1A8ZA

Structure determination of a 16.8kda copper protein rusticyanin at 2.1a resolution using anomalous scattering data with direct methods
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
LDTSWKEATLPQVKAMLQKDTGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLDIPAGATVDVTFINTNKGFGHSFDITQKTPPFAVMPVIDPIVAGTGFSPVPKDGKFGYTNFTWHPTAGTYYYVCQIPGHAATGMFGKIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords RUSTICYANIN
publication title Structure determination of a 16.8 kDa copper protein at 2.1 A resolution using anomalous scattering data with direct methods.
pubmed doi rcsb
total genus 34
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 1998-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1a8zA00
2AVFA 1ILUA 1BQRA 2OCCB 1HAUA 4CSPA 4BDVA 1NIFA 2BP0B 3EHBB 4HIPA 3RYMA 2DWSA 1L9RA 2WO2B 3DKHA 3H4FA 1JZIA 3OM3B 1PMYA 6PCYA 1N70A 1WAEA 1NIBA 1BAWA 1SDDA 2HX8A 2OV0A 3IE9A 5B1AB 3NJNA 2PPFA 2ZOOA 4A2EA 1NZRA 2IDTA 2J5WA 1IBZA 4A68A 4AI7A 1JZGA 1OCRB 3ZIYA 4NAJA 5IY5B 5B1BB 2VW4A 2XVBA 4UF7C 5D4HA 8PAZA 1HFUA 4A67A 3DIVA 4GXFA 4N4YB 4DP6X 4HZ1A 1X9RA 4YL4A 1RCYA 2DYRB 4NB7A 4E9RA 4A66A 1A8ZA 4JHUA 4MFHA 1M57B 3GYRA 1KBVA 3V9CA 3TBCA 1KDJA 2FT8A 3FSAA 2BP8A 4YSAA 4E9YA 1BYPA 3AY2A 2PPEA 4GY4A 1QLEB 3JTBA 3X1FA 2CUAA 4P5RA 1SF5A 4BWTA 4YSRA 2YAPA 1AS7A 2VMJA 1TKWA 3NSDA 4G71B 3FPXA 3V9EA 4YSCA 1MDAA 3T6ZA 2IDFA 2P80D 2QT6A 2IH8A 2YAFA 3OMAB 3QJVB 1CURA 2VW7A 3NJIA 2PPCA 4KNUA 5AFAA 1CYWA 4YSUA 3PPSA 1PLBA 2J56A 2VM4A 3NSCA 2Y1AA 4JHVA 2I7SA 4PAZA 1AACA 2BZ7A 1AG6A 3NJHA 2YAMA 4GP5B 4AKOA 3X1EA 1V55B 2E86A 1FFTB 1I53A 4BK5C 1PLCA 4AKQA 1A4CA 2QPDB 1AZNA 1ZV2A 2GBAA 1SFDA 2HX7A 5I5IA 1JVOA 1IKOP 2FNWA 2CALA 5D4IA 3AZUA 4RH4A 4KO6A 3ZBMA 4A2GA 3AW5A 1TEGA 3QJUB 4QKTA 1HAWA 4KNTA 1PZBA 3ASNB 2X88A 3S8GB 2JFCA 5F7AA 5I6MA 3QJSB 2IDQA 3PAUA 3FU7B 1BEXA 4Q8BA 4E9WA 2EILB 3EH4B 5TK4A 2GHZA 3U25A 2XX0A 3WNJA 3TBBA 3T71A 1M56B 4A2HA 3ZX1A 2XV2A 3X1BA 1PLAA 4DPCX 1WA2X 3C75A 3NT0A 5PCYA 1V54B 1KDIA 2HX9A 2XU9A 3WG7B 1KGYE 2HRGA 3NSFA 1KCWA 2JKWA 2PLTA 5B3SB 2YAOA 4CSZA 1FWXA 4DP7X 1A3ZA 1MZYA 1JOIA 2B08A 2XXFA 2YARA 1XB8A 3FQ2A 3ZDWA 3ABGA 1DYZA 2XXGA 3OQRA 4N8UA 2CCWA 3UGEA 3EH3B 2FJSA 4BDVB 4A2DA 1PY0A 2BWDA 1GS6X 5E9NA 1RKRA 3OD3A 4DPBX 2NRDA 1T5KA 2BZCA 3N55A 2J55A 1GSKA 4M3HA 2HLEB 2PP9A 1PCSA 1PNDA 3WI9A 1E67A 2TSBA 1BQ5A 1SDDB 1ZPUA 1EHKB 1E65A 3L45A 4HCIA 3HB3B 2W8CA 1AG0A 2GIMA 2OJ1A 3UACA 1AR1B 3BVDB 2RACA 1QHQA 4YSDA 3T6WA 3CZUB 4HCGA 2Q9OA 1ASOA 2ZONA 3IN2A 1AZUA 4GYBA 1AS6A 4X4KA 2FT7A 1JZHA 2FQEA 2QPEB 5B7EA 2ZXWB 1AQ8A 4G70B 1TU2A 1OV8A 3NJJA 1VLXA 3S3BB 3KW8A 1J9TA 3WKQA 1IUZA 1NIAA 4E9TA 4G7QB 4TXVB 2FQGA 2DWTA 4GP4B 3TA4D 2EIMB 4E9QA 1W8EA 1PZCA 2MTAA 2IWEA 2MRYA 1MG3C 2AFNA 1OF0A 2BP8B 3H56A 3NSYA 3PAZA 2BW4A 1NWPA 2WSDA 4EF3A 2XYBA 4KO9A 3S3DB 1AANA 3H4HA 3TU6A 3QJRB 3QQXA 1PNCA 1DZ0A 1ASQA 3FYIB 3UADA 4E9VA 1E5ZA 3GDCA 4PCYA 3GXUB 2QDVA 3MX0B 1JVLA 3QPKA 2FWLB 3SBQA 2YAEA 1CUOA 1J5CA 3WKPA 2R7EA 3ERXA 1NPJA 2N0MA 3FS9A 9PCYA 3KW7A 1J9QA 1AIZA 4G72B 2AZUA 3ABLB 1ZIBA 1PAZA 4M4RB 4QLWA 5F7BA 2PPAA 3D12B 2UXGA 3DTUB 5EHFA 1ET7A 1TEFA 1JXGA 1A65A 1E5YA 3NP4A 1L9TA 1L9QA 4UANA 5I6PA 2PPDA 4YSOA 3UAEA 4BWWA 3PXLA 5I6LA 1ADWA 1XB3A 1KBWA 1OE3A 2BHFA 2GI0A 4ZK8A 3FU9A 2JXMA 1NWOA 1WA1X 3T6XA 1GS7A 3HEIB 1J9SA 5D4JA 4AZUA 1NTDA 1ASPA 1OOWA 4DP5X 4DP1X 3IEAA 1XMEB 2DY2A 1A4BA 3FQ1A 4YSEA 2P80A 1BXAA 1FA4A 7PCYA 1B3IA 2YAQA 3AG2B 4BWUA 1NICA 3NJMA 4KO7A 3MBWB 2CBPA 4KOCA 4E9SA 2QDWA 3UABA 2IWKA 1GS8A 4L0PB 2A3TA 5TK2A 5I6OA 2YAHA 2UXFA 1JERA 1ID2A 3NJFA 1PZAA 1J5DA 1ZIAA 1RZQA 3PLYA 1ZDSA 2EINB 2XUWA 4YVNA 2UX7A 2EIJB 3CDZA 2XLLA 4HHWA 4UAHA 2IH9A 3PAVA 2IAAC 1W6LA 2UXVA 2LLNA 3X1GA 2GB2A 4JKNA 2B3IA 2FTAA 3NP3A 4DPAX 1OE1A 1NINA 2GC4C 4G7SB 4W1TA 4BXSV 5A7EA 5B1KA 5I5JA 5I26A 1NDTA 3AG4B 2CAKA 2XV0A 4KOBA 1GY2A 3IN0A 5B1JA 5I5MA 2XWZA 2X87A 1E30A 1BXUA 1ETJA 2Q5BA 1F56A 1URIA 3FPYA 1JZJA 2BP0A 3FSVA 1JZEA 1NIDA 1AZBA 2Y69B 4F2FA 4GP8B 3T6VA 1SNRA 2I7OA 4DP9X 2BWIA 4F7KA 1MZZA 1NIEA 4DP2X 2UX6A 4DP4X 1WA0X 1AS8A 2IDSA 3NJKA 3SBRA 3S8FB 3WNIA 4YVUA 3SBPA 1W6WA 4YSSA 3ABKB 2PP8A 2DV6A 1JZFA 4AX3A 1WS8A 1AOZA 2H5UA 3BQVA 3T9WA 1SHXA 2VW6A 1CC3A 1PF3A 1GW0A 3CVBA 4W9ZA 1SF3A 1CYXA 3X2QB 1KCBA 1ET8A 1SFHA 3CVDA 2BW5A 3FQYA 3NJLA 4HCFA 5I6KA 3JT2A 1ILSA 1KV7A 1OCZB 2PP7A 2XX1A 3FYEB 4Q89A 2DYSB 4F2EA 5B7MA 2R7EB 5FC9A 1SJMA 1L9PA 1AZRA 2AZAA 4NERA 4ENZA 2TSAA 4HAKA 2YXVA 3ABMB 5AZUA 1EZLA 2H47C 4K9JA 3G5WA 1BQKA 3FU8A 3N2JA 1AAJA 1GR7A 1UATA 1YLBB 2IWFA 3WIAA 5I6NA 5ANHA 4YSTA 2VM3A 2EIKB 4FAAB 4FA7B 2W88A 5LDUA 2GSMB 2GC7C 2I85A 3AG3B 2UXTA 3FT0A 7PAZA 3FSWA 2FT6A 2BO0A 3UAAA 3FSZA 2J57A 3QJTB 1M9WA 4P5SA 2H3XC 1GYCA 3NYKA 1RZPA 2VSKB 1QNIA 3AG1B 1OCOB 1GY1A 1A4AA 3CG8A 3S3CB 3PCYA 4DP0X 1ET5A 2ZWNA 5I28A 2PCYA 4KNSA 1BXVA 1XB6A 2AANA 2PCFA 6PAZA 3EF4A 1BYOA 1KYAA 1MG2C 2VN3A 1SHWA 2VSMB 3IBOA 4A2FA 3X1NA 4DP8X 1V10A 1WS7A 4E9XA 1ZDQA 4HALA 5PAZA 2WO3B 2FQFA 4G7RB 2IDUA 1IBYA 1L9OA 2XV3A 4BXVA 2HZHA 3TASA 2YQBA 3FU7A 3QJQB 3CVCA 3OMNB 1J9RA 1JXFA 2HRHA 2HXAA 4KO5A 1N68A 4YSPA 5B1JC 5AKRA 1OE2A 3ASOB 1X9UA 2FQDA 3CDZB 3NJGA 2CJ3A 3SQRA 1NPNA 3OMIB 2YXWA 1IC0A 4HHGA 4AKPA 1OCCB 1AZCA 1R1CA 1L9SA 4YSQA 1JXDA 4WKXA 4WTQA 3EH5B 5B7FA
