1A8ZA

Structure determination of a 16.8kda copper protein rusticyanin at 2.1a resolution using anomalous scattering data with direct methods
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
LDTSWKEATLPQVKAMLQKDTGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLDIPAGATVDVTFINTNKGFGHSFDITQKTPPFAVMPVIDPIVAGTGFSPVPKDGKFGYTNFTWHPTAGTYYYVCQIPGHAATGMFGKIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUSTICYANIN
publication title Structure determination of a 16.8 kDa copper protein at 2.1 A resolution using anomalous scattering data with direct methods.
pubmed doi rcsb
molecule tags Electron transport
total genus 34
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 1998-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1a8zA00
3X1FA 2XV2A 1AZRA 2IAAC 4GXFA 3UADA 2PPAA 3X1EA 1B3IA 2BWIA 2HX7A 4DP8X 2YAEA 4YSOA 2Q9OA 2HX9A 2PLTA 2I7OA 1W6WA 1NPJA 1PLAA 2A3TA 2AVFA 4PAZA 1GS7A 1MG2C 2GBAA 4GP8B 4KNSA 3AG4B 2FT6A 4HALA 4E9RA 3FU8A 2JFCA 2J56A 2XV0A 1GYCA 1GR7A 2DYSB 1AG0A 1WA2X 1ZDQA 2PPFA 2FTAA 4JKNA 2YXWA 2Y1AA 3QJUB 1L9RA 2NRDA 1AR1B 1L9TA 1SF5A 2QPDB 3V9CA 4G7QB 1JVLA 1NTDA 2CJ3A 2XWZA 3NYKA 2OV0A 3DTUB 1OE1A 2XXFA 1J9SA 3EF4A 3FQ2A 3GXUB 1XMEB 1EHKB 3FQYA 5B1JC 1ET7A 3AG3B 1BXVA 4DP9X 3OD3A 4BXVA 3CVDA 3CVCA 1ZPUA 3WNJA 4GP4B 5I5IA 1MZZA 5EHFA 1WS7A 1ET8A 2MTAA 2XYBA 1E30A 1JERA 1WAEA 1JXGA 1BQ5A 1IBZA 2FT8A 8PAZA 1RCYA 1ILSA 3CG8A 5I6MA 4YSTA 2YAPA 3OMIB 2R7EB 5B1JA 1AACA 5I6OA 3EH3B 3AY2A 2HRGA 4YSCA 1OE3A 3WKPA 4YL4A 4WTQA 2IDFA 1J9RA 1X9RA 3NJFA 5AZUA 1MDAA 1NIDA 1V10A 4DPBX 4DP4X 1PAZA 2XUWA 1E65A 1AOZA 3ABKB 4ENZA 2VN3A 4DP5X 1J5CA 3UAAA 1ZV2A 1ASOA 4BWWA 2DV6A 2X87A 3BQVA 4G72B 1VLXA 4K9JA 1NWPA 5ANHA 1AZUA 2QDWA 3T6WA 1GSKA 3MBWB 4GP5B 4HCGA 3QJQB 2IWFA 5F7AA 3FQ1A 4N4YB 1ETJA 1JOIA 1JZIA 1PY0A 1HFUA 5B1BB 1PLBA 1PF3A 3H4HA 3FU7B 2FNWA 1JZGA 1HAWA 3IN0A 1N70A 3T6ZA 3U25A 2OCCB 5I5MA 3CVBA 1PLCA 4KO6A 1SJMA 1QHQA 3NP3A 4E9VA 3N2JA 1QLEB 1NWOA 1E5ZA 3PPSA 3FPXA 1BXAA 3G5WA 3NJIA 4UAHA 5B7MA 2BHFA 2VW6A 4BWTA 4A2DA 1WS8A 3WG7B 1RZPA 2BP8B 2IDUA 2DYRB 2OJ1A 4JHUA 1AS8A 1ET5A 1OCOB 2CCWA 3QJTB 1JXDA 1SDDA 3AW5A 4TXVB 2HX8A 2XXGA 2EIJB 1E67A 2JXMA 2VW7A 3ABLB 3ASOB 1M56B 1XB8A 5PCYA 1A65A 1N68A 2AZUA 4KNUA 1ZDSA 2PPDA 1PNCA 2GC7C 1GS8A 2VM3A 3NJJA 1NINA 2EINB 4DPAX 2H47C 2QT6A 1SHWA 3X2QB 3DKHA 3JT2A 3OMNB 2FWLB 2AZAA 3SBRA 2R7EA 3DIVA 1F56A 3ZX1A 3EHBB 4HCIA 2W8CA 1JVOA 1JZFA 1OCZB 4Q89A 3GDCA 4G7RB 1A8ZA 4YSDA 2I85A 3PAVA 3QJSB 3ASNB 4CSZA 1M9WA 3WNIA 5I6NA 4E9SA 3UGEA 1DYZA 3N55A 4EF3A 5I6LA 2PPCA 1XB6A 1SDDB 1NIBA 4BDVB 3C75A 3WIAA 5PAZA 1A3ZA 1J9QA 2XX1A 5F7BA 4FAAB 2FQFA 1IUZA 1SNRA 1DZ0A 4HCFA 2FJSA 3FS9A 4YSRA 3TBCA 1ID2A 2EIKB 1PNDA 1ASQA 4AX3A 2YXVA 2BZ7A 3FU7A 1UATA 2B08A 1KDIA 3NSFA 2EILB 1ADWA 1R1CA 2QPEB 4F2EA 1AS7A 1URIA 1BQKA 4A2FA 1V54B 3AG1B 2CALA 2WSDA 2X88A 1X9UA 3UAEA 2BW4A 1QNIA 4BK5C 1V55B 2IDSA 3SBPA 3ZBMA 1KYAA 2H5UA 2VSMB 1E5YA 2J57A 3CDZA 1EZLA 2BP0A 2BP8A 4YSPA 2GHZA 5LDUA 3KW7A 1CC3A 3TU6A 1AANA 1TEFA 2GSMB 4PCYA 4YSUA 5B1AB 2WO3B 3GYRA 1SF3A 