5LUMA

Alpha-crystallin domain of human hspb6 patched with its n-terminal peptide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
78
structure length
78
Chain Sequence
GHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein/peptide
molecule keywords Heat shock protein beta-6
publication title Structural Basis for the Interaction of a Human Small Heat Shock Protein with the 14-3-3 Universal Signaling Regulator.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 78
sequence length 78
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lumA01
1GMEA 3QORD 2MNWA 2KMWA 3L1FA 3VQMA 2CR0A 1X5MA 2Y22A 3L1GA 4PBDA 2K8QA 2JKIS 3L1EA 3N3EA 3Q9QA 1SHSA 3J07A 2N0KA 3QORB 3EUDA 3IGFA 2CG9X 2N3JA 3GLAA 4PCKA 2XCMC 3QORC 1WH0A 1RL1A 3W1ZA 4M5SA 1WFIA 5DS2A 4ZJ9A 1WGVA 3QORA 2Y1YA 2RH0A 2WJ5A 3AACA 2KLRA 2BOLA 5DS1A 4I88A 4FEIA 4JUTA 4YE0A 4RZKA 3AABA 4MJHA 4YLCA 5LUMA 2WJ7A 3Q9PA 4YDZA 4ELDA 1EJFA 4JUSA 4YLBA 2Y1ZA 2O30A 4YL9A 3VQLA 3GUFA 3GT6A 4M5TA
chains in the Genus database with same CATH superfamily
1BZ7B 4CJ0A 4JFVA 5CMAA 1G1YA 2KDGA 2BERA 4P46C 2R2CA 2HT4C 1JXGA 4GIPD 1VFUA 2VERA 3HAEG 5HHOE 2D7TL 4R2GB 3BISA 4RBPH 4JRYD 2O6FA 3CMOH 2FQGA 4BKLA 1UD5A 3KMDA 4PI2A 4QO1B 2OCJA 1MFEL 1LO2L 1WAAF 5AG9A 5KW9L 3HHRB 2J1KA 1YN7B 3LS5H 2YEZA 1WUZA 3ARGD 2Q3XA 3PDDA 1JF6A 1P69B 2CH8A 3DOSB 3UEZA 2NY2B 3C8HA 5DRNA 1OV8A 4ELDA 1SJMA 1IGIH 1C7SA 1AO7E 1O5PA 2OYPA 4L3EA 3KDMA 3HI6L 4ZSOB 3EHBB 1MELA 4X4XA 1U9KA 4QGTA 3RLSA 1MCNA 4S1SL 3ELAT 3VX0A 2O5YH 5KSBF 1A3RL 4Y7MA 3WJLA 5CEZD 5A7EA 1I8IA 4MMZC 3LNDA 5AEAA 5AYQA 3RPBA 1XF2B 3VTTA 3MRFA 2AJZB 1DQVA 3ATFA 2DM7A 3O3BB 4R5VA 4UCFA 4U7MA 3UABA 1JNHA 4EDXB 4OJFL 1OB0A 4HJ0D 2OTWB 5ID1B 4PR5B 4LPVA 4FMFA 4V2CB 4Y9FA 5IVOA 1M42A 3Q8FA 2C9QA 3CV5A 4E9VA 5GS2D 1AY1H 5HI4C 2VXUH 3DMMB 2YR3A 1IGFH 4G42A 3D5OF 3DA0A 3DTXA 3GO1H 5HD8C 1KGUA 4O5LL 5FDWA 1SEQH 3ARED 3CPUA 5DR5L 5MENE 1JWUB 4HEPG 2OR9H 4Y2OB 3V55A 4NQVB 4R26L 4HJUA 4C4KO 5LBVA 4APXA 4CW1A 1WO2A 3F7LA 4JFTA 1AJ7H 4FG6D 4JUSA 4AGPA 1CC3A 2DQEH 2D2CC 1R24A 2CRMA 4MZRA 1JFQH 2FSEA 1F86A 4PLKC 4FFVC 3OKLA 3EFFA 1I9IL 1MY7A 1OSYA 2IQ9L 5F7MC 4OAWA 5EBWB 3HE6C 2GTZA 4U2YA 4PD4J 4UIKH 4EVNB 5IESH 4DKAA 3EIFA 1AIFB 4JRXA 3SPVA 1CMOA 1P1VA 4L4VD 4N0YH 3U4BH 4U4IA 1D5RA 3QDJE 1M9WA 4MWFB 1SF3A 3GJEA 3VXSA 1S9KC 2DZEA 1N2RA 1CE6B 1FF5A 2JWYA 1BD2A 1JNLH 2H8PA 2ZUVA 4APQD 4OF6A 4YX2H 2PXYB 4HJJL 1UB6B 2A83A 4YSEA 4LNRB 2PYED 1ZSDA 3E9TA 2EEAA 1VEPA 1FIGH 2H2PD 5KVFE 3WTTA 4PWHA 5FYJD 3P77A 4UZUA 3EO1B 4PWIA 2DMKA 4M5ZH 4HETA 1BIIB 3CHXA 5IJCC 4GRWB 4Y9CA 3ARBA 4DOHB 1BGXH 3WD5L 4DF9A 1JGIA 3GNMH 4YDJA 5CZVL 4A7GF 3GMRB 1FPTL 3FQWB 1TMQA 5BXFB 2YOAA 2NY3B 2WMPA 5F8RC 4Y4HA 1OAJA 3DRQB 3QUZB 4YIQB 3QHFL 3SGEI 4DH2A 3GHBL 4GMTL 4ZXBC 4UBDD 5I76A 3DVIA 4BFOA 2PCPB 1R5IA 3IJSB 4XP4L 5D55A 1HOCB 3FQNB 2YC1A 3BWZA 3LSOB 2R56H 2VIRA 3ATAA 3Q2WA 3S4SG 2IMNA 1CLYL 1OGSA 2YMXH 4CNIA 1EHLL 1UA6H 3PJLA 2DIEA 4N28A 3K1DA 1MFAL 3NRPA 3AS1A 4MAUH 1G9NC 3ARDC 2XYCA 3F64A 5JXEC 4OCSH 4Q9QH 4P5KA 2WCPA 1PSKL 5C0FB 1CGTA 2VN7A 1GW6A 2NQCA 5ICXA 4MJHA 1R33A 1NC2D 1G7HA 3TN0C 2R69H 3CFJA 3UO1L 4EF3A 1YY9C 3PGCB 1ZK9A 1P7BA 3QZOA 5EIIA 4KZDH 4XNMB 2JV6A 2DQCL 3MLSL 1YNLL 4UQIM 3BXNA 1HE7A 3HCVB 1E5CA 3EH3B 5C9KA 1ITBB 4TNVK 1TETL 2VNCA 4RA3A 1H15B 1QSFE 1U8NB 4JPSA 4MB4A 4POUB 3RURA 4QXGH 4CVZA 4F27A 5FYKH 5HDQH 3WSQL 1WWAX 3SZKC 4M5YL 2ESVA 4DEUA 1MF2H 4IRJB 3QDMB 4PBXA 4DJMA 4FABL 2AQTA 4HK0A 3DX8B 2GTQA 3AMKA 1NEUA 1X7TA 3N43B 1TPXB 1PZDA 4POZD 1ZVSB 4WFED 1T21B 2VLKE 1G87A 5T1MB 5I1LA 2WQXA 1OP3K 1KZQA 1YN6A 3HAEB 3QISA 5KVEH 1NINA 2WHVA 2OX5A 4NRYB 4GBXB 4MCYA 4BH7B 5CCGE 4PI0A 3GUTB 3ESOA 3SY0B 4KQ4L 4PRIA 3WNNA 2Z7ZA 4G82A 2L7QA 3CMGA 3C87A 2F7OA 1J9RA 2Y23A 3OB0H 4RGND 3BUIA 3VXQB 5IB5A 1QKZH 2ZXGA 2QSTA 2R0LL 4AL8H 3AQXA 1SHWA 1OALA 4B27A 1ZXQA 2H47C 4PMFA 2EEFA 3LNIA 2GY5A 1WZ1H 3H53A 4JO1H 1W72B 4DZBB 3P1VA 3TT1H 3MKKA 2NLJB 2B15A 3DJRA 4LSRL 4BE5A 3QEGL 1U58A 3D2UA 4G1EA 4MA3A 1GS7A 1KIQB 5EZPA 4JM2D 5EEZA 4JFHD 1E30A 3L1EA 1IE5A 4NKDB 4F1SA 3O3EA 5FM5M 4KJWD 5BO1L 2GEQA 3IB4A 4P5TD 2VN4A 3ZZQA 1BQSA 2YXMA 2ZX5A 2F6AA 2XQ0A 3MX0A 4X5LA 5GS0H 2P3YA 4JO2L 5C0ND 3MGAA 5T5NF 4OV5A 1EZUA 2ZWYA 5JQ6L 5SV3A 3CLEL 1GYUA 3QFGA 1WFUA 4LEOB 1AI1L 2ZOKB 4TTGA 5E0FA 4HBCH 2EDWA 5I0VA 5FKPB 3POCA 2VITB 2Y1VA 3O41B 1RIUL 1XD1A 2G60L 4I2XE 4OTXH 3P9WB 3F65A 1TVDA 2AKRA 4PWGA 1X4XA 1OARL 4KH2A 3P40A 2FJGB 2YLHA 4GUPB 4XR8C 4JPKL 3B2VH 4DVBA 2WWKO 2VZOA 4LARH 5DXWA 2BVEA 3QWRD 2AEIT 5CJ5A 1P5UA 1XAKA 4FLHA 3CVHA 3P30H 3VDAA 4HF5H 4EUPH 5GZOC 3NEEA 4BHUA 1PL3A 3JUZA 3IFPA 1CGXA 1XHHA 5B1JC 1PLGL 1LEGB 2VH5L 4F7CB 3IGLA 4HZLB 4GG6F 3A4EA 1PIGA 3HC3H 3HNVL 3VJ6A 3BN9C 3EOBA 3VXNB 4LHJB 2X4SB 3KW7A 5I0DA 2BIQA 3KH4A 3WLWC 3CSGA 1ZHLB 5F1NA 5TQ2H 3D6GA 2FH6A 4M48H 2UX7A 1IC7L 1JHLL 5LWYL 4L8CB 1UT2A 3SDCB 2WLIB 3MRIB 1EZVY 2VB5A 3U9WA 2IG2H 4BZ1A 4W9ZA 1GGBL 5EZIH 1BQUA 4MD5B 5D6CA 5MEPB 4OR1A 4AKOA 4X7EC 4QOKB 5IUCA 1W2KT 4CMHB 3GSNA 4PRNA 1P4BL 3JV4A 3DBXB 2DYPB 2LLLA 1RVFH 2DOCA 2WXLA 