chains in the Genus database with same CATH superfamily
4HC1A 4NQXA 1KEMH 3B3IB 2OCCB 4PJIA 5D8JL 1A3QA 3P4LA 4ODUA 5MEOA 1IGJA 1RZKL 2WQVA 4GKNA 1QSFD 4R7NA 4S1QL 1L9RA 3OM3B 1DBKH 4NWUL 2X1QA 1UKTA 4JFYB 1ZRUA 1SDDA 4PTTB 1UB5B 1J1XL 1YN6B 5ISZE 2EE2A 2HAZA 1F4WL 3MV9B 3MLPA 1J18A 3ZZ1A 5KUMA 4OT1L 1G43A 1FFPB 4E5XB 1E4KC 1FGVH 1PG7X 3D2TA 3OAYK 2GJZB 1JZGA 4M8VA 3IFLL 3QFJE 4TUJA 1LWRA 5B1BB 3SDDA 8PAZA 4BFRA 5LCVA 4JQIL 3UTTE 4M8QB 4HIJB 5LGHH 3D52A 3V4PH 5F9DC 3C60A 4LHQB 4DP6X 2ADJA 2X4RB 3WL9B 4TNVF 3V8OA 1KB9K 4E9RA 2XKNB 4XNUH 4AH2A 3GC3A 1P9MC 2VISA 4QAWA 2I26N 3MODL 1XIWB 4JHUA 3OV6A 3WS6C 2ENYA 2D0FA 3WEOA 3TBCA 3OB8A 1OT4A 2OTUB 4EAEA 4OCWL 1JPGA 2Q6WA 4LT7A 1MCLA 2J6EL 4PV1C 5A40E 2PPEA 4H8WC 4MBOA 1BGXH 5GZNA 1E4WL 1ZVHA 4PI2A 3L5XL 4ORGB 1F00I 3HPLA 1URLA 2QADC 4MNHA 3LQAL 4LSPH 4OFYA 3ECBB 3KPPA 3ARGD 3MQIA 4M5SA 1P7BA 3EDKA 3ENEA 3KPLB 3PRZA 3QUMH 3BGMA 3VA2C 3WJMA 5FO8A 3KGSA 5D7JD 4OKVB 5LNEA 4CBZA 1KELH 2WBWB 2MOVA 3U83A 1M6UA 2UY6A 3A67L 4FQHA 2VZOA 3B7SA 4W6YB 3GI8L 4DN3H 3H7BB 2J56A 3MRGB 1KGXA 4MKMA 2M26A 1JF1A 5IG7B 4ZS7L 3WBDA 1MJ8H 2E56A 1LK3L 3MUJA 3T3PE 4X6EA 4X80H 3V7AE 5AVQB 2DMHA 4JFPA 4WAFA 1VPOH 3CDFA 3D3VA 4L4TA 2OSLA 1FFOA 2B77A 3EH1A 4TULH 2Z7WA 4OCNC 5EIQA 2OMXA 3X1EA 4YMPA 1MREL 4Y1AE 2O6DA 3PP3H 5SX4H 3VJ6B 1NGXB 4WO4C 3OR6B 4OUUB 3KWTA 2AEQL 4L29B 4PJEA 4HJ0C 4PUBL 1SBSH 3IFPB 4APXB 1I8KA 1CYGA 3AZUA 3W38A 1G5GA 3V4LA 2OA9A 2AABH 5FCUH 4BYHA 2NNAB 2HG5A 2OM5A 2BS8A 5E8EA 5JR1L 1MPAH 1H19A 3QORB 4YXKH 3HC0B 1LE9A 3ASNB 3VVWA 1P0SE 1Y1UA 1UEYA 4XH2B 3R0MA 4IBQA 4GLRI 1Z9SA 1UASA 4WFEE 4KUZH 4GRLA 4OBRA 1ETZA 3LKOA 5F1KC 4NJAH 3VG9C 3C8KB 5AW7B 2UV3A 1LO5A 4BZ2L 4TUKH 2O5ZL 1A7OL 3X1BA 1L0PA 5GJTL 3SE6A 1PLAA 5KSUA 4YGVA 2BSTB 2HUHA 2EDRA 4LDLB 5IB4B 2N1TE 5F3BA 2FLRT 3NPSC 4O5LL 5DHYA 4N0CC 1H3GA 3L2MA 2VXUL 2ZJSL 1TTUA 1FRGL 1GKOA 1XZ0B 1H3WM 3QQDB 1FWXA 1MLCB 4IRZA 3APMA 3FO2B 4N5UA 2B1HL 4WIQA 3WIFB 1IBGH 1UFGA 4ADJA 3KJ6H 2Q3ZA 2AJUH 3OHXC 1UKSA 3M7FB 5GRJL 2BNRD 3O3BA 4F15C 4NHCH 3HZVA 1N5YH 1PY0A 3QNFA 2BSDA 3TN0C 1DQKA 4QMEA 1DCEA 1U8LA 5T1DL 1F4HA 2BZCA 2FJHB 2Y5TA 4TQPA 3K8KA 4X4MA 5AB2A 2X0WA 3I6GA 3KYAA 1MUJB 2XSKA 3NEXA 3FH5A 5BV7L 2R27A 3X3GL 1HT6A 2EYRB 4KZ0A 2P5EA 1VCAA 5T3ZL 4RVBA 5TQ0L 2WMPA 4WVRA 4M7LT 4NQSA 4B9JA 4ZNCD 5D1XA 4PJHF 4O4YL 3FJTA 4OIIL 1EPFA 1I7UB 4UZGA 5CJ5A 4G5ZL 3BPLB 3NCFB 2ZUUA 2BCKA 2QSCH 3N6YA 3PWPA 1UVQA 4RRPM 3V5HA 2PN5A 2VRAA 5SX5K 3OKMB 3LKPA 4S2SA 4LNRA 3CDGA 2JLPA 4ZPTA 1MELA 2DL9A 1G7HA 1SQMA 4PW3A 4S0SD 3QZNA 2YO3A 2OAAA 5D72H 4UT9L 3W39A 3EZ8A 2XIIA 2L4OA 5DEGB 4J8QA 3DOIA 3C12A 5EU4A 3BKCH 2EE9A 5D7IA 5CD3A 2UZIH 3N5AA 1FG2A 4TVUA 3QUGA 4HHAB 1KIUB 3Q8FA 1VIWA 4LLDA 4E9LA 1SY6L 2R2EA 4GSRA 1F58H 2OL3B 4KO9A 3D0AA 3UL4A 3TNNB 5F9WB 2EDOA 2X70B 3QJRB 1QWUA 2PW1A 4U33A 4YPGB 4DKTA 1S9KC 3P4MA 1DZ0A 1GGIH 3UADA 1TKWB 4FLRA 4OAWB 4YN3A 2XZZA 5A3ID 3L3GA 1F3JA 3MI6A 3DUUA 1NMBL 3OPZL 3EKCA 3I85A 3ECWA 1MFDL 1J5CA 3U82B 4OD2A 1I9RL 4FP8H 3U0PA 1IJNA 2VQ1A 3QJFB 4ZX6A 4OSUH 3FU5A 5DC2A 4WWOA 5DRWA 5EZJB 4Y5YC 2DWDA 5F9OL 1ITCA 1IZKA 2VAAB 3GSVA 1SJXA 1YEKH 3MLSL 4TLKA 1PX8A 3MLRH 4GSQA 4QRPE 3MLXH 1GAFL 1UWGH 3EBHA 4MA3A 4G1EB 4PGCB 4KKBC 2CBMA 3ZKQD 2Z8VC 2WSKA 2BMKB 4BFEA 4EUPA 5JW4M 3CN1A 1GS7A 1INQB 3KWUA 4RGNC 4Y9BA 1MCHA 5MI0B 3ZHFA 4A55A 4OVUA 3EOYG 3SQBA 1Q0YH 4L8BA 3D5OF 3BH4A 4DP1X 1BXXA 5D1ZI 4KTDH 1HDMB 1P4LB 4JR9L 3SDCD 3FQ1A 4K3DH 5F7WC 5BQDA 5ITBH 4LLMB 2H0JA 1FA4A 1G7JB 3AG2B 4FEIA 4YR6A 3WIIL 3VWJD 2CRMA 1NCAL 3ROOA 3V4VA 3D7PA 1WG3A 3ISYA 3UABA 7FABL 1P5VB 2IWKA 5KVGL 4U0QB 4DEPC 2W65A 1QZNA 3QDMA 3F85A 2DZEA 5L7XL 4IBSA 3LD8B 4BK5A 3VXUE 3BT0A 2UVEA 2QQKL 4N2AA 4I4WA 5TGBB 3ATAA 1CGXA 2P24A 2I60L 3O8XB 1NAMB 4DQOH 5A2BA 1TTAA 5KOMC 1W0WB 3UZEA 3NCJL 1MW3A 3S5ZA 3X1GA 1RXLA 2HFGL 4JFZH 4DHLA 2JELH 1CXLA 1D2OA 3QA3A 4OM1H 5J8OA 2FTAA 5JOPE 4Z5RA 4IBWA 1EV2E 3R7RA 1N5AB 5D1ZD 4JM2F 4MJ6B 4D9QE 3RX8A 2EYTA 1FLRL 5FGSA 3F5WA 3SJVA 1E43A 1U93B 3L5IA 4XBEL 4YX2H 4R9HA 5IVZA 1XV8A 3L7EB 3B9VA 4BH8A 4NKMA 5B8CB 4DETA 4XO9A 1MQ8A 1JDDA 2X87A 3NGBB 5F6IC 1BOYA 4L37A 2Q5BA 1FNAA 2G2NA 1F56A 4PYHA 5TTRA 2R23B 2EC8A 4JS7A 2VXTL 4QJ5B 4YHIB 2A7BA 3OKOB 4HPYH 4PSRA 5CSZA 1YJDC 3O2VL 4JM2C 3HW7A 4PJGE 3DX1A 1ZHLA 5TJWK 4P0DA 4Q9QL 2BX5A 2AXGB 4K7PH 3C5ZB 1R17A 1I7RA 2XTJC 4NOFA 2WJ7A 1CFVH 5H37H 4DP4X 3F6IA 4NZUL 1U91B 1U8JB 2OW6A 1C16B 3KDMB 3ABKB 1YEDB 4L23A 4G82A 3B4NA 4X5WB 1DVFD 5E1IA 25C8L 4X7TB 4OQTH 2VW6A 3QYNA 1W9XA 3A6BL 4XNDA 4OF7A 5B1CA 1AXSB 4B9PA 3HCVA 1SF3A 1GYVA 4P2QA 2CRYA 2V9QA 3RJOA 4LU5L 2ZXCA 1OSZB 3E3QC 3I50H 3P11L 3O4LD 3HE7B 4D8PA 1JHTA 5KUKA 5I15H 4R7DB 2DLFH 2VZVA 1FVCB 5K59F 1N8ZA 1TZHA 1AQKL 1UM4L 3AXIA 4HAGA 4NKDA 5D7SL 4RFOH 1RULL 1UA6L 1B88A 1FSKC 3NMEA 3GBNL 2AEPH 4P59H 2I5YH 3ZDZE 1IGTA 4OGQC 2V37A 4WEBL 5ID1B 5IREA 4HAKA 3P3YA 5LXGH 2CMRH 3E7JA 2YPLD 1P9MA 4Y2DD 