 4ZMZA 5AW3B 4XOAA 2IDQA 4HFWA 1AMYA 1ZDSA 1PLBA 1O5DT 5CD5D 5J1TC 4NO3A 3M17A 1KC5H 3QK0A 4MJJA 4BFKA 1WEJH 5DC9B 3ZYJA 3CLEL 1YN7B 2P26A 2J57A 5JOEA 1Q0YL 1A9BB 3GSUA 4YSQA 1U6AL 3MOAH 3HAEG 1T1XB 4LCVA 4NZRL 2HG5B 4OJAA 3F65A 3O6FB 4MCZB 2P1YA 3JYCA 4RGNB 4X7TB 5LLIC 4MNQD 1AD0B 1M1XA 3L7FB 4HJUA 4R5TA 3M07A 1KCVH 4MD0B 4N2OA 1SLVA 4X9YA 5C0CB 1ZGLP 3GPEA 2VLJD 4XN8A 4FCHA 1WSST 3TZVA 4DZBA 3OAWA 4ANKA 4UYPA 1K4CA 2BSDA 4NQCA 4HOXA 5AVZB 4PWEA 2W60B 3AREB 4HBQA 3RX5A 1MFEL 1JZHA 2BOBA 3HMWL 4Z76A 3B4NA 2EC9T 3ZPDA 4X4ZA 5CBAB 1N5YH 2NY0D 3GXPA 5MEQB 3CVIL 4RDBA 4TMPA 3MACH 1BM3L 2PPDA 3UJTH 4O2EA 1BVKA 5CZXC 4FP8H 3ZRCC 2I7SA 2GTWB 3S8WA 1TG8A 3ZYOA 4KXZI 2H5UA 1EXHA 4DGUA 4MJIB 4ZFOB 1SYSB 2CGYA 2QTEA 1P5UA 5AVYB 3ZE2E 1WTGT 2CA4A 4XPGL 1E4XI 3MBEA 2FVNA 4NP9A 3W9EA 1NIFA 5I66A 3IPBA 4H88H 2BP0A 3FSOA 4Y5XC 5AFAA 3APCA 1CL7H 2DV6A 3KYMA 4LU5L 1QWHA 1B6UA 3LZLA 4XN2A 3RWCB 2APSA 2EDHA 2H3NA 1J5OH 2ZUXA 4D7PA 5ANMA 2F5AH 2ZOKB 4JQVA 4M56A 3SIKA 2AJVL 4PB0L 2EIEA 1EA9C 2GHZA 1S78D 1X6LA 2IAND 3QW9A 4WEBH 5KSAB 3LDBB 4PP1D 1VKXB 1IIKA 1NCJA 4L3EE 4UM8A 3CFEA 2R69A 1DANT 3WI9A 4QTIH 4JCMA 4B3VA 2J2ZB 2WLKA 1X7TA 3BIAX 4RA0C 1IQDB 1IZJA 3WDIA 1FIEA 3FTSA 1D5BA 4C8XA 4ZDHA 1RUAH 2UY6B 5D1ZD 2ZG1A 2F15A 4B27A 1HXYA 1NOAA 3BQUD 2FL5A 3CZKA 2BIIA 1B4RA 2IOOA 4F91B 3I02B 4OM0L 1J05B 1FPTL 4L4VB 5AZEH 2PXYC 2EXYD 1TF4A 2YQ2A 2VITB 2MCPL 5L8LB 1QASA 1T7WA 3V5DB 3O0RL 5ESQA 1IL1A 5DCCA 4NO0B 1XSJA 2R1WA 4X6BB 1G7QB 1Z9PA 2DYPD 3MGTA 4O58L 1OAJA 4C4UA 3P0VH 4M62H 5EOTA 2H2PC 2LU5A 4CVWA 1LEGB 4WV1C 25C8H 1I1AB 4XBPB 4M7JH 4AW4A 3OKDA 4Y9EA 5IP4A 2A38A 