1A8ZA

Structure determination of a 16.8kda copper protein rusticyanin at 2.1a resolution using anomalous scattering data with direct methods
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
b'LDTSWKEATLPQVKAMLQKDTGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLDIPAGATVDVTFINTNKGFGHSFDITQKTPPFAVMPVIDPIVAGTGFSPVPKDGKFGYTNFTWHPTAGTYYYVCQIPGHAATGMFGKIVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUSTICYANIN
molecule tags Electron transport
publication title Structure determination of a 16.8 kDa copper protein at 2.1 A resolution using anomalous scattering data with direct methods.
pubmed doi rcsb
total genus 34
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 1998-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1a8zA00
5B3SB 4A2HA 1JZFA 2ZWNA 1GY2A 4DPCX 3FPYA 3CDZA 4A68A 5B1AB 1M57B 2PCFA 4YSUA 1PCSA 3NJIA 5D4HA 3ABLB 2BZ7A 3DTUB 9PCYA 5PAZA 4HAKA 1NIEA 1J9RA 1A4BA 3FU8A 4PAZA 1A4CA 4RH4A 3FSZA 2YAEA 1E5YA 2PPDA 1J5DA 1A4AA 1A8ZA 2I7SA 4AKOA 1B3IA 3TU6A 1MG3C 3TBBA 1PLAA 1NIFA 2FQEA 2A3TA 4PCYA 1M9WA 1SNRA 4YSDA 2QT6A 4QLWA 2YAOA 1KV7A 2GB2A 2XVBA 4FA7B 5AFAA 4CSPA 4WKXA 1N70A 2HX7A 3SBRA 3QJQB 4BXVA 1KDJA 2AVFA 3N55A 4G7RB 3FQYA 5I6KA 5I6OA 1ET5A 1OF0A 1NINA 3N2JA 1PZBA 3QQXA 7PCYA 1E30A 1AG0A 2JKWA 1HAWA 2Y1AA 3NJFA 1GS6X 4HIPA 3FYEB 2MRYA 1TKWA 4K9JA 4YSOA 1JZEA 3ASOB 1E67A 3QJTB 3S3DB 2UXFA 4UF7C 1WS7A 2P80A 4KNTA 4YSAA 4BK5C 4YL4A 2B08A 2ZXWB 1NPJA 3NJGA 5B1JC 3AW5A 4GY4A 4HHWA 3X1BA 2MTAA 1BYPA 2FJSA 2J57A 2PPEA 4FAAB 2YXWA 2VSKB 3UADA 2GC4C 3NJMA 1JXDA 1PLCA 2WO2B 1AG6A 1XMEB 3AY2A 4GP5B 1GY1A 2QPDB 5F7AA 2CJ3A 1AZBA 1IBZA 4A66A 2FQDA 1TEGA 2H3XC 3S8GB 3FYIB 1QNIA 2XV0A 3PCYA 1BQRA 1JVOA 7PAZA 4KNSA 1PF3A 3CVBA 1W6WA 1SFDA 5I6NA 4HCGA 3FSWA 1IKOP 2W8CA 5B1BB 1PLBA 2IWKA 1KBVA 1OOWA 3IEAA 2ZONA 4F7KA 4GP8B 3GDCA 4BXSV 1KYAA 2CALA 2JXMA 3SBQA 1OV8A 3NP4A 2YQBA 4F2EA 1OCCB 3QJSB 3FPXA 4G7SB 3C75A 3DKHA 1KBWA 2Q5BA 3FS9A 3QJRB 2YAHA 1QHQA 3H4FA 5I28A 2E86A 5I6MA 3NJJA 4ENZA 2XXGA 2PCYA 1OCOB 2VM3A 1AAJA 3G5WA 3AZUA 5B7EA 2WO3B 3FU9A 3S3CB 1AOZA 2AZUA 2RACA 2HRHA 5TK2A 1NWPA 4G70B 3WNJA 2UX7A 1BYOA 1SDDB 4M3HA 2IH8A 2XV2A 4N8UA 1GW0A 2FT8A 2I85A 4AZUA 3AG1B 2FQGA 1E65A 4BDVB 2BP8A 1RCYA 1NZRA 1SF5A 1V55B 2PPFA 4DP6X 2EIKB 2PP8A 1M56B 2YAQA 3MBWB 8PAZA 3ABMB 1RKRA 3HB3B 1J9SA 1BQ5A 1JERA 3EHBB 1ET7A 1DZ0A 1AZCA 4E9TA 5A7EA 5AKRA 3WI9A 2CBPA 3PAVA 4DPAX 2FQFA 1URIA 1MZZA 1EHKB 3OMAB 3HEIB 1CUOA 3SBPA 4YSQA 1HFUA 3OMNB 4YVNA 5B7MA 4YSTA 2IWEA 3DIVA 1JZHA 3IN0A 4UANA 3TA4D 3ABKB 2FWLB 3T6ZA 2AZAA 1GS7A 2X87A 2XXFA 1NTDA 2J56A 4DP5X 4DP2X 1J9QA 3FSAA 4A2EA 2H5UA 4G7QB 4DPBX 2R7EB 5B1JA 4JHUA 4E9YA 1KGYE 3ERXA 3NSYA 3JTBA 2OJ1A 1JXGA 3IBOA 1R1CA 4KOBA 4N4YB 4X4KA 4KO7A 2PPAA 2GHZA 4DP1X 2CAKA 3QPKA 2UXTA 1X9UA 2XYBA 1W6LA 1IC0A 2IDSA 4MFHA 2XLLA 1BQKA 1VLXA 2BW4A 1ZIBA 3OD3A 1SF3A 2XU9A 1NIBA 4A2GA 4E9SA 2BZCA 1TU2A 1KDIA 3H56A 4Q89A 1GS8A 2QDVA 3CVCA 4BDVA 4GP4B 2BP8B 3WNIA 1BXUA 1F56A 1NIAA 4UAHA 4HCIA 1KCWA 1IBYA 4G71B 3PPSA 4HALA 2YXVA 4ZK8A 3S3BB 4F2FA 1PY0A 1MG2C 1ZDSA 4M4RB 4A2DA 3FU7B 3AG2B 2BO0A 4EF3A 3WKPA 1ETJA 2Q9OA 5I5JA 3NJNA 5IY5B 1AR1B 3ZIYA 3FQ1A 1L9QA 2VN3A 1ET8A 1JXFA 1JZGA 2VW6A 4W9ZA 1BAWA 4HZ1A 1J5CA 2IDFA 1JOIA 3OMIB 5ANHA 3UAAA 4BWUA 4YSPA 1AIZA 2QPEB 1AQ8A 2W88A 1A65A 1ADWA 2PP9A 4KO5A 4E9VA 5LDUA 2PPCA 4JHVA 2R7EA 2DYSB 1NPNA 4QKTA 2GSMB 3ASNB 4YSEA 2DWTA 4TXVB 3V9CA 1CYXA 4YSSA 5F7BA 3X1EA 1GR7A 1DYZA 2ZOOA 2VSMB 4NERA 5EHFA 4NB7A 1BXVA 3RYMA 4YSRA 5E9NA 3X1GA 1FA4A 2XV3A 1CC3A 4DP9X 1ZPUA 1WA0X 2HXAA 1NDTA 2UXVA 1V54B 3H4HA 3OM3B 3EF4A 2VMJA 3TBCA 1L9PA 4E9WA 1HAUA 1ID2A 2X88A 4E9QA 4AKQA 1SDDA 3GXUB 1AZNA 1L9RA 1XB8A 4WTQA 2QDWA 2IH9A 2UXGA 3T6WA 4E9XA 2XUWA 3OQRA 4Q8BA 2PLTA 2H47C 2OCCB 3D12B 2GIMA 4CSZA 3KW8A 2IDUA 2JFCA 1BEXA 5TK4A 1ZIAA 4AI7A 2HX9A 3BQVA 1T5KA 1PNCA 2CCWA 4P5SA 5B1KA 1PZAA 5I6PA 1CURA 1AS6A 3KW7A 1XB3A 1ZDQA 4W1TA 3T6XA 2VW4A 3PAUA 4JKNA 2J55A 3V9EA 1AS7A 3WG7B 1PZCA 2BP0B 1AACA 2DV6A 3ZDWA 1PMYA 3FT0A 1OCZB 2XX0A 1XB6A 3UGEA 1AANA 1WA2X 3T9WA 2TSBA 1NWOA 2DYRB 5I26A 2BW5A 1SHWA 1PNDA 2AFNA 2EIMB 1L9OA 2FT6A 3L45A 2B3IA 1TEFA 1JZIA 3PXLA 1L9TA 3TASA 4AKPA 3CVDA 3WIAA 4A67A 2J5WA 3UAEA 1SJMA 3PLYA 2VM4A 1J9TA 2XX1A 1QLEB 4G72B 1ILUA 2EIJB 5I6LA 4HHGA 4AX3A 2BWDA 2WSDA 5I5MA 3NSFA 1BXAA 4NAJA 1MZYA 2EILB 1YLBB 2BHFA 2DWSA 1ILSA 2IDTA 3NJKA 4DP8X 3U25A 3T6VA 3CG8A 2UX6A 3FSVA 1WA1X 3IE9A 4DP7X 1WS8A 4DP0X 1W8EA 3NP3A 1NIDA 3NYKA 2YAMA 4L0PB 5D4IA 1RZPA 2DY2A 3EH5B 1NICA 2IWFA 1AZRA 3X1FA 1EZLA 5D4JA 3X1NA 2HLEB 2NRDA 3FU7A 3ZBMA 1FWXA 1X9RA 1ASPA 2FTAA 2IAAC 1IUZA 2GBAA 4P5RA 3CDZB 2BP0A 1N68A 2EINB 3T71A 2GI0A 3AG4B 5PCYA 4E9RA 4YSCA 6PCYA 1AS8A 1I53A 4KO9A 1GYCA 3NT0A 3SQRA 1V10A 2HZHA 3NJLA 3NSCA 1E5ZA 2FT7A 2PP7A 4GXFA 5I5IA 1SHXA 1L9SA 3S8FB 2P80D 1JZJA 3BVDB 1CYWA 2AANA 2YAPA 3EH4B 2CUAA 4KNUA 3WKQA 3X2QB 3ZX1A 1ZV2A 2IDQA 3IN2A 2FNWA 1ASOA 3EH3B 4BWWA 1RZQA 1PAZA 1WAEA 4YVUA 6PAZA 1AZUA 3QJUB 5B7FA 2XWZA 3QJVB 2HRGA 2VW7A 1OE1A 2I7OA 5FC9A 1UATA 1MDAA 3NSDA 2TSAA 1GSKA 1JVLA 4GYBA 4HCFA 2BWIA 2LLNA 3UABA 1KCBA 1A3ZA 1OCRB 3FQ2A 4KOCA 4DP4X 4A2FA 3MX0B 5AZUA 4BWTA 3JT2A 2YAFA 2GC7C 3NJHA 1SFHA 2N0MA 3GYRA 3CZUB 1OE2A 3UACA 2OV0A 3PAZA 2YARA 2HX8A 2Y69B 4KO6A 1ASQA 1OE3A 3AG3B 3ABGA 1FFTB