3GHBL 5EO9B 3SQOL 3IMWA 1V3JA 3VFSA 1KLGA 3WS6A 1FDLL 1TQTA 1UATA 4RMTA 3ZQ9A 4K15A 3T3MB 4FHKA 4E36A 4FFYL 2K3TA 2E6QA 5KS9F 2WTPA 4Z7NB 1TQBC 4X6CB 4PJDF 4QWWD 4AG4H 3OJMB 4K8RD 3NVQA 2HVJB 4X9BA 1N4XL 1ZWIB 3P4OB 2ZAIA 3VMPA 2Q2EB 4URKA 4E41D 1VFAA 3V6OC 1Z66A 3U79A 4YHNB 3BWAA 3ZR5A 4F5CA 3QIUB 5HDQL 5I0WA 3F12B 2YGQA 3VFOA 1JK9B 3FL7A 1L3NA 2YD0A 5IEHA 1LWJA 2WNXA 2VC2L 2VDML 1I3GH 3U0WH 2VO5A 5FFOA 5AG9A 1O6VA 2HLFD 5FCSH 2VDQH 3ZL2A 2Y2WA 1OF2A 3PGDA 3AC0A 4KJYB 2WZAA 2V2TB 1RUPH 3EGSB 4I77L 1PX4A 3KPQB 1O75A 4U0RC 4WO4A 1EQWA 1MHEA 4NN7B 5I6XC 1ZA3A 3SGKC 2CBTA 2V0AA 4G9DA 4LCWE 4JHZA 1QPPA 1VADA 1X9QA 3QIBB 5I1AA 1VB9A 4QO1B 4ZXBB 1HXYA 5I8CB 2HMID 3SO5A 1BEYH 3GLEA 4H88H 3GRWA 4XP4L 1U58A 4EMZA 4OF0A 3VFPB 5HYJA 1CIDA 1NFDE 1IO4C 3WEXB 4LVNC 3X11B 4XPAL 4AV5A 5KN5B 3V0DA 2W60A 4JJHA 4IIQB 5DT1L 1WPCA 4W6XB 1G7LB 3VI3B 3ULUD 2NNXA 2UZYA 5DRXB 3R8BB 1ZT1A 4I2XB 4U1JA 2J12B 1JD7A 5INCA 1CXFA 1FNGA 3DKHA 4ZUTA 3VI4F 2ZKMX 4ANXA 1EO8H 4YO0B 5JYLA 4MA7L 4PH8A 4RLDA 1K6QL 4JY6A 1BBJB 1BF2A 1J0IA 2V3FA 3PV6A 4GXVH 2FLMA 1OALA 3P1VA 1IAIM 4YE0A 4ZFZB 2W81C 4LF3A 3ZZQA 5IV2B 4H1LH 4JDTH 2UY7A 1SYVB 2OYKA 3BMVA 2R2BB 4FQ2L 4W9KC 2NDGA 3OZ9H 3TN0A 3HMXH 1CFMA 1XR9B 4I3SH 4EN2A 2R1YA 5GGRB 1CMOA 4WEEA 5GGVY 1O9WA 2XA3A 1KXHA 1OZUA 3DTXB 2D7OA 1OK8A 1VZGA 5E2TH 1DFBH 3K2UL 1JUFB 5T3ZE 3DUSA 5IVXB 3CV5A 2OQJB 1YEHL 2GJPA 2AQQA 4BKSC 1G0YR 1IARB 1ZD6A 4FGMA 2LABA 2OYPA 3UC2A 5I19H 2WUBH 4MSWA 1IIIA 4XBMA 1ZA6B 2ZSVA 4ZO8A 4WGWB 3BKJH 2BP8A 3I9IA 1OTSD 1WQVT 2DQFB 3WO3B 1E27B 4H2AA 2E9BA 4PQXA 3PGFL 4M1CD 2FO8A 3AREC 1RZKH 3FFCE 4S1QH 2EXYD 4X7CC 1S78D 1BFVL 4DZ8B 5DJXB 1KB5L 4IU2A 2F8IA 1XTLA 4P3WA 1DP0A 4YL9A 1XR8A 3WHE0 1XCQB 2OW7A 2A1WH 4OT1H 3T04D 2P43B 5C08B 1UCBL 1INDH 1E28A 2KL6A 2XBTA 1CN4A 2PYEB 1E8WA 4MNQB 3U7WL 1UTDA 4ZTPL 4KK5C 3T8VA 3TYFB 1BMWA 4RDQG 1A6ZB 2GIXA 2A73B 5AW9B 4P57A 5C0FA 1VFMA 1EWHA 2QQNL 3S48A 4YXLL 4GNKB 2VLJD 3LQAC 4FMKA 1I3RA 2XWXA 3SSGA 3TA3B 1XSOA 3QXAA 4OF8A 2Z9TA 3EH2A 4JFFD 2CPUA 2DDQH 5B38A 1KBKA 1PYWA 2EE3A 5IK3A 3DVFA 4V2BA 1KCUL 4OCWH 1IAIH 3NUKA 2J6EH 1G6RB 5G5DA 3WELA 5BJTB 3IAQA 4JZJB 2CKBA 5GGUB 3LQAH 4C4KO 1BEXA 2WJ5A 3TEXA 1JTPA 4GAJL 4E9WA 4Z7WF 2GT9B 8FABA 4PJCA 2GHZA 4NZRL 2QKSA 3U25A 1IIKA 1BD2A 4X8XA 1ORSB 1RJCA 3EYFA 3RL1A 2X9WA 1O6SA 1IX2A 1L4IA 2WXLA 3A67H 4G42B 3SDXA 2B0SL 2WGXA 3GI8H 1PKQE 3OC5A 5PCYA 3AADB 1FZKA 4P49A 4HH8A 1RP8A 1BVLA 2X4TB 3L9RB 2C3VB 2CLRA 3KPSE 1HN1A 3L4YA 1LK3H 1JZDC 3GZOA 4YXHL 5C0EA 2F7IA 5CKAA 1XXDC 1OAYH 1YY8A 1MREH 4TYUA 3EH3B 4C58B 3BPLC 2MOGA 3ARQA 1FIEA 2BWDA 5JLZA 3A0OA 3OD3A 1HI6A 5KVGE 1SXAA 1YA5A 2NRDA 4C4BA 2CDEB 2IOOA 4D0BA 2NX5B 3L3HA 1T6WA 3HS9A 3D4ZA 4U3SB 4GSDL 4TTDD 3UBXG 5HPMA 5FHAH 3TXAA 2OJ1A 4IOSD 1K9TA 3SKOA 2VZSA 1EUUA 1GW6A 4IHBA 5F7FA 4B6ZA 3BVDB 2RACA 3IXAA 4IS6B 4XMKL 1QHQA 3BJLA 3HI5H 4WW1A 3T0EE 5IW1A 5KANI 3EJCA 4BZ2H 1Y1DA 4K7FA 2O5ZH 1A7OH 1LD9B 1T1ZB 1VJSA 3B2UC 3P73B 1V3MA 4V1DE 1KN4L 5B7EA 4JDZB 1AYRA 1TJGL 5F9WC 3WDIA 1IFGA 4MXQD 4O5LH 5I1HL 2IQ9L 3LPFA 3AFLA 2VXUH 2ZJSH 4NRYA 2X41A 2EIMB 2VDNL 4FQXD 2YFNA 2IWEA 2B1HH 3W5NA 1J05A 2WLHA 5DJYA 2RB8A 5F3HB 5C0AE 3UJTL 2VR7A 4X6DF 4XO5A 2FX7H 4MLSA 5DK0A 3REWB 1WIUA 3A24A 1IFRA 2WYHA 4NXSA 2X6CA 5ACMA 5T1DH 4AYGA 1ASQA 5IWLA 3O0RH 1L6ZA 3V0HA 1JV2B 3NCBB 3GDCA 1KYOK 3MA9L 3FQTB 4GPVA 5BV7H 3BWUC 3X3GH 5T3ZH 2XVGA 2D0HA 4M7ZB 4U2ZA 5LKNA 1T7WA 2Y07H 4QRTA 4MA1C 1ZHKA 3MFFB 4L1LA 3VRLF 1PCXA 1K2DA 2PCPA 4O4YH 4OIIH 1S7RA 4GW4A 3BVTA 4G5ZH 1UJTA 3L5JA 3HMWL 1XCTA 2WKLA 4JM0A 2WZ0A 1ET7A 1NGYB 1G4RA 5D7KD 2EC9U 4L3ED 3ZE1F 1CR9L 2KH2B 2FR4A 4Y5VC 4UT9H 3WLWC 3NRPA 4UINL 2RIKA 3QI9D 5I9QB 2F7PA 2A4ZA 3FKUS 4XB8A 2WNGA 3DIFB 4WJ5B 4ZSOA 3X14A 2EDFA 4JFEE 3PG2A 2WOYA 1IEBA 2JMRA 4G9FA 1SY6H 2NY0D 4K94L 3L4WA 1WHOA 2CM6A 3RWIB 4PEEA 3SD2A 2P47B 3IVKB 3LD8C 3EJYC 3B7TA 1PIGA 1PAMA 3BP7A 3QEQB 1B3IA 1QX1A 1D5BA 2IADA 1G4MA 1NMBH 4PJIE 3SY0B 1F90L 3MHZA 3O8XC 5DWUH 1MFDH 4LGSB 2QGEA 4N8PA 1YN7A 4KOCA 2WN3A 1GS8A 3HZMB 3T0VA 2DM4A 2K8MA 2Q3AA 2UUDK 5ABDE 1BMGA 3Q8CA 3N1GC 4KVNL 5F9OH 5GJSL 5I1DA 2LE9A 1H6EA 2MQCA 3D85A 3NZHH 4R4FL 4BGLA 4HXBH 5JO5B 1DLHB 3MLSH 1FHGA 5KS9A 2AK4A 4YFDB 4F3FA 4YVNA 4IJ3B 1MEXH 3U9PL 1AR1C 2XLLA 5B8CC 4PRHB 5AOIA 3MUUA 5GGTL 2LLNA 4LEBA 3GZQA 5T3XD 3SDDD 2YD7A 1IGCH 4MAYB 5EBGA 3SYAA 2QVFB 1H8LA 4ZI8A 1G9NC 2QV2A 1BJMA 3C5ZC 4QOKE 3E8UL 1XH3A 4JKMA 3VFVA 3WKML 3EG9B 3ZTNL 2YWYA 4U6VL 4ETQA 3L3DB 4JR9H 4KKCC 4WKZB 2XWZA 4UM8B 1DQTA 3BZ5A 1FLTX 2H3NB 3GKWL 2NDFA 1GPOL 3B3IA 2IAMB 1ZLEA 5IW6B 4QRQB 5HDRA 3WIIH 1JZJA 5DQ9B 3CMOL 2OJEB 2CJUL 1AZBA 3BAIA 4LFHG 3ZQXA 2BNUB 7FABH 3POHA 5KVGH 5BRPA 4H25A 2ICCA 4JFYA 1NIEA 4WFFD 4ZUSB 5L7XH 4PTTA 1UB5A 1YN6A 3U48A 2X89A 2VRQA 3UPCA 3MV9A 2MEJB 2E5EA 4LESA 4OH2A 2HVBA 4LBAA 1FFPA 4E5XA 4XT1C 1WHPA 2OMYB 3HE7C 2GJZA 3B34A 3L13A 1O9VA 2I60H 5DHDA 1S7UB 2NY6D 4Y4HC 4B0MM 3EDEA 4M8QA 2V5MA 4HIJA 1FGNH 3NPZB 4FQPA 1GW0A 4RSVA 3RWHB 3D3VE 4UT7L 1UXLA 5DRZB 2X4RA 2J7LA 3WL9A 5L0QC 2B4CH 4F58L 2PABA 2XKNA 4L4TD 5FUZL 2EICA 3HR6A 1KV7A 1XIWA 5F7EL 