5LUMA

Alpha-crystallin domain of human hspb6 patched with its n-terminal peptide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
78
structure length
78
Chain Sequence
b'GHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein beta-6
publication title Structural Basis for the Interaction of a Human Small Heat Shock Protein with the 14-3-3 Universal Signaling Regulator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein/peptide
total genus 12
structure length 78
sequence length 78
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lumA01
4JUTA 1WFIA 2N3JA 4YDZA 2MNWA 3L1GA 4I88A 3QORB 2Y1YA 1RL1A 3AABA 3N3EA 3VQLA 2XCMC 1X5MA 2Y22A 2JKIS 4YL9A 3EUDA 4M5TA 3L1FA 3QORA 4FEIA 4PBDA 4RZKA 3W1ZA 2WJ7A 3IGFA 4JUSA 3GUFA 2O30A 3J07A 3AACA 3L1EA 2KLRA 3GT6A 5LUMA 4ELDA 3VQMA 1SHSA 2CG9X 2Y1ZA 3Q9PA 2RH0A 2K8QA 3GLAA 5DS2A 1GMEA 1WH0A 2KMWA 2BOLA 4MJHA 1WGVA 3Q9QA 4PCKA 3QORC 2CR0A 1EJFA 4M5SA 4YLBA 5DS1A 4ZJ9A 4YLCA 4YE0A 3QORD 2WJ5A 2N0KA
chains in the Genus database with same CATH superfamily
5J7CC 3WO3B 1N68A 4O51B 4LFHG 5AVQB 1BPVA 3PQYB 1MW0A 1QR4A 2MJWA 1SNRA 3KPTA 4IRZL 1E9PA 3IGFA 1V7NH 1W8OA 2YPLA 5TJWK 35C8H 2JKTM 2HTKD 4H0HB 4P4KA 3DNKA 3WFZA 1O6SB 2Y07L 4U0RC 3LS4H 1IGTB 4LT7A 3D5OF 5GS0D 3QGVA 1HOCB 4XE0A 2P43B 4W1TA 32C2A 3H4FA 4H13C 1S9XB 3EO1A 3EOTH 1TETH 5EZJB 1AGEA 4MXQC 5AZ2H 5D70H 5EZOL 3T0AA 4G6KL 4LSVL 4O2CB 1CLYH 5EZIH 2EKSA 3VDAA 2GITA 2AEPL 1R3HA 1ZIAA 2JCWA 3BSZH 2R2BA 3KYOB 3PJSA 3Q3GA 4RGOH 4NQCA 4DZ8B 5A6MA 4H5SB 2UX7A 3NA9H 5I8OL 2R2CA 4F58H 2QR0B 1M6OB 3FT0A 3LH2L 3RGVD 2WZ5A 3CXHK 1JFQH 4XC1H 3V95A 4L3CB 5I2IA 2BWQA 2XTSA 1LP9F 2A74C 2RA1A 1EHAA 4P2OC 4G80B 3SPVB 5KSAC 2Y7OA 1G7MA 3CDZB 3VNYA 5AYQA 3F5WA 3T6ZA 1RUAL 3BAXA 1G84A 4GW4A 4G8AC 4QO1A 5T1KD 1NWOA 3ME0A 5HHXH 3KCPB 4OM0H 5HVGB 3ARPA 5A1AA 1MOEA 4NQVA 3APMA 4H40A 2VWEC 2YARA 3C09C 2VM4A 4KK8C 4P23A 4ZUUA 5GRJL 5CCKH 1JV5B 3E1ZA 1EA9C 4PHZA 1U8IA 1K6QH 1SEBA 3R4DA 3DYPA 4DKAA 5DA0B 5DJ8A 4BFOA 1GC1H 1M9WA 1FH5H 2A73B 2KPWA 2LHAA 3TBCA 1OGTB 2WQRA 3U82B 4DUVA 4LVHC 1E9OB 4JJ5A 3S4SG 2BMKA 1HE7A 5DI8B 1PGRB 2AEQL 3C2AH 3P9MA 1MVUB 5DGQA 3LQAL 5GJSH 3QPQD 1EGJH 3K1DA 1OCRB 1Q72H 4RFOL 1AJ7H 4GRLD 4FYRA 2XN0A 2Z92A 5J1AA 2YN3A 1OGAD 3BH4A 4PS4L 5E4OA 4Z7WE 1M2OA 5M95B 4QXUL 3QULA 2WKOF 4JS7A 5A2FA 3JV4A 4NKMB 4KTEH 4KZCA 3SDCC 2VXQL 1L9NA 5D6DA 5FGCB 2XBZA 1MCPL 4J8RA 4NS0A 3WSQH 1KFGA 5JPNC 1BPLB 5I6NA 2E7LA 4KZDL 1FRGH 2GVYA 1DFXA 3MR9B 3PY9A 2G5BA 4M1CD 4ZAKD 4G42B 4EUPH 1JHLL 1NOFA 2BPBA 4LGRB 4LSRH 3SPCA 4BSWB 3RTQB 1PG7X 2BM3A 1Y0LA 4L5FH 1JGDB 3T4YA 4PWIA 2BDNL 2XX0A 1ETA1 2WXIA 1QNZL 2GHZA 1RK7A 1LO2L 3VXTB 4PJCE 1HVXA 2FO4A 4OLWL 3EOBA 2OV0A 5D9SB 5I74C 1RIUH 1X5XA 5JO5B 6FABH 3QORD 1KCSH 3FQWA 2NY5L 1J1XH 4RGNC 1AYRA 3QW9A 3T0BA 1EJ6A 2E6PA 2G9HB 2JELH 3L3GA 4WLCA 5LWYH 1WFUA 3H9SD 4OZFB 4YPGB 1PDKB 1KNOA 2EIZB 2Z0UA 1FNEB 3FQTA 5D1QA 1S78C 4M5TA 1KC5H 3REVB 1DVFB 5F9AC 4WWPA 4FA8A 4RIRB 1K72A 4M6ML 3I9GH 4JCWA 1CGTA 4YSTA 1D5ZB 4U3XA 2BCKB 3SOTA 4OH2A 1AOZA 3QYCA 2VM9A 2OJ1A 3NIDB 2BP8A 1W0YT 1FPTH 1EEUA 2J5LB 4OTXH 5DS8A 2OCCB 1K4DA 1WCBA 4ADGA 3BT0A 1FO0H 2P5WA 1E8YA 4MB3A 4F2EA 4ZMLA 1CXFA 3BQUA 3HMXH 2F58H 1N18A 2B1HH 3X13B 1OP9A 4IRSB 2WIMA 3P0VL 4BZ2H 2IBZX 2D31A 2BS9A 3GQFA 4XTRC 2WQUA 1OPGL 5I5JA 3QZWA 1KYAA 4H1LB 4YDIL 5AZUA 3L08A 3FH8A 1DVZA 2F7QA 4NO2B 1E8XA 2JKJA 3MV9E 3S5LG 3EZJB 4X7SL 3CJJA 1TZIA 4RMSA 4QRQA 5CGTA 1YEIL 5GGVH 1QWHA 4DQOL 2VSMB 3GRBA 4G11A 5FIEA 5IW6B 3BVDB 3OAUL 4S1DC 3O2WH 5BVJB 2BOLA 1Y1UA 1JUFB 3HRZA 2OMVB 3QG7L 5DZVA 3ULSA 4MJJA 3Q1SH 1FZOA 1LDPL 1AR1B 1NWPA 4HUWA 2YEZB 3IDYB 1J0KA 1G4MA 4F2MB 1HHJA 5EB9A 2ZG3A 1CL7H 5FV2A 4YXHH 4JJHA 4JY4A 5FR3A 1P2CB 4OGZA 1BVZA 2BIPA 1S3KL 1J5OH 3CFBA 3BH9A 1JFHA 1D6EB 3F7VB 3MRRA 2A9MH 3W1ZA 4RAVA 2OMWB 3I9AA 1FZMA 1M7UA 2B20A 4CVUA 4EQ3A 3C5ZD 3PWJB 3V0WL 1A2YA 1LEKB 5DC4B 4KQ0A 5DHVB 1UCBL 3GHPA 3QUGA 4NBZB 5KYXA 2ZTBA 3WS3B 2RH0A 3L3HA 3NCWA 4OGXH 3EGSB 5LBSL 3IEAA 4PWEA 3GBNL 3P4MA 3GXDA 2J56A 1PSKH 2OAAA 1BMZA 2OMUA 3WXVL 1HH6A 3UO1H 5IIEA 1EZUA 3VXPA 5K9QG 1RUML 2VH5L 1O6VA 2XTJB 2CKBH 4M7KH 3G6JE 4U1SB 2V4LA 4N0RA 1WBZA 4D8PB 4PJ7A 5C3TA 3TBYB 1I7RB 2DYSB 1DBBH 2X28A 1EHXA 1NPUA 1AGDA 1JZEA 1Q4NX 2JJWA 3Q8AA 4Z8FL 2YQGA 2A9CA 3D34A 4DGIH 3PWLB 3HC2A 3P9LB 2QSVA 4HS3B 4XE5B 4CNIA 2BCMA 2WUBH 1NDGA 3B2PA 3NZ8B 4J23A 1LE5B 4MRBA 1MFBL 3O4LB 4L37B 4UNIA 4IBUA 5AAMA 2E6JA 3ARED 3BXNB 1RZJH 4JKKA 4YHPB 3F00A 3VTTA 1I8UA 1DO5A 3W9EA 9PCYA 2E7MA 2WTRA 2Z35A 2BWDA 4GRMB 4ZFOB 2Z64C 3DSNA 2PWFA 1AKJD 4PWJA 1RLWA 2YO3A 1P6AB 1QBLL 4PCYA 5SWZD 4HLEA 4KHTL 1W72A 1IE4A 1L7IL 3NJMA 4X4MA 2R29H 3EGDB 1C08A 3OD3A 4QAMB 4ADJA 4NNPH 3WLBA 5D7IB 5CJOH 1BOGB 2Y1AA 3G9AB 1SDAB 4JM4L 4WW2F 2OMNA 4JN2A 1J5IA 4GSRA 3WU1A 1UGNA 4KVCL 3VGGA 4MXVE 4OFVA 1HWWA 4FNLL 1GJIA 3RTQC 1ADQL 5KVGH 4PUBH 5FKPB 3RVXD 3W11C 2K6YA 1RJYB 3S6CA 4P46A 1UA6H 4Y4FA 3OGCB 4OZHE 1ZPUA 4MCYA 1TQTA 2VN6A 1QLEH 3CSYA 3L17A 3IE4A 2D0GA 5I16A 4NUGL 1A1OB 4S11A 2GQHA 2EEBA 4I77L 4JFHE 4KQ4H 4WUUB 4J3BA 2FJFB 