5IQNA 1T03H 3G6JA 2CKBB 4YR6A 3PIQB 2VC2H 4XP5L 1WWBX 5FUCE 5F3HA 1IBBA 1JGUH 2D31B 2GSIB 2VLJD 1M1XA 4F5CA 3FU7B 4PJ5D 3WEOA 2A99A 3VRJA 3JWOC 1ETB1 1XGPB 4CN1A 2XFXA 3WLBA 1PGRB 2DQJL 5IBTL 2QLVB 1LXMA 5KSAA 4BKTC 3HVNA 4U4BA 1D5BA 3F84A 3S3SA 3NRQA 1RJZB 1VADB 2IGLA 1RY7B 4H25B 4KK9D 1WZLA 5TDNB 5C9JB 4MDJB 2R8SH 2NR6C 2IBZX 4OI8A 4CC4A 3O3DA 1A2YB 4N20A 4BD4A 1HDMB 4YXHH 4G83A 1KYOJ 5DK0B 1UWEL 2SODB 2E4TA 5DMGC 3UTPE 1HN1A 4D0DB 1D5ZA 1GMIA 5FYLE 4AYGA 2CIIA 3K3QA 5HHVH 1N5YL 3CFBA 1IVLA 4AG4H 3B2DC 1J8HB 2CLVA 4WJ5B 4LSSH 1MJJA 2EDJA 5I9QB 4QJ4B 1A6WL 5GRWA 3LZFL 4N8VG 2X0VA 3O8XD 3S88L 1BW8A 1GY2A 3BO8B 4WEUD 3LRSB 1OAKH 3ILEA 5IHBA 4M8QB 1UFGA 1UASA 3HR6A 4ELMA 5EUKA 2HRLA 4NT6A 1ETA1 5KJRH 1AR1D 2JE8A 1LK2B 4N5UA 4HUMB 5BS0A 1W8NA 5HVWA 1DEEA 1CXLA 2AFNA 3UTQA 1NTDA 4UNVA 2J2ZB 4UQBA 1WBXA 2O61B 1ES0A 1KB5H 2B2XL 5TGBA 2WSPA 1F4YL 1M7DA 2AI0H 1WYJA 3T8MA 5C0EA 4MCNA 1HS6A 4AZUA 1I3RB 3ARFC 3EGDB 2D0GA 2DWDA 3S35X 1AQHA 1FA4A 3SCMD 1DBBL 5AW6B 2H1PH 3TZVB 2ZE0A 2DEWX 4G8EB 3RA7L 5SWZA 3DPBB 1UM5H 3MLWH 2PNDA 1NMAH 3HB3C 3HG5A 5EOQL 4HKZB 3RGVD 4ZW7A 5E8EA 1T89C 1DVUA 3ZOAA 5G4NA 5JR1L 2E5EA 2IAMC 5DUML 4PIRF 4ZRGA 2OJZH 2CDGA 1YEIH 1NCDL 4Y19E 2VW7A 3NZ8B 1WTGT 3EBAA 3QNZB 4M43L 3L4YA 2NXYB 3EJYC 3FOLA 1UC6A 3SEPA 2Z8VC 1HHHB 3VTMA 5LDUA 3WS3B 2VQ1B 1EJOH 2LOEA 3PWPE 4P49A 3G5VA 2IO5A 3QUMH 2HJLA 4KNTA 3BQUC 4X98B 5I18H 1G6RA 4OLXH 1R34A 3GQFA 2F61A 3CXFA 4ODTL 4OGXL 1MOEA 4OUUB 1DVSA 3S98A 3T0EC 4PS8A 1AGFA 3IMRA 3HUJE 4JPIA 1MHEB 4FOMA 1LWJA 3MNMA 3ZQXA 4WW2C 3FTUA 1B9ZA 2EIBA 3VWJC 1OZTG 2AK4D 5JYMA 1MLCA 3RWJB 1N26A 2QQLH 4RGOL 2B0SH 3U48A 2PO6A 5CJBA 1E28A 1AYRA 4X6EB 3ZKXC 3MN8A 4DGYL 4JUTA 2HFTA 4LHUA 2ZUWA 4KK5D 2DYSB 4KAQL 4XE0A 3DO4A 4YLBA 5DHVA 5GGUA 5FV1L 4N25A 4LDCA 2H4EA 4OLUL 3BLPX 3U7AA 2WIMA 1TU2B 3D33A 5KTEH 4PB0L 3ARYA 1CD1B 3OXRB 5HHPA 1XAUA 3U4EA 5I17A 3NYKA 5E8NB 3D50A 2W60A 3ARQA 3PAYA 3VD1A 3WELA 5L2KA 3S34H 4LKCA 4PJIF 5D2NE 3LZPA 1T83C 2MCPH 4NQDA 4XP9H 3FH8A 3TWCL 4ZMZA 5HDBE 4JN1H 1EO8H 4PJBB 2FIRT 5LGYA 4OZIE 3D52A 3EJQA 1MAML 4D9RD 4IHOB 4P2RD 1XR9A 2BH0A 3EYSH 1HI6A 3B9AA 1CDUA 1X5MA 2FEDC 5BV7B 2OP4L 5EU7C 1DQLH 2WM0A 3DETC 5I8EB 2BSSB 3RI5K 9CGTA 3L7FB 2WC7A 3OKNB 4J3WA 4XNBA 3VXSE 5GS0C 5L4JA 3V10A 4R7NA 2R59A 4ODXA 4HFUH 2A1WL 5AZ2L 4JZOB 1D3CA 2YD4A 2ZCZA 2ZWNA 2WV3A 2AXJA 4GAGL 4G8GB 4B41A 3M07A 5DC9B 1LO0H 1SY6H 4FAAB 5HYJE 4R7VA 3UAJD 2ARJA 4FQCL 2VRQA 1R4XA 2A3TA 5I6XC 4PRBB 2XVLA 4WHYG 1RUAL 3KM1A 4PQXA 2C34A 2DJUA 4DPRA 4H5SA 3BUQA 1IE4A 4RQQB 3VXMD 4KKLC 4QCIA 4OUOA 3STLB 1WF5A 3EH1A 1A6VH 2UY6B 1JYWA 1TF4A 2H41A 1C5DA 1K9TA 3WTVA 5DVLA 4ZMVA 5IGXH 5E9DB 3I02B 5FOBA 1N59A 4NHUA 4WFGE 3FT3A 1PX8A 2X3BA 4IU3B 1P84J 2HLFC 3QI9B 3BRGC 2P42B 1QFWM 5HHOB 2VABB 4MJIA 3ETSA 3DIFA 4JR9L 4M29A 1MRDL 2X2JA 2OMBA 1BFOA 3HZMA 4LCWA 3ABMB 3RVWD 4LMQE 1CXHA 1HJCA 4F80A 3CXHJ 3FTSA 2O6CA 4J7RA 5C0RH 3RIAF 5D93B 1EO7A 2CIKA 2EDQA 4L4TA 5K1VA 3KPLA 4F9LC 2YQBA 1XH1A 2MQ3A 3W0WA 3NJXA 5IUSA 1RHFA 1OIOA 1VCBC 2CJ3A 4NLAA 1AG0A 1TZIB 2G5BB 3FT4A 3GMPB 3JVGC 4AKQA 4NN5B 1X9UA 4X80L 4Z8FL 1DJZA 5LJYH 3FHQA 1ZOXA 1VEMA 1YPZF 4D9LL 1AO7B 4HUUB 4M1CC 3HI5H 4Y4KB 4XVUC 4MQ7A 3CH1A 2FBJL 2X9WA 5JOFA 1YQ2A 1AD9B 4ICWA 5F89A 4JAMA 4XRCB 3QQXA 4HWZA 3SB3A 5D71H 3EAKA 1G5GA 2NZ1A 1SLUA 4LSPL 3Q9QA 4AIEA 4OIIH 4X4ME 3HS0B 4J2XA 3SE8L 1FI8C 5CINH 3G6DL 1KBVA 4HLZG 1MEXH 3OBAA 4NHCH 3HNTL 1I3GL 3GBDA 1QD0A 1DSWA 5D2LE 4EI6A 3V8CA 4IK6A 1GPOL 3OHMB 3ROLA 4K23L 1I82A 3UYOD 5AKTA 1E4WH 3OJDA 2FUQA 1ID2A 3MPCA 4KUZH 3B2UC 2JCCA 1XF5A 2Y2YA 4J3UA 3IJ9A 3BP5A 4DKTA 5MENB 2EYTA 3ZYZA 2W9LA 3FF7A 3LPWA 4PJAF 3T0AA 5L7XH 1UD3A 1DJHA 1FFRA 1QSEA 1QBAA 1WHOA 2DQHH 4YHLH 4RAVA 2Z31C 2H6PB 3V4VA 3I9AA 2WXQA 4QAWA 4RVBA 3F6LA 4AQ1C 3ILPA 5J11B 4YN3A 3N1PC 2ATKA 2VL4A 1TKWB 4L3CA 4DW2H 3FT2B 3Q0HA 2YD5A 2XQBH 4HKXA 4N8PA 4YDKL 1YEFH 4KZEH 3O11A 3LV3B 3CFUA 5DUPH 4F9PC 4LESA 4OCYL 5DJXA 5L6YL 5CLXA 1Q0XL 4WAFA 4P46A 4F7TB 1JWMB 3NABH 3LIZA 4XAKD 4F91B 3UBXI 3AJ7A 3EFDL 1KN4L 3VH8A 4JG1H 5J1AB 3SJVA 5CZKA 3C5XA 2CK0H 2FWOA 3QDJB 5ANMA 2V8MA 3QDHA 1EEZB 3L3DA 3TCXA 3T6ZA 4KUCF 1IEBA 3A67L 4LVHC 3TBCA 1NEZG 2IWFA 2H0PA 3U30C 1JVOA 4L0YA 5IB1B 4F58H 2Z91A 2DKSA 4I77L 1I7RB 3C2AL 3LZRA 4LCVA 2R0WL 5E6SB 2HUEA 4MMYA 1VB9A 5H94A 1RZQA 3FCTA 4GINA 3R8BB 4K3EL 5EU3B 3BKML 3SDAD 2YPKB 2R0ZL 4QAMB 3MO1A 1ZHNB 3QORB 4AQ8C 1URIA 2CG9X 4MAYD 4PV9B 4NKMB 3ZMRA 3T6QC 3CDFA 4N2GA 2WWMD 1NUNB 3EJTA 4MMZA 5LAXB 3ECBA 3WTWA 2Y4SA 2O6DA 1MAJA 1Q0YH 3MBXL 4XMUA 6FABH 5I5IA 5D1XC 4NJ9H 1C1EL 1OF2B 5AVRB 2C3WA 4PREB 3QUXC 5HGHA 1ZT1A 4X6CE 1PEWA 4QHNB 4XMPL 2FYYB 3BP6A 4HS6B 5HGDB 4KX8A 2DDQL 5CUSH 5AW8B 1FFPA 4UMSA 1UCBH 5TPWH 2VDMH 3KVQA 5DD5H 1MCLA 4B5ZA 2FGWL 2DD8H 3H3PL 3FQXB 4XHJD 3MLZH 1ONQB 1U92B 5IY5B 3NA9H 2CBQA 3GTTA 2VKWA 5IVXF 1S7UB 2YMOA 4YDIH 3Q6FA 3BDBA 1DSFL 2BNRE 2JKNA 2HFGL 3MRKA 2NPLX 4N26A 1MCSA 4QHKI 4GH7B 3O2VL 2P80A 1FV1A 3MLVL 1QSFB 2QT6A 3CFIC 3GI9H 3R1GL 2QFPA 4M7LH 2WCGA 3UG5A 2QPEB 4HIJB 3BIKA 3U2SA 3HG4A 1HXYA 3HE6A 3QCVL 4Y8DC 