1A8ZA

Structure determination of a 16.8kda copper protein rusticyanin at 2.1a resolution using anomalous scattering data with direct methods
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
LDTSWKEATLPQVKAMLQKDTGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLDIPAGATVDVTFINTNKGFGHSFDITQKTPPFAVMPVIDPIVAGTGFSPVPKDGKFGYTNFTWHPTAGTYYYVCQIPGHAATGMFGKIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination of a 16.8 kDa copper protein at 2.1 A resolution using anomalous scattering data with direct methods.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords RUSTICYANIN
total genus 34
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 1998-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1a8zA00
1SHWA 3WKQA 2VN3A 2FQDA 4AX3A 2UXVA 3HEIB 1ET7A 3QQXA 2GI0A 5B1JA 4KNTA 3ABGA 1NDTA 1X9RA 3GDCA 1NIBA 2J56A 3G5WA 1XB3A 2W8CA 5I6MA 5EHFA 1SNRA 2OV0A 4W9ZA 2J57A 4KOCA 4A2FA 1AAJA 5I6LA 3OMNB 3FQ1A 4HZ1A 3NJJA 1E65A 3BVDB 4A2DA 1IBYA 1ZV2A 3S8FB 4JHUA 1AANA 1JZHA 4MFHA 1KDJA 1FFTB 1A3ZA 1NWOA 2XV2A 1XMEB 1CC3A 4Q8BA 2R7EB 3PLYA 2I7OA 3FQ2A 1A4BA 3EHBB 3QJQB 3AG1B 1BQ5A 3QJTB 4A2EA 4DP0X 3C75A 5TK4A 4AKOA 1ZDSA 1ILSA 1N70A 2GB2A 1ILUA 3FSVA 1BXAA 3QJSB 2IDTA 1WAEA 1YLBB 3KW7A 1GS6X 5TK2A 4UAHA 1GY1A 3CVDA 4KO7A 2GSMB 3QPKA 2TSAA 2DWTA 4PAZA 1NIAA 4ZK8A 1SFDA 3AW5A 4NAJA 1OCCB 2J55A 1OE2A 1GS7A 3PCYA 4G72B 9PCYA 5I6OA 4E9QA 4YVUA 5D4JA 1ET5A 3CDZA 1SJMA 3S3CB 4F2FA 2LLNA 4BXVA 4KO6A 4YSRA 1AZUA 3FU9A 2IDUA 8PAZA 3WIAA 3IN0A 3CVCA 4DP8X 3NSDA 3ABKB 1OCRB 3S3BB 5E9NA 3H56A 2IWEA 3T6WA 1KDIA 3ZIYA 2BP8A 3N55A 2A3TA 3FU7B 2HX7A 2FQFA 4E9TA 3QJRB 4UF7C 1BQRA 5I6NA 3OQRA 3IE9A 1V10A 3PAVA 3D12B 3NSYA 3DTUB 5I28A 1FA4A 3WG7B 2YXVA 4BK5C 1NICA 2HLEB 2WO2B 2DYRB 2BWIA 2QPEB 4GP8B 2XUWA 2PP8A 3SBQA 1W6LA 2ZOOA 2BO0A 3UABA 2XV0A 1VLXA 5I5JA 3FS9A 4PCYA 1ASOA 6PCYA 3IN2A 3DKHA 3GYRA 3EH4B 1QNIA 5D4IA 2PP9A 3U25A 4YSUA 4AI7A 4E9WA 5LDUA 3WNJA 3JT2A 3ZX1A 1J9TA 1ZDQA 4BDVB 1OOWA 4AKPA 1XB8A 3ASNB 4KNSA 3AG4B 4A2HA 1KGYE 5I6KA 3S3DB 1IKOP 2CJ3A 2YAMA 4JKNA 1PMYA 5ANHA 3MBWB 3ABMB 1OV8A 1MZZA 1AS6A 5F7BA 1IBZA 5PAZA 1A8ZA 4RH4A 2W88A 3EH5B 2B08A 2JFCA 3X1NA 2AZAA 2QDWA 5F7AA 3CZUB 3CVBA 4X4KA 2IH8A 4HIPA 4E9YA 2PPEA 2E86A 3NP3A 2EIMB 4W1TA 5I26A 4CSZA 7PCYA 1IUZA 4NB7A 1JXFA 2CUAA 1L9QA 3PAZA 3UACA 1JVOA 3X1EA 1J5CA 2HRGA 2XYBA 3ASOB 1TU2A 2OCCB 3NJIA 3NT0A 2FT7A 3WKPA 1E5ZA 2PPDA 2QDVA 1RCYA 4A68A 4Q89A 2ZXWB 4YSTA 1CUOA 4YVNA 3FU8A 3SBRA 1J9SA 1W8EA 3DIVA 3X1BA 4FA7B 4BXSV 4YSEA 2CALA 2VMJA 4YSOA 1OE3A 2IH9A 3TA4D 4YSAA 2UXFA 4E9XA 5AKRA 2BHFA 2IDFA 4YL4A 3X2QB 3FT0A 3IEAA 5B1KA 2I7SA 1ASQA 2X87A 3SBPA 4KO5A 3EH3B 4DP7X 4G7QB 1IC0A 4P5SA 4TXVB 1GS8A 2BZ7A 2AZUA 3WI9A 1AG0A 4BDVA 1HFUA 2FTAA 1F56A 1AG6A 4GP5B 1E5YA 4F2EA 2CBPA 3NSFA 1A4CA 1CYXA 4G7RB 2H5UA 1BEXA 2RACA 3BQVA 3NJFA 5B1AB 5B3SB 4ENZA 1EHKB 2VW4A 1JVLA 4EF3A 4DPAX 4G71B 1NTDA 1AOZA 4BWTA 3T6ZA 1CYWA 2H47C 4GYBA 2CCWA 1DZ0A 2Y69B 2FWLB 1FWXA 4DP6X 3GXUB 1KV7A 2FT8A 5I5IA 3NJGA 1JERA 1AR1B 5PCYA 1NINA 4P5RA 1NWPA 2AANA 4UANA 1TEGA 4HALA 4JHVA 4DP4X 2GC4C 3FSWA 4HCFA 3X1GA 3N2JA 3PXLA 2JKWA 1M57B 3KW8A 3PPSA 1PAZA 1PZAA 1W6WA 4A2GA 1PLCA 3H4HA 4YSQA 1E67A 2YAQA 2P80D 3FYEB 2DYSB 1PF3A 2VSKB 1AZBA 1M56B 3FPYA 2VSMB 1BXVA 4M3HA 1NPNA 2HX9A 3ABLB 2YAOA 2EIKB 3QJUB 1SF5A 1PY0A 4YSCA 2YAHA 1MZYA 1KCBA 4BWWA 1PNCA 5I5MA 2AFNA 2YQBA 4HCGA 5A7EA 1E30A 1ETJA 5B7FA 1AIZA 2UXTA 3NJHA 4GY4A 3ERXA 1A65A 1GW0A 2WSDA 3UAEA 4HAKA 3AY2A 2Q5BA 2IDSA 1MG2C 1HAUA 2HZHA 1JXGA 1NIFA 1EZLA 4K9JA 3X1FA 4WTQA 2BP8B 1JZJA 4HCIA 4KO9A 3V9EA 1NIEA 2YARA 1X9UA 1L9SA 1KYAA 1NIDA 3NJLA 1ADWA 4DP2X 3NP4A 1AZNA 4M4RB 1PCSA 1AQ8A 1RZQA 1SHXA 2BP0B 3AG3B 3L45A 2Q9OA 3AG2B 2XLLA 4DPBX 1JZGA 1WS7A 5B7MA 2IAAC 2XV3A 5AZUA 2BWDA 4A67A 3RYMA 2I85A 4AKQA 1M9WA 2EILB 7PAZA 3T9WA 3JTBA 4WKXA 1GY2A 3TU6A 1BYPA 2GC7C 2IWKA 2BZCA 3T6VA 1V55B 1WA2X 2H3XC 1L9OA 3H4FA 3NYKA 3T71A 2VW6A 1XB6A 2FQEA 1NZRA 1DYZA 4GP4B 4E9SA 2XVBA 3FQYA 4E9RA 3UADA 1R1CA 5B1JC 1J9QA 1OF0A 2BW4A 2TSBA 2YAEA 1AZRA 1T5KA 2DWSA 1AS7A 5AFAA 1A4AA 2MRYA 1ZIBA 2DV6A 1OCOB 2PCFA 3UGEA 1OCZB 2ZWNA 1SDDB 1L9PA 1TKWA 3EF4A 3NJMA 3QJVB 4BWUA 2X88A 1KCWA 3S8GB 1RZPA 1GSKA 1BQKA 2VM4A 1BYOA 2FJSA 1PZBA 4KNUA 1WA0X 1B3IA 1GYCA 3NSCA 2XXGA 1AACA 5FC9A 1BXUA 1RKRA 2IWFA 5B7EA 2XX0A 2VM3A 1JZIA 1AS8A 2Y1AA 1URIA 2XWZA 1PNDA 2WO3B 4N4YB 4DP1X 2GHZA 3FU7A 2GIMA 1N68A 4YSSA 2HRHA 2BP0A 4QKTA 1V54B 2UX6A 1CURA 1I53A 1ID2A 4AZUA 1GR7A 1OE1A 2QPDB 3OMAB 1UATA 1ZPUA 3NJKA 3ZDWA 4F7KA 1QHQA 2PPAA 5IY5B 2XU9A 2UXGA 2XXFA 4GXFA 4NERA 1KBVA 1MG3C 4QLWA 2OJ1A 1JZEA 3TBBA 5B1BB 3PAUA 2NRDA 5D4HA 3T6XA 3FYIB 1BAWA 3AZUA 3UAAA 2PPFA 2R7EA 2PP7A 1QLEB 1ZIAA 1SFHA 6PAZA 1ASPA 2XX1A 1WS8A 4E9VA 1J5DA 1ET8A 1WA1X 3SQRA 1NPJA 4HHWA 3CG8A 4YSPA 2PPCA 3FSZA 2HX8A 2J5WA 4KOBA 3FSAA 2PLTA 2CAKA 2IDQA 4DP9X 4FAAB 1L9TA 4G70B 4HHGA 3OMIB 3WNIA 1TEFA 2N0MA 1PLBA 4L0PB 2YXWA 2HXAA 3TASA 2DY2A 3TBCA 1PLAA 3FPXA 2QT6A 2EIJB 1JXDA 3CDZB 3NJNA 4DP5X 3OM3B 1HAWA 3HB3B 1SF3A 2FT6A 2YAFA 2ZONA 3OD3A 1J9RA 4A66A 1AZCA 2AVFA 1L9RA 2B3IA 1PZCA 2FNWA 1SDDA 2BW5A 2MTAA 3ZBMA 1MDAA 2GBAA 2JXMA 1KBWA 2PCYA 3IBOA 2UX7A 4YSDA 2FQGA 2P80A 4G7SB 2EINB 4N8UA 4DPCX 1JOIA 5I6PA 2VW7A 3MX0B 2YAPA 3V9CA 4CSPA 1JZFA