chains in the Genus database with same CATH superfamily
3LIUA 2JB6B 3SJVE 5DEJA 5CHNB 1ODUA 3W9DB 5HHOE 3P0YL 4KVNH 5MEPB 4LP5A 2A9ML 5JW5B 3LMJL 3IDYB 5DVMA 4BGLA 5G2NA 1RULH 4DJMA 3VFMB 4JM2D 4DUVA 4H1LG 3TJEL 4KITB 5CBEA 4DN4H 5L88H 4YH6A 3K46A 2GJZB 4ZW6A 1UCBH 3DSNB 3WO3B 4OZIB 1INQB 3UBGA 3L9YA 1C08A 1A4AA 3C60D 2O6FA 3JWNG 3QUZC 3QUYD 3S96A 4YNYB 3RG1C 2ZCHH 5FYKE 4QHKJ 5ICZA 4Y4KA 4MDJB 5D1XE 3CSBA 2XVBA 1S5IL 4PJCE 1BZEA 1N70A 3DHUA 4ZD3H 1AHWA 1QAWA 5I6OA 4WUUA 2WQRA 4W9EC 4Z7UE 5C7XL 1I8KB 2J1YA 4DK5A 3UTQA 3QQXA 3SE3A 2ADYA 3JV6B 4YBQD 1UYWL 1RERA 1YMME 1QFUL 4X8CA 3KPQB 4I9WD 3ZE0E 2XT1B 2WKOA 3O9WB 2F5AH 1E67A 4H8WC 2DJ4A 4JHBA 3L2NA 3QVAA 2EYRA 5D1ZB 2ZWLT 1HKLH 4TUKL 1OW0C 2ADGB 5FV1L 3L16A 4GG6F 4AMXA 1A5FL 2Z0BA 2P4AB 3CBKB 2DMCA 3RDTC 2YPVA 3BZFB 2WN3A 3V0VA 2YMXH 5E2VL 5LNEA 3UMTA 2VJ8A 4N2EA 2G75B 3DO3A 1T7YA 5T1LB 5D2NA 1XR9B 5DMKB 3TBWA 5L9DH 3LKQB 3IPBA 4KJYA 3HIZA 2EH7H 1HHKB 1FFNA 1UM4H 4K55A 4XWOC 3RY5A 1ZT1A 2R1XB 3OAUH 3DVGB 5EZPA 2VLME 3VFSA 3QQ3B 4U1NB 2BVQB 5FGCB 4L8DA 5BOZG 2EAEA 3OWEA 3SE9L 3D51A 4NQEE 4DGIH 1BD2E 4EMZA 4P3DB 2ZSVB 5FO9B 1AVAA 1YY8A 4OM1L 3T3MB 2F0CA 3LZLA 2FYVA 2WVSA 3FT9A 1U8CB 1R75A 2GIYA 1IKNA 3EYQC 3ES6B 3QW9A 1GHFL 1M7XA 4ISVA 4X5XB 2KZ1B 4EIGB 1A9EA 4LLVA 2Y1ZA 4NO0A 3V5HB 5D72L 3ZTJG 4LOEA 2YAHA 3GMPA 1D6VH 5KVFE 2R0ZL 2PCYA 3SKUD 2NNFA 3WO4B 1N59A 4LLQA 3BWUF 3UPRA 4EI5B 1A47A 3FU9A 1QD0A 5DMIL 1HL5A 4RMVA 1HOCB 3MC0A 1H9VA 3T4AC 3WNJA 4G1MA 1U95B 2D0GA 1F41A 2A9DA 3FL7A 2H32A 4XX1G 4KXCA 4AZUA 1QWNA 2HPOA 1KIQB 3GRBA 5JIHA 2FQGA 5AZEL 4ORZC 5H35B 1SF5A 2ZUUA 3LZFL 4OGAC 5ERWA 5BZZA 1QTPA 3BUYA 1VJSA 5AVQB 1A9VA 3ELAT 5KVDL 2WBJA 3CMOH 3ZE2E 1MCCA 2LABA 1MCHA 3OKMA 3TPUB 3FSOA 1TLKA 3L3OB 3OC8A 4N6RA 5L7XH 2DLHA 2FEJA 2WTOA 1HYSD 1MIEH 3ZZSA 2OMNA 3OL2A 4B7IA 1G94A 1TQCB 2D73A 3TO4C 4EEEA 1PYWA 4H7VA 3W0WD 3LIZL 1DUZB 2AJUL 5DJXA 1DJWA 4X8JA 1BWMA 4LU5H 3MZGB 4KDVA 5KSAB 5D8JH 1NANH 1ROCA 4NAMA 2WZPD 4DP2X 4WW1B 3N06B 4ZQKB 1FDLL 2PCPA 2QGBA 1KGIA 3HW7A 1WZLA 2PO6D 4KY1L 3U9UA 4S1DD 5B1JA 3FBKA 2FX9H 4K3JH 2ZXEB 4P2QE 4HLZH 5DEGA 3MRRA 4GAAA 3IJYA 2D7OA 3WEMA 4AK2A 5A2AA 3CBRA 4ZG1A 1RIUL 4CW1B 4X80H 1ZXQA 4C4UA 2D2CC 3PJNA 1PJ9A 4N0UE 2OMZB 1KCUH 3CN2A 4XP5H 5AB0A 3L1OH 2KHAA 2ADIA 2XLLA 4IIQC 4I18A 4FRWA 1BD2A 1F90L 4WI2A 5GS0L 4A2GA 4TSBH 3IGKA 1YEIL 3MO1B 4PV9B 3L3KA 1B2WH 4WDIB 4R7NB 1U92B 3EOAA 2X09A 5E2TH 3TT1L 3PPSA 2YA2A 1ZVSB 2NSQA 4HALA 3ME0B 4J28A 2KLTA 4WI8A 1NC2B 1OPOA 5DC2A 1MAKA 2NNRA 4QF1A 1IIIA 2JE8A 4A6YH 3V0FA 4YR6B 4V11A 1LTXA 3BWSA 1DANU 2ESVA 1ETJA 4MA3B 5I5JA 3QO1A 3LRKA 2XDHA 1D6EA 1T3FA 3UIYA 1TYJA 5EUOF 1EEYA 2X4QB 4F5CE 1FH2A 2NY7H 3MRGA 3ARDC 2ZF9A 5JPNA 1BV8A 3SJVA 2CO6A 3FQRB 1LO5A 3A47A 4XAKE 5FUCC 5KSBB 2ZXQA 3UAAA 5B4MC 2HKFH 4D0DA 4R7DB 4PVNA 4JQVA 5IW3A 1DO5A 4LKCA 3V0AC 3M17B 4Z76A 4ECNA 2Q76B 5IKCB 5DD0L 4RIRB 5FYKD 2XPGB 2PWFA 2EYTA 1P84K 2W60A 2YLKA 5DJZB 1TQWA 1VPOL 3WHE0 1DJHA 4B41A 2K6ZA 5IFHL 2DMKA 2H8PB 1IAII 4F15B 3O8XD 3ASNB 3MRNB 3O4LB 3CFQA 2KDGA 1CYXA 3ZE0B 5J8OA 5IJKA 4L8BA 1DYZA 2KI6A 4JHAL 3HG2A 4ZUUB 3RYMA 4HLZG 3E6HB 4KK9C 2DS4A 2ILLA 3H9YA 3LN5B 4MHHG 3MRCA 4MQTB 4B9IA 2NXZD 3E6FB 5BRPA 2QGDA 5TDNB 3K6FA 2R4RH 4A04A 3OXSA 4CADB 3KLHD 4WUUE 4Z0XB 5EU3A 2D3LA 2NLJA 5JA9A 1T83A 2G0KA 4PRPD 1SMAA 3HRPA 1QKZL 4HUWA 4GAJH 5DFAA 3W2DH 4IRJC 3IDJA 3AMLA 1A4KB 3AS2A 5DJCA 1MCEA 5G5DA 1DBJH 2IDUA 5FGSA 2ZX6A 1TQBB 1H6TA 3CH1A 3QUYC 1RUQL 4DN3H 4Z7OF 1HC1A 1YA5A 4HV8B 3PWNB 4A37A 1S3RA 4R2GB 4A6YB 2C9VA 1YEEH 2E8ZA 3IM1A 5DK2B 1LE9A 3TZVA 1YUKB 1CVSC 3D25B 4FQXA 3L6FA 5FUOL 1IBDA 2YPKB 3EXLA 1KZYA 1KCLA 1CG9B 4ONHB 3UGEA 4AH2B 3OJMB 4O58H 4YPGA 5HJ3A 1PTZA 4FDWA 2HMID 1I85A 3QEQD 2EIMB 4L4TE 1XXDC 4JPWH 5FKAA 2IC2A 2IANE 4KKAC 2BVYA 4JQVC 3AU0A 2FGWH 4R96A 2J5WA 3HLAB 1HZHL 4LCIL 5D1ZC 2ICEA 1KGJA 3FQWA 3T2QA 1RPUA 1CPUA 2VM4A 3WFDH 3KS0H 1QLEB 3BKML 4YHYC 1ILUA 5A6IA 3LKPB 5BMFL 2PF6A 2D0FA 4X5PA 4JY5H 3DNKA 3DMMA 4G8IA 1WF5A 4RGNC 4Z7VA 3T77B 3VW3L 2FWOB 1MVUB 2PXYB 3QRLA 2F5AL 1MZYA 2V17H 5I1CH 4YHMH 3MJ6A 3LEXA 4FTVD 4HFUH 5EC2A 2HJLB 4KVCL 1JVKA 3EGXA 1URLA 3MOAL 1NGXA 3ZHKA 4PWHA 3EH1A 4QY8A 1HE7A 5DLML 1YJDC 2GI7A 5I0VA 3BH8A 4TNWF 5EEYA 1K5WA 5DO2C 1NICA 2F58L 2ZUSA 3TBWB 5F7NC 4GSQA 1EUUA 1MRFL 3CH8A 4TLTA 1P6FA 4HFWB 4L5FH 4Y9GA 5C09D 5ICYA 1K3IA 3IETB 4G7VH 1F3DH 3CDZB 2BP0A 4YDZA 3TA3D 3HPJB 2VN4A 5ETUA 2CLZB 5HYEA 4GI9A 2DDQL 4AIZA 3ZTNL 1ZK5A 1F6AA 3NQKA 2K7PA 4LU5L 2YSSB 5M95B 3HN3A 3CX5K 1KTDB 4HUCA 3V5KA 4F7CB 1XEUA 3VO0A 3QORA 5KYYB 5E8EB 3F62A 4AJWA 5DJAA 3ZT7A 4JHWL 2Z4QA 3L3DB 4PJ8A 3UYPA 3EJZC 5GRJH 1RJYB 1INDL 1KB5A 4XPAL 2E0PA 4IK7A 3WIFA 4TRPL 1CYWA 4G9FB 3DHJA 5LUMA 4KQ4H 4PGBB 3M8OH 4QEGA 2AI0L 3VRIA 3ZVVA 1RZQA 4M61B 3P73B 1WAEA 3UP1A 1MVFA 3MRPB 3EO0A 3MXVH 4U4BA 1G7JB 4Y7MA 1AKJB 1D5BB 5CD5D 3JTSA 5EZIL 3OJVC 5TTRA 3ULVE 