4PJEE 4XPBL 1FLRH 2QLVB 4XBEH 4LSUL 4QXVA 2OTUA 1CDIA 2QELA 2R9HC 2CRZA 1PD0A 2VXTH 3MCLL 1L9PA 4ORGA 3O2VH 5J9PB 4UILL 3ECBA 1EZLA 3G5WA 1S9VB 3LNHA 2NY1B 4JY4B 3KPLA 3MSPA 3I3EA 4XP9L 4BUHA 1JGLL 2VM3A 4OKVA 4FAAB 4NZUH 2AK1H 5D7HA 4QXGL 5DJ6B 3ZMRA 3FRPG 1EZUA 5DZVA 1BVZA 3V4UH 2G0LA 1OSPH 3H7BA 3L08A 4ZNEA 3MRGA 4DGYL 1N12A 1O7DE 25C8H 2AHIA 5T33L 2H32B 3A6BH 3FUJA 5GS0H 3ESVF 1E5UI 2GUYA 2F5AL 1OGTB 4W4NA 5H37G 3VJ6A 3QH3B 1NGXA 1IBHA 5F21B 5CM1A 5KVEL 1ET5A 3OR6A 4OUUA 1VFOA 4NN7C 4L29A 1MCKA 3IFPA 3WIHA 4APXA 2ROXA 1NCDH 2J8UE 3NH7L 4WI6A 3W56A 4CW1B 1UM4H 4GT7A 2NNAA 1WS7A 5D7SH 2ICWI 3TGXA 2E7CA 5FYKD 5EDSA 1UA6H 1D5XB 1OGAB 2WO3B 3GBNH 3HC0A 3N91A 3O81A 3QORA 4HALA 5ICZB 1G9MC 1WK0A 4RCAA 5MENB 5D1XE 4MNGB 4XH2A 3AT0A 2P5ED 4AQEB 3QDGE 3DXAB 2MQ0A 3SQOH 5JXAL 3ARWA 1FDLH 2J2ZB 4Z3FA 3OAYH 3C8KA 3DRTB 3PWPE 1R19A 3GINA 2YUVA 3VGBA 5EBMB 4PRIB 3LMJL 3DYOA 4UAOB 4HFUH 4FFYH 5A2IH 1EXHA 1A7QL 1Z9OA 3HUJF 1E4XL 1PZ2A 3UPAA 2BSTA 1QFPA 3WJJA 4HSCX 2O5XL 2A5UA 2P8LB 5IB4A 4UQ9A 4PCKA 3B1UA 1OARL 15C8L 4AYID 2XRAL 4Q0XL 1XGUB 3DGGB 2WQUA 1AZCA 5D7IE 1GKEA 1XZ0A 2YPKB 2JSFA 1MLCA 4L2LA 3FO2A 3QHFL 3WIFA 1ZGLM 1TSRA 1H8SA 4OZIE 4R2GC 5HDQH 2IBZY 4HIIB 5LBSL 1NOAA 3WFCL 1C12B 1LWHA 3V0VB 5LCVH 2H1LM 1ZE3C 2VC2H 2VDMH 3OTTA 4DKAA 2R51A 2CO7B 2FJHA 4IBVA 2P8MB 4B95C 1MUJA 4A37A 4BQ9A 3PXJA 2EYRA 2Z7UA 4FYSA 5C3IA 2VR9A 4I77H 1I7UA 2W0PA 1DVSA 3ZIYA 2WXJA 4FLOA 4U7SA 5CCKL 1CVSC 5D4HA 2HT4D 1A6VH 5FM4A 2JJUA 3OKMA 1HL5A 2TRHA 3RJDA 2C4FU 1MCSA 5GXBB 3RVWD 2ZAGA 1JYXA 1M9SA 1M71B 5DEGA 3H53A 2X3BA 3A4AA 3NQKA 1OAUL 3MMEB 4GB9A 4LOVA 4WCYL 4G6AC 5HGHB 5I1LB 3CMGA 4H8HA 1YPZF 4HHAA 3IS0X 2A83B 1KIUA 1HS6A 4XP5L 3N42B 1NMAH 5B4MC 3GZPA 5DT1H 2NR6D 3SGDI 2VDPB 4TN9A 2OL3A 4G1MB 3H6AA 3TNNA 2X70A 4YPGA 3P2TA 2B9BA 2BS9A 1TKWA 4HETA 1SEBB 5B39B 5E6ZA 2EH8L 3EOBB 4UYQA 1K6QH 4M7LH 2YEZB 1DQDL 3FFDB 2IDFA 3KPRB 3TA3C 5CIPB 5EU6E 4KKAC 3VTTA 3QJFA 1QRNB 3OGCB 4B27A 1X6NA 2CHXA 4B3EA 5EZJA 4PBVC 5AYQA 1B0RB 3ROLB 3HA0A 3FHQA 5T1MB 2VAAA 1AACA 3S2AA 3QDAA 4UQEA 5HHOE 3QDMD 3MOBL 4YHOL 4HU2A 3D39B 1E8YA 4Z7OB 4ZUWB 1V55B 4KJQD 1KGWA 4JZJC 3WN5C 1R5WB 1IQWL 2Z92B 3MO1B 3MRMB 5AVZB 4PGCA 3FT1A 1MFEL 2WD0A 2BMKA 1AZNA 1YEHH 2VR8A 2YIHA 2VXQA 5FYKU 3F62A 2NNCA 3T0AA 2CALA 2IEPA 1KCVL 1X5ZA 2PUQT 1INQA 1SOQA 4WUKH 1I1AB 5DD3L 4KQ0A 3R8QA 2MCPH 4IOIB 3VXMB 1MIEL 3P30L 3MNWB 4K9EL 4N20A 2E7BA 1OW0A 1KGCE 4U1LB 3PGFH 3EYQD 4UT6H 1HDMA 4Y5VA 1P4LA 4LGRB 4D9RE 3BAYA 4J4PD 2EDTA 5CJQL 5FYJU 2VUOA 5BOZG 1BFVH 1ODAA 1XQ4A 4LLMA 4I5BB 2KI6A 3SJVD 5SWZB 1G7JA 5C92A 4FFVC 1ZHBB 3N85H 3ARFB 3PL6D 3TBBA 4AUYA 3QZWB 4A2HA 4JE0A 4UNTA 1T03L 1HKLH 5CP7B 1P5VA 2FZ3B 2LW3A 1A5FH 1CT8B 4IGBC 4IW4C 4OZIF 2XQYA 3OKKB 1WZKA 3HBQA 1Q72L 4PB0L 1VF5C 1E9QB 4RISL 4NUMA 4QCIB 1HX0A 5HBBA 2GSIB 4MGXA 1J0JA 3FONB 4YXLH 5TGBA 4GRMB 1RD6A 4LL9A 3O8XA 1NAMA 4UOW1 4U1HB 2FJSA 3GSQB 4CGTA 2JQAA 4QPEA 1W0WA 1A6WL 4LLQB 1YEEL 1B90A 2HFTA 1Y0LB 2WWKT 1MAML 2J55A 3N55A 2XOTA 2XWBB 3H42H 4P2QE 3ZHNA 2XQYK 1N5AA 3U7YL 4G8EB 3PP4H 4MJ6A 1Z5LB 4J3VA 3UBXI 2EIBA 1U93A 3B8SA 2WB1A 4ZO6A 3FZUC 2FL5B 3L7EA 5CNHA 3VA6A 5B8CA 4NZRH 1XO8A 2R23A 4HCGA 4YHIA 4GS7B 3OKOA 2ZONA 3T08A 4P23B 1LM8V 3UCQA 3WNPA 1U8HB 4HPHA 4K5PA 4JN1L 4B97A 4HSAC 1PZUB 2AXGA 2XZQL 2B0SH 3C5ZA 4WTZA 3T0WA 1EANA 3ARDB 1IGFH 3K2MC 3HG4A 1IUZA 1FH2A 4N2HA 4OCYL 2H2SC 1KB9J 1U91A 3SD5A 1U8JA 2C7FA 1C16A 3KDMA 4G83A 1U8OB 1YEDA 1B9KA 1VKXB 4MWFB 1KTCA 4M6NL 4X5WA 4YZFE 2FD6H 1L5GB 5LN4A 1TFPA 4N85A 4X7TA 3AMKA 2XYBA 3E2HB 2NQDA 1I4FB 1WBYB 3II2A 1AXSA 4WLCA 5FDWB 5LBGA 2QADD 3SPJA 1M4KA 4XMTA 5F6HI 2Z7YA 3Q2WA 4S10A 3M88A 1OSZA 1BBDH 4JPKL 5EU7E 2ZX6A 1WBZB 3HE7A 5J7CC 1CUOA 3H1ZA 3DHJA 4G6ML 4R7DA 5DR5L 5I9QC 4WI5A 1FVCA 1NPJA 1UWYA 1KJ2L 3LZRA 4RA0C 2JI2A 4EUPH 1CL7L 3ZDXB 3RRQA 3ZYZA 4XMKH 2AGJL 5DVKA 2PPAA 2IANB 3HBGA 4JRXB 4QJ3B 3V5DB 5ID1A 4NBXB 5LGKA 4PGZA 1KN4H 2FIRT 1SXCA 3KGUA 3L95B 5EO9A 5JHDE 4KUCF 1E5YA 4ICWA 1XGTB 2SODB 1QFWL 3E6FB 4WO4D 5I1HH 2F54E 12E8H 3PYCA 2NPLX 4HJ0D 2IBGA 4C47A 1ZK9A 2XPGB 1JRHL 4NOBA 1TZ8A 4KKNA 2DQIL 3P54A 4OLEA 3V4VH 4X6CA 2WBXA 3UJTH 1OO2A 2AJSL 1HCZA 2XKUA 2HVJA 2O93L 3PFQA 3P4OA 1ZWIA 4NLAA 2ADFL 4JFHD 1A3LL 4LSTL 5CUSH 5D7LB 2E6PA 4YHNA 1WF5A 3QIUA 3F12A 3ZDYB 4AT6B 1KACB 1DBBH 3MA9H 4Z95H 4P04A 4IJ3C 1JK9A 4AQ8C 4DEWA 5I66B 2C26A 4FJZA 3ULVE 4D0DB 1AD0B 3SCMC 3U0TB 2D3JA 3D07A 4I0PB 4ZX5A 2A3TA 2DYPB 2OXGB 1S4IA 2IVFC 1F18A 2X4NB 3CLEL 3ZUCA 4MAYC 4AGLA 3HMWH 5DUBB 1HOEA 4QHLB 4N0CD 4KJYA 4K94C 3EGSA 5CGYC 4K55A 3WUWB 3CFQA 3KPQA 3X3FH 4BHUI 1CR9H 5KVEE 4KXZI 5F8RC 3GIZL 5AZ2L 2YPVL 4HHWA 1NBVL 4HUKB 4EO5A 4GG6E 2EEAA 4HK3N 1XF2B 2IAMC 3QDJD 4QO1A 3B5TA 4QRBA 4ZXBA 2GB2A 3TN0D 5I8CA 1EFXB 2D3VA 1JPFB 2GC4C 2JKTM 5DA4A 3IDMB 2PWGA 4WNSA 5I5JA 3VFPA 1P1ZB 4PJAB 2E47A 3AG4B 1B2YA 3WEXA 2C3GA 3NG5A 3X11A 4XBPB 4BD4A 3BW9A 5KN5A 4JEGB 3NRFA 4IIQA 1GXEA 3U4KA 4OLUL 4X8JB 2ICEB 4AJVA 1G7LA 3VI3A 2H41A 5DRXA 1QLRB 4I2XA 3T09A 3TV3L 4U4BA 3B7YA 3L4ZA 4YO0A 4UM9B 3LOWA 5EZLB 3TVMC 1RZGB 1BBJA 2WLZA 4KVNH 5GJSH 5BZDB 