chains in the Genus database with same CATH superfamily
4HGWB 2NW3B 2R0WL 1WAAF 4H0GA 1QRNA 1KIUA 3UBGA 2BSRB 1FL3B 1RULH 1Q4NX 2ADGA 3QQXA 3MA9H 5FYJH 1R5WB 5DHMC 2WLLB 5LGJB 1G6VK 5TQ2H 3L95A 2FB4H 3ZE2F 3LZRA 3AWEA 2BDNL 5C0GA 1BOYA 1ZGLM 4KVCH 1QVOB 2CIKA 5EULV 5F9WB 1A3QA 1CDIA 2W8CA 1MHPH 3MROA 3PWPA 2WZAA 1V27A 1SNRA 1BD2E 2OV0A 4HFWB 4XN1A 2C7FA 3QQ9D 1KJVA 2BHZA 2IANE 3HZMA 2DM7A 2ENSA 2WLNA 4BH8A 3VXRD 2OMXA 4BE5A 3VQ2C 5F0PB 2PMZA 3ZE1B 4HHAA 1WSST 3F3HA 3FTSA 2K7PA 2G60L 3HFFA 3PREA 3JV5A 4Z3EA 5I1LA 2F1BA 1DBMH 5EH1A 1DEDA 3I50H 1K85A 3QIUB 2FECI 2AEPL 5DEGB 3E1ZA 1ETA1 5FYKU 3SDAD 3D51A 3X11B 1QWUA 3QJQB 2WNWA 1A3LH 3CFIC 3VH8A 4LL9A 5T1LB 1LL1A 2HFEA 1FF5A 1LO5A 2DQJL 3QUYA 4RDQF 3V5KB 4EI5D 3D39B 5EU5A 5FUCE 1UM5H 4UAHA 1JHTA 5CJOL 2EVHA 4LLVA 3QPKA 3IGAA 2I5YL 3O11B 1KENH 3DX3A 3AU1A 2VERN 4LAQL 5DMJB 5FHBH 1Z2KA 2VR8A 2YPLA 4B7LA 1SFDA 1BFOA 3LEYH 1IVLA 1RERA 2WVVA 3ILEA 3VVWA 4IOFC 1RUQH 3PCYA 5C86A 3VXSB 5ETUB 1KB5B 1M71A 1U8QA 3PHQB 2F6AA 2XQYK 5CBEA 2WLHA 4DQAA 4XVJH 3E8VA 5LQBL 3WNPA 1BZQK 4ZX3A 1CU4L 2HRPL 5IIEA 2E9GA 4URTB 4BQ8A 1JGEA 1M7DB 5I15H 3DMMC 4HIEB 1KTCA 2TRYA 5GGSY 5EO0B 2H32H 2E4FA 4DVBA 4NPJA 4NLAA 4OBSA 3ZHNA 5BCAA 2KPNA 3FULA 4JKLA 1QPXA 43CAA 3B9KC 3HG3A 5BVPL 2BXZA 5CP7A 3VWKD 1H5BB 2XZQH 3OQRA 1BFVH 3MRPA 2BHYA 4EZMA 3ECVA 3VNZA 1IE5A 2EEBA 1E5UI 1VEPA 1I9JL 1UT9A 2F58L 4D9QD 1VFMA 3QWRA 5I17B 1K4CA 1KGJA 3WTVA 2BWIA 1KGUA 2PYFA 1EAOA 2ZOOA 2GBVA 1W16A 4I8DA 1AGCB 1NQBA 5D2LE 3WIIL 3M86A 4L37B 4H40A 3U0TB 4HJ0D 1LDSA 4HCRA 4KI5F 1EJOL 1BBJA 1ZT7A 3KWXA 1QNIA 1CLYL 3B2UC 4FKKA 3ZKMD 3ZO0A 2PN5A 3N41B 1HL5A 3HFMH 3WN6A 1XB8A 2DI9A 4Q4EA 3WSQH 3P4OA 1KGYE 3P3TA 2V0AA 2OTWB 3I84A 4YDVB 2WBXA 3UTSB 4QXVA 4XP1H 1VCAA 3WLWC 3OVUB 3ABMB 4XPGL 1H15A 1NUFA 2J8OA 2XRAH 3Q6FA 5IFHH 2WUBH 3R1GH 3PIQA 4HK0B 3FTYA 1MFEL 5I75B 2Y9RT 3Q8CA 3L8QA 3X1NA 4XMLL 1OAYL 3DBSA 2R29L 3SKNA 2WLKA 3IWVA 4L23A 4EZKA 3FRPG 1MVUA 4JQVC 4TTDD 5LGHH 3NP3A 2J6EA 1KTKE 2AJZB 3OGOE 3QXWA 1MIEL 2D0GA 4M7ZC 4CSZA 2MCAA 1T0PB 1FNAA 2CUAA 2QVIA 3IKCB 2WXRA 4YNYB 1I3RB 5B39A 1LO4H 3HBQA 5CLZA 3MNDA 5JXEC 3ATBA 1EHAA 1J5CA 3SGJA 1QWHA 2ETWA 1ONQB 1CJYA 4OT1L 4K0OA 2QHLA 3B2XA 4FHBD 4G3YH 3LVTA 2GT9A 5JHDA 4O2FA 3RURA 4WU5B 2AHIA 1CD9B 4OFYA 1K5NA 3FQNB 3EGDB 5T3XE 1JGEB 1M7DA 2X40A 1OAQH 1B3JA 3QSKB 5HGBB 5DDHA 1OCWH 2MOQA 4BFBD 5I18L 3MTXA 1QTSA 5I8EA 2EVGA 2Y72A 1NCHA 4Z7WB 5AKRA 3GFUA 1OWRM 2J21A 1K8DB 1SY6L 1Z9OA 3GBMH 5INDA 2MCPH 5B1KA 5FYJD 5DQ9A 4KV5E 3C60B 43CAB 1I3VA 4QTIL 2CH8A 3DSFH 4GFTB 2ID5A 1UWXH 3FC8A 2X0UA 5DT1H 1F86A 1NFDE 5KVMC 3GXNA 2PWFA 2NSMA 1LXMA 3MRMB 3QB7C 4F7MB 6CGTA 4HSCX 4PRAA 5JYLA 2RFXA 3LHPH 2EEDA 4IJTA 2FJHB 2ORBH 3AQXA 1C5DA 4Q9QL 2RACA 4IEFA 3BQVA 4TL4A 1TT6A 2B59B 2BVEA 1AE6L 3G5XA 4Q0XL 4MHHI 5AALA 2VR9A 7FABL 2H6PA 2WSPA 2ZOTA 1TZ8A 4UQIM 3LN9A 1QEXA 5KYXA 3P77A 3FMGL 4DTGH 3LRGA 1FWXA 3II1A 3SDXB 4A7GF 1KV7A 4CC4A 5BUPA 1T20A 4RQQA 2E7CA 4AL8H 4ELME 1OGAD 4AK1A 1HOCA 1ND0B 4OCWH 3QDAA 4UANA 2NTFB 1QI4A 5KSBE 1FJ1B 1MJ8L 1OSPL 3IJ9A 4HALA 5AEAA 4DP4X 3O3EB 2X70B 1UKQA 4YH6A 1IFRA 2JJWA 4UZGA 1HK6A 2JKSA 3KYMB 4WUUD 3WUWA 1E67A 4NO2B 3NK3A 4OT1H 1NEZA 4GNKB 2H0FA 5KAQG 2EIKB 3ARDA 1JDCA 2UYLB 4XBGA 1SF5A 3QNFA 5DQJA 3DIFB 5F44A 4R96A 5I5MA 2AK1H 3CZNA 5E7BA 2P44B 3B7TA 5AW0B 1TVHA 1LQBC 1KBKA 3L7EA 4W9DC 4LSTH 4N26A 3AQZA 1K6QH 3BPOC 3KDPB 3LQAC 1ZS2A 3MRFB 3F8UB 1A1MB 3IJEA 3PV6A 5D2NA 2FSEA 3TBWA 4BHUI 1ZHLB 5AB2A 3MCLH 1ETB1 1X5YA 2N7AA 1W15A 4G1EB 1TCMA 1NIDA 4M6ML 4UU9B 2NQ3A 4PTTB 2BSEA 3FH7A 3HBZA 5D1QC 4PJFA 1RPUA 1OANA 1YC8A 4PW9A 4P3CL 3V4VL 1IJNA 1F2XK 3BKYH 3HMXH 5ALCL 4ZTOL 1CFSA 2XN2A 2MMXA 4NKDA 1P5VB 3AM8C 4XO4A 3QXVA 3HNVL 4AKQA 4WFFD 1OHZA 1WD8A 2I85A 4CAGA 3B2UD 1R24B 3PP4L 4HIXL 4N8CL 5AVYB 4OZIA 1LHZA 3TT1L 2NQCA 3WHXB 4FNSA 1XSIA 3OXSA 4S1RL 4U3SA 3UJTL 5J06A 1FAIH 1MY5A 3KEDA 3RTQB 1YMMB 2WN2A 4G8GE 5D8JL 4PJ6A 5HGAA 3KG5A 2ICEA 2GYSA 4WEMB 4QRTA 3UADA 4AJVA 5GSRB 1PQZB 3BD5A 3GDBA 4JRXA 5DYOB 4OIIL 3BPOB 3U30B 4NBYB 3ZDZE 4QO1B 4OGYL 1CF8L 4F7TB 5B8CA 2WQAA 3GO1H 4POUB 3QZWA 2X5PA 5C8JB 2IGTA 3DI2B 2DWSA 3PGFL 3QCUH 4G8FB 3KXFB 4RSVA 4E5XG 5CILH 2Z8WC 4PU2A 4I3SH 4JFQA 5I1AA 4XX1G 2CDGB 3WS3A 4MNGB 1BYOA 4L3EB 4KK5D 1A64A 1TIUA 1P5UB 5FECB 2VO8A 3FUMA 3BSZH 1RZIA 3MLSL 1FVDA 2IPUK 4G83A 5BOZG 2BVUA 3FN0L 4OBRA 4X5WB 3UYRL 3KE0A 4PGCB 4YOKA 3F84A 1U36A 3QEGH 4WFHE 5EG6C 3ZQXA 1OE1A 5AYTA 1UWGH 3RVXC 1JMXA 1ZS8A 4FXGA 4K8RL 3FFCA 1QHQA 2PPAA 1KJ3H 1ACZA 4Y16D 5FA4B 2YZ8A 1HKFA 1DQJB 2DQ6A 2R15A 4FQQB 5IB1B 2WB7A 2DQHH 3BQUC 1EK3A 4GSRA 2QV4A 1QUNB 3G6AA 2IMNA 1CD8A 4L9LA 3TBBA 5KBKA 2GI7A 4DO4A 3OGCA 1XVSA 4KI1A 5D4HA 5ENWA 4PTTA 4NI6A 2Z1KA 3FYIB 5JW4Q 1BAWA 4XBMA 1LM8V 1DE4B 3SGEI 5EORH 1WICA 2DH3A 4QLRA 2OX5B 2WB1A 3MLYL 1F8TH 2EXSA 1FFQA 5E6RB 1D5BA 2DZEA 5KANG 4YMPA 5HPMB 4XPHL 4X99B 2ZP8A 4E9VA 3MOBH 5TFSH 