1PZAA 2E86A 5AKRA 2CUAA 4E9YA 3T6XA 1XB3A 9PCYA 3FSZA 5A7EA 1WA1X 4NAJA 1BAWA 3PAUA 1T5KA 2B3IA 4G70B 1J9TA 1L9OA 6PCYA 5I5JA 6PAZA 2UXGA 4QKTA 2DWTA 4L0PB 1JXFA 1NPNA 2PCFA 3NJMA 1FWXA 2LLNA 2YARA 2FQEA 3NJHA 3NSYA 3QQXA 1IC0A 3ZDWA 3KW8A 4W9ZA 3IN2A 1TEGA 2TSAA 4DP0X 3EH4B 3EH5B 1L9PA 1TKWA 3OQRA 1BEXA 2UXVA 2GIMA 2YAMA 3NT0A 3L45A 4KO7A 2AFNA 1ZIBA 4YSAA 3CDZB 3MX0B 2BP0B 4DP1X 4DPCX 1CURA 3NSDA 3JTBA 2HLEB 4DP6X 3IBOA 4AZUA 3ZIYA 5D4HA 3PAZA 1GY1A 4HIPA 3ERXA 3CZUB 7PAZA 2H3XC 4BDVA 3FYEB 1KCBA 1NICA 2GC4C 4M3HA 3OM3B 2BZCA 4GY4A 4KOBA 5I6KA 3WI9A 1KV7A 1ILUA 2XVBA 4AKPA 4P5SA 4YVUA 3S8GB 4A66A 3T71A 2FQDA 3QJVB 3S3CB 1IBYA 4WKXA 5D4IA 3TASA 1BXUA 3FT0A 5TK4A 4E9QA 2PPEA 3SQRA 4AI7A 4KOCA 4DP7X 4BWUA 3QJRB 1PZCA 1CYWA 4F7KA 3IE9A 2Y69B 3PCYA 2PP7A 2CBPA 2IH8A 2IWKA 4KNTA 1JZHA 4X4KA 1PCSA 4AKOA 1YLBB 3X1NA 1OCCB 4AKQA 2YAFA 4GYBA 2DY2A 1NDTA 2HRHA 4E9XA 1FFTB 3X1GA 1A4BA 2PCYA 2UX7A 1BQRA 5FC9A 2P80D 3T6VA 1W6LA 2VMJA 1KCWA 1A4CA 2VM4A 3H56A 4HZ1A 4M4RB 4G7SB 2ZONA 2I7SA 2PP8A 1RKRA 1OOWA 4ZK8A 2J5WA 3TA4D 4FA7B 1L9SA 2FT7A 2VSKB 5TK2A 1OV8A 1BYPA 2P80A 1OE2A 1AS6A 3FPYA 2TSBA 3IEAA 4W1TA 2UX6A 4NB7A 4YSSA 7PCYA 2UXFA 1NIEA 3OMAB 2W88A 3SBQA 2YAQA 1SFDA 2XX0A 3HB3B 2UXTA 4YSEA 3FSWA 2RACA 2PP9A 4A67A 4CSPA 1BYOA 3UACA 1AZNA 1TU2A 4F2FA 2MRYA 3ABMB 4UANA 4A2HA 3V9EA 3D12B 3PXLA 3NP4A 2HZHA 1M57B 3FSAA 3RYMA 5B7FA 3ABGA 2QDVA 5D4JA 1GY2A 2YAOA 1AZBA 3NJNA 1JZJA 3BVDB 4E9TA 2ZWNA 3S3BB 2IDTA 5B7EA 4N8UA 1CYXA 2HXAA 1AG6A 3WKQA 4KO9A 4HHGA 2GI0A 2ZXWB 2ZOOA 3TBBA 1A4AA 2IWEA 2N0MA 4MFHA 1JZEA 2YQBA 4YSQA 1MG3C 2XU9A 3AZUA 4HHWA 3FU9A 1NIAA 1J5DA 4A2EA 4YVNA 2IDQA 3FSVA 4BXSV 4JHVA 1AQ8A 3PLYA 1CUOA 1WA0X 4G71B 1SHXA 4HAKA 1RZQA 1SFHA 2EIMB 2J55A 2JKWA 2Q5BA 3FYIB 5I26A 3NJKA 3NSCA 2GB2A 4P5RA 5IY5B 1KBVA 1AIZA 2IH9A 4UF7C 1FA4A 1I53A 1KBWA 2BW5A 1KGYE 1MZYA 1NZRA 1ZIAA 3X1BA 2AANA 4DP2X 2XV3A 3S3DB 4NERA 1HAUA 1GW0A 1AAJA 5B3SB 1OCRB 4KO5A 1L9QA 2DWSA 2VW4A 2WO2B 2XLLA 3NJGA 4A68A 1PZBA 1KDJA 1W8EA 3AG2B 3S8FB 4E9WA 1PMYA 1NIFA 1GS6X 3UABA 5B1KA 4QLWA 1IKOP 1ASPA 3NJLA 2YAHA 2BO0A 4Q8BA 3T9WA 5I6PA 1OF0A 1AZCA 4RH4A 2FQGA 3H4FA 3QPKA 4A2GA 5E9NA 2CAKA 5AFAA 2BWDA 3HEIB 5I28A
chains in the Genus database with same CATH superfamily
3VJ6B 1T5WB 3HAEB 2XV2A 3FT2A 1LO3L 2Y5EA 3MRGA 2H6PB 5D2NE 3FQNA 2VH5H 3HE7A 4GRLC 2R2BA 3X1EA 5EULV 2A6IA 1WAAE 2E6PA 1ZHNB 2VQ1B 3OKMA 1DEEB 3ZE1F 3ZTJH 2D03L 1ORQB 4WI6A 3SY0B 3RI5F 3QGVA 1WICA 3R19A 2DMHA 1YA5A 1MRDH 3FU6A 4L8SB 1KCVH 2YEZB 1SGKA 2WO4A 2BLFA 2HJFB 5SX4I 2BIOA 1F6FB 2QEJA 4GS7B 3VXMA 1HZHH 2DICA 2JFCA 3FQWA 3SHSA 1H3WM 2XV0A 3KPSA 2I27N 3IU4H 1IGIH 2Z8WC 1Q9KB 4WRLA 1OWWA 4BJLA 1L9TA 5I6XC 5F97E 3REWB 5BVPH 4P3CH 4PRBB 4X8CA 3EG9A 1WCBB 3T0DA 4LBEA 4GXVL 5D1ZA 4OFDA 3DV6B 2FJHA 4J3OG 1BXVA 4JFPA 5HGBB 4RZKA 2GFBA 3QEQB 1ZSHA 3LZPA 4NKMA 3F05A 1EJOL 3GBNL 4Y1AA 4FTDA 5FB8A 3SDXB 5I5IA 3M8OL 1WS7A 3F64A 4KDTC 2X4UA 4ORZC 3KWVA 4BZ1A 1BJ1H 1P6FA 4YHYB 3NEEA 4IBVA 2L8AA 3CU1A 3DV4A 1IBZA 1DDTA 3W11C 4OZIB 3CLWA 5FR3A 1RCYA 1RUPH 2H45A 4L0ZA 4JM2A 5AUMB 