2HYMA 4YZFF 3VFNB 2ESVB 4ZFZA 5IV2A 4JO4L 1JCVA 1S9WB 1SYVA 2R2BA 3RY4A 4KNQA 2HKHL 1UZ8B 1XR9A 1A6AB 1QATA 5GGRA 5GGTH 3SEPA 1ORQB 2YMTA 3SE9H 3DTXA 3CVBA 3ATBA 4BH7B 2LQRA 2XYCA 4G80B 1JUFA 2XQYG 1EJ8A 3BOVA 1V7NH 4ZJ9A 5IVXA 3SGEH 1SDAB 2OQJA 3E8UH 4KKLC 3WKMH 1SN2A 4TLTA 4U6VH 3DWTA 3MRBB 2ZX5A 1ZA6A 4NCC2 3GKWH 1MHPL 2ERJC 5J6SA 2DQFA 1E27A 1R47A 4LFHD 5CINL 4JPVH 2BVUA 1HNGA 1QFOA 1NANH 4BCXA 3CMOH 2CJUH 5BZZA 2ICWJ 5F1NB 1CXIA 4HCRA 4U1KB 4C56B 2R2HB 2NY4C 4PJCE 1EBAA 5DJXA 5CGTA 1CQYA 1GR7A 3FNKA 1CBVH 3MDJA 1T83C 4KKBD 1RFDH 4URTB 1XCQA 5DVPA 5C08A 4Y1AD 4CSTA 1HZKA 1DL7L 2AKRB 3KHQA 3SDXE 2UXTA 4FJ6A 1BD2D 1GRWA 3UTPD 2PYEA 4MNQA 1FNHA 4RGND 2NXZB 4GUQA 3TYFA 1A6ZA 5D93C 3IGAB 1X4YA 2A73A 4N1EA 5DMJB 3AQXA 4RESB 1K4DB 4Q4IA 5E8DL 1EAPB 5GGVL 3VH8B 5I8OL 4WTZG 1H6FA 1YPZA 4UT7H 3V52L 4TTGA 1GY1A 1NOFA 3IAGC 4F58H 3TA3A 5AW4B 4YFLI 2AJYL 4S0TD 5FUZH 3BVUA 3U1SH 2VLLB 1BFSA 3OLGA 5F7EH 1RK7A 2NZIA 1TLMA 4XPBH 3TESA 1MVUB 5CMAB 3G5YB 4X5PA 1YNLL 2DKSA 3HG1B 5G4OA 1WTLA 1G6RA 4UTBA 5PAZA 3COOA 5BJTA 3GRWH 3MCLH 1DE4B 1AGCB 2PXYB 5E70A 4ELDA 4ENEC 4JZJA 4J3WA 5GGUA 4UILH 3CVCA 3FUHA 1HSAB 3ILEA 1JXFA 2GT9A 1SN0A 5D6DC 1UOLA 2DMGA 2Y3NA 1KXTB 1ZV9A 3D87B 5SV3A 5K9JL 2EVGA 1CD9B 3KLQA 2DQ6A 4XP9H 3KGTA 5TDNB 5FAAA 4WI2A 1ORSA 3BI9X 4AIXA 1KC5L 2EYSB 4G42A 4QXGH 1GL4B 3OX8B 3QXDB 4OIBA 2W07B 1F6AB 1AY1H 3OXSB 2X4TA 3L9RA 5GS3A 2C3VA 3BUTA 2YXWA 4TNEA 3UJIL 4DAGL 3C9NB 5LAXB 1MFAH 4LSDA 1FN4B 4GAGH 4QRSB 4WKXA 2O5YH 4M93C 1RVFL 3IRZA 5AOLA 2F5AH 3ZT5A 4FLSA 4DK5A 5KVEH 3OAUL 2WO4A 1TCMA 5JOEA 4M5YL 1Z0MA 5EC2B 4QRUB 1SZNA 4NNPL 4JM2D 1B0WA 2CDEA 3NH7H 2LVEA 2AEIT 1S5IL 2NX5A 1LHZA 2OYLA 3VXTB 1WAEA 2L7JA 2XTJD 1HU8A 4U3SA 3CSYB 5C2BH 1MRFH 4ODXB 2A74B 4GKOA 1BV8A 5JXAH 1JG9A 4NAJA 2V5TA 4IS6A 4YDJB 5TE7L 3PIQB 4YBHA 2WANA 1U3HB 1LD9A 1T1ZA 3LMJH 3P73A 4N4YB 3WNNA 4DO6A 5FPIA 4JDZA 1A7QH 1E4XH 3EBIA 2O5XH 1E5BA 1FG9C 1T7ZA 5HHXL 2CZNA 4M02A 5T5FA 4OCLC 3M8OH 4QY8B 4OQ1A 1OARH 15C8H 2V33A 2XRAH 4LP8A 2YGPA 1A21A 3QHFH 4ZSOE 4QNPE 4MD0B 5GGSY 3P02A 5KTEH 4XMPL 4QRRE 5F3HA 3OZKA 4OGYH 5E08L 4PIRF 4G9FE 3QCTL 5LBSH 4QD2E 3SODB 3QSKB 3WFCH 3L9BA 3REWA 4I3GA 2AQ2A 2FGZA 1EAJA 2CUAA 4YBQC 4LCUB 2OX5B 2VLKE 5IBUG 4BWTA 1CXHA 2YAPA 3UEZA 1OGPA 1KTLB 3NSDA 1FPTL 3QNXB 3GD1C 1JV2A 3ZZLA 1MDAA 3FQTA 4Y2OB 5FFGA 4DKFL 2CJSA 3BSZA 1T7YA 5DWPA 5CHNB 1FYHB 5SWSD 2FGWH 5K39B 3MFFA 3NJIA 4L1HA 5T5NG 5D1QB 3MGAA 2IGFL 1A7NH 1B4JL 1SLUA 5F88B 5CCKH 4PAZA 1M6OB 2KMWA 4LLYB 3OAZH 2ZF8A 4U05A 4HGKC 2AVGA 5FEBA 5D6CB 2CUHA 1NGYA 4NPKA 4KV5E 5CKGA 2NMSA 5EO1B 4QRFA 3NK3A 2FX9H 4IRSC 4AKOA 1E4HA 2AK4E 2VITB 2WWNA 3CBJB 4L1DA 3DX4A 3D0LB 2YLKA 4PBWD 3OG4B 2ITDB 4JHAL 2AV1B 2BOCB 1ZV2A 4WCYH 2XY1A 4H7VA 3DIFA 2FNWA 4JUTA 5F97E 3ARZA 4WJ5A 4NKQB 3N43B 3AW5A 3QUZB 4OJFL 3TO4B 5DUPL 3V0WL 4KNTA 2FWOB 3MRNB 3A21A 1WV7T 3B9KB 4WJKB 5D55A 2KZBA 5I75B 3RWIA 2JFCA 3DVNB 5F7AA 2P28B 3IVKA 4NT6B 5CJXA 4KH2A 3VFGL 4UCFA 4UQ2B 3J27A 2EH8H 3QEQA 3TF7C 4B53A 3SY0A 3EO9L 4N8VG 3WNJA 1DQDH 5E03A 4PJ7E 5DMIL 3RLSA 3RUGB 1IGYB 3C08L 3CFKB 5E6UB 5BOJA 3HZMA 5EORL 2H4EA 2XQBL 4L5FL 3ULSB 2C7UB 3QZPA 4OW6A 2XWDA 4K9EC 2EAEA 5HPOA 3H9SE 1QVOB 5AW8B 5JO5A 1DLHA 2F53B 2W0LA 3MOBH 1S5HB 3MV9D 2IBZX 1XB8A 1YG9A 2Q86B 4Y7MA 1MFEH 4PRHA 2CWRA 1DHKA 5DVNA 3IE4A 4PJ6A 4Y88A 1QLEL 4LPUA 3KR3H 4HU8A 2X3AA 2D7NA 3TWYA 4DPBX 2NSQA 3CXFA 4MAYA 5DD3H 4F2MB 3LRKA 5H94B 3S36X 1A4JB 4QKXB 1QD0A 2VMCA 1MIEH 3P30H 1YAZA 5F6HJ 1ROWA 4XNYH 3EG9A 3ARDC 2CGYA 3GEWB 4OFQA 4JDVB 5E51A 4ZMLA 3L3DA 4WKZA 1YYLH 4UM8A 4BGDA 3IDXL 3E9TA 1UQSB 2H3NA 5EEVA 2IAMA 5IW6A 4QRQA 5IQNA 3RWJB 4ZMXA 1JYVA 1JGUL 3CZUB 3EFFB 5DQ9A 3IN2A 1A4KB 3FT9A 1HHIB 2OJEA 2QZQA 5IB2B 2BNUA 1T03H 4X7SL 5KG9B 5ALCL 1UT9A 4LMQE 1AE6L 4X8GA 1OPOA 4ZUSA 1UC6A 3S3SA 3NTCL 3CFMA 3TIDB 4PB0H 4RISH 4JVWA 3WUZA 4K23H 3VGHA 2OMYA 1QUPA 1QLFB 2MTAA 4NX0A 5IB3B 2WAQA 3ORJA 1DVYA 1TENA 1E2VA 1LP9B 1OHQA 1HHGB 1S7UA 4YQXH 1QSFB 2VM9A 3JTSB 4AVKA 1KOAA 2Z3FA 1A6WH 1YEEH 3ARED 3IM1A 3RWHA 4NQVB 1XH1A 1SLVA 1FH5L 5DRZA 3KVQA 1MAMH 1KPVB 3F58L 2OULB 2LGNA 1Z32X 3EOAB 3U7YH 4PCYA 4BCYA 3MUGB 4GMTH 5C2UB 3IJ9A 3ZYIA 3BZ4B 1Q4NX 3MVSA 3NAAH 1VENA 4OD3L 4XNQB 2AZUA 2WPGA 3MLVL 5CFAA 4H20L 4M4RB 5HVHC 1JXJA 1UCTA 1QFUH 4KK5D 4XCEB 1XEUA 3RIAF 3RA7L 1HWHB 5TE4H 4JN1H 5J9PA 3BPNB 1DO5A 4BFJA 4Q6YA 4BUGA 1S9VA 5T1KD 5KBDA 1RZJL 2XZQH 4JY4A 5IHUL 5GGQL 1PD1A 2XPZA 3QS3A 4D8OA 2BVTA 1W15A 3VFRB 1FFRA 3GPSA 5DJ6A 3FU9A 2WK2A 2APFA 2A9AA 1Z3RA 3T6XA 4F1ZA 1G6VK 4M6NH 2P49B 4AYSA 1I9JH 4JFQB 4ZMNA 2VRKA 2H32A 3ARGB 4XVUC 3AUWB 3QARA 4I0KA 1M05B 3QFDB 1JWUB 1OGTA 2GCYB 5D7JB 3QH3A 4JPKH 3BRGC 3F7QA 1YEJL 3MBXL 1WCBB 3BIKB 4HUCA 4S11A 4G6MH 5DR5H 3GI9L 3GXMA 1WJ3A 3NRQA 5F7NC 4FQCL 3U36B 2CBPA 2R29L 4H8VA 1KJ2H 1Q1JL 4FNPA 3WEAA 4CW1A 5TK2A 3OLIA 3LHAA 3NFPB 4NQQA 1CTOA 1D5XA 1OGAA 3GJEB 5ICZA 1KNOB 5JA8B 3UAFA 5MENA 5SWQB 3BFWA 1N7MH 3NABL 4MCNA 2B7DT 3C2AH 1KG0B 4MNGA 3V0EA 5KAQF 5IOPB 1JYNA 1KMGA 4AQEA 2V3DA 3DXAA 3GUTB 2FJGB 5D96B 3HB3C 5FR3A 2J2ZA 1QFWH 1ML0A 3DRTA 3JWDH 2PTVA 3IDNB 3M1BB 