5IROA 3MBXL 2WWNA 1UJTA 3L81A 1JGLH 3KVQA 2M8XA 4ZJ9A 3MUHL 4KOBA 4L1HA 4BH8B 2MHAA 3L9EA 5JW4R 1ZK5A 5SWSE 1I7TA 3VG0H 2W9DH 3QJXA 2IADA 3TFBA 5ID0A 3WNIA 1TEFA 1IL1A 4YXKL 5FIEA 5DJ6B 2GUYA 3LMJH 4NJ9L 1A1NB 1TYRA 2BMKA 4L4TA 4RMUA 1GJWA 4PQXA 1FL6A 2OJZL 2VDNL 1MJJA 1E5CA 2QSCL 5DMIL 3D4CA 3TBCA 1OB0A 3DUSB 1U3HA 2XY1A 1M7UA 2DJUA 2DQEL 3RIFF 4G6KL 3SYAA 3HZVB 2HFEB 4PVMA 4OGYH 4Z7OE 4MLIA 1MJUL 5FYLL 4FZEL 4P2RE 3WYRA 1OZTG 4G8FA 2YPVA 1C08B 2JB5L 2DD8L 1WWCA 3A6CH 4MSWB 5IG7B 2E9IA 2BDNH 5JNYB 2BLFA 1XXFC 3BESR 5LLIC 3CX5J 2PCYA 4YFLF 5HHNA 4QRUB 4G8EA 4NQDE 3WEMA 1BVLB 3RUGB 1S7SB 6FABH 1E3ZA 5KYWA 5GS0L 1N2RB 1EFXD 2YAPA 1NBYB 3QZNA 4N25A 3GK8L 1TZHB 3O6MH 5C0GB 1NBZA 1QSZA 1YAZA 3HLAA 2YLHA 1JNNL 2F8OA 4M00A 3K4ZA 4UTAH 3FRPA 5JIDA 4EI6B 1GJUA 3D9AL 4QYOA 1PS3A 1U41A 2K70A 3ZU8A 4FG0A 3G5WA 3TEXA 4BRJA 3BFQG 3C6LD 3QHZH 1BA9A 4KZDH 4NHCL 4KTGA 1IBGL 5L8LB 3L5JA 2VQ1A 1MOEA 4NPYA 4TOYH 1TF4A 1A7PL 5GRUH 2XKNA 4XODA 3D09A 1XTLA 2C34A 2OSLB 1UVQA 3KPLB 3TCXA 1RHFA 5IB3B 4JHUA 3V55A 4Y1TA 4PRPA 1Q0XL 4PREB 5DC2A 4JANB 2BNRA 3N1MC 4PS8A 1EHNA 5DD3H 2Y5QA 1BSIA 4LCUB 5IOPA 1Z3RA 4IRZH 3BAWA 4IU2B 4U1JA 3VE0B 3K72A 3UAFA 1MHEA 3F12A 1KFAH 3B56A 1C5BL 2YSSB 3VXSE 4W4OC 4G7YL 1NSNH 1BG1A 4U3CA 5F7WC 1MFDL 2BOBB 3HHRB 5AW1B 4N8PA 5IB2B 3WNKA 4ANVA 3WKMH 2GHWB 2V6HA 1WAEA 3KW7A 3UTZA 2NY4B 4P05A 1AGDB 1QRND 3EJYC 4QHUA 3PWNA 1P4UA 4B41A 3VTAA 4LSPL 4AIEA 3CCHB 3F01A 5C0EA 3ARGC 5KTEH 1KN4L 3ZL4L 1IL1B 1YNLL 4X6DA 3LDBB 3ZE1F 4LL1A 2FR4A 2KZKA 4GW1A 4G6JL 4KJYB 4XMVA 1W0YT 4WGWB 5HP5A 5DQDH 5GGVL 5I6OA 5I8CA 5E8EB 1IGFH 4N1EA 3ROOB 4UMSA 1EHXA 1KCLA 3CDZA 4M5ZH 4LVOB 2LLNA 4JR9H 2IALA 4MXWH 2VMCA 5ABAA 3MFFA 3PFQA 1FC2D 2IDUA 3GRWL 3RRQA 3S36X 5KVEL 3NSDA 4BFNA 4XRCA 3H7LA 3T77A 4BH7A 1R4XA 4JY5H 2XFGB 2Y7MA 2W5PA 1CI5A 5E4EB 4X7TB 1BCIA 2R0LL 2WTOA 1J05B 2A3TA 2GITA 3AS3A 1RUPL 1GGIH 3UZQA 1XCTA 3QJRB 2ZXDA 2COVD 1K4CB 1ZSDA 3RWDA 3G9AB 1V10A 2WIIA 4HOZA 1WP6A 1S2EA 2O6FA 4TNWK 2Q7AA 3FKUS 1ZLVK 1FVCA 2Y3AA 5D1XB 2CR0A 4RFOL 3FQXB 3NABH 1IAIL 1JV5A 1X5MA 3UBXA 4UB0H 4L3EE 3RNKA 1GIGL 4XN7A 3ZR5A 1SXSA 4JPKH 2NX5B 3F7QA 3UTQA 2OBGA 4G59C 1Q0XH 2F5AH 3V79C 3FRPB 5LBSH 5GHWL 4KX9A 3MLZH 1A47A 5CP3H 3TPKA 4C59B 3U4BH 1HQ4A 1GIGH 4UBDD 3L1OH 4PCYA 3NTCH 3S37X 1ZANH 1U2CA 3EH4B 1WFJA 1N59B 3QYMA 4IIZA 1Q0YH 1N19A 3JYCA 3C12A 3EG9A 3U4BL 1NAKL 2X2HA 3K5SA 2D0FA 3ME0B 2H3NB 4F5CA 2IQAB 2FEEL 5EC1A 1LVEA 2R29H 4NWTH 5I0DA 4JFOB 2G4EA 3GSWB 2F53D 1MN4A 3QNZB 5IHWA 1AS6A 3DTXA 3IBEA 2BNUA 1D5IH 2BM3A 3VE0A 4ODSL 3HS0B 5HYJA 1KC5L 5FUCC 4IRJC 5ALBH 1SHMA 3GXFA 1K6QL 2E7HA 3CZUB 5DEZA 2F08A 2DJSA 4YPJA 1LYQA 4YR6B 2QBWA 1A9EA 4ANKA 3V0AC 1KWKA 4J3SA 4LPWA 4GAFB 5T1KB 5IROD 1MI5E 3FU3A 1JWSA 4XP4H 2FH6A 1IC7L 1SYSB 4L8BB 2RHEA 1EXUB 5DRNB 2B0SH 1L9QA 2V8LA 3ZYJA 3W39A 1NLDH 2UZIH 4PLOB 1HZKA 4X9GA 4WF7A 3DGGB 2AQNA 5A2KH 5ICYA 4FQHB 1NJ9A 2OCCB 3SJVB 4JFEA 5LNDA 3KVPA 3O6FD 3CC5A 4CKVX 1CFQA 2AVGA 3P54A 5D7JB 1CUOA 2F54A 5DVKA 5FHAH 3IDMA 2AAAA 3SBRA 3T04D 5CZVL 1TSRA 3DIVA 1SBSL 4ZUUB 3X1BA 2R59A 5BVJB 1DANT 2J88L 1EJOH 2EYSA 2VMJA 5LB1A 1I7RB 1U8LA 3C8KB 3RGVD 4B5ZA 4H88L 3B5HA 3UFIA 3BRGC 4NYLB 3INUH 3RTQD 3RB7A 3T77B 2V8MA 3BVTA 1S4IA 4JY5L 3NA4A 4PJ7B 4KZEH 3MJ7A 2MJWA 2V5MA 1E9OA 5C0ND 3DVGA 3RBSA 3BWUF 2P5WA 2WANA 4KO5A 1AJ7L 4DP7X 1AH1A 2D4DA 3RU8L 1LE5B 4ZSOE 1ZSDB 3T5WA 3VYPA 4BELD 1QTYT 4NC1E 4X6CB 4N90D 2F8XC 2ZNWA 2B77A 4U1MA 3JT0A 2UZPA 5DRXB 5ACLA 2WXHA 4K3DH 3RI5K 4JHWH 3CSGA 2L7JA 5D5MB 3EYOA 3PNWA 4K7PX 3MBWA 1FNSH 5AAMA 3NAAL 4LOUC 3MGOA 4DGVL 4P48A 3CXDL 3SYQA 5F9JA 4DK5A 4ENZA 3HHSA 5IUCA 1DJWA 5BPPA 2P24B 3U6XS 4OGXL 2DEWX 1RPKA 2EJ1A 2VJ0A 5E94A 3SDCD 1AOZA 2C9VA 3CGTA 2R2BB 2B14A 3NCEB 3QXTA 4L8SA 4NUGH 4TLKA 3FUDA 3IKKA 3KWWA 4RX4A 5I5IA 5DYFA 2EDHA 3Q5TA 1OAZH 2IQAA 4WWKD 3UZEA 3EOAB 2IGLA 5HYJE 1PD0A 1Q72L 4XAWH 5EEYA 4AGPA 2AANA 3WUWB 2CDEA 1YMMA 1T0NA 4WCYH 4JHVA 2R69L 2QTVA 1BXXA 1KY7A 4PJIB 5FAAA 5HYSB 1OAZL 3QORD 5HYJB 3UGUA 1GPOL 1EQWA 1Z9SB 3TO4B 2J4WH 3L5HA 1PLCA 4OZGB 2ZE0A 1FI8C 3BH8A 5I30L 3FYEB 1Q9OB 1GW6A 4F7TA 3HVDA 3EO9H 2NDGA 5B8CB 5H4ZA 3QI9B 3ABLB 3RG1C 1BAFH 3U1SL 3BZEB 1HT6A 3O4LA 4NNYA 3MLWL 4BCYA 5D7EA 1KCBA 2KBGA 4RGMC 4Y1AD 1THAA 3OKLA 1ZHKA 1CE6B 1YG9A 1ETJA 3P9MB 2EAEA 4AE1A 1A1MA 5D2NB 2FATL 4EQ3A 2Z4QA 3NJHA 5JPNA 5LN8A 5JPNC 2ZUQB 5C0CA 3KM2A 3VFUB 4QJ4B 1G6RL 4ZAKB 4NQTA 1FZMA 5GPRA 5JMRA 2X3AA 2Q6WA 4RISH 1T66D 4WTQA 4PJXF 3QUYC 4HCIA 4HKXA 3LZFL 4ONGL 2JMRA 2YARA 1NDMB 4UBDC 2OK0H 5F7DB 1ADWA 1CFSB 4I0PA 4PJ9D 4JO5A 2DTSA 2R1YB 1UD6A 1UKTA 4X5WA 5E1AA 2YOCA 2GUOA 5FS5A 1A02N 2C8NA 3VG0L 2YGQA 4PJDF 2CXKA 3HZMB 4N8CH 3OAYH 1LEGA 2XLLA 3VI4F 3MNZA 5B7MA 3D30A 4OFPA 4AVHA 4PLNC 3GI8L 3F64A 3IAPA 3ZGIA 2OYLA 4OUUA 2GTWB 2EDYA 1I1FB 1TNMA 2I07B 2YMTA 4XC1H 4PB0H 2QFPA 4H25B 2H3XC 2CO6B 3VRJB 4KH2A 1MVFA 4JKKA 25C8L 4GQ9H 4HWBH 3QIBB 2YD6A 3QZWB 4D8PB 1N0LB 5B1JC 2ZTBA 1NDGA 2R69H 2ITDA 2JSFA 5GGUA 1RZ8A 2DF3A 4MNHA 3VGBA 3RTQC 5C0BE 1U6AL 4BZ1H 4R3SA 2A7BA 4KTEH 3FSOA 1I9IH 1AS7A 2YPLB 4DK3A 2V5TA 1Q9KA 4TSAL 4ZQTA 3PJSA 