4YFEA 1EZSA 1JV2B 2FVNA 1Z2KA 3LQAC 4Z23A 3N40F 4WTWA 1XGPB 2CO7B 2CGRL 1IX2A 2D0HA 3TJPA 4IEFA 4NKOA 3WEXB 3DRTB 2YPVL 1G7HB 4X5QA 2X0WA 1ZHNB 2AXWA 2JI1A 4M48L 4PJBF 4ZS6C 1P7KB 5D7IF 3RNQB 3VSQA 1CN4A 1J86A 2IANA 3WEOA 4OZIE 2FO1A 3U82B 1QBBA 3QJHA 4U1HA 2EDRA 5CEXA 2VTFA 2FECI 3DYOA 3O3AB 4KO6A 1MCBA 1JV5B 4YHZH 1KB5L 3NAAH 1CDHA 1EAQA 3FT2B 1E3ZA 3IDGB 3ULUF 3FPYA 4OCNC 5JIIA 4TQIA 1QA9B 4QXTB 3RFZB 4M6OL 1DCEA 2NY5C 2ZT9C 1KIRA 9PCYA 2X89D 4H0IA 3K5SA 3LB6C 1REIA 2R2EB 4G9FE 2EC8A 2NUTB 1F6FB 1FBIL 5KSVB 4V2BA 1YEHL 1NDMA 1VFOA 2PPDA 2Y7QA 1MJ7L 4RGNE 4TNGA 3EOBB 3VU2A 2XNAA 3CZFB 5FECA 3KBFA 4RVBA 1GXEA 1QNZL 5K93A 1IFRA 2EE3A 3CVHB 3L5XH 5IM7B 1KV7A 1NL0H 4TUJA 4FA7B 3I6SA 4JHAH 4PS4H 1H6FA 3DX3A 4KXZH 4N90E 1HXYA 1MY7A 4HBCH 4IU2A 2C4XA 5KVFL 4RMSA 4L8CA 2P7TB 2NR6A 4PD4J 4LVOC 4YFLI 2AEOA 4PRDA 4WWPA 3TM6A 3QQ4A 2UUDK 3CHRA 4CVWA 1SY6A 2OK0H 1I7TA 3NJFA 1T6BX 3HB3C 3M8OL 4HVBA 1JNJA 3GI8H 3OPUA 3MX0A 1YVLA 1RIHH 2F5BL 4Y9FA 3HG3A 5FGRA 1U8PB 2YMTA 3NCFB 3NACH 4FHKA 1OW0A 2FIKA 1NCTA 3SZKC 2NR6C 3HBZA 3UG3A 3QH3B 2C4FT 3ARED 2NY1B 5D72H 4EIUA 5T1KD 4JVPA 2VO5A 2JIXD 1S7TA 3QORD 3DLQR 4NUMA 5CHNA 1NAKL 4AYID 1NPUA 2QELA 4OZGA 2WO2B 4E9LA 3KXFB 3QDJB 2X4OB 3BJ91 4FFZA 3LKNB 4C56E 3IJEB 4N2MA 4TSCL 5ID1B 4AZ8B 1CDCA 4KKQA 1GKOA 1Q9LA 4FQIH 2YD2A 5F89B 2UVFA 5I1CL 3UJIH 1AHWC 1JF1A 3LRGA 1SJEA 5LAXA 1A6TA 1TJGL 4BFIA 1IM3A 4HCGA 4KAQH 4XC1H 5DJZA 5AQ0A 1O5PA 1CGXA 1CLYL 2IBZY 2IWKA 4HULB 2A4ZA 3BUBA 3V0EA 2HG0A 1HSBA 1IGTA 4BXSV 5I8OH 1KENH 3QCUL 3QFGA 2EVGA 4K07A 5HI3C 4Q4IA 1J88A 4ZS7H 1UEMA 3FPXA 1KJ3L 3SDAA 3FCBA 4WUUB 2OL3H 2ZYIA 4NZTH 5I28A 4AYEC 3N85L 5BMFH 4ENZA 4HCRA 1B0RA 1ZT4A 4MMXA 2A6DA 1QFWH 2ZXBA 5D9SA 5C09E 1RZ8B 3AZUA 5IBTH 3GSVA 5HI5D 4PJ9B 1CXKA 2HRHA 1I9RL 2QKIC 4KQ3H 5DD3H 1FVCB 2D2OA 5F70A 4UU9A 4YAQA 4LNRA 3STBA 4AYGA 1J0ZA 5JNYA 4KZEL 3BZEA 3HN8A 5KZCD 4BHUA 2ADGA 3F7KA 4DP6X 2N0KA 5DA0B 5HYSB 1MAML 1UUSA 2IPTH 1RUQH 3C5ZA 3HZYA 1ZGLP 4MWFB 3ABMB 4AQAA 5BNXD 4BK8A 2WTRA 3EHBB 3MROB 1IGMH 3L5WA 1AZCA 4AM0B 2V2TB 4A6YA 4UBDC 2APFA 3R0MA 3UEZA 1FYTA 4RA3A 5EZIH 4AT6A 4EI6A 4FQLH 4Y4HB 1D5MA 5FYLH 3T0WA 3ARGC 2IPUG 5D1ZD 1GMEA 3OXRA 3D85A 3SBPA 4JGJA 2O5ZL 2IWEA 3LZRA 3NRPA 2HN7A 3VI3F 2H0EA 4Z8FH 4NUGL 5I82A 1PS3A 4OD1H 4XCNA 1XL6A 1NTDA 1PIFA 3B9KA 4DP5X 2R2BA 1MCLA 3UROR 5GRJL 3QQ9D 3ZGIA 1FH5H 1S7UB 2R0LL 4NFCA 1AFVH 3X12A 4X98A 4M00A 4DSYA 3LJ3A 2ENSA 2CA3A 3C6LC 3O2DL 4JKMA 5IQ7L 1ZT7A 1WIOA 1J5HA 3E3QE 2YEQA 4KOBA 1R1CA 2QQLH 3I85A 4NC0B 4URTB 5HHME 1FL6A 3DC0A 3GSRA 4F80A 3D39A 5KJRL 1UACL 1I1CA 4WNQA 3VXQB 1TO4A 1CLZL 2GUOA 4L05A 4B97A 5DR5L 1OEZW 25C8L 1O0VA 1WWBX 4R97B 1BW8A 5FYKU 3RVUD 4IRZA 5EBGA 5I15H 1ETZA 1RL1A 3UZVB 2FLMA 3U7WL 1H3WM 3O3BA 1N6QL 1VLXA 5F72S 4A2LA 4OVUA 5HDBE 3VI4B 12E8L 4YHML 1AZZC 2V2WA 3RWHA 4G6KL 1QLRA 32C2B 2X4PA 4UMSA 1QSZA 2HYMA 3H56A 3TBVA 2F7IA 3AM8C 4NZTL 1KIQA 4Q4EA 4BDVA 3V4VB 1QFWL 1CU4L 1IGFH 5ERWB 1AKJD 1SXBA 2GJ6D 2W38A 4ZUVB 1UGNA 5D1ZA 4NYLA 3HAEH 4FJYA 5KBMA 2ZOLA 1ZHKB 4U31A 4A2DA 4ZDHA 4NC1E 4ZFZB 4U3SA 3ARSA 2PMZA 5LQBH 4JCWA 3ZIYA 2RFXA 3CLWA 4Z3HA 1AXSB 3CJJA 1IJ9A 1SLXA 1BVZA 5IBLC 4ZOEA 3PWVB 4X6BB 4WHCA 1A7BA 2GKIA 4B6ZA 3D07A 3G5VB 2EUXA 2VR3A 3V6OE 3C6SA 4MD0A 3K6DA 1RZKC 3RWEB 4PW9A 3HC4L 1E5AA 2Z7ZA 4HCRL 4KTEH 1EX0A 1MJJA 4I9WE 4MA8H 4U7MA 1ADWA 3AS3A 4MNQA 4GO6B 3MRDB 2YQ2A 4NQDA 1PG7H 3I50L 2DL2A 4G9FA 4F9PA 4CU8A 5FUZL 4NPKA 4PJXE 1Y0LA 4EPSA 1DVFB 1OAKH 1OAZL 5J57B 3MRPA 2AMGA 4L4VD 5EBLA 5I1EL 4P46D 4FHJA 1TTBA 4HWUA 4RA0C 5IQNA 5F9DC 4J5VA 1UG9A 1X7QA 4OW6A 3S6CA 2BOCA 4MB3A 4Y9CA 2MCPL 1B4RA 3X1GA 1F4AA 2ZAGA 3QJOA 4ABWA 4HUXA 3M46A 2KLRA 3GMPB 3F7LA 5BQ7B 1AQHA 2LW3A 3B2XA 1IC7H 2YO3A 4JDVA 4KZ0A 2QKIB 2YK1H 4HKBA 4APQD 3IU4L 2Q86A 1A7RL 2KL6A 4UTAL 2HXAA 3FAXA 4QNPF 3RVXD 1AI1L 3WHE1 3EOYG 4DW2L 3ASWA 2IAMB 2VMJA 1SEQL 3EOAB 3RURA 2TRHA 4XCEA 1PGRB 3NIDB 4B7LA 2VB5A 4WTQA 1CE1L 3O3AA 2DL9A 3D39E 4XZUA 1UD2A 1MPAL 4PJBB 3ROOA 2XPYA 5D7LD 5KN5B 4KX8A 3CIAA 1JPFA 3MRHB 3QAZC 5GZOC 4PB9L 1EK3A 5TF1L 4RMBA 3BQUD 3HRZA 4XNQB 3QCTH 3NIFB 4NSKA 2KPWA 4MLIA 2Y2YA 3G6AB 3CVIL 2VW4A 1YO4A 2F8IA 4L1SA 4PSRA 1YEGH 4K3GA 4XPGH 4WNSA 4CKQA 1S9VB 3U30C 4W70A 3LEVL 2X40A 5DWPA 3HUJE 4I2XB 4LOVA 4LESA 3S7GA 2DV6A 2Q76A 4MMZB 4YXHH 4OFQA 2C1PB 5T3XL 4JJOA 4PGEB 3EOBA 1QMUA 4X8JB 3HUJB 4I2XE 5JPNC 3ARDA 4JLRB 3T0BA 1M7IA 1U8LA 3QE5A 1JCKA 4HKXA 1E4JA 1D5RA 1KG0A 1KGXA 4DESA 2YUWA 5EZJA 3LNEA 3GJFH 3O6KL 3WIFB 1E6OL 4WGKA 1X5YA 4OQTL 2ALAA 2CG9X 5IQ9B 4I5BB 4KVCH 1N3NB 3T0EE 5DEGB 1NBYB 4LSRH 1U3NA 5TF0A 3T3MF 4GSDH 2LTQB 3CC1A 1AIFA 1ZEAH 3G6JE 4M9OA 2ED9A 4IK6A 2F54B 4I0PB 1R46A 5E7BA 1WT5A 2VC2H 2BHFA 3EZJB 4PJCB 2B77A 2ZCLH 4Y5VA 3IFPB 4ZMAT 5CM1A 4WUUD 1NCNA 4U1LA 3FN0H 4JFFB 5JOFA 2R0KH 4YUEL 1BFSA 4IRJB 3C2AH 4ETQB 1ML0A 4WQOA 4NNPL 2I5YL 5IQ7H 3MXVL 4UM9A 2JF1A 4OLZH 2HT3D 3ULVC 3QJHB 3CH1B 4U1HB 3APDA 3SYOA 2FO4A 4HZLB 3R1GH 1RZPA 4JDZA 3GBEA 3CCHB 1TUPA 1XCXA 2AW2A 3DIFA 3D1MC 1DBML 3DOSB 5F6IC 5L2KA 3RL1A 1SOQA 4YXLH 5T3ZH 1IVTA 3MGTB 1S5HA 4Y7OC 1YPZF 4EXKA 1FAIL 1NMCB 