4IDJH 1CURA 2YWYA 3CN4A 3X2QB 4GW4A 1YSOA 4NQEA 2K3HA 2GW5A 4MQSB 1RMFL 5EN2A 2VLKB 1ZLSL 1XH3B 3DK0A 5I1KH 2HVJB 3MJWA 1LO3L 3QEQA 4D7PA 1WFJA 3CJJA 3BUBA 1YUHB 2XWBA 1BFSA 1JCVA 1LYQA 1YDPA 1VDGA 4B9ZA 1A47A 1WC7B 1KV3A 1M56B 3AQDA 2FIKB 3MODL 4PG9B 4S1DD 4U1LA 1IX2A 1KB3A 4OZFA 4P3DA 3FRUA 3LH8A 4DN4L 5F1KC 2XBTA 3LS4L 5I75B 5IFHL 1MVUA 1P4IL 2P5EE 1TR7A 3RVUC 2QGDA 3CHRA 4LDLB 5BUAA 5EDSA 4UT6L 4YBLB 3V0WH 3DOIA 1ASPA 1BF5A 1V8HA 4G5ZH 4QDGA 4NZUL 2DM2A 5C0AA 5DURD 4ZTPL 4FG2A 1MI5D 4MQXD 3W11C 1EUTA 5TDPB 3K6OA 2DBJA 4ZXBA 4TUUA 1HXMA 4FA8A 1S7VA 2OTUA 4HU2A 3U4AA 4S10A 2F8VA 4YBHA 4BFGA 1A7BA 1Q9OA 4ONFL 2F19L 3FU5A 1DBAL 1R5VA 3CXDL 1XH2A 3RX5A 1IAOA 1D9KB 1KGWA 4BRJA 3PCYA 1OGPA 2FUTA 4HOXA 3OHXB 3ARDA 5JXEA 5FHBH 1RUQL 2ATAA 1YAZA 1K8IB 4HPYL 3CCHB 3WKYA 1IM3D 1S9YB 1FRGH 5F9OH 4XMKH 2WNKA 3D18B 4OIAA 1MVYA 3TN0A 2GUOA 1BMGA 3W9EB 1U3NA 3ATBA 3TYFA 5I19L 2Q10A 5ITBL 2FQFA 4I2XB 3ARRA 4YAQB 4CJ1A 1CDHA 3KLKA 1JMXA 2ZCLH 4GNKB 4EIGB 3KXFE 2DTMH 5TH2A 3UZVB 3W9DB 4RMUA 3B8SA 3IDIB 2JKRM 2KPWA 3NCEB 1AGBB 3LQZB 4M8RA 1ECZA 2FBOJ 4GSDL 1Y07A 2OMUB 1Z3GL 3FUFA 4PCSA 2ETWA 1L5GB 3HMWH 4RISH 5EWIL 1U2CA 2WVUA 2X89D 5C08D 1DLFL 4Z7OF 3IE9A 2UXFA 1KIUA 1J9SA 1J5HA 3TESA 1SGKA 3O2DH 4KXCA 3SDXE 2X4TB 3F00A 4WQOA 3SKOA 5F7UA 5E00B 3VD7A 1SYSA 1BOGB 5DLMH 1HCYA 2PETA 2WVVA 2W59A 1S78C 2EEDA 1ZV2A 1JN6A 1B90A 1FLRL 1I7ZB 1R75A 2H0JA 2BVYA 4OD2A 2PPCA 2AF2A 2GABA 2YQ2A 3S6CA 5EOCH 1PLBA 3INOA 4MVBC 1N6VA 4X7TB 3B9KD 1F3DH 1LE9A 3HG1A 2HLAA 3UEQA 2GSGA 2IAND 1TQBB 2WB1A 2BLFA 2NNRA 3MGOB 4QXTA 4X9GA 3QO1A 4IKNA 4PGDA 4N2DA 2BP5M 2I5YH 2YEVB 3PWVB 4WSKA 3MRCB 3LZOA 1CT8B 2DWYA 4XPFH 3TCTA 2NUTA 1CDYA 3PP4H 4Y2DC 1IAKB 2NXZB 5KYNA 5ESQA 3UACA 3PQYA 1VGEL 3DX4A 2Q5BA 1ZV5A 2XDHA 3MSPA 2AMUA 4IOIB 3R4DA 4NNYA 1F5WA 1V7NL 2FEJA 3L95A 4DAGL 1IILE 1B0GB 2X5PA 4U1KA 2ROYA 3BAIA 3VX1A 4B9GA 5GJSH 2Q8AH 1BLIA 3MRNA 2F1BA 2YZ1A 3T6XA 4YHYC 1FL3B 4XAWH 4BBWA 5EC2A 1EXHA 3AMLA 1DLHA 3UCQA 4QHLB 2E59A 1IBGH 5DF0A 5C0GA 5MI0C 3M1BA 2D8KA 3OKMB 4PJDF 3HZYB 3LRLA 1F4AA 4GP4B 2HWZL 4A63A 4JCMA 4NNXA 1E50A 5DJ2A 5IJVA 4HLEA 4X5XB 3TA3B 5H4YA 2NY7H 2HJFB 2GY7B 1DVTA 1MCFA 4NB7A 5F7YC 2WKOA 1YC8A 3DTDA 3D39D 1I1FB 1UVQB 1XGQB 3GSWB 5ILTH 3OSKA 3NJJA 3BUTA 1LNUA 1JTTA 3GIVA 4PRHA 5DJDA 4RRPA 1AQKL 2N0MA 5T1LD 3DUUB 5T1KD 5KAQG 5GGRB 4BK4A 3QG7H 4MS8C 1BJ1J 4JGNA 2WZAA 2WBKA 4BQ9A 4NO0A 5GZOA 1CGWA 4AVIA 1HVXA 2WLLB 3GMOA 4DP4X 1YUKB 5B1JA 1BF8A 4LCIL 4MXWH 2BP8B 4OLVL 5KVDL 4S1QH 3SOBH 1F2QA 1SOQA 4IRZH 1KYAA 4XPBH 3UZQA 4Z6AT 4W81A 3L5WB 2Y1YA 2CO6B 3PAZA 4WI3A 4LBEA 1V3LA 4XC3H 2HLEB 3LMJH 1KBWA 1A4CA 2K7PA 3TCLA 4M1GH 1MJ7H 1UXSB 1OM9A 1RQ5A 2WIIB 4P4KB 1CE1H 4PGEB 4UV7H 3X12A 5AUMB 1KWKA 4Y1AA 1YG9A 4MNHB 2H2SC 3QJUB 1U3HB 3N40P 2E9BA 2XWJA 3LDBB 4MB3A 2AJUH 2EDHA 4OD3L 5I0YA 1IAMA 3DPDA 5I30H 1A6UL 4OZHA 3K4DA 4GAJL 3SDDB 3MREA 4K71C 2K4AA 3FU9A 5E4EB 5LO7A 1YYML 3P3SA 4HCFA 2NZ9D 4LSUH 2YGNA 2YJQA 4ZFGL 3GMQA 4XN5A 3HBPA 1NCBH 1YY8A 5AAMC 5FA4B 5C0BA 3ET9F 2VN6A 2YRBA 7FABH 3EDEA 1E7UA 1P4LA 2VQTA 5DUBA 3GB7A 3VYNA 2QPDB 3G9VA 1UWXH 1VCAA 1CLZL 1EH9A 2QVKA 2IALA 3ZKQD 3AXLA 4BKLB 4FNRA 1FLTX 4P48A 4G71B 4LRIC 4XO9A 1LGVA 3MV7D 1PLAA 2YEZB 5BNXD 3B9EA 4ILDA 1KIPA 4AYFB 1DUYB 4UQDA 2W9EH 3PWPB 5IOPB 2NR6A 1TCMA 5EO0A 3KDMB 2NX5D 1RSFA 4QT5A 4K2UH 3KNBA 1U0QA 2WLJA 4GPVA 5IIEA 3HZKB 3QIBB 1Q94A 3FHEA 3KL3A 1AKJA 3QUYC 3HUJB 3I85A 4MXVE 4NRZA 4UOQA 4RNRA 1EZVX 3GXNA 1KCSL 3MRFB 4PRPE 4RSYA 1EAQA 2VDNL 2Z3FA 4N8CH 4PLJC 2ZOWA 3QIWC 1G0YR 2Q3ZA 3K6SA 4HIHA 4ORGA 5GISH 2OJEA 2WXMA 2QSCH 3IAQA 3QQ3A 4Y5VB 4PGBA 5JPMB 1I85C 2R4RH 3FUKA 3NIGE 2QHRL 3O45A 5IBLD 4R4ND 3F5WB 4X8JA 3C75A 4HS8L 2ATPB 5HVGB 2P8MB 4EXKA 5D7SL 1IGMH 1MFBL 2IEPA 3CN1A 4AGNA 1ZIBA 5E2UH 3FO2A 5C0JA 1ZEAL 3ZE0E 4APXB 3ARFA 1ANUA 3BVWA 3T2NH 3NIFE 1OB1B 2X6UA 2Q6WA 4P2RE 4ZJ9A 4A66A 5HDBB 1T04A 1M57B 3NEOA 2Y2WA 1R24B 4JW3A 1AZRA 5KVGE 4OZIB 2VSMB 5F7FA 3FQ1A 3I50H 5L2JA 3V5DA 1T7WA 2OMYA 1DANT 1P6FA 3EFFB 5I74C 3TBSA 3KYMA 3ESVF 1GGYA 3RU8H 1RHHA 3N85L 5KBPA 2XZAL 4U6VL 5K93A 2WQRA 4PJBF 2Y5EA 5TQ0L 1T89A 1GZPA 4M56A 4RIRB 2A0LD 3ZKMC 1NGZA 4BE6A 5C92A 1K4DB 1T1WA 4JRXB 4MD4A 2IAMA 2ZKHH 4J6RL 4O02L 4QHKJ 4CKVX 4BWTA 3WFHA 4YK4B 4ZNEA 4L3ED 2HTLD 3GJEB 3VXSB 4KY1H 1U8MB 2XTSA 4R8WH 4RX4A 1ZTXH 2E7CA 4UYQA 1KN2L 4WUKH 4UDUA 4I3RH 1XBRA 5BMFL 5EBLA 5HYJB 3FBKA 5CN2A 3P77B 2PYFB 4FQ2L 2P8LA 3WYRA 3EO0B 1LO5B 3BQUA 2RFXA 3LTVA 5K9QG 4YDJB 2VDKB 1OF0A 4KQ3H 4YXLL 1G7MB 5KZCD 1HH9A 3L1OH 3T0EA 2OSLB 2M1KA 4Y5YC 1XBDA 1H3XA 4G80B 4G6FB 4M6AA 4PIBA 5GHWH 1DVYA 2FWUA 5F9JB 2OMVA 4Y4HB 5JZ7D 4WW2A 3VWJA 2YD6A 3LQAL 4RMBA 1T6VN 3NACH 2HRPH 4FTVA 3KGSA 2QEJA 2H3NB 2YAMA 1A1OA 1WAPA 2VIRB 2EUWA 3N5AA 1D7BA 3ARXA 1VRSA 4QRTB 4EMZA 1TTAA 5EUOE 1R9FA 5D7HA 2DLHA 3QRFM 2C1PB 4ZUUB 5JOPD 1KNOB 1S9WA 4C83A 3G5WA 1J05A 3IAPA 3G5YB 3H4HA 2D7MA 2V9UA 1QYGH 1FO0L 4WO4C 5H8DA 3FK3A 3MKGA 4N4YB 5ELIA 3ZDXF 4Z3GA 2NW3A 1G7HB 4XCEA 4H0LC 4W68A 2P8PA 4G6JL 1U33A 1QTPA 2Q76A 2OW7A 1T83A 2WKLA 3BXNB 4OFIA 4OZ4A 1MH5A 3S36X 