3QEGL 4UM8A 2PYEB 3NFSL 3I3BA 2BVYA 3U1SH 1S9KC 3H7BA 4IU3A 1YYMH 3S8GB 1CDJA 3BW9A 2W38A 3Q6GH 4H26B 3EGSA 3DNKA 3HRZC 2FD6L 3MX0A 4KY1H 1M1XA 1OSEA 4XVTL 2XA8H 3O3BA 1O0VA 3UC0H 3IJYB 2H32A 3GLEA 4U1KA 3VXRB 5IJCC 1VF5C 5IZ7A 2HN7A 5AZ2L 1SN5A 2A0LC 4LEBA 3BFWA 4QIRA 5HHQA 3ETBJ 5LWYH 5DJ0A 1CR9H 1I53A 2FX8H 2A9NL 2DN7A 3AM8A 2OA9A 3ILPA 2FL5B 5C0CB 3D0LA 1UFGA 4RFNB 1JZ7A 1A3LL 4PCTA 4S2SB 3GHEH 4KI5E 4WEEA 2YUWA 4GRLC 2XU9A 2FX9L 1BZ7B 1UWEL 2XXFA 4G9DA 4PCKA 3KVDD 4AQAB 1UCBH 3TEYA 4EI5B 3ETSA 2A6IA 4Q9QH 2EE6A 1JZEA 1RLBA 2CJSA 5CGTA 2QL1A 2WLYA 1JWUB 3D0VA 3FQRB 3T4AC 1VPOL 4DKFL 4OTXL 3U0WH 3T4AA 4BCXA 2VXVH 3VSTA 1FORL 1RIVH 1UJ3C 3FO0H 1MWAH 2HPOA 4KVNH 2ED8A 1LD9A 2XX1A 1ET8A 3BVNB 5BV7H 4LRIC 5JHLL 1HHIB 3L08A 3NCMA 2XTSA 1OAXH 5IQMA 1SEBB 1ZLVH 4HVBA 3GBML 4P3DA 2XZAL 2IDQA 4Y1SA 1MCWM 4G6FB 4FQJL 1JK9B 4X6BA 3SO5A 4ATWA 1PJ9A 3HZVA 4W6YB 5FDYA 5JZ7D 3K8MA 2VDRH 4E41B 3JYBA 4D8PA 4X7CC 3N06B 3T4YB 1XZ0B 4K5PA 4YHZL 5SWSA 1PLAA 3MRLA 3K91A 1DJIA 2I32A 2C7UA 5ID1A 2VLRA 2GSGB 3RWIA 3HG0A 1I3RA 1L0XA 1UZ6E 1EANA 3HJ0A 2OPCA 5C7XL 2I27N 4RGOL 4RA0C 3QZLA 2OR9H 3KEHA 3PWNB 1B4LA 1LMKA 2NSQA 4LF3A 4RFOH 5KYWB 2BY1A 4EXPX 4F8OA 3BKYL 4K71C 3U4EA 1UOLA 1NBYA 4N0CD 3HCVA 1E27B 2V9UA 2ODHA 2KDYA 3GS7A 4P5TA 4OFKA 2FJUB 4GUPA 4JN2B 2VTFA 3ALWA 3JWNC 4U1LA 4PJ5E 3LN4B 1Z3GH 1SN2A 3HC4L 1VEMA 1ZT1A 4UTBA 4AITA 2DICA 5INDB 1RK7A 3D39D 1KGIA 5DJYA 1MHCB 2ITCA 4P46D 2CDFA 1E4KC 2ZKMX 4HF5H 2ICCA 4KKZA 2ZX7A 2F5BL 2ZWLT 4Q6IC 3FHAA 1RK1A 5C0BA 2W65A 4L3ED 5E99L 5JUEH 1NIBA 3SOBL 1F4HA 2EO7A 2OZNA 4DZBB 1J87A 4KHXH 1FLRL 1RZGA 3QAQA 2Y7QA 1DVQA 1N6UA 4MNQE 4KOCA 4KVNL 3L1EA 1WH0A 4FN0A 1LWHA 5DD5H 2CSPA 2A83B 1F6AA 3QWOA 4ONFH 1DQKA 5IHZA 5KTEL 2HFTA 2JTYA 5DJDB 1MFCL 5HI5D 3T1FA 4W9KC 3KH3A 3RNKB 1KN2L 4YXLH 1G7JB 1A3ZA 2CIIB 4GQRA 4WHDA 1YN6A 5TPWL 5JTWA 1CC3A 4H5SA 2I7OA 4F57L 3AG1B 1BQ5A 1F42A 2XZQL 4PJ9A 1E5AA 5TK4A 3UBXI 5LG6A 4ETYA 1AGFA 1UD2A 1BXAA 3BPNB 5G4MA 3RVVD 5D72L 3OKMB 1CFMA 5HYSG 1TJHH 1ZE3H 1K3ZA 2V5SA 4UTAA 4FNLL 4UQCA 3H9YA 3ME0A 3ARFC 4XZ4A 2QR0B 5GGRY 3IGKA 4FI7A 1JGVL 2DQFA 2Y25A 4PSRA 3QI9D 5T33H 2CWRA 4Z77B 1B90A 2V17L 2DYPB 1AC0A 4N9GB 3IETA 2A9MH 3BOVA 4ALAL 4JG1L 2M26A 1P84K 3LPGA 3P0GB 2IPKB 5DS8A 5FM5O 5D7SH 1CLZH 2C7UB 3HN8A 4J3OG 5F6HJ 3S3CB 2J8HA 3GTTA 4IGBD 5DRWB 1ESOA 1ODUA 3EDJA 3K2MC 5LCVA 1AD9A 3RKPA 5MENE 1CXIA 1M7XA 3CVCA 2R23B 3HNSH 1Q94A 4GFXA 3OX8A 1JTTA 3NVQA 1JYXA 3GJFH 4Q58C 1FIEA 4GMSH 2XTJD 2XBZA 1U8PB 4K15A 2BP8A 3ZIYA 3D1MC 2LTQC 2UVFA 2XWRA 3CLFL 5J1SC 4KGJA 1L3WA 4GBXD 5FFOA 3DX4A 2WC7A 4JO8A 4WW2F 3DVNB 4D7BA 5JXAL 3RIFK 3A5VA 4PJFB 4A2LA 4XN5A 1PW3A 3LSOB 3UG5A 3VFSB 1XGRB 2AI0H 3FN9A 2ZIDA 4NQCB 1HQ4B 4MCMA 2HLEB 4JPWL 2OCJA 5BO1L 5KSBB 3CSPA 4HBCH 5IBLC 2VLKA 2DJ4A 3AABA 3BKJH 1D7CA 4GUOA 5FWRA 1JPSH 2NZIA 3V0HA 4L1BA 2NUTB 3QORB 2J8UA 1HKLH 4DZBA 1NCAL 5EC2B 3TWYA 4NO0A 3QIBD 4WI2A 3U25A 5E2VL 3LZNA 4JFOA 3CIAA 1AFVL 4E9WA 4JDTH 1USQA 5EU6D 3X14B 2ICEB 5BRZE 2I9TB 4Z76A 2WCPA 4FERA 4DK6A 5DYOA 3HN3A 4MQTB 4C4BA 4X4ME 1KYFA 2KZ1B 2AC0A 1GOGA 1RMFH 4G8IA 2BIIA 4QO1A 3VFRB 1IM3B 4CRPA 3C6LB 3IU3B 5I1CH 1A8ZA 4PHXA 5IJBC 2K4WA 1EHLL 5IV2B 3DV6A 5KUMA 2OMUA 1NCUA 1QX1A 1I8MB 2FUQA 3EJQA 3ES6A 2XN9B 4APQC 3APNA 4E9YA 3BC9A 4DCQA 1XFPA 2EADA 2QQKL 2EICA 2ZXQA 5DI8B 1G6RB 4W1TA 5I26A 2OI9C 4FQHA 4KU1A 4FYSA 3MRNB 2EC9T 2AK4E 1Z0MA 2P49B 3DUUB 3VFGH 2JJUA 4LCYA 2F8IA 1YYML 3BISA 4NBXB 1NKRA 3KR3H 4WFFE 3CHRA 1I7RA 3TVMB 3CVHA 2ADIB 3FUHA 3MV01 4ZTEA 3F65A 1V3MA 5F1NA 4YVNA 1FCCA 3LQAH 1H6FA 2X28A 1UM5L 1DVXA 4B60A 4FCHA 1F4YL 4DUXA 3QI9A 4XXCC 1XH0A 4YSOA 3TP4A 3HAEH 1XGYH 1OD9A 4PG9A 1H6TA 1E9PA 1IC5H 1KYUA 5IBUG 1J8RA 2I25N 4M8QA 5B3JF 5DRZA 5MEPA 2QGDA 4JQIA 3VXPA 1DQJA 1BVNP 3T3PF 3EDFA 4Y9CA 5CJBA 5CUSH 3TBSB 2CO1A 2HVJA 4ZAKA 1M53A 3IRPX 3MR9A 4EMZA 4XBEH 3PG2A 4ZFFA 3MLPA 3S8WA 1HFUA 4M56A 4JZNB 1TQBC 2R9HC 3RWCB 3W3BA 3MV8E 4D9RE 3LPPA 3MVSA 5F93C 3ZTNL 4KROD 4YGAB 3KXFD 2W0LA 3QH3A 3M1BB 2BVPB 3VRIB 4PP1C 5DO2D 4KHTL 1X5IA 3UO1H 3SY0A 2AKRB 4PY8I 4ZMWA 4RETB 4TF4A 1BF5A 3DHUA 3QWQB 4HHAB 2EVFA 2C9XA 2VW4A 1JVLA 4GT0A 5ACZA 4V33A 3MZGB 2PF6A 2E8ZA 3V4LA 5C71A 3VXUA 1V5JA 1DZ0A 2YN5A 4G5ZH 4GKSB 3GEWB 5GS1A 1ZKAA 4PJIA 1RPQA 1A1NA 1M9SA 2BMKB 1BJ1J 3PHOA 2DBLH 3GNML 2GSIA 2X9ZA 3UDWA 1KEMH 3THML 2D7TH 3G7TA 4JFFB 1W80A 4WFGD 1D7FA 3CK0L 3D39A 4MA8L 5LO7A 3BLPX 4OCRL 4P07A 3D5OF 3TN0D 3VJ6B 1JHTB 2BRRL 2GJRA 4GIOA 3M1OA 3WJJC 2ZYRA 3N2JA 3ZT6A 5KJ7E 3N3EA 4P9ML 5CKAA 5KW9L 1M57B 5MI0B 2O5NA 1A6WH 1HHJB 5CHNA 1XR8A 3CN2A 5E6IA 4KXZH 3WL9A 5GRVK 2VSMB 4AXWB 3W0WE 1F58L 1IAMA 3RIAK 2YFOA 2X4SB 2V2WB 5DI8A 2DL2A 1BVLA 3RUGA 5KSAD 1ZEAL 3VFNA 5C9KA 1GOFA 2ZP0T 3MRNA 1FO0L 4U0QB 1KTLA 4R7NA 1DFBL 3ZSSA 3P11H 4BSWA 5JQ6L 4M1CC 3LZQA 1GW0A 4OIBA 1J1OL 3OLDA 1AHKA 1R34A 1T4KB 3IDNA 3SPVA 1M3JA 1XAKA 2A73A 5CSZA 2PO6D 4LCIH 1TPXB 4M6NH 4YLBA 1E6JL 5F88A 1M4KA 4TVPE 4AGOA 4XWOC 2ZUYA 5AAMC 1JP5A 5E9DE 4PB9L 1X9UA 2BINA 1BMGA 3F6JA 3Q9PA 1G9NL 4B3VA 5JPMB 5C6WH 1I7ZB 2HT3D 3D25A 2WLIB 2BFVL 4QTHB 3PE9A 1S78C 2F5BH 