2DKUA 1NKGA 3W82A 1NEZA 3ARDD 4L0YA 4IK7A 4X5XB 1DVFC 4WV1B 4XNQB 4EBQH 1W0WA 4AQ8C 1I8IB 1OALA 3VWJB 4OY9A 1PQZB 4DW2H 2J6WA 3PGFH 4JFXA 3TJEL 1AD0B 1J1PH 1RZ8A 1I3RA 4BIKA 4U1MA 3D09A 5MENE 3MV8A 1T83A 4GAJH 3GXIA 1MN4A 1X7QA 1Q0YL 1QG3A 4ZOCA 2RR3A 1EK3A 1NGXA 5KS9B 4WKZB 4PJ5D 4KUZH 4JPKH 3TGXA 4FLRA 4ZMVA 4ERSH 1FFOA 4AMKL 3CLWA 2V8MA 4HT1H 3L5JA 3K2IA 4APXB 3KS0H 2GUOB 4NQXB 2CK0L 3TBTA 1O9VA 4HUNB 4J6RL 4JFEB 1AY1H 4S1QH 4IRSC 1A4KA 4BE5A 5T3ZD 1GZQA 3STLB 3QH3A 4OJAA 3FQUB 2XYCA 2V7HA 3UOAB 3ZL2A 3W2DL 3LN9A 1JWUB 1OK0A 3MOAL 3MXWH 3GGWA 1I53A 5EU7C 3BDBA 5AYTA 3B3BA 2WVTA 4JRLA 1AXSA 4NJ9H 2IH1B 3FU7A 1KXVC 1CBVL 4J5VA 3C6LA 4FADA 3BSGA 2WBJD 3GMPB 2D3LA 1LO0H 3C08H 4L8SB 5IFHH 3GSOB 1XR9A 4B3VA 3MCLL 3BZ5A 4DP6X 4FHJA 4KTDL 3VXSE 2CRMA 5HYQA 1HHIB 5CBEB 2A2QT 1WS7A 4JPWH 2GCYA 4AVJA 5F7FA 5LN8A 1BQHB 4YHZH 2WLMA 1V5JA 2J21A 5H94A 2HX8A 2I69A 4NRZA 3KVQA 1C16B 3G04B 4FA6A 3O6FB 1AR1C 1A9BA 4KKAC 5F2FA 3NIGF 4PJGA 3IDYC 1YY8A 2BNRB 3CU7A 5JDSA 4AUJA 4YHKL 2EDKA 4GYBA 5GGSA 4GIAA 2J1ZA 3MUGB 3B9DA 3MLZL 3BHBB 4U1JB 1ZE3C 2BY0A 4WU5B 4GMTH 4NX0A 4DOHB 1M6UA 2ICWJ 3FQNA 4HWZB 4KI1A 3N1GC 5CEYB 4FL4B 4FXTA 4G8GE 3CU1A 3IU4H 4IRJA 4PJFF 4PGDB 2OFQA 3RIAF 1RURH 3GINA 3SE4C 3DX4A 2D73A 4GMSL 2EUVA 1XBRA 7TAAA 1XGQA 1I85A 3T65B 1VGKB 2UV3A 4ONGL 1URLA 3MYJB 2F54D 1OAJA 2XTJC 2ROXA 3V0GA 4FZ8L 3C6SA 3ULVC 1FC1A 1W9XA 2IG2H 2P1YA 2IQ9L 4BK4A 2K4WA 3WE6B 4R26L 3H7LA 3S3DB 4Q9QH 1NA8A 2YOAA 1H6FA 5HHOE 4UOZA 3IJEB 4KXZH 3BZEA 3QNZB 1AMXA 2BIHA 4OLEA 2V6HA 4D0DA 3PWPA 4KK9C 5JXED 5DVPA 4WAFA 3QJSB 4AIZA 5AVWB 3ARFD 3TNMA 3AW5A 3V6OE 4GW5A 8FABB 5CZRA 3VTMA 1QAWA 3PP3H 4F8TA 3X17A 4QCIB 2IV8A 3Q5OA 1HYSC 3T6QC 3HCVA 1H6EA 3UPRA 4OCSL 4EQ2A 4J3OG 2DZEA 4FXGB 4JO8A 4Y4KA 5C8JB 4Q9BA 4NCC1 2EIEA 2WXMA 2AITA 2VMJA 5ISZB 4OGQC 4ZO7A 4F7CA 2AZAA 2ZUYA 3FT2A 4KROB 3KBPA 1FNSL 3P4OB 4D9LH 2VKWA 3VO0A 1KCKA 1J7VR 3P4NB 4JUSA 2HLAB 5CIPA 5IG7B 4BFNA 1RKRA 5L0QC 5HI5D 2ZICA 1MWAB 3QJRB 5C0AE 2H32H 4HCRA 5EBMA 3SOBH 3OB0H 3JUYA 3V4PH 4ZFZB 2ESVA 1QSEB 5BJTA 3ZQ9A 2HFEB 3FMGL 5T1LA 3UYPB 1IUZA 2FWOB 4MBOA 5FW6A 1J0HA 2ZCKH 1WO2A 3FB6A 4XGZB 2X41A 3QFGA 4PG9A 1EQWA 4IMKC 1UTDA 2N7AA 2UXGA 1WG3A 4K9EL 1EAPA 5FFLA 4U1LB 2AZUA 5BNXD 4PRIA 2R56H 2RHEA 1LHZA 3K6SB 4E9TA 4D9RD 3TEWA 3DO7A 5I1HH 4F37F 2CCLA 3FYIB 3IDJA 3EAKA 1GH7A 4LRIC 1SGKA 4PRBB 1SQMA 3R0NA 3WNOA 4A2HA 4WV1C 3RJOA 4DP8X 4Q4IA 4WTXA 4AJVA 2ZP0T 5FV1L 3VWJC 4KTGA 1IIKA 2AJUH 4O00A 1MIML 3QO0A 2UWEF 4A7TA 2XWTA 3TU6A 3WI9A 2P5PA 4GNKB 4UQAA 5ELIA 4Z1PA 2P7TB 4LEOB 5FOBB 2JTYA 1CG9B 2R0ZL 1XMWA 3LRGA 3VB9A 1NAKH 4WZ9A 1HKLL 4UTAH 3QDJA 4WUKL 1F11B 1MCNA 3RNKA 3X12B 2X4SB 3O8XD 3P02A 3UTQB 3Q2LA 5CCHE 3CVHH 2Q20A 1PD6A 3HZVB 43CAB 1ZA3A 3KYKL 2VDPH 5BXFB 1NDTA 3NFSL 1FORH 5HXMA 4U1GB 3NQKA 4TNGA 1M3IA 2Q7YA 3RLSA 1KB5H 4JFQB 4HEPA 2PN5A 1NJ9A 2NTSP 5FO7B 1FNHA 3ZRSA 3WBDA 4LEBA 3KYMB 1LXMA 3MREA 3QJHA 4PFEA 3SKNB 2AHIA 2W91A 4G9FB 3GBEA 3JTSA 4I48B 1R3KA 5EZLB 5TDPB 2P46B 2AQNA 4QXTB 1Q9KB 5C97A 1SQ2N 1UJTA 2XN1A 3TM6A 4J3XA 2JLPA 3TZVD 4NUJB 3PAZA 1T1ZB 4HUXB 4LASH 1NMBL 4OZIB 4L8SC 4GBXA 1NGPL 1AXTL 5EIVA 2OL3B 4FF9A 1I8KA 1MRCH 3TF4A 3BT2L 4QOKE 4RA0C 1XH1A 2MHAB 3E9TA 2FYYB 4BH8A 2LAAA 4ZYKA 3RKDD 1ET7A 1ITCA 2E9IA 3T04D 4H8WH 3PGCB 1IFRA 3B34A 4L3ED 4A63A 2AJVL 1D2OA 1KDJA 3O6FC 2XV6B 3S36H 4MWFB 2HG0A 1QBMH 2AC0A 2DQUH 1IMHC 3MLSL 3RB7A 3WIIH 4Q6KA 4S0HA 4XP4H 3P2BA 3PJNA 3MNDA 3SYAA 4KH2A 3PL6A 3MOQA 1J87A 3S3SA 5L88L 1CT8A 2QTVA 3CUPB 4V1DE 4PMFA 5AZEH 3V4VA 3EJUA 1ZJAA 3SDAD 4ELKA 3C60A 4UQBA 4DN4H 5C70A 3MCG1 4LVOB 4YSEA 3HG1D 1LNUA 3MA9L 3PCYA 4XCNB 3AXLA 4ZZFA 2HT3C 4FULA 4YSAA 3OR7A 4W9HC 2Y06L 3ZTJG 1UQSB 4ANKA 4XN8A 5F7MC 4AQEA 5JOFA 5DSCA 3WFCL 3VSUA 4U6TA 1LVEA 4NNXB 5C0CB 5JLZA 1HXYA 1WBYB 2A1WH 1DR9A 2VLKB 3PREA 2COVD 2XZZA 4FFVC 4JREB 4M8VA 5DJCA 1FP5A 4XPBH 3VRLE 1VACB 3ZHNA 1DVTA 5DZAA 2H0JA 1I9IL 3ZE0B 3HG4A 3O2VL 4LLAA 5T1MB 4IBQA 4U2YA 5I1EL 5K1VA 4DCQA 4MA3A 4LL1A 1GGCL 1GY1A 1OT4A 3KLLA 4K3EH 4Z7VF 3AY2A 2DMBA 4NCDA 5IV2A 2DS4A 1WBXB 5DJ2B 4MJ6A 2DQJH 4TUUA 4N0CC 3U48A 4OSUL 1PU0A 1XD0A 5IK3B 5ADOL 2DYRB 2FD6H 4OIIH 3UMTA 1F1GA 1TCRA 4PJAF 4QRSA 1AQKL 1JPGB 3RUGE 4RSVA 4FXGC 2EXYC 3ILPA 5E9DE 1YNKL 1QSZA 4RZCA 4OCWH 4DIXA 5T5FL 3CZSA 4FRWA 4G7VH 1OY3B 4KROC 3HNVH 1ECZA 5LQBH 1DL7L 5GGTA 3MRGA 1DQQA 4JR9L 3ZHFA 1N26A 4Y2DD 4WF7A 3NIFF 3GEFA 3OJVC 3GTNA 2OXGA 5G2NA 2Q5BA 2WLIB 4AEHH 2WJ7A 4D0CA 2V2TB 5CAYB 4IMLA 2F6AA 2A6IB 2IWKA 3FUFA 1IGJB 3GI8H 3O0RL 1DE4B 5GSVB 5HI3D 5ID0B 1U3YA 5GZNA 2L4OA 1XH0A 3S88L 5EOTB 2D9QB 3UADA 5HGGS 5TK2A 2J1WA 4JKLA 5C0JA 4JJOA 4OD3L 4PV8A 1BCIA 4AKQA 4XMKH 3AGVA 4Z7VB 4PRPD 2BSRA 3VW3H 1N70A 3QC6X 3UACA 3G6AB 2NW3A 1ZLEA 1FJ1A 1HSBB 2IH3B 3I9IA 3TYGH 3HKFA 3DK2A 4K7PX 4N0YL 1AIZA 4OM1H 5E5LA 5HYJB 3VG9B 4RISL 4BK5C 3IF1B 1IKFL 1PZAA 3HEIB 2KC0A 4FMKA 1IC5L 4AUYA 4APQD 3OXRA 1W0VA 1R4XA 2NY3D 5TQ2H 4BK8A 1YUKB 3OBAA 2E8ZA 2KKQA 1WC7A 3PXLA 1H6TA 2XZCH 2XDHA 2X0WA 3F7RA 2Q8BL 3EYVB 2VDMB 1OSZA 5I15L 4BQCA 2Z93A 1PPIA 2CK2A 4U1GC 4KK5D 1DTUA 