2AXJA 3HI1B 4P5RA 2Q20A 3QIUD 4B0MM 3RPIA 2DM4A 4WTXA 3RNKB 3UTPE 5C9KA 3OPZL 4D8PA 5ALCH 3VH8B 2ZG2A 3WOVA 1KB3A 4BHUI 1BZ7A 3CFBA 3ARFA 1I1YA 4MJIA 3V52H 1THAA 3RWGA 2FHFA 1KEMH 2Y7QB 4FNQA 5FKAB 2EYTB 4KJPC 4Z77A 1VZIA 5ACZB 4HC1L 1FV1B 4H13C 1KN2L 3K8MA 3GBMH 4MCZA 1EO7A 1NCBL 1OB1A 1LK2A 3OWRA 4DK6A 4GFXA 4GUCA 1T6WA 3QZOA 5F0JB 1HXYB 3MLWL 1FQ9C 2VZUA 1PIGA 1SJHB 2BSRB 3FJTA 2UZPA 2VERA 5LGHL 5HHVL 4K5NA 3GJFB 5GJSL 1ORQA 4HCFA 4DCQA 2O4EA 2YEVB 4ETYA 2HWZL 5FDWB 3SDCD 5F88B 3KGSA 1OM3L 3MRLA 1HYRC 1WIUA 4FZEL 3DX9B 3P0GB 4Y4KD 5F3HA 5DVPA 2A9NL 2V9TA 5JIQA 1L0QA 3AUVA 4ZODA 3SPGA 5DUML 4AQAB 1ZVNA 1UADC 2BSCA 2DIBA 2HFEB 3OKNA 4PMFA 4RETB 2C3XA 3C60A 2OMWB 4P2RB 3KYNB 3CQQA 3SKJH 4IIQB 5B3JE 3QDJE 2C3WA 4UTBA 3H53A 3S88L 3HA0A 1U30A 5JIDA 4G80B 3U2SB 2CKBH 2H3NB 2F7RA 1F90H 2LT9A 2I9LB 1SEBB 1N0LA 5C1MB 1VB9A 1E90A 4Q6IB 1JI1A 1E6JH 3W11C 3O11A 2WB1A 2W81C 1OT2A 2HN7B 5DTFB 3V0HA 4S2SB 4F7CA 3MTXA 5EEZA 3AU1B 4PTUA 3UL4A 4P0DA 5C0BE 2PABA 4RH4A 5D1XC 2VUYA 1K72A 4UZSA 4RMUA 3TU6A 4UT7H 1AO7B 5D2NC 1V7NL 3MUY1 4X9IA 4JFDA 1LVEA 5C0RL 4QLWA 2X4NB 3GXNA 4X4MA 1FL6B 1WUNT 5T33H 3Q44A 5AFAA 5IJCC 1U36A 2VUOA 1KIUA 4OI8A 3ZQXA 4HJIA 3UP6A 5K39A 3OAWA 1GYAA 2XG4A 1A7PL 4X6CE 4JDEA 4PJXA 5AVUB 3V5DB 3SE4A 3KLKA 1P4UA 1ZANH 2BSSB 4RAVB 2O61A 2NX5D 2GITB 5HYJD 2WWKT 2J6EA 2A99A 3QEGH 4OZFH 2QHRL 4BFGA 5TFSH 3N1MC 2RBLA 4PJGF 1F0LA 7TAAA 1UZ6F 2A38A 2VMDA 5E56A 4KNTA 1CE1H 3HTLX 3LEXB 4TULL 4ZTEA 4O5LL 1N7MH 2QPUA 3UTTE 1D7DA 5EO0B 2NY0B 5DMJB 3SPHA 3HHSB 2F7QA 1F4YL 3WMSA 4QRUB 5K9JH 3PGCB 1RK0B 3WEBA 5C0DB 5LQBL 1IT9H 3BIBX 4AJVA 4XB7A 3BZ5A 4N0RA 1BOYA 2G9HA 2VDMB 1G7IA 1EFXA 2FQDA 4J12A 3S37L 3EFDH 1RUPL 3G3LA 4KTDH 1F8TH 3QS3A 5E1AB 4OZHB 3RWJA 4JAMB 1VFBA 3H3KA 5AOJA 1YZZA 2Z31B 1JFQH 1TETH 3L4XA 3GMLB 4AV4A 4KKLC 2GSGB 4R2GC 4NQDB 3GHEL 3HR5B 1KTDA 5I1IH 3ULUC 3WS6A 1HEZB 4JO3H 5DVLA 4Z7AA 2X70B 2F61A 2P43B 2F54E 5ADOL 1OCWH 1FGVH 4X98B 4WZ9A 1S3KH 1OCCB 3ZO0A 3HS8A 4Q2ZA 3KJ6H 3C75A 5KYXA 3LKOA 1KBWA 1FORL 2FDBP 3QIWC 4H1LA 3WJJA 5CJXA 5I1AB 4NENA 4D9QD 3JYCA 1QBLH 2MTPA 3P73A 3KPSE 5I6MA 2H26A 4OUUA 4C58B 5F9JB 2ZOUA 2XXGA 3TV3L 4YHLL 5IR1B 2FB4H 1MDTA 2VLJD 4NN5B 4ZO8A 2X38A 5I1DA 2GG1A 5EB9A 3TIDA 1FNLA 2DAVA 4OGZA 1H15B 5LDSA 1R5IA 3KVPA 4DAGH 3IXTB 2LFGA 1MRCH 3BMVA 1GJIA 3JUZA 1TENA 4N2FA 3VTMA 3ILPA 3KWVA 4HP5A 2JKLA 2XG5A 3U1SL 5BS0E 2RD0A 1G5GA 3RWCA 4YHOL 3BO8B 1S7TB 3B2DC 1M05A 3VB9A 4HIQA 4ZMLA 8PAZA 2ODIA 1DQLH 3AWEA 4FXLA 4BSVB 1KNOA 4HIXH 4HKZA 3NEXA 1BQ5A 1J8HA 2NSXA 5AKSA 3HAEA 1KXQE 4Y4FA 1XCQB 3WI9A 1K4DA 5L8JB 4GXUN 4NBZB 1E8XA 2FQFA 1ZA6B 2J21A 3Q06A 1YYML 1RP8A 4FXKC 1A6UH 3SKMB 3KYOA 1DVSA 2ZICA 4AG4L 3B2UD 3ZT5A 5DR5H 3ARDB 4BFJA 3MLPA 4MD0B 5B38G 2OXGA 2OR9L 2J56A 4C57C 1MJJB 5CJQH 2CKBB 4LFHG 3VFVB 3QG6B 4XAKD 3S3SA 1N6QH 3W81A 1FZKA 3CZFA 3BVXA 5A2FA 4ZXBA 4FEMA 5E7FA 4M56A 1R34A 3S88H 1SGKA 2FBOJ 1TZ8A 1T0PB 1UD5A 1JGEB 4TSBL 3MUGA 4P23D 5LHDA 1OSEA 4J3SA 1JE6A 1HX0A 4N4YB 2CM5A 5GISH 4OV5B 3HZ3A 5ITFB 2HMIC 2VXTH 1BAFL 1FFRA 2HT2D 5C0CD 2CAKA 3LDBC 3TCLB 2XI9A 3EJUA 3TNNA 4FADA 4YS4A 1AH1A 1MFUA 2EIBA 5I19L 3ARXA 4MJJA 4QT5A 2QKIA 1FPTL 5LB1A 3QJZA 2CGYA 4WK4B 3COOA 3KLAA 4L3ED 3QGVA 3JUYA 1BVNT 1N5AB 4U0RB 2WYZA 3O6FD 4JZJB 1RZGA 4NNPH 2X6VA 5LGYA 1ZSDA 3O2WH 3W82A 4CVZA 1F56A 2DBJA 4RGND 1FSKC 2G9KA 1YUHA 2DYPB 4H1LH 2FIKB 4GQ9H 1IEAA 4NWUL 3PXJA 3WTWA 1ES0A 3EZ8A 5HDBB 1Q0YH 1PY0A 4HBQA 5F7KC 2C5DC 1EAOA 3MRMB 3GZKA 4PV1C 4PS7A 1EJOH 2IQ9H 3QUMA 4IM8A 5LKNA 1I4FA 2XQYG 5EOCH 2J3SA 3K2KA 1ET8A 4FMFA 1RUML 3PWLB 1JZGA 3VE0B 3MUJA 2L04A 4UOJA 3CHXA 3VXTB 3SDDA 1S9VA 3BGAA 4JFUA 4HGWB 2IH1B 3N1PC 4L3CB 1IARB 1AIZA 4MS8C 2R2BB 3OAYK 1WGVA 3OG4B 3FFDB 4KO5A 4P2OC 4XXCC 1IM3B 2PPCA 4NM4L 3TH2T 4OV6F 5DYOB 3MJ8B 2EDXA 3VI4E 3BFQG 2F74B 3GSWA 1KIPA 1T66D 1PZUB 1MJUL 1NC4A 3VW3H 1IGTB 1WPCA 4TNFA 1EHAA 4Q14A 5DUPL 4APXB 4IRZH 1P7QD 4PP2B 4EDWL 5EHFA 2GPZA 5FYJL 3JV0A 5A43C 5D5ME 4LOUC 2EE2A 4X4ME 5HHVH 1CFQB 1UT2A 2X05A 4WV1C 1DJSA 1HILB 4LL9A 1S9WA 4U7SA 1KPUB 1UASA 3REVB 3LZNA 4QRPD 2AABH 4OZ4A 3P9MB 2EYSA 1LQBC 2VR5A 4FZEH 5C08E 2VN6A 2ZP8A 4U6XA 1DVTA 2X88A 2ZX9A 3DBSA 4AVKA 4UU9B 4YAQB 3GXUB 1AZNA 1GGIL 4QRTB 1SN2A 3V7AG 2HFEA 3OKNB 1KBPA 2QDWA 2OI9C 4BK5A 2YEZB 1R17A 4R9HA 2H1XA 4Q8BA 3ZW3A 2YXMA 3ZKQD 4JN1H 2X9YA 2ZUQB 3ALWA 3KW8A 1ZEAL 4AMKL 1BZQK 1S7WB 1BZ8A 5INDB 4U3SB 3ZTNH 5F3BA 2DMGA 1S2EA 5HHNB 1NH6A 5C0EA 5HD8C 1I3RB 3VQMA 3L95A 1V3KA 3TFKD 1QKZH 1Z7JA 3EO1A 3MNWA 3QUXB 5EPMA 1C5BL 1CF8H 4V2CB 2MMXA 2N7BA 3I02A 3C6SB 5D7LA 1TR7A 4OD2A 1SMDA 1OAUL 2A77L 2HCZX 4EUPB 2AXFA 3R4RA 1HI6A 4JO2L 4H8PA 5CZVH 3FT0A 2EDQA 2A74C 3FH7A 2HPTA 5C2BH 1OARL 1WA2X 4JFYB 4JR9H 5HPMA 1NAMH 4IBQA 3ZZ1A 2TSBA 1WDAA 2CRYA 2NY2C 2ZNXA 1KZQA 3HE7C 3SKNA 5BRZB 1TFPA 3MDJA 5IOKA 2DQJH 3EJJX 4QOKB 3RDTB 4KKBD 3RWGB 4M7LL 2EC9T 3EYUL 2BVTA 4AW4A 1FV1A 1RP9A 1X6NA 3KNBA 3KJ6L 4FD0A 5MERB 3QUKA 3GMMA 1PY9A 1I7RA 2R0KL 1SJMA 4JY6B 4PJAE 4OJEH 1EHLH 2R59A 1SY6L 4AQEB 4O58L 2AQ1A 3F6IA 2F1EA 3NSXA 5FYJU 5J6HA 5I6LA 3GXFA 3K5RA 4HSAC 5GGRB 1T2XA 3UBXG 