3LEXA 5E7FA 3SDXF 2VZ1A 1S6NA 3WMPA 3AG2B 3RZCA 4P2QD 5HHVL 3ILPB 5D7JD 3Q1SH 4PRPB 1M6OA 2BHUA 1CICD 3HE6A 1UA7A 4TUJB 4ZUWA 4P2QE 1E0OB 1Y0LA 2LLGA 4P5KB 1DSYA 4PRPE 5CEZD 5HVHC 2ZYIA 5IJKA 1IEHA 4ENEC 4LVNC 2BZCA 3T2LA 2B1AH 2X2IA 3I2CL 1NLBL 4Q9RH 1Y6NR 5TJWK 4CDGC 3WENA 3G5VB 2JKJA 4FNLH 2DBJA 2DQTL 3EJTA 2AXGA 3POCA 3K1KC 4GSDH 2FK9A 4PLKD 4HZAA 2VLJB 4HK3N 4WWNA 5SWZD 5GQBA 5LKNA 1WUNT 1M7IA 3KLKA 3QC6X 3QDGD 4EDXB 4LMQI 3J8F7 4AUJA 2NR6A 3WTSA 1O6SB 4GKSA 3VMPA 2F19H 3GMPA 5L2JB 3QQDB 4AW7A 5H35B 4U6HB 3ARTA 3HRZB 4XVOA 1A4AA 2XPGB 1AO7D 3RI5F 4MAUH 1DQLH 3V6OE 3RDTC 5IF0A 4O51A 2WINB 1AE6H 2R2HA 1Q0YL 3B8SA 4YDKH 2LR4A 5HY9A 2XXGA 1AACA 4HUWB 2BK8A 4AQ1A 5K39B 2VC2L 5D6CB 2WCGA 3V4PL 3NJXA 4U0RB 2VM3A 4U1GC 3MLZL 2GSGA 4N0UE 5HDWA 3P4NB 2WM0A 1Y07A 4WEBL 2GHZA 4IHBA 2GEQA 4NRZA 4Q6IA 5GGRA 1X3DA 4UTAL 4PGBA 5JQHC 4LF3B 4KXBA 5KZCB 4QKTA 3PABA 2EXYD 3ARSA 1GOHA 2FLRT 2V7NA 3K7UA 2QPDB 1FAKT 2IH1B 1IGIL 1JF5A 3BT2L 3EFOB 3NCXA 4OIFA 4AV4A 3N0AA 3WY4A 2VLLA 5IW3A 1E4XI 5J89A 1RIHH 2JCCB 4DN3L 2Q3ZA 1T83A 5BRQA 4DEUA 1NCOA 2BIHA 4Z7VF 1DVFD 1QFWL 3DX8B 2OMNA 5JPMA 1LD9B 3FTXA 4H2CA 1MFMA 2O72A 4UDTB 3WJLC 2J6WA 4G6MH 3I6LD 2B1AL 3A4DA 4JE4B 2NY0B 4QR7A 4UWQB 2W65B 3DO4A 1K3IA 4D0DB 3BWUC 1ZIAA 3RVXD 1WA1X 1TENA 5CU5A 5BOPA 1RZGB 1U58A 5K9KA 5L88H 2E27H 4YBLB 5DU7A 2R56L 3ZRFC 5IVXB 1IAOB 1VDGA 3C2AL 2FZ3B 5EPMB 5EEUA 4UDUB 4Y16A 2FD6H 3D33A 3QDMD 1I1AC 2K9UA 4X4YB 5EOTA 1WEJH 3G5VA 1N3NA 4WI5A 1UOWA 2RCSH 1XIWB 3R7QA 1ZTMA 1UM4L 1GH7A 3BDYH 4OSUH 4OZFG 1X7QB 4D8OA 2VOTA 3GZPA 3SO3C 4NHCH 4R7XA 1JGUH 5FFLA 2D8KA 3I3EA 3PQYE 5JIHA 1Z9LA 5EOCH 4JFYB 4Z7UA 2A6JA 1WHPA 2E46A 4XMPH 2R8SL 3WFCL 1EXUA 5F7UA 12E8H 4IS6A 4L4JA 3HCVB 2NSXA 1PEZA 3HLKA 3DX9A 3K8LA 1HHKB 4NQCD 1J1PH 2CJUH 4FQ2L 1QASA 2W60B 4JJ5A 3K4AA 4XI5D 2BW5A 1UZGA 3C6EA 5GS2D 2FYYB 2JXMA 3HG1D 1JFQL 3IBOA 3P9LA 3GPSA 4JG0H 1YRKA 5DUPL 2ENJA 4UNIA 1NCNA 4O4YH 5F21B 3WOVA 5ERWA 2I9LB 4DPCX 3CZFA 4KK8C 3VWJD 2CNYA 4O2EB 3KCPB 1KENL 1FV1A 1LE9A 2NY6D 1DBKL 3DJZA 4E41E 1BQSA 2WXKA 2UXVA 5LN4A 4LLMA 3KLHC 1ET7A 1JWMA 1NCCL 4O02A 5A2BA 1CLOH 1N9PA 2D3JA 3GXIA 3QG7L 2Z9TA 4FMFA 1W72A 4RX4D 4OFIA 2F7QA 4OZGE 4D9LL 3RWEB 3ZKMC 3CHXA 4ZW6A 2O61B 3NCCB 2OJZH 2VDNH 4PLJD 1A0QH 5D5MA 3KPRB 4OCXL 3VGAC 5AAWA 4A2DA 3U46B 3NRPA 1VGEH 1S3KH 5EEXA 5DD6A 1BVZA 1MFUA 4J3OH 5DO8A 4NQCA 3TESA 2JB5H 3A6CL 1BZOA 2AEOA 4P2YA 1IARB 4FQLH 3ZL2A 3EFDH 2DLGA 1XMEB 2OMXB 4LPCA 2QPFA 3EOTH 1S7QA 3KPQB 3A23A 3QXAA 1N0XL 2BP5M 3OKKB 1L7TH 2VXTL 5K93A 2ZPKH 1FH2A 2D03H 5H4YA 1SJHB 4WK0B 4L4VB 3SJVD 4A37A 4F2MB 1KIQB 1BM3H 5DK2A 3P4LA 4OLZL 1LILA 3QCVL 5IMOA 1GS6X 5B38G 3VXUE 3KBPA 3W0WB 5IESH 3REWA 3WGUB 2UY6A 1ZWIB 2AEIT 1U21A 2TSAA 4MXVE 2DWTA 5T5NG 2MNJB 3ARGA 4OV5B 4UM9A 1Z9PA 4PAZA 4XPAH 3PUUA 4GAJH 1IZJA 2CHWA 5H37A 3WO4B 4IRSB 4R5VA 1WUZA 4EDWL 1JFQH 5IV2A 2B8OT 1XF5A 5GSVA 3ZSTA 3TEWA 4WJG3 2PETA 2V3EA 2DEYX 4TOYL 5EN3A 4XH2A 4YSRA 2EQDA 1P5UA 1YAIA 1HILB 2A2QT 4K4KA 4UCFA 3ZTJH 4FA8A 2FJFB 4KUCD 5EWIH 5CBEB 1N5YH 1MNUH 2H2PD 3O6LL 3MRDA 4JFHD 4AYDC 3VFSA 4AWJC 3P9LB 1NOLA 2Q3AA 1A6AB 1WTGT 3IFLL 2DTML 5FHBL 4RZKA 1AKPA 3TH4T 1H9DA 5KSBA 1OAKL 3JTTA 5DHVA 4GXVL 1G7HB 1OP9A 1WWAX 1S46A 2YXMA 1YCSA 3MV9D 4DW2L 5LXVA 1UZ8B 3CC1A 2WJ5A 1WZ1H 4N2OA 3NJVA 1U3HC 2BSTB 2PP8A 4JHAL 1E28B 2JWYA 3FQUB 1EAJA 1AHMA 4HJUA 1T89C 1QWNA 3X3GL 3TZVA 3S98A 3DGDA 2KDGA 3ARPA 3BH4A 3UJIH 3IYLW 3KCWA 5TTRA 3IFOA 6PCYA 3VD1A 3GYRA 5D2NC 4LCVA 3QUXC 1O9VA 4OLUL 4LP4A 2VLJD 3JT2A 4U4IA 4ALAH 4AKPA 1BAFL 3MA9L 4KNSA 2FECL 1KEGL 4J8RA 1USZA 3RBGA 3TV3L 4OI9A 4R8WH 3JSSA 5I8OL 1X4YA 1THCA 4M6MH 4R5TA 5F8RC 3HAEG 4FA6A 4H0IA 1MZZA 4HMEA 3RGBA 3CSBA 2JB6A 3GMOB 1MWOA 1AP2A 3P4OB 2XQ0A 3EZJB 4YFDB 2EUWA 1ZJAA 3KGUA 3ARFD 5ALCH 1SBBA 1J5OL 1ZRUA 4P06A 5SWZA 3FT1A 1F3JA 3GSOB 2VMFA 3CLFH 3QDJD 3ECWA 3FB8B 2NNAA 4NBZB 7PCYA 1TU2B 5AVXB 2JQAA 5E5MB 3H0TB 3UJTH 1MCLA 3O3AA 4JFFA 1SLUA 3PAZA 2GEEA 1BMWA 3PDGA 5F0JB 3B5TA 1RUML 4OF8A 1EUTA 4KRPD 1I85A 4FLQA 2WVTA 4WO4C 3ECQA 1INEL 3TYGH 3QJZA 4Z7NF 4NQSB 5IGXL 1E5BA 5CKGA 3WL9B 1E2WA 3CTTA 3UZVB 2F2HA 4KMTL 1OE3A 3A4EA 2Z7WA 1RIHL 5CLWA 1GGCL 3D0LB 4KXAA 3RNQA 3QUHA 2K6WA 1XF1A 4WEBH 4CGTA 1X7SA 4LDLB 4E9XA 2ZX5A 1S9XA 4L29B 4N24A 5C9JB 5CR1A 4M48L 4JY4B 2XWDA 4GPVA 3U2JA 1QR1B 1F2QA 1RSFA 4MX7A 4GSDL 3SBPA 2XQYA 4TXVB 5IBTH 2D7NA 3QH3B 4NM8L 4J3XA 4MXWL 4F8TA 1CXHA 3N1QC 2UWEE 2Q2EB 2VYRE 2YC1B 4PUBL 3IJ8A 2E47A 5KSAA 2WNXA 4M9OA 1XHHA 4KZ0A 3Q6FB 3MRHB 4JBSA 1AIFA 2AV1B 4JL1A 4TM9A 4RGOH 4M9PA 3BPNC 1DVTA 4Y5VC 4Z3HA 5T1DH 4DPAX 1WBZB 3JWNG 1FC1A 1WWWX 1NGZB 1UENA 2WYZA 4IU2A 2WYIA 4OJFL 2FWLB 1PX4A 4IEFB 3UIYA 5L88L 4W6XB 1ERNA 2FT8A 1J1XH 4U4BA 1JIBA 3T4YA 1FRGH 1BPLB 1NFAA 3ISWA 2AQ2A 4WWOA 1F41A 3CHSA 4ZMQA 5D7SL 2Z1PA 5LHDA 2AXGB 5C09D 2Q20A 1HHGA 2AW2A 5EBGA 1D5IL 3ZE2E 3VI3A 1XBRA 4OVUA 2ZSWA 1KLUB 4S1RH 5D1QA 5EZIH 5A6LA 4ACPA 3IPFA 2I26N 3H9ZA 4PJAE 4OVVA 3W2DL 2IF7A 2X6UA 2XZCL 3QEUB 1IGMH 3I3DA 3CSFA 3B9VA 4JFXA 1K2DB 3ROOA 4RBPH 4Z7AA 3ULVL 2JV6A 3KAAA 1QR4A 2K0RA 1XR9A 3T8VA 4LIQL 1E30A 5B7FA 