4JQIH 5FA3B 5DDHA 1JD7A 1MRFH 3WTYA 5AOKA 2ZCHL 2VLRD 4AQOA 2HG5B 5F96H 3MRIA 3OSKA 2UZYB 3V6ZA 4L29B 4N8CH 3F12A 3FTYA 3O41B 4Z7WA 1WZ1L 1OAQH 2OMYA 5IWLA 5E8EB 4UM9B 3N40P 3MLTA 1M1SA 3Q5TA 1EDYA 4XPTH 3ZL4H 5JXAL 2XWZA 3AITA 4JO5A 3CPLB 5F1IB 2SODB 2FATL 4X7DC 3QAZB 3VACA 2AK4B 1SEQL 5I8EA 3S5LA 2H9GB 4QGYA 4FFZA 5GRZA 3U0WL 4G8FA 4H26A 1OGAE 3TIEB 1DCEA 2V9TA 1FL3A 3V5HB 3GXUB 4HCRL 5EPMB 3WTTA 3BPCA 4Z3GA 1G1OA 2WKLA 4Y5YB 3DETD 3RWJA 4LLMB 2O72A 1XAUA 1FLRH 2OTWA 1J0JA 2QEJA 4PJCA 2YLKA 4M7JH 4GUPA 3VFTA 1R0AH 4W9FC 3NJVA 3KYNA 1OPOA 3QIBB 2COQA 2VO5A 1XL6A 3HJEA 2X4QB 5DRNA 4N24A 4Z7QF 5F1KC 5CJQL 4F7MA 3HPLA 4YXKH 4BCZA 1EFQA 2GIYA 1PEWA 3MTRA 3IGLA 1CIUA 2L3BA 4LVOC 3QJZA 5ACLA 3P69A 3D2UD 3B6SB 2F61A 4PJIF 3VWKA 4B7IA 2IH9A 4JG1H 1I4FB 2QHLA 1UA3A 2BX5A 5FHAL 1I7ZB 4XVUD 3S8GB 2YSSA 3QZPA 5HHMB 1QPXA 3JWOC 2Y24A 4H20L 4HK3J 4WNSA 5C0BD 3CN0A 3DO4A 4E9LA 4JREC 3H9SE 1UT1A 3TNNA 4XWGH 1L6PA 1FCGA 1EO8L 2GJPA 4K23L 5KAQG 5F8QC 2A99A 4Z95L 3DKHA 4PCSA 4NHCL 5HYSG 2R9HC 2GT9B 1TZHB 1YEWA 1PFOA 2B9AA 5CJ5A 3IAGC 1CUOA 4FQ2L 3V0HA 1G43A 1MFUA 2DQFA 4GAYB 1PLGH 2QADD 2N3JA 1KTLA 4U4IA 1LEGA 2EE3A 5CEZD 3MV9A 1YYLL 1FL6B 4RFNB 2ZUSA 2J1YA 1QUNA 2K9UA 5MP6L 4UWQB 3DX6A 2Z31D 5EC2B 3TFBA 4PV1C 3FO0L 1JGEA 1A65A 2QJDA 5E94B 1F97A 4Y16A 1R3LA 2HT4D 4OCMC 2JJUA 3WS6C 1IQWL 2APFA 2ZE0A 5CINH 1NCDL 3TPUA 3MNWB 4ATTA 4BZ1L 4DK6A 4XAWH 5E1AA 2WO2B 3T2OA 4JO2H 2OKMA 2A4ZA 1UURA 1GGIH 3VSQA 1A6PA 5L2JA 1GZPA 1ZT1A 3N1PC 4WTZG 2W0KA 2VDLH 2WUCL 2XWCA 4QHLB 4HG4J 5FCUL 4OF8A 5A40E 5PCYA 4MNQD 3IFPB 5G5DB 4DT2A 2FO1A 2R0KL 2VT0A 2WIIB 1JJUA 1HNFA 3RPIA 4LLYB 1KIQA 1U58A 1A1NB 3IKCA 2LQRA 3V4VL 4AG4L 1F4XL 5IVXB 1MNUL 4Y5VA 2XG5A 3DHMA 3I2CL 3ESOA 4XB3A 5DJYA 2ID5A 1FG2B 1K8IA 3N40F 4UQDA 4YSOA 5FF6A 4UOJA 3L5WB 4ECNA 3MLXH 4UQCA 4YDVA 2X4OB 3VG9C 5LBGA 1BAGA 3T2LA 1L9QA 3HA0A 5EOCJ 1NCAL 3HUJF 1A0QL 4FQIL 1M1XA 3G6JA 1CE1H 2EDJA 3S8WA 3VFNA 4KU1A 1KUMA 3T3PE 2OSXA 2MCG1 1BAFH 1JZIA 4X7TB 1R33A 1UM5L 4WWKB 4XBGA 1LEIA 1HU8A 2A77L 4QRUA 4R7DA 1K5NB 3ES6A 4ZD3L 4LHUD 1MLBB 2X05A 3W57A 2ZWZA 1N5YH 3UGUA 3WIHA 5KVMC 2YGVA 4AL8H 3E6HA 5DEGB 1T7VA 1DJIA 3UDWC 4HS6A 4EE2A 2C5DC 3VD9A 3ZYJA 5D6CB 4NQED 5KUMA 5DJ6B 4BJLA 3CMGA 3PS6A 2CLVB 1ND0A 3KS0J 3IYLW 4LOUD 2YUVA 4OJDH 4AKPA 3L2LA 4CGUB 4DP2X 1BWMA 1E27A 2W0LA 4B5EA 2V3EA 4RNRB 1OD7A 2IADB 3VXOB 4IKKA 4QTHB 2VXTH 1G9ML 3KDPB 1BIIB 2IC2A 4POYA 3UP1A 3QXDA 2NYYC 1HDMB 1KBVA 4E9RA 3CLEH 3MHZA 2Q1EA 5KVEH 3QAZC 3ZDWA 2R4SH 3OHMB 5LNGA 2DI8A 2EDBA 3K72B 2VZOA 4JKPH 3NRQA 5MEOA 1WQVT 3BKYL 3CFNA 5I18H 3WJLA 4Y5YC 4WEMB 2PO6D 1Q1PA 1BFVH 4R96B 3QDMD 5SWZE 1LWRA 3PWVA 3FUKA 5AW7B 4CU6A 2AANA 2I85A 4NLHA 4X6EB 2F08A 3WJMB 3CSPA 2W8CA 5LLIC 2JB5H 4QLRA 1SBSH 3GMQB 3MO1A 1AE6L 4OZHA 1WEJH 4KNQA 5F3HB 3VI3F 2X9WA 4I85A 5IHUL 3QIBC 4ZPVA 4N2DA 4U1IA 4XHJC 2XQ0A 4N2OA 2BNUA 2BNQB 4PIBA 4TRPL 2D0HA 3S37X 3V4UL 1U2HA 3LKPA 3QEHA 4MD0A 2OCFD 1H3GA 4L1DA 1UWGL 3BEWB 2LLNA 1MG2C 2F8OA 3P3SA 5F89A 1A6VH 2PYED 4P4KB 5AG9A 2B9BA 2ZUWA 4WSKA 5E2VL 1TZGL 5MENA 2NY4D 1L9MA 4M48L 4X6CE 5IJVB 4JEGB 4Z3FA 2JJTA 3EO1B 4R4NC 1AGEB 1N67A 3LZFH 5JORB 2GJ6B 5GJTL 5ALBL 1CF8L 4X0NA 2OR7A 2PTVA 4MLIA 1GHFH 2EKSB 4UQ2A 3QPXL 2GITB 3HR5A 5DHXB 2WSDA 2R2BB 3PJSB 4G9DA 4XNXH 4NQCB 3ZKNC 4MAYA 2M2DA 3AC0A 3ARRA 3KE0A 4UDTB 1AD9A 1IO4C 2VJ0A 1CZ8L 1BDYA 1VGEH 5IB5B 2NY7H 4O02H 2EQDA 1GOHA 3OG4B 1U6AH 5I2IB 2MCAA 4OCXL 2F1EA 4TOYH 2YWZA 5KVDE 3VFRA 2D2CC 2ZKMX 4PB0L 1QFUL 4LGPB 1ID2A 2WOBA 1GRWA 3L16A 4G6AC 3X1FA 2NXZB 4PJ5E 2FBJL 3F5WB 1FNGA 4FFTA 1NCNA 1YNTF 4GW4B 4LSQH 4QO1B 1H5BB 3HLAA 1NCBL 4RFNC 5BRZD 4F3FA 1E67A 2WINA 4KFMA 3RWIA 1E50A 3FU6A 2VDQL 5T3ZE 4P23B 3L1GA 1LLAA 2BSBA 2X6MA 4ZUUB 2I32A 3EF4A 1E5BA 1PIGA 2ZT9C 1J8KA 1SEBB 3D3VB 2AXWA 3VXSA 1KGUA 5HHNA 4ODUA 3UZQA 1D9KA 4FC3E 5DJ8B 2QTEA 1A7BA 2CO3A 5F7DA 1ML0A 4P2AA 1QOKA 1SHSA 3QG6A 1S3RA 5A3IC 4WI6A 5DUBA 4S1RH 2HLEB 2MOVA 2ATPA 5HPMA 4XMUA 3MLUH 4JJ5B 2BMKB 4FHKA 2JCCF 2NNAB 1OAZH 3H2WA 4Q14A 2RCSL 3P9MB 2IFFH 3ARZA 2WCGA 5HJGA 4XP6H 3SGDI 2DTMH 1QVOA 4W9DC 3VXMD 1DCLA 1XBDA 3EXJA 3AMKA 4ANUA 2BVEA 3U46A 1TTRA 1X5MA 2PXYD 2Z92B 5AKRA 4RMBA 5J1AB 4X9YA 2YFOA 1AACA 2NZ1A 2HTLC 4I89A 4PJ9B 5DQDL 3X14B 4X98A 4ODVH 1MDTA 3BWUF 2Y9RT 3QIUD 4NI3A 2L0DA 2AGJL 4G8GA 3PYCA 3DGDA 2XRAL 3QULB 4R4FH 4EXKA 3JV4B 1I1AA 4Z7OB 3FUJA 5L4JA 3PHQB 4L4VE 5FECA 4E0RA 3VFWB 3W5NA 4J8RB 1QO3A 4IGBA 2XA8L 4JPSA 3CXDH 1EX0A 5KSUA 2X53A 4RGMB 3RHWF 4JHWL 4RMTA 1NCWH 2JKLA 5EO1B 5HHOA 1ZTXE 1PZCA 2P80D 5HDOA 5E2TL 4I8DA 4HIXL 3V0AC 1R34A 2X09A 1T2JA 3EOBB 5DS2A 1PZ2A 1BAWA 3IJHB 4J4PD 5AD0A 5ITBL 2FX7H 3V6OA 1SJMA 2F54E 4BQ9A 1OARH 3FQWB 2OW7A 3AZUA 3ZTCC 1JF5A 4RH4A 4PJ8D 1T4WA 3L3GB 5LHDA 1IFHH 2IQAB 3COOA 2X2IA 3EH4B 3FQTB 4GP8B 1T6WA 4KDWA 5D1QB 2OULB 4AY0A 1D6VL 3LKQA 4N6QA 4NOFA 3ABKB 1JDCA 2DLHA 3KLKA 1WISA 4NENA 1N9PA 3N44F 4MD5A 3ZDYF 1KJ2A 5C08B 2F5AH 4KK6C 5DHYA 2Z65C 2BP8B 3DV6A 4K94L 3KPOA 4BQ6A 4DF9A 4ZS6D 3K6IA 5DS8B 1WCBB 1NINA 2CNZA 4KNUA 5C0AA 4DEUA 4YAQB 3WO4B 2P5WB 2ZF8A 1E4KA 3R0MA 