4G6JH 4MRBA 4KKZA 1E9OA 3FF7A 4NRXB 2ITDA 1H8OA 1DFXA 3QI9D 4KXZI 2EXSA 4CVXA 4DTGH 2BHUA 2IAMA 4DZBA 3ULSB 2ZZUT 3RKDC 3QDHA 2QQKH 4GAFB 4PUBL 4UNVA 4D7BA 3BVWA 3JWNH 3QC5X 3U25A 3QEUA 2ADJA 5IBUG 2QQNH 3B56A 4XPTH 1IKFL 4KQ0A 3QXDA 3O3EA 3MRHA 3BQUA 4IKLA 3A6BL 5BS0A 1XF3B 2OMXB 4PBVC 4UILL 1N10A 2DY2A 1QW9A 3L7FB 1IEHA 3EH5B 1P2CB 4XXDA 1CL7I 5CS7A 4ZFOB 3TWCL 3JWNC 5D4JA 3TBTB 5GRWA 3UC0H 2HLEB 4OFPA 5E51A 1ZV5A 1FWXA 1QG3A 4PJ8C 1NLDH 1OSYA 4P5TA 1OM3H 1CZ8H 2IAAC 4LSPL 2WJ7A 1X5ZA 2QFRA 3A21A 2E7BA 2XXCB 3T71A 2A73B 3GMLA 1KXQA 2QPSA 3REWA 4LP4A 3OC5A 2J44A 1M6OB 1KY6A 1BFVL 3ECUA 3AU1A 3U1QA 2ZSVA 3FT3A 4Y8AA 4N5UA 1R5VA 1T21A 3NSCA 3PXHA 4ZXBD 3SGEH 4DGUA 1AO7A 1UXLA 3S96B 4ONFH 3U46B 2CLVA 1ZV2A 1PFOA 2WUBL 2C7UB 4FFVC 1S9XB 3FQUB 1T4KA 1QBLL 5GSVB 4YVUA 4I48B 5EOCL 3QXUA 3IF1B 3QJUB 4J3BA 2L3BA 3JTTB 5LG1A 3G5ZB 1OE1A 4JPKL 2NT1A 4N0YH 3UO8B 3MLTA 3NSDA 1NA8A 1FNSH 3ILQC 3T0XA 3C09C 5F9OL 5BV7C 4J3OG 3ETBJ 1GTFA 3S5ZA 3D09A 2CIIB 2BNQE 4JFFA 4F9LA 5C0RH 1N26A 1J8HD 5K9OA 3DO4A 3LHPH 2F68X 1J1XL 4QRRA 2YAFA 1RZJL 5JHDA 1KC5L 2CK0L 4OZGF 5ID0B 2CA4A 1YMMA 4HPYL 2BH0A 2J8UF 4LEOA 1XSKA 2D03L 2ZPKL 3JVGC 5BRZE 3FRUA 4PJGB 1QUNA 5HYSG 3WTTA 5D7IA 1TOXA 3APCA 4G43B 3ZTJH 4A2HA 3U36B 4BSJA 3FOMB 1B4JH 4XVJH 3VXNA 3CSFA 3IU3B 4DPCX 4CA4A 3B2MA 4UUJB 1SZNA 1PCSA 1YPZA 3Q9QA 2XJLA 5JR1L 1WRFA 5IF0A 5T5FH 3NCYS 5IK3A 1Q90A 2OXGB 3UG5A 4OZHA 2VDLL 4B27A 5C0NC 4XNYH 2C1PA 2XTLA 3UTPD 4RZCB 1A8ZA 2WIIA 3MXWL 3ARGD 1PLAA 2C9RA 2AJVH 3KWUA 2FX9L 1TPXB 1M7IB 1U8LB 4YK4B 4NRYB 1G6RA 5DVKA 5EU6A 3D39D 2CDFA 1IC4L 2YGPA 3AAZB 4R7XA 4DEWA 3SBRA 3S36X 3QHTC 3ARGB 3FUIA 5EOQH 5IT2H 2WQSA 3V4LA 3Q2CA 3ARBC 3R06B 5JHLA 4IDJH 3ULAB 5DHVA 3GGWA 4ACPA 2XVLA 1KBGH 3EHBC 3NH7L 1TVBB 4NKIH 3RDJA 2CBMA 1PDKB 2FEEI 2VL4A 3OZKA 4I89A 1M9SA 4Z7NE 4WWKD 5K5YA 2X2UA 4JB9H 1R5IB 2LTQC 3TCXA 3DRQB 2MWCA 5JXEA 5FV2A 1WS7A 3T0AA 1D3CA 3B9AA 3W39A 2WYHA 4EZLA 2XACC 1T5WA 1UCBL 4QF1B 4ZAKD 3KLQA 3WBDA 5AB9A 5HBBA 4JKPH 3SIKA 3BHBA 1RHFA 2B7DT 2JB6A 5IJKC 1EHLL 1ZPLA 1XZWA 4L4VB 3KM2A 4D0CB 3HMWL 2O5ZH 5IVXA 2RAMA 2VYRE 2MPAH 2YIHA 3CZSA 4PHZA 3SPJA 2CR6A 5F7AA 3EYOA 4MA1B 3S8WA 1TO5A 2IPKB 4HOWA 1RJZB 2NUPB 1X4ZA 3CPUA 5FA4A 1J48A 3K1DA 2D9CA 1QZ1A 1AMYA 4PTUB 4P04A 3VXRD 2R39A 2X41A 3F6JA 3U30B 4Z7UF 3ISYA 1DLHB 1T04B 3BP6A 1D6VL 3PQYE 3RNKA 3H8NA 4HX1A 1FNEA 5DYOA 2J20A 3VGFA 3VFPB 2Z92A 3VH8A 4D9RE 4X6DE 4TSCH 4F7KA 2NYZA 4M7LT 3O4LA 3OLGA 4ODXB 4Q7DA 3HJ0A 3GC3A 1AHWB 4ZAKA 5DD3L 1W72B 4LSUH 2CNYA 1MF2L 4RWHA 3HC3H 3O6KH 1CK0L 5CAYB 2Q5BA 5C07D 5HGHA 1BGXH 2X1QA 4DUXA 4HA1A 4OJAA 3MCLL 3UAJC 4P4RB 3PP4L 2WO3B 3GSNA 5ES4B 2QADB 3HHRB 1SBBA 1GKEA 5E23A 5L9DL 2YD6A 3NTCL 3DARA 1ZXKA 1CQYA 4PVBA 1AP2B 3SSGA 3MO1A 4PYGA 1XR8A 1P1VA 5EC1B 4AVIA 4HK0B 4R7NA 4KROD 1MFVA 3ZDXF 1YUHB 5D93B 5CP7A 4WI9A 1WH0A 1JXKA 4FXGA 1SDYA 2OMWA 1T1XB 4NFDA 4KRPB 4UNTA 4LVOB 3KR3H 2X9WA 1FJ1A 1U9KA 1KYDA 2IQAB 4YHPA 1A2YA 2CBPA 4DPAX 3G5YA 1NEZA 5D6CA 5T1JA 4PW3A 1PZDA 1A3RH 1IGJA 2X6CA 5D1QA 4YVNA 1FLRL 2ZCKH 1A7OL 2DJMA 4LVNC 2SODB 4X80L 2A83A 4L23A 3NCJH 3SKNB 1KXTB 1DQMH 3CQFA 5JPMB 3C6EA 4Y4HD 3FQXA 2CDGB 2EKSA 2P48B 4PP1D 1L7TH 3TJHD 2X42A 4O2EB 4X5RA 3FQWB 2HLFD 3TNMA 3NFSL 4MTMA 4LBEA 4YWGH 1GGYA 4IMKA 2OSLB 4LCYA 1CU4H 1IGFL 4X2UA 4DP1X 1NCAH 2ZAIA 4OCMC 5GRZA 1KELH 1NGYA 1DR9A 1G0YR 3ARUA 3WY2A 3ULUL 2QQKL 4F27A 3V52L 3UAFA 1NBVH 4I0PD 5KSAD 2HJLA 5HDQH 2Y24A 4J39A 3CFKB 5DQ9B 4H26B 4GP4B 3Q1SH 2B15A 4P05A 4NCC2 5FO2A 1Z5LB 5LLIC 1AGCA 3CVIH 4L37A 2JQZA 5D70H 1I7UA 4OLVH 4WU7A 4X5LA 4GRWE 1EBAA 2K4WA 4L0ZA 1F5WA 3RVVC 2BO0A 1IKNC 2ICWJ 5JHDE 4EF3A 2UZXB 3NGBB 5I16B 1MH5A 1VFMA 3K6SA 5C97A 2ICWI 5FAAA 3MUZ1 5GGTH 2YMXL 5E2VH 4FNPA 4QUOA 4X99A 2YD8A 4IJ3B 3I3BA 4U0QB 4NLAA 1ZRUA 4CUCA 3ATFA 5KSUB 1M6OA 1PCXA 1ZK9A 3I02B 43CAB 4AEHH 1SLWA 3GMQB 3TZVB 5MEQA 1Q38A 3LH2L 2Y6TE 3C8HA 2B14A 3DPDA 1TZHA 3AACA 4I77L 3OZ9H 3IWVA 4K8RL 3DO7B 3BCDA 3JT0A 4YX2H 2ZKWA 4KH2A 5IMOA 3RWDB 3ZL4H 3CX2A 3QFJA 1XDTT 1IFGA 2AABL 1S78D 3O2VL 4MXVF 3RGBA 1K8DA 2VDPB 5D93C 3KCPB 5DWUL 5B1CA 4OM1H 4O02L 4R90L 2J25A 3HCVA 4UQDA 4WTZG 1ZLVH 3GLZA 5MP6H 2VSMB 1I9JH 1N2RA 1ZVHA 5EULV 1W8NA 4AYSA 2IXQA 4XOEA 2CJUL 2W1NA 3L7EB 4HWZA 3B34A 1GH7A 2VDRB 4AUUA 1A8JH 4TS6A 2CSPA 2J4WL 4HPHA 3KPRE 3KH4A 4ONGL 1WBYB 1NDTA 2UXVA 4PB9H 4XNZB 3EO9L 2BHYA 2HAZA 2QHRH 1RZGB 1FN4A 4JZJA 3ARPA 1U92A 2OPCA 5IEHB 4Q9QL 3DUSA 1HAUA 1S6NA 2TRYA 3OLDA 4W6WB 5AAMA 2QMJA 4G3YL 4QHLB 5HYQB 3N1GC 2DPKA 3QR0A 2BM3A 1SY6H 4Y5XC 4OIIL 2KPNA 2PLTA 3RWCB 1A7PH 1QR1A 1O6SA 1RZIB 3BGFB 1JPGA 2JFCA 1BEXA 1OGAB 4M5TA 4X9GA 4C4KT 3CC5B 1AI1H 1FVDB 1I3GL 2Y5TB 3TBYB 4JPIB 3US1A 4JFQB 1ZLUH 3QZBA 2CCWA 1AS6A 1QQDA 3MMEB 2A4EA 3O45A 1MHCA 3BEVB 5DRNB 5C9JB 4H8QA 5DSCA 3VXTA 3V9EA 1EEZA 2VRQA 2X4SA 3T65B 4OM0L 2OCFD 2GK0B 1P5UA 4OQTA 4W9CC 1IBHA 4L3CA 4LKCB 5IKCA 2CO4A 4N0FA 1R9FA 3BD3A 3C9NB 5D7JD 1OGTB 1XB6A 5T8IA 4FG6D 4CRPA 4WIQA 1UM6H 5EEXA 3FO0H 1X9LA 2VDRH 4J6IA 3OKKB 4Y0GA 2EDWA 4R3SB 2ISDA 3UYPB 3L3DA 5BOPA 1FE8L 5JHLL 1X5FA 2B3IA 2X1WL 5DC4B 3BIKA 2EECA 2A0LD 