2JLPA 5IFAL 3BGFC 4ANXA 4EZKA 5EUOA 2X4QB 1I9RH 1U8PB 3C5SA 4FFYL 1D3CA 1SBSH 2VSDA 4P5TC 2YSSB 2M2DA 3UG4A 3VNZA 4AYMC 4CSSA 2C9QA 1OSZB 5I1EL 4B96A 3VFOA 1LMKA 1ZLDA 3PF2A 2AJVH 3ZHNA 1H3UA 3WEAA 4NQDB 2CJUH 1FFRA 3C2AL 4WV1B 2CMRH 4FXTA 1YDPA 4DP5X 5GGUA 2PXYA 3S37X 5B3JE 1KXQA 2Q8BL 3MBXL 2AQSA 3SEPA 1KLUA 3FTZA 5D96C 1E6OL 3O2VH 3VQMA 5AZ2H 4GMSH 3DXAE 1FQ9C 2YGQA 5J9PB 4NKDA 4GP5B 3AABA 4HCGA 3MRRB 4PJFB 3E38A 1SXCA 3X3FL 4PV1C 5FGBA 1P7QB 5IR1B 5GS3A 4HPHA 4JZOB 5IB4A 4IM8A 1WT5A 1YJDC 3LEXA 3MRHB 4NM8H 4XP9L 2QGDA 2I5YL 3FB8B 1MREL 2FNWA 4QXGL 2YPVA 1XR8A 5FM4A 1RQ5A 5HI4C 1YPZB 2C3HA 1WWWX 3K74B 3SE9H 3B9KC 3HJ0A 5KSAD 3CHXA 1R34A 2X9WA 3ENEA 3PHAA 4FC3E 4O2CB 3BZ4B 2FDBP 2NR6C 4WJ5A 3RPIA 1FH2A 4Z1PA 5C3TA 3FSOA 3MNVB 4UDTA 3ZKXB 3SIKA 3ZE0E 2MNUA 5JW3H 1MFDL 3CBKB 3CXDH 3WEXA 2MHAB 2YOAA 1SYSA 3K81A 1CE6B 3ZHFA 1XEUA 4J23A 1AO7B 2WHVA 3MUZ1 3PFQA 3S5YA 1OTUD 3W0WA 3BX7C 2DAVA 3OKYA 4Y5YA 1BF2A 2AJ3B 3SPHA 3ALXA 3C8KA 4L37A 4XOBA 1BBJA 2VW7A 2G60L 1G0XA 3FRUB 2QQLL 3T2QA 4L2YA 1WBYA 5EDSA 1A65A 3P2BA 4M6MH 5E8NB 2R2EA 2CRYA 2YRBA 4O58L 4U6YB 3MLXH 1CK0L 3VGAC 1RVFH 3MNZB 3ALWA 2WVUA 1SHWA 3HTLX 3LPOA 3X2QB 3DKHA 1ETA1 1S7RA 1LP9B 2R0ZH 1DLFH 2CWRA 4HP5A 4B9CA 3C6LD 4K4KA 4JM4H 3ZX1A 4Z7VF 2EYTB 5E00B 4HK0B 1PIFA 1JG9A 3ARDB 3EOBA 4FQJL 4U0RB 1IKFL 2DQHL 3QZOA 5DZPA 4N0UB 5GS1A 1LE5B 3DVFA 4GSQA 5BQ7A 1GGBL 3US1A 2HKFH 4DKFL 5KYXB 1U3HC 5C0AE 4Y4FD 2IWGA 4G8GD 3OAZK 4JO3H 4APQC 4N2FA 2GJZA 3ARFB 4B5ZA 1E4WL 4L5FL 4LHUA 5GZNA 3QNYB 1NC4A 3GJEB 4HK3J 3OXRA 4JCMA 2UWEA 2WIMA 5T1LB 3BPCB 3VWJA 1CGVA 3WAKA 4OSUH 4YO0A 1ROCA 2WUCH 5IP4A 4JFXB 4PRHD 1U8MB 4BD4A 3Q2NA 5FLVA 4OIIH 3WFCL 1YUHA 3SYCA 4Y2NA 4X5PA 1NJ9A 1T7XA 2EIKB 1TVBB 2X4OB 1GZHA 3AS1A 5DVLA 3WV0A 2NLJB 2AGJL 3PUUA 1BVKA 5FW7A 4UINH 3UP6A 5TQ2L 1JBJA 1R5IA 4JRYA 5F0LB 4HJIA 5D1QA 5A3IC 1NFIA 2W07A 1EJ8A 2OSYA 2X9XA 3CV5A 4QHKJ 1DVZA 1NMAH 1N12A 1TZGH 3WTXA 3VCLB 5I1JH 4LNRA 4KBPA 5F0JB 4AJ0A 2BW4A 5I1AB 4QHMB 1VKXA 2IGLA 4XZUB 3MJ7A 2X4RB 4QHUA 3L1EA 1HOCB 3HI5H 4DZ8B 3SY6A 4KQ0A 1EVTC 4RFNC 2WYTA 4RAVA 3KW7A 2ADIA 1QBLL 4LHJB 2DTML 3MRCB 3GMRA 4KZDL 1J86A 2ITCB 4YLCA 3S2AA 2OMZA 3IU3B 1W2KT 2J1YA 3H9HA 5JOPD 4ZUVB 1FE8H 4KJQC 3QFGA 5A7EA 5EZLA 3CH1B 4FNQA 2B3IA 1Y18B 1YEDB 5TFSL 6PAZA 2Y3AA 1BX2A 3S97C 3POCA 1IJNA 1IV8A 4N5UA 1EAQA 4LCCC 2B8OT 3K5RA 5F7FA 1OSPL 2VZTA 4F2MA 2B1AL 5HVWA 2IV8A 1IC0A 4MA1B 1F4XH 1FFPB 3ILQD 5FW8A 5EO0B 2NY6C 5D7SH 3BAKA 4N2HA 2W81C 1KIRA 3FRPG 2EUZA 1A7NL 2COQA 2ZSVB 5HGAB 3ZHKA 3WN5A 4JQVC 4P07A 3G6AA 4LBAA 2D7OA 3TYGL 1L7IH 1OB1B 4I0PD 3NSDA 4G6AD 4XNYL 2EAEA 1HQRB 4LSSH 2HLEB 1HHHB 3HC0B 1DUZA 3VXNB 1YNLH 4KI5E 5HYEA 4HIPA 4TULL 2VR9A 3FO9A 4RA0C 1E4XH 1PKOA 1VZIA 4FE9A 4F91B 3EDJA 4LSPL 3FYEB 4FXGB 2DQUH 1OLLA 5K59E 4E68A 5K5YA 4I9WD 1FAIH 4FNLH 4RWHA 1LILA 4A2MA 4JDTH 1A7QH 1F5WA 2LLGA 4HKZA 1BJMA 2IQ9H 1HK6A 1EO8L 2FEEL 3D18A 4TSCH 4EZMA 3IDIA 1XF4A 3WLBB 4WGKA 3QO1B 5E08H 3PJNA 3LRSA 1KIUA 2H2PC 2ZF8A 4DKAA 1RZJL 4JY4A 2SEBB 1JI2A 5AKSA 4MJ6B 1OW0C 4P2OA 4H20H 1PZCA 5AOIA 1NQBA 2HRPH 