2C8NA 1R3JA 3BQUB 4PMEA 1NCHA 3HC0A 4Q6IA 2D31B 2NPLX 1NCGA 1CFTA 3QZWB 5C3IA 1ES0A 5DUML 4RAUB 1QWNA 3QXAB 1PLCA 1ZPLA 1E4WL 4A67A 4NPYA 3O9WA 2YRLA 4BZYA 1L9OA 5LB1A 5AENA 4DGWC 3KLQA 2GTWA 1GGYA 5HD8C 3S3CB 4P4KC 3TV3H 3OAYH 1L9TA 5J6GA 1R5VA 4UT7H 5DZPA 5EZPA 1JVLA 3NABL 4NAQA 4N2KA 4FG6D 4L1LA 2G75A 2O1AA 4U6VH 2AEIT 5FWRA 3N44B 2WANA 4D9RE 2BRRH 3W56A 4U6XA 1HK6A 3QUYD 1JOIA 1L5GA 3HRZB 3KL0A 1V3KA 1FZOB 3DC0A 4WO0A 3MJ7A 4U3HA 3MOBH 3LY6A 4HYTB 2DQCL 4HVBA 3VUAA 1J1OH 1HHJB 5HY9A 2YR3A 4KITB 2P26A 4JY4B 3G5WA 3MLVH 4NPKA 4OIFA 3BH9B 3EO9H 3RIKA 3SDXE 3FO2B 3ZDXF 1MCRA 4RAVB 4HLZH 2NXZC 1FZMB 2CO7A 1RK1B 4FQQA 1A2YB 3FRPG 4NPJA 4ZX6A 1IB5A 1Z3RA 1H5BC 2MNJB 2DM7A 3L3HB 1HZLA 5LXGL 4HWEH 1CICB 1G1KA 3AU1A 4UB0L 3K80A 4P23C 1DQDL 3ARYA 2JI3A 4B60A 4BH7A 3QJTB 3N85L 2HVBA 1WV7T 5C0FA 4MGXA 3NAAL 4JO3L 3HNSH 4PTTB 5AW2B 3UZEA 3LV3A 4NGHH 1P4IH 4JG5A 2LGNA 4LSUH 4QOKA 5FHBH 3IFLH 4M03A 4PJ7B 4IOSA 1GAFH 2KI6A 4F93B 1AGDB 3ARWA 4P2RD 3F58L 5EU5B 4LPVA 5IF0A 2FX9H 4CNIB 4HSQA 1JK8A 1NDGB 4ELDA 1YECH 3OR6A 5JR1L 1RI8A 4M1DL 2AJSL 4RETB 1JZHA 2UVEA 2KQNA 5KN5A 4OT1H 4PGBA 5LGHL 1I8LA 3DRQB 3BJLA 1FL5A 4IHBA 4WI2A 4EDXA 4AGNA 1RSFA 4G8IA 2NSMA 5D1ZD 3SIKA 1IM3D 2Q0ZX 2WTRB 5H37G 5ADPL 1ZHKA 3DSNB 4PJ9C 5E6ID 4V1DA 2BIOA 3EO0B 4L3EE 3HFFA 3NZUA 3ATDA 1W72B 2LOEA 2ADFL 1OP5K 2O5ZL 4M1GH 2ED9A 1T20A 4K3GA 5D6DC 1C08B 3CFIC 2XZQH 2NY2D 1IBBA 3WLBB 2E7LC 3D4GA 3WEXA 1P7BA 3C75A 3HAEG 4JN2B 2FGWL 4W6WB 4HXBL 4NUPA 4O4YL 1KN2L 3EZ8A 1M3JA 3Q1EA 1A4AA 3LKOB 4NUMA 4RGMC 2ROYA 4YLQT 1UCTA 1LK3L 12E8L 2IH8A 1EHNA 2G3MA 4G6FB 4P59H 3GZPA 3HG1E 3WIAA 4OIAA 4UIMA 3SODB 3T71A 5K93A 3TV8A 2XJLA 4MCYB 1VLXA 3SKJH 3L3KA 4O2FA 3CSYB 3QO1A 5I23A 5MHSD 3KLAA 5DJAA 3ZU8A 5I16B 4BKLA 1UWYA 3FTSA 1MEXH 2CBMA 5IFJB 1HZKA 4P57B 5D1QC 3RUGA 5C0ND 5E9DA 2DBLL 2X42A 3FFDA 1MFEH 2DQHL 1OP3K 1W0WB 3U4AA 5KEZA 2XKSA 4L8DA 1RZ8B 1I3RB 3QXWA 3FK3A 4U1MB 3MV8B 3QEQD 1RIHH 3U2IA 4CA4A 1X7QB 2E9WA 4JRXD 2FT7A 4N3UA 3RBGA 3U0TB 1NGXB 4B96A 3IS0X 4F8PA 2VMCA 4Z7IA 1P6FA 4PJGF 3UTSD 3MNVB 3T8XA 3WDJA 1FFOB 4P8QA 4OFKA 3WO4C 4GG6E 3K4DA 2CG9X 4Q56A 1UYWL 3B2VL 1R5IA 1Q1JL 2VR5A 1PG7L 3BQUC 3MCKA 1JTPA 3RWHA 3TBTB 4YHML 5DD5L 4EI6A 3NP4A 1GZQB 1FGVL 1A3QA 2W60A 1U3HD 4N86A 2P8PA 2V7HB 2W9DL 4OLZL 1VZGA 3HI1A 5FB8A 4PWKA 2E27H 3NFPA 3GGWB 5IMLA 1AXSB 1XMEB 3KPQA 2AKRA 3WFDH 3FU7B 2YD4A 2V2WA 4ZBJA 4QTIH 1CFQA 4FTVD 4GSDH 1HJBC 2QZ5A 2UXVA 3QB7C 3D33A 2C3VA 2X6AA 3ALWA 3RGVA 5LG6A 1XR9B 3RVWD 5HHQA 4L18A 4DAGL 3WAJA 1DBMH 4IBZA 4B41A 3X3GH 1ECYA 3FOMA 3V9FA 3B43A 5HYQB 2X3BA 2GCYB 1E2WA 2XYBA 2E47A 4IW4C 1QEWB 3LCYA 1X4ZA 3TFKD 3HRZC 1UD8A 5T1KA 3WN5A 2IAMD 4YDKL 5HHVL 4FNPA 3VYPA 4JVPA 3VB8A 1YY8B 5I0VA 5JDSB 3U2JA 4QXGH 5GGSB 5CP3H 4CU7A 1XIWD 1OAYH 3ERXA 4JFOA 2WLJA 3H3PH 4P5KA 2ZP8A 3FQNB 3HMWL 3GMMA 3LX9A 2JNZA 2M8XA 5HYSA 3PU7A 1VFBA 1NBVH 2QFPA 4DGYL 4AIEA 1CICC 2QVFB 3ARVA 1BEYH 3POHA 1KYOJ 4P3CL 4B5ZA 5KJRH 4OQTA 4GXUM 4HIHB 3ZN6A 1MJ7H 1U9KA 3VXNA 3BGFB 3T0EE 4GRLA 5IHZA 3C6SB 2VLRE 4X83A 6CGTA 1BVNT 2HRHA 5IUSA 2IPTH 1NKRA 4MRCA 2PP9A 1OGAA 1RULL 1HT6A 2Q8AL 3FQXA 1BLNA 4OF5A 4ENEC 2F19L 1S7VA 1DSWA 2CUMA 1E9QA 3BZEB 2ICCA 1IBGL 5FEBA 4X5WA 4TTDD 1WICA 2KL6A 3M86A 3IMWA 3PWNA 4ZOAA 4AIZB 3TNMB 4LMQI 4L5FE 4GW5B 1H3WM 7PAZA 2J72A 5L2KD 4B9YA 5AB2A 4YX2L 2OYKA 5B39B 4ZAKA 3JXAA 4KNTA 3E8UH 4L4JA 4WTZA 3TPKA 3RVVC 3HCVB 4E41D 3UPRB 5DD1H 3RE0A 5TF0A 5EUOF 1PCXA 4Y4KB 1JRHH 2XN2A 5BVPL 3PP4H 1J88A 5D8JH 3CDGB 4QXVA 3JWNC 1JGVH 3WENA 5ICYA 3L4UA 4F7CB 4Q0XH 2VXUL 3FT2B 3W9DA 4BDVA 5L6YH 4EIBA 3VDCA 4OFDA 1QR1A 5CIPB 3CBRA 3GKZA 4HJJH 5E6SB 4UIKL 3QORA 2YMTA 5J6HA 1A5FL 3O6KL 4AUUA 1G6RH 5C07B 2A9AA 2GYSA 3AWFA 1XCTA 1LP9E 5TF1L 5EBMB 1OSPL 4HJUA 4YDLB 3H9SA 3GSNA 2ZYIA 5DLLA 4UOW0 2ESVB 1UOVA 4M29A 3UH8A 1XB3A 3KDMA 3O4OB 3QDHA 3BAYA 2CLRB 5T1LB 5JMRA 1WDAA 3F7YA 1T0MA 3FB6B 4B9FA 4PG9B 5E00A 5K9QI 3MJ9H 4M61A 4IU3A 3GEWB 4D0BA 2Q87A 3ZR5A 1EAPB 4NZJA 5EOQH 3VXUD 3EOAA 1IQDB 4PRIB 4CKVX 4G1EA 4K07A 5C0BE 3DO7B 3AG4B 4ABQA 2V2XA 3IDJB 3NTCL 3TS8A 4XVTH 4GXVH 3IDXH 4WEBL 4U7SA 1HEHC 3RVUD 1TSHA 1DANU 2VC2H 4MMXA 4MAUL 5ACMA 4R8WH 1QPKA 2XFXA 3QO0B 2EYRB 4WTWA 1OAXL 1T83C 2HUEA 2Z8RA 3GJEA 1TOXA 2QQNH 3HE6B 5L8JB 1IFGA 2BOBA 2ZKHH 3QZNA 4FZEL 4L23A 5HDBE 9CGTA 1KENH 4EUPG 4BGLA 3DDGA 2RBLA 3TCLA 1D7BA 5CEZE 5EC1A 1VADA 3S96B 2AJXL 4I4WB 4TYUA 2WWOA 1MCDA 3AG3B 5B3NA 1DQLH 3UJIL 5FO8A 2VSDA 2YPVL 1ZA3B 2OX5A 3DA0A 5TE6H 1HAWA 1Q0XL 4XO3A 2Q7YB 2ZOTA 1KULA 1IZJA 1P7KA 1SLWA 2Z91A 1UOLA 3I3DA 3FL7A 1V3LA 1NJ9B 4ODTH 5DR5L 4F9LA 4QRPD 5EEXA 3QJHB 2ZSWA 5C6TL 1U91A 3ATBA 3MV7D 2MTAA 4HWNA 5B1CA 3SKMA 3FZUC 5FYKU 1IAIL 1R3KB 4OLYH 3BAEH 2I60L 3GMNA 1GIGL 4JRYD 4HCIA 3DXAD 3HG0A 3NMEA 1DZBA 3QPKA 5HDRA 3DBSA 2FB4H 5DK0A 4C59B 1F3JA 4P4RB 4GBXB 4K5MA 1TQBB 1QTSA 1I8KB 4MNQE 5CS7A 4HD9A 2DLIA 4HAFA 2HKHH 1T66D 5E4EB 4HUKB 5FYLL 5B3JF 2APSA 3WV0A 4BH8B 3C5ZA 4PVLA 4ZYKB 4L3FA 1MNNA 4XCFL 5C7XH 3CN1A 1SN0A 3I6SA 1EUTA 2UY6A 4EN3D 5I6OA 4JDTL 1EVTC 3ESMA 3DBXB 3C9NA 3BUIA 3K5RA 3HZKA 3MX0A 