3DOIA 4EO5A 3LPFA 1IGML 4GY4A 3ERXA 2UYLA 4OD1L 4XBGB 3DETD 3CIQA 4WHCA 1RUMH 3QORC 1L7IH 1HAUA 1OK0A 4HJGA 1XD0A 2ZG1A 4H8WC 4JE0A 4OW6A 3WFBL 4AIXA 5J8OA 3SQBA 2NY3B 1EEUA 2NXYB 3NPZB 5IGXH 1L9SA 4N2IA 1CCZA 5GJTH 3NA9H 4Q9BA 2P7TA 5D7KD 2Z35A 1WZKA 4TULL 3CQFA 5K9QG 4P5KA 2QSVA 4XVUD 3VI4B 3QE5A 4JFWA 1EIBA 5JO5B 3MRCB 3N9GL 4AQEB 4Z8FH 4OZGF 1BWMA 4KFMA 2IAAC 1OZUA 1HL8A 1I4FA 2XV3A 2ZXGA 5FYKL 5IJDC 5IFJB 3AB0C 2BNQE 1JV2A 2AQRA 2J43A 2ZYSA 4H5SB 1WFUA 2O6PA 3KHQA 3PWPD 1PZ2A 2IOOA 4N28A 1HZHL 3HNTL 4JKPL 4DJMA 3NYKA 1XGTA 3OXRB 1FYTB 4PM1A 5ILTH 4KK6D 3CMGA 2W1NA 4C56E 1S7WA 4P57A 3TBVB 4MJ2A 5L2JA 4JRYE 3RAJH 5EC1B 2WXPA 4KKAC 4NFBA 1UWEH 1KF9B 1IGCL 1OF0A 5E6IC 3RL2A 1IU1A 4AGNA 2DJMA 3VWJB 2D03L 2WXNA 1OAUH 4DNLA 3DC0A 4CMMA 1JE6A 5J6HA 4J2XA 4ZPTA 1UGNA 1QO3A 1DVUA 5ECGA 5TF1L 1LEKB 2PCFA 1XGUB 3UGEA 3ZGHA 2ZWNA 1A9EB 5KVFE 4B5EA 2YRLA 3QPQC 2ZKHL 4NQEA 3LNFA 5B8CC 1F90L 3FT3A 1UWXK 3EHBC 1KLGA 2BCKB 2AV7A 3APCA 1OPOA 2VDOL 1IM9D 4NKOB 2G2NA 3GI8H 5L0QC 1JZ4A 4NN7B 2CLRB 5AENA 1R3LA 2C26A 3L3KA 3WELA 2WLZA 2Z7YA 1WLHA 4HAGA 2VLLB 3CZEA 4XP6L 3E3QC 4O58H 2BZDA 1A6TB 4EN2A 5BS0B 4HWBL 1URLA 4WENB 3T0XA 3NQIA 4NKDB 3BAXA 1ZPUA 3HE7D 5I16A 3C9NA 4TNVF 1Y7VA 4U1NA 3ZYIA 4F7EA 3RGVB 1S7TA 2OXGA 4LHUB 1KBVA 3WXVL 4H8UA 2A5UA 2VAAA 2WKLA 4KKCD 2X44D 5C97A 4M3KB 3BSZL 1X6NA 1MLBB 2EIZB 3AAZA 3BRDA 2H1PL 2JQMA 1DO5A 1EVTC 2BSCA 4JY6B 4OCRH 2WXGA 3T6XA 1HQRA 3ZKQD 4KITB 5GS0H 1ZLDA 5FLVA 2DPKA 5A2AA 4NWUL 5J6SA 1BV8A 4RZCA 4W9GC 3WLWD 3NQKA 2XNAA 4XPAL 1JSYA 5DUBB 2ZXCA 1RXLA 4XN2A 2CRYA 4A7QA 5ENWB 1BZ9A 4A6YA 3CXHJ 3M8OH 3OJDA 2F74A 2J5WA 2O5ZL 1J5OH 1BJ8A 2BS71 3GQFA 2XQBL 3BJLA 5E8DL 4QGTA 5L2KD 3OMIB 3MRJB 3GIZH 3QDJB 4Z95L 4PRIA 4R2GC 4WGVB 1WGVA 1WZAA 2R51A 4L0PB 3S97C 3D2UA 4Z3JA 5C08B 4XNXL 5JW4N 2DQJH 1JTOA 1BJ1H 1EAQA 3NCBB 1CICB 5EU4A 3V0WL 1CGSL 5KJ4A 4I0PC 5MEQA 3X12B 1F8TL 3HB3B 3K71B 4ODTH 1FO0H 1NOAA 5J6HB 4JG0L 1XEDA 1E9QB 2Z31A 2BFGA 4AT6B 1CWVA 5CEZL 2B3IA 4LOFA 1BLNB 2MTAA 2D73A 1FV1B 1LE9B 2XA3A 3QFJA 2WWMC 5ESVA 3SE3A 4GUCA 4U1GB 1CFTA 4ZUTB 4FABH 4N8UA 3VACA 5I6PA 2H1XA 1DN2A 3CFJB 1FGVH 4H8HA 1AY1H 4CC1A 5IFAH 4EIGB 1G4RA 1H0DB 4KRLB 2CO2A 2C9AA 4J3VA 5DRZB 2VITB 1EO7A 3K4DA 3RDTB 3HEIB 4AE0A 1OGAA 2VMDA 1CK0L 3KBEA 4NC0B 4NS0A 5D96C 2WWKT 2PKDA 3L48A 1S9WA 2VDLL 1KXTB 4JW3A 4BINA 3CV5A 1NGWA 3X3FH 1D5BB 4J27A 3ULUE 2AJXH 3MODH 3QUGA 5GJSH 4OLZH 3QJHA 3ZKND 4JFPB 2HFGH 1OY3B 4HBQA 4YWGL 5I6MA 1RP9A 2RH0A 5EIQA 5I1IH 3O2DH 3GRGA 4HPOL 2DWYA 1DN0A 3U9UB 3WFHA 4Y9GA 3RU8H 2A6KB 2LU4A 2X9XA 4G9FA 2MH4A 1MFVA 3LXUX 3HPLB 5GZNA 2LOEA 4Q2ZA 4IIQB 1Z32X 2XV2A 3ZDXB 3RIKA 3QQ3A 2XTJB 3OPZH 3DX0A 3BN9D 1NC4D 4DP0X 3P0YL 5AVWB 4WK2B 3DETC 1WBXB 4MNQB 3TEUA 3VYOA 1ZT4A 4JFDA 2EC9U 3QJSB 2UY7B 5DJZB 3CH1B 3KLAA 1QTPA 3B7SA 4GW4B 5D8JH 3NCWA 2BOBA 4YXHH 1KB5L 4K07A 3FUEA 5IBUB 2EEAA 1U8KB 2AXHA 4LO9A 1TQBB 5C0JA 1MREH 3RDJA 1RH8A 2ZUXA 5L4MA 1WYJA 1GJIA 3CN1A 3LNDA 2Q3XA 9PCYA 1E4XH 4XO5A 3H9HB 3V10A 4MBOA 2M2DA 4DN4H 1KPVB 2FUTA 5EUOE 4A6YH 1TFHA 4Y19B 4JLRB 2OMYB 2V37A 4C83A 2CKNA 4G7VH 3FU9A 2YGNA 5DDHB 2P5WE 4YBHA 3IGUA 3C08H 3S5ZA 1KC5H 1DDHB 1E3XA 2PUQT 2NXYD 3FB5B 3U36B 4DKTA 1R3JB 4TVPH 3SCMC 3QIWD 1YY8A 4UI2A 2NT1A 1RJYB 3VJ6A 3AXHA 3VI3E 3C5ZB 3LD8C 3MXWH 3RPKA 3FU7B 1A7BA 3JV4A 1WAAA 4UF7C 1ORSA 5IW6B 5T3ZH 2YD9A 3ZZSA 4HJJH 3LS4L 1BQRA 4FC3E 2YKKA 4K23H 1T89A 2ZSVA 2E0PA 2ZG3A 1RZJL 3JVFC 1SHSA 1H3PH 3FQUA 3PP3H 4CVZA 4X7TA 2F54E 2YWYA 3UCQA 3FUKA 5IHLB 2Y6TE 1T1WA 4X9FA 3OSVA 2WK2A 3TBYA 5C0NC 3UAJA 3MOQA 4MDJA 1OGAB 3AJ7A 2MCPL 1IGYB 5FF6B 2X4QB 5F1SA 2O5YH 3CNKA 3VMOA 5GIRA 2Y6SC 2KZBA 1T21B 1XX9C 5KS9F 2H6PB 2D3LA 2YD4A 3DKHA 4KGLA 4I3RH 4CBZA 2WTPA 4FTVB 4HFWA 1SJEB 3K6OA 3INUL 5F0MB 5F70A 3CAFA 3EYFB 1DJYA 5DD5L 2Y2YA 1X5XA 4J3UA 3WFHB 1CPUA 3G6DH 2AMUA 4QRAA 3NEEA 1IGIH 3Q3GB 4NDMB 1IGTA 5KSAB 4JM2B 2CJ3A 3DVIA 2HG0A 1RV6X 1BQHA 2PW2B 3NABL 5F7BA 3SOBH 3ATAA 5L6YL 4P3WA 4KZDL 3LY6A 1EWHA 4GRWE 5H8DA 5E2JA 4N2NA 1AZVA 5CCKL 5HSFA 5LWYL 4ORZC 1MCIA 1WBZA 1C16B 3O8XC 2G5BA 5F8QC 1UHVA 5EU5B 3CH1A 3KLAB 5HGHA 2EIMB 2R0ZL 4I2XA 1YQVH 2APWA 4NB7A 4KHTH 3UO1L 4IRZL 4ZRGA 1UCBL 5F71A 1P2CA 1T1XB 2YRBA 3LS5L 2MIZA 4R2GD 3QRFM 5C2BH 2UZXB 4HMCA 4YHPB 1RVFL 2YR3A 3JTSB 4XHJD 4NRZB 4Q6IB 1BQLL 4Q89A 1GMIA 2Y22A 3KPSB 2QVTA 4Y4HA 3S5LG 1AR2A 3EZ8A 5D1XA 3PABB 1Z66A 5KVDH 2FLBT 3JWNH 5ICYB 4Q9CA 1F11A 3L13A 5BJTB 4Y4KD 5I0VA 1KJMB 2WWOA 2IH9A 3CK0H 3WY3A 3VXTA 1KN4H 2NLJB 5A40E 5JOPD 5KEZA 2NNRA 2C4FU 4GRMB 5E8NA 5SWZE 4XR8C 3CFDB 2OW7A 3CLWA 3QDMA 4ZFZB 4NC1C 4DOHE 1GKEA 3QUYD 3A47A 1N5AB 1IKNA 1FNFA 3BVVA 3WIHH 3JWOC 5DHVH 3RVTC 1K8IA 1OF2A 3HI1B 1MEXH 1R24A 2AJSH 1YY9C 2FTAA 2WHVA 4N0FB 2YK1L 4Z0XA 5FO8B 5K1NA 4PP2B 1N67A 4D0DA 5GZNC 4H0LC 4WLCA 4Z9KB 4MDJB 3O4LD 2EE9A 3GSWA 1YPZE 3WEBA 4X6DE 1SXBA 4HLEA 1BEXA 5C7XH 3EO1B 4FXKC 3EYUH 3N85L 3B9DA 1UASA 2X42A 4GINA 4O00A 2FBJH 4PVBA 5CMAA 4ZOBA 1OVZA 5DZAA 3J2PA 5J56B 4YR6A 1ZT7B 4GYBA 2CIIA 5EOTB 4FTVA 2F19L 3NK4A 2Y69B 2XJKA 1YUHB 1AQDB 1JPGA 3MV9B 3KWTA 5M95B 4AJYV 4XN8A 2VGLM 4A04A 