5LXGL 1BPVA 1BXXA 1E8WA 3KR3L 2E46A 5BO0D 3KZ8A 5CN3A 2EE0A 4LSTL 1T89C 2DLEA 4J4PA 5AUMA 1IQWH 1A6VL 2WWMC 4YHLH 5DLMH 3C5SB 3FQTB 5DK0A 3AB0C 2H6UA 2NXYD 3WIHH 1BCIA 5KANI 2XKNA 1A7OH 3U0PA 4GAGL 4MZIA 5FYLD 2MKLC 2X5PA 4HW6A 1U8PA 3SO3C 3UC2A 1QYGH 2K45A 4ANVA 3QO0B 4NQEB 4OSUH 3U7AA 5ADOH 1C16B 4NKQB 4UTCA 4WWNA 5K9OB 1E8ZA 1FG9C 1WS8A 5I66B 4PRNA 3KWWB 5INDA 4ELDA 4DVBA 4JY5L 1NIDA 4K71C 4WWKA 1YC7A 5FA3A 4AV0A 1YMMB 1T0NA 2Q3AA 3GSUA 3CDYA 3VXOA 2VIRA 2IWFA 1AD9A 3L9RA 1QFWI 1NCDL 3F58H 3G08A 5CGYD 2CQVA 2Y06H 3LQZA 4IRJD 3X14A 4LLDB 3AUWB 1X9RA 3RPBA 3E0GA 1ZE3H 1I8UA 3DYMA 4UT7L 4K73A 1BMWA 3FCSA 1NJ9B 3MI6A 3SDDD 1HHJA 1A6TB 1YYMH 4XVSH 2Q10A 1SPDA 1E28A 2V9UA 3MNVA 4JO1H 4CL7A 2F54D 5FO7B 4R5TA 3MV7E 3SE8L 4A7GF 3SQBB 4UCFA 3VFPA 5B22A 3UAJD 2R2EA 1F4WL 4ERSL 2KUTA 4JX0A 4N8VB 3VAEA 1WHOA 5EU5B 1SRDA 1WVZA 2XZQH 4YDLB 4K7FA 4LEXL 1C5CL 2ZKYA 2CUAA 3HC3L 3NZ8B 2BVPB 3MFFA 3GIZH 3PFQA 3QEGL 1ZLWK 3O81A 1E2VA 4AE0A 3IAGC 3QR2A 4GMTH 5JORA 5GGRA 1P4IL 3QJVB 4S1SH 2W07B 1NCWH 3CDFA 2K4AA 3SZ6A 3RA7L 1UATA 4CMMB 2NNXA 2MPVA 2PUQT 4BK4A 3SCMA 4FQ2L 4AQ1C 1MWOA 3L3IA 2BWIA 4XPAH 4P5TD 2WKGA 2BVUA 1D9KC 3KPPA 5C0CA 1FSKB 2WPGA 3Q1EA 4F1SA 2RTTA 1WZKA 4LGSB 2HT4D 3CN1A 3FCUB 3GYRA 1KT2B 3O41B 5HHPA 4OLVL 3UJTH 5CEZD 4O02H 3UO1L 3N40P 2YARA 2Z3FA 4N6QA 4Q6YA 1Z0NA 2Q6WB 2YEZA 1T5XB 4DGYH 1DFBH 1OKEA 4JG9A 2H0PA 3CZKA 1S8DB 2Y5EA 4NUPA 1GY2A 4IW4C 5DHYA 3EXJA 5E2JA 4FQCL 4OF0A 3LZPA 2NNCA 1JTOA 3GM0A 4JO3L 4U33A 2PCFA 3NJIA 3EO1B 5EN3A 1JNLH 5D1QB 2XWEA 1DEEA 2AF2A 1HXMA 2NUPA 1USZA 1TLMA 4NUJA 3TPKA 4I1PA 3BIAX 1JWSA 5D7JA 3ULVF 1R5VB 2G60H 1E5YA 1IBBA 1SJXA 2Z4QB 3H9ZA 3MA9L 4NGHL 4PJ8B 4EZJA 4DHLA 2XETA 3VTTA 3F8UB 4WO4B 2NXYB 1DN2A 4NM4H 5IW6A 4J8RA 4MX7B 4M5YH 5KSAC 4ODWA 4QR7A 3FB7B 5KJRH 1S7XB 5E8OB 3ESOA 5E94B 4X4XA 1CL7H 4YEEA 1N8OE 3AABA 4U6YB 2AVFA 2P3YA 4PGDB 1P4LB 2ZYHA 3IDMA 4GKNB 5CSZB 5D2LF 2CHDA 1ET5A 1RK7A 3UCRA 3MV7A 1V7MH 1EGJL 2H45A 3L3OC 1ZTMA 2LR4A 4A7QA 1J8RA 2UZIL 2Z35A 2J4WH 2V2WB 3KVQA 3RWHB 2OYKA 2PYFB 4N2AA 4P9MH 3MLXL 1G0XA 4QJ3B 4AOFA 4GEJA 2W0LA 3B4NA 1P7KA 4Y1SA 5LJYH 3ILEA 4HEPG 4LLUB 3CFCL 4IGBC 3F05A 5HJGA 4QRRB 2ZQKA 5AG9A 2JJSA 4EQ3A 3KPTA 2BC4A 1PX8A 4YSAA 2LLGA 2NXZB 4YL4A 4AGQA 4FQIL 2O6DA 1LO0L 4HHWA 5KSBF 2MTAA 1C5DB 1EDHA 4K2UH 1R4XA 3D2TA 1TQTA 4AENB 2VSKB 1TETL 1ORSB 5TGBB 1Z5HA 5HYSA 3CHSA 3ZJAA 4LAJH 5AVYB 2YQ3A 1ADQH 2XTJD 1J0JA 4NKDB 4GP5B 5J1AA 3IPFA 3ZDZB 1CXLA 2EDNA 5CN2A 2G30A 3TLRA 1JN6B 4U49A 2FD6L 1M1XA 1XF5B 3QFJD 2FATL 4OCYL 2NY4D 1SVCP 1SJVA 4BH7A 2J1XA 4NQSA 1NDMB 1OM9A 7PAZA 1F4YH 2NZ9D 1O6TA 4P59L 3MRDA 1IGJB 2JJUA 3CVBA 3DJRA 2YSSA 2OTPA 2DN7A 2BWQA 2L4OA 1KBVA 3AXLA 3QORB 5KYYA 4GRMA 2FB4L 4OGQC 1FO0B 4PWKA 1CGSL 4IKKA 1T22B 4XNUH 5CZKA 3H9SD 4N1EA 3RUGE 3IDXH 2K3TA 3VFUB 4KXAA 4K4KA 1UH4A 2EC9U 5DMGD 3K80A 3MOQA 3GJEA 1OAXL 2F19H 5EZOH 2KKQA 3FB8A 1NGYB 1Z9NA 4GS7B 4ATWA 1LL1A 3IRZA 4YE4H 3UGXA 2EDBA 4OLEA 1MW3A 3ATBA 4QHLA 1FHGA 4KJQD 4X6CB 2X4PB 5BPPA 3B6SB 1ZMYA 4YLBA 4BE6A 4XVOA 1E65A 3V4VA 1RCYA 1C5CH 4KZDH 1Y6MR 1IILE 4P9ML 3ESUF 5AVVB 4JM2C 1GPOH 4NQTA 1DQJA 2QMKA 3KL0A 4FF9A 5IBTL 1U8NA 1CFNA 4JZNA 4O4YL 1UXSB 4QRPA 3MJ9A 3O6FA 1HOEA 3P69A 4X7TB 1QQDB 3CGTA 2A7BA 2WZ6A 3H9HB 3GUTA 4HEME 1KTBA 1GIGH 3Q7JA 4LEBA 1Q9LB 4NQVA 1HIMH 2ATPA 4LCCC 1OP3H 4TQEL 3QUZD 2C8NA 3EJPA 4DKTA 3RFZA 2ADFL 3IFLL 3US9A 4TMPA 3QXTA 4PJ9D 4B9ZA 4OAWB 2WOBA 5B7MA 3IN0A 3A0OA 3RU8L 4OVVA 2DD8H 4RX4D 1HSBB 3QUZB 1DLFH 2DQFA 1MXDA 3QNXA 1X5IA 4F91B 2LU5A 4Z7VE 4POUB 3ZE1F 1UXWA 2GAZA 1LE5A 4EXPX 2YUVA 2ZG1A 1JDDA 3P2BA 5TPWL 5IMMB 1QWHA 4KK5D 4TTDD 5ISZB 2OL3A 3FHQA 4DERA 5A2CA 3P0YH 1K8IA 2GCYA 4X4KA 1TZIA 3M45A 5DS8A 3J07A 2GBTA 2CCVA 2GEQA 5KVDE 4LBAA 4UINH 4EVNA 4NZJA 3RX8A 3WJLC 4EJ1C 1G1CA 2HFGH 3ILDA 3N42B 1WWAX 2CPUA 3RB7A 3ZHLA 1FGNH 1NCIA 3STZB 4BZ1H 5JOFB 2CE6A 1BBJB 1JP5A 3V10A 3RIFK 3EIFA 1QRKA 5T3ZD 1BXUA 5DGQA 4KY2A 3UXFA 4B50A 3TF4A 5C6PB 3QI9C 2CU9A 3CFJA 3VA2C 1D9KB 2OMUA 4TUOA 4ZRGA 4Z7UA 1U3HB 2YXVA 4J6RL 3S3BB 2GTWA 4HCRH 4HUMB 1EA9C 1ZDSA 2GT9B 3RGVC 4OJFL 3FU7B 2CBTA 2J8HA 3SPCA 3WKPA 3NJNA 4FCHA 1G7PB 4Z95L 4LB8A 1AR1B 4XVUD 1L9QA 4FOMA 3O2WL 1JXFA 1HHJB 4JFEE 4CJ0A 1CLCA 3EYOB 5F1OB 1AC6A 4W9ZA 4GNKB 4F7EB 3RQ3A 5FO7A 5B39B 4E5XB 2HKHL 3QIUA 5DUPH 4WJG3 4IKIA 4QRQB 4WY7L 1P5UB 3HE6C 2I60H 3B9KB 2WW8A 5AZ2L 2IMMA 1QP1A 3EDJA 3HG0A 4PGEA 2VLRD 1VACB 3TCTA 3X11B 3LRHA 5GGRY 1FFQA 3HUJA 2IADA 4Y88A 1BMGA 2ADFH 3IFLH 3PPEA 3BKJH 3ARWA 4OJYA 3LXCA 1WJ3A 5KG9A 2XZCH 3FZUC 5F1IB 2HT4C 3ZXAC 1GR7A 3LKSB 5HVHB 2VLKD 4NZRH 1BXVA 2CHZA 2R0WH 5I76A 3RKPA 3WIIL 3S3JA 5E9DD 5AYUL 4ZUWB 4L3EE 1ZLDA 4J3OF 4U6HB 4Z5RB 2VZ1A 5F1KC 1L0YA 3C6LD 5F88A 5AWNL 3TBVB 1FNAA 4IDLA 2WANA 1WA0X 5C0CB 2X0VA 3K4AA 3QUGA 4JRXD 4KC3B 1FG2A 1R3LA 1VFAB 3TBCA 1MWAL 1Z5LA 3GNML 5CLZA 4MJHA 3ILQD 3FQNA 3NBNA 3BZEB 4X9YA 5DRXA 3PWJB 3KYNA 4JREC 3ARFD 2BVOB 2B59A 4MNGE 4GG8A 2OCCB 3TN0A 3MNZB 5GGTA 4GSXA 1WG3A 3VFNA 3CSYA 4WKZA 1FZOA 1PG7L 5SWSA 5TK4A 3KWTA 1UWXH 1UA6H 4FMVA 3GKZA 4HIEA 4PJXF 1J7VR 1PZAA 3WD5H 5GSRB 4GKLA 1IAKA 