1Q94B 4FNSA 2V2WB 4OF3A 4LHUG 1E8YA 1WK0A 3OKLA 4AUYA 4N2NA 2ICEC 3H4FA 4XNUL 1WGVA 5MEQA 1HS6A 2I26N 3U0TB 1O75A 1U8MB 5IW1A 2XBDA 2WCPA 3Q01A 4KMTH 4TNGA 1KELH 1G7JB 1OAZH 1J5IA 4LL1A 1QSVA 3FT2A 4IRSC 4TUUA 5DO8A 2CNYA 4JPIB 5I1CL 4S1RL 2WJ7A 2Q0ZX 4Z5RB 3BAIA 2DM7A 5E8PA 4G7YH 1U58B 3MTXA 4XC1L 1D9KB 4W6XB 5HDBF 1GZQA 3ZDZB 4MJ5B 3WIHA 4ZW5A 2HMIC 2I25N 4PBXA 1DJWA 2YRBA 3EXJA 4R7VA 4PU2A 1JZ4A 5KYNA 1UOLA 4PJGA 4X9BA 3WFEH 3BAYA 1G7LB 1WBXB 2YRZA 1FVEB 2WIIB 1X5MA 4J7RA 1QAWA 4J39A 1GS7A 4G1EB 4ANWA 1J0IA 3M6DA 2BPBA 4O02A 4XNQA 3B2MA 1U3JA 4U1MB 2W0KA 5EUKA 2H6OA 1RSYA 1HINL 3ALWA 1MCOH 32C2B 4JJHA 3BYTA 3MLRL 2VLRE 2Q87A 2R0KL 2BFVL 3FT9A 1F4WL 3ZDXE 2HT3D 1R9FA 4DEPB 3NFSH 1JFHA 3MR9B 3O3BB 1CIUA 4PR5A 2BS9A 4CMMB 2ESVE 3TIEB 2NZ1A 3T3PE 2BSCA 2HFEB 4M5ZH 2IBGA 4DPAX 1DDHA 1FG2A 3D18B 5EN3A 4K2UH 2ARJA 2X10A 3UIYA 1N7ML 3OGOE 1V7ML 4AL8L 1EXUB 3L1EA 4QRRE 2F54A 1GSKA 1RUKH 2UUDH 1I9JH 3O3AB 4FKHA 5D71H 2PW2A 5FYLE 5MERA 1DQQB 3VI4B 3SOTA 2R23A 4GFXA 1QYGH 4H5SB 1Q9WA 5BQDA 1L0XA 2F9BT 3I75B 4NO2B 3ZTCC 4HH8A 5HJGA 2AMGA 1MVFA 2NY3B 1DVSA 4G9DA 3LB6D 2OMTB 4L2LA 1FZMA 3HRZA 4TPRH 1TXKA 5C0DA 4J4PA 3GRWL 4ZW6A 2GK0B 3DXAE 1ZT4B 4O5LH 1BJMA 4NC0B 5KYXA 2NNAA 1S9WB 3OHXC 4MVBC 4KV5F 3KPRA 1W0VB 4NRXA 4OFYA 5I1HL 1PKQE 2WXFA 4RWYH 3GXTA 1NEPA 4GOSA 2WUCH 1T03L 2BP8B 2HG0A 4OQ1A 4NRYB 1M6OA 4LSDA 1UQSB 2YOAA 4YH6A 4JDZA 1O5PA 3SGJC 4NERA 5L6YH 4UV4H 1JNLL 1IKFL 3ALPA 1UA6L 1V27A 2C26A 3AZUA 3RTLA 2WYZA 4N25A 2V9RA 5E8OA 2HXAA 1DBKL 2D73A 3IJSA 4UOJA 2FNWA 1OPGH 2BNRA 3VXRA 3A6BL 3HC4L 4GI8A 1FE8L 3EO0B 1HQRB 3G6JB 1J48A 3T8VA 1JWSA 3ASWA 