4M1GH 3PJNA 2ERJB 5CSBA 2JQZA 5CN1A 2K7QA 3L5WA 3BH9A 3UMTA 5LGHL 4DVRH 4PTUA 4JZJA 3EYVB 3GMRA 3HVNA 5G4OA 1KFAL 2JI2A 3D52A 2L4OA 3NH7L 2ADJB 4GRLD 1AKJD 2EE2A 2XXMB 2APFA 2Q86A 4YDMA 3VRLE 4DSYA 4F8PA 1CDUA 5BS0D 5F96L 1T22A 4OQ1A 5JORB 3KDMA 3REVA 4PRHE 3FO1B 1HNFA 2LU5A 2DYSB 2VRAA 1MVUB 3QZMA 2H0JA 4PRHD 1KZQA 2CM6A 2DYPD 1DUYA 4WW1B 4YSCA 2IFFL 4FDWA 5KVGL 4OM0L 4M61A 1QLRA 4Z23A 2DWDA 4PS3A 4LLUA 3BP4A 4IGBB 2P5WB 2ZICA 1L6XA 2A4ZA 2F7IA 2V4LA 1FN4A 1XSOA 2OI9B 2VDQB 3AWFA 1QSVA 5J3HC 3SE4C 4D94A 4IBUA 1T1YB 3RVUD 4AZ8A 1AO7B 5AD0A 4PJCE 5LVEA 3UTTA 3M1CA 4UMGA 4MCYA 5I2IA 5F3FA 1T6BX 5JO5A 5BW7C 1TTCA 2BVTA 2NY5H 5BJTA 5IVZA 3L3KB 4HPOH 5FUZH 3AC0A 2DDQL 4KDVA 1KEML 5E8NB 3KWUA 4Z7WF 2XWXA 1SEQL 4LAJH 3HB3C 4HKXB 1NH6A 5MEOA 1WFTA 2XXCB 3OKOB 1HHHA 1A6TA 4F1ZA 5IKCA 4ORGB 3C60A 1KLFA 3LKQA 3O6FA 4LQ1A 3NIFB 3OJMB 1T5WA 3V8CA 5D7JC 2CCVA 4P2RD 3UGXA 2DQHL 3NIGF 1T04A 1Z9NA 1ZTXL 3LEVL 4NQCE 1YECL 3BT0A 1QQDA 2YK1H 1TCRB 4AEEA 3NZ8B 3NCFB 1DJSA 2EIZA 2HVKB 4FG6C 3PP4H 4HIXH 4L4TE 4L8CA 4KKNA 1XB6A 3LMJL 4NJ9H 3KH4A 4E9SA 2HFFA 1FL6B 3FQYA 4G42B 3K2IA 1QO3B 4P0DA 4AQ8C 1XCXA 4JFDD 3VRJA 1CO1A 4OZGA 1IEAB 4FZ8H 4TNGA 1TITA 3S35H 5EZLA 3OJDB 2CLZB 1U3NA 2EC8A 2ZX9A 4BRVA 5A3IC 4IRJB 1O9ZA 3U6XA 3WCYA 3SDYL 1A5FL 4S1QH 3EXLA 2X6BA 3DYPA 4HH9B 5DJ8A 1KB3A 1IM3D 4O58L 3L5WB 4NO5A 2YQ3A 3MYZA 3DK2A 4PGJA 3EBHA 3MREA 2DMCA 4G9FD 4ISVA 3ZHLA 3QJVB 4DHLA 3AROA 1H6UA 2FJSA 4WAFA 2X4NA 4Y89A 3SGKC 3D2UB 3RGVC 4I3SL 2CU9A 2WBKA 1HL9A 1I3UA 3GIVA 3O3DA 4PS4H 2OSXA 4HETA 3F7KA 2X4TB 4XP4L 4HC1H 3WE1A 2D9QB 5F7DA 3KPOB 4X7FC 3WIHA 1UWGL 2DWXA 4M7KH 2JI3A 4KZCA 4YO0A 2BP0A 5KVGH 4QF1B 3RX5A 4X7SH 1JGDA 5GISL 2CGRL 4U2YA 2DWDB 4XHQA 5IJVA 3BRFA 2YJLA 1AQKL 4LASL 3D18A 3QNYB 4L0ZA 2L7EA 3FONB 3HNTH 1KT2A 2UUDK 5D55A 3CZLA 1S5HB 3QULA 4PFEA 2ATAA 3GTNA 1FH5L 2UXGA 1QA9A 1EZUA 2HTKD 1HU8A 1ZVYA 4QHLA 4R0LA 3KL0A 1EHLH 4MJHA 2GY5A 4OGAD 3IS0X 4H8WL 3TBSA 3TZVB 1QRNB 4BHUA 5B1BB 3LRSA 3FT2B 5GS3A 1S3RA 2NUPA 4HUUB 2NCEA 3P2DA 1R5WA 1NCWH 3EBAA 1MCQA 4P9HC 3RWHA 5KS9A 4MA1B 4RNRB 3MACL 1NDGB 2ITDB 5GGUB 3HG1B 3ZT7A 4ZS7L 1EJFA 3GSVB 1ZVHA 2Q8AL 5HVGB 6PAZA 4ZFOB 2NXYC 3RVTD 1NPJA 3QP3A 4HSAC 4OZHA 4ZOEA 5DD0L 2VWEE 3ZR6A 2EH8H 4GKLA 2VDRB 1JZDC 3IJSA 3NDYE 3FSAA 2C3XA 1Y6KR 4M6AA 1QQDB 4N0RA 5C08A 2F61A 5F1IA 1WO2A 1UKSA 4GS7C 4OD1H 3VDAA 1I8IB 3RVWC 1EEYA 1UACL 4G8GA 2G9KA 3M45A 4JQXC 5IMKB 3Q8FA 4X0KB 1GKOA 1I3GL 3TASA 1CLVA 3FB8A 3KPNB 3STLB 5F7LB 4JMXA 4AJWA 1O6TA 3IRZA 3NZHH 4M1DL 4LKXB 1WBXA 3IE4A 4U1HB 4V1DA 3ZKSD 2BIMA 1F4WL 3L5IA 3V0VA 5E2VH 5C8JA 1O9WA 4FULA 3GINA 4KBPA 4HT1H 3V4UL 4HPHA 1TR7A 1HCYA 2AVFA 4X5XB 3HBPA 1PZCA 5BO0D 3EGXB 3S4SA 5DJ0B 2ENQA 3SDDC 5AG9A 1XQ4A 1OEZW 1U91B 5I30H 4G7SB 1SM3L 2YGPA 4P23B 2C9UA 1TYEB 5F7EL 4HX1B 5J9PB 1NBCA 3CWGA 5T1LD 4YHZH 1BQLH 3A4FA 3NSXA 3ZYZA 5HVWA 2XN0A 1MWAA 1K5WA 5H37H 5CJ5A 4MX7B 2XWBB 2NX5A 1TVBB 1AXIB 1QFOA 5FYKD 5EBWB 5DGQA 3CZJA 2VXQL 3B3IB 2OFQA 4MZIA 4XXWA 1XB3A 2Y1YA 1PKQB 2WUBL 3D18B 3QNYA 3R1GL 1N18A 4UNUA 2EP6A 4E0RA 5CEYB 3SDCC 4XMXA 5DD3L 5DWUH 5E9DB 5IHUL 3C8HA 4U7SA 3VSVA 3MRPB 5JYMA 3CD4A 1B0GB 4P3DB 2ICWJ 2LHAA 5D7LD 1AIFB 2AV1A 4PRHA 4NXSA 4ALAC 1AYRA 2CBOA 3PXHA 1NCDL 4ZMNA 1BAGA 1A14L 3I9GH 3D6GA 3UTPD 4N5UA 3FT2A 5T5FA 4AUYA 4B0MB 3CN0A 1CXKA 1ECYA 1MCWW 3MV11 2ADYA 2BNUB 1OGPA 4L05A 4M43L 1VHPA 4J7RA 3QAZB 4K9EH 4Q8BA 4B27A 4AYBA 1L9MA 1WBYA 4Y2DB 3MV7B 3QJTB 4RGNC 4ZS7H 1P4BL 3E6HA 3TJPA 3T1FB 4LGRB 2MOVA 5IQLA 1KB5H 4MMYA 4LIQH 4MBRA 1A1OB 2OQJA 4GBXA 4KHXL 2BC4A 5JDSA 1A2YA 3FTWA 4NKMB 3IFPB 3ZUCA 1AY1L 5F1IB 4Z7QE 3U4EB 2DLHA 4XWGH 5DHXB 3S96A 3QDGB 4UINL 2DW5A 5ISZB 4YDVA 1RIVL 5E2TH 5INCB 1YPZA 2IC2A 2MPAH 4C83B 3ZDZB 1IC4L 4UAOC 3GMMB 2G3MA 4HOMA 5KG9A 2FIKA 3FZUD 3KPNA 3STLA 1B9KA 5D4JA 5IF0B 3WO4C 5E2TL 2APTA 4Z77A 1NFDA 2UVEA 1OGTB 4KO6A 5DJYB 3C5ZA 3ZE2B 4FZEH 1UEMA 2JTDA 2W0PA 5DZVA 3TA3B 5IMLA 1G4MA 2QGCA 2C1OB 1ORSB 2CUMA 2XWJB 4H7VA 4PJ8D 4MZRA 4B7IA 4IBLT 3MRIA 4Y2OB 3UTSD 2EDMA 3RKDD 4PJ5B 1B4RA 2UZXA 1T0MB 4Q0XH 5GGSA 4IK6A 3OX8B 4LSQH 4C56D 3D39E 4MKTA 4O5LH 3NRQA 5E0FA 1GC1L 4L8SC 4U1IA 2R0LH 4CVXB 4LXFA 5DO2C 1AGCA 5I28A 4WU5A 1D9KD 4FQIL 3S88H 4QAWA 4CSSA 3GLZA 5DSCA 3LH2H 3NPSC 4WWKB 4J6RH 35C8L 2ARWA 3TF4A 2VZOA 3LZLA 4FJZA 4Y5XA 1SJVA 2X41A 3CDCA 3I6SA 2NYZA 2PR9A 3VFPB 3EYFA 2P24A 3BZ4B 1YUKB 2E7LC 3VFOA 2IAND 3LV3A 1T6VN 4HKJA 5JHMA 4OQTA 3WFDL 2PP9A 5JZ7C 5D1QD 3II3A 4MB4A 4JM2A 4L8SB 5FW6A 3EJZC 1JMZA 5F9AC 4CC4C 4TNFA 2BIPA 2C9SA 4GAYA 4M29A 2YMXL 4Y1AE 3KLSA 4PRHB 2WBWB 3PIQB 4HK0A 4QWWD 3S35L 4Z0XB 5FO8A 4HW6A 3TS8A 3HMWL 4B9YA 1JG9A 5I6KA 4Y2NA 4MRBA 3SKNB 3S3DB 2OL3A 4EKJA 3S5LB 4S0TD 2XPZA 4OD2A 2JJSA 4N5ED 1ZOXA 3O6LH 3WIFB 3JV0A 4B53A 4RH4A 4JM0A 3MUJA 3K8KA 1FGVL 1SJXA 4S1SH 4PRBB 5EBMA 1EGJH 2OJEA 1MFDH 2QZQA 2XICA 4ONHB 2XZAH 3CVBA 4QPEA 4BZ2H 5K9OA 2V2TB 1ZLWH 5DTFA 3STZA 4HKZB 5GGTA 1M1SA 2PPEA 5HDQL 2IH3A 3GMNA 1XIWD 4ETQB 4MJIE 1A2YB 1HVXA 4WHTB 4YN3A 1CG9B 4ZAKC 1I8MA 3P30L 2PR4L 4FQLL 2B2XL 1AHWA 5D2LA 2MCG1 4KQ3L 3S96B 3B9KA 1HESA 3QQ4A 3UACA 