1GZQA 4QTIH 1A6AB 1DEEB 2MSPA 5AOLA 2WM0A 1TTGA 2AMUA 5BW7C 4NUJB 4XB3A 5JHBA 3HVDA 3U7YL 4JEGB 2L7QA 1YMHA 4ZI8A 2FEDC 1DL7H 4S1DC 4HEPA 2NY5L 4MNQB 4Z7WF 4BQ9A 4M3KB 2DW5A 3TEUA 3MNVB 5F0LB 2PXYD 3BSZH 2DYRB 1DBKH 2OMYA 5IBLD 4BCXA 1WWWX 2X2IA 3ARFB 2ITCA 3WFZA 3GBNH 3WNPA 1YNKL 5IB1B 3PHSA 1JYXA 5GGVL 4CMHC 3TASA 2EIZA 4LSUL 1SOKA 3FOLB 3VRJB 3I9AA 3IT8D 2JKRM 3EJCA 2XX1A 4Y5YA 3RZCB 1TDQA 4JJ5A 4ELMF 4TL5A 2C9SA 2W0KA 1F4WH 1ACYL 4TV3A 2DQEH 5E9AA 2BSRA 3EYVA 5SWZA 4JS7A 3S34H 3MRJB 3FT1A 2IFFL 3BZDA 3VG9C 3P3UA 4XCEB 2DQGH 4N1HB 3CFDB 5IWLA 1OTUD 4XAWL 2NY4C 3LEVH 3CK0L 1WA1X 4XT1C 4DQOL 3DMMD 4ZMZA 3K71B 5F3HB 2W65B 5D96B 4EN2A 3ARDD 4S1SL 4O51B 2FHBA 3NN8A 2YAMA 4BFKA 5IJBC 2A6IA 5BVPL 1D5IH 2WXKA 4NKDA 4B96A 4J8QA 3MJWA 3QZWA 4WO4C 4G8FA 4KJWD 3X1NA 2YWYA 4UT9H 4UINL 4GKZA 1I7ZA 1XIWB 2CHNA 4JPQA 4UZUA 3DIDA 2GK0A 1SHSA 3MXWH 3PHQA 4L8SB 3C2AL 1N68A 1S7QA 2EINB 1OZUA 1RIUH 4N0FB 3DVGA 1D2OA 3T3ME 2QVFB 2VQ1B 2EDDA 5KSUA 4C47A 4KUZL 4OLUH 1HEZA 1WAAE 2FRGP 1DDHB 3BRGC 4GINA 2A6KA 2FBJH 4BFNA 3NJLA 1C08B 1NLDL 2WLIA 3WAKA 3OB8A 4YPJA 4LF3A 4U2YA 3T3PF 5C6TL 3VQ1C 1ONQA 2CXKA 1M7DB 3O3UN 1BAGA 2E9GA 2EDFA 2YAPA 4PB0H 5ANMA 5BW7A 1DVZA 1EXGA 2ITFA 4KHXH 4ZMOA 2D3VA 3ULVL 2P5WA 2VABA 3IJ8A 1T1ZB 5GIRB 1RZJH 2Z93B 1UHVA 4PJIB 4GKNA 5LN4A 1E4XH 3IMVA 2B4CH 2Y7NA 3BKCL 3ZOAA 1KULA 4N8VG 3SKJL 3NCBB 4FL4B 1ZJBA 2QZ5A 4K7PY 4R0LB 4XX1E 2CO2A 1FGNL 1MFDL 3MNMA 1M4KA 2OULB 1NMBL 3E38A 4HJSA 5LAPA 4X6CA 4PCTA 5CMAA 2K8MA 2CKBL 3II3A 3LNIA 1B2WL 5CGTA 4F7MA 1E6JL 3UFIA 5ISZD 2QEJA 4QGYA 4LQFL 2W91A 3L3JA 4Y2DC 2OV0A 3OX8B 5E4OA 4K3HA 1MHHB 2UZYB 2OZ4L 4DOHE 1G7QB 1QRNA 5E5MB 4GEIA 4ALAH 2EIEA 2HX8A 2VE6A 3FMGL 3FH5A 3OKMB 1AO7D 1F3RB 1U8KB 2AEWA 1UWFA 1H8SA 1C1EH 4TLUA 5GJSH 1A02N 3QIBB 1BIIA 2E56A 4RISH 4MZRA 3S35L 4UB0H 5F7EH 2EDOA 4XO3A 1QLFA 4PG9A 4KROC 3FUHA 5HHOD 2FBRA 4HJJH 1MHCB 5TH2B 4ALAC 1R5WA 4AJ0A 1M1XB 1XF5A 3BD4A 1N0XL 1FFNB 3C6LB 3POCA 5AL0A 3MLWH 4BH7B 4BFEA 2Z31A 1I1YB 2YAEA 1B3JA 1I3UA 4MJIB 4C54A 1FL5A 4HS3B 2GSGA 2IBZX 4QOKE 4PU2A 5F9AC 3BJLA 4L8DB 5IMKB 5B21A 4UQAA 3HE6A 5E6IC 3GS7A 4PRAB 5FWQA 3V4PL 4JLRA 4Y2LA 4NZ8A 3QDGD 4D2NA 2OK0L 3PREA 5EF1A 4R90H 2HX7A 2YSTA 3QJQB 4J4PD 4BXVA 2MJWA 4MJ5A 5J1SC 1LDPH 1JNNH 1BQHA 3CHPA 4OGYH 4Y4HC 3SDXE 4CAGA 5I6KA 2BHZA 4P07A 4QWWD 3DPBB 4N22A 5GS3A 3KLHC 2YKLL 5GGSY 4QT5B 4LGRB 2Y1YA 4DO4A 3KXFD 1KBKA 3KPPB 4U1MB 1GS6X 1H6EA 1DDTA 1U21A 3MRLB 4H4NA 2W59A 4XI5D 2Z1KA 4MD4B 3OJDA 1JZEA 1RXLA 4OF7A 5F7FA 5IT2L 2R29H 3MLSL 5HHPB 3DTXB 2MQ0A 3QO0A 1OL0A 4BCYA 2IGFH 1ES0B 3TT3H 4BH8A 2VDOH 1PZ5A 1MCJA 4JMXA 2FJSA 3WDHA 4JQXC 1A3RL 3ZPDA 4EQ2A 3NJMA 3BUYB 4MNQE 1XMEB 3VXOB 4P06A 4Y16C 3VFRA 4ZOAA 1URZA 2E5EA 2FGWL 4HF5L 1YEEL 2WLMA 4MCMA 4XMPH 3S8GB 4FP8H 3VXUD 3GUTB 35C8L 1K4DB 3F12B 1HK6A 1J0KA 1F02I 2DQGL 4KNSA 1PF3A 3KYOB 4TYUA 3D9AH 3FSWA 1QO3A 1HDMA 4WLCA 3THMH 1X5AA 1KLGB 2BRRH 5E8PA 5I1JL 5B1BB 1PLBA 4M6OH 4RFNB 3MCLH 4LMQI 4HJJL 1QFUH 2ZONA 3U4KA 2XZCL 2ZJSH 3GBNL 3QG6A 4HWBH 1W72H 4G9FD 5IB3A 4WEEA 1OV8A 3VD4A 4IU3A 3S8FB 3PJSB 2WUCL 4Y5XB 3QJSB 4NHUA 4G7SB 3VSTA 2P52A 5CILL 3ETTA 4QHNB 4EO5A 3H4FA 4U6HA 1YCSA 4Z5RA 2RIKA 3SPVB 1BVOA 1BECA 2KDYA 5BZDB 2YA0A 4WW2F 5C86A 5CINL 4F8TA 1CJYA 3K8KA 4P4KD 5HY9A 3J27A 4FNRA 5TK2A 3SYPA 4X9HA 1X7SA 1T7VA 1G6RH 1QFPA 2O6PA 4I1RA 1F3DJ 1K2DB 3AWGA 1J1OL 1DN0A 4GIOA 2XY1A 4DQOH 1XGQB 3L3KB 4K3DL 2ENQA 3JZYA 4N85A 3RJQB 1F2QA 2PR4L 3BZFA 2YAQA 3MBWB 2ZSWA 3HZMB 1MCWW 3GSXB 2JTDA 3CFEA 5I8EB 4AGLA 5MI0B 4EOWL 3L81A 2CRMA 2B0SH 5ITBH 4G8GE 5E8DL 4E9TA 3WL9A 1YEKL 3TA3C 3WXVH 2VR7A 3ZUNC 2B4CL 3QUMB 1FGVL 2M2DA 2OS7A 1LD9A 1LMKA 5KS9E 1URIA 4RWYH 2WB7A 2EVHA 4FI6A 4AQOA 2C9AA 2X89A 1KYUA 5FW6A 2X4UB 1JZHA 1HNGA 1RLBA 1WFIA 4Z78A 1DP0A 4FQJH 5LWYL 4IJ3C 3VXSE 3I3DA 4Z3IA 3QZPA 4YWGL 1QI4A 4JFXA 5E6IB 2WWOA 1YY8B 3H85A 1I82A 2R69H 4G1EB 3GTNA 2YPVH 1F2XK 2XPGA 3WENA 2YZ1A 5I19H 2PW1A 4G7QB 2VLLA 8FABB 3IDIB 4HC1A 3QEQB 1CR9L 1JIBA 5INCB 1J5IA 4AM0Q 5SX5H 5CD5C 5F9JA 3QHFL 3PDGA 3QRGH 4KO7A 1OP3K 3DXAE 3QPKA 2JKIS 3QWOB 4D9LH 5I76B 5C2UB 1EBPA 3ZE2B 2BXYA 3QIBC 1MFCH 2BW4A 1IBFA 1FBIH 4P2QB 1QSVA 2H3KA 4JGMA 5JMOC 1PAMA 1WICA 1SBSL 4K9EL 4BFBD 4C83A 1YG9A 2EYSB 1NGXB 1BQSA 4AQZA 5H35A 3PAYA 3LVTA 4WK2B 3B8YA 1M05B 3Q5OA 4HUWB 5D2LA 1JNHA 2OZ4H 4UILH 3IB4A 3ROLA 3NK4A 5TQ0L 4JG0L 1Y7VA 5C08A 5IQOA 3I84A 4PIRF 4X6FA 5L4IA 1AE6L 5BV7B 1LEIB 1BOGA 3MNZA 2C9XA 1M71A 2WCSA 1C7SA 5DMYA 1GJWA 2X12A 3MR9A 1TFHA 2OJZH 2NQCA 3BW9B 1OP5H 3OMZA 1BVLB 4K3JL 5J1AB 2EUWA 2Q8BL 2WXFA 2VQ1A 4H88H 2HTKC 1G1KA 3IAPA 2IDFA 4FGMA 3V5KB 4CN4A 1AXTH 1JSYA 3EFDL 3UTZB 4WI3A 3K2UH 4YSPA 1KBBA 2FUQA 2VLJE 2Y1VA 3MLRH 2A6KB 3QA3B 3VUAA 1YMHB 3P2DA 3UJJL 3TA3B 3VFSB 2VITA 1YAIA 3BVNA 2Y3NA 3RJDA 1WFTA 4YPGB 4AEFA 2EE9A 1BA9A 4XPBL 4MDIB 5FO9A 2FAUA 3GS4A 4NP4H 4FQQA 3X3FH 5J13C 2FSEB 2J5LC 1EDYA 2AAAA 1IL1A 3PHAA 4WO0A 3UTSD 5HI5C 4QRSA 4WFED 5KS9A 4HK3J 4NERA 4PGZA 5EFIB 4JN2A 2GFBA 2R0LH 1FYTD 3ECBA 3DX1A 1QEWA 4XOAA 1E40A 1WCQA 1DQDH 1MFDH 4FTVB 4JJ5B 2CIIA 1U2HA 3MA9H 1G7HA 6FABH 1KCSL 1Q94A 