2XNAB 1RI8A 2FWUA 2IH8A 4X4KA 5D1XB 2Y6SD 3RVVD 3IJEA 4LDEB 1MFBL 4JFHD 1U92B 4S0HA 1S5HA 1YEFH 2BVUA 2FJUB 3KL0A 4N2KA 4BSVA 4UB0H 1T1XA 1KN4L 4GYBA 4PRPA 2NDGA 4G8IB 5GRVK 4LSRH 5EU6A 4HIIB 4J3WA 1XGRA 3ZGIA 2P26A 4MJJA 3ATAA 1J05A 3W56A 4OKVB 5IW6B 4TNGA 1GOFA 4PJAA 3EOAB 1G7IA 1ZWIB 1QR1B 3QDGA 2OYPA 4XPBH 3QQ3B 4WO4A 4ZO7A 4DGIH 3AROA 1BFVL 3LSOB 1Z1WA 5MEPB 4RRPM 4A7VA 4TYUA 1JWUB 1KV3A 3LQZA 4FFYA 3JXAA 4FQLL 3FTSA 3O8XB 2WIIB 2JJTC 4TUUA 1AS6A 2KHAA 4XT1C 2DZEA 3N9GH 4MA3B 3ZTNH 5JXED 1AFVH 1C16A 1I3VA 2YUVA 3SODB 2HVKA 5HHPA 4YX2H 4XBPA 4JGNA 5F7YC 2HTLD 5SX5K 2VKWA 5BJTB 1BYOA 1HC1A 3LIZA 3T3ME 4OH2A 1DBKH 5DXWA 2NY1C 4GBXC 4UTBL 5ECJE 2VDML 4M5SA 5CLZA 4HJGA 4UTAL 3ZUNC 4R4NC 4DKEL 1YECL 1S46A 2C3VB 2IAMD 3PHSA 2AEPH 4OGYH 1ZD6A 5IUCA 5FDWB 5D7JC 4XWOD 3S3BB 5EPMB 4EN3B 1IC5H 1MAJA 1CYXA 1KGCE 1GA2A 3GXIA 4PWEA 2YQ3A 4P23D 5BMFH 1RUQL 1WWCA 2ZXWB 3WAJA 4HUWA 3GXNA 4OV5A 4M62H 1FFQA 2GIYA 4KQ3H 1KIQB 1F42A 3AITA 2MNWA 2BNUA 2Q7YA 1HL4A 4N8VG 1KFAH 3UTZA 3EOTL 2G9HA 4OFYA 3OG4B 5AW8B 4Q9QH 4XNQB 5EIIB 4KXBA 1KJ2B 2NUTB 1N8ZA 4B0MM 2A9BA 4NN7C 1SFHA 3FYIB 4R2GD 4DK5A 4KTGA 4UZUA 4IU3A 4HEMA 4E41B 1CGTA 4P5RA 2IH9A 1KEGL 5HVGB 1RLWA 4M9OA 4JCWA 5C0AA 3VH8A 2WNGA 1JRHI 5J89A 1KJVB 3VGBA 4CC4A 4GUPA 3C09C 1C5BL 3PWPD 1YNTA 5DD0L 2VW4A 4GAJL 1G6RH 3ARED 4WKZB 2X1QA 3DO4A 4W9IC 3M86A 2JVUA 2FGWH 1WWBX 3MV9A 5E2UL 1QNZL 4MCNA 1VGKA 5IB3A 2XQBH 1A14H 1W8NA 3MODL 5B1KA 3OAUL 4N2GA 2Z6FA 3T0XA 5B4MD 3LD8C 4ZMNA 5KZCB 2P5WB 4NKIL 2E9WA 3ARGA 2BPBA 2FQGA 5C0EB 4XP4H 3RNKA 1J5IA 1KB5L 5KBNC 1UCBH 3PDOB 2DF3A 3R0MA 3DVGA 1A6VH 4LOVA 1BAFH 3B5TA 5ACZA 2VDRL 2IGFL 1PSKH 3UTSB 3PIQB 4FKHA 2P47B 1ORSA 1B3IA 4MNHA 1VFAB 2H2SD 3FCBA 4ELKA 1D5MA 4BRVA 4Z7OE 4XBGA 5KBPA 5JORB 5E4EC 5AL8A 3WSQL 2A4CA 3ZZ1A 3S4SA 4U6TA 3DIFB 3BAXA 1MHEA 4F92B 2ZX5A 3NIFB 5DT1H 3IETB 1P5UC 2JKJA 3JT0A 2Z4TA 1KACB 5D2LE 3VTMA 3VU2A 5KS9E 4IDJH 4ATWA 3GTVA 1A22B 2VXVH 1M4KA 2IBZY 2F53B 2EXYC 5D5ME 1QASA 4JKNA 1F6AA 1MIMH 5DLMH 1WC7A 3H54A 5AYTA 4LT7A 4TLTA 4AQ1B 3O0LA 4TNVK 3WIHL 4QNPE 1CFMA 5C9KA 1AQDA 3DGCR 5GXBB 5L2JA 5T3XH 1QABA 2OV0A 3ILPA 1IGYB 2V5SA 4I0CC 4O02H 4AZ8A 5IHZB 4UT6L 2DKUA 4KXZI 5GS0H 3BQUB 5I1GL 4XP5H 3A4DA 5T3XD 2HA1A 4MXQD 4D9QE 4WNSA 3TEZA 4Z95L 5HHME 4XI5C 1DBBL 1T5XB 1U33A 2MJWA 4HWBH 2BOBA 2VWEC 4PU2A 3GSXB 4XCNB 4XGZB 3S7GA 3K0YA 5F88B 4JFFE 3KPRB 1SM3H 3KYNB 4OCSH 1XQ4A 1WAEA 3LIUA 2WLIA 5CLTA 1JXGA 1XH3A 2CHNA 3RL2A 3QZWB 2R4RL 3LRGA 3WO4B 1T1WA 3QE5A 3GM0A 4QY8A 5IQ7L 3DX7B 3OKNB 4JY6A 4R7DA 3ETBJ 5DHMC 1SJHA 1LK3H 2IANE 2DQIH 4XPAL 3LN4B 3BKJL 3D3VD 1QHOA 1MHPL 1XSOA 3EYFA 3IWUA 2Y1VA 3NN8B 1Y6KR 1V10A 4N8PA 4PS4H 2QV2A 1AOZA 3DUUA 3DPDA 1PY4A 2YSTA 4PBWD 4YBQD 3D85D 4LF3A 3RIAF 1XIWA 3BPOB 4J27A 5D4QA 2OJEA 3O3EA 4X9BA 3GK8L 5C0DB 3QRFM 3O6ML 4G72B 1W91A 1UHVA 1W0WA 4G6ML 4JZJB 5DUML 1NFDB 2NY4D 4Y4KD 3QDMD 2V3FA 2QDWA 5T5NF 5I8EA 2C4FU 1QLRA 3FU0A 4ZO8A 4W9LC 4CUCA 1BDYA 1I3RB 2Y2TA 4DGYL 3MO1B 1NC2A 4ILDA 4PY7A 4AXWB 2ZTBA 1HFUA 3L17A 4XAWL 5EIQA 5ICXB 4KX7A 3O4LD 1QQDA 3UL4A 1DQTA 3D0LA 4QYAA 