1GPOL 5TE7L 2O5XH 2DQ6A 1BWWA 2PPCA 4YWGL 1S7WA 2NZIA 1I9JL 4JO1L 3VGAB 3VFPA 3FN3A 3P3UA 1CT8B 2GY5A 3V4VB 4KDTA 4ELKB 2R83A 3C60B 4PCKA 2UUDH 2ZG2A 4POZC 2IDCA 4ZNEE 1OGSA 4JL1A 4P2QD 3SE8L 1XFPA 3H9ZA 3OKDA 1LNUB 3BKCH 3ZQXA 2CHXA 2H2PC 4JFDD 5FYJH 1GSKA 3OR7B 4HF5L 4NKIH 1I85C 5DFWH 4AQEB 4YXLL 5JOFB 3BGFC 4U1NA 5DSCB 3AREA 4DESA 5JLZB 1HXYB 4NQEE 1ZA6A 4A68A 4U3CA 1GYAA 1QFPA 2VQ1A 4W93A 1TT6A 5DJCB 4UYQA 1WAAF 1TJIL 2ZXGA 4PU2A 2AS5M 1TKWA 1B6DA 1EJOH 4NQSB 1U4EA 1ORQA 1R17A 2PUQT 2HZHA 5SWZA 1A1MA 3F05A 4QRFA 4GKZA 1NMCB 1O7DE 4GQ9H 4DCQB 4MA3B 3KPLA 3QVAA 4CC1A 1OE2A 3IDIB 3U7WL 3UIZA 5IV2B 1MHEA 2EDWA 2YC1A 5KVGE 4MJ6B 2VDOB 1EZVX 4HX1B 4YIQB 4J1UA 5LNDA 1NSNH 4OVUA 3S4SB 4BYHA 3L3JA 1I31A 2QQKH 1MFAH 1TCRB 2YK1H 4QRSB 1QD0A 3VQ2C 4TPRL 3ILPB 4Y4KC 3RWEA 4HMDA 4RZCB 4X4YA 3QDME 3IMSA 4K55A 2VZTA 3CBJB 2HN7A 1JGLL 2K7PA 5ECGA 4ZO8A 3WFBH 4CN4A 5J57B 1RVFL 3MRGB 3OXSA 2JQMA 1DQQB 4IOIA 4X6CA 3AB0B 4K9JA 4EI5D 3Q6GH 4WI7A 1M4KA 2UXFA 4QNPF 5CUSL 3SHSA 4UQ9A 3LJ3A 3TCTA 1U8PB 2R69A 4LQFH 1BBDL 4MS8C 2VJXA 1I7TB 4W9EC 4YDLC 3VTAA 1OK8A 4D0CB 3ARDA 2NDGA 3D30A 5K9JL 5IGXH 3O4OC 3HW7A 4IMLB 4HH8A 2XPGA 4Z5RB 1VKXB 2PYEE 2DH2A 4P5SA 4KI5C 4ONFH 2ZUTA 5T1DH 5BZDA 2BS8A 5I1CH 4LHUG 2BSTB 2XWEA 4LPUA 1XXFC 1T6VN 4X5PA 1LE9A 3ZY7A 2CM5A 1JP5A 3I6LE 3JQOB 1WD9A 4PJ5A 5HI4C 5C0JB 1BZOA 4WW1A 4PV8B 5CWSA 3HVNA 3WFHA 1KPVA 1SJHA 2BOCA 1JWSA 2APBA 4PY8I 1NL0L 2NW3B 4OZ4A 1FJ1B 2X1OA 1S4IA 4JZNB 3EH1A 5J3HD 4ACPA 3TBWA 2EC9U 4KRPB 4ILDA 3SZ6A 1G9EA 3HE6C 3IMRA 1OWRM 1VB9A 5GGTH 3UAEA 1W0VB 3KVDD 1JGUH 4U6YA 2P9RA 4HU8A 1CFBA 3OVUB 2WHVA 1HNYA 3CMOL 1WGOA 4LO9A 4IBTA 1JN6A 1WC7B 1E6JL 2JVUA 3VRIA 5KYUB 5BRZE 1YEEL 4P04A 5B1JA 1AO7D 2J6EL 2WBJA 4LARH 5C09E 2XU9A 2Z93B 1ZVSA 1BQUA 2K70A 4W9GC 3T4AA 2QZQA 3KD4A 2Y36H 1KGXA 5D7SL 5DDHB 1KTKE 1A7PH 4NQDD 1RFDH 1DJYA 3SD5A 1C5CL 1T22A 1O7SA 1AIFB 2BHZA 2FH6A 3I50H 3MRIB 3V6ZB 2KMWA 4JY6B 4WENB 3F12B 5KSAD 4WJG3 4P2OD 4Z7WB 2NQ3A 2YPKA 3A0OA 2OJEA 5KTEH 1SXSA 4DVRL 2DWEA 1GZHA 4GQQA 1XTMA 4L4VA 4W9JC 4XP5H 1MSPA 3QFJB 4GBXC 1EEZA 1TQBC 4A6YL 1TTUA 1N19A 1MW1A 3VXME 3AS3A 5DZLA 4HOMA 4AYGA 1RIVL 1JNLH 4AYEC 2V37A 5I8EB 3S5LB 5E4EC 4G8FB 1LO3L 4H26B 5G4NA 5AWNH 4F7EA 1FL3B 2B4CC 2Z9TA 3BPCB 1IVTA 3QUZD 5AG8A 1BJ8A 4HC1A 3RWJB 3U4EA 4ZMYA 5GHWH 2OR9H 3I6GA 4E5XA 1B2YA 2C4XA 4WI5A 2OTWB 4CW1B 5CBAB 4PJCB 1T5WB 4OLVL 5FOJA 2DIJA 1JMXA 3AXHA 4GUPB 2BZ7A 5C92A 1J12A 4XHQA 1NPJA 3VFTB 3FRUB 4ALAH 3ULUC 3KYNB 2F54A 1SDYA 1T1YA 2G2NA 2ARWA 5JA9A 5DRNB 1X6NA 4NKOA 3HS8A 2VZ3A 4AITA 2NXYD 4JE0A 3HPLB 5GRXG 3C60C 4FCAA 1OO2A 2A0LD 1GGTA 3A6CH 5CN1A 3L81A 4HD5A 3NFNB 2VDKL 2YBGA 2VNCA 1F58H 3VWKB 1WWBX 4JY5L 5JXEA 4WJKB 2PCPA 3ARFA 3FRPA 3D1MC 5ALCH 1WWCA 2VDNH 2C9PA 2YSSB 4F33A 3W0WD 3O3DB 4EDWH 3B9KD 2NSQA 1NAML 4JLRA 1HCZA 3RWCB 3UTTB 4A2EA 1A8ZA 4OD1H 4KAQH 3TNNB 3JWDH 5H8DA 2WM0A 4GKLA 4ODSH 1T03L 4CVXA 2QPUA 3HB3B 5I1JH 1NMCC 4GP5B 2DLEA 3LPOA 1YJDL 3DECA 3SGJC 1NLDH 3O0LA 3Q44A 3ATAA 4Y2OA 2ADJB 2DQFB 4WCYH 3GK8L 4M5ZH 4C47A 2ZNXA 1KTLB 1LEGB 3CK0L 3MV9B 3RZWA 3ZTNL 1BW8A 4HZAA 4WI4A 4N1CA 3DX6B 1BZQK 2ZXWB 3GZKA 4FE9A 1C8QA 3FT3A 1JGEB 6PCYA 2EYSB 1I9RH 1KEGH 1FG9C 1NLBL 1S5HA 3QISA 4HBCL 3NIGE 3PG2A 5DD6A 5H37A 3SE9H 3PAVA 3AB0C 1NEUA 2ZWKA 5E6ZA 2XETA 2APXA 3TPUB 3GUTB 1VHPA 3EJSA 1YPZB 2GTZA 1A14L 3ILEA 5L2JB 5KUKA 1ZT1B 8PAZA 4HMEA 2R4RL 3HAEA 2C1PA 4HQQH 5F9OH 3RGHA 1F6AA 3VI4A 4ICWA 4QPEA 4UM8A 3UEQA 4JGNA 4PRDA 2ZYHA 2DQGH 4ZO9A 3QQDA 4YSQA 1CLCA 3SDXA 1S7TA 3WY1A 4FLHA 3IM1A 1KIQB 1U58B 2AI0H 3CSBA 2E75C 3FTUA 3G6DH 1WRFA 3IKCB 3MQIA 5TPWH 3ZZQA 3RFZA 1ZGLA 4Y5VB 3IJ9A 3O8XA 3L3IA 4JZJA 4YR6B 3SCMB 2RQEA 4MXVF 5BV7L 5T33L 3HZYA 1FYTE 3P3TA 5DU7A 3UJJH 4GQZA 1HFUA 4YDVB 4WK0B 4ZMQA 1TDQA 4P5RA 3S5YA 1M1XB 3G6JB 2O26U 4JB9L 4RWYH 3BD3A 3VFNB 5GXBB 4UF7C 2YUXA 5E8PA 1E4XL 3UBXI 1D5MA 1KOAA 5GISH 4OZHF 1JZ6A 1BD2D 4XBGB 1LEIB 4W9ZA 3CAFA 4M3HA 4QRUB 3KJ6L 4KXDA 3TZVA 4UNTA 3E6HB 1CURA 2WJ5A 4M4RA 4G7QB 4M6NH 1IGIH 4HS6B 4QHKI 4UTBA 1B3IA 2VISA 5FS5A 5IJBC 5I66A 3RWDA 4LEXL 4PJBE 1MCCA 1XV8A 3BDXA 3A3YB 4ICXA 5KW9L 3PV7A 4TVPL 2F5BH 4MXWH 3U1QA 2B1AH 1ND0B 1NGYA 4FEIA 4PLJD 4Q7DA 4RQQA 3S35H 3DX1A 1IAII 4ZUTA 4P2RE 2NCMA 4UZSA 5EEWA 4L3EA 1E27B 2OK0H 3WY3A 1KZYA 3LRSA 1G9NC 2GUYA 3H42H 1RQ5A 4N87A 4EVNB 4TLKA 5IQ7H 1BGXL 4DFIA 1NCCL 4PJDB 4K7PL 1G1YA 1ZS8B 3QXDB 3WXWL 2MPVA 3KPRD 5E7BA 3RAJL 1OTSC 2FJSA 3NJLA 5GGRA 1D5IL 1XXDC 4IRZH 5MEOB 2AQQA 1IJ9A 2X3AA 3SDAA 3LVEA 4MQTB 4DZBA 3MBED 2IAND 2MIZA 3L9BA 1AGCA 5JZ7C 3IDMA 4TQPA 2Y07H 2X4PA 3PWVB 4U05A 4DHLA 3BUPA 1YQ2A 5T8IA 3HG1A 5LDUA 3MO1B 1JYXA 4WHTA 3E9UA 5EZOH 4XN4A 4G6KH 4G5ZL 1FV1A 4HFUL 3GIZL 4RMUA 4XPFL 3WLWD 4CDHA 1JZ7A 2UWEE 2J8UE 3FF8A 3O11B 2HLFD 3RNQA 4U1IB 5JW3L 3G08A 5I8OH 1A3LL 3UZVA 2DL9A 3NCYP 3LKPB 3QEHB 4JMXA 4MD0B 5DMKB 4LCCA 3LH2H 5I6PA 4WI0A 2WV3A 3ZGIA 3RTLA 1A7OH 1RUPL 2WB7A 3IKKA 3QUMA 5KSBE 3OMZA 5T3ZL 4YBQC 3VWKC 5I1IL 2FR4A 5MENB 5I24A 5DJXA 3Q2WA 1ZJBA 3MAWA 5FKAB 3Q13A 1RUAH 4W6XB 1IC7L 4HHAA 1PF3A 5KWYC 4HU2A 4G59C 3MFGB 