5LUMA

Alpha-crystallin domain of human hspb6 patched with its n-terminal peptide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
78
structure length
78
Chain Sequence
GHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein beta-6
publication title Structural Basis for the Interaction of a Human Small Heat Shock Protein with the 14-3-3 Universal Signaling Regulator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein/peptide
total genus 12
structure length 78
sequence length 78
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lumA01
2Y1ZA 2KLRA 2KMWA 2O30A 2Y1YA 2XCMC 3N3EA 4YLBA 3L1EA 2WJ5A 4FEIA 4RZKA 4JUTA 3GLAA 1SHSA 3Q9QA 3QORD 2CR0A 3AACA 1WH0A 5DS1A 2WJ7A 3EUDA 3J07A 4YLCA 4MJHA 2BOLA 4PCKA 3Q9PA 3GT6A 4I88A 3L1FA 3VQMA 3QORB 4JUSA 1WGVA 3QORA 4YL9A 2N3JA 4M5SA 2CG9X 4YE0A 3IGFA 1GMEA 3QORC 1EJFA 4ZJ9A 2JKIS 3VQLA 4PBDA 3AABA 1WFIA 5DS2A 4ELDA 5LUMA 2Y22A 4YDZA 2N0KA 2MNWA 2RH0A 4M5TA 3W1ZA 1X5MA 3L1GA 1RL1A 3GUFA 2K8QA
chains in the Genus database with same CATH superfamily
2ARJQ 1MRDH 4LEXH 1JGVH 1N9PA 3JT2A 5E0FA 1DBBH 1E65A 3UPCA 1MDAA 3EYVA 5IBUB 4LDEB 3L7EB 3SD5A 3FFDA 4PH8A 3V4VA 2BFVL 4X7DC 3BFQG 2VZVA 4HEPA 1I9IL 3WY4A 1FZKA 2WQ8A 3Q6GH 1DBJL 3OQRA 1OXYA 2FQFA 2CKBA 5E4AA 5BVJB 1FNFA 1P2CB 4MNGA 4QF1B 2NW3A 1LILA 2V17L 5B3JE 1UUSA 3WEMA 4RAUA 1CT8B 4FMKA 3P0VH 2XCMC 5FO8A 1J1PH 4OZ4A 2PW2A 5E0QA 3TPUA 5JTWA 5E94A 1BF8A 3NQKA 1F4XH 2HT2C 2QPUA 1RERA 4AYFB 4OZIB 4JHAL 5DD1H 9CGTA 1MCBA 1J9SA 4WJ5B 5DQJB 4DUXA 1HH6B 2OI9C 2VDQB 2YN3A 4FULA 1I7ZB 5F7KC 1IARB 5J6HA 4XZUB 1GA2A 4M7LH 4N2OA 3TBWA 4JQVA 5F6HI 3DJSA 2X1PA 1SJEB 5TQ0H 4F7CB 3FU7B 3EYSL 3LZRA 4M5ZH 3IWUA 1E5CA 3FO2A 3OR6A 1FZJB 1T1XB 3OLEA 3M88A 1ZT7A 5I8EB 4EN2A 1Y1UA 4YDMA 1BMZA 4DHLA 5I1DA 2CCWA 1FYHB 1YUHA 4AW4A 1DJIA 2PTTA 3ZR5A 3ROLB 2Z3FA 3HG2A 4UYQA 2X2UA 5HHOE 4WI7A 4R90H 1PF3A 2X5PA 3UFIA 4X4KA 5HDBE 3BP7B 4PJGF 2Z4TA 2PETA 3NA9L 3NSCA 3PABB 5C0IA 4L8CA 3PJSA 2R29H 4MS6A 3KWUA 2VRAA 4WWKC 5C0DB 4MD5A 5E99L 4JFXA 3WXWL 2OYLA 4KVCL 2K70A 4N2MA 5HHQB 3VXUB 5M95B 2WAQA 3GXPA 3S36H 3DVNB 4N0CC 1K2DB 2GI7A 4YL4A 5D7JB 3LNDA 3D18A 3GRWL 3ARXA 1PZDA 4AM0A 1T7ZA 1CDYA 1CYXA 3FTXA 5C2BL 4E2OA 4R4NC 5DMIH 1R24A 4GG8B 3R06B 3TA3B 5EBWB 2EIBA 2VDRB 2ITCA 2APWA 2XXGA 5SWSA 3EOBA 3KH4A 4LSDA 2UWEB 2AQNA 5I8KL 1T1WB 1U8CA 1JVKA 1N67A 3FSZA 4JKNA 2V3DA 4TULL 4BFGA 5JPNC 3WTVA 2OMWB 3RHWK 3TU6A 4X6DB 1BXUA 2BP5M 1UC6A 1AHWB 1XDTT 5EOCH 5BS0A 1AR1B 4P2YA 3B2VH 1MIML 5HXMA 1GS6X 1KY6A 4YHMH 1OP3K 3RWIB 4N90E 1UXLA 3LEXB 4TVPD 2YC1B 4GQPH 2W60A 5I24A 2GBUA 2B1HL 1I8IB 3MRNA 4ATTA 3QYCA 4Y2OA 2HRPH 4CC0A 1NM9A 3K4ZA 1OANA 5IG7A 3RIFK 4F7TA 5I1KL 5E2WH 4N2DA 1KG0B 2EEXA 5D7JD 1AZBA 3PCYA 3QB7C 4JRXB 1QR1A 3QRLA 3U4EA 3UDWC 3CJJA 5IMKB 4JN2A 1R3KB 3U7WH 1KN2L 1D5IL 4G9FD 4Z6AT 2AS5M 2ADYA 4QT5B 3RVWC 5T1MA 3TA3D 1JYNA 2HLFC 4J3VA 4LLYB 4RNRB 1KV3A 3S96B 3Q2CA 4C4BA 1OZTG 1BM3L 5ESAA 4F8TA 1OGTA 3ZKND 3M46A 4B3EA 1F3DH 3BPCA 4V1DA 5DRXA 3W0WE 2H3XC 4G6JL 3Q0HA 4A7SA 1JPTH 3TP4A 1AKJA 3T0AA 1IC7L 1AR1D 4UUJA 3B7RL 3BUQA 2Z1PA 3MLXL 4GI8A 4KROB 4LU5H 4O4YL 4L3EB 3SJVE 1EXUB 2XC8A 1ORSB 5K39B 4LFHG 2BVOA 4JE0A 1KTCA 5BRZD 1MW0A 2IQ9L 2EINB 4GMTH 4NKOB 2IH9A 1M9WA 2ZPKH 4ODVH 2WZPD 2AZUA 5I2IB 5I8CA 4XNYL 3DPBB 3NH7H 2RB8A 1LQSR 4HP5A 2CR3A 1KSRA 2HVBA 2QV2A 4YDJB 1YQVL 3KH3A 4EVNB 1CGUA 4GMSH 1IC4L 2QGCA 2VLLB 5FV1L 3L3GB 4LP8A 4AL8H 5IP4A 1WF5A 1GGTA 4XCFH 1E6JH 4QO1B 2L8AA 4I7ZC 3SD2A 3UGEA 1OAQH 3UTQA 1GCYA 3WE1A 5MEOA 3CDGA 1ZGLB 4EZMA 5EULV 3BEVA 5FHBL 4P5TD 3VWJA 5F3BB 3G04B 3MYZA 4BH7B 1SXSA 1EGJL 1OT4A 3H9SB 3FBKA 1QLEH 4ZMLA 4OFYD 1GPOL 2JJSC 4HWUA 5I75C 1R19A 5FOBA 2OTWA 4BINA 2Q5BA 2DKUA 2BNRB 3RDTA 3WTUA 1T04B 2EUZA 3MJ8B 3NGBC 5DS8A 2Z7ZA 2DDQL 3QUXA 3MA7B 4KO6A 3HUJB 3DHMA 2JH2A 1IFHH 1MCIA 3L4XA 4NQVB 4X5WB 4Y9CA 1XWVA 5ENWB 5GRYA 3L7FA 4WGWB 5F9AC 2FBJH 1P6AB 3EJZD 4GJTB 5C09D 3RWGA 4L3ED 1ZHNA 3FB5B 3MV9A 3Q13A 1U8OB 5E9DD 2Y7OA 1GIGL 3INUH 1M7XA 2EYSA 5D93C 1JPFB 1XV8A 5D1ZC 5DQDH 4WU7B 1DVYA 3LZFL 4Z7VF 4Y1SA 3QJHB 1S7SA 4GSXA 4R7LA 3FDWA 4YFLI 1CGSH 2VDLL 3PWUA 1FZMA 4PBDA 4JL1A 1QSZA 3C6SB 3GXFA 2MKWA 1G7JB 4XMWA 5AB0A 4K5MA 5HYQB 4UAOC 1CR9H 2WWOA 3WFCL 1W0YT 5EZLB 1XD1A 4DQOL 4GAYA 4IRSD 5CLWA 3VTMA 3V4VH 4BE5A 4IKJA 4YSEA 1T6WA 4HA1A 3K2KA 2BNRD 4GRMB 3BN3B 5DFVD 1AH1A 3H6JA 5L4FA 2AJXL 4BM7A 2L7UA 3GSRB 3MDJA 1BG9A 3K8LA 2CKBH 3BPLC 5ANMA 4D3CH 1QW9A 2XA8L 4PP1D 1RHFA 5IR1A 3COOA 1Z66A 3GHBH 4HV8A 2NR6D 3OKEA 4KHTL 4WWPA 4HOMA 1CXEA 2YGQA 3HJEA 3SPCA 2WQWA 3GZOA 3Q8FA 3DJTA 3PAYA 5GSVA 1FJ1A 3D30A 3T0DA 2J57A 4OZFA 1YC8A 2ESVE 3EDDA 5F7NC 2VXVH 3F85A 2H8PA 5J6GB 2E47A 1U92B 3DMMA 3OSKA 2R0WH 4IGBC 4MWFB 4P46A 2AQ1A 4PWGA 1LWJA 3NCCB 3ARSA 2KYIA 3B4NA 4U1NA 5F7DA 4ZZKA 1GGBH 3QPXH 1L7TH 2APFA 1TZHA 1A6TA 5JR1H 1TQSA 1E7VA 4FQPA 5IB1B 2CLZB 3TJHC 4B41A 5A2CA 1NWOA 1CDIA 2E9JA 1F2QA 4Z7OB 2A83B 1Q4NX 2WBXA 5INCB 1RD6A 3HJ0A 2W38A 4PJEA 3L95B 4NN6B 3JV4B 4UOW1 2P5PA 1KGCE 3T77A 2ZNXA 4JKLA 2YBGA 4LCYB 3WTTA 1B88A 2Z93B 4M1CD 4YBLC 3ZKXC 1HOEA 