3U30C 2C7UA 4RMWA 5KOVC 3NPZB 5F96L 3PQYA 4XCYB 3F7RA 3OMIB 3AFLA 2R1XB 3T71A 3RY6C 1G7MB 3OJDA 1OAKH 3HR5B 4DZ8A 2VLJA 3K2UL 2JB6B 2ZUQC 4CADA 3L95B 2XN9E 4MD5A 2QADB 1KC5L 5K9KB 1OAYH 1B9KA 1L4IA 3CFDB 4M6NL 3UXFA 2WXMA 1ETZB 1I1RA 1QI5A 4L5FL 2JKIS 4PJEE 3IMSA 3TN0A 1GKOA 2JKRM 2A9MH 4HC1A 4HIJA 3HC3L 3ZX1A 2HVJA 4H8WL 4KK9D 1SQ2N 1Z5LB 3MBWA 1XCQA 3T5WA 4AGQA 4K94L 1QA9B 4CBPA 2RHEA 4N5ED 3JWNE 5MENA 2GABA 5DUBB 4RFOL 1Y6NR 3CBJB 3VI4A 4BUQA 4LHUA 5DYFA 4HIIA 5CXPA 1NBVH 4L5FE 4CN4A 2FB4H 3ZIMA 4JGNA 1FZJA 2JXMA 3FT3B 1TSHA 4QNPF 5DRZB 4YOKA 4B9FA 5MHSD 1RFDL 2UXGA 1WLHA 2PUQT 2ED6A 3DX1A 1SVZA 3MLSH 3P4OA 4XC3H 4IBUA 3MFFB 1SY6L 1M1SA 2FJHB 5TFSH 3BQUC 4TLTA 5C3IA 3QIWB 3FB5B 1ZWIB 2C9RA 3S34L 5KVGH 3FB8B 3BH4A 2EICA 2R83A 4LL4A 1XTLA 5FOJA 4YQXH 1GMIA 3UTSD 3KYKH 2ZUVA 2EEDA 2X6UA 1WFIA 5MP6L 2N1TE 2X70B 3MNVB 1JZJA 4N2MA 4F20A 4JRXE 5DD0L 5TQ0H 1J0HA 5FA3B 1BA9A 2QZQA 4PH8A 5F7FA 5F96H 5HGBA 5I28A 1G4RA 5ACMA 2OAAA 3FO9B 2X4SB 5GZOA 5A2JH 4L8SA 1MCJA 3DVNB 3QUXD 5DYOA 3TIDB 3TEZA 4JG0L 1FNEB 5DJ0A 2MPAL 2FBRA 4UB0H 3C60D 2N7AA 4HG4J 2V7NA 3FO0H 2F8VA 2XXFA 4OFKA 2EYTB 4KFMA 4RQQB 4D3CH 3L45A 2XG5A 3WNLA 1JYWA 3OKYA 4KY1H 4PSPA 2XV2A 3UCQA 1A7RH 2KZBA 4EDXA 4JK0D 2DYRB 5EU7E 2EADA 4KKRA 5EZLA 5C0RH 4HJGB 5E2VH 1PKQB 1WPCA 3O81A 3CH1A 4P5TB 5CSZA 5EIIB 1XGQB 3QUHA 3GRWH 4ZX5A 2MFNA 4Z7AA 4OZGF 2LTQC 1W72H 4MZIA 8FABA 3SGDI 2CO7A 5JW4Q 4OZIA 4WCYH 4DVRL 1LLAA 1AYRA 2GBAA 4L8CA 3SZ6A 1C5CL 5BXFB 4P5RA 3SBQA 2EH7H 1L9SA 3KXFD 4GP5B 2P24B 2XZAL 3OKDB 5D7HA 5L9DH 5IVXB 3ARGD 2YFOA 5AW2B 1CXFA 5KYYA 1MG3C 1WAAA 1RIVH 3KH4A 3U30B 3GGWB 4Z3GA 