4XC3L 5D7JB 1U8QA 1JV2A 2ZONA 1CR9L 3BW9A 1IJNA 3GHEL 3L5XL 4QHMB 4UQ2B 3HR5B 5D5MB 5F9WB 3ZE1E 4GG6A 4TQEL 4TULL 3HZ3A 4MAYB 4JUTA 4RDQG 4Y4FD 5GRJH 1AD9B 4XMTA 3IJ7A 1KIUA 3VFGH 3HB3C 2D9CA 3PXHA 1SXBA 3VXRD 1INEL 1N0XL 1UH3A 1C1EL 2CM6A 3QEQE 3VFOA 1JPFA 4JRXE 3VFRB 3BSZA 5E8NA 4Y2DA 3M6DA 5DJ0A 2C9XA 3UTSE 4HV8A 1N10A 3N42F 2D03L 1FNGB 4CILA 3DOSA 4HHGA 4GFXA 4KJPC 3G5YB 1WP6A 2J2ZB 2UZPA 2GY7B 3QUKA 4L1TA 3HLAB 3QR1A 1CN4A 2AEQH 5IVOA 4F3FB 2WINB 3BGAA 2ZJSL 3LQAH 1OIOA 3TEYA 2GKIA 4U3SA 2H41A 3A67H 3FSOA 3B2UD 2XQBL 1DVFD 3KM1A 4JGUA 1T21A 4M62L 1ASQA 1K3ZA 3VXSB 4PS4H 4ZUWB 5HHNB 4ODUB 3UZQB 3ZMRA 1D9KB 4DK3A 3KJ4B 1GS6X 5F7DB 2CR3A 1RZKL 3NH7H 4QXUH 4WHCA 4XOAA 3QG6B 4DPCX 3N6YA 5DUBB 4FQ1L 1DANT 1MY7A 2ATPB 3TBSB 4FTVE 1IC4L 1U2CA 3US9A 5EN2A 1U8HA 5KOVC 4WI9A 1SXCA 1MCPH 4R0LC 2WXOA 1DLFH 2X5PA 5C0EA 3V52L 2EH7L 4K8RL 2MKWA 4K4KA 1QVOB 4X7FC 2EO7A 2RJMA 4YO0B 1KCWA 4LDOB 1VEPA 1JHLH 5BO0D 1GGBH 1LJMA 3U46B 4APQA 2CPCA 2I7SA 2E9JA 2HPOA 1IC1A 3KEDA 2BDNH 1FC2D 1PX8A 4I87A 3MODL 3BEVB 5F3FA 2XWXA 4X98B 1EGJA 3ARQA 1LO2H 4Y5VC 1HL9A 4G8GB 3RIFK 1AS6A 4PM1A 4E0RB 5FECB 3SCMC 3S2AA 3T8VA 5JUEL 5F3BB 4XWOC 2AQRA 2HFFA 3GLDA 1A66A 2WVVA 1QO3B 2NY5H 1VPOL 1QYGH 2OMXB 2E59A 2JFCA 1JZ3A 4YE0A 5KSUB 3L95B 3T0EA 2VLRA 1AQDA 4U1KA 1ZD6A 3H0TB 4HPOL 3L5IA 4NSKA 3PFQA 1CDYA 3NN8A 4YDJA 1SJXA 2WY3B 2XCMC 1NFAA 4GKNA 2I9LA 4M6MH 4ZODA 2A3TA 4PJAE 5FDYA 5HHOB 2GC7C 5ILTH 4JFFD 3SD2A 3GMLA 3KHOA 4EUPA 1I3GH 5FA4B 4L1BA 4URTB 3QXUA 5AD0B 4I3SH 2J4WL 3DSFL 1CB4A 4MASA 1JK9B 4KKAD 2ICES 3JSSA 4KKPA 2XQYG 4HXAL 1T7XA 2E56A 4KVNL 3VJ6A 1UVQB 5HJBA 2JB6A 3LKQB 3ROOA 4Q9CA 3P0VH 5ABAA 1DUZB 2XT1B 1OPGH 3FPYA 4NENB 1HHHA 2UZXA 3FSZA 2L7UA 4MD5B 4PRNB 4TN9A 1Z9OA 5D7LD 5BRPA 1KB3A 3LXAA 1KJ2B 4TSCH 1B6UA 3PFUA 2Y2YA 2EEDA 4UBDD 5L2KE 5MI0C 3KPOB 4AIXA 3ATEA 5C0AB 4E41E 1LP9A 1F90H 2XTJD 4UNVA 1CGYA 3WJLC 4EIUA 2G2RA 4E9YA 3QCVL 1R3JB 3BISA 1YEIH 2QPEB 3HC0B 2B5IB 4DQOH 2EILB 3D2UA 3CZKA 4N5ED 1F2QA 4RMQA 3P77B 1O75A 3CH8A 3HMXA 1W15A 2V3FA 4NPYB 3O9WB 1W8NA 3QG7H 5C0BA 3EYOA 2DEYX 1HAUA 3L54A 1A7QH 1ZXQA 5FM8A 3OF6D 4A7VA 5HPOA 4UT9A 2R59A 4HJGA 3ZDZB 4KKLD 1TO5A 2IGFH 3K81A 3GSWA 3QZMA 2V33A 3QQ4A 4PB9L 4RDBA 5J6GB 3R1GH 4FA7B 2JJTC 3V0WH 4YHNA 1DO6A 3VXUE 1YYMH 1UENA 1UCBH 2G75B 5D7JC 3K46A 3OM3B 3A4DA 3JVFC 4N5UA 2RD0A 1ACYH 4HS8L 4U6XB 2DIBA 2G0KA 4XP1H 4GB9A 5F9WC 5LBSH 3MACL 1QW8A 3AADB 4W70A 2BW4A 4MAYC 1IT9L 3WXVH 2Z31A 3BKJL 2TSBA 4XZ4A 5HY9B 2J43A 4J3TA 1RUMH 2KZKA 2VH5H 3ZOAA 3RPBA 1NPNA 4KO9A 1ROWA 5I5RA 1TPXB 4PEEA 1A3RL 3WN6A 3TA4D 4FQQB 1MW2A 2CO7B 3RDTD 4Z8FH 1C7SA 2CGYA 4TMPA 2CWRA 2J25A 1WVZA 2XLLA 3S37L 3SY0A 3AU1B 2PNDA 3NT0A 3MV11 3SBQA 1WS8A 2VR8A 1MFBH 3FSAA 4PBWD 2A83A 4FD0A 5DWUH 5C0FB 3R8QA 1IU1A 2OTUB 4MNQA 3RZCA 4PHXA 3LV3B 4J3OC 3DGCR 4B50A 3DYMA 4QOKB 5IBLC 1D9KC 3D39D 4WNQA 2DW5A 4JANA 4NP4L 3MV7E 3KJ4C 3QSKB 1N4XL 5F93C 3UBXB 1QBLH 5JOEA 3N3EA 4KHTH 5F7UA 4JRYE 4Z7QE 3DXAE 5IF0B 4EIZC 4KMTH 2ENSA 4H2CA 2CKBA 1JK8B 3OR6B 3QJOA 1AHMA 4HLJA 4JM4H 4YFLI 1E2ZA 3GSRB 1EWHA 5KN5B 1T3FA 2CBOA 3AUWB 4PGBB 4KVCH 4PJIE 3THMH 3V0JA 2E6QA 5LCVA 5SX4I 4ZSOA 4HUUA 5F7EH 4EDXB 4A7GF 2VMEA 1O7VA 5E9NA 3OPZL 1E28A 3E3QE 1ZHKB 5FYJD 3SYOA 3SE3A 4V1DB 4PW3A 4PS7A 3QHZL 4TQHA 1DJSA 1GS8A 1XL4A 3EBHA 3UC2A 3FN9A 2UYLA 3LRHA 4ZNEA 4QRAA 4OV6F 2DBJA 1SLVA 4LHUA 2DMHA 1T20B 3H9HA 2Z7ZA 3VD2A 3N50A 3ZQWA 4CADA 1OQOA 3WEXB 2PTUA 2E0PA 2HJKA 5IOKA 5D4HA 2WC7A 4P06A 4HULB 4I77H 2ZQKA 3Q05A 5A6IA 4NQEA 1EXUA 4HG4K 1MCWW 35C8L 5SV4A 2UXTA 2R29A 2WQXA 2Z0BA 3RY5A 2EECA 1E4XI 1RP9A 5KSVA 4N2GA 4S2SB 1BVKB 3I9PA 4GIPD 3SGKA 1UD6A 5DVKA 1TETL 4JFDE 4UIMB 5D70L 1UB6A 1CLYL 3DVGA 5TD4A 1Y6NR 1IEAB 4I18A 3L3KB 3UO8B 4X80L 4M00A 3TH3T 4O2FB 3QO1B 4RGOL 1XZ0A 4AMKH 1MCEA 1RHFA 2Z3FA 5DJAB 4WSGA 1F3DH 3VQMA 4BKLB 2ARJA 2CK0H 2ZPKH 4J6RH 3RUGB 1A21A 5C9KA 1BXAA 5E9DB 2PO6A 5T3XL 4ZFGL 2NY6D 3QDMA 4EF3A 2VRAA 1TCMA 3QIWD 2OCJA 1LGVA 4L8DB 1S5IH 3BWZA 3W2DH 5FYKD 4D94A 1LTXA 4KMLB 4ZTEA 1OLZA 3JT2A 3DJ9A 2AQ1A 3SKOB 2PF6A 1BZ7A 3T8XB 1BSIA 5CCKL 2K9FB 5IM7A 1R5IB 4YEFA 5DFVC 3FCGA 2AAAA 3MCKB 1K6QL 3RWHB 1PBYA 3MCLH 3V0VA 2B5IC 2YS4A 2PYEA 5KAQF 4KTDH 4XCYA 3G7TA 5ACZA 1DHKA 3SBPA 5CZVL 5FFOA 2P8PB 1GC1L 5F72S 2VQTA 1R5WA 3HI1B 1VFMA 1SYVA 5FB8B 3LB6C 1X7TA 4OGAD 4IBLT 4NN6B 3NFPB 3O9WC 3DOIA 3ROLA 5IMLB 3O6MH 3C2AL 2OMZA 5JQIB 3KPQB 3A22A 2AKRB 5GJSL 3GKWL 1EGJL 3DUSA 3CZEA 1CFQB 4AKOA 5EFIA 3GDBA 4P2YA 3T3MF 4YHKH 1T04A 1U93B 3EKCA 5LGJA 2C3VB 3OJ2C 5AOMA 1HILB 5HHQB 3MLZH 2ZXEB 4FABH 1YRKA 1FQ9C 4NC1E 3FOMB 2KZBA 1KLGA 1OT1A 2OW6A 3ZK0A 2WYHA 3K0WA 5DFAA 4KKCC 4KTEL 1A22B 5D55A 5HTSA 2DD8H 3LIZL 2CCVA 5T1KB 2X2JA 3T2PA 1QI4A 5BRZA 2YD6A 3WSQL 1ED3A 4GMSH 1TEYA 5GZND 4WU7B 2HFGL 5C09A 1CVSC 1E3FA 3P30L 4ONGH 1RERA 2Y3NA 3EBGA 3QJXA 5AW3B 4N8VG 5DVMA 2V3DA 5GS0H 1MCIA 1TPXC 2IQ9H 5B4MC 3N5AA 4JFOB 3L4CA 4M6OH 4WW2A 3ETBF 3ZE2F 4P5KB 2QKIA 3C8HA 3GMMB 4AJYV 1JZDC 2Z1KA 1VFBB 2DDQH 3OV6A 5F7AA 1RHHA 1AO7E 2PPAA 1XB6A 3TP4A 6FABL 1T6BX 1KCSL 1DSFL 2D0FA 1RU9H 5EU6D 