5L9DH 1T66D 1QA9A 4KRMB 2YFOA 3LYRA 1OM3L 2EH7L 1GSMA 3AY4C 4LAJH 1GVIA 3LVEA 2WWKT 2ADIB 2LU3A 3LX9A 4LLWA 4NM8H 5AD0B 1T03H 2ZWLT 3ECWA 1NFDE 5DQ9A 4PJ7E 3O3DB 1XX9C 4PP2A 5E6IC 3MXWL 4AQ1C 3GBDA 3UAEA 3FT3A 1RJZB 1IKFL 3ZE0B 1NUFA 3TNMA 3U0TB 4JVWA 2MCG1 2PCYA 4AY0A 3U83A 1YDPB 5C9KA 1ROCA 2WXJA 3QWQB 4OZGF 4D2NA 1U93B 3IYLW 2DD8H 3FU6A 4YHIB 1QPKA 3MX0B 3X11A 2WXRA 4F2FA 3HZYA 3KYAA 1XH1A 3FTSA 2NX5B 4QHNA 4DKFH 3UAJC 1F3JA 5DHMC 2H6OA 3FT2A 3NESA 2HTKD 4QGTA 4Y5VB 3IXAA 4IIQA 4U31A 3NSDA 4YXLH 4JY4B 4NO2B 4CVWA 1T7XA 2QJDA 1R5VB 4HAFA 2VL4A 2ZT9C 1BAWA 2KS0A 2MRYA 3QIBA 3QZWB 3T3MF 3N42F 1E4XI 4HK3J 1MNUL 4JAMA 1BFVH 1S6NA 3H6AA 4LRIA 1P7QA 3HTLX 4GYBA 1NANH 2G9HB 1F6AA 3SE8H 3CG8A 2FHBA 1ZJAA 3FU3A 3F58H 2GTQA 3T3PB 5TE4H 3IMTA 4AJ0A 4APQC 4D9QE 4F15B 1IGCL 2EZ0D 2VLJE 3ROOA 3G6JA 1E6OL 2NY4C 5DJZB 3PGFL 3CDYA 1ZTXE 5DF0A 2IADB 1CF8H 1BYPA 2P42B 4R0LC 2RD0A 4DKEL 1DVFB 2IAMA 5DZ9A 1OAZL 1V8HA 4L3CB 1XZ0A 3IDXH 3Q9QA 5DC9B 4ZUVB 1O9WA 1RFDH 1R3IH 2EVGA 5CINL 3FCTA 1EDQA 1Y6KR 2MEJB 3D52A 3QIUC 3Q2LA 1OSEA 2NX5D 1USQA 4J12A 5CD3A 2FEDD 2BMKA 3ETSA 4F7PA 3JV0A 1EZLA 2ZOWA 4L9LB 1JZDC 5ICXA 2H6UA 1A14L 1NZRA 3LXCA 3WFDL 4BBWA 1U2HA 3D12B 3KE0A 4LDCA 4DERA 2WXOA 3A6BL 4KTDL 1NBYB 1JDCA 3FMGL 5JUEH 1PZUB 4Z7UA 2NZ9D 3HAEH 1XGRB 5C0FB 2BNUA 4BQBA 2VH5L 3MNZB 1N5YL 3T09A 4IOIA 1FPTH 2Z8WC 3MO1A 5HGAA 2NLJA 4OFQA 5AG8A 4ELDA 2VZSA 2IPKA 1BJ1J 5I1GH 2VUKA 4IBUA 2CHDA 5JHLA 1BG1A 5D7IF 1B6DA 3PNRB 1FC1A 4LL9A 1B4LA 4GQQA 5H94B 3FU8A 2NY1D 3WFEL 2BERA 3MGTB 4N3UA 2J5WA 3EGSB 1FE8H 4CJ0A 2GCYA 2FYYA 5I1IH 2CO1A 4L0PB 4ONFH 2XPYA 1KLGB 4A2FA 2GPZA 5I1HL 1FDLH 4RWYL 5A6LA 2X4RA 3DVGB 1JCKA 2FGWL 1NMAH 1L9MA 2EACA 5D7SH 3UP1A 4WUKH 4F80A 5HHPB 2EDBA 3PFQA 1I7UA 4IMLA 3F7QA 3VW3H 3Q48A 3HNTH 4YJZL 2Y07H 2WSPA 35C8L 4H20L 4IJ3C 4JANB 4FLHA 4RIRA 1PAZA 5D71L 4NQEA 2QR0B 2V5YA 3AWGA 1IM9D 2HN7B 1PZBA 2X4TB 4DEPC 3MV7B 2BZ7A 3MFFA 4WEBH 1DQDH 1QSEE 2C5DC 3L3DA 4L1DA 4R2GC 12E8H 4OLUH 1OO2A 3H4FA 4LGSB 3TCLB 4LNRB 4E5XA 5LGYA 1P7KA 3G9VA 1S5IL 1MKFA 1PJ9A 3DYOA 1NM4A 1X9UA 5J1AA 2D3LA 2QQKH 1ACYH 2YRLA 4ENEC 1SMAA 4XTRC 2Z91A 3GXTA 4CSSA 4PWIA 2W9EL 4QRPB 2ZYSA 2BY2A 5IEHB 5AVZB 5JHDB 1NCOA 4HQQL 1OGPA 4XOEA 4AIXA 3FN3A 1HOCA 4QRSA 2W0PA 3RPBA 1ZVHA 3B8YA 5T5FL 1GC1H 1MAML 2Y1AA 4GNKB 4MB3A 5IB3A 2CK0L 1T4KB 1A3ZA 5F0PB 5I16A 1LE5A 1JPSH 1BP3B 1QI3A 4PJCA 1MCJA 4OZFH 2OULB 3ARQA 1U9KA 1EXGA 5DS1A 3VI3E 4AXWA 1A6UH 2QHLA 3MCKB 3ZGIA 5ABDE 2DLEA 3BAEH 4ZSOE 3KR3H 1X4YA 1ZY9A 5E4EC 4AIZB 1KB5H 3CXDL 3DROB 2KZ1B 3GXUB 1GMIA 2WBJA 2ZSVB 5LNDA 4TNGA 3WBDA 4J3XA 4PJXF 5DJCB 2E56A 1U8HB 4FI6A 2F08A 3KXFA 2AEQH 2OR8A 3LPFA 1XVSA 4J3OC 5FYKD 4QRPD 3KVQA 4PJIE 3SIKA 2EXWC 3SDXE 5JHDD 1CIUA 2E6PA 1Q0XL 4P57B 4JM2F 3H4HA 3O0LA 4ZX3A 3QA3B 4MJ2A 1MCOH 3U82B 3CX5J 3QORB 2XWXA 1HE8A 1MJJB 4S1QH 1W0VB 2EYTB 4N8PA 2XZQL 2YD2A 1QNZL 1FFTB 3HFML 1KYAA 3AM8A 4LSQH 1CGWA 3UMNA 3VRLE 4A39A 2DS4A 4YH6A 5EOCJ 4DUVA 4YHNA 4LCUA 4XN4A 5IEKA 4OZHA 1DBKL 3H9HA 2WP3O 4AMXA 1I53A 2DI7A 1T2QH 3QUHA 1MHPL 1MN4A 1NCHA 2AK1L 3MMEB 1A6AB 1AIFB 1BX2B 1NCCH 3IF1A 1EMTH 4C55A 3UJJL 4POZD 3L1FA 4JY5H 4NUGH 2ZYIA 1PYWA 3NJJA 2VDNL 5AAMA 3VNZA 4DN4L 1LEIA 2AFNA 2BIPA 5A16B 4WO4B 1YO4A 5AZ2L 3OAWA 1A5FL 4W9FC 1IM3D 1AJ7H 3P54A 3W2DL 1QLFB 4TLTA 1UWFA 2MMXA 4C47A 2LLLA 1LEGA 1PDKB 1XT5A 1UZGA 1RH8A 4R4BA 1BIIB 2UZYB 4H8PA 4OCXH 1CDJA 1HTYA 4LASL 1Z3GL 4PTUB 2CDEB 4L4VA 4JPIB 2XKSA 4IYKA 5LQBH 3BAWA 1BECA 2DWDA 4KQ3L 1BZ7B 4FG2A 3DOIA 1VKXA 4ONGH 2APTA 2X3BA 4NP4L 5JXEA 2ADJA 1UB5A 5CEXA 4MDIB 3GTVA 3V10A 4ABUA 2Y6TE 3EBHA 4MXQC 3VI4A 3DXAD 1M2VA 5I76A 4PRIE 4RSVA 1KCUH 4OLXL 5GGRB 5IVZB 3BE1L 1HAUA 2A4ZA 2Z7UA 3NZ8B 4F92B 4ODTL 1IT9L 1NEZA 5E8EB 3OR7B 3BJLA 1F97A 5IBUG 3WXVL 2DI9A 3SOBL 5EU5B 3CBJB 2IANE 2ZX6A 4YZFF 4KH9A 3OXSA 3FCUB 1C12B 4L2YA 3TO2A 5IMLB 3BQUA 5C9JB 1KWGA 4I48B 1RJYA 3SZ6A 1B3IA 2W65B 4M7KH 2IBZX 3FS9A 5DTFB 5JQ6L 4HDIA 1J5OH 1FL5B 3D85B 3CU7A 3KPLB 1AP2A 2J2ZB 4MASA 4MAUL 4TNWF 3ECUA 4U6YA 4YGVB 1DQLH 1QBMH 3P3YA 2F53B 3SDDA 3T6ZA 5FF6A 4FNLL 5F9OL 3LB6D 5GZND 3F5WB 4KY2A 3P0YL 5C0AD 5AEAA 3CHSA 4NAMA 2MFNA 1ITBB 2XNAA 7FABH 2HAZA 4KVPA 5DJYA 4YAQB 1CTNA 5F9WB 1BVKA 5B38B 1CG9B 3EADA 3QCTL 2FO4B 4C56A 2AK4E 1HYSC 4GH7B 4QHLA 5L2KA 1HL5A 4OM1L 3TJPA 2PO6B 2BZCA 2B9AA 4QRBA 4S0TD 5C7ZA 1F90H 5L0QC 5EF2A 2LW3A 4ZMTA 4QR7A 4E9QA 3E6HA 1WFIA 4OLWH 4GAJL 4D9RD 5JHLH 5J06A 3ZDWA 4I2XA 4FNRA 4JRYB 4KKPA 1T5XB 2YXVA 5LAXA 3UTTD 2NY6C 4QRAA 1TLMA 4HMEA 1DVXA 2VDMH 3EO0B 4XCEA 2XZZA 2DRUA 1JV2B 1FLRL 3GKWH 5DHEA 5I28A 5J8OA 2QSQA 2F53D 5HJDA 2BFGA 3VTAA 1IGFH 2YSSA 4QRRE 3ETBF 4HKZB 4FCHA 4Z7WA 1BJ8A 1MRCH 4KHXH 4UILH 1XGZA 3A23A 3CUPB 5JA8B 2X1XR 3PWNA 2FHCA 3SPGA 3RL1B 4JPKH 5E6YA 2FL5A 4Y16B 3HPLB 3MUY1 3GTNA 1SXZA 4PG9B 4RFOH 4AEFA 3RGVA 1X5MA 2ZAHA 3TZVD 3FZUC 4NX0A 3GMQA 1E8WA 3EJTA 4OLYH 2M8XA 3JZYA 1QTPA 3QUZC 2NY3D 2CO6A 1Q9WA 2LFGA 2PO6D 4OCSH 4S0SD 2VWEE 2DQDL 2CIKB 4M6ML 4EUPH 2NZ1A 1Z32X 5IJBC 2WGNB 1MWAL 3ETBJ 2X4QB 3TNNB 2BCKB 1M42A 4JY6B 1U2YA 1PCXA 1I4FA 4IU3B 3KLAA 