4Z3GA 4JO8A 3GMMB 3UX9B 1LO2L 3AQYA 5IFJB 3TH4T 4Z7QE 5J8OA 2VUOA 1U8OB 4L9LC 5ALBL 2ZWLT 2ESVB 5AVRB 2AXJA 4RWYH 3AU1B 4L3AA 4XNUL 3HHMA 2M83A 5B7MA 5DUBA 4CVZA 2VW6A 1Q72H 3EYUH 1IM9A 2WINA 3QRGH 1HXKA 4FQ2L 2EICA 3X11B 4B97A 4U1JB 1HINH 2YBRA 2IDUA 4LPTA 5EORH 5EOQL 3QUKB 2DQMA 4PJ8D 2DJ4A 5INCA 1NMCC 1IL1B 3PL6A 3WXWH 4OBSA 3TBVB 3HR6A 2ZP9A 4YE4L 1FZMA 5FCUH 1TOXA 4ZAKD 3WHE1 1TQBC 3VO0A 3L2LA 3V5DB 2HPTA 1HH6A 4ZUUA 2J72A 1ZGLA 1CFBA 4D8PB 1GGTA 1HCFX 1M6OA 5C08D 3JVFC 3UTPD 4AC4A 2H8PA 3FMGH 5FYJL 3QZLA 2Z8RA 3T0ED 3MNWA 5HJGA 4IGBA 3VX1A 4LCUB 4PREB 3K1KC 3FFCB 4HDIB 1B6DA 1MCHA 3VFWA 5EO9A 4B6ZA 5CKGA 2B0SH 2CDGB 4A6YA 1NLBH 4KRPC 2MCG1 3QDME 4DN3H 3GMOA 2F54A 4NQSA 4N2IA 4P49A 4MZ3A 1N5YH 4KKPA 1JF1B 4LCYB 5JIIA 3RP1A 4BZYA 1A3QA 5BV7B 1LD9A 2R56L 3ASNB 4NO0A 4UOW1 5F1IA 3I9PA 2XTSA 3RB7A 4ZFZB 3I6GA 3FL7A 2CNYA 2IG2L 4HUKB 3D34A 4NBYB 2OMYA 3RGVC 1MXDA 5DO2C 1JJUA 1NEUA 1JK8A 1I82A 3WHXB 4GFTB 3BRDA 3ARBA 5JXAL 5E2TH 2AHIA 4RX4D 3SYAA 5EZOH 1N2RB 2BDNH 5HYSA 1DQJA 4JQIL 2DWDA 1T1YB 3T8XA 1WBXB 3DX1A 1G7PA 1AGDB 1UJ3B 5KSVA 4HMEA 5J1SC 2VXSH 2CRMA 2F5AH 1S7VB 3EJJX 4ZO6A 4Z77A 4UTBA 3DRQB 4PJ9C 3HZ3A 2FIKB 4YLBA 4Y4HD 1FF5A 2JCCA 4HJ0C 4IKNA 2A77H 1KTDA 1JCVA 1XCQA 2DI8A 2OR9H 5FM5M 2GJJA 3CCHA 3MLUL 3OJDA 2ORBH 2KI6A 5C7XH 3U9PL 2B5IC 3HLAB 2R69L 1WG3A 4JE4B 3V4VH 2IOMA 43C9A 3UAEA 1FFOA 4G11A 3KYKL 1KC5L 5I2IA 1RMFL 2KZKA 2OTPA 4P2QB 5L9DL 4OQTH 4S11A 1NL0L 3GLZA 2ZNWA 2EVHA 3VSUA 3IJ9A 3GSNB 5DYOA 1NCAH 2GSMB 2NY3D 2VLRB 3KPNB 4PJEE 4UT9A 4C83A 2VUYA 4UUJA 4E9YA 1XB3A 2CA4A 4AYBA 1OGTB 3D48R 2O6DA 5TH2B 1T1ZA 3FSZA 1WA1X 4POZD 3WNKA 3WFEH 4OF3A 4BM7A 5CLYA 3EHBC 5I0XA 5J0BA 3H2QA 1J9TA 2XFXA 4ONOA 4RGNB 3ARRA 4YGAB 4N87A 4QRQB 3ZDXB 4YHOH 4FMKA 4X6DE 4I48B 3PXHA 4K3JL 2ADFH 4UIMA 2I07A 2J71A 4PRNB 5TPWL 4YR6B 2I9TB 3FO1A 1S8DB 1QRNB 1UOKA 5FOJA 3P0GB 1N4XL 4JLRA 4R8WL 5D2LA 3V0AC 3EH5B 2JTYA 5F7EH 3NT0A 3FQXA 2XETA 3L5XL 1N8OE 4J6RL 4K8RC 1OAXH 4DT2A 4Y2OB 4YDMA 5IM7B 2NZ9C 1X6LA 4N8CH 1D5BA 4OFPA 2EIEA 3RUGE 4XP6H 2VDLB 4F20A 1ZA6B 4TSAL 5C09B 2KH2B 3TPUB 4BIKA 1GY1A 1KB5A 4MLSA 3FQRB 4JHAL 3TWCL 2AC0A 4WFHE 1QLFA 3FHEA 2ZKWA 2GUYA 4PHZA 3PP4H 5CBEB 3FUDA 2AV7B 3V5HA 3ZDYE 4BH8A 1EFXB 4JFFA 4H25A 2IH1A 4P4KA 1Q9LA 3RU8L 4KK9C 3ZQ9A 2DDQL 3N43F 4AL8L 4AKPA 4ETQB 1A3RH 4GT0A 1IBGH 3ZUCA 3S3CB 4A37A 2V17L 3PGFH 3O0RH 4AEEA 3N6YA 3HUJE 2K4WA 4HLJA 3L8QA 3PREA 4QPEA 3U82B 4FEIA 2CGRH 4YXLH 4WHTA 3MUY1 1QATA 2XZQH 3AADB 1F4WH 3N5AA 3MV7D 3D39A 1KCSL 2Z0UA 4S1SL 1CB4A 2DRUA 3ISWA 1HT6A 4K8RL 3T77A 5FECB 3DVNB 4ZS7H 3QXVA 1H9DA 3RHWK 4ZFOL 2R83A 3FDWA 3WIHA 5EC2B 3F01A 4UNIA 3UAJC 5IEKB 2FO8A 4L3EE 3V55A 3W1ZA 1IGJB 3QG6A 5BZDB 4UT6A 1JAEA 2DY2A 3VNYA 1NDTA 3PAYA 4KITB 2L7EA 5CZKA 2XTLA 2LGNA 3UXFA 2XWBB 2E7LC 3T6VA 4N5ED 1W6LA 5IQ9A 4JHWL 4M5YH 5HYIA 1AP2B 2KC0A 2N7SA 2VMFA 3N1FC 1CD1B 1OK8A 2EEDA 2BFGA 4G5ZL 4HZ1A 1MCPL 4LVOB 4QRUB 5GGTL 3RZCC 4G7SB 4F8LA 1ZY9A 1M53A 4RDQG 4Y16D 3TGXA 3U0TA 3TBYA 5J6HA 3TO4A 4L4TB 5E03A 3TA4D 4FA7B 3VWKB 3CZLA 3DA0A 1E9OA 1IAMA 1FNEB 2LU5A 3FUJA 