2JELL 4N1EA 3VXMA 2JJSA 4AYSA 4HMCA 2H45A 2Q3XA 2YD2A 3VXNB 5LWYL 2AQTA 3IMVA 5A2BA 4NQDE 1X5YA 5IHZB 2PXYA 1L0QA 3ETTA 2YHGA 3LSOB 4HJIA 4HWUA 2CDEA 2H1PL 4PRAA 3VI3E 1OGAB 4J39A 3DJTA 5DK2A 2JKXA 1UWEL 3FQXB 1BLNB 1KB9J 3QIUA 2GIXA 1S7VB 1FNSH 3ASNB 3IK2A 2ZCZA 3NRFA 1ZK5A 1FPTL 5B7MA 5KBDA 2YQ2A 3PWNB 3D9AH 1IGCL 1II4E 4Y1SA 1FFNA 4AZUA 4BRJA 1FO0L 1I8LC 1WIUA 1Z9MA 5AEAA 3ARBA 3KWWA 1BXVA 2BVUA 2VWEE 1X3DA 1SJVA 4ZAKB 1UXMA 1QZ1A 1IEBA 4N2HA 3MNZA 2B1HL 5I5IA 1B0RA 5K59F 2WZPD 4BZ2L 3FMGH 1XQ4A 3PP3K 3DPBB 5DD0L 2NOYA 5IW3A 2E46A 1ZMYA 5J56B 2OSYA 4JHZA 2P80A 4HJ1A 4G43A 1EERB 5ICYB 3NCJL 4G9FD 1ZHNA 4ZW6A 3W9DB 1TG8A 4BDVB 4K9EH 1F86A 4J4PA 4OQTH 4LQ1A 1QR1B 1Z32X 4JG0H 3EBAA 5J6HB 4Y1TA 3M7FB 4PJ8A 1XCTB 2IOOA 1N64H 4TM9A 3ZW3A 3H9SB 5I1DA 3GSNB 2OI9B 4UI2A 3DARA 4FG0A 3KDMB 3ZTEA 5ICUA 4FAAB 1MIMH 3L9YA 3VNZA 3F7YB 1DQVA 1T0MB 5E00B 1PZSA 4M61B 2H32A 3KM2A 3U36A 2R0ZH 4LIQL 4D0BB 4WWOA 4ELMF 3KBHE 3V4PA 3JV0A 1HKLH 5E0QA 4WUKH 3W0WE 2ICWI 4G1EB 1KJMA 3MGTB 2V2XB 3STZA 1H8LA 1RZFH 1MFCL 1CL7L 1KN4H 1BV8A 2DICA 3DHJA 1Q94B 5D71L 4Z77B 4MMXB 2A9ML 3D0VA 4DETA 2FLRT 1E2VA 3CZUB 2JCCE 4V2BA 2XFXB 3T3PF 1AMYA 4LNRA 3D85D 3GJEB 5GGUA 1HQRA 2BOBB 4OGXL 3SN6N 4N3TA 4ODXA 3TCLB 3SBRA 4UNUA 5HGBA 3QAQA 3KLHD 5EC1B 4LCWD 5TDNA 1PSKL 2WWKO 4KRNA 3ZZ1A 5K9KB 3OLEA 3GRGA 3INUH 1N3NB 4DKFH 5C0CD 1IAIM 5FO8B 1NGPH 2OX5B 2QQQA 4M7KL 5JPMB 2HTKC 1P5UB 2VE6A 5D72H 2WP3O 1P7KB 3FCSA 3KW8A 4UTAA 2Z91B 4KKBD 5D2NE 5AW0B 1FWXA 3CVHA 3GRWL 5DMYA 4NN6C 2ZSWB 1U91B 4JE4B 3IPBA 4JK0D 3VD4A 3C6EA 3LS5H 1B9ZA 3BESR 4ZXBD 3SKMB 2AJVH 2BY3A 1TEFA 3QUYA 3VX1A 2NNXA 4FFYL 4YZWA 4NQTA 3B5HA 3WUZA 3AY4A 5DK0B 5FUCE 3V5DA 1FYTA 5ESQA 4PP1D 3FDWA 4NO0D 5BQ7A 3RKPA 1SMAA 4B0MB 2ZSVA 1MHCB 2CJSA 2QQLH 4UILL 5DUPL 3RVTD 2YAPA 1D3CA 1KTDB 3BLPX 3T77A 4AZ8A 1NKOA 4KGJA 4Z78A 4YBLB 3AT0A 3OKOB 2TRHA 3C5ZB 1FN4A 2F7PA 4JFVA 2CJTA 1N59A 4GOSA 4NNPL 5CILL 1QKZL 2UY6B 2YZ8A 3ECBA 4IOFC 1IRAY 4YH6A 2Y06H 2PKDA 2FK9A 5J8OA 4Z3JA 3C9NB 3MX0B 3UG5A 1TTCA 3Q8CA 4F8OA 5FO9A 3WFCH 3DMMB 2AXGA 1S7WB 1CTOA 4X6FA 3ZDYE 1AKPA 4PUBL 5E1IA 3HN5A 3VFPB 1NFKA 4PJBA 4N22A 4N2EA 1LO5A 1UADC 4MFHA 1EXGA 1I9IH 4A2GA 3EF7A 1BD2E 1KGIA 3GLZA 1S9WA 3O2VH 2CCWA 1UA6L 2IDUA 3CDFA 4KPHL 2ADIB 3I3EA 5I1EH 4P2RA 2G60L 3O2DA 4HW6A 2LVEA 1QLEL 1GGCH 3OKDB 1WA1X 4AGMA 4R5XA 5BV7B 2VITA 5EOCL 3S0PA 2GBVA 3QPQC 1QP1A 1EMTL 4OSUH 5EULV 4U1NB 4ZFOL 3AREB 4PN6A 1YVLA 5D1ZA 4XP9L 1AQKH 4EBQL 4NO5B 1IM3A 1YNKH 4GH7B 4QRTB 3D52A 4ODWA 1I3VA 2XNAA 3PGFL 1J1PL 4FS0A 4G3YH 1AKJB 5E6IA 4Z3EA 5I1KH 1LD9B 1TKWB 2CMRL 5T5FH 5CD3A 1PW3A 3F7QA 1JPTL 1ORSA 4LCIH 5SWZB 2L04A 4WEEA 4FNUA 5EG6C 1QFWL 3S48A 3AQDA 4GKZB 1DL7H 4LPCA 5AOZA 3KPLB 5G55A 1OCWH 4JR9H 4WFHD 2GABA 4DPRA 4ERSL 1MHEB 2YC1B 4R84A 3D50A 4GRWF 4HT1L 4QHPA 3KPRE 1B0GA 5D93B 3VD7A 3LEXA 2UWEA 4Y7OC 4HLZG 2J8UA 4IDLA 4ZAKC 1T2XA 3N04A 3L3JB 4XX1E 1AY1L 1TNMA 3U6XS 2VABA 3KVPA 5F88B 4DP4X 3OKLA 2NDFA 2IANE 1SY6L 2J3SA 4ZMAT 4PI2A 2HN7B 5I1AB 5KSBA 5FUOL 3S88H 3PNRB 4NUQA 3WAKA 3Q9QA 4IOIB 3OXSB 4NJ9L 3Q5YA 3MRCB 4X6CB 3SDDD 2R23A 4ZW5A 1VCBC 1DQIA 3ABGA 3FTWA 4XX5A 1X6LA 4N68A 4U7MA 1VA9A 4G1MB 1N5AA 1VSCA 3O3AA 3C08L 4XN9A 1NFDF 2OI9C 3DDFA 5IFHL 1RLBA 3ARDB 1UJ3A 3EJRA 4N0YH 4R5TA 2D7PA 4XBMA 5LAPA 2QDVA 4ZMOA 3V0IA 3P73A 3QQXA 1DJHA 1IC5H 3FQ4A 1XGYH 3QEQA 4YHZL 4LCYA 5BZDB 4JRXA 1LE9B 2FQDA 1TO4A 5AVSB 3PLYA 1QQDB 4PJ5B 2HFTA 4W9CC 3UTSA 1BFTA 5TTRA 1KPVB 2BOCB 2H3NA 1JWSB 4FG2A 3WFHB 1X5KA 3DTXA 2Q8BH 1UD4A 5I15H 3Q01A 4CSPA 1CD1B 2XQYK 4OZ4B 4XHJD 2Y7QB 3MGAA 5C0RL 4A7QA 3HVDA 3DLQR 4M7ZB 4MMXC 3VXRE 2NY1B 4GMTL 1NMAL 1OKEA 1NM9A 4MJID 4R7NA 1RV6X 1U3HA 1CGUA 2ZCHH 3X1GA 4QD2E 1JL8A 4PP2A 4PS8A 1XF1A 3DIVA 3TN0B 4ZPTA 3BFWA 5BS0B 1BM3L 4J3WA 3SZKC 2Y1VA 5DHDA 3FFCD 1K3IA 4LGSB 3VRIB 2R69H 2WXGA 4NYLA 2CHNA 4R4ND 3HG3A 5HHMD 1BM7A 5K39A 2CHZA 4FTVA 1F41A 1PD0A 4HUVA 2AK1L 2WBJB 2YEVB 4XX1G 5JPMC 5JXAH 1P5UC 1ZVSB 1KTBA 3GBML 3NCYS 3ZKND 5I0WA 2IG2L 2IPKA 1YJDC 2DN7A 1BJ1H 2FATH 2A9NH 3DI2B 3EYQC 1SEQH 5FM5O 3U0WH 1DUYA 1KYDA 3OZLA 1PIFA 4F9LC 4Q9QL 1C7TA 2P44B 4W4NA 5DQJB 1T22B 1GJWA 4JRWA 1TJGH 4GINA 3BC9A 3U0PA 2YPKB 2IAMA 3DJZA 4R97B 2OJEB 4GRWH 4UMGA 2DWEB 4XOEA 4H25A 2H3KA 1DBKH 1BQLL 4HZLB 1DJXA 1EEZB 3MLPA 1S7SA 1YCSA 2DKSA 2RGSA 5F0PB 2AQ3A 3SBWA 1XIWA 5CJQH 1OL0A 3L7EA 4YBLC 4B27A 1YEGL 4F7EB 1KGJA 3C5ZC 1Z2KA 3QA3A 4X8XA 3U4EB 3Q48A 4D9LL 4XRCA 4HKXA 4P5MB 3M07A 3I6GB 1HWHB 4PJAA 1LM8V 4XO8A 2QV4A 1F0LA 3U6RA 3BGMA 3ETSA 3GO1H 5A3ID 2GAZA 2WLLA 2X12A 5F7WC 4FKHA 3DMMC 1ZLWH 4H20H 3IJSA 4LSSL 1V55B 2FSDA 3LNGA 1T1YB 2X4NA 3KG5A 3QQ3B 4NKOB 1CC3A 4DEWA 2ZCKL 4O2EA 3II3A 4KDTC 4K23H 1D2PA 3ESUF 4KJQD 4Z95H 1OAKL 4N1HB 1O6TA 1EANA 2HTLD 4JFFE 4XNUL 5BV7C 2PCPB 4XNAA 1TFPA 1MZZA 3ARFB 3FRPB 2VDRB 2VAJA 1EFXB 4M8QA 5EU4B 4AENA 5JW4M 1CD8A 1N12A 3AREC 4F33B 5L2KA 1K4CA 1MAKA 4F2ME 4PW4A 1YYLH 4JLRB 3TT3L 3WDHA 3R4RA 2ARJQ 1GW6A 2AJUL 5MP6H 4E41A 1DVXA 3EFDL 4P07A 4I0PA 4FTDA 1N0LA 2PCYA 5JIKA 2P8LA 4FCHA 4HC1H 4CVXB 5I17A 5FK9A 1TTAA 4XO5A 3QEUB 5D7LE 