5D2NB 4Q0XH 2KPNA 3TCTA 2FNWA 4FYQA 1DP0A 4PJAF 3O2DA 3DSNB 3K1DA 4QXTA 1WWBX 1HJBC 3OG4B 3IDJB 1UWYA 4D8PA 1OT1A 3SE3A 2BIHA 3B56A 3HNVH 3GO1H 4BUQA 1N7ML 1KXTA 3QWRD 4NZUL 4ZFOA 4PRPE 4PJ8B 4ZO7A 2QELA 1RK0A 4MCMA 5KSVB 1GYUA 3TH3T 2VLKB 4CW1B 4OGXL 4Y16D 2HH0H 4OCRH 5EO1A 4K73A 4OF0A 1O7VA 5F96H 3IS0X 4KXCA 3CFDA 4RSYA 1QFPA 2MQ3A 4UTCA 2Q87A 3HFFA 2B16A 2E9GA 4O02A 3PREA 1MCFA 5FWQA 4ANWA 3CSYA 1TKWB 1AACA 2DYPA 1VDGA 4A7TA 1A4BA 4QKXB 1U95B 1DE4B 4TQEL 4XO8A 4OUOA 4P4KA 4PJHB 4HCRA 3MQIA 3EFOA 3W39A 3D39A 2GQHA 4B5ZA 1MFVA 3LPOA 1KGUA 4MA8L 2CG9X 2I60H 3ZKMD 1TQBB 2DBJA 1ML0A 3R8QA 4ELME 2ZJSH 2FJGA 3DBXB 4ERSH 1T0MB 2V7NA 1XGYH 1LP9A 4U6VH 4N2IA 4OJFH 1OAYH 1KPVA 1BEXA 5E1IA 2UY6B 1RAMA 1H3VA 1TZIA 2A74B 3EF4A 2YPKA 3L3OB 3L1GA 3QC6X 3GUTB 4YBHA 4PJ8D 1E5BA 1MLCB 5D5MB 5HYJA 5DZLA 2HKFL 2MPAL 3FF8A 4JB9L 4F33A 2G4EA 2DJ4A 3VXPA 1JUFB 1A2YB 2DTMH 3MUJA 4AUJA 3EZ8A 5FW6A 5BO1L 3U4BH 4PB0H 4PMFA 4DOHE 2OMXA 2ZKYA 3FTZA 3QJFA 5DJDA 4Z7QE 2R2BB 2VXUH 1NCWL 4I9WE 2FCBA 2VT0A 5D7LE 5BMFH 2QVFB 1OTSD 3VGAC 3IU3A 1AIZA 3KPNA 3S5LA 4X6CA 2CU9A 3SE9L 4AQEA 4GB9A 3EFFA 2IDQA 4M5TA 4G80B 4RGNB 3WHXB 3ASNB 4NO5A 1R4XA 1R1CA 5FYLH 2B4CL 4PVMA 4XXDB 4PJ9A 4RGOL 3BYTA 4FQJL 1N64L 1AZCA 2EDDA 2H0JA 1S7RA 3FFDB 1FSKC 1QG3A 3KLKA 4DEWA 1FP5A 1GHFL 2HFGH 1EQWA 5EORH 1KFGA 1QO3A 3QQ4A 5JDSA 4KI5D 1CTMA 4UV4H 4WF7A 3DUSA 1EHAA 2XN0A 4S1SL 4X0KB 1NJ9A 4JGNA 1IBGL 4OSUH 5EU6A 4MMXC 2A6IB 2CKBB 4BZYA 3GXIA 1S7UA 4KVNL 4MNGB 2VO5A 2A9BA 1FGNH 2EE3A 4AC2A 4NO3B 5EUOA 3EOYG 1RXLA 5F7MC 3ARYA 4M4RA 1TPXC 1ZLDA 3IE9A 5A2KH 4N1HB 5DMKB 3CVIH 3BN9D 1PZCA 1P9MC 3ARGD 2WKLA 4OZ4B 4ZS7L 5E2TH 3QYNA 1TO4A 3TPUB 5E8PA 4NQUA 3UTSE 2HKHH 2MCAA 5CP3A 1HS6A 1OL0A 2WHVA 3LEYL 4LO9A 1DFBH 4E9SA 4OGAD 2ADGA 4CAGA 3ARRA 1IQWL 3JWNH 4TLSA 3E6FB 4DUWA 3NRPA 1SXBA 3RVXD 4GG6A 5DRNA 3QDJB 5JOPE 5E8OB 2HPTA 4FN0A 2CH8A 3TBWB 3KJ4C 2COQA 4FQIL 1JZ6A 1FNAA 3N1QC 5FUZH 3GPSA 3BMWA 4JPWH 4MQ7A 3DIFA 4G1MB 3NT0A 2E4FA 1ZT7B 6FABH 4M03A 4OF8A 1TZ8A 2NSMA 1YUHB 4XO5A 4CVUA 3ALXA 2PTTB 4J39A 3CDZA 1QRNA 2ENJA 3A6CL 3BH9A 1A64A 3GI8H 1KCRL 1ERNA 2I7OA 1L6PA 5AW9B 4DO6A 5CS7A 4YX2H 2Q3AA 4KKCD 2P45B 2R1WB 4FOMA 4F58H 5C0IB 5B4MD 3PJSB 1XCTA 1A7RH 3E0GA 5ALCH 5I1EL 4YHOL 3BAJA 4ZPVA 5DK3A 4WJKB 4MD5B 1Q0EA 3NIFF 1USZA 1KLUB 4XHJD 3KM2A 3UGUA 2B5IB 4H8WC 5GGTA 5E1QA 2HJKA 5ILTH 4A2EA 5HJBA 3GLDA 4WI8A 3RZCC 3TS8A 4NKIL 1TJHL 3N0PB 3VG0L 4OCYL 1H8SA 2ZP8A 4PJ6A 5A1AA 4PGCA 3JVGA 1J0ZA 4WHTA 4S1DD 3AREC 2O5YL 3PP4L 4LCCA 2IPUG 1Q9LA 4G70B 1J8SA 2NTFA 1E4KA 2ITCB 3QH3B 1RZJC 1NCTA 1GGIH 5FGRA 3EOBB 1JZIA 5IOPB 3V6OA 1F1GA 1U8CB 3NCYP 3RFRA 1J9RA 1EEUA 4FXKC 2WY3B 4OJDH 4Y4FC 3EYQD 3C6LA 1OAKH 1THAA 4PCKA 3EFDL 3MXVL 2AV1B 5BS0B 1U8JA 1YNLL 2ENSA 5I1LA 1A1MA 2QVIA 5ITFA 4KRPC 2HJFB 5C0BE 1FUNA 4HS8L 4L3AA 3GB7A 1EHLL 4WWKB 2GEEA 2W60B 4V2BA 1N6QL 1YNKL 5KW9L 3MRNB 2G75A 3VFGH 2YK1H 4H0LC 1DUYA 4FTVE 4M00A 3FSAA 2BK8A 3T2NH 1WYJA 3ME0B 3MRJA 2CXGA 4JCWA 4AYBA 4DKAA 1XSKA 3NCJH 5A43C 3DVFA 5D9SB 1QR1B 1IJNA 3MLVL 3HE7C 2FJHA 4ZAKC 3U4EB 4W4OA 2VITB 4JN2B 2AABH 4MLSA 5AW7B 1D9KC 3SGJC 3Q1SL 4BZ2A 5I5RA 3ATDA 3IVKB 1QNIA 4R26H 4Q9QL 3UYPA 2ICWI 3G5XB 2Z0UA 5TF1L 2YAOA 3NIDE 5ESAB 1PNDA 4PJ5E 2VAJA 4JO3H 2CRYA 5SWSD 3VXSA 4X5QA 5E9NA 3X1FA 3BPCB 3P2TA 5DRXB 2D8KA 5JPNB 3QZWG 2ODHA 5SWZE 5IWLA 1AKJB 4EE2A 1KBWA 5BS0D 4UUJB 3BYYA 4Y1TA 3US0A 4KXZI 4MAZA 3C60C 3ZJAA 2I26N 2BC4A 5DVMA 2YD3A 2FAUA 4LLUA 1OQXA 4OCMC 4HISA 3EDKA 4H8WL 3FHAA 1V3LA 3HI6L 3WAKA 2KC0A 1GR7A 1Z5YD 5FYJU 3PDOB 1TEFA 3L3IA 4YE4L 5BCAA 3BKCH 3WIHL 2FJSA 3IAPA 4MNQE 3HG3A 1EBPA 1KYOK 1RZ8B 2Q86B 5MENE 4O02H 2JKTM 5D1XB 3TFKD 3CWGA 3KCWA 4N20A 1UJ3C 5JLZB 1H8NA 4XP6H 2A9AA 3QJVB 4OAWA 3PL6D 3QQ3A 3FH8A 1AGFB 1OE1A 2P5EA 4XNMB 3UTQB 2EDQA 5MEOB 4HU8A 2GVYA 1RZJL 4UT6A 3BEVB 3ZZLA 2X1OA 3PV6A 4MX7A 4MDRA 4HCRH 3DURA 1LMKA 1AGDB 3L1OL 3OZKA 5T5NG 4G6AD 4AEIH 3QG6A 4M7JH 1R3LB 5FOBB 5DJAA 4OF5A 4LPVA 4FGMA 5DS8B 5KBDA 1D7FA 1I1AC 3C5XA 3QUXB 2VN3A 4V1DD 1SBSH 4GIOA 5ISZA 2F6AA 5MP6H 5AQ0A 3F8UB 4J4PA 1AKJD 2Y22A 3AFLA 3L7FB 3TYFA 3ULSB 3V0EA 4ADIA 2R4RH 3QG7H 1CFVH 1L5GB 2NRDA 3MV9B 4OCWH 1ADQL 1JXJA 3DRTA 3BP4A 1A3RH 1ETA1 2UXTA 1U91A 3KGTA 3N5AA 4XVJL 1PJWA 2WXLA 2E7CA 4ZFZB 4QCIA 1S7SB 5JO5A 2JI2A 5C0CE 3TWYA 4HF5L 3KPMB 1P5VA 1OD9A 1NCDL 2RMNA 3RVVD 4NQDE 5EZOL 1E0OB 3RU8L 4A2MA 2ZYRA 3VWJD 4X7TA 5AW6B 1EJ6A 5DR5L 2N1TE 3AB0B 3US9A 4D9LH 5LBGA 4O9HL 4HFUL 4PY7B 4HU2A 1G9NC 3DIVA 4W6XB 3I3DA 4KUCF 2Z4QB 5E5UB 5K5YA 4G8GE 1NGQL 3BJ91 3MGOB 3RDTD 4JCLA 1JK8A 3QUXD 2L7EA 4OJCA 1IZJA 2FNBA 3MRLA 5E5LA 1SDAB 3UMTA 5AL0A 4BIKA 5GJTH 5ANMB 4H8UA 2I32A 3I02A 3CGTA 4RESB 5KVGH 1N5AA 4ALAC 5IR1B 1FAIL 4HV8B 1UGNA 5BRPA 1R5WB 1XGPA 1CK0L 3AXHA 4R7DA 5HBBA 1PY0A 4RETB 2PCXA 1DN0A 3DGGB 3DOSA 4P2OD 4DSYA 1I8AA 1S4IA 3IAQA 4OZFB 4LQFL 5D1ZB 3GIZH 2DQ6A 3RDJA 5HSFA 1IKNC 5EF1A 3DMMB 5CP3H 4OM0H 2DIAA 4Z0XA 3RURA 3N1MC 3QQ9C 5JOEA 5DUPL 1KBGL 5ESVA 5T3ZL 3BUIA 5F7DB 1IEAA 4UAOB 1RUQH 4HJEA 7PCYA 1MG3C 1TZHB 2AXGA 1HSAB 1A6TB 4KMTH 5T3ZE 1QFWH 4WNQA 