5A2FA 2ERJC 4GAYA 1SF5A 2BWDA 3MACL 1PDKA 4XVTL 3DJSA 4JRXD 3FS9A 4GSRA 2ADYA 2JKLA 4JKPH 1YNTA 4LCCC 3T4YB 1XZ0A 3P02A 3ME0A 3BPNC 4QRPA 3KHQA 2DLEA 3CPLB 1BD2D 4R3SB 4KTEH 4O4YH 1N4XH 3UFIA 5KYYA 5D2LB 3RWGA 4D8PA 2GT9A 4FCHA 4KKNA 1PCSA 4IRSC 4XCNB 2BSTA 2Y7LA 3FULA 1YHPA 3RZCB 3ARBD 4MCYB 2F54E 1WFMA 2X42A 5CEYA 8PAZA 3NQIA 1G7QA 3GUFA 4Q9BA 1JGVH 1GOGA 2F53E 4U3SA 4WCYH 4K8RH 4UAOC 3O6LL 4YHPA 5AW5B 5A2IH 1SYVA 1QX1A 4OQ1A 2O6EA 4Y4HD 4H1LG 4D9QE 2FD6L 4U33A 1KTJA 4FJYA 3QA3B 5D7JB 1ZK5A 4I48B 3BPOB 2ZOLA 1R3IL 5HVFB 4C58B 3ZE2F 4DP5X 2Q8BH 1YEKH 4MNQA 5AOZA 3V5HA 5DS8B 4YQXL 1OAUL 5LQBL 5DJ8A 4F33B 2R15A 1JGEA 2Z7WA 4TNWK 3SGKC 2VDLB 7TAAA 4TQEH 3FFDB 3ZT6A 2X88A 3VAEA 4ZTEA 4XE5B 1XEDA 3V9EA 4I18B 3EGSA 1O6SB 3FYIB 3NT0A 3RHWK 4LOUD 1A8JH 1Y7VA 4G9FA 2EXYC 4UT7L 3CFCH 3LRHA 3W57A 1T5KA 5E03A 3RUGA 3QJHB 2QHLA 1FG2B 2VLLA 4QYOB 2WBWB 4F9LA 4BFEA 5E2VH 4Z3TA 2J8UE 3FU6A 3P69A 5ENWA 4A2LA 3JVGA 2NTSP 3WFBL 4XN4A 1KY7A 1QBMH 1NMCB 1S8DA 1GGUA 1NBZA 4N3TA 2ESVD 4U1IB 1MJUL 3GMNA 2XNAA 3ABKB 3HC4H 3IKCA 1OTSC 3L9RA 2O5ZH 3IDNB 1ZHKB 1C12A 3QH3A 4MYWB 1WAEA 4JGMA 3QDAA 3V8OA 3DX7A 2F9BT 1E6OH 5E6IB 2YAOA 4OF0A 2XTJC 2F8OA 1TFPA 3NSYA 4N5EC 4Q6YA 2EC9T 3BUDA 1LDPH 1QSZA 2KZWA 1R3JA 3QO0B 2CPCA 4LHUG 1T5WB 4WWID 5ITFA 2DQIH 1QW8A 4NM4L 4PRID 1IAII 2ZWZA 2X6MA 3IFPB 2Y7SA 1UOWA 4X6CB 3B1TA 1NDMB 2R51A 4GKLA 3UG3A 3REVA 2FT7A 4HUXA 1J87A 1VFAA 3HR5B 3EOBB 5J56B 3QQ4B 5TE6H 4AV0A 4XO3A 4X6BB 1RLBA 3EJZC 3IT8D 3L6FB 1SVCP 2VMDA 3FF8A 4LL4A 4AMWA 3OZ9H 4I9WE 4S2SA 3SO3B 1RL1A 2BNRB 3D2UD 1N0LB 4X5WA 2Y1AA 2Z31A 4G7YL 3U82B 4OLZL 2G3XA 4S1RL 1D2OA 4ODHH 1L7TH 3TLRA 4RZKA 4EPSA 5DRWA 4AQ1A 2ENJA 3PJSA 4ETQA 1JZ5A 1KLFB 1NCUA 3E1ZA 5C6WH 3L2NA 1HWWA 1KTBA 3TU6A 3GSNB 5CEXA 1TEFA 1OCWL 3EYOB 2R2HB 3PQYE 3EDKA 4KO6A 4XBEH 4F9PA 1F2XK 3CAFA 3OWRA 1RURL 4LEXL 3V6FA 1A9VA 3HZVA 1GGIL 4E9WA 5JQIB 4JG9A 3QIUC 4KK8C 1INDL 4TNEA 3KPNA 4XOCA 4GLRH 4FP8H 1CYXA 5EZJB 2GI7A 1ADQH 3S2AA 3AG1B 2XFXB 4WJG3 1CFNA 2OFQA 4DPCX 4QF1A 4DESA 3AWEA 1KEGH 4X9BA 5EORH 3ZXAC 5L9DH 1MJ8L 5BJTA 3DVGB 2XPYA 1ZANH 1W72H 4M5TA 2GFBA 4NZTH 5JDSB 5CGYD 2NY4D 3A47A 2P5EB 4GO6B 4KITB 2GPZA 5I1AA 1L7IL 1DL7H 4AEIH 1OSEA 2ZTBA 2X4RB 2R0KH 1SFHA 3HMXA 5IEHB 3O4LE 2ZQKA 4AQ8A 5KANI 2P46B 3Q8CA 4OBRA 3UYRH 2BIOA 3GKWH 2CIIB 1PU0A 5B4MD 5JIKA 4FQXB 1V27A 1Z9SA 3BX7C 2F58H 2VISA 2V2XA 1ZGLA 2JMRA 2MSPA 5D1XA 4PJHA 4E5XA 5JO5A 3H56A 3QUXA 4H8WH 3IFNH 5I16A 4GW5B 3PGDB 4XC1L 5IK3B 4K7PL 4ZMXA 4NT6B 4W6XB 3OGCB 4P99A 2BOCB 1V7MH 1YO4A 2ZD0A 3SKNB 2JB5H 1DEEB 3UTQB 1A7PL 3TC9A 4XBGA 5D7EA 4TL5A 2GSMB 1BFTA 1M7DB 5I1EL 4Z7UA 1K5WA 4MA7H 4IIQB 2YK1H 3QUMA 4K5NA 5AALA 4NNPH 4KGLA 4PEEA 4BA0A 3P9LB 4XCFH 4H1LB 3O0RH 4AIOA 3KXFB 3SQOH 2VJ0A 1UXLA 2JKIS 1LE5A 2J6EL 5HYSA 2VDOB 3ZRCC 3US1A 2EIZA 2W9DH 4DNLA 5FYJU 2M2DA 3KLHC 3PWJA 4R2GC 1HZHH 1BXXA 5KSAD 3GSQA 4XPHH 2DQDH 4MXQD 5JUEH 2DQTH 4U1SA 4AMKL 3ZKND 5I8OL 3SDXB 3O2WH 1AGEB 3Q48A 3OJVC 1P9MC 3GGWA 3K72B 3QQ9D 4Q56A 4RWYH 4CGTA 1OWWA 2NY2C 2BZCA 2Y6SD 3WDHA 3VQMA 4NCC1 1XCQA 1MHHB 1A3ZA 3FSZA 3H0TA 3RPKA 1UGKA 4DETA 2FB4H 3PXLA 3VXRE 3KWUA 3EHBC 1CXEA 1UACL 4XP1L 2WCSA 2CQVA 3BZ4B 4A6YB 2ZSVB 1GC1H 3L7EB 1JPTL 3CUPA 1BQ5A 1E4JA 3G5VB 3BC9A 2HJKA 2MPVA 4PYHA 4FHBD 1WGVA 5T3ZH 5IEKA 1TJMA 1G6RB 3L8QA 4OSUL 4JM4L 1AS7A 2R2EB 1G4MA 4CKQA 2Q7AA 4NGHL 4F37F 5F8QC 4YSCA 5C2BH 2FR4B 4KXDA 2LU4A 4M7ZC 4FQIH 4JDVB 4RCAA 1OXYA 1SDYA 4M7KH 1KZYA 3RQ3A 1E2VA 3MROA 1SJHA 3CHOA 3WG7B 1GSMA 1CLOH 1MLCB 1CWVA 2ISDA 4NSKA 4DHLA 3ULUD 5BS0D 3DMMC 3DO3A 3PDOA 2JF1A 2J71A 2YWZA 4LFHG 3NCWA 5B3SB 1E27A 4ELKA 1EJ6A 3T71A 1J1OH 2SEBA 3MBWA 4YEEA 5F0JB 3K74B 1TJHL 3TVMB 4LF3A 4DP9X 5GGUB 1Q72H 3H42L 3EYFB 1AZCA 3RKDD 3N9GL 3GWJA 3IPEA 2I07A 2WXKA 4W70A 2E27L 5I17B 3BSZH 1XGUB 1PZCA 4K8RC 2UWEE 2ZF8A 2AQQA 1SY6A 3ZDYE 4B0MM 4HLJA 5SWZD 3FT9A 3MR9B 4OT1H 1CO1A 2BOBB 4QR7A 4NYLA 3DXAE 4FFTA 5IHUL 4G5AA 3RVTD 3BZEB 1T4KB 4OGAD 3KPTA 1JZ2A 4YDNA 2CBPA 5A40E 1RUMH 3IDJA 2CCLA 3GHEH 4FFYH 1CR9L 3CSPA 3TJEL 5GSVA 3TIEA 3DV6B 3ECQA 4KI5E 2F5AL 4RWHA 3DHUA 3VXOB 2PXYC 4W4NA 1ORSB 1YEHL 3F58L 2VM4A 1MCIA 4YVUA 5GRVK 4B50A 4XH2B 5EF3A 1WIPA 5LBSL 5EF2A 4CVUA 2BSDA 2R83A 4GXVL 1JUFA 2QR0B 5KSBA 4R7NB 5AW3B 2EUZA 3WENA 2G0KA 1UWFA 2MQGA 5DGQA 3OVUB 5DD3L 1F18A 5E5MB 3SYOA 5E1AB 3CSBA 4YHNB 3MA9H 2VYRE 3B2XA 4XNQA 4TRPH 1J10A 2PTTB 1MQ8A 2GIYA 4ZO9A 1G43A 2NY3C 3EOTL 1M7UA 3RWDA 1FNSL 3RWEB 3RVXC 2HFEA 5FO9A 2PO6D 4X7DC 5DSCB 3QHZH 4GKZA 4KROB 4TQPA 5E95B 4LHUD 5F9WB 2V7NA 2WTRB 4Y2DA 3RKPA 1C5DB 2XA8L 3SKUD 3N1MC 2OR7A 5FOBB 3OPZL 5TE4H 1KELH 4P0DA 3FT3B 4LAQH 4NUJA 2UXGA 3L5XL 5T8IA 4ZUSB 3AFLA 5CLZA 4R4FL 3VU2A 3NTCL 1ZS2A 4AEFA 1HFUA 4J3OD 5I0XA 3UADA 4EBQH 1XDTT 5AWNH 4KXZI 4DQOH 3RL2A 5L0QB 4Z7WE 1NAMH 5L2KD 5KVEE 3KPLB 2X6BA 3WEAA 8FABA 2XG5A 4NQDD 4M6NH 1I9RL 2LAAA 3MRMA 4TPRL 1JWSA 4ORZC 4PJGF 3M86A 4H8VA 5CN3A 1A4JA 3CH1B 3L3KA 5DQDL 4Q89A 5DQ9A 2YSTA 3GINA 3BW9A 4GW1B 3DX1A 4HCGA 4B60A 5TDOA 4HALA 4A7UA 2Q1EA 2YD3A 4IRJC 4HUVB 4ENEC 4ZPTA 1TVHA 1G1OA 1U8KB 2X7LA 5DJAB 