2J7LA 1G7QA 1AG6A 1OAZL 1XD0A 2G3MA 3RX8A 1DQLL 2NNCA 4G6KL 5ETUB 1YYLH 4YSEA 3AU1A 2DW5A 5BCAA 2IFFH 1HC1A 2J12B 4WTZG 5BOZG 3BUBA 2JIXA 3HUJA 4YHLL 5AW4B 2B1OA 1NLBH 3SDAD 3V95A 4XHJC 4KGJA 1RUQL 1PZSA 3FB5A 5BRPA 1IGCL 1HIMH 2XQYG 1W6WA 3JXAA 4KPHL 1F3RB 3C5SB 4UT6L 3VGEA 2K6ZA 2Z6FA 1UKTA 2K4AA 5CO1A 3RZCB 1M9WA 3SCMB 4K8RL 1MIEL 4QGTA 3LNEA 4M7LH 1G9NC 2DWDB 2V2TB 3U25A 2BY2A 3EJPA 5FPIA 4Z7VB 4AMXA 4WWKA 4LMQE 1QUNB 2FJFB 1BYPA 3HC4H 3KLAB 2C9PA 5AB1A 1RHFA 5AUMA 4PV1C 7FABL 4DT2A 2BSRA 4DP6X 1TQBB 1TTCA 2H0JA 4GLRH 2F54E 4L8BB 5IB1A 1NEZA 5KYWA 2YIHA 1IEBB 1SOKA 4N2HA 1OCZB 3D09A 1I8KB 3KXFE 1QABA 3I9AA 3OZ9L 2MEJB 3R7RA 3G3LA 4ODUB 5EF0A 4F1ZA 3KPNA 4Y1AD 2A73A 3KPOA 3TVMC 5ACLA 2NY4D 1Q9OB 3GRWA 4JUSA 5SX4I 3FQXA 4I1RA 3KWWB 3SE3A 1JVOA 5AVUB 2P5ED 4XCEA 4JFOA 3V4VH 3ES6B 3H9SD 3QEQE 1NBQA 3IKCA 3E1ZA 4LLDB 1K8IA 1DBJL 3LNDA 5FYKU 3VXPB 4QHMB 5ENWA 2GJRA 4UMGA 4CILA 4AT6A 4AEIL 4QTHB 4OCWH 1HEZB 2FIKB 1CTMA 1NBYA 3PXLA 4PV8A 4Y2LA 1JZ7A 1JFQL 1KCSH 3M1OA 3GHBL 2EVGA 3ML9A 3GMOB 2GITB 1FBIH 3A22A 2BY1A 4J3BA 3NIGB 5INCA 1RZPA 2ESVD 3TBBA 2VERN 2YUWA 3AADB 2QSVA 2XFXA 4MCMA 5EUOA 3CN4A 5AZEL 1KBBA 1MRFH 3VFTB 4HLZG 4LGPB 1PQZB 1OK8A 1VESA 3R18A 4K5LA 5K39B 3H3PH 4JFUA 3VXUE 5F3BA 2HWZL 3PL6A 5JO5B 1G0DA 4DHLA 1JK8A 5FW6A 3KWVA 5LDSA 3EYQC 3OWEA 1CF8H 3DX4A 3PWNB 2VLKE 3QB7C 5F1IA 5HVGB 1JNNL 4GRMA 2VXVH 4YS4A 5CS7A 2ZXDA 5T5FA 2OTUB 4J3SA 1TJMA 3PQYD 4YNYB 4MNHB 3TT1H 2FIRT 1FNGB 1E2VA 3MRCA 3VDBA 4PRIE 3K72A 3OSVA 1BF2A 3VGGA 1UWXK 3A21A 3QI9C 4OLVH 4X99B 2VZTA 4D9LH 2E74C 1NCBL 4PRNB 3ZJAA 3QIBD 4L3EB 3GTNA 5FHAH 1H5BB 1ZJAA 3MBXL 