4PLJC 4CBZA 2V9TA 4ZW5A 5JORA 5HGGS 1E4XL 5DHVA 1T22A 3FK3A 4YBQD 2K8QA 3II2A 3QUKA 2VSDA 1AGEA 3GS4A 4YLBA 1GZPA 2Y6SD 4JDEA 2JI3A 5DLLA 3T77B 4DCQA 4OKVA 5TD4A 1F58L 4X9IA 5AUMA 3HMWH 3PYCA 2CALA 1YPZA 2DQGH 4X6EA 1IGYA 4BKSC 2ZCLH 4HUUA 4UZUA 2ZOUA 4XC1L 4R4FH 3OC5A 3ULUF 1KULA 2LU7A 5DQ9B 2PWDA 4YSOA 4E9TA 4PP2B 4PLNC 1QI4A 5AOZA 4I1NB 2F1AA 4M6AA 1DBMH 3DMMD 4P46D 3D2TA 4XCCH 1FIGL 3UGXA 4BGLA 4IGBB 4UNVA 4B0MM 3SO3C 5MEPA 1QFHA 1OW0A 4HXBH 4JQXA 2XZAL 3GXNA 5GGTH 3HW7A 4PVNA 2VDKL 1QD0A 3RWHA 4Q97A 3ZK0A 1S9KC 1G9NL 2OCJA 2I24N 3S3DB 1AE6L 4QHKI 2EVHA 2EDOA 3HZYB 1JWSA 3WLBB 3WDHA 5LXGL 1M71A 1JVOA 4NOBA 3IXAB 2YPLE 1PD1A 4OCNC 5D55A 4O2FB 1OVZA 2EVIA 3BP5A 2N7BA 4I77H 1KENH 1FN4A 3AG3B 1OCZB 1QR4A 2YFNA 3HMXA 1UFGA 4JAMB 2JJTA 2CCVA 2JKJA 1P7QB 5DJ0A 2OYKA 3Q2WA 1OHZA 1F6AB 3O2WH 4NWUH 4UZGA 4ZTEA 1BMWA 3O6ML 4QHMB 1A1NA 2XTJB 3AU1A 3EH3B 2MQGA 5E6IB 1GMEA 4Z3IA 1FFOA 4AQ1B 1A3LL 3VQ1C 1IGJA 4QIRA 1KPUA 3FW6A 3G6JB 3VD5A 2WXNA 2H3KA 2FATL 3FRPB 3CIAA 1N8ZA 2J88L 3STBA 4NWTL 3LJ3A 5J12B 2EIDA 5A6IA 4JHWH 2IAMB 4JO4L 5IROC 2J6EL 4D0DA 1XZ0B 1I1FA 3ZIMA 5PCYA 2C9QA 1U8QA 3LNGA 1ZT4A 2HVJA 1MI5A 5EU7C 5CD3B 4E68A 4PIRF 3U9PL 2BMKB 3IDIB 4LLDA 1RHHA 4Z18A 4BZ2H 3LRHA 4M48L 1FVEA 1NIAA 5ICXB 3WJLC 4UTBL 1FL6A 1GJUA 5EH1A 3NJLA 4P06A 4XB3A 1IBZA 4L4TE 4AH2A 4QWWC 1MELA 3QIBD 1I3VA 2WOBA 5GZOC 3IJ7A 3EHBC 1B0GA 1P7QD 3X14A 2I9LA 4XP9L 3BKYH 4XPBH 1EHKB 3NTCL 1KLFA 2VNCA 3C5ZA 2CGRH 2GJZA 3PV7A 4F2MB 2XTJD 3WCYA 4APQB 1BGXL 2BNUB 3QFJE 2YMXH 1YEJL 3IRZA 3FSWA 4L5FH 4JHVA 1QFOA 5HGAB 1QUNA 3ATEA 2NLJB 4HJGA 5I1CH 2UXGA 4M6OH 3MLZL 5EDXA 1A9EA 1M05A 2IPKB 2IAMD 4PS4L 4LVHC 5IW3A 4CNIA 4UIMA 3M8OH 4MD4B 1J8HD 2ORBH 4B9GA 1MFDH 1CE6A 1WV7T 2BDNH 2J1XA 1JNLL 3QIUB 3U6XA 4UT6H 3MACL 4OH2A 3OKMA 3R0MA 1RCYA 1CFMA 4DTGL 5JYMA 3GMLA 1WP6A 3QJSB 3ESOA 2E46A 1G7PA 4OV6F 3UX9B 1I8LC 4F91B 3ZY7A 1XR8A 1BJMA 1I85A 1CLOL 4DP1X 1F56A 2AGJH 2E27H 3VQLA 3ZHKA 4JFZH 1YA5A 3SGDI 2NYYC 5I19L 1E2ZA 1BD2A 2NXZC 4UQEA 3RAJH 3ECQA 4CGUB 5FO7A 4YDZA 2UZPA 3L5IA 4BK8A 2X05A 2OMYA 4IMLB 2CJSA 4CGTA 5B38G 3QNYA 1PX3A 1EH9A 1X5XA 4XPAH 1MREL 3PHOA 3TBCA 4FMFA 4Z7IA 1AI1L 2YWZA 5TE7H 4RIRB 3FOMA 4HK0A 2CWRA 4NQEB 1OTTD 5C0RH 4E36A 1Y7VA 5FFGA 1KCLA 1E8ZA 1BQKA 1QBBA 2A3TA 3L3DB 3QARA 2APVA 3RE0A 3AQZA 5KN5B 1CDBA 4ZG1A 3UAAA 4A1RA 1KFAH 1LK3H 2PR4L 1ICTA 3Q8CA 5KBKA 4BWWA 2GJ6B 5AOLA 2BVPA 1Z1WA 5TQ2L 3SDAC 1AD0A 3LRMA 4PTTB 4XI5C 2EC8A 2JKSA 4QXUH 5GS3A 1U8MB 2B3RA 1FNLA 4NAJA 4QHPA 4K3HA 3CBRA 4K23H 5LXVA 1A7NH 2AI0H 4FS0A 4LGRB 4G6MH 4ZXBC 4K3DH 3MOQA 1HOCB 3CFUA 4QRSB 5ECJE 3ZE0F 3FNKA 1SDYA 4XVSL 4QTHB 1D5BA 5IB3B 5I16B 3WMSA 4OFIA 4U0RB 4FP8H 4RQQA 1NIFA 5IB4B 3BGMA 1ZV2A 2WUBL 4NQED 3K1KC 3D3VE 1IGIL 5L8KB 2DWTA 1OTUD 1XF4A 2EO1A 1ZTMA 2PPEA 2QSCH 4AXWB 4DEPB 1G6RB 4LBEA 2LT9A 2CJUL 1FORH 2DQUH 1AO7E 3N9GH 5E1HB 1MRFH 2VR7A 2ERJC 3BEWB 2DM4A 2WBJB 5D1QA 2EDMA 2OTPA 3QUML 4DGWC 3OZ9H 2ZQKA 3EBIA 3LEVH 5IUCA 1MFBL 1YEKH 3KXFB 2A77L 5DHVH 3WMQA 1KIQA 1EO5A 4AVKA 3HI5L 5DHYA 1NCNA 5KSBF 1JZ4A 2VDNB 2BFVH 1ZANH 4RRPG 3K72A 3CZJA 3BCFA 3G6AA 4Y88A 2OR9L 3ZDZB 4U4BA 2X0UA 1KDJA 5KANG 5I0DA 4XP5L 3SQOH 1S7VB 1X5ZA 4Z7VE 4EI5C 3QCVL 1M9SA 2YLKA 4X9YA 2V17H 3PPEA 2F74B 5D8JL 1CQYA 1T83A 2J8OA 2VR6A 4JFVA 4XAKD 3ASWA 2EDNA 2ESVA 1TJIL 5CLYA 4FQHA 4OQ1A 1DCLA 2WTRA 2QZQA 5BVPL 1MFCL 5IEKB 2PMZA 1OSPH 4MYPA 4WW1B 1I31A 4N9GB 2OYPA 3E1F1 2IALA 4P5RA 5I6NA 2ZG3A 3IF1B 4G43A 3I2CL 1SYSA 4PN6A 1KYDA 4QOKE 3L08A 3ZE1B 2QBWA 3RWJB 3PP3K 5DJ6A 3PS6A 2EIJB 4OI8A 3IMUA 1LEIB 1MCCA 3VWKC 2V4LA 4FXGA 2X9YA 5T1DL 1EHNA 3KXFD 2HVKB 4G1EB 3CXHK 5DI8A 2RFXA 3TX4A 3EW3B 4P2CG 4P9MH 2DJSA 5F7BA 1KTDB 2NY5C 4Q9RH 1LEGB 3EYSH 1NAKL 4PLKD 5DWPA 2J1YA 4X6FA 5FDYA 4R4BB 4QNPE 3VFMA 5DJ2A 2OCFD 4KKAD 3PWLA 1Z5LA 4BFIB 4OGQC 1VADB 1KXVA 2DWDB 3HMXH 2KQNA 1F41A 3D25A 3FFCD 3F12A 4TYUA 1NFDA 2ADJB 3QXAA 1UB5B 2B59B 4Y89A 3WFBL 2XWZA 4PJ7A 4UMSA 3VI4B 2B15A 3NA9H 4K0OA 3W38A 2BVYA 3I6SA 4KGLA 5T8IA 5K69A 4KFMA 2Y36H 5D70L 3MVSA 2DKMA 5FYLD 2AK4B 3FUJA 4YDIL 1NEZB 1UVQA 2K9UA 3TEZA 2FJFB 4U1JA 4KVCH 3TIDB 3HLAA 2GC7C 1HZHL 5C0ND 3NFSL 4FADA 1JHKL 1YY8B 3OXSB 3BSGA 4FKHA 4L1LA 3V95A 3O3AA 3TO2B 2VW6A 3B7UX 3BQUB 4YLCA 5BO0D 2I07A 1RJYB 4PRHE 5D7HA 3VMNA 5BUAA 5C2BH 5KVDE 4I18A 3ZU8A 3UYRL 3QCUL 4HETA 1HWWA 1S9YB 4PQXA 1AP2B 1AOZA 3QRGL 4U6YB 2VUYA 4U6XA 5LGKA 3SDDB 1MFAH 5FF6B 1C9SA 3JTTB 3DPDA 2NCMA 4L4VD 2J8UB 5I8KH 4A6YL 3QDGE 1UZ8A 1KT2A 4Z3TA 1H3PH 2H26B 5DC0A 8FABA 2EC9T 3O3BA 5JXED 2XNAB 2EXTA 4X4ME 4TQIA 3K2UL 5DJYB 1DBAL 1LM8V 2W1NA 1MIMH 3VU2A 3MODL 4GKOA 2XWJA 4OZGE 2VLJA 4C56B 3RVTC 4QHLB 3Q5OA 3VFOB 4FA8A 5L2KB 3K46A 1UD8A 3N6YA 1EIBA 2R59A 3EJQA 1NFIA 1TTFA 4IBZA 3NDZE 5K9QG 3U0WH 1J10A 1ZS2A 1JWMA 3VTTA 2NY5L 3HLKA 4QYOA 1TYEB 1MH5A 4HS3B 3BQUD 2YKKA 5DYOA 3G5ZA 3VSQA 1HHIA 2O5NA 3FQTB 1D5IH 4HALA 5CMAA 5IESL 3T3ME 1S3KL 2JI1A 2SODB 4NT6B 3SDDD 1JXGA 4UQ2B 1BM3H 2YSSB 3R1GH 4K7PY 1DQJA 3O0RL 2BWQA 4QJ5B 3UPAA 3PWNB 4XP1H 3GSNL 4G6JH 2FL5B 4EKJA 4FI8A 4NN7B 5I8OL 4RMTA 1IC7H 3HC4L 4U1HA 