5I1GH 1NH6A 2BHYA 4U1MA 1DTUA 4GQQA 5DFTA 3C12A 2JQMA 1H6UA 3TIDA 1MCPH 4PRPB 5I15H 1B0RA 1TOXA 2M26A 3CC1A 3KPSD 5EO1A 3VI4A 3CHSA 3UJJH 3HC2A 2A9NH 3HUJF 2DQUH 4MA8H 3B5TA 1AR2A 1NAKH 1J18A 1U93A 4PJXA 2A4ZA 5BZWB 5BUPA 4O02B 4QTIL 3MYZA 4M7JH 3LKPB 1QFWL 1ZE3C 1ZWIB 3NIGB 1AC0A 5D7KD 1NBYB 1LEKB 3BAWA 4YSDA 5BCAA 1JI1A 2EINB 4LKXA 4AEEA 4GFXA 1JZIA 1ROWA 3H8NA 4G6KL 3NIDE 4YWGH 5K9OA 1S7QB 1NQBA 4QRUB 1FHGA 5AVVB 3ZE0B 1U3JA 2EZ0C 2MKLC 1USZA 4RAVB 3J07A 3NIFB 1EGJL 2BK8A 4UUJA 3IBEA 4WWKC 5HHXL 2P47B 4BA8A 2OSWA 1SM3H 2CSPA 4MJID 3KG5A 4NEHB 4HKXB 4JHWL 1UZ6F 4LCWD 3QZBA 4BM7A 2D7TH 4ZTOL 4A7SA 4KTYA 4EXPX 1REIA 3TH2T 3SO5A 4JFEE 5TE7L 1UH4A 2Y25A 1D5XA 3CQPA 5AAMA 3W2DL 2HVBA 4L4TD 3D3VE 4L29A 2BSEA 1LO2H 5D4HA 3W0WD 3V5KB 5KW9H 2IBBA 1MRCL 4IBVA 4H8WC 1OOWA 3GIZL 4J1UA 3GSOA 1IEBB 3N44F 3ISYA 5AVUB 4LRIA 2N7BA 3HI6H 3KPOB 3MFFA 1H3VA 1CFMA 3CVDA 3VFVA 1E9PA 2CNZA 4KPHL 5D5MF 4S1SH 1FO0B 3IMSA 4LOEA 5F6HI 1A3RH 1GYVA 1XSOA 2C5DC 3FCTB 4F24A 3Q1SL 3VD5A 4GT0A 5T3XD 1CJYA 1FGNL 3MO1B 2V5RA 2VLMD 4LGPB 2IWEA 3VB9A 3MJGX 4JFFA 5I82A 3C09C 1BZEA 3QUYA 4OJFH 3ZZLA 2X9YA 5CWSB 2BVPB 1HSBA 4YJZL 2K45A 3GXTA 2YGQA 1BZQK 2GJ6A 2XN9E 4LP4A 5E51A 2KC0A 5IB3B 2WVTA 1I1AB 1CUOA 3QDGA 3VGGA 4BSJA 2C3VA 1CFBA 4TVUA 4JK0D 4RMSA 1KLUB 3ZIMA 3QIWA 4NN7B 2XPGB 3QARA 1NIFA 4CAGA 4S0HA 2WJ5A 2NTFA 4HUNB 1S9VA 2UV3A 1CDIA 2CHZA 4O5LH 5DR5H 2ZWKA 1J9QA 3ZHFA 2PP8A 3L4TA 4L05A 4R26H 2E9JA 3EYUH 3BP6B 5EUOB 1I85A 3T3MF 4UDTB 2YPLA 4X7SL 3V79C 1QSED 4TMPA 5DHDA 1FFPB 3G08A 1RXLA 1BWWA 5IHZA 5J89A 2LW3A 3CSYB 2EICA 1GHFL 1JV5B 4PJ6A 4UANA 1IM9A 1FIEA 5D8JL 4MCZA 4PN6A 2GJPA 4JN2A 5BW7C 4ZUVB 2X12A 4GKNA 1DQQA 3VXTB 1I9IH 1P7KA 3F7YB 2D2OA 2IQ9H 4M9OA 4P46D 4RRPG 1E9OB 2HT4D 4Y16D 1SN0A 4KJYA 4K5PA 4BGLA 1P84K 5G4OA 1UTDA 1QATA 2YBRA 2UUDH 3SJVD 4F8NA 3QZWB 4X8CA 3BIKB 3EH5B 3L5IA 4WU7B 3UMTA 5KS9F 2EQDA 3N0AA 5AYTA 3U2SB 3V0JA 3HE6B 2AEOA 2AJSL 3CZSA 2MQ0A 3DDGA 4IU2A 1S3KL 4MKTA 1Y18B 1KJVA 2QDVA 4GW4B 4HJJH 5DI8A 1TFHA 2Y5QA 4V1DE 5FB8B 4FQJL 4QJ3B 2J43A 2R29L 4WFHE 4KTGA 5E2WL 2F54B 2XWBB 1R47A 4JFQB 4N2HA 4ZZKA 4RH4A 3OKOB 3WD5H 5CZVH 2F53B 3MZTA 5IQ9A 4P3DB 4WEBH 3G6AA 3OC8A 1FPTH 4RDQF 4G6MH 3SPCA 1TYRA 3HS9A 1S3RA 4KNSA 3C5ZB 5CF3A 1F42A 3QHFH 5EEUA 3GHBH 4GMTH 4HPOL 3ULVC 1ZHBB 1UWGL 4XP4H 2X10A 4Y5YA 2EDFA 4EI5B 4XPGH 4PVLA 2OULB 5I9QC 3Q1EA 2EH7L 2AV1B 5HI4D 5HI5C 4G6AC 1F58L 1X5AA 3LEXA 4FZEL 1EHLH 4WKZA 1C16B 1ORQB 3S35H 4E41A 5HD8D 2E9IA 3MV9E 5IB4A 3VFPB 5FLUA 5B7EA 4LCUB 1PSKH 3O2DA 2FYVA 4GQ9L 3VMOA 1T0MB 3IFLL 4LSTL 1IAOB 2VZUA 3DURA 2CAKA 1EHAA 1HAWA 3UO1H 2ZNWA 4XXCC 5E8PA 3ARDB 4E2OA 5E1QA 1NFDA 1BAGA 1DJWA 2X2HA 4L4JA 2J8UB 1YNLH 3MLSH 4WI5A 1BZDA 3GBLA 4WO4A 3LNGA 1WA1X 5HPOA 1TETH 3MRRA 4DP2X 5IB2B 5K39A 3GMLB 2XIDA 4FFVD 3TZVC 2GUOB 4F7EA 4L9DA 4OFKA 3WSQH 4BCZA 1V05A 3ALXA 4P3CL 3HE6D 1HIMH 4AOFA 3TASA 4G1MB 4ZS6D 5TH2B 3EXLA 1O6VA 5K5YA 4NQED 3VRLE 2JI3A 4F57L 5C0CE 2ED6A 1DFBL 1TTBA 3WDJA 3VD2A 3FCBA 4LCCA 4KX9A 3FB7B 4Q4IA 3L3HB 3QEQD 2IQAB 2X9XA 4RMWA 3EOAA 2N3JA 1N64L 1S7RA 2R23A 4WTZA 2VDRB 2Z9TA 2LABA 5BZZA 4KQ4H 3SKOB 2NXYC 4IRSA 4U0QB 2GJRA 3I2CL 4E42A 1SYSB 4RBPK 1F13A 1F3JA 3AABA 2J20A 2WVVB 3GJFB 1PG7W 3IRCA 3WO3B 1EJFA 2OI9B 2R0LH 2P4AB 1JZFA 2KDYA 4WI9A 1XT5A 3MYJA 1UA7A 4L0ZA 4YC2B 1WA0X 1YZZA 5C0AD 5FIEA 2ADFL 3D85B 1BXAA 1KJ2B 3HG1B 3FXIC 4MRCA 1HH6A 1QLEL 1U8LA 4LSRH 5FXCH 5DMIL 5K59F 2XCMC 4XBPB 4ZXBD 1G9MH 2WINB 3ZHDA 4B95C 1P7HL 3ERXA 4XCYB 4JG0L 5IG7B 2NUTB 2XX1A 3VI3E 5F7KC 3SGKA 3T2LA 4PY8J 5BO1H 1A9BA 2AP2A 3PQYB 4LSQL 4PG2C 1RZ8B 3MJ8A 4NNYB 5BQ7B 3KPRA 4XNYL 4JO2H 2FZ3B 5JXED 2WLYA 5DVNA 3QC6X 1ITCA 3CLEH 1A1MB 3QB7C 1AI1H 5L8JB 1L3WA 3DVNA 3TEYA 3MRNB 3TN0D 4X9IA 4R83A 3PP3H 1YY9D 4NBZB 4TSAL 3TF4A 1NFIA 5IFJA 1DLHB 3F05A 5C0GB 2FJFA 1RIUH 3KR3L 4OGZA 1A65A 5EV7A 2JB6B 1XIWB 1PYWA 4NNXB 1BDYA 3VD9A 4JPKH 4BK8A 4YGVB 1TQVA 5F88A 1LEIB 4JDZA 4AUJA 2ADGA 3BOVA 1VESA 3N42F 2EE3A 4WUUA 3O4LB 3K4AA 5BV7C 2G3NA 5CBEB 2V0AA 1HCZA 2WW8A 1T80A 5EB9A 1LNUB 2V37A 5DJDB 1WAAE 4HJGB 3FH7A 1NGPL 2VR8A 4ZUTA 4JE0A 3BSGA 4JM2F 3K80A 1HYRC 4NO0B 1OVZA 4G43B 4Y1TA 4JHUA 3GMOB 5DD0H 5I8KL 2L0DA 2HG5B 1UXWB 3UOAB 3FAXA 2CKNA 3HG1D 4PWKA 1FDLL 4LCYA 4XB8A 1IGTA 2WSKA 1IC7H 2BDNL 2ZP9A 5LWYH 1K6QL 5KSBE 2X4UB 3E8UL 2J6WA 1P2CB 5DRXA 3CVHL 1GGBH 2ALAA 3OAUL 2P1YA 2DIJA 4AC2A 2ZYIA 5J57B 3LIUA 1QABA 3DK2A 3VA6A 4PP1C 4HT1L 1O9ZA 3QPXL 1MZYA 1QO3B 3F7VA 4DTGL 1BQHA 1KFGA 3CFEB 4HH9B 4EZMA 2NNAA 4XP5H 4XZUA 2I60L 5GGQH 4OFPA 3QI9C 1HE8A 2V8LA 3MREB 3NPZB 3UJTL 3BH8A 4Z7AA 4PP2A 1NLDL 3V7MA 5IBTH 5LKNA 3GFUA 3GMQB 4ABVA 5FFGA 3QIUA 4U1JA 5GS3A 4PJ9B 2G30A 4UV4L 1RIHL 5D93C 2NCEA 25C8L 3RY5A 3WL9A 5HSFA 1JYXA 2CLRA 1P4LB 5D7LA 4BH8A 3C8KA 1NBQA 2CCWA 1BHGA 3CN3A 4FE9A 4LK4A 2IALB 3TEWA 4PJIA 4NN5C 3A24A 4QLWA 4Y4KC 1XGRB 2C7UA 4FNPA 3VXRB 5ESAA 1Z0MA 1KIPB 1CD0A 1XCWA 1ZVHA 1CXIA 3MRQB 2P5WD 3H9SE 4PRHD 4RMTA 4YE4H 4JMXA 3GTNA 5HYQA 4G3YL 4Q58C 2N7AA 1N5YH 1BJ8A 1VPOL 2DBLL 4QT5B 3HS0C 4ZMYA 1YMME 4C55A 4R4BA 5GZOD 4IOFC 3CSFA 1AKJB 