2O1AA 3NGBB 4EIGB 3Q9QA 4X98B 1HHGA 3DIFA 1FV1B 2ID5A 1P2CB 3HS0A 4A2DA 4GXVL 1M42A 5IROC 3U7WL 4KXCA 3C08H 4G43B 4H2CA 3D2TA 5JXAH 1HCFX 2XKSA 1ES0A 4XB8A 1ZWIA 2ADFL 4M5TA 1E7UA 4N0YL 4RGOH 3VWJD 3ESNA 5I0WA 1H0DA 3JWDL 2XZZA 3HR6A 4KMTL 1FSKC 1N8ZB 3LEVL 5CMAA 4PBWD 2KMWA 5BO1H 4LQ1A 1LWHA 4CAGA 4TQEL 3T3MB 3DIFB 4M1GL 2E47A 3FZUD 3QI9A 2YD4A 1HESA 4N2DA 4ZFZA 4YDJB 4WF7A 5HYSG 4NNPH 1R0AH 5GZND 1BM3H 1WZMA 3BT0A 3DDFA 3K6FA 1KJ2B 3N91A 1DQJA 1Q38A 3L1FA 2NY5L 1I75A 1U3HA 2EIDA 1U93A 4S2SB 4BE6A 5DU7A 3D0LB 3O0RH 1ZLUK 1QRKA 5KBPA 2NXYC 5C08B 2GJ6E 4ODVL 2VM9A 3WEXB 1HH9B 3KLLA 4IRSA 2E7LA 2PXYB 2UZXB 3HI1B 4P46A 5CUSL 5TPWL 1U41A 2W9LA 4MAYB 4GRMB 4P59L 1A3RL 5C09D 1JHKH 3RWHB 5EULV 1J9RA 2IDSA 2VDLB 1WT5A 1WV7T 3RWGA 2HPOA 4YE4H 3F6IA 2EJ1A 4HISA 5T3XD 5FGSA 1IGTB 1U6AH 2J8UA 3ESMA 4PJIB 5JIPA 2AK1H 2IO5A 2IFGA 3GIZH 3QUMH 3WAJA 1JHKL 4MZ3A 2WQXA 4PGCA 1BQRA 1A7OL 3L3JB 3LEYL 2HN7B 3RVUC 4MAUH 2QLYA 4E9TA 1KGUA 3Q3GA 1EJ6A 3BVDB 4N20A 4Q6IC 1WO2A 4X2UA 4A7TA 5T1LA 15C8H 5DR5L 5A2AA 4K8RH 4OZGA 5JDSB 1R46A 4Q58C 5SWZD 1K8IB 2B4CL 4ZZFA 4P3WA 5BV7C 4OI7A 4JFDD 5C0EA 2DIJA 1NINA 3P3UA 3FC8A 4RWHA 1Z3GH 5CN1A 1I8LC 2EH8H 1AY1H 3NIDE 4OFVA 3RVXC 2ZXEB 1NGYA 4M1GH 1OEZW 1I3VA 3HUJE 2WQSA 4M29A 5HHNB 3SQBB 1U95A 2DLIA 4PN6A 2V2XB 4PYGA 4IRJD 5C2UB 5F97E 3A0OA 2ITEA 2D3VA 4LCWA 1MAMH 4ZMPA 1YYLL 4Z3EA 1I1CA 3UJTL 5E1QA 5LGJA 4WWKB 1BLIA 4AQZA 4HS8L 3F58L 1S7VA 1JN6A 2BVUA 1RIVL 1M53A 1X5YA 2AP2A 3CVIH 3S3JA 5CLTA 3GBEA 1UZ6E 5IT2L 1RI8A 2ZXCA 1GIGL 4HJTA 4JR9L 4FFYL 2A6KB 5HP5A 2PW1B 3U6RA 1AC0A 4HCFA 1HJCA 1HKFA 2JJTA 5CJOL 1BZ8A 4HSQA 3X1BA 