3VSTA 2QHRH 3RGVB 3VD3A 2EDHA 3RFZA 2ZZUT 3TEXA 3LVTA 4C56D 2QADB 1JZ2A 1WBYB 3U48A 1KZQA 3CVCA 2Q7YA 4IOFD 5L2KD 2AJSL 1Q9WB 2CO6B 3JUYA 1DJSA 1W0WA 1K8DA 1X9LA 4XNYH 5AWNL 5I6OA 1CDHA 3M86A 5TDPA 5L0QB 4OCLC 5E2VH 3RL2A 3ZTNL 1PNCA 1MZZA 1EAPB 3UTZA 2NY7L 1I4FB 3BDXA 3ECBA 3WLWC 5LN4A 4IW4C 5KSAA 3AUVA 4JFFE 3GFUA 4NPJA 5F7AA 4DP4X 5FHBH 5IJVA 1WHPA 2QKIC 1T89C 5DGRA 4ZUTA 4U1KB 4XWGH 2A6JB 1GZHA 1EGJH 3DNKA 4XN1A 5AALA 4D8PB 1G9ML 1ZKAA 4WFHE 5ITBH 4TTDC 1GPOH 4E9LA 5B8CA 1KXTB 1Z7JA 3MLPA 3HR5B 1ACCA 1RK0B 2PXYA 2NPLX 4A37A 4ZODA 5CJXA 3MRCA 5E6SB 2BLFA 2AEWA 4ZNEE 1IVTA 1R3JB 3D6GA 3RGVD 1JZ3A 5EEZA 3BZFA 2PYEB 1WFNA 3CFDB 3MNMA 5I30L 1A6ZB 4M3KB 1GIGH 2XTLA 4ETQA 2AXJA 1DO6A 5D7IE 1AGCA 2DYPB 1P84J 2WJ5A 4N2KA 4H1LB 1WLHA 3W9DA 3VB9A 1ASOA 1E9QB 4P4KB 3T4YA 3K80A 2VDLH 4LPUA 4XNXL 3D39B 5AAPA 4B9FA 3RUGF 1YEDB 3PWVB 2XX0A 3DSFL 2HLAB 4AQ8A 2C1PA 1PZ3A 2D7NA 2V7NB 2WWMC 3WFCH 1LP9B 1MIEL 5HGHA 2ZWKA 3FXIC 1KTRL 5SX4H 2YPKB 1LGVA 5C3LD 4NRYB 4S2SB 4FD0A 1JGLH 5HYJB 4PEEA 4JBSA 4F33B 4KJPD 1RZIA 4ABVA 5HI3D 5FYJH 2XA8H 3IU4H 4KITB 2OMXB 4RCAA 4UBDD 3GIVA 4KHTH 2I25N 3QJFB 4XE0A 1FFNA 3P02A 5DSCA 3IDYC 3HI1A 1N0XH 2DYPD 4EDWL 3KPNB 3CXFA 1MCDA 4AQEB 3FB6A 2I85A 5IV2A 3EFFB 3VI3A 3WO4C 2QMJA 1XCWA 1OIOA 4K71C 4GS7C 3UPRA 2IDUA 4P4KD 3LIZL 3RVUD 2X9ZA 1XH3A 4ZSOA 3T6VA 4PJ9B 4YZWA 5CILL 1CLZL 3D39D 1IILE 3QIWC 3MOAL 1S7RB 4PJFF 5CZVL 3HNSH 4HJJL 4X4YA 1MPAH 1QO3B 3QQ4B 4HKBA 5JDSB 3ZL4H 4Z77B 1ETJA 2ZSWA 4LL4A 3U30C 1NWPA 3WN5C 3I75A 4G8EB 1P1ZA 1YNTA 5D96C 1EJFA 1TQWA 3UBXG 4PJIA 1RUKH 1F4YH 2FX9L 5HYJD 5BUGA 5JOFB 5JW3L 4JKPH 3L2MA 3H3PH 5G5DB 4FQXC 2WKOF 4BQ8A 4HC1L 4RMSA 3KLSA 5CR8A 2KERA 4G7SB 2JCCF 5E8PB 2EH7H 3CD4A 4JFSA 5KG9A 1A0QH 4DFIA 1UCBL 5LWYL 3HC0A 2DYSB 3ZDYE 3VFUA 4PWJA 3VGAB 5F1OB 1D7DA 1CGXA 2C9SA 3MXWH 4B27A 1SHMA 4UT9L 4XPTL 1Q1JH 4Z76A 4UZSA 1O7SA 4GG6B 2GJRA 1N2RA 4PJXE 3QNZB 1SDDA 5DRNB 1UA7A 2JQAA 2Y2YA 4IKNA 4PJ9D 2YSTA 4AYDC 4FYRA 5K1JA 5A2AA 5GS1C 5E70A 2LABA 3KG5A 3PHQA 5BQ7B 5M7QA 4NQCA 4MQ7B 1G1YA 1SUHA 1ZVSB 2CHNA 4L1HA 4YDVB 1TOXA 4WKZB 1BBDL 3PF2A 2PCPA 4JKWA 2E59A 1SM3L 5EU6D 3LS5L 2CM5A 2WTOA 3LAFA 5E2JA 2BP3A 2ZUVA 5CR1A 1MVYA 1AC0A 3T1FA 5LG6A 3BH9B 3NACH 4JG1H 5KSUB 2IFGA 3EJCA 1W8NA 2EXSA 2TRHA 1MCWW 1BXAA 4FE9A 1BQHA 1GY2A 1NL0L 5CEZD 2VERN 4HPYH 4JFDE 1EUTA 4OZFG 1ZWIA 2B2XL 5IJKA 2EDWA 1FFRA 1MNUH 1RJLA 1BQLL 3UBGA 3LKRB 4YUEL 1T6VN 3P73A 1JPST 2A4CA 4PRIA 2HJKB 1IGCH 4K8RC 1KBPA 3APCA 3FC8A 1RZFL 5FKAA 4CU7A 3RA7L 1UJTA 3D5OF 4BZ1A 1E6OH 1ZTXH 2FX8L 4Z78A 1XL6A 3BUDA 1YC7A 5EZJA 3FPYA 4WHTB 2VSCA 1A7OH 1QX1A 4GQZA 4X7CC 3RX5A 5IBLD 4DKEH 1I8KA 1OAZH 1Q9LB 4OIBA 1F86A 2SEBA 3D33A 4CU8A 2WD0A 2YN5A 3H7BA 3PU7A 3RX7A 2D0GA 1ET5A 1AQMA 1TQVA 4XMXA 3ZTJG 4HHWA 5EIQA 4Z3GA 4F7EB 4UU9A 5KYXB 3CN0A 1QRND 4Y8DC 1RP9A 1A14H 4HT1H 3B2DC 5ALBH 5IFJA 2OL3L 5J3HC 1U8JB 1GSKA 1MQKL 3ESVF 3H2QA 3BOVA 1A1MB 5D2LE 5ITFB 2EH8H 3CV5A 3QULA 5SWZB 4S1RL 2JK5A 4LOUC 1BXVA 1I3RA 3GB7B 1MHHA 2F7RA 5IREA 5CP7A 4JFOA 2E4TA 1WGOA 2MQ0A 4MBOA 3FMGH 2G75B 1WUZA 1DUYB 2WQSA 2NCEA 3V52H 1JNHA 3MRJB 3BDYL 1BCIA 3LCYA 4MNQB 1N0LA 2VR3A 3NZHH 3VD0A 2VH5H 1BWMA 1EUUA 3DOHA 3K8KA 3THML 1N5YH 1UKSA 4HHAA 3O41A 5EIIB 1DCEA 2FJHB 4BDVB 3HCVB 3T65A 3DX8A 2OM5A 5HYEA 3OKLA 1DQQB 1P1VA 1SLVA 5D5MF 3X2QB 3UYPB 2GUYA 2YOAA 2HT4C 5TFSL 1CICD 3VXSB 6TAAA 4OD3L 1A02N 3GS7A 3UP6A 3PHSA 4XBPA 3C6LD 3II3A 5AVYB 5DRWA 1XGTB 2MOGA 2IWEA 4CU6A 4TQHA 3K8MA 1FA4A 4OW6A 4ATWA 1YEHH 2BC4B 4Y19E 1H9DA 4XNZC 3GNMH 4KRPB 2NY0B 3BH4A 3BUYB 4LVEA 1B4JH 2A9CA 4EXPX 3ESUF 4K8RL 5IVXA 1NGWA 2FSDA 3ET9F 3FRPG 4Z95L 1NDGB 2VOTA 3FB8B 4HK3N 1KWKA 1P7HL 2IDCA 3FQUA 3LH2H 3QHFL 5AVRB 2A0LC 3WD5L 5JNYA 5B1JA 4XMTA 2G5UA 1MUJA 4WEUD 35C8H 2WVVB 3QQ3B 5FA3A 1KJ2L 2P5EB 5F7LB 2XA3A 3ZYZA 1J48A 1UM6H 3BPNC 3FFOA 3HE7B 3V0JA 4PY8J 4KO5A 1MWAA 2R2EB 1QWNA 1T0NB 4MX7B 1D9KB 4NQDB 5F0LB 3CVDA 1F4WL 5JIHA 3DURB 3R19A 1TJGL 2VJ0A 3GSWB 4OIFA 3A21A 4M56A 4JO5A 1XB8A 4CRPA 1J1XH 5F70A 3VXSD 5F7HA 4XVUC 4O2CB 4AYSA 3L17A 2HMIC 1XXFC 2MNUA 1TTGA 4L3FA 3CFEB 3NFNA 1L9TA 4N28A 1CL7L 1Z9NA 1HQ4A 5HDBF 4XOCA 3RKDD 4YHLL 2BW5A 2WCPA 2W9EH 3C60B 1HHGB 4MAYC 4NYLA 3TONA 2BP0B 2DH3A 2R0LH 3B9KA 4YO0B 2ZUUA 4HQQH 3CFCH 1QFUH 1U91B 1G7HA 1M2OA 4WW2F 2AJVH 4X5XB 1JOIA 4FQ2L 1MAMH 3UACA 4KRLB 1OOWA 4JG9A 4NDMA 3PIQA 4DP9X 1YMHB 4LCWA 2P5ED 3NSXA 2BWDA 4OI9A 4PJAE 2W5PA 5DZJA 1RZGB 1S7TA 4YFDB 4X7TB 4XBEL 2HB0A 3BQVA 3RTQC 2IGTA 1JK9A 2DOCA 3C08L 1JD9A 3CXDH 4PMEA 4KDTC 4ELMA 3EBGA 5EBLA 3CHQA 1GTFA 3TWCL 1VLXA 1JK8B 2ZICA 4MBRA 1SJHB 3MTXA 1ZK5A 2ZX7A 4HPOL 5ISZD 2H45A 3MRLB 2FTAA 4J4PD 4G5ZL 4KJQC 4XXWA 3CZFA 3Q44A 4EZLA 3SGKC 2MKLC 2IXQB 2JKRM 3I02B 4WJG3 1U3HA 3SCMA 3NQIA 1JHLH 1XGPB 2GSMB 3FO1B 3DX3A 4KJWD 4R7DB 4X6BB 5E5MA 1Q0XH 3VE0B 1DN0B 2QQQA 2V2XA 2C3WA 3QUZA 3QO1A 3CMGA 4HLJA 1NGYA 4AJWA 4U2ZA 4CMHC 2HRGA 1UB6A 3AG4B 4Z0XB 3VXOA 5AW2B 1QNZH 1BHGA 3V8OA 1H5BC 1OSZB 4GPVA 1HESA 3A6OA 4DZ8A 1L6XA 1A7PL 1WGVA 1MQ8A 3KPPA 2TAAA 4YFEA 4RH4A 1IEAB 3OHMB 4IRJC 2AXGB 1BXXA 5FKPB 5FO9B 