4J7RA 5EBMA 4H0LC 4PRIA 4PVNA 2Q0ZX 2XA8H 3QCVL 3APCA 1A9BB 1AMXA 3K8MA 3L1EA 4KY1H 4DPAX 1ACYH 1E90A 1RY7B 2DQIH 2P8LA 3K6DA 1JZ7A 3N1QC 1WGOA 3MZTA 2AJSH 5DSCB 4TQHA 4HISA 5FS5A 2CAKA 4XNZC 1EO7A 5F1OB 1JN6B 1XGUA 5D6DA 2WLKA 4AV0A 3FT4B 3V0FA 2YPKA 5I5MA 3NK4A 4N6RB 1A3LH 4AGQA 4BUQA 4HIIA 4PRNB 1KCSH 3DO3A 3QBTB 1H8OA 1C12A 4NJ9H 3V0VA 3CXDL 4MZRA 4RFEB 1NIDA 3B2UD 3HE6C 4LAQL 2CO7A 2Z1KA 3QUKB 2Y6SC 3A4EA 2P8MA 1BJ8A 3O2DA 4KKZA 1OGSA 4DP2X 3CLEH 5GRWA 1FV1B 2CLZB 3BPOB 5AVVB 1TJXA 3D06A 3F01A 5I1GH 4YSSA 2DBLL 1VGEL 2QFPA 5B3JF 1IU1A 4XGZB 3GIZH 1JP5A 1XWVA 2YPVH 2FHBA 1NBVH 4N0RA 2H5UA 1YC7A 4NQDE 4WW2F 5G4MA 3D1MC 3X13B 4L9LB 5C0NC 3KYOB 4LPYA 3S5LG 1M71A 3LPWA 2WUCH 4OBSA 3Q1SH 1BJ1H 2APXA 3MMEA 1ADQA 3BLKA 2CGRL 4ZMZA 1KYOJ 5HGHA 5I1LA 4JB9L 1F1AA 2R7EB 2LFGA 4UMSA 2K6WA 2HKFL 2A83A 1GYWA 4ZW3A 2LT9A 4JKWA 4OZGE 1H3VA 4BFIB 3FTGB 4G1MA 4LLWB 3QZLA 3QEHB 4ISVB 2NXZC 5JOFB 1D9KC 1FO0L 1T89C 2L8AA 2C9PA 1IBDA 2DQDL 2GFBB 3UDWC 4L9DA 1SEBA 5B39A 1BQKA 3EOBA 4BKTC 3WLWD 2YEZA 2OBGA 3CSPA 4AW7A 4GEJA 1PVHA 4GINA 3FFDA 4ICXA 1X5IA 1NEZB 3KPRA 2EIKB 5CIPA 2ZUQB 2GI7A 1QRNA 3OGCA 4JO4H 2HN7B 3OB0K 5BRZE 3FT0A 3WIHH 1H3TA 2HKHH 1AGEB 1JPST 3FSWA 2XVKA 1B0RA 1G7IA 5T1MA 3ROLA 4LVHC 3QJTB 2NTFB 4X50A 4UTAL 4P5SA 5EUOB 1IVLA 1LQSR 4Q6IC 3TBYB 3ZL4H 4X4YA 3D39A 2PXYC 1NCNA 4ZUWA 5KBNC 3EJYD 1R5WA 2Z92A 1YYMH 3CG8A 3MO1A 3MRMA 4AK2A 2X09A 4PP2B 4TPRL 1IV8A 3O8XD 3K81A 3M17B 1JTTA 3U30B 4LCVA 1MG2C 3D9AL 1SXBA 2WCGA 1I1AA 4JJOA 5BMFL 1MHPH 1WT5C 1W8OA 4IOIA 4MB3A 3VXMA 4AQAB 3MNWA 5CINH 5CCGE 1T2JA 4U1LA 4YS4A 3QQ3B 3PE9A 4GH7B 2A9CA 1DVXA 2PO6B 1U3YA 1HTYA 2OMNA 3BDBA 5EV7A 3TASA 2Y0SA 1YUKB 4I5BA 5B1JC 5SWZA 1JF5A 3CHXA 4F1SA 1ZHBA 1AR1D 1HXKA 3ARFA 3QDHA 4NN5C 2EP6A 3QZWA 4KHTL 4FTVB 4I9WE 5LXVA 3DETC 4XX1G 2ITCB 3JV4B 1DL7H 1NPNA 5CP7A 2FZ3A 1CT8A 4QHKJ 4PS3A 1YECH 4NBZB 4TVSa 3NFSH 1ZMYA 1BYNA 3LN5B 3OKKA 3RPIB 4M8UA 3SDCB 3C5ZD 5LLIC 1E9QA 5E8DH 4QCIA 5GGVH 5ESQB 2GSIA 4KKCD 3FONA 4U6YB 3L16A 2YBGA 1V7ML 4GRMA 3V52H 3NJXA 2HTLC 3OBAA 3W9DB 4N2CA 3EJQA 3GSQA 4U1HA 2AJYH 3PHQB 3EIFA 5DQJB 5FUCC 3K8LA 4LLQA 3ZW3A 1QBLL 1U36A 1Y0LA 2H6PB 3D69B 1GMIA 2X1WL 1KJ3L 3H4FA 3WFDL 1QHOA 3T0ED 4A6YB 3KS0J 1D6VL 3WLBB 1J86A 2XWBA 2EDYA 1YNLH 4K3EL 5DF0A 3UPRB 4N9GB 3K2KA 3SOTA 4G8EA 2NW3B 3VXOB 4J6IA 1Z5LA 2HX8A 1GA2A 1CLVA 1U21A 2CXGA 3W0WD 4R4BB 3NJNA 4MXVE 1BLNB 5D71H 1KENH 2WQWA 1PJWA 3B37A 3PQYB 2FL5A 3HE7D 4A68A 3AGVA 4TLSA 1LEIB 3H3PL 4C55A 1SN5A 3DHPA 1A7PH 4Y4HD 5D5MF 3LH2L 5ENWB 4BSVB 1DBML 2KBGA 3QW9A 4P23A 4TSCL 1U8HA 2LR4A 4OFKA 1HWGB 5D1ZB 4FC3E 4LIQL 4PY7B 1YNTB 3THMH 3ARDA 3UJIH 4UV7L 2J1KA 2C3XA 4DAGH 1SPDA 3T3ME 4OZGF 4HLZG 2EVHA 5BXFB 1G7MB 3LKRB 4AEIH 1XTMA 2HRPL 5A6MA 4PWKA 1Z1WA 5LGJB 4HKBB 5DJZB 1VKXA 1U8OA 1RVFH 5IMKB 3PNWB 4MWFA 3WE1A 5CZXC 1L5GA 2R9HD 5D1QC 4E9YA 2ZQKA 3OAUH 3V9FA 5C07E 4LOFA 4M5YH 1I4FA 1WBYA 4YNYB 4CVUA 5FDWA 5CJOL 4NNPH 4N2KA 3IMTA 3TO2B 4WNQB 3S35L 4QXUL 1I7ZB 2WYZA 5E0QA 1S5IH 3W82A 1XD1A 3LN4B 1WBZA 4PY8I 1E3ZA 3RWFB 4KNUA 2VR4A 1ACCA 2EDJA 4LARL 3BE1L 3PABB 5ICXB 4FTDA 3M1OA 2F2HA 2IANA 2VLRE 4MZ3A 4JRXA 3TO4C 4HS8L 3V5DA 4X7EC 2D3NA 1IAOB 2Y2TA 3ZE0B 4ADIA 1EO5A 3L95A 5IHHA 2X6UA 3B9KC 3QIWB 1Q0XH 4JPQA 1XGTA 5FA3B 2X2IA 2DQCL 3E6FA 1BLIA 3KCPB 1XCXA 1Z9NA 3LY6A 3ZTCC 2KDGA 1GIGL 2XPGA 5F7HA 2N7SA 4A2GA 4XMPH 4AGNA 4GKZB 3O4OB 1J48A 3P0YL 5EC1B 1A0QL 1PZBA 5MERB 4Y2DB 1J88A 2DLIA 5I0VA 5D7LA 3LXUX 1J8HE 2IDQA 5E4EB 5J3HC 4YHMH 5CU9A 2ZOTA 2WHVA 4WUUE 4AT6A 5DUMH 3VI3E 5F9JB 1G7QB 4FZEL 4Q9BA 4I2XE 4AITA 5I66A 1YNKL 1IM3B 1Q9KB 2XWRA 4PJFF 4D0DA 1AD0A 3VUAA 5A6IA 3U0TA 3KYNB 2IGFH 4I0PA 2ZUTA 2OXGA 2DYPA 4R5XA 4HIHB 1Z3GH 4XXDB 4AYMC 2X4NA 1KDIA 1B4JH 3MROB 1ACZA 4WFGE 5DUBA 4ZOEA 3ZO0A 4QHLA 4E41B 1R3IH 2YAOA 3WUWA 5I1CL 5B39G 3GDBA 1KYUA 2YARA 2YJQA 4R2GD 2F1BA 5K1VA 4DPRA 3HAEG 4HJJL 5KW9L 3O9WD 1RUKH 1XF2A 3EGXB 2BRRL 5B3NA 1D7BA 5E5UB 1EFXA 3U2SB 4MXVF 3VQ1C 1JPFA 1NEUA 3IDMA 4ZX3A 1U8PB 2A6DB 3OR7B 1P1ZA 3L3JB 5DUPH 2GYSA 1TZGL 3NFNB 4YLQT 1PFCA 1BCIA 1C5CL 4ABWA 1Q38A 1TTRA 4XBPA 5J1SC 5IHZB 2Y6TE 1QMUA 2P9RA 3L4XA 4J27A 4NCC1 3JWNE 4HZAA 1UZ6E 2EIEA 4X8JA 1CLOH 2ICEA 2Z64C 2FO4B 3R06B 3T1FB 4NLHA 3EO9H 2X53A 3T6WA 3TPUB 1QLRA 5DMIH 3WEMA 4UUJB 4YHKL 2BZDA 4UM9A 4FKKA 2ZXWB 2Z91B 5EZLA 2LU3A 5EORH 1KXQA 1RZGA 1ZXQA 3VMNA 5BZDA 3ESMA 3VFNA 4L5FH 1HINL 2EEXA 4TNWF 1JS4A 2ESVA 5AL0A 2WZPD 3RDTD 4G6AD 1GGCL 5C08E 4RWYH 2DWTA 2EDNA 5KSBB 2PR4L 1S9WA 3CVHB 4NUPA 3TBWB 1EXGA 4MJIB 4X5RA 4Y9FA 1UZ8A 4MNQE 3SDYL 5B4MD 4RBPK 3PAZA 3HE6A 2D7QA 4HT1L 2OMVB 4F37K 1ORQA 1PU0A 1CDGA 1QLEH 5AOKA 2BCMA 1NCCL 4BH7A 2QTVA 2HA1A 4G80A 5HYQB 3ZQWA 3BPNC 4Z7VF 5KVMC 3CFIC 35C8H 3MX0B 4NWTL 2I9TB 3ARPA 4L4JA 4YIQB 4JM4L 3TA3D 3MRBA 4AEFA 4KKAD 3BLBA 3ERXA 4QXWA 4Q14A 3IDXH 1JGEB 2E9IA 4MVBD 5DC4B 4LBEB 1JF6A 4N86A 3HNTL 2QVKA 3QEUB 4XMWA 2B9AA 3EYSL 4LEEA 4DGIL 1SOXA 1B4TA 4LQFL 5F1NA 5E9AA 3RFZC 4U1KA 4C56A 2R2HA 5HD8C 1HE8A 3OQ3B 5ALCH 4KHXH 2VZ1A 2GIYA 4HK3J 3NTCH 2XWCA 4BWWA 5I6LA 4JRYD 2LHAA 3TFKC 4Q9RL 4MLIA 1ZOXA 2IWGA 2AKRA 