5IHBA 1HH6A 4L1SA 5DK3A 2WC7A 2ZG3A 5D4HA 5LBSL 3F62A 1N9PA 2XYCA 5I2IA 4PW4A 2A0LC 4HKZB 3IJHB 2JB5H 5IIEB 4ZI8A 1KG0B 1FAIL 1H3PL 1V54B 2X53A 4MJIA 4ZFOA 3UTSB 3VFMB 1EHLH 5IW6B 1QSFE 5E2UL 1U8QB 4J3OF 2ENSA 4ODSH 1JDDA 3VG0L 1KTDA 3IMBA 1QATA 4MNQB 1D9KD 4AOFA 1F18A 2F1EA 2FH6A 4X8XA 3SPVB 2NCEA 3OXRB 3U4EB 1XB8A 1DLHB 5C0AE 4RFEB 3L9EA 5C0NC 1ZE3C 1J5DA 4GP8B 3NN8A 2X2IA 2XTSA 3JWNC 4OJDH 5D8JH 3WD5H 2WQRA 4GG8A 4H25B 5JXEA 5EU7C 4N0UA 1BXAA 3BC9A 4HPOH 4YLQT 1IC1A 2GY7B 1PLAA 3OHMB 2EIMB 3WGUB 5JW3H 1HSAA 5KVEH 3MDJA 1HL5A 5AKRA 2E7BA 3WHXB 4ZPVB 1BP3B 3QZOA 5AOIA 2Z8SA 4EOWH 3U0PA 1H3WM 4L4VD 4PGDB 5DK2A 4MQTB 2BCKB 2EZ0C 4PJ8C 2FEEL 3LKOA 3GDBA 2AJYH 4X8JA 4Z8FL 3NJJA 1FJ1B 4LXFA 3L5IA 3CWGA 3B37A 3ZHFA 5D2LA 4PTUB 4NI6A 3IU3A 5E7FA 5KSVA 3LDBC 1R3LA 3TYGH 1J9SA 4ONHA 1S5IH 5CM1A 5C71A 1I9JL 5CCHE 5JORA 1E3FA 1CDCA 3MRQA 5I8CA 2CLZB 2WZPA 1RZJH 1LO5A 2D31A 1M57B 3KYNA 4E5XA 2YD5A 3QO1B 1MLCA 3MNZB 1HH6B 3AQZA 4UDTA 3P73A 4LDEB 1WA0X 2DBJA 4U6XA 4W93A 3S36H 4DP4X 5CP3H 3UAEA 1UUSA 2PW1A 3U6RB 1FA4A 4YMPA 1AGDA 2FZ3A 4Q74A 5TE7H 1LEKB 4G8EB 4CGUB 3DPBB 3VI3B 4N5EC 2RMNA 1YJDL 1NSNH 3FQYA 1BWMA 3QHFL 3UYPB 3KM2A 3MNDA 2LQRA 2V3FA 4NKOB 3H9ZA 3CE1A 4AQ1B 2DPKA 4KKPA 3QIBA 2JB5L 1NGQH 3DC0A 5KUMA 3G7TA 4ABUA 1FI8C 3ZE0B 1OVZA 1AR1D 1TQSA 1IBGH 3GWJA 3IJYA 4YHLH 4J1UB 4KK8D 3K72B 1FNFA 2IFFL 1T5XB 5AYUH 2Y06H 5F7WC 4BQ9A 3LNHA 3VXME 3WIIH 4BH8A 3Q1EA 2K4WA 1IKFH 1DN2A 1UA6H 3VCLA 2HRGA 2X9ZA 1I8IB 1SBSH 3IPEA 4WHTA 2XRAH 4L48A 4JR9H 3IETA 4CC1A 4GY4A 4FE9A 4HJ0C 4NRZB 4JPKL 4WUKL 1HOCA 2YHGA 4B6ZA 5CCGE 3ZKXB 3RQ3A 3U9UA 4RBPK 4KMQA 4EI5A 