4Y5YA 1MZYA 4LARL 2VDKB 2AK1H 2WYIA 5FDWA 5DHVB 1FLTX 3MV8E 2G0KA 3U2SA 3UJJH 3VXME 4NXSA 1Y18B 2O6DA 1XBDA 4WFGD 4JDEB 4X8XA 2YA1A 4WCYH 4DN4H 3GF8A 1VACA 4OKVB 1J9TA 4JCMA 1A5FH 2XI9A 2CJ3A 2XX1A 4X6EB 1YPZB 4BELD 1IGYB 4HUUB 2CRIA 2HRHA 2PN5A 3CZGA 3T6XA 4F9LC 4LASH 4CSPA 3AXLA 1A9VA 2PP7A 4MVBC 3HE6C 5K1VA 1KZYA 1SRDA 5C07D 5FGCB 2X4PB 1OQOA 5E6ZA 4BHUI 4KTEH 4U1GC 3U36A 1S78C 3L6FB 4CL7A 1PSKL 4O5LL 3RWHB 3QUYA 3POCA 1I1CA 1X5FA 2Y3NA 2VXSH 4N6RA 2GTZA 1ECZA 1WG3A 4M6NL 4BZ1H 4DK5A 4ODTH 3X1EA 1Q38A 1IT9H 1JWSB 1A7BA 2VXTH 1E8YA 1ZCRA 3LMJH 2CHZA 1M71B 3FT0A 2UXVA 4QKTA 3SHSA 4P59L 4JFQB 3WJMA 1HEZB 3UTPD 3DDFA 4PJDA 3VDCA 1ILUA 4MQXC 3OKYA 4LLAA 3BP5B 4K2UH 5IHUH 4UOZA 1NH6A 2OYMA 3LNHA 1WITA 2Y5TA 3NG5A 3EJYD 1M7IA 3MBEA 5DJ0B 2VCOA 3WYRA 4R96A 3TXAA 1W91A 1WZLA 1A1NB 4L0ZA 1IGJB 2XDHA 1D7BA 4ZOEA 2F61A 1N8ZB 1TEGA 4Q14A 3SO3B 4MRCA 1WDAA 4AMWA 5BZZA 1FH5H 2N01B 4DKTA 3RIAK 5DD6A 4D0DB 4XCYB 1NOAA 4XMPL 4R8WL 1I1FB 4GXVH 3F3HA 1SEBB 1CU4L 3AY2A 4AJYV 3Q05A 1U8QB 1BZEA 3ZTEA 2HVJB 1MI5B 2IMMA 1INQA 3U1PA 2HRLA 3SGEI 3HC3L 4LLDB 1RHHB 4GAJH 4HGMA 1AXIB 4J3OG 4X83A 5I6XC 2K4WA 2WCGA 3KEDA 5HHME 1SF3A 2HFEA 2AJUL 3ZN6A 1MFEH 4XGZA 4YNYB 4FFZA 5H35B 3EUUA 1CD8A 4P3WA 4AH2B 1I9JH 4JX0A 4PGZA 1FLRH 1YAIA 2EDTA 2WQVA 3EH5B 1B0GB 2BIMA 3CNKA 3DUUA 3X14B 2I9LB 4AEEA 2IWGA 2Q1EA 4ZS6D 1KLFB 1D3CA 4LPXA 4JUTA 1CTOA 2ZUTA 4ZX5A 2R2HB 3BWUC 5E56A 2EXYD 3JWNG 4LSRH 4FQCH 4ZD3L 3Q06A 1N4XH 2JJWA 1QUNB 4N2BA 1NEZG 3C9NA 2I5YH 3CFNA 3RWEB 1A9EB 1M05B 2QEJA 2EP6A 2WBKA 1DVUA 5SX5K 1Z9OA 4CNIB 5B3NA 1GW0A 4UIMB 2A73B 1CFNB 5JW5A 4HIJB 1AZZC 2FB4L 2WM0A 4M1DL 1HEJC 4AQAA 2P8MA 1SN2A 3N85L 2MHAA 1MI5D 1F4HA 1IEBB 4MA7H 2NQ3A 1MWAH 4KMLB 1I7TA 1ZHKA 3M6DA 4EI6A 3OKMB 1IC0A 1D7CA 4WTQA 3GEWB 1CFSB 5DZVA 4P2RE 1NPUA 2XWCA 4J3SA 4PG2C 3P4MA 4PJ5A 4D8OA 3TJEH 1LNUA 4ZMYA 3IPBA 4I0PA 1XR8B 3CLEH 4KOBA 3OJDB 3HBQA 3BVDB 4HBCL 5B1AB 4B0MB 1BD2B 3BLPX 1YMME 1TXKA 2D3NA 2DQTL 3EHBB 4EF3A 1N7MH 4NGHH 1W8EA 3C5ZD 4NZUH 3L9EA 3FAWA 3HHSA 4N90D 4ODWA 3QNYB 4IDJL 3RY4A 2J4WL 4LVOB 4U49A 4OGXH 2DQCH 3PHOB 4OVVA 4Y1AA 3FOMB 1HL8A 4CN6A 4X5PA 5I82A 1HEHC 3WIHA 4ES9A 4NSKA 2L3BA 1O7DC 5MHSD 2WWKO 4G7QB 4ADGA 5H4ZA 3N40F 4LVHB 5LLIC 3O6KL 2IWFA 1TCRA 2JIXB 5EEVA 4KKQA 2L4OA 1JV5A 3UCRA 3BAIA 4QYAA 2WLNA 2W0KA 4YSPA 4PRNA 3CZUB 2KHAA 3GLEA 3ZDXB 4FNPA 4TQEH 4QAWA 1YJDC 3DX2A 4UIKH 5KOVC 3GI9L 3MRPA 4FXKA 3QAZC 3WE6A 2B77A 3T4AC 3W0WD 5KANI 2BVQB 4Y4HA 1S5HB 3TVMA 5D6CA 3VXTA 4ZMPA 3WTWA 1CFTA 2Q7NA 1BD2D 2NXZB 1X5IA 3I50L 2P5WA 4MNHA 3RY5A 5D7JC 1HILA 3S98A 2B0SH 4RQQB 2NOYA 1FG2A 3S36X 5GHWL 5I5MA 3BGMB 4XAWH 1H0DA 2QQLH 4RISL 4ZO6A 1YEGH 4DVRH 5AVSB 2Q8BL 3TA3C 4W4NA 2K4AA 3NP3A 2O6FA 5C0CA 3UIZA 3CPUA 2UYLA 4LBEB 1WFJA 1ZAGA 3NAAL 1NC2A 4XWOD 4LIQL 3HZMA 3ZKNC 4XODA 4LIQE 1ZGLM 3SE9H 1MCKA 4RMRA 4DZBB 1IGMH 3GSUA 2KDYA 5D1QB 4MD0A 3O9WA 4NLHA 4Z0BL 4X7SH 1AHWC 1AR1C 2B4CH 5B39G 3SDAB 3EGXA 1GYVA 3GJFB 2ATKA 2D31A 2FX7L 1KIQB 4X80L 1OWRM 3AQYA 3MUHL 4DKDC 3OM3B 1PD0A 2GW5A 4WI0B 1GHFH 2E7BA 4OZIE 4NOFA 4PW3A 4HWEL 3G6AB 4DN3L 2VDQL 4S1SH 2OW6A 1UM5L 2GBAA 3KGRA 4PR5A 4Z3FA 4N8VA 1IBGH 2VC2H 1T80A 2R9HD 3ARPA 1V3MA 3G6JF 4ZXBB 4KDVA 1PZ5A 2Q2LA 4N1EA 1S7XA 4XPHH 2BSBA 5FUOL 2Q8AL 1WISA 1AANA 4AUUA 5BPPA 3P4OA 4D7PA 1F42A 3S88L 3SE6A 4P5TC 2CZNA 3X3FL 1O75A 3O8XA 4FQHB 5I66A 1FO0A 2WTRB 4OT1H 4H1LG 4NI6A 4ZMAT 3QSKB 5I6LA 1X6LA 4GRWE 3V9EA 2PCFA 3O4OB 2IALB 2RA1A 3QO0B 4G43B 3RVWD 1YJDL 4MXWH 4E42A 2VQ1A 3HHRB 2ERJB 5D1QD 5DJ6B 1IAOA 1JZJA 4OD2B 2Y7SA 5DEZA 4RMWA 4TVPL 3OLGA 4FXGB 4KROC 5KVMC 2GFBB 4ZOCA 3V4PL 4TVPE 5BV7B 3H2PA 5BRZA 3KPSB 2X38A 1PLAA 1W8OA 5AAWA 2B9BA 4U3SA 1Y6NR 3MRKA 1YYML 5IM7A 3VXUE 5DJ2B 3IN0A 2EDJA 3IJHA 3PWLB 1MJ7L 4L8BB 3KLHC 4PD4J 5FYJD 4XO3A 4WI2A 1E9OA 3SY6A 2CUAA 1GW6A 4EI5B 4HG4J 4DPBX 4N0FA 4J6RL 4X5LA 4WSJA 3D25B 2Y25A 1KCRH 5J1SC 2XWDA 2B1AL 3QXAB 3GGWB 3DV4A 2VDRL 4YPGA 2ESVD 3VVVA 1KEGL 5JIKA 3PDDA 1OM9A 2ARWA 2XG5B 2XZCH 4JMNA 4LBAA 3QR0A 4HD9A 3TN0A 5AB9A 2UWEE 4IRSC 5KYWA 5K9QI 3LN5A 4U1LB 1KTLA 4NLAA 4QHUA 5I18L 5DFVC 4X6DE 5CIPA 3HS0C 4U1JB 4JL2A 4POYA 3HLAB 5DEFB 4EN3A 4AWJC 1TJHH 5DFWH 4AI7A 4KJYA 3WHE0 1FGVH 4OCYH 2XBTA 4PCSA 3AXIA 5C09A 2I07B 3OB0H 4PP1C 2PNDA 1T5WA 2O5YH 3F7RA 4NBYB 2V8LA 5KJRL 4WV1A 2YPLA 1K8IA 2J8HA 4U6XB 4CILA 5HYIA 3IXTA 5IB5B 5CWSB 5DJ8B 1NAMA 1UM4H 1INDH 2JB6B 3LOWA 2EIEA 4YGAB 4JRXE 2WQRA 1DEEB 2EYRA 1DDHB 3BH8B 1PLBA 2XRAL 1UZ8B 1KT2B 2IAAC 5A2LH 1HZKA 8FABB 3EFDH 4TSBH 4UDUA 4YIQA 3CN4A 3V79C 2PLTA 3V7MA 1H3TA 1AHMA 5JIIA 1JJUA 4CC4A 1I1YA 2UZXA 2XWJB 4AKOA 4F2EA 4YHZL 3GHEL 4P3CL 1HKLL 1IAII 1EHLH 3CXHJ 5AG9A 4FA6A 1Q90A 2UZIH 2K3HA 3WNKA 2X4OA 3QEUA 4WI6A 2NY2D 3WKYA 3F7VB 2A9DA 2J6EA 4L3EE 1YZZA 3RWDB 1MLBB 4FG4A 4M1CC 4QYOB 1JF5A 3WENA 1LO2L 1T66C 2XWBA 5DYOB 4I0KA 3G5ZB 4AE0A 3PGDA 1J8RA 2D7PA 4FZEH 2BXZA 1SGKA 2NR6A 3LHPL 5C1MB 3SDXF 1QSFB 2ZOOA 2G9KA 3P30L 4KZEL 4ZPTA 1NANI 3L9YA 3GRBA 4KAQL 1NCBL 4HUWA 2VL5A 4PJGA 4X9HA 4MZ2A 5TF1H 2E7DA 4WFFD 2F7IA 2P43B 3C8KA 1CGTA 1DQJB 3HG1A 4L1SA 2YEZA 