2AJSL 3DSFH 3FO0L 3NIDB 1KXVC 2Z64C 2QBWA 2WBJA 4X9YA 3WMQA 5C92A 1G5AA 2VDPH 5CN3A 2WXIA 3S36H 4ZOEA 2OK0L 1IE5A 1XF3B 2AITA 2UZXA 4BH7A 3L1FA 3BUTA 5H35A 3B2UC 1S9XA 3OMAB 4Q6IC 1UWEL 4UQ2B 5HHOE 1KTLB 1OM9A 4TQHA 5T1KB 3BH9B 1BMZA 4Z7WB 2PP9A 1DJGA 2OULB 4A67A 4WWKB 5CJXA 3I3EA 1G5GA 1I8MA 5IVOA 3ABMB 5JDJA 1MEXH 4XNZC 1PZ2A 2XTJD 3LEVH 3IPFA 4A7QA 5MEQB 2XXMB 2MOQA 4UQDA 2CIIB 3LXAA 1WYJA 3VXRB 4JRXE 5ABAA 1DLHB 5IROA 1HCYA 4H44C 5GRVL 4CADB 2R29L 2PWDA 4N8UA 4J4PC 4XRCA 3F7QA 4KHTH 4G1MB 2VLKA 3ARPA 1EPFA 2R1YB 2VERA 3M88A 3MCKA 5I1KH 1H5BC 2GI0A 3TBBA 3STBA 3L48A 4EE2A 3T1FB 3AZUA 2O5ZL 5CILH 5HDBB 3BIAX 2X2UA 2NY2D 2R0WH 4QRRD 1J5DA 2A9NL 4JPSA 1LEGA 4PB9L 2JB6B 3O4OB 1Z9LA 4JPIB 4Z23A 3PJSB 1TTBA 4JG0L 1KPRB 3UPRA 4P9HC 4XCEB 3RWDA 2J55A 4FTVD 2Y4SA 2YWZA 1ZAGA 2OYLA 4GG6E 3V7AE 5ISZD 3O3AA 1EVUA 4KQ4H 2W9LA 4X9FA 1GOGA 1EXUA 3SGDH 2X4NA 2AANA 3U9UB 3RVUD 4LSTH 5MP6H 3EYQC 4U31A 3TCXA 3BKMH 5C0RL 1INQB 5CD3A 4X5WB 4L4VB 5AOJA 3S0PA 3MXWH 2OSLA 2QKIB 1F3RB 3TH3T 3ZHDA 4IJ3B 3H42H 2QSVA 4FQHB 2Q7NA 4FXLA 4OM0L 5CP3A 3S88H 3CVHL 1UM6L 1VGEL 1MDTA 3QORB 1FSKB 1LEKB 3HE7D 2ZUTA 3KPOA 1DQDL 1KN2L 4QRTB 3GRWL 4CSTA 2VN7A 2JE8A 3ARQA 2R51A 4V1DB 1MNUL 2IV9A 5CF3A 1OF0A 1HEZB 3BPNB 1N7MH 3OV6A 3IRCA 3QPKA 5FYJU 3TJPA 3EUDA 4KKAD 2R2HB 1RUML 1ZJBA 5F9OL 3J8F7 1V7NH 3UBXB 4IHOA 2P8LA 1NGPH 4HS8H 3VXMD 3GPEA 1RIHL 2WQRA 3FONB 3VI4B 5EEZA 4GAGH 3E7JA 5ILTL 3V0WL 3KPSD 3T5WA 4M43L 4TLSA 4YSOA 3POHA 5KYWB 1HXMB 2EXWC 2WUBH 4L8DB 4PV8A 2D9CA 3LEYH 3QIBD 3GUTB 5ERWA 1K8IA 4PPTA 1DO5A 1UQSA 1GS7A 2GBAA 2V5RA 4PJEA 3EBGA 4HF5H 4HFUL 2PTTB 2CLVA 3B1TA 4WEBH 5DFTA 4LCWE 3K5SA 1FCGA 4JQIA 4CKVX 4U6XB 1AJ7L 3BP4B 4B27A 5E9DE 3I02A 5J06A 1A9BB 2D3LA 4TQ8A 4Y1AD 3C5JA 1E5UI 2XHNA 5T1MA 1SF5A 1MH5B 4AIXA 5E2WL 1MXGA 2OS7A 1MW3A 3GJFK 2B9BA 5FYKL 2V2WA 4ZZFA 2JCWA 4Q9CA 6CGTA 5CJQL 4UV4H 5M95B 3W9EA 4YC2B 2IVFC 1OSEA 4MAZA 3BAEH 2B9AA 2DQDH 2AK4E 1XWVA 2RFXA 3HI6L 2R69A 3LH2H 4ODXB 4WGVB 4GRWF 1FNFA 4BXVA 1ED3B 4RLDA 2FGZA 4ZMPA 5C0JB 4XO4A 3U2SA 1RURH 3SDAD 5E6SB 1OD7A 2CO6A 4DVBA 4NN5C 1R5WA 1FP5A 2FL5A 2RALA 2QSTA 3NSJA 3D30A 5D72H 4Y2DA 5I19H 5I6MA 2PCPB 4WI8A 2PXYD 1WIOA 1IAIH 4G80A 1OT2A 1YQ2A 3LPGA 1ZS8A 4JFDA 1HKLH 4LIQL 3QS2A 1L9MA 1DN0A 3MRNA 5BS0A 4PUBL 2BJML 4HV8A 3TZVB 3U4BH 3GBEA 1GGYA 1OGAE 1D9KA 2IADA 3CK0L 3B2VH 3VXUE 2BVPB 4HK3N 1HTYA 3O3UN 3UC2A 3ZL1A 2HWZH 2JSFA 4P5MB 3F7VB 4K5NA 4JW3A 1CWVA 5DHXB 3QI9B 4AG4L 2K6ZA 5I1DB 1CR9H 4IHBA 1NSNL 4GS7C 2XN9A 3ZGHA 1SDAB 3QFDB 5LBSL 2SODB 4YHLL 3SO3B 1A3LH 2BXZA 3WO3B 4CMMB 5JIHA 2FBOJ 4QRPE 3UJTH 4FZ8L 5BRZE 3H4HA 4WFGD 3NOIA 1Z6JT 4OIBA 5CEYB 1NM4A 1JXJA 5ESAB 5CBAB 3T6ZA 1OTTD 2NXZD 3W0WD 4XTRC 4F8QA 1OARL 5I1LA 2C1PB 3E6FB 5KW9L 3QNXA 2VL4A 4DK6A 2PYFB 3RGBA 2UZYB 1CLYH 5MENA 1UG9A 5I9QB 1GGIH 1N0LA 3ME0B 5HJDA 1CIDA 4WW2A 3VG0L 4EIUA 2HH0L 5DVPA 3TF4A 2ODHA 3QJTB 4TNVF 3RVTD 1UGNA 1JFQL 4KJYB 3RWFB 4MMZA 4K5OA 4WHYH 2XXGA 4RBPH 1EUUA 3DYPA 1WEJL 3GIZL 3HBPA 2HKAA 5DUPL 2R23A 2Y06L 4I4WA 3BWZA 4KVCL 3CSFA 4JKMA 5T5FL 1HHJB 3FTVA 4ZFOA 2BY1A 4X8JA 