3QPQC 5HI5C 1EJ6A 3IWVA 2XETA 4WK2B 1K72A 1JNLH 4MMZB 5H4YA 3IGAA 3UDWA 1ESOA 3FUDA 3VH8A 1K4DA 1EAPA 3HNSH 2ZSWB 1GC1L 1W0YT 1FH5H 1JI1A 5CR1A 4JFDD 1NUGA 1RZJC 3U6XA 4AQZA 4FFVD 2F58H 3QZMA 2VLLA 3LIZL 2L7UA 5D96C 1ZHNB 3F64A 3QDGD 1MVUA 5CMAA 5AB9A 2WC7A 5EF1A 1EHNA 3G5YA 4GFXA 4GQPH 4KO7A 4P8QA 2NQ3A 1C1EH 2RJMA 1F1GA 4OD3H 5EBWA 3VO0A 2NX5E 3MLVH 3HG1A 4IGBD 4H20H 3OPUA 2G4EA 2DEXX 2CK2A 1U33A 1YC8A 3LQZB 4PWIA 1DE4A 1AGCA 2LU4A 2PXYA 1RUQH 1HCYA 3GMMB 3IJYB 3RA7H 2DQGL 4UMGA 2XJKA 1HSAA 1KXTA 5IHUH 4JFFB 5GGQH 5DA0B 5HHME 2AJZB 2WTRB 5TDNA 1ZLUK 4XAKE 5FX3A 4KMTL 3U9UB 1WT5A 2BH0A 1JPEA 3N0AA 2EYSA 4J2XA 1DSWA 1SJEB 5CP3A 2O30A 3OX8A 3QXDA 4OIFA 1RK0B 5HDBB 2W07A 1F6AA 3CBKB 3OXSA 5B1KA 4K71C 3F7RA 5LAXA 1UZ6F 4KOBA 2XFXB 4X5QA 5B1JA 1FN4A 1IC4L 4QRSA 2E74C 1QI4A 3BPOC 3FZUD 4FG0A 4WFHE 1DN2A 2R83A 2BSSB 3GJFH 2D7TL 2ZP8A 4ZAKB 3T8MA 5HYSB 1I8LA 3FPYA 3K6IA 3MBXH 4W9LC 5EC2A 3M46A 4QRUA 1UURA 2WXOA 2X05A 1RV6X 3GI9H 4FQCH 2R29H 1EHXA 1Q1JH 4UBDC 4DP9X 2V7NB 4Y89A 4GG8B 3VXTA 1LNUB 1BZ9B 4PJXB 4ALAL 3CSYA 4LHUB 3ILQC 3NABH 2H2SD 4ODXA 2A74A 2E0PA 3HI6L 2ZG3A 1UWXK 3QWQB 4YDJA 1U42A 3KDPB 3GMPB 5E1HB 3MRHB 3PIQA 3JWNH 3WU1A 3HG0A 3GTNA 1U3HA 3K4DA 4XO4A 4K73A 2UWEB 3QCVH 4XPTH 2VAJA 4Q2ZB 3I3DA 5AW2B 3SE8L 4HCRH 3NJLA 3VACA 1J8SA 3S2CA 4QY8A 3BDYL 5J12C 1OCZB 3MRJB 3WUWG 3VD2A 3GMQB 5GHWL 2J71A 1LL1A 3KL0A 3FMGH 3HS0B 3I9PA 4MD0A 4HOXA 3CH1B 3LHPH 4MDRA 4X4ZA 4PGJA 1W72L 3CHQA 2X4PB 3PUUA 4KI5E 4F9LC 3HHSB 1AZRA 3N1FC 3CXDH 4UQDA 4LCUA 2OX5A 2R56H 5CJ8A 3ABMB 4LAQH 1KTLA 3QNXA 1IJ9A 3VFTB 4TM9A 1QQDB 1N6QL 4JGNA 4YEEA 3GSNB 4Y2OA 3UYPB 1M1XB 4YHLL 5EBLB 4UOZA 3PV7A 5CHNA 1JYWA 3QEQD 5K39A 5I73B 3PWNB 4HJTA 4WNJA 3U2JA 2PTTB 5D1QA 5CGMA 1F8TL 3K6SB 3MJWA 2BFVL 1Z5YD 1VGEH 2EO9A 4HWBL 3U30C 3MACL 2IOMA 4TSAL 5F88A 3UAAA 6FABL 1M6OA 4KUCD 4LLYA 4ZPVB 5KAQG 4RMQA 1MN4A 3DJ9A 3ETTA 4UTBH 5D6CA 5EO1A 3NYKA 5HTSA 3K46A 2VITA 4PPTA 3DROB 3FCBA 3KJ4C 2PO6C 2OR7A 1M2VB 2ITDA 4PRHE 5E4IA 2PNDA 2AV1A 1HH6B 1P7QB 2BOCA 2CGRH 2RH0A 1OANA 1OLLA 2ICES 1QAWA 2L7EA 4JB9H 4LL4A 3SCMD 2VN3A 3TPKA 4OZHB 1MWOA 2HKFH 3QUZA 3TO4A 3M07A 1V10A 5C09D 1SDYA 5I5RA 4ABQA 1Q9WA 2FWOA 3MRNA 4MAYD 3DX0A 4L3EB 2CBQA 3B9KA 2BVQB 4EXPX 1BF8A 3BUQA 3DVNA 2DKUA 5CGYD 1OSEA 2FJFB 1QSEE 1X7TA 2BP5M 3QI9B 2BSBA 1AO7D 2DQDH 2EEBA 4NT6A 3SGEI 3OC8A 4U1NB 4UQ2A 4HD5A 3S36H 2HP4A 3AROA 5KZCD 5ERWB 3ET9F 4JY5H 3RUGA 1IGYA 2IAMD 3CFKA 3RY6C 1YY9D 3HZYB 5DHXB 4F57L 3ZLQC 3BWZA 2C9AA 1NANI 3CN2A 3ULSA 2C7UA 4HHGA 4JG0L 4UTAH 1OCCB 1QVOA 3O3AB 2F53A 3IDYC 1HQRB 1S5HA 4YOKA 4YC2B 2Q86A 1FVEB 1YNTF 1PD6A 4BZ1A 2GITB 4ACTA 4Z7UB 5DFWH 3GRGA 3JYCA 3CZKA 4WTWA 1R75A 1QNZL 2BP0B 1J0ZA 3KLAA 3D9AH 4QT5B 3HHMA 3LPPA 2EH7L 4QYAA 3P0VL 4F2MA 5H94A 2P26A 5TFSL 1A4JA 3TVMD 3HHRB 4I3RL 5D1ZC 5L2KB 5INDB 2GBVA 2YFOA 4DUXA 4JDVA 5IP4A 4Z7QB 1AKPA 1UQSA 3RWJA 2X10A 4JHBA 1NSNL 3EFFA 4XI5C 1A4KA 3I75B 1HHIA 2QKIC 5IB2A 4KHTH 1QR4A 4XHJC 4JPIB 2WB7A 1SHSA 1SYSA 3B6SB 4HZ1A 5KG9A 1FFQA 1CB4A 4DK3A 4YL4A 3ETBF 2WQSA 2DYRB 3TIDA 2EDXA 1XGPB 3CDYA 4MFHA 4KKLD 1SLXA 4KI5F 3U6XS 4N2DA 1CLZL 3KEHA 1QLFA 3AAZB 1T0OA 4A7GF 5IB3A 1X5AA 1V7MH 1UD4A 3N44F 4L3FA 3PFUA 2GY7B 1LP9A 2DQJL 1HHGA 3F05A 3LV3B 1QSFA 3JTSA 4LLAA 1UM5L 2DICA 1G9HA 3U4BL 3JWOL 2R0ZL 4PGDB 4NQVA 1ECZA 1F2XK 4K4KA 1KJ3H 4YSRA 3WFDH 3TT1H 2WLLB 1KPVA 2NY4D 3Q1EA 3QUYC 5EEUA 1Q94B 3EOAA 3S4SB 3FB7B 1G7PB 4Y0GA 3ZUNC 3QIWC 3MUGA 2HJLB 2COVD 5BS0B 1DQQB 3BZ4A 2JI1A 1PW3A 3QO0B 4EDWL 3NZUA 4J3SA 1PJ9A 1CI3M 4XNQA 2NY6B 3ZVVA 4YSUA 2P45B 3OGOE 4I18C 3PPSA 2P1YA 4M4RA 5AEAA 1SHMA 1OGAE 1T66C 3T0BA 3B9AA 4XCEA 4UOJA 4DT2A 3LH2H 1RSFA 5EEWA 4TSCH 1F97A 1RPKA 4MNGE 4UB0H 1UFUA 3O4OC 4Y1SA 3ZGHA 3AY4C 3DXAE 2CHDA 4LIQH 2P8PB 3DGCR 4FQIH 4FQLL 2R69A 3D18B 4UV7H 4HWEL 2H26B 2K9FB 5CSBA 3W5MA 4PRIE 3VFRA 1CO1A 1PSKL 3QXWA 1I1CA 5I5IA 3Q2LA 4RH4A 5IT2H 2IJ0C 1F02I 4BRVA 4FI8A 5CO1A 4GEIA 4TNWK 1DN0B 4JFQA 4CNIB 3ZHKA 1E4XI 3ARGA 3DV4B 2JQZA 2X88A 4ENED 5CJOH 4XN8A 1M05A 5KOVC 1QYGL 2PWDA 2V9UA 3QFDA 4OLXH 4QXUH 1JWUA 1ZSDB 2GCYA 5HGAB 2JCCB 5D7JA 1S9XB 1W80A 5FYJL 2XX0A 2J8OA 1IC7H 1WCBA 2JB6B 2RQ8A 3BIKA 4RWHA 3U36A 4AM0Q 4E68A 2H7WA 4HMCA 3TCXA 2O6EA 4XNBA 4LARH 3BE1H 3PF2A 1WZMA 1BIIB 1V54B 3NFPA 4JLRB 3GJEA 5CSGA 1KNOA 3A4FA 4LB8A 3VXRD 5SWQA 2JKWA 3FAWA 5HGBB 4HS8H 1BF5A 5B3SB 1KG0A 1PGRB 4MQTB 2R1WB 5IOPA 3GUTA 3G6JB 1FZJB 2FJGA 4YWGL 3WTWA 1PZ3A 3IDNA 3F8UB 3M1BA 3MTRA 4AC2A 3GMOB 5AYUL 2A0LC 2FYVA 2CHWA 5CLZA 1A9BA 2HFFB 3H85A 4Z6AT 4XCNB 2JV6A 5FKPB 4XMLL 3WAKA 4ZOCA 1F11B 4GAFB 4NS0A 5DSCA 5FOBB 1BQ5A 2MQ3A 3GUFA 3P0YH 4OLVL 1JN6A 1A0QH 1QEXA 1IC5L 3FT4A 5HP5A 4N6RA 4YBLB 4A7QA 4MAZA 1DVQA 1CK0H 4PRNA 1IGIL 1VFBB 5K9KB 4CA4A 3V5HB 4FZEH 5DLML 1IBFA 4RFEA 5HDOA 1DO6A 1JZHA 3QUKA 4YDIL 2E6JA 3MKGA 1CF1A 4PU2A 2X4QB 1C7SA 1FV1A 2EDHA 2W38A 2CLZA 1S7QB 4FQQB 1NUDA 3OLDA 2IPTL 2VDLB 3O6MH 3H2QA 4TXVB 2ZCLL 1QRNE 2FQGA 2ZWLT 4FXKC 4IRJC 5CD5C 1FL3B 3IPEA 2V5YA 2AFNA 4XGZA 4BKLB 4HJJH 4YGAB 5AAWC 2WSDA 4JGUA 1HZHL 3GXPA 2ICWB 5AZEL 1AANA 5J13B 1OSYA 4JKKA 2BHUA 4J6RL 