1FIEA 5F0LB 4YHIB 5HGHA 1P4BL 1IQWH 1MWAL 1B0IA 4BZ1H 5L4IA 2ICWB 1NFIA 5D93C 5IUCA 4WTQA 1YUHA 1KYOK 2APTA 1Z0NA 5KANI 1FIGL 4ONOA 3IDNA 2OR8A 1ZANL 2VDPL 2Y7SA 2QPFA 3SPJA 1FORL 5L7XL 2NZ9D 1A6AB 2XTJE 3PUCA 2C9AA 4XO9A 1KB5L 4J27A 3RVXC 3ULVE 1ZVYA 4D7PA 5FCUH 4OW6A 1NIBA 3CFTA 2Z7YA 3FT3B 5I71B 4X6DF 2CD0A 1S5HB 4LHJB 3KEHA 1RUKL 4JFPB 3DRTA 4QI3A 1EHLL 2DWDA 3BE1L 2G4EA 3VXUA 4EO5A 2XPZA 2Y6TE 4AG4H 1F4XH 1SLXA 3GXTA 2TRYA 3O4LE 2Y2WA 2R0WH 2GTZB 3I2CH 5B7FA 5IFAL 1JF6A 4S1SH 3ARDC 3MMEB 5DURD 1MRCL 3HAEB 5GPRA 2B08A 4QTFA 4C58B 5ESAB 2OZ4L 1F6AB 3VI4B 2H8PA 4UM8B 1KLUA 2FWLB 3ELAT 3BO8A 4ZRGA 2EDEA 2TSAA 1N8OE 3ECQA 1MHPH 2Y7NA 4NI6A 3SDXB 2DMGA 1UM5H 1U8MA 5D7IE 4BSVB 4EI0A 2A77H 1QBML 1E90A 1PJWA 1UM4L 2GG1A 2XWBA 2JKNA 4ISVB 3ZIYA 4ZD3H 5D7HA 5ID1A 4DNLA 3O8XB 4S0SD 3WIIL 3L3IB 1CL7I 4XP4L 4XVJH 2BNQD 2CJ3A 4M7ZC 3HZYB 5FGBC 2NY1C 2YD5A 4JRFA 1PD1A 1ZV5A 5EN3A 1QTYT 4AYFA 3TN0C 1D7CA 4YK4C 1F3DJ 1I1FA 4ANVA 3MV7A 5E5UB 8CGTA 3VG0H 1D5MB 4XH2A 5HJ3A 2Q76B 4DKEL 1NANH 3QYNA 4JRYA 3DXAA 5B1JC 1G9MH 2OL3L 1QMUA 3QUXD 1PYWA 2WLZA 2WBJC 4JHBA 4LCUB 5EUOE 1TF4A 3TZVB 3BRGC 4NHUA 2K1MA 3IN0A 4GW1B 1S9VA 3FH5A 3Q8EA 4YEEA 5AVUB 4AW4A 2VGLM 4PYHA 4M4RB 4PJIA 3F7KA 1NGQL 2VISB 5E08H 3BKYH 3RWDB 3D39E 3IDGA 5AW8B 3ARXA 3DROA 4RQQB 1NGYB 4G2AA 4H8UA 1UATA 1X9UA 3ZYIA 4HJEA 4TL5A 1CDUA 1U4FA 3O6LL 4L3EB 2YA1A 3EJCA 2NXZD 4OVVA 4R97C 3RI5F 4EN3A 3LRSB 1AE6H 1GZHC 1XEDA 3VCLA 1XGTA 4YGAB 3DUUA 5IHUH 4N26A 4XN2A 5AB9A 4IEFB 25C8L 3SKUD 1EUUA 4LLDA 4OZGF 4JFEE 1SMDA 4YLBA 4YHYB 1ZTMA 2F7IA 1CLZL 4TRPH 1K8DB 3PHAA 4UTCA 5GGRB 1SOSA 2B39A 5FYJE 3UBHA 1RZKC 4BFRA 5I6XB 3D3VD 5B8CB 3SDAB 1AZVA 4DZBB 5HGAA 3D18A 5F44A 5MERA 3IDMB 1EDQA 2X4PB 4UOQA 5J9PB 4MDJA 3FU5A 4PBDA 1TZGH 4K8RC 1AANA 1J05B 4JFDA 4M48H 4FQHA 2EVJA 4JFZL 4JGMA 5A2IH 2APWA 2ATKA 3JWOL 1BX2A 4LEEA 2Q3AA 5GJTH 5ALBH 1CQYA 2FQFA 4AEHL 4KFZC 4OCLC 5AKVA 1KCUL 3SDYH 1UFUA 1MVFA 3G08B 5LG1A 1DEEA 3NSXA 3UZVB 1CZ8H 4LCCB 5AOIA 3FN0L 4N8VA 1LWHA 2PETA 4OCXH 3CFEB 4LRNL 4D9QE 1Z9NA 4PB0H 5KZCD 4FLQA 1QFUH 1LK2A 4MNGE 3ARFC 2DJMA 5DJXB 4XMKL 2FBJH 3T0XA 3VW3L 4QEGA 4HHAB 2W94A 4O5LL 4BKTC 1TEGA 2Y6SD 2BNRE 4C4UA 4I3GA 1DLHA 1KF9B 1U8QB 2P28B 1NCBH 2HYMA 3BW9B 5EDXA 4GG6B 2CU9A 1SVCP 1Z66A 4WDIA 4B95C 4OM1L 2JK5A 5B7EA 4DOHE 5BUAA 1HINL 2PPFA 5FYKE 4EPSA 2AJYH 5ICXA 3VFOB 4TNWF 4HEPG 3H56A 2XZCL 3GLEA 3JZYA 4TV3A 1ZWIA 5E8NB 4Y2DB 4EI5A 5CD5D 5DJ0B 5HI5C 4HV8B 1ZLSL 5D7EA 3QUKB 2RCSH 3T2NH 4JQIL 5JNYA 1TVDA 4R3SB 4Y5XA 4JHAH 4Y19D 2N1TE 4FI8A 4U3SB 3UFIA 1OTTD 5I71C 1MREH 3FUHA 3QUMH 1AP2B 5F96L 2G5RA 3ZZSA 1M7XA 1P69B 1T21B 2JIXD 3GI9H 3GS4A 3FUIA 2IOIA 1WJ3A 4QF1A 4K71B 5DQDH 1WITA 2YJLA 5C08D 2AGJH 3QNYA 4HUMB 3Q2VA 4RBPH 4PRPB 3AACA 1WZLA 4Z7UE 3RQ3A 4XPTL 4M5YH 3FT9A 4PJXE 4YDNA 5C0EB 2E4TA 2W9LA 5LBVA 5IOPB 5DS1A 3RA7L 1GCFA 3M1OA 1RPUA 4APQB 2NY3B 2ZZUT 1FLRL 3KL3A 2WQVA 3B37A 2IFGA 4AQAA 3LZQA 2VDML 3RFZC 3ESPA 5E2TH 3BP5A 4HIXH 3O8XC 4QWWD 1T89A 2JI1A 5GGQL 1WAAE 2GFBA 1AO7A 2XIBA 2AV1A 3VE0A 2VR3A 5ITBH 4H8HA 1EEQA 5DC9B 3ZYOA 2AJZA 1QSEE 3JUZA 5B1AB 4AOFA 4YXKL 2GSGA 4NQDA 5EUKA 3K2KA 1QZNA 2MCPH 2VLRB 4U1KB 2MNUA 2VKXA 3VI3A 5EDSA 3LPPA 1B4JL 4NSKB 4XI5D 4JG1L 1IEHA 4GKNB 2I9LB 5KSAA 4P2OA 5LJYH 3KPNA 4PGJA 3OKEA 3S3BB 3DJRA 4C56B 3TZVC 3GMLB 4KY1H 3ETBJ 4EUPB 5DEZA 5EU6E 4K94H 4L2LA 3PWUA 4UT6L 3FCTA 2BINA 3EJJX 4UDUA 2CDFA 1DP0A 4V11A 2IF7A 4JBSA 4KXZI 4QNPE 3A6BH 3MRMA 2FSEB 3IMBA 3H54A 1SF3A 1BVLA 3ISRA 3LHPH 3QUZA 1N7ML 5EH1A 4ES8A 4BSJA 2JB6B 1DJZA 5HDBF 1KBPA 4K7PY 4BFIA 2W80C 2X1PA 1HHHB 3NOIA 5DUMH 1UACL 2Q2EB 3ZKSD 1PLGL 2DF3A 1E4WH 5EBWB 5ES4B 4JX0A 1CICD 1BBJA 2WVSA 3N06B 4KV5F 4K3DL 2H1LM 4YHYC 1T2QL 3L6FA 1MY5A 2CSPA 2F0CA 4IK6A 1WTLA 1LP9B 3X1EA 2NSXA 5I6XC 5B8CC 3SDAC 1N2RA 2QVIA 3QQNA 4XNYL 5JOPD 2G2RB 4KOCA 3GJFA 4N2IA 1YNTA 2EIMB 2BXYA 4G9FE 3D2UB 3EJYD 3V55A 4JQXC 3HOGA 2OMTA 3RL2A 4LESA 1Y1DA 2BERA 1C9SA 1FO0B 4ZTOL 2P47B 4HWBL 4TSBL 3W0WA 3A4AA 5EV7A 3B9KA 4KX9A 5C0BB 1U95B 3UCQA 4AJ0A 2UY7A 3BVXA 3WJJA 3ZUCA 4F57L 4IQHA 3D7PA 4LCCC 2CRYA 3WNMA 2DQCH 2DQEH 4HJGB 1E4HA 1IARB 2IXQA 3GSWB 3L9RA 3QQ4B 1G5AA 4Y0GA 2G30A 1M7IB 2JCCA 3EOYG 3MRJA 1HCYA 1P7QD 4NZTL 2J20A 2J88L 1NCOA 4IKNA 1S9YA 3OAYK 2Q3ZA 3V0EA 1KJ3L 2VYRE 2QADB 3S97C 5LXGH 3DOHA 4XBEL 1WLHA 3EFOA 3MLXL 5F1SA 1DQDH 2ED6A 5DYFA 1INDH 3N85H 3PUUA 2Z31B 1QUPA 2Q86A 2EH8H 3EH5B 2VN4A 3NAAH 4JO3H 1CE1L 2BHFA 3FTXA 1RUQH 2DYPD 2JSFA 1XGPA 3HE7C 4FXLA 5D2NA 5EIQA 4HIJA 3MXVH 2WYTA 4BUGA 4Y2DC 1EH9A 4CU8A 3X2QB 2KYIA 3CHSA 2P4AB 4RRPM 3LVTA 4QHUA 3RHWK 1OTUD 4LCWE 3F58H 4H88L 4QY8B 4KJWD 3S9DB 4MB4A 4XCCL 5I76A 5TQ0L 1L7TH 1P1ZA 5C0CE 4M1DH 1TQSA 2AJSH 3SY0B 4ESKA 2VLKE 1CDBA 4DKDC 1ZDSA 4P9ML 4QHNA 4UT9H 1JMZA 3E8VA 1G7QA 1PEZA 1KGCD 1E5UI 3IAPA 1CDGA 3CPUA 2EDRA 3ZE0E 4MNQB 1JCVA 4WO4D 1V27A 4X7EC 5ADPH 3REWA 2MOQA 2EDFA 4JM2F 2XIDA 4WJ5B 1I8MB 4K71C 4JANB 3CX5J 4KKZA 3SYCA 3TYFB 5C2BL 1KIPA 2P48B 5CEZH 2DI7A 3O3BA 5JW4Q 5I82A 1GW0A 1UASA 5EEZA 2W07A 2CKBB 4ZTPL 4MTMA 2ZUUA 3RILA 3MJ6A 5KVEL 2CUHA 1N6UA</