3JBG7 1ZPLA 5DFWH 1UD6A 4BWUA 2FL5A 2JJSC 4FJ6A 2AXFB 3NCXA 1A6WH 3LZFH 1U8IB 3KPPB 1QPXA 1RK0A 2VQUA 3ZE1E 4KKPA 2X40A 1BVKA 4EUPG 1FNLA 5F6HJ 3BN9D 2Y07H 4JVWA 2PCFA 3MA7A 1ACCA 3QXAB 3WLWD 3K6SB 1CG9B 4W9HC 1NOLA 1ODUA 3FB8A 4PV8B 4B9YA 1HHIA 1H8OA 1NGQL 1EAPB 4NP9A 3BP4B 3MTXA 4Y1AD 5HHNA 4ETYA 5HDRA 3U6RB 4ODUB 1F4YH 4ODSL 1ZT7A 4QTFA 4N68A 4X8JB 1IRAY 2DMGA 1DBBH 3TO4D 5D1ZC 3OB0K 5FYLH 2Z1PA 3B5HA 4TNVF 3ZDYB 2UWEB 5J11C 3L16A 2NY0B 5HPMA 2QGCA 2ZOOA 3PYCA 1II4E 4AH2A 5KG9A 2Y7QA 4NQCE 3RA7H 3PHQB 3IFOB 2BX5A 3VA2C 5C0BD 1BZ7A 3DXAB 1U8CB 3ULUL 2AJVL 5EOQH 3B7RL 5C6PB 3BYYA 2WBJB 5L2JB 4LP8A 3V5DB 4HXBL 5JR1H 5DUMH 2I27N 3KYMB 2VMEA 3F7PC 4LIQE 2JJUA 1NCDH 3SBWC 2CJUL 4E9LA 4QO1A 4X6FB 4KH9A 2ED9A 3FT0A 4HP5A 4M43H 1XB6A 4NN6B 1NGZB 1P9MA 4TSBL 1IIKA 1YN7A 1DQKA 4K5OA 2IAMB 4P9ML 4F7PB 3U6XA 2NR6D 1MPAL 2XVBA 1E2WA 2IFFL 4PW4A 4Q9RL 3IKKA 2IGFL 4PV1C 4PGCB 4ZSOA 5LLIC 4OGXH 3QORC 4M4RB 4HC1L 3TTYA 4GSXA 5A6IA 1WTLA 2ZYSA 5T1JA 2IFGA 1KV7A 2P8LB 4XO5A 4LGSB 3V0VB 3T3PB 1AHMA 1XF2A 1KBBA 2AJZA 3KLLA 4F93B 1R17A 4RGOH 3O3BA 3VFSA 3P0VL 4EDXA 4U3XA 3VFTB 4TULL 4DGYH 2OTWA 5ID1A 2BW4A 1HK6A 3FQYA 3CHPA 2ICES 1W0YT 2HZHA 1XEUA 3NCBB 4KAQH 1G7LB 4UOW0 2KQMA 1J0YA 4OLUH 4FTVB 3DMMA 5ID0B 1EK3A 1RZKL 2QQNH 4NOFA 1A1OB 4PB0H 1JWUA 1QTSA 4Y2OA 4NQVA 2LV4A 4XMLL 4Z7WB 3ARFD 1NDGB 1KPRB 2IH3B 4H8PA 4JMNA 4UQ9A 1TTRA 3WUZA 3WNPA 2HTKC 1WE5A 1J05B 2A9AA 2JH2A 2P45B 4JHZA 4P06A 3QWOA 3ULAB 1IEAA 3TTSA 1COBA 4PSPA 3BFOA 1KYFA 1MAMH 3GK8L 1DBJL 5DO2C 2Q76B 2GAZB 1B0WA 1KENL 3RL1B 4PJEE 2OP4H 3GBML 3HB3D 1XV8A 2HFFB 1G9MC 2NY5L 5EBWA 4D0CB 3WTXA 1IC4L 3T0VA 1TTGA 2WXGA 3IWUA 4MMXC 4M61B 4M62H 1JSYA 3ZDWA 1YNTB 4OCWL 2B1HL 4MRBA 1MUJB 2GBTA 3JV6B 1KPUB 2N56A 4E5XG 2X4NA 4M93B 4QRPB 3T6WA 4G9DB 4MWFA 5GQBA 1RK1A 4HISA 3EJYD 4RX4D 4HOWA 2JJWA 4EZJA 5DJCA 1CE6A 2A1WH 1UZGA 4QI3A 2PXYA 5D7KE 5AZ2H 4GAGH 4LNRA 1B6UA 4C57C 1FGVL 2BSTB 1JXJA 1TJIL 4L3AA 1ZJBA 1TEYA 4FQCH 5HJGA 3U1QA 4BZ2H 3EO1A 3BQUD 5I75C 1FYTE 1RUAH 3DYOA 1BIIA 4YBLC 2DQMA 4NENB 1JF5A 2X38A 3T0ED 4YHPB 5AVYB 5AB2A 4LASL 2ITCB 2V2WA 1SYVB 3GMRA 2XBDA 1S7XB 3FQWA 3NIGF 3NIDB 4CC1A 1EFXD 3VWJD 3MXVL 5BXFA 2FHBA 4M3KB 3DRQA 4YIQA 1OE1A 4FTVD 1F1DA 1BVNT 2XWTB 4LU5L 2WLHA 4GG6E 2K3TA 5JPNC 2PCPA 5ES4B 3IJSA 1HOCA 1JZGA 3LSOA 4JR9H 3NIFF 1MRDH 3DHJA 2PMZA 5H35A 4FNSA 4JFEB 3WTYA 2KLTA 3MUZ1 2NY1B 2FECL 1D9KC 4WV1B 3D3VB 5IVXA 1YYCA 3DTUB 3OHXC 2VDQL 4EUPB 5I66A 3FSAA 1OTUC 4G8FB 1ZXKA 4Z8FH 3HI1A 2YLKA 4X80H 3FQUA 4D9LH 4LVEA 1UCTA 5FX3A 2R4SL 1ASQA 3T1FB 1NC4B 1ZDQA 2WXFA 2L4OA 3PGCA 4L5FL 4R5TA 2R1XB 3L13A 4XNMA 2VDKH 1C08B 5HVHB 4J3XA 1CL7L 4PUBL 3KBEA 3HCVA 1AVAA 4F8PA 4A37A 1H15A 1U8NA 4LSPH 2DY2A 1S8DB 4G7QB 1AGCB 1M4KA 3SE8H 3G6DH 4IRJA 3HNTH 3DETD 1I3GH 5GXBB 3NAAL 3QXDB 2D7OA 5B1CA 3DX8A 4PJCF 3CU7A 5T5FA 1F6AA 3CZJA 3V4UL 4AJWA 2XN9B 1GPOH 1BLNB 1CGYA 2L7EA 4PJFF 5JA8B 1ZVSA 4K23H 1QQDB 3MLYH 1OP9A 1T21A 4Z5RB 5T1MA 5GS0D 3HAEA 3GBNH 4KOBA 1IJNA 3MNWB 1LQSR 4OJYA 2F74A 1T0NB 3CZFB 5ERWB 5C09E 4BH7A 3KWXA 4I5BA 3SY0A 1VACA 1KXTA 1ADQA 1BVLB 2YJLA 2IDCA 1GL4B 1UQSB 3VXQA 4N9OB 5F3BB 4KWUA 1TQBC 3RWFA 1KACB 3GM0A 3V0EA 3WIHA 5I1JL 4ZD3L 2B9BA 3U0PB 1U4EA 4MNQD 4BUQA 1W72A 1EDHA 1HINL 2QADD 1L9RA 4DZBA 1U6AL 2NLJA 1XSKA 3JWDL 3W3BA 4YDKH 2BS71 5A6MA 5BOJA 1NANH 4Z3FA 2NXZC 1VENA 4TLSA 5GRVL 5DRWB 1T1YB 2D3JA 3FSVA 3K2MC 4WWKA 4XCCL 5GS2H 2HLFD 1Q0XH 1RD6A 4NKDA 3QPKA 5FUCC 5HDWA 4G9FD 6TAAA 1E42A 2NT0A 3EFDH 3PHOB 2PF6A 3R7QA 3NK4A 1PD6A 4U1NB 2YAPA 3LEYH 4ES8A 3A67H 1W0WB 4HUKB 2AZUA 1L9QA 2WZ0A 2ZG2A 3QJSB 5FKAB 2IAAC 3V4VL 4I77H 4V1DB 5TJWK 1DQTA 3WCYA 4LEOA 2R0WH 1K3IA 4XPTL 4M1CD 5CLYA 4XVUD 4L23A 2YAQA 4M3JA 5FKPA 5HP5A 2RACA 2VITA 3TA3C 1P1ZB 4K3EH 3T9WA 3BKMH 4HEPA 3WKNA 3IGKA 3O41A 2R0ZH 5FW7A 5GZNC 2PWHA 1WZKA 2X2IA 3J2PA 5JW4R 2X09A 2W07B 4PWJA 3LIZL 5DK2A 3CE1A 4GUPA 4X9HA 1KB5B 3IS1X 1ZLVH 2XWCA 2WUCL 2OSXA 4QMEA 4W1TA 1M2VB 4A2EA 3MHZA 2FK9A 5IMLB 3X3GL 4A55A 1E8WA 1T5XB 1KPVB 5I8CB 3MBXH 2E7BA 5TF1L 3KJ6L 2CM5A 4YSPA 1Y1UA 1C1EH 4PHZA 3BE1L 4L37B 4KOCA 1LEGA 2BS8A 2G0LA 4NZ8A 3AU0A 1BMZA 4NQQA 3SQBB 4F7CA 1L9PA 1SBSL 3P4MB 2VISB 4N0UE 3GS4A 1XR8B 3B2UD 3STZB 4WNSA 4DP0X 5C3LD 2DDQH 3MV9B 2F5BH 3VXNA 2E6QA 2X4SA 3CDCA 3H3PH 1DUZB 1ZHLA 5KN5B 4LL1A 4EZLA 1I8AA 2GTWB 3BFWA 5FR3A 4P4KC 1T66C 2AXGA 5SX4H 2W65A 2Z31D 3I9GH 3LKSA 4L8CA 1EERB 3P2TA 2HFGH 2WLIA 5J6HA 1X5ZA 1U3HC 4XBGB 5I6NA 3A4FA 4MD5A 4YSQA 4J3SA 2AHIA 3MLVH 3AS3A 3LDBC 3ZT5A 5MEPA 3R1GH 4LPXA 5BW7A 4J23A 3VSUA 3WFCL 3SDDC 3QUMB 3DBXA 2DYPA 1MWAL 5E4EC 3UYPB 1ACZA 1ILSA 3AU1B 2KPNA 2OZNA 4ICXA 3QCVH 1HNGA 3QPQC 4Z7QF 2X1OA 1EWHA 3DSFL 3PIQA 4NM8L 3VMPA 1BXUA 1DQML 5I6OA 5C0CB 3JTBA 5B8CB 2GSIA 3INUL 2D31A 2A77L 2DJ4A 1TYJA 1RMFH 5EPMB 3JV5A 2Z4QA 1RCYA 4PJDA 1XGPA 1EFQA 3RI5F 3L08A 1LO3H 1LP9F 3GSQB 2J8OA 1PD0A 3WKML 3RE0A 5AVXB 3VJ6B 3GGWB 2D03L 1ZAGA 3MODH 1VADA 2E74C 3CX2A 4H25A 1V55B 3WNOA 1WBZB 4DN4H 1DJIA 3DYMA 5TDNA 5C9JA 3LS4H 4MDJA 3TEUA 5F6IB 3DIVA 4U3HA 3H0TB 1G6VK 1N3NB 4UM9B 3TBTB 4UT6H 3CX5J 1A2YA 