2AXGB 4KRNA 2PWHA 3QXAA 4I2XA 4JFPA 1DUYB 5C86A 4KY2A 1E8WA 4DQOH 2BSEA 2VW6A 4IRZL 3UGXA 4PRHB 4ZQTA 1KULA 2L7UA 1MAJA 4IOFD 3MJ8B 4L9DA 2GEEA 3BOVA 3US9A 2XCMC 3PPSA 4XX1G 1HVXA 3HB3C 5HGAB 3SE4A 4HU8A 5DJAB 3KJ4C 2HLFD 3EJYC 1DVTA 1HI6A 3NA9H 4EI5B 1P5VA 5JIKA 3QNZA 4NXSA 4PJHE 4AL8H 2ZX7A 5HDOA 3RDTC 3CUPA 3MRMB 4GKNA 4MAYA 2P5EA 4WU5A 2EVHA 4Z0XA 4N8CH 1K4CB 4POZD 4XBEL 3VM7A 4CKVX 4I2XB 2F53A 4NX0A 3HG0A 4JFHE 5EN2B 1HILA 3S2CA 1O7DC 2Y69B 4ANVA 1IC7H 4FXTA 1ND0B 2NNAB 2A9DA 1T83A 3D85B 2YPLD 2OPCA 4MA1C 1WBZB 4GUQA 4Y2DA 2D0HA 2IWKA 4YSCA 3QQ9C 1ETB1 3QQNA 5LG6A 1R3HA 3NCEB 4IDLA 4XNAA 3FK3A 2BIOA 2Q6WB 2CH8A 4FQ2L 4NQVA 3Q5TA 3F84A 5CN3A 2CKBB 3WFEL 4UQAA 3NYKA 5A7BA 2H2SD 3KLHD 1KLFA 3MREB 1QLEL 3BZEA 5E4OA 5EEWA 1GC1L 4U33A 1CYGA 3L4XA 3TIEA 2WB1A 3WU1A 4PR5B 1KIQB 2CKBL 3UPCA 3MV9E 4U6YB 3BKJL 3FT1A 1RZ7L 5GISH 1MCHA 3LKNB 3CFBA 4Z7WF 4Y1AB 5IHZA 1P2CA 3HS0B 2PCFB 3QDGE 1MJUL 4N3UA 3UDWA 3AU1B 3ATDA 3MRKB 5KUKA 1R3HB 2QSQA 5I6MA 1I1AD 1YYMH 4HKJA 4QHKJ 4Y5YA 5DD6B 1MAML 3PRZA 2LV4A 4M6NH 3ML8A 5D1QD 4GBXD 1AR1B 4YZFF 2O61B 5FYKL 2Y23A 2HVJB 3G5VB 3LSOB 4FABH 5T1DL 5L7XH 1UASA 2BXYA 4E9VA 2QQLH 4OGXH 2VDKH 3NJNA 2PO6A 4AC4A 4M7LT 2QDWA 3L81A 3OL2A 4QF1A 1JHTB 2H2SC 4QPEA 2GJ6A 1L6XA 3QAZC 3DETC 2MOQA 1LXMA 3QNYA 5EIIA 1XGYH 2FUQA 3P11H 4YBQD 1DN0B 3CZJA 3SDCC 5EN2A 4ONOA 3JV6B 2Z64C 4U6TA 4J6RL 2Q2LA 1Z6JT 3K4DA 4OGAC 1JXFA 4NNXB 2BNQD 3WN5C 3HRZC 1MCCA 3CUPB 3MRMA 1PQZA 4GKNB 4Y88A 3RP1A 4AGNA 3UPRB 2IQAB 1CZ8H 2YGQA 5JMOC 1AGCB 3VSUA 1GOGA 2E76C 3H4HA 3WJJA 5ADPL 4JG1H 1H3XA 2FO4B 1X5XA 3I6GA 5KZCB 1QACA 3SPGA 2K8MA 2Z7UA 4XVUD</