1C9SA 1BFTA 3Q9PA 4CVXB 1N5AA 2ITDB 1QOKA 3H4HA 2FWOA 3OR7A 2PXYA 4IHBA 4WDIA 5E4IA 4P99A 3VNZA 3ULSA 3I6LD 1INEL 3A67L 4YDNA 1U95A 2MOGA 2UYLB 4HJ0C 4LSDA 4Y9EA 3R19A 4L3EB 4AL8C 4BKLB 2XG5B 3WTXA 4PS3A 2IH9A 1ND0B 2UXGA 4QDGA 3T6WA 3VGAC 5IIEA 5T1KA 3AGVA 2P8PA 3HI5H 2R9HD 5EN2B 4AQ1A 5BJTA 4TOYL 3LEYH 4IS6B 2O72A 2ITEA 3D2UD 3QUMH 1JZ4A 5JYLA 1HWHB 4BFOA 4J3OD 2FK9A 5F1NA 5DYFA 1UQSA 1X5HA 3PWPB 1XIWA 5L0QC 2IH1A 4R7DA 5IVNA 1S7QB 3EOTL 4HWBA 4QWWC 1CDBA 3VGGA 4GG6E 2XX0A 4NAQA 5FECB 1LO0H 2XHNA 1PX4A 1RSFA 3QR1A 2F15A 2JLLA 2R2HB 3CVHA 2JTYA 2EEBA 1AGBA 4YO0A 1F1GA 1X5MA 5D7EA 3V6OC 5ABDE 2K70A 1IV8A 1PNDA 2AFNA 4JFVA 1L9OA 4LCUB 5DJDB 3I6LE 3L45A 4ODTL 3NIGB 3OKEA 5DLLA 3OAZH 5KYWB 4U6VL 1KB5B 1JL8A 3BLKA 1MELA 1WC7B 2APVA 2CZNA 3PL6A 3WIAA 3ZRFC 4HH9B 4ZUTB 4DFHA 4JANB 3DPBA 3EYQD 3BVTA 4OSUL 3N91A 2NQ3A 4IOFC 3WNLA 2BDNL 4PJEA 4OLWL 4LL4A 1T1ZA 3ZYJA 1KPUA 2VLJA 2VDRL 3GLAA 4JR9L 4AX3A 4U1MA 1DSYA 1IGML 3G5ZA 2HP4A 4L4VE 4NAJA 2NLJB 1P1ZB 1VKXB 1R3LB 1VFAA 3DWTA 1YLBB 4U6XB 3HC0B 5TE7H 2HVJA 3QDAA 5LXGH 2E27L 2EKJA 3D0VB 4I18B 4N87A 4ADIA 5EBWA 2DWEB 1BQUA 3AREA 4O02B 3JVFC 3KYKH 2B9BA 1L0XA 4JRWA 4DGIL 2ZKHH 2XICA 1UZ8B 4D8OA 3O6MH 5IJVA 4GQ9L 1EZVY 1HHIA 4Q58C 1FVEB 4WI0A 1MI5E 4PFEA 3U0TB 2V2XB 3QQNA 1XEDA 3KPSB 4WF7A 5EUOB 1P9MA 1PG7W 2Y3AA 3B9EA 3O2DH 4J3UA 3WXVL 4FQXD 1HNFA 4L1TA 3UYRL 3ZDZF 4PWEA 2C26A 1OT4A 3IJSB 2Z8WC 3C8KB 1QLFB 1CGYA 4PG9B 5E70A 5H37G 1HYSC 4UUJA 3QDGB 2FH8A 4ODBD 4RGOL 2BCMA 1DLHA 1T04A 3BP6B 3QUML 5EUKA 5ILTL 1NFKA 4F7EA 1LO5B 5AZEH 2BRRL 2R1YA 3MLUL 1NCDH 1NAMA 1XH3A 3GRWA 3WUWG 1T03H 4FABL 5KZCB 3UZQB 3ENEA 4NT6A 3BEWB 1F45A 1JUFA 1MCIA 1A3LL 4QRBA 2XNAB 1BZ9B 2VM9A 4OZHE 1AQMA 1P5UC 1Y07A 3RI5F 1GA2A 3IN2A 5KVGE 2D31B 3EH3B 2Z4TA 5DZVA 3MLXH 5E8NB 2JQAA 5HGHB 2H2PD 2OM5A 3SPVA 4XBGB 1U3HD 3PP3H 2YWZA 3HAEG 3UZEC 5HYJA 5CKGA 5IQMA 2ZG3A 3LAFA 1E9OB 4W4NA 4NRXA 1MVUA 1N6UA 4W93A 2D03H 1E3XA 3MRJA 4ZUWA 1HKLL 5CO1A 1XBDA 4R0LC 3UC0L 2IALB 4WFGD 3RGVB 2QADD 1Q9KB 2CDEA 2HH0L 1SLVA 3TVMA 2WP3T 5DMGC 3EGXB 5GZOD 4N8CL 5H4YA 4E41E 3IRPX 3FQ2A 3WTSA 4I0KA 1ITCA 2FIRT 5F9WB 4JZJC 3KYMB 3DRQA 5K59F 1EZUA 4Z3EA 1V3MA 1R3IH 1V3JA 4JG0H 5DDHA 5FX3A 1U8QA 5I30L 3P9LB 1A4KA 2ERJB 3UYOD 5LCVA 1BFOA 4OIBA 5FEBA 3I50H 2H1LM 2H9GB 4TNVK 5I8KL 5KUMA 4MJID 4NDMA 4JBSA 2LVCA 3EF7A 2XA8L 3NIFF 1KFGA 2ZWNA 2C7FA 1P7QB 5B1AB 2VMCA 2WUBH 3ABLB 1Z1WA 3G6JF 5EPMB 4Q6KA 4Z78B 5JW4M 4TVPL 4DGYL 4OD2B 4JFXB 1KXTA 1HQ4A 3CXDH 2GVYA 4S1QL 3FSZA 3ZQWA 3GINA 4YHIB 1U8OA 2I32A 3VD1A 4X7SH 2VQUA 1B3IA 4AKOA 1NFDB 4XMKL 3OF6A 5FFOA 4PJHB 4HX1B 1ZOXA 2OJEA 4YGAB 5HJ3B 5CEYB 3EYSL 3Q2WA 4XCYB 2DKMA 2XVGA 4PI2A 3WELA 2JXMB 5HP5A 1F11A 3MLSH 1JZ3A 4IU3B 2Z93A 4PJIA 2X7LB 1MPAH 2ORBL 2GQHA 3K4DA 4HSQA 4JL2A 4X6DA 4LQ1A 4D9LL 4JFPA 5GZNC 1KELL 3FOLA 1G9HA 1IBGL 1NINA 4YHZL 3ULUH 6TAAA 4KK9D 4Y5YB 3RVXC 3RZCA 1B0RB 3H1ZA 3MHZA 1Z6JT 3FO2B 5DD5H 2IJ0C 3S48A 2VAJA 1JMZA 2XTJB 3PF2A 2HT3C 3ULVD 4K9JA 1DZBA 2AJXH 2HKFL 4PJ9A 2GYSA 1W72L 2OAAA 2YBRA 3EBGA 1JHKH 3D50A 5C0AA 3HG1A 3S2AA 1E4WL 2B08A 2F08A 1PKQE 3LNDA 1ZHLB 1WP6A 5EIIA 4RMWA 3P3TA 3BSGA 1IKFH 3ESMA 3I75A 1E6OH 1YQ2A 4GXVL 1S46A 4A1RA 3WFHB 2G5UA 4PH8A 2DWYA 3FU5A 1NKGA 3ZL1A 1JXDA 4N24A 2HUEA 4FNLH 2BNUA 1QUPA 4XNBA 4QYOB 4PJDE 3QCTL 3L7FA 3BT2H 4ZW5A 2XWCA 1RZ7H 3BYTA 3QP3A 1V5JA 4GKZB 4AT6B 4EI6B 4F33B 4HZAA 1RVFL 2XV0A 3PCYA 4KJPD 4EBQH 3G5YB 4WI4A 4YXHL 2CK2A 3RIFF 3MKKA 1FL5B 1GOGA 2VKWA 4RZCA 1QPPA 2DQIL 2IAMD 4IBWA 1U8IA 4N0CC 3BN9D 4N2BA 4JM4L 1Q4NX 1MQKL 3TV3H 3H42H 3UX9B 1QHOA 4M1DH 4NP4L 3J2PA 5I1LB 3GDCA 3KDMB 1QASA 2N7SA 1KYAA 5A6MA 4ZX3A 2A1WL 3FNKA 2NOYA 5C8JB 4LLYA 4MJ5B 3VX1A 3IXAB 2VAAB 3O0LA 1XO8A 4Q9BA 4F57H 1VGEL 4ZOCA 4BRVA 3FS9A 3SDCC 1QEWB 3QJRB 1SM3L 3TX4A 5C92A 3U48A 2VABB 5FPIA 4RZKA 4MJIE 4JFZL 3J8F7 4BZ2A 2GJJA 3H3PL 4XR8C 1A66A 2E8YA 3ZYOA 3F85A 3EJRA 5FUOH 3QCVL 3V6ZB 2C3GA 4B9GA 2EP6A 4M7JL 4PM1A 3EAKA 3ZR5A 2CWRA 4DGVL 2VDMH 1HINH 1ZHNA 2ZXCA 3KL3A 5B38B 4GUOA 3ROOB 5KN5A 3TURA 5HVHC 1YDPB 4K5PA 4JQIA 5DD5L 4ENED 1PZ3A 3RE0A 3O9WC 4M8QB 1D5XA 1I3GH 1IC1A 2X53A 3N1QC 2GBVA 2WVVB 4WW2C 3VFWB 1XZ0B 2GSIA 3BWAA 4YC2C 1UQSB 2JKJA 2V9QA 5C9JA 4UT9L 2UZXA 5F0MB 4TULH 4WI7A 3OZLA 5JUEL 4ELKB 4ZAKC 1EFQA 3S5LG 1JF1B 4DGWC 1BVLA 4YSQA 4B60A 1TTCA 1YPZB 2DEYX 4BFIB 5IFHH 4LHUD 1OGTA 1MJ8L 3B7UX 4KGJA 5TE6L 5TH2A 1PKQA 5IF0B 3IMUA 3EGDB 2YJLA 3QRGL 3R0NA 4JGNA 2ZAHA 3RWEA 5LBSA 4HU2A 1TITA 3MJ9L 2ATKB 1CFTB 4KGLA 2ED8A 1TZHB 5DUBA 5BVPH 2VDNL 1RJCA 2J71A 3FSAA 1U6AL 5F6HJ 1BLNB 1I9RH 4KQ3L 5KBKA 4HUVB 3QPXH 4Z6AT 4DPBX 1RZKH 2EUVA 3G6JB 4HDIA 5JLZB 1WC7A 1JGLH 1LK3L 2GJ6A 3DV4A 1ZCRA 2V5YA 1RFDL 1YYLH 2XFXA 3GHBL 2G2RA 3HZKA 3PDOB 5E00A 1IL1B 4M1CC 1EERB 1G9MH 2MCMA 3K2UL 3QULA 3GSVB 1KY7A 2JCCE 4JN2B 4KUZH 3GSNB 4OKVB 4IDJL 4P2AA 4NBYB 1OD7A 3TN0C 3ECBB 1KBGL 4LVEA 4YL9A 4DKEL 3QQ4B 5JXAL 4O2FB 4U1LB 2EEDA 2I69A 4E9SA 2ROYA 3G6DL 5JXEC 4M48H 1EMTL 3GPEA 3WNIA 5IEHA 1GZHA 1RMFL 2X9XA 4AIXA 1K6QH 1KTKE 3KYAA 2N59A 5CFHA 2HVKB 3AADB 4F2FA 3RIKA 4F1ZA 2AQRA 3VI3A 5IUSA 1FYTB 2KZBA 3ZR6A