1HHJB 1HDMA 5IP4A 1HSAA 3HVDA 5AOMA 1OAYH 3QIBC 4NZUH 2UZPA 1KFAH 1SMDA 4MSWB 4ZTPH 4L8DA 4D0DA 3BSZA 3IJYB 1QZ1A 3W82A 2WTOA 5IF0B 4HG4K 5IEKB 3CQFA 1DP0A 1J8HA 2JIXD 3FT1A 3LVEA 5IM7B 3WMSA 4WJ5A 5D1XD 1ZIAA 4QHPA 2WXIA 1YMHA 3P0GB 2YPVH 3QUXD 4ONFH 2KHAA 1UGNA 2F19H 4PS3A 1DBAH 1TLMA 3MROB 1SJHB 3BO8A 3K5RA 3MVSA 3LRSA 4YLCA 4Y5VC 4ZPVA 4LLQB 2DH3A 4M8QA 5JPMC 2K6ZA 1D7CA 4FFYA 5KJ7E 1LK2A 4LPCA 4EIZC 5JMOC 1RUQH 4EN3C 2VXVL 5DFAA 4HPYH 2RMNA 3QCUL 3PHSA 5FHAH 1J5DA 2SEBB 3MBWB 2FWLB 1I75A 3X14B 2J2ZA 2O61A 4QY8B 1MHPL 1S4IA 2KL6A 4XXCA 5I19H 4PMEA 4BYHA 1AS6A 1I3RA 2C9VA 3A5VA 3EGDA 4DUVA 3E9UA 1IZKA 4GYBA 3RAJL 5D2NC 3TPUA 2FATL 5CCKL 2I07B 3UO8B 3TZVA 2B4CL 2ZKMX 2AABL 3EJRA 4JQIL 4GSDH 4WHTB 1J88A 3S48A 1Z3GH 1OAQH 3K4ZA 4JQXC 1Q90A 5EWIH 3DPBA 4PRDB 1DLFH 2EXWC 3ZHKA 1LL1A 4HKZA 1JZ4A 1MCHA 3KYNB 3EBHA 2IV8A 2KI6A 3DROB 3IDJB 2GBUA 1AKPA 4OIBA 3QR2A 4YK4C 3OKDB 1FLRH 3NZ8A 4IBUA 1YPZE 5ADPL 4Z77B 4IBQA 3NZHL 1WEJL 4ZQKB 3WV0A 1UH2A 4NERA 3LN9A 3NH7L 3AS2A 4HJEA 2GHZA 3AT8A 1HHHA 3L4WA 3TT3L 3RVUD 3WS3A 1Y6MR 2VQ1A 5C1MB 2A5UA 1E4KC 2ZKXA 3CZUB 4RFOL 5KSBB 2K8MA 2X44D 1NAMA 4AMXA 2DLFL 2VSKB 3ARPA 4KJPC 3EF7A 4OLYL 4Y7OC 5F72S 4OUUA 3MV01 4LEBA 2F7IA 4HHGA 3KPMA 2XBZA 4I0PC 3W11D 1FFNA 1IGYB 1ACXA 1MHEA 1H3WM 4LLMB 4A7TA 3RWDB 1MXDA 1RH8A 2A6IB 5T5NG 2HFEB 1E9QB 3HC0A 5DVKA 5JHDA 1M7XA 1V7NH 2YSSB 4ZX4A 2V7NB 4Y2DB 1FZKB 1G9HA 3V4LA 2KLSA 4J27A 5ICZB 2I25N 2A4CA 4PG2A 2EE9A 1JE6A 5AVQB 4RMRA 2J1XA 2UXTA 4YSSA 4F2EA 1T0PB 3AADB 3S36H 3L4CA 4PJAE 4AVHA 1TTFA 5AL0A 3F6IA 1TU2A 1TO5A 3UROR 2VXSL 4A6YH 1AOZA 2O5XL 2EO9A 3IYLW 3FO1B 3OXRA 1HESA 4N8UA 4QRAA 4ZW6A 3V7AE 3S9DB 4W93A 2CGRL 3VSQA 5E8NA 2BINA 2P5WE 3KLQA 3TV8A 3TBBA 1R0AL 1JCKA 2XG5B 4N90E 1OSPH 5C70A 1JWSB 4O9HL 4IJ3C 1QR1B 3H9SB 5D1QE 1OK8A 3WHXB 4PJBA 1A4JB 3IPFA 1NCNA 2BNQA 4IHOA 1YMMB 4KK6D 1KBKA 4HJ0C 5J06A 3NDZE 1GZHC 1V3MA 5CNHA 4LMQI 3NSXA 2X7LB 2KT6A 4U7SA 1VLXA 3M1CA 4H2CA 5DGRA 5BZXA 4OLVH 5KVDH 1S78D 2WZPA 4MNGA 3MOAL 1B0RB 1OCOB 2X28A 5EO1B 4HU8A 3TEZA 2DM4A 3OPUA 5AZEH 3ATEA 1A7OL 5SWSE 1EUUA 3RZCC 5CHNB 4S0SD 4MVBD 2YAEA 1BM3L 1U93B 4B53A 5F0MB 3E6FB 1SEBA 1B3JA 2VXQL 1MDAA 3D07A 4KVCL 4G8GA 4XN8A 3CC5B 1AACA 5CSGA 4PRBA 4U6YA 1I8UA 1X44A 5CBAB 4K4KA 3N04A 3QFJE 3EH4B 3QNYA 2XFGB 3BPOC 1G1CA 4JO3H 5D7JC 5E24E 4W9FC 4OD3H 4N0CD 4Y2DD 4HKJB 4RQQA 1A6UH 4FERA 3STLA 2AQSA 2NYKA 2UZYB 1OM3H 4YHML 2ITDB 1XCTB 2Q2LA 1YYMH 4NQCB 2VMFA 3I6KB 4R84A 4UUJB 2FHFA 4ZFGH 5E9DA 3I02A 1I9EA 3VD0A 2N59A 1T0OA 4RLDA 4P2OB 4Z7VF 3RX7A 4I18C 2GCYA 4IU3A 3QNXB 1UM4H 1HQ4B 3QI9A 1LLAA 4KHXL 5HHOA 2VABA 4K71B 1F6LL 2JFCA 1FNGB 3ESUF 3NOIA 4QHUA 1Q4NX 5GGTL 1CLZH 3QRLA 5BVJB 1P7QD 2PR9A 3CK0L 2H2PC 5IVXE 3TPKA 4UIMA 1TTCA 4HGMA 5LNDA 3VE0B 1PAMA 2ZOTA 1TZIA 2G5BA 3A4AA 5F7BA 5F97E 2ZCKL 3ESNA 1AO7A 4HUUA 1NMCC 3BJ91 1Q9KA 4Y4KA 1U36A 4AVKA 4K3DL 2K7QA 2E8YA 5F1IB 1AD9A 1IC1A 3KLDA 3U36B 3LB6D 2Y24A 3OX8A 4FQ1L 2PCYA 4XOAA 3EDFA 5E6IC 4LSDA 2J44A 3JWOL 3HS0A 4MS8D 4R7XA 5F1SA 43C9B 1KCSH 4JO4L 2VDNH 5E2JA 3SYQA 3WFEL 1IB5A 1XX9C 2V33A 1U3YA 5IWLC 3QEHB 2JJSA 1ZLWH 1A7RL 3FH5A 1HSBB 1RUPL 4NFBA 1J1XL 2ZICA 3O9WB 4OFYA 1R3LA 4CVWA 3GO1L 4WK0B 2BJML 2C3VB 3D25B 3MRLB 4LOFA 2OR9L 4IM8A 4Z1PA 4AIZB 3B9VA 1TEGA 2IBZY 1KCRH 4QYAA 4XX5A 5MENA 2Y6TE 4AEHL 5D7SH 2XG4A 1YEGL 1BZ8A 2H2SD 3SBRA 3D0AA 3IWVA 5F0LB 4MZIA 1ZEAH 3S3PA 1BFVL 1OAZL 1QNIA 3ARTA 2VXTL 1A0QH 1KTLB 2G2RB 1A5FH 5F7EL 5D1ZA 1A7QL 1IM9B 1BQLH 1UJ3B 2MFNA 4WLCA 2Y7MA 4JN2B 5SWQA 3RVVD 2CR3A 1TKWA 5E9NA 1RIVL 4UIKL 3T6VA 3FT2A 3KYKL 2IDFA 2OPCA 5IESL 1I1RA 4GAFB 1X7QB 4BHUI 3LV3A 1JHTB 1P7KB 2GB2A 2HG0A 1KTCA 1C7TA 3TFKC 1NCCL 4N0YL 1J0HA 4PJEB 3TP4A 3N85H 3U4BL 3P4OA 1BPVA 2BSED 2XZAH 4PCKA 4LQ1A 4F7TA 1JWMA 5TQ0H 2DL9A 3AGWA 4JFUA 4O02H 4J6RH 5J1AA 3UC0L 4BRVA 3QDJA 1EEZA 3SBWA 1KGJA 2NW2B 3ZDZE 5IQOA 2JK5B 5IB1A 4HD9A 1BGXL 1IFRA 1KN2H 2XJLA 1I7RA 2EABA 5BMFH 2X4QB 3X1EA 5CGMA 2OMZB 1YVLA 1FYTB 4JPVL 2GK0B 5EU3A 4FX5A 1KT2A 5K9QI 3X3FL 4JFFD 1ZVNA 3QUYD 1ZHNA 1YYLL 3QORA 3K7UA 5IW3A 4H8QA 2QGEA 4DK6A 2GJ6D 4GO9A 4NKMA 4Z7OE 1BQHG 3EOYG 3QDGD 3BWSA 3ZO0A 3WNKA 1DSYA 1S2EA 2E6PA 2GK2A 2R56L 3CBKB 3LQAH 4FQXC 5LAXA 4PLJD 3UPAA 2H6OA 3QIWD 2XN0A 4GG6B 5J4MA 1UA6L 4Y5YB 5DJZA 4F3FB 2ED7A 4HJTA 3FFCE 1KCVL 3WXVL 3GSRB 1OF2A 5C0NC 4PREA 1ETZA 1HHKB 1OGTB 2YPLD 4WKZB 5IHLB 4QHNA 5HGDA 2D0HA 2FYYA 4HS6A 4RAHA 2MTPA 5B21A 1WV7T 3APMA 1OL0A 5BRZE 4E0RB 4G70B 2XV3A 3FQXA 1IM9D 1FO0H 3HEIB 3LVTA 1Q1JL 3E0GA 3OWEA 5DZAA 3OAYK 4GOSA 4NO2A 5E1IA 3VFMB 1S7UA 5HDQL 3I6LE 3IGUA 4NWUL 5DZ9A 4JJOA 4IIQC 2EC8A 2V7HB 5F70A 3N0PB 5LG1A 4BIKA 2EP6A 3K71A 3OF6A 1GIGH 2LR4A 4XVTH 1QSFA 4OKVA 4F7EB 3LKOB 3VGDA 3AWGA 4HIJA 1UM6H 4I9XA 1JG9A 3ZKMD 1NUGA 4B9PA 4MMXA 2RQ8A 5DHEA 4OCMC 1KSRA 4CSZA 5CJQH 1UG9A 3GZKA 4PJDE 1GMEA 4B9IA 1MFVA 3U1PA 1XH3A 2H7WA 4UOJA 2IDQA 2HVJA 1SDAB 4PBDA 4K07A 1TSHA 2OMWB 1YUHA 5C09B 3TM6A 4BFFA 2OBGA 1WC7A 2WANA 4PG9A 1SVBA 2FIKA 3B3IA 3O6LH 1F3JB 1WZ1L 2IJ0C 4MFHA 2Z0UA 5IVZB 3TT1L 4ZFOB 3X13B 4CGUB 5KYUB 4N1EA 5CGBA 4UAOB 