4GNKB 5KVGE 5IBLD 4HSCX 3SYOA 2CHXA 4U1KA 4Q6YA 3GLAA 1VF5C 4OZHB 1A7BA 1XGYH 1AE6L 5CR1A 5FS5A 1NDGB 2UY7A 3O6FA 4FI7A 3P9MB 1MAML 3UO1L 3OMNB 5E1AA 3WL9A 4C56D 3P3RA 4JRXA 5CIPA 4NHUA 3S5LG 3V5KB 3NA9L 1P1ZA 5GZND 3W9DB 1NC4D 2WK2A 4OD2B 5GGTA 2GSGA 1Y0LB 3ATDA 2RA1A 5E8OB 3VWJD 1UEMA 1TQWA 4M9PA 2B2XH 4Z7IA 3L9RA 4KX8A 5DGRA 3DX2A 2RGSA 2EYSA 3RVXC 3UGXA 1KELL 3RY6C 4TMPA 1Q9OB 3QUGA 4OAWB 4LEXL 5F9AC 5DJZA 3FF8A 2VLMD 3P30H 1SLWA 2IIJA 2WXLA 2P43B 2WTRA 3TPKA 4YEEA 1K5NA 3H9SE 1QBBA 3LQAC 4NXKA 5DK2A 1JHLH 1CF8H 3LTVA 5DJ0B 4LPUA 3B7RL 4GG6A 3NZ8A 3GEWB 4CRPA 5F1NB 4IBWA 1T7WA 1X9QA 3GZQA 1PNDA 4PRDB 4J39A 1PZDA 1CQKA 1AC6A 1PZ3A 1ND0B 1RZKL 2ZOLB 3BVVA 1B2WH 3IS1X 4NQUA 5GISL 3NSFA 3RWEB 2EILB 3HE6A 4W9HC 4CW1B 4PJDF 3LMJL 4XH2A 3TV3H 2IF7A 1K2DA 4MNGE 4NPYA 1UD4A 2R29A 1QWNA 4GLRI 2XKUA 4U3XA 4M48L 2F61A 4ZMVA 1XF5B 4XN1A 4ATTA 1YYML 1M42A 5AB1A 5FLUA 4DVRH 3LKQA 1WP6A 1Q0EA 1KYAA 1JWSA 5GGRY 3HG1B 5JHLL 2WQVA 4QHPA 4EVNA 4G83A 3QWRD 3GSUA 3KVQA 1KSRA 2C5DC 4HEPG 1UWXK 3TBTA 4XBMA 3GYRA 1WO2A 1FORH 2CJTA 2GJ6E 4GW5B 3TT3L 3TO2A 4HS6B 9PCYA 4BEIA 3P77A 4LESA 3VRIB 3H9ZA 1J87A 1KBBA 3V8OA 3SKMA 2ED8A 4G70B 3FN0H 1BM3H 1TPXB 3N1PC 1E6JL 4AITA 4G8EB 3WGUB 1CGUA 4WTZA 1QKZL 4DZBB 2ETWA 1X7QB 1PX3A 3K91A 3NABL 2YARA 4F15B 5B39A 3HHSB 3DOHA 1CDJA 4YBLC 3RRQA 3ARFC 4N6QA 1R3JB 1E4JA 5EG6C 3D2UB 2WN3A 4NQTA 3DARA 3F5WB 5SX4H 1OT1A 3CVHA 2OR8A 2D31A 3GHEL 4YQXH 5F8RC 2Q87A 2CE6A 2D03H 4L8BB 3WLWC 3AAZB 2CKBH 1O6SA 3V6FB 4AEHH 3HPJA 3GRWA 4Y89A 5DLLA 1A1OA 5CFHA 2VC2B 1PJWA 3CC1A 5C0CB 1MCWM 3EGXB 3WJLC 3CLFH 5GHWL 1LLAA 4PP2A 5E5LA 2CR3A 5KJ7E 2FR4B 3U6RA 1FPTL 5LLIC 3DO7B 4BDVA 1Q0XL 5I1CH 5KTEL 3CN0A 4M3HA 2APWA 3FFDA 3GMNB 4LL4A 4FLHA 1DSFL 4P2OD 3ZE1E 3NCFB 3AXLB 4PBDA 2DKSA 1H3PL 4ODHL 4JKLA 3W2DL 2OLDA 1AH1A 4PN6A 2BRRL 2B59B 1T20A 3BCDA 5E5UB 5F21B 5DC0A 3HZVA 1S5IL 3HZYA 4OT1L 3QUXC 3GHBH 4PRIB 2P5EB 4BZ2L 3NAAH 4PRPD 4R0LA 1MOEA 3AUVA 2JK5B 3ECBB 3L4CA 4LRIC 4ONGH 3FKUS 5EU6D 2ZOWA 3L2NA 1UM5L 5A6IA 1I85C 3RX5A 1U8HA 3ULUL 2J12B 5IJVA 1T3FB 3MROB 1CYWA 1ZHLB 5JHDB 4YDJA 3RJOA 5ES4B 3GZPA 1JGUL 4LVHC 1B90A 4XMKL 2HG0A 3QDGD 4J12A 1UJTA 2FYYB 4AK1A 1MI5A 2APTA 2G2RB 5EH1A 5IFAH 1EBPA 2BSRA 3T65B 1L5GA 2I9LA 5M7QA 1D6EB 3LV3B 3M07A 2BOLA 3PXJA 1BQRA 2DIJA 2EQDA 2VMJA 1P4BL 3D1MC 1A6AB 3KDMA 2YLKA 4YHKL 5FYKU 5KYUA 4L1DA 3C6EA 2DLFL 3IFPA 5AG9A 1BOGA 3LIZH 2FD6L 4ZO9A 3CFMA 4ALAC 5IHUL 5LJYH 4IRSC 5BRZA 1KB3A 3EGDA 4LCIH 2Q8BH 5HHVL 1F6LL 2G0KA 3EJRA 4X5RA 5FKPA 3VA6A 1QBMH 5C0FB 2E76C 2V7HB 1AHWB 4X0KB 1G6RB 1UADC 4ICWA 5I0ZA 3NACH 4N6RB 2NW2A 2TSBA 4YFDB 5J5EA 3CZEA 1XGQB 1TZAA 5IVZB 2W88A 3H3PH 3MOAL 1II4E 1B4RA 1BPLB 4QCIB 4HWEH 1NLDH 4RISL 1MREH 3ULSB 5IGXL 1UB5A 1P53A 5K39A 4RMUA 5E6YA 4A2HA 4KH2A 4DH2A 3I84A 2HZHA 2CLRA 1ZLUH 5B7FA 1CDIA 3VI3A 1BZOA 2WVVB 4OFYD 1AZBA 1FN4A 5BUPA 4MWFB 2PF6A 5E99L 3HNSH 3EJPA 5EOTA 1CFNA 5LBSA 3R8QA 3WS6A 4NWTH 1IIIA 1AG6A 2F74B 1WBZA 4RFEA 1BFTA 1SVCP 4NRYA 2GUOA 4ALAL 4NBXB 3CX2A 4MJ2A 4UAOB 4K7PY 2KLRA 3RFZB 4I77L 1JGIA 1MFVA 4UM9B 4ODTH 1R3KA 1L7TH 