4HIJB 5L4FA 1ZLUK 3DJSA 1SEQH 2CKBA 5DEFA 3O3EA 1XCQA 2ODIA 1DUZB 1G6RH 3EGDA 4PJ9C 3BAIA 5KG9B 2VLRD 2QDVA 1RCYA 4A68A 4TLUA 2IFGA 1T2JA 2AK4A 1OARH 2ZCLH 2ZF8A 1UG9A 1JN6B 3BP7A 1KBBA 2VDLH 5DQ9B 3O4OB 1TVDA 1ZA3A 3MLVL 5M7QA 3TA3A 5IMLB 5JIMA 4QRRD 3C9NB 3H3KA 2EIEA 3TH2T 1IC1A 2DI7A 2VSCA 4YL4A 1F4YH 2I69A 2O5ZH 1TVHB 3IEAA 4N6RA 4X6EA 2E9JA 4O02B 2X87A 2YD7A 3EH3B 3H9SA 1IC5L 1J8HD 3G5YB 4ODWA 3MRFA 3H2WA 3UOAB 4JO1H 5HD8D 2A4CA 3CFTA 4RZCB 3ZDXE 1F56A 5BRZA 3MBXH 4HUMB 3S37L 3DXAA 2HVJB 1VCBC 2PYED 25C8H 2CO7A 1V3LA 3LEYL 3QUZA 2YPLE 5T8IA 3GXMA 1FFRA 2HA1A 3LZPA 4K3DL 1YQVL 4P99A 1KCVH 1F90H 4GSXA 1T4WA 2J8UE 4EF3A 2A9AA 3UIZA 1OTSD 5E95B 5HHME 1CDBA 1NTDA 3W5MA 1O7DE 3WGVB 3T6ZA 4NC2B 1TSHA 2J71A 4YE0A 3OKDA 1CGUA 1KJ2L 1P1ZA 2Z91B 1N59A 4JFDE 4AEHL 1CF1A 3AU0A 3GXUB 4ZFGL 3DI3B 2Q86B 4N2KA 2EECA 3NJGA 4P23C 4YGVB 4Q6KA 4NFDA 4WSKA 4L4VA 1NC2A 2AJUL 4P8QA 2I24N 1NWPA 5KOVC 3F62A 1S9VB 2G5UA 4NFCA 3MKGA 3TJHC 2NNCA 4ZTPL 4GKNB 4PJEF 4DQOL 4D0BB 4Y4HC 3MOAH 3QJFB 2WYHA 4QCIA 2JKXA 1PAZA 2GK0B 1R17A 4HU2A 4UM9B 4YSQA 2V2TA 4QAMB 1QFWI 1KJ3L 4LHUD 3EDEA 4LK4A 5AVUB 1C5CL 1BD2D 2M1KA 3TZVD 5MENA 3IRCA 5EOCL 3S48A 4WEUD 2YAHA 3VM5A 1PNCA 1E7UA 1Q1PA 1IC7H 1XR8B 2H41A 4AIOA 1CXLA 4KAQH 1YEGL 4BK5A 4PJEE 1BQUA 5IB4B 2MCMA 2Y1VA 4CUCA 4LVOC 5KYYB 1ED3A 1HN1A 1EZLA 1WISA 2X4RA 3EFDL 3QXDA 5HDBB 3GIVB 3OLEA 1IIIA 3B7UX 3R06B 4O9HH 1UTDA 3QCTH 5CSZB 4U49A 1BPVA 2CE6A 1KCKA 2ADFL 3QFJE 2BVPA 4L3AA 4DTGL 3ESMA 5FYJE 3VRLF 4G6FD 3HS0C 2WXQA 4RMQA 1XCWA 3KYOB 2VDOB 4M7LH 2BSSB 4LSRL 5CCKH 5ACZB 4OZIB 3LJ3A 3NAAH 4JPSA 3PUCA 1JZGA 1TCRA 1HJCA 3AGVA 5IROC 3PGFH 1NFKA 3MJ8A 2HVKA 1HHIA 2V3DA 3Q2LA 4J3OC 4JO2H 1M9WA 2R0ZH 2DLTA 4MD5B 3T9WA 3VXNA 1VA9A 1UOVA 1MCRA 3FB6B 2GC7C 2YZ1A 5BRZB 3V4VA 4GRWB 2VAJA 3PJLA 4EZJA 4PG2C 2VW6A 2J72A 1CGXA 3RFRA 1NZRA 3H9SD 4MNQA 2YS4A 3QUYB 4PRIE 2EIBA 3BSHA 1HJBC 3BQUD 3PL6A 4KNQA 3M17A 4M5YH 4TSBL 3GSVA 4BD4A 5E94B 4B0MM 5T5FL 3MUGA 4X99A 1L7IL 3HZYA 2YAEA 3FUJA 4F20A 4AXWA 4JO4H 3SCMA 2Q7YA 3JZYA 1JCKA 4YHLL 4R4BB 1FFPA 2D0HA 4GH7B 2WVVB 1MW2A 2ZOKA 2GTZB 2Y06H 4ICWA 2GJZA 1LNUB 2XY2A 3SE9L 1F3JB 3GSOA 4B9JA 1M2VA 2P9RA 2X4TA 5IWLC 3QQDA 1YO4A 5L4IA 4KNUA 1Q90A 3VMNA 4GUPB 4JN2A 3MRQB 5LCVH 4UOJA 2FX7H 5FWQA 3V6OC 2IWFA 4P4RA 5EU3B 2QEJA 3GKWH 3HMXL 4AOFA 4X5QA 5MHSD 4U6VL 4G1MB 4KMLB 4YDKL 4V1DB 5L2KB 2VH5H 2OMVB 2XKSA 3ARBD 4HFUL 1S7VA 4WJ5B 1IQDA 2G5RA 2YD0A 1MH5B 2C3VA 3LKSA 5F1KC 3OKLB 4FQIH 2H9GA 3L4XA 1YEIL 3HI5L 3LDBC 4L3CB 3KGTA 3L3JA 1Z3GL 4GW5A 5EFIA 1JZ3A 1I1AA 1LO0L 5FYKE 4PGBB 5HYQB 4I1RA 4OZHF 4GQQA 2OYKA 1Y0LB 1X6LA 4QJ3B 5LGKA 4HIHB 5CGYD 1FNGA 1R3KB 4QHKJ 3HG1A 4AG4H 2AQQA 3BLBA 4LCWD 4TKWA 5IT2L 2WKGA 3P2TA 4ZFOA 1C8PA 2ZUTA 3AZUA 2DMKA 1BZDA 1EDHA 4NQEE 1P9MC 5DD0H 5J3HD 2O5XL 1GGYA 2PPFA 1MREL 1VENA 1FFOB 3V6FB 2IV8A 3B3IA 4EDXA 3MNZB 1H8LA 2EKSA 3QEQB 4YHNB 4KXZI 4PWJA 1KFGA 3I9AA 4N8VB 5D72H 4HT1L 3V4UH 2HX8A 4B3EA 2X7LA 3G04B 4MAYB 1B0GA 4JFUA 3FQTA 1NGQL 4FFYA 4QMEA 1HCFX 1M42A 4C56A 2WNGA 5I1JL 1PZ5A 3TJHD 4AL8C 4EI5C 4HUWA 4AYMC 3IETB 4XNQA 2D4FA 5HGHB 3K6SA 4BZ1A 5AAPA 3N40P 1XTMA 5H2BA 1CBJA 2Y7LA 4UTBH 4PJ8A 1DQTA 5GS2H 1IAII 3EGXA 3SDXE 5BUGA 3MNMA 3OB0K 3ALPA 3E0GA 3E2HB 3GKWL 2Q7YB 4NZTH 2BC4B 3K74B 3QIUC 3V9FA 3D69A 4WI3A 5FCUH 4HX1A 1I1YB 1N2RA 3VGEA 3T2OA 3QHZL 5LUMA 1DVFA 2EXTA 4K94H 3V6ZA 1YHPA 4YSDA 3MUZ1 5JLZB 2BJML 1X5HA 3VFVB 2O6EA 4ES9A 3FU6A 5E6YA 3CDYA 3F7PC 2UZYA 3BMWA 3MX0B 2ZNXA 3LSOA 5I1DA 3FO2A 1K9TA 2Y36L 3JQOB 1EEZB 4AX3A 3RHWF 3APFA 1DCEA 1DP0A 4AEIH 4JMNA 2NW2A 1HDMB 1KELH 1NMAL 5FK9A 5K1JA 5EIIA 3ABGA 3DURB 4XRCB 2APBA 3KPTA 3BWZA 5CEYA 1X9RA 1LO3L 3PU7A 3P40A 2DKSA 3RFZB 3N1FC 1JYNA 3FO9B 4OCLC 2A9NH 1KJ2B 2YA2A 5FO9A 4WO4A 4ZDHB 5GGTH 3FO0L 4FFVD 1LO2H 4WUUB 3Q8BA 3RWDB 2ALWA 4D3CL 1VFBB 5TD4A 3CVHL 1OO2A 3GGWA 3BVDB 3S7GA 1HIML 3WDHA 1HE7A 1YEJL 3ARDC 5AVRB 1ZV5A 3I6LE 5BMFL 1AANA 1SYVB 1FVEB 3T8XA 5EU7E 4NHUB 4XPGH 4N2AA 5IFJA 3UTQB 2R1WA 3P77B 5EZJA 5CEZH 5TQ0L 3NIDB 1J10A 1XSKA 3QIWB 5T3ZL 5C0AD 5DZNA 3LKPA 5KSVA 2DQIL 1KG0B 4NKMA 5DFVC 2EDJA 3L5XL 2CRMA 3S34L 1YNTF 3FSVA 5DJXA 1DFXA 4NJAL 5GZOC 1ND0A 4N8VA 2IDTA 4CU8A 1XV8A 2W0KA 2EDOA 3ZDXF 4AEHH 4E9LA 1TZIA 1GY1A 3CVDA 2CXGA 3BUQA 1AXSA 4FG6D 5J5EA 4NCC2 2FH8A 2ED9A 2W95A 4RLDA 4JDZB 2F1EA 1IQWH 2H6UA 4FGMA 4WVRA 4UT9A 4QRSB 1Q72H 2OL3B 4KQ4L 2D2OA 4N2MA 1KCRL 4UUJA 3ARQA 4FFTA 2IALB 2WN3A 4PJCF 4FFZL 5DEJA 1CLYH 4IK7A 1BWWA 4E68A 1CZ8H 1H8OA 2ADIA 5HJBA 5I1GL 2UWEA 1DUYB 5TDOA 2P8LB 3F7VA 2OTUB 2KZWA 5KBNC 1FLTX 2C4FT 3QC5X 5DTFB 3S3JA 4A7SA 1OTSC 4YIQB 1AZUA 3P3YA 2AEWA 1HXYA 3LNHA 1E7VA 4EUPG 4DP8X 5IVNA 2H2PC 4QGYA 1HNGA 4ONGH 2AF2A 2HRLA 3HIZA 5ESAB 2AJ3B 3RWEA 1UA3A 3N55A 3VXPB 3U6RA 4G8GD 1ZTXE 1JI1A 3DGGA 2FJFA 3OPZL 4HUVB 3HUJF 5DC9B 4CVUA 5I76B 4UILH 4F58H 1ZT1B 3FO2B 3ZMEA 7TAAA 5MEOB 3ZTNH 4W9HC 4F3FA 3VFOB 3LKRA 2CDFB 4MXQD 4D9QE 3QRGH 3FBKA 2AJYL 3S2CA 4Z0BH 2CUIA 3CU1A 4O4YL 2H7WA 1SGKA 1VLXA 3IDGA 4XC3L 4X6EB 4PJHB 4E5XB 3OXSB 4U3SB 5E6ID 3SPGA 3IN2A 2YXFA 3H9SB 4ODXB 1RUQL 3KLLA 5D4IA 1P6FA 5FYLH 3MAWA