1I7RA 4ZW7A 4U1HB 5AYQA 2DTSA 2IH1A 3VRLF 3H9SE 2WLHA 2VDPH 3RFZB 3OG6B 1OAJA 4H8HA 2VLJD 2YD5A 2DV6A 4XNUH 3W9EA 4H8WH 2BNRE 2GBTA 1W0WB 4ZOAA 5I1AA 1S9XA 4TKWA 3US1A 4YE4H 3HUJE 2HTKC 2OV0A 3WIHH 4QGYA 4W1TA 4NN6C 1DJXA 1FRGH 3O11A 4UINH 3SEPA 2R56L 2YQ2A 3ARBA 4DAGL 4MMZC 4R7XA 3OC8A 3ECBB 4YSCA 1WSST 3N44B 1A9BA 1FBIL 2XN9A 4M5YL 5GISL 3N1GC 3ZE2E 3NIGB 5KSAB 4LDOB 3ZDZF 3EO1B 5IQ7L 1I9RH 1J5IA 5M94B 4GBXA 4HIQA 5DUBA 1LO0L 4ZUTB 1HH9B 4FLQA 3C12A 2BWIA 5HVHB 2AXWA 5T33L 4G3YH 4HIPA 3ARDA 2EZ0C 2KZWA 3MROA 2PXYB 5EF0A 3V0WH 4LKCB 3ZYOA 4P3DB 1NLBL 5KZCB 3MRCB 3RWFA 2N4IA 1ECYA 2O72A 4MCYA 4Z8FL 3P11H 1B2WL 3G08A 3VFVA 3MRQA 4XR8C 3IJEB 1X4ZA 1I8UA 1QBAA 2NUPB 2W88A 3K5RA 4ICXA 4ETQB 4HJIA 2IDSA 3ZE1F 4XVJH 3CVHL 2WLIB 2FEDC 1AGCB 3PLYA 4Y5VC 2Y1ZA 5EIIG 1RKRA 4GKNA 3SYCA 5FM8A 1JZEA 3TV3H 3NJGA 1QATA 3HRZA 2DJUA 2O61A 2DMGA 2ZKHL 3B9AA 4LLMA 1WEJL 4J3OF 3HZ3A 5T1LA 4NIKB 3WKMH 1NCDH 4X42A 4FXLA 5DHXB 5KSAD 1LXMA 4QXWA 3RU8H 3WJLA 2C1PB 4A2HA 1MVUB 1G7IA 3D69A 1DUZB 5HGHB 2BP8A 3GYRA 1CBVH 5E95B 2O5XL 3UBXI 2NZ9C 1PG7L 4LDLB 1G84A 2KL6A 1KIPA 1RLBA 4J28A 1E30A 2ADFH 3SKNA 2PXYD 4QTIH 1GAFL 1MG2C 4ODHL 4ZMWA 2F5BL 3VSVA 3ZXAC 1MJ8L 1RZIB 2XOTA 1AVAA 1S9VB 4OUUA 1PW3A 1A21A 1V54B 1WS8A 3CMOL 1R47A 4I3RL 5SWQA 1FAIH 3GIVB 4Z7OE 1HWHB 2ICEA 2FECI 2WZAA 4OBRA 4TV3A 1L9NA 1WIUA 4G83A 1VHPA 1FVDA 3O6FA 5DSCB 2N0MA 3GXDA 1N59B 4LQFH 5KVEE 1FO0H 4NI3A 4NZTH 5IV2B 3O45A 3L45A 3NJKA 1C5CL 1QACA 4L9LC 2K3TA 2Y2WA 3W1ZA 1ONQA 3UPRB 2X10A 3FHQA 3MCG1 4UQ9A 3BFWA 1KBGH 3TBYB 3D0VA 4L1TA 1OCOB 1WFUA 4BKLA 3BD4A 1YYLL 4TUJB 1FYTA 3OAYH 4XN7A 2J8UF 5EU4B 3QUMA 4HKBB 2ID5A 3IBEA 4W9DC 2ZSWB 3FN9A 4N2AA 5J5EA 1E4XH 1F45A 3AMKA 4H25A 5I73C 1F3RB 3ZE0E 3JUZA 5INDA 4BFBD 4NHUA 4NPYA 2YD4A 4B60A 3MOBL 1C1EL 5GS0C 1JDDA 1YLBB 2FHFA 5D1ZI 5IHBA 2F5AL 3DDGA 2VERA 4DPRA 1J87A 2BJMH 2V6HA 4N1CA 5EO9A 1CI5A 2NX5E 5IGXL 4D0CA 5MEQA 1U8NB 1IBDA 4XC1H 3HC0B 3V6FB 1U2CA 4LCIH 2L7JA 2A9NL 5E8DL 4LHUA 2V7HA 3OB8A 3MZTA 1IEHA 4Z76B 3WO4B 4PLOB 1N2RB 2H41A 1FIGH 1SDDB 1KIUA 2WZ6A 4ORGA 3MCLL 4LAQL 3TFBA 2FIKA 2MPVA 2XZAH 5DWUL 5CIPH 3IS1X 1JXDA 1HSBA 2GT9A 3EYUL 3PHQB 4A7UA 2E8YA 3L2LA 4NQCB 3TBSB 5IKCB 1AE6H 2CAKA 2EKSA 2JSFA 5E2UL 3SBWA 3T3PE 1TYRA 3IN2A 4PWKA 2FD6H 4IBVA 5SX5H 2PCPB 1SBBA 4LSTL 1XIWA 2FVNA 2PABA 2ZWNA 4UAHA 3QGVA 3VXQA 3WSQH 5LXGH 4A38A 4FZ8L 1SN0A 2NQCA 5KBNC 3VQ2C 5E4IA 2G4GA 4YK4C 1AXSA 2V0AA 3T0VA 4BUGA 2EE0A 3VGHA 1BQHB 1NAMH 2IG2H 4GSUA 1FC2D 1LWRA 1RU9H 1E43A 1IM9A 4FQXB 3D50A 5FK9A 3ARUA 4NQTA 1E9PA 1ZWIB 4KK8D 4NM4H 4FABL 1BWWA 1ZA3A 4QXGH 4WSGA 3D2UA 1B6UA 3BKJL 1I3GL 2QMKA 4HAKA 3P73B 2E0PA 3WU1A 1XAKA 3O6MH 1TU2A 4R2GD 2ED9A 2JV6A 1A3LH 3OMNB 5TDNA 3OMZA 4Z78B 5EEXA 1ZS8B 2J88H 2WLYA 4UTAL 3MBXL 4I87A 1JRHI 3TOPA 4MB5A 4NQCD 2J6EH 4CMMA 4EBQL 4ADJA 4ENED 1M7DA 4JZJA 3H7BB 4HLZH 2EC9U 4PRHA 2LQRA 3MRFA 3IFOA 5CN2A 5GS0L 5HYSA 3V2AR 3VFNA 4PGDA 5KJ4A 5A40E 1COBA 2YUVA 4JQIA 3SYAA 5JIPA 4AOFA 5IFJB 4ZO8A 3A67L 2DMBA 2EKJA 4W9ZA 1T2JA 5IJCC 4HKXA 4PI0A 3T0BA 3I3EA 3QULB 1JVLA 4QY8B 3CX5K 1UQSA 4MA3B 1XB6A 4R97B 4XC3H 4ZDHB 1I3RB 3A4FA 1R0AL 1MHHB 1HN1A 2EAEA 4JFOB 4Y19B 4XP9H 1NLDH 5BW7C 4HLEA 3NTCH 4POZC 4TOYL 4OZGA 4PRID 2P47B 4YHPB 1ZDQA 4P5KB 1IBBA 5JA9A 1N0LB 4MGXA 3KPOA 2QZ5A 3QQDA 3QJZA 1YEJH 5EEUA 4HHAB 3S3BB 2FWLB 3QPKA 4TPRH 2CR0A 3LQAH 1Y0LA 5T1KA 3QDMA 3IKCA 3VCLA 2JB5L 1SHWA 2GB2A 4H7VA 3T65B 1ZHBB 4CKVX 2XWTA 1TFHA 2VLRB 4I5BA 3U9UB 3PAZA 4N5ED 5F6HJ 3QORC 3EYOA 2XQBL 4NUMA 1L0XA 2ZE0A 2OZ4L 1GGUA 5D4IA 1U8IA 3FO9A 4HEME 5CN1A 2GYSA 3EOTH 2LGNA 3MACH 1R3HA 2A6KA 3LN4A 2YZ8A 4YQXL 4N0RA 4ZTOL 1QBLL 1F1DA 2MTPA 3SYOA 1C5BH 1JF6A 1HHHA 5IVNA 2FIRT 1CLOH 2DQHL 1LJMA 3G5VB 5BQDA 3GSNA 4XVOA 5I19H 1HL4A 5IVXB 1NGWB 3KDPB 3FQUB 5JDJA 5LCVL 1DTUA 1WCQA 4CN4A 4IBWA 1LEKA 4P49A 2YQBA 4WO4C 4X9GA 4QRPE 4Y9BA 2BW4A 1E7UA 3ESPA 5FA3B 1QHQA 2A9ML 1IM3A 2RH0A 1E2VA 5JHDE 4X7FC 2UX7A 4A7GF 1NSNL 2QT6A 2DM3A 1E4HA 3C2SA 5LAPA 2ZF8A 2X3AA 4XX1G 3D8MA 1LYQA 2OPCA 3UC0H 2ZX8A 3LB6C 4R3SA 5GZNC 4XXCC 4JFFA 1P4BL 2R27A 5D4QA 2Z64C 5IHZA 4HH9A 43CAA 3BFOA 5I6KA 5JIQA 4GEJA 5FV2A 3BWAA 5TQ2H 3FU9A 1IE4A 2ED8A 3NFNB 5DJXB 2NNCA 4QRRD 3OKKB 3DXAA 4M3JA 1KNOB 5AVTB 3B9KB 4B53A 3GPEA 3HG4A 4E41B 2QQNH 4Z5RA 1YY9C 4ZNEA 1G7HB 3UH8A 3GBML 2LLNA 1JZ8A 2WJ7A 1JE6A 3RB7A 2VSMB 5CGYD 3ILPB 5IQLA 4NZRL 3S5ZA 3M1BB 2N7AA 2WUCL 5D7IA 3CSPA 5KEZA 4M7ZC 1ETZA 4LCWB 2WUBH 5IW6B 1SVCP 1HI6B 3NP4A 1IGIH 1WZMA 3MLUL 2WNGA 3GINA 4TNWK 3I6LE 4AIOA 1ASPA 1D5MA 4NNPH 3VO0A 1XR9A 2E86A 1UXWA 4G59C 3G7TA 1HE7A 2CJUH 2XJLA 4GLRH 1PFOA 4L2LA 2IFFH 4KZCA 1RZQA 1FV1A 1CE1H 2BNQA 3QUMH 2CLVA 3CN3A 2X1QA 3OKNA 1AQDA 3MJ9L 3TZVC 5F9WC 1UT1A 1JPGA 1Z9LA 4LEXL 2BOBB 1TO5A 1AMYA 4RRPM 4F8PA 1P6FA 2NY3C 2QVTA 1U3HB 2PO6C 3SCMB 3KLQA 4CC1A 1M53A 2CSPA 3B9KD 4MAYB 4AEHH 2G2NA 4JZNB 2OR9H 3WIFB 1URZA 2V2XB 1QTYT 3JV6A 4HGWA 3VXNA 1NDMB 3SKOB 5HJGA 3OAUH 4L37A 3Q6GL 3VB8A 1IC5H 1NGYB 2F2HA 3E8VA 3VG9C 2X4UB 5DEGB 4NAQA 3VXOB 3VYPA 5E08H 3P9MA 3K7UA 5I71B 4LCWD 1HYRC 3A4DA 3P0VL 4LK4A 3HG0A 