4YBQD 2J5LC 5E0FA 4W6WB 3X13A 4L9LA 3KYOA 3VG0H 3DDFA 2R0KL 1T20B 1TDQA 4JO1L 3D39D 3CFEB 1MWAB 2YAEA 1S3KH 1ULVA 5FYLL 3WKPA 2O61A 2R7EA 3KW7A 1OWWA 4QF1B 3FT2B 4G72B 2FRGP 3N0PB 4BFIA 4MZ2A 3FTGA 4WEMB 4LLWA 3QEHA 1ZVNA 4MMZC 4OLYL 3VGDA 4ISVA 5JOFA 5LJYH 3GF8A 3VXMD 2X2HA 3VMOA 4YHKH 3AB0B 2DI9A 2GFBA 4IRSD 1UXMA 1HXMB 1LQBC 5F8QC 2YWZA 4PJBB 5BVPL 5K1NA 4X6BB 3JVGC 5I6PA 4I89A 1L7TH 3B2PA 2GK2A 1NEZA 4RZKA 4XO3A 1BDYA 1MHHB 1ADWA 1KBWA 5SWZD 5T1LB 3K72B 4KTYA 1GGCH 4ZK8A 2HN7A 4ZMVA 2PR4H 3NZSA 3W2DL 4KXDA 4F9LA 4M1DL 1GGBH 1AGEA 5EU5B 4OUOA 1DANU 3SDYH 2ZG2A 5EOCL 4RMRA 3CPLB 2NTFA 4HT1H 4TQEH 3EBGA 4OTXH 4DP5X 5EUOA 3TBYA 1XMEB 1MCCA 4HULB 4WV1B 3R4RA 3WFZA 4H8QA 4AMXA 4J5VA 4WI8A 4PJ8C 1AD9B 4UV4L 1N19A 4Z8FH 2YAQA 3IXTB 4PP2A 3P2DA 4WWID 3P77B 1H5BB 2WNWA 2YKLH 3M17A 4E0RB 2GEEA 4F7EB 2CO6B 3JSSA 4Y19E 3QO1B 1RJYB 2C9RA 4AQAA 2YAHA 2FX8L 2X4SB 3Q2NA 3HNTH 2VMDA 2E7MA 4N2NA 3NJFA 3WGVB 4XOAA 3QQ3A 2J4WL 2PO6A 4LQFH 4PJ5D 5C7XL 1J5DA 3R19A 5IQ9B 2ZXEB 4K3HA 4DO5A 1WITA 1ZDSA 1GC1C 3AM8C 1T22B 5E8PB 4HK0B 4DJMA 1JJUA 5K9OB 5BW7A 2B16A 2H6UA 3WSQL 5CEXB 1VDGA 4JVPA 4EI0A 5EB9A 1QBAA 4FTVA 4Z0XB 1MCQA 3C8HA 4ZAKC 2WVUA 5E2WH 2ITCA 3JV4A 3MN8A 3A22A 5I1JH 3F3HA 1TYJA 3LN5A 3RPIA 3O11B 3SDCA 5DO2C 3ARDD 3U46B 5ESQA 4U6YA 2JJTC 2QBWA 3PL6B 3CFUA 4HWUA 3Q06A 3RY6A 1LO4L 1Z9PA 4NFDA 3PHQA 1PKOA 5DQJA 1N67A 3AS0A 3LIZH 4CMHB 1MI5E 2XHNA 3BGFB 2H6PA 3MOAH 3D69A 4A6YA 4LSPL 3BT2L 2VTFA 4GP8B 2VKWA 4Y9EA 3WLBA 2I7OA 5DZAA 4A7SA 3UPRA 4N9GA 2JTDA 1OAKL 2FEJA 4YDKL 2NW3A 3MLZL 3VXOA 2B1AL 3SDAB 4R4BA 2OZ4A 3FTVA 3DVGB 1BLNA 4TVPL 3PQYA 4XN2A 3WNIA 7CGTA 1OY3B 4IKLA 1IEHA 4JMXA 1LEIA 1TOXA 4LLVB 5E6RB 3HS0C 3CN0A 1OP3H 5ENWA 4BSVA 5FO9B 1N26A 4JRXE 5M7QA 4B5ZA 5EWIL 1AOZA 1CL7I 1P53A 3MLTB 2VDPH 4KMTH 3V4PB 3Q9PA 4ZUUB 1YVLA 5D1ZA 2IAND 3X2QB 4NQCD 4PY7A 2QSQA 1YNTA 3G6DH 4K5LA 3NEEA 4ANWA 4HCFA 1HE7A 4Z76B 4MXQC 1F45A 1TJMA 2VLKD 5EZIL 2XG5B 5BXFA 1G7MA 3LKRA 2ZCHL 4Y16C 4ALAC 5LGJA 4HKBA 1QFWI 5DJZA 5IMKA 3PNWA 5I73C 4GJTB 3QRGH 1WFMA 2D0GA 2D7TH 2AEWA 3UTSD 2QVTA 3MNMA 1JRHI 2PETA 4YNYA 2AZAA 2Y4SA 2TSAA 3TO2A 4DFHA 1QFHA 4WNQA 1I7ZA 3FULA 1K4CB 3QUMB 3ZDYE 3RWEB 3LN4A 3N2JA 3QULB 5D7LD 2Q8BH 4ZMOA 2X1XR 3AXLB 1HIML 2IWFA 1TQUA 2EADA 3RWFA 5I6NA 4PLJC 2BVOB 4TUKL 2HG0A 5IW3A 3D08A 4KH9A 3I6SA 2V6HA 2W9EL 5IQ7L 3AG3B 2F18A 4K3JL 1OM3H 2NY2B 3PABA 2P5PA 4PRPB 5ICXA 3BWSA 4KRNA 1LXMA 5FV1L 1AP2B 4XVUD 1OL0A 2KLSA 4EBQL 1IAOA 5F7KC 1LMKA 3LQMA 5IM7B 4J1UB 3UBXB 4HEPA 2XN9B 4YJZL 3QIWA 3GMLB 3KJ6L 2AJUL 4JREC 5FA3A 2FH6A 3SE8H 1DJWA 3LDBB 3H2WA 5CWSB 1XD0A 2PF6A 3AACA 3BDYH 4LVOB 3KCPA 4PFEA 1N5YL 2VB5A 3CNKA 2BRQA 1GZHC 2HVKB 3QWOB 5GHWH 1R3HB 5TF1L 4DP8X 4GKZA 2ZICA 1WBXA 4GI8A 4PJAE 4E9XA 3MNVB 2BY1A 1HVXA 3RAJH 5MERA 3AY4A 3QWRA 4G7RB 4Y2DA 4LDCA 5IFJB 2K3HA 4AL8C 1KFGA 4LMQI 2HRHA 3GZKA 3HB3D 1DLFL 1DJYA 1Z0NA 4YC2C 4F8QA 5F9JA 3H9SD 4Y2NA 2QSCL 2FQDA 4YHLH 3DO7B 2CJ3A 4QYOB 4LP4A 4KX7A 1IM3A 1Q9KA 1NKGA 4YDZA 1WAAE 3LZNA 4DERA 3KYNA 1CFNB 4HIHA 4HWBH 1KXQE 4XXDA 3MACH 3LKNB 4TSAH 5DVLA 4D2NA 3MROA 6FABH 4MDIB 2ZUXA 3KPMB 2IF7A 1A3RH 3FAXA 4MXWL 1L0QA 4E41A 1EX0A 1YMME 3BKCL 3RZWA 1A02N 3RKDD 1JXDA 2GJ6B 1U6AL 3MR9B 2BIIA 2ESVD 2EKSB 4QEGA 4QRAA 4X42A 5I1IL 3EZJB 3SPVB 3TM6A 4HYTB 1HAUA 5AVWB 1MFCH 4TQ8A 1F58L 3EGXA 3WCYA 3JXAA 3ZRFC 3LZQA 3HE6D 3U2SA 4ZFOB 3F7KA 3NPSB 2Y6SD 5FB8B 1U8PA 2A6DA 3OR7A 3ELAT 3L3JA 4ZOAA 1PPIA 3NFNA 3FCSB 3FF7A 2GAZB 4NUGL 2PPFA 4U2YA 3OHXB 5IHZA 2ZOOA 1FYTB 3EYOB 3QDJB 3DA0A 3T1FA 1UEMA 2FO4A 2VW4A 3D48R 3R06A 3TPUA 2B2XL 4R0LC 2KYIA 1IZJA 2OMWB 5I0YA 4UUJA 4IKKA 4F57H 3STLB 2Z91A 2BJML 1X9RA 5C0ND 3JUZA 4NENB 2V2WB 2R59A 4C56D 5SV4A 1ACXA 4A66A 4PB9L 2AJXL 1TJIH 4JG0H 1CI5A 1YMHB 4GFTB 3GYRA 5ISZB 4P5TB 4NQED 2XCMC 4JL1A 3CVHA 3TBWA 4MJIA 3TJEH 4B96A 4J8RB 3QFJB 5EF2A 2OMVA 1RZ7H 1Q0YL 2WLJA 1QNZH 2NXZD 1D9KD 4V11A 1BREA 4PJHB 2EH7H 5HYQA 3P0VH 4N0FB 5TFSH 1P1VA 1THCA 5C0CE 4I3RH 3MX0A 4KMLB 43C9B 2I9TA 4YIQA 2QT6A 4FFZA 1J5IA 1J1PL 4HJEA 4FYRA 1E28B 1JGEA 4KFMA 4LBEA 1OLZA 1HEHC 4K5MA 3QEUA 1KJVB 1N0XL 1NSNH 4WJG3 4XBGB 2YC1B 1WRFA 5EN2B 3HG1D 2DPKA 2BS71 3INUH 5CXPA 1U92B 2FBRA 3S37X 5HVFB 1GSMA 3JWOC 2PXYD 4PGBB 3KWVA 4ZDHB 5L4JA 1UD2A 3E1F1 4IM8A 4FG4A 4JFZL 4OLWH 2JELL 5E95B 3MREB 1ZLVK 1CLZH 4Y5YB 2HMIC 2NXYC 4MMZA 1TEGA 5J5EA 1NC2D 4M29A 2Z31C 4Y9GA 1SM3L 2MOQA 3X17A 4JGJA 5EO0B 2G9HB 2R0ZH 3JWOH 2ZSWA 3QB7C 2CKBB 3JVGA 4YX2L 4J3OF 4Q8BA 1X5FA 3EH4B 4GW5B 1WAAF 3WY2A 4WRLA 2AS5M 1RZFL 5EDXA 3VFWB 2Q2LA 1TMQA 4ODVL 4Y1AB 1ZHNA 2LFEA 3MCG1 4PJ9B 3NIDE 3SPHA 4X98B 3REVB 1M56B 2WXKA 4EDWH 3DETD 4RGNB 1A64A 1GCYA 1KFAL 2VN7A 5IJCC 2XIDA 4Y2LA 4NYLB 1KGYE 3LQZA 3GMMA 1VACB 3IJYA 5AW1B 3F6JA 3D34A 5DD0H 4L8CB 2BDNH 4JFFA 1A66A 2HTLD 2XXGA 4FQLH 4YBLC 4H0IA 2F0CA 4IMKC 4Y8DC 2WTRA 4HWEH 1M2OA 3UROR 1PSKH 3MV7E 4EZKA 5JQ6L 4DEPB 1OD9A 1SJEA 1ZS8B 1A1OB 1RK0A 2JK5B 4J3OH 4P2YA 1WIOA 1NDGB 4D0BB 1U41A 1HQ4B 3N40P 4Q74A 5AYTA 3I50L 1UH2A 3QK0A 2XFXA 4IMLB 2F6AA 4G6FB 1ZLWH 4ZMAT 1DVTA 1X5HA 2DLFL 1FZMB 3AM8A 2GIMA 3UACA 1QYGH 2IGTA 1V27A