2VTFA 1AXTL 1GS8A 1E3XA 2D4FA 2O30A 4MB5A 4IKJA 4YQXH 1OAUH 1HH6B 3VNZA 5LQBH 3QHTC 1CVRA 1CQKA 2EKJA 2HPOA 4B96A 3CZKA 4Z7NF 4IJTA 5TDPA 1KGCD 4E41D 3QXTA 2YD7A 5JPNA 3FUDA 3KWTA 4BSVA 2X2UA 4Z95L 3PFUA 4P2QE 4LP5A 4JL2A 4XMWA 5MERB 2BY2A 4O58L 4UT7H 1D9KA 3R7RA 3TVMC 1ZA6A 4KK9C 3MRHB 1PTZA 3OHXA 1E5UI 3BLBA 4WO4D 4YL4A 1ZTMA 2EDNA 2G2PA 1K8IA 3PV6A 3RYMA 4IQHA 3DVNB 3CCHA 1MFUA 3TFBA 1S9YA 1G7JB 1HL4A 3D18A 1NFIB 1J5OL 5IFJB 3HTLX 3OQ3B 5I0WA 1GOHA 4XP6L 2XTLA 4YAQA 3W9DA 1PYWB 1NCGA 2JCWA 3DKHA 3TBVB 4NI3A 4NBXB 3UZVA 3TBYB 3ZRFC 2G4EA 2B8OT 3U46B 3IDIA 1UATA 3MCYA 1AGBA 3LQZA 5C07E 2LFEA 1L9TA 2OMUA 4I1PA 1QNZL 3IRZA 3GPEA 1MWAB 3K6FA 4NM4H 3OMNB 4IRSD 3BZDA 4YLQT 1E2ZA 3V52L 2X4TA 5MHSD 5E00A 2NRDA 3SE4C 5DMJB 1IBFA 2QMJA 5DMKB 2UZXB 4N0UB 1CLVA 3GXDA 1ZVYA 5AB9A 2QVIA 4P23D 2H1LM 2XQYG 2MQCA 2IG2L 4POYA 4X7TA 4LCYB 5EZIL 5GGVY 5F0PB 3MGOA 4FZ8L 4G7YH 1JOIA 3LHPL 2C9SA 4S1RH 3PWVA 4MS6A 2TAAA 4OVVA 2BNUA 5D72L 1CT8A 3U2JA 1IVTA 4KROC 1XSIA 1FNFA 3NUKA 3S88H 5F9WC 4NAQA 2NY6C 1OCWH 3KPRD 1T6WA 5IVNA 5CO1A 4LEXH 1BQHB 1RURH 2RH0A 3CBRA 4IOIA 1GGIH 1E8YA 3GKZA 4TVPD 5CSZB 3RIAK 5DS1A 4XZUB 1INDH 2XWXA 2BVQB 1RP9A 4L2LA 1B0GA 2EXYD 2BSCA 1VAHA 4XN1A 1KGIA 4GSUA 4PP2B 1JPSL 2A4EA 2DPKA 4YFLF 1FL3A 3QIUB 1XF4A 5L0QC 4QNPE 3SDYL 1MJ8H 4DGIL 4UTAL 4QHLA 1FZMB 4P57B 1JNNL 3OKMA 5D7LB 3HZYA 4AW4A 2YA1A 4KRPB 4N6RB 3V0HA 4YHIA 4PJIB 4WIQA 4HDIB 5J1SC 1OTSD 1FORL 3TA3A 2HJFA 1KCLA 4WUUD 1SXZA 5EN3A 5ESAB 5HHVL 1QHQA 4BQBA 5C6TL 4DKFL 5GZNA 1J8KA 2YQGA 1UVQA 3MV8E 3GSWA 15C8L 2J7LA 2XTJD 4LVOB 5HYQB 4N5ED 1FBIL 4JNXA 2BNQE 3DUUA 2XXCB 4BQ6A 1FVCB 4R4BB 1DFXA 2EIJB 3M1OA 3T04D 4TOYH 3GXUB 4R96B 2X6CA 5KJRL 2WLLA 3D9AH 3PL6B 4AC4A 2YA2A 3GTVA 3OGOE 4LB8A 4N2LA 5I6LA 4MNGE 1SFDA 4XC1H 2PCFB 3FUEA 4K7PH 3VI3F 3KL0A 2AI0L 3MUGA 1E65A 1ZSHA 2QBWA 3HMXL 2ITFA 1A7PH 2XRAL 1A4AA 1HHIB 5CR8A 3BN3B 5HHNB 1SJEB 1UXSA 4P4KA 4PGEA 2H1PL 5I1EH 5AUMA 4PHXA 4MNHA 2JKSA 4BQ8A 3BRDA 3FSWA 4PM1A 2VDPL 4HFWB 3QXVA 2JKTM 5E2TL 1U3HA 2WOYA 5HTSA 1E40A 1NMAL 3D30A 5HPMB 1A3LL 3SDDA 3CVIH 5CILL 5JHAA 4OZGE 4H20L 1IQWH 1JZHA 4NC2B 3CVBA 4AGMA 4DFHA 5LBGA 4B0MB 5FA4A 5D7LD 5I8OH 5IROC 4ZG1A 5HGAA 3PABA 1QPPA 1IGJB 2JI2A 1U8PB 4TQHA 2OYKA 3UTOA 1D6VL 4B97A 1URLA 3EUDA 4ZMTA 1L0QA 3I3EA 3VWKB 4Q6IB 4Y19A 1YPZB 1PZBA 1UYWL 4PJGA 3ZDXE 4M5SA 4UQ3B 4HEME 3EZJB 2Z7YA 3ZSSA 4AK1A 3SHSA 4GEIA 1UACH 3EGXB 4XP1H 5FW8A 1PKQE 4FMVA 2H32H 1DUYA 4AYFA 3VDBA 1CBVH 4YE0A 3NBNA 4EEEA 1JPTH 3PWPA 5IOPA 5EBMB 3OJMB 5DWUL 4F92B 1OWRM 1UUSA 1G0XA 4NGHH 4Z3IA 1LWHA 3AXIA 3HZKA 3QIBA 2QQLL 2AQNA 4G11A 4LLYB 4JFPB 3HUJA 4HX1B 4BZYA 4JE4B 4TNWF 2QTVA 4WRLA 1VEOA 1Z9PA 5LNGA 1I1AC 2HXAA 2BVUA 3G6JF 2C9AA 1R6VA 2DF3A 1XVSA 3RVWC 3VFSB 1EMTL 4M7ZB 4NN7C 4Q52A 1NWOA 3OLIA 4M6ML 3UTSE 3ZQ9A 3RHWF 2VUKA 3LKQA 1U41A 4N2KA 3L3OB 4PVNA 4Y5VA 1QVOB 1TJHH 3BGMB 4KKCC 5I24A 1KJMB 5E4AA 5JPMA 3H42H 4PJAB 1AE6L 2FX8H 3F5WA 3N9GH 4EN3A 1OGAD 4B9CA 4EDWL 2ATPA 2BY0A 5FWQA 5E6ZA 1OT1A 2P8MA 3C5SB 3S34L 4EE2A 3VD3A 4DPBX 1VA9A 2MCPL 1JPST 3ZE2E 2E27H 4WDIB 4DP7X 1QHPA 1PG7X 4A38A 3W38A 2GJZB 2AQPA 4BZ2A 5B3JE 3A22A 4CILA 1JPGA 1OB1A 3EYSL 3ELQA 5D2NA 4ZMOA 3QWOB 1MSPA 5D1QB 2HCZX 1RZIB 3S3JA 1IEAB 2Y1ZA 1OP4A 2LFGA 3KLHD 4OZIA 4R2GD 1AQDB 4ECNA 3PUCA 5INCB 1AHKA 5ALCL 5GGSB 1AHWB 1YQVH 3HE7B 3HPLB 5FK9A 4JQXA 3LRMA 5FV2A 1CR9H 3TJEH 4XZ4A 4DGUA 1DQIA 2F5AH 2LAGB 3HBZA 4RIRA 2WD0A 1K4DA 2ZXWB 2NY2D 4HFUL 1YEHH 2X4NB 2H0EA 4OCNC 1T2QL 3RTQB 5SWSB 5D5MA 4TLUA 1RK1B 3V6ZB 1J7VR 1LO0L 3BAEL 5E5LA 4ELMF 4OJEH 2CO7A 2E75C 2OS7A 1U8MA 2EDEA 2F15A 3EHBD 2XWEA 4PB9H 5DJCB 4B5EA 4ZFFB 3ZE1F 4AK2A 5D7IF 1A25A 1XGZA 4U6HB 1QI5A 4YHOL 1M3IA 3RY6C 1CTOA 5DD3H 3WU1A 5HYJA 1E4KA 2CR6A 3IVKB 2PYFA 4NXKA 4Z76B 2W38A 5E99H 2C9UA 3C5ZC 2C4XA 3EO0A 1LO5A 3EOTH 4QRRA 4GKOA 1FNSH 3QC5X 3QFJB 1I4FB 4HMCA 3BLKA 4KU1A 1MG3C 4WI8A 5FGCE 1G7MA 4FS0A 4HKBB 2V2WB 1UZ8B 2OSLA 3SSGA 4EI5C 4I0PA 2BIMA 4G80A 4LLAA 3P3RA 1HCVA 3TJPA 3AY2A 4W6WB 3TJHC 3MJ9L 5F9JA 3LKRB 2A2QT 4TUKL 4NUMA 3BCFA 4XTRC 4FADA 4NKOB 2O6PA 3OPZH 5B3NA 3DMMD 5MEQB 2CK2A 5HGBB 3L5XH 4GI8A 3KBPA 2YD9A 5C0RL 1O7SA 2Z4TA 4R4FH 2H3NA 3N41F 4P05A 4PAZA 1JRHI 5F7NC 1OEZW 4MBRA 3NTCH 4HD5A 5H35B 1LMKA 3MBEB 3ZL2A 5DZLA 5C2UB 4QRTA 3CHQA 3Q13A 4OF5A 4IYKA 1VSCA 3X11B 5E8OB 5IVXB 3UBFA 5IQ7L 2C1PA 4ZUUA 5I66B 1XH0A 1KNOA 2LU7A 1OTTD 2PP7A 2X87A 2VZ3A 1I9RH 3G5YA 4TPRH 3HI1B 4K8RD 1NIDA 3FQUB 4BFKA 2GI0A 4OFDA 4A2DA 2F7PA 2O26U 4YZWA 4KHTL 5DQDH 2AGJL 4OIIL 3U7WL 2A9CA 1MCQA 4GXUM 5KS9A 3VFUB 1KXVC 3DWTA 4MZ3A 4P5RA 2VSCA 4UAHA 5EF0A 3US9A 2B1AH 3UTTE 4X4MA 3DGCR 1ZLUH 1Z1WA 4V33A 3T4YA 4YSUA 2CO2A 4HSCX 2VWEE 1GZHA 2X6AA 3CH8A 5ECJE 2VL5B 3CPLA 4R3SA 5AAWC 4ANKA 1WISA 3H7LA 2PXYD 1J12A 3QJFB 1F6AB 5D2LA 1U8HB 3V95A 5DZPA 4QTIH 4XCNA 3VO0A 4YL9A 1QFWH 4I0KA 3OG6B 3RZCA 2OI9C 2FCBA 1NMBH 2F74B 4TUJB 4DEPB 4I5BB 4QEGA 1IFHL 4YHLL 2CA4A 4ZK8A 1VACB 2E46A 1KXTB 4YC2C 4ESKA 1IBHA 1JZ6A 3QZLA 4J3OF 3S97C 2NY3D 2BFVH 4TTDC 3S37X 3QUZD 4MJ5B 1B4LA 3RWFB 2R39A 4KZEL 2VZTA 3QA3A 5D7JA 1X7SA