5BVPH 2IH8A 1X44A 3B9VA 1UD3A 4NZJA 2ZKXA 4X8JB 3HZVA 4Y5YB 3AU0A 5AOMA 3SN6N 3MRRB 2PPAA 3BT2H 1I1RA 3NIDF 2PPDA 2LHAA 3W37A 1KJ3L 5F6IC 1UADC 5HD8D 4XMUA 4Y16C 2ENPA 3ABKB 5KYNA 2G60L 4JR9H 5IF0A 4AX3A 4PRBA 5T1DH 2APBA 3BVXA 1JZ5A 4UNIA 2WQXA 4M7LL 4OB5L 5LKNA 1FL3B 2IEPA 4G9DB 5GGSA 2FSEB 1A25A 1U3HD 3SCMD 4E9VA 1NAKH 5A3ID 1ZHLA 5TQ0L 1DSFL 1LD9B 3FCGA 4G6KL 2B3IA 4M5ZL 2K7PA 3SOTA 3VGDA 2OW7A 1EEYA 2UUDK 5GJSL 3QUZD 2A6DA 1M4KA 1YVLA 3MLSL 1DJHA 4FFVD 4I9WD 5D2NC 4NKDB 3TBTA 2VDOH 3ZKMC 4R5XA 1Y1DA 1H5BB 3L4UA 3U36B 4F8OA 3E2HB 3STZB 2D7QA 3IE4A 3QUYB 4HIHA 2F53E 2ZXEB 1P5UA 1WFOA 3ISYA 4UT9A 3DYPA 1UXMA 2R29L 4LLQA 3ISRA 4X98A 4YDIH 1MY5A 3QWRA 3VJ6A 4PJ8C 5JXAH 5FFOA 3GSVB 4AZ8B 2DZEA 3CE1A 2C26A 3UIYA 4QRQA 1HZHH 4TRPH 3F6IA 4EAEA 5L7XL 4JM2A 4G42B 4PJDB 1CI3M 3FCBA 2L04A 4HXAH 5KVDH 3BRDA 1V27A 2CD0A 4AL8C 2COVD 3UYRH 3QCUH 1EZSA 2Y5TB 4ORZC 5GGUA 3NN8B 4MJIB 2ZWSA 3RJDA 1OTSC 3QRGH 1M7IB 4JQIH 3DKHA 3MBEB 3NMEA 4P04A 4LSPH 3WEBA 1JDAA 4JFDA 4Z9KB 3NK4A 4JRYE 4PS8A 5F3HA 4A6YH 1F6FB 3LRKA 2WLLA 3HE6B 3QHTC 2XACC 1RUMH 2C9AA 2V5TA 2OJEA 2AQSA 3KPQA 1TQBC 4H26B 4PGBA 3MODH 2NDGA 3QUYD 4JN1L 2VN7A 2Z92A 3APDA 4K9JA 4KI5C 4WK2B 5DD6B 5FM4A 3QIWA 5FGBA 3CH8A 5JOPD 5BNXD 1S9WB 3L3OC 2CIIA 4EI0A 5CSZA 2VB5A 4HIIA 1G7LA 5EWIH 1INQB 2X44D 3L48A 3DX6B 2NQDA 2HRPL 5TE6L 3JWOL 2IJ0C 3O6LH 3SY0A 3QRFM 3CFQA 2NY5H 2F0CA 3BN9C 3MI6A 2HFEB 1BVLB 3ARGC 1NMCB 2AXFA 4KTYA 4C8XA 4XGZB 1XF5B 4GXUN 4Y2DA 3D51A 5IESH 3EBAA 3DARA 1S3KH 4UDTA 3B3IA 4AKQA 3EG9A 2AEOA 1WBZB 4OGAC 3MBED 4PBXA 1AY1L 5EPMB 4O00A 2VMEA 4X7EC 4MMYA 2RAMA 4UM9A 2IF7A 1VFMA 4K9EC 1TCMA 5D2NE 3RVXC 4H5SA 3GSNH 1D5ZB 2VE6A 4F37F 4ODUA 1AQHA 1BZQK 5I8OH 2FZ3A 3HC4H 3Q3GA 5ICUA 1FVCA 4R84A 1TQTA 3C9NB 1H15B 1DFXA 4LU5L 1J1OL 1JF1A 4QPEA 1AD9A 3WHE1 2QL1A 5AWNH 3LKNA 4GMTL 4AQAB 3VD9A 2VLKE 2P8MB 3MAWA 2MHAB 5D6DA 3IEAA 4TUUA 1I7TB 1FNHA 4MZ3A 4W93A 4F3FA 3GZQA 1X5AA 5I6XB 1IO4C 4GP5B 2YPVL 1OP5K 3T0EA 3BZEB 5B4MC 4JS7A 3P4MB 4FYTA 3FHEA 4XX5A 5C3IA 1LNUB 3ULAB 4I0PB 1OAQL 2Z8VC 3LZOA 2JCWA 1LDSA 4XHJC 1G9MH 1H19A 2R15A 1IGTA 3DJRA 5LUMA 4PJHE 1QLEL 2M83A 5IHLB 3NJNA 1O6SA 4UF7C 2ZOTA 4XPGL 3FTVA 1ROWA 4JQVC 4Y1AB 2AJYL 2YXFA 1U8PA 4I13B 4OU3A 4S1DC 5IQ9B 1IFHL 4KI5E 1OF2A 5BRQA 3O81A 3RP1A 5BZWB 4F1SA 2KI6A 1XGUB 2FBJL 2X2HA 3LHAA 3QQXA 3P4NB 2OSWA 1L6ZA 1TCRB 5D5ME 3INUL 4ZQKB 1JV5B 3FQXA 4KK6D 1KJ2A 1R46A 4JM4L 4MS8D 4W81A 4KXBA 4PRNB 1NA8A 3EYQC 4CA4A 2QSTA 2JQZA 2W0LA 1G1KA 3HZKA 3GS0A 2ZUQB 5ICYB 2WK2A 5IQMA 2YAEA 4XN5A 2WINB 2WO3B 4PJ5D 1A1OB 3WE6B 1X5KA 4FNSA 4I0PD 3H3BC 5MI0B 3VXTB 3NCBB 1CR9L 4MJ5A 3WELA 3MRIA 1MIEH 3EJPA 5KS9B 1CFTB 4K9EL 1N3NA 4RGNE 2B5IC 1ES0B 4A2DA 3OKOB 4HWBL 1ZLUK 5C2UB 4PW4A 4HD5A 2DM7A 3PQYA 1J86A 1FG2B 1OSYA 3D4GA 4Y1AD 5AB2A 3KD4A 1H0DB 3P2BA 1ZIBA 5GRVK 4PV8B 4NKMA 4KO7A 2CKBL 5CKGA 5J9PB 4D3CL 2UYLB 2Q76B 3ABMB 1PGRB 3GHBL 4MNGE 3MZGB 5E5RB 2WO2B 3DC0A 3OAZK 3IGAA 4HJ0C 3HZMB 4EDWH 3MFGB 1SFDA 3KPRA 4GRWB 3FYEB 4PJAA 2LOEA 3OHXA 1JYWA 3WS3A 3GSUB 3MV01 4ZUSA 4PGEA 2VZ3A 3O9WB 3QP3A 3KBFA 3LIZH 4L9DA 3OPZH 1HQRA 2R0WL 2ATKB 2BVEA 1LHZA 4Y4FD 3OWRA 2VR8A 4EPSA 2KZKA 1YYCA 3U2JA 3L5WA 3AQXA 2LU5A 2Y7QB 3QAZB 4MYWB 4FHKA 1JYVA 4J3TA 4Y4HD 1TZGH 3T4AB 3TVMD 2WAHA 3QPXL 3X12A 3V4PB 1G0XA 1L7TL 4PR5B 5JR1L 3PRZA 3QDJE 1Q9KA 4DETA 3TFKC 1PZ5B 4ZO9A 2V8MA 2P5WD 5JW3H 4KUZL 1N6UA 3P4OB 1OALA 2QDVA 4LSVL 1H6EA 3ARVA 4DO4A 5I66B 4G9FB 1FO0B 3B5HA 4XCNA 4R7NB 5GRJH 5C0CD 5L9DL 5TPWL 4G6AC 2IQAA 4POUB 1NC2D 1E4WL 4P5MA 2PCFB 2EVFA 1NKOA 3Q6FA 4NM8L 2I27N 2XV2A 1T03L 4I1RA 4YSRA 1WZKA 4E42B 4XN2A 2VQ1B 4UT9H 4XPTH 3O9WD 4ZYKA 1UT9A 4IK6A 3U6RB 3X1BA 1UOVA 1HXKA 2CBTA 1CDCA 2EILB 4U2YA 1YN6B 4ICWA 1ZPUA 2D7TH 5DURD 3MV8A 1MFMA 3ALPA 5CCKH 2GUOB 1MOEA 5HDWA 5BRZB 5F8QC 4GAFB 1HFUA 4U3SB 5KOMC 1ULVA 3MRKB 5I26A 4EJ1C 2YAQA 2F68X 5IM7B 5CN3A 3IJHB 1IAIL 2OMUA 5D1XC 1X7TA 3I9AA 2HLEB 3UG5A 2C4FU 3VA6A 3CU1A 5E00A 3F2LA 3O4LA 5F21B 4N0FB 4AG4H 3PL6A 3RVVC 1IL1B 2BXYA 2GIXA 5ACLA 3F00A 3DV4B 1QKZH 3AC0A 4YPGB 4YXLL 3S35H 4A7VA 3O8XD 1AKPA 4P5TB 1ZSDA 2B2XH 4NZ8A 2CQVA 3TN0B 5EOTA 2OXHA 2EE9A 3QJTB 1BQLH 2D73A 3LN5B 4YUEH 4N5UA 2VMDA 1BFVL 4QD2E 4QHUB 5IB2A 3QUXC 1BFTA 5BS0E 3VRIA 4EN3B 3LKOA 4KJYB 5TE4L 3QI9A 4U3XA 1DZBA 4KDTA 3VFTA 1KPRA 3L5JA 4JDVA 4YEFA 5C09B 5KJ7E 1I1AD 4GFTB 1T5WB 4WU5B 1CZ8H 2GITA 2OJ1A 1BW8A 1QWHA 2AAVA 5E9DB 1CF8L 3HAEA 4KXZH 4WV1B 2BHZA 4F57H 4ZMOA 1K8IB 3R7RA 4NCDA 4I3SH 4YSDA 2HWZL 3ILEA 3IXTB 4RLDA 5EO0A 1RFDL 1NAMB 1EO8H 3NCFB 1CIDA 2DPKA 4NO0A 2AQTA 1WCBA 1B9ZA 1H3GA 3IM1A 5F1IA 1CXHA 4UT7L 4ZMNA 4UDUB 3MRHB 3B2PA 3DTDA 1E67A 5AW4B 5HDQH 2AEPH 4WWNA 2OL3H 1FNGA 4PB9L 1LK2B 2E76C 3M1OA 3WI9A 1MHEA 1I1YB 4S1RH 4LKXA 3AB0C 4KC3B 5ETUA 3TN0D 4AT6B 4IRSB 4HZLB 4KK9D 4YBQC 2I7SA 2X4OB 1ZDSA 2Y6SC 3FUDA 5JUEL 2DEYX 1KJVA 3HS0B 4EN3D 2DQJH 2P24A 2BIIA 2ZONA 1FQ9C 3U2IA 4AC4A 1U8KB 3FKUS 5ADOL 3MR9A 4PBWD 5GXBB 3TESA 4P23A 3R7QA 2XWBB 4ONHB 1A6VH 1U58A 2EUVA 1YEEL 5K9OA 1C08A 2G5BA 5C8JA 3GDCA 2F58H 2YPLD 2GY7B 3BZDA 3LZLA 3ZE2B 5C70A 4L1BA <