3OLEA 5D93B 3TFKC 2IPKA 3RWGA 4PJBA 3DX9A 3WMSA 1LK2B 2XRAL 5C6PB 3VJ6A 1T5WA 4K94H 2FRGP 4M7JH 3KDPB 3MKKA 2W91A 5IT2H 2H6PA 4ZSOB 3RURA 3MV9D 4AUYA 1EZVX 4XPGH 5HDLA 4Z3EA 1DVTA 1MRCL 1DEEA 5AW3B 3T8VA 1I53A 2JELH 1ORQA 4HA1A 3SY0A 3RHWF 3TF7C 4O02B 5AVYB 4L8SA 4WEMB 3ARGD 5E8DH 4ZUWB 4HCRL 3V6OE 3MTXA 3IGFA 5DZOA 2HJFA 5CS7A 5GGQL 4HT1H 5E2VL 3QDJE 3SCMC 2H0FA 4NP4H 4IBUA 2I69A 5T5FA 1R9FA 1ZHKB 4W9EC 4XMLL 2OI9B 4PR5B 1YN7A 1Q9KA 2W9DL 1BF5A 1IM3B 2ZCLL 3KGUA 6FABL 4ZS6C 1X7TA 3REWA 4DEPB 3MUGA 4Y19A 5LKNA 2VMEA 1IKNC 5EEWA 2GTWA 4PRBA 2QV4A 1MFAL 4M5TA 5AVQB 3QC5X 3DV6A 4Z7VE 3O9WA 4Z78B 5IIEB 3QFJE 2EKSA 4W81A 1HL9A 5AVVB 3H0TA 4EN3C 3MDJA 3SDXA 4HSAC 1ONQB 3HG4A 4OCYL 3O45B 1KGUA 4O2EA 3QUZB 1WE5A 3CNKA 3IKCB 2PO6B 4U1LB 4OZIA 5FUZH 3CH8A 3W81A 1HU8A 5IBUB 3ZKMD 4DESA 3Q2VA 5AUMA 1MKFA 1MCKA 1A4KB 2DIAA 3VFGH 3L3JB 1JHTB 2FT6A 4KK5C 4RESB 4AIEA 2X4QA 2NMSA 1U8PA 4M1GL 4X6FB 2YSSA 1OSZA 1WA2X 1UWGL 2DQGH 2ROYA 1TJIH 3OHXB 3BP6A 1USZA 4NQDA 3R7RA 1AGCB 4WV1A 5DMIL 3CFIC 1U3HD 4KZDH 4UIKL 3IVKB 1Q0YL 3DTUB 4APQD 5MERA 4M6OL 1LDPH 5I8OL 3TYFB 4AEFA 3P4NB 4RRPA 1NAKH 5SWSB 1RIVL 3JWOL 3V2AR 4DUXA 5J9PA 1OB0A 2XWXA 3D50A 4PJFA 2FB4L 5K9KB 1JERA 4PB0H 3MJ8A 1P7QA 3QCVL 1KGIA 3QUYB 5IR1A 1DBJH 1OVZA 1QRKA 1S3KL 1H3VA 4MCZB 1KXHA 1BZ7A 5JHLA 3MRHA 2H4EA 4ODWB 4QOKA 1WF5A 3FB8A 1I9EA 3SGEI 3CSYA 1XIWD 3CLEL 4OM1L 5JIKA 1YPZA 1HZLA 3EYOB 1A7NH 3OJVC 3B9DA 5JUEH 5A3ID 5I30H 3RILA 5LGHL 3AY2A 1IARB 1KJ2L 2K78A 3BZ4A 4NJ9L 4XR8C 5J11C 3FTWA 1H15B 4D0BB 3QO0B 4LKCB 2JIXB 3MNVA 4DP4X 2FEDC 2XUWA 1MWOA 2X10A 2VN3A 2MHAA 1GAFL 2CK0L 2AERT 4TULH 2HT2D 1CE6A 1FG2B 5DR5L 1KLFB 1AO7A 4MB5A 4YDLC 3TIDB 3I6LD 5IBTL 3WIIL 4ENED 2FVNA 2FX9H 4GQPH 3VGFA 5I17B 1IQWL 3KR3L 3RWCB 3N91A 3IFNH 3D0AA 3OKOB 5E8NA 1IQDB 4MJIB 1LQBC 3KL3A 2EO7A 1IM9D 2X2HA 2YN3A 3F12B 3D5OF 4IOIB 4K0OA 1ACZA 3PL6D 2OCCB 1QFUH 3CVBA 1PLCA 3GSQA 1AKJA 1SJMA 1REIA 4JPWH 1LP9A 3CFBB 2ALWA 1X5JA 2NY6D 3FTGA 3H7LA 1S4IA 1JD7A 2EYTA 5E00A 3AU0A 3KYMB 1MCEA 3ARDA 3DJRA 4A2DA 1K8DB 1CFVL 4Y4HB 4HQQH 1LE5A 4Q0XL 4D0CB 1KN4H 4PJHB 2HT3C 4O9HL 4C4KT 2E27H 5KYXA 4HLZH 3P11H 4IGBD 4D2NA 1YN6B 5C6WH 2CBTA 2FUQA 4HZAA 4A6YH 4OCXL 2YRLA 3G6JE 5ITBL 4PJ5D 3O3DB 3UZEC 3QNYA 4A7GF 3GJEA 3ABLB 1E5BA 4JDVA 2PR4L 5T1LA 3V4VB 4G6JL 1JGLL 4IBSA 4X0NA 2F54D 5L88H 1U8MA 3L1OL 1PNCA 1BFVH 1NPUA 3VTAA 2HMID 2VM3A 3BAWA 1HL8A 3MR9B 1RU9H 2NY3B 3TJHC 3C87A 5CHNB 1WDAA 3QISA 1M7DA 4NO0D 4X4ME 1TVBA 2X4OA 3D2TA 4TUKL 2E7MA 2GTQA 4NFCA 3I3DA 1A7PH 1BZDA 1I7RB 4PQXA 3BPOC 3S6CA 2WZ6A 2X53A 4N24A 4B9IA 3RJDA 3ARBD 4K7PL 2G0LA 1PAMA 1IGCH 3UYRL 4P2RD 5B3NA 4LLMA 3BUQA 3G9VA 4HCIA 4OD3H 1JVOA 2EC9T 4JZJC 2E9IA 3B56A 3BKYL 3L5WB 3GDCA 4JFEA 2Z31B 4KWUA 4AQAB 1HXYB 5I1AA 3PWNB 1Z9PA 4QHMA 4UTBH 4BQBA 1XR9B 4XZUA 3TEUA 2KMWA 1YO4A 2X4RA 4X4XB 3TN0C 5EFIA 2WVSA 1JP5A 3C2SA 4UV7L 5I6LA 3BDYL 2NOYA 1NA8A 1V3JA 3BEWB 4ZMWA 1HI6B 3MRCA 1G9MC 3P3YA 3IU3A 5DUJA 3BHBA 1QLEH 2DMGA 3ZTCC 1M1SA 1DQMH 1DVFC 1WK0A 4QTIH 5CN2A 4EI6B 4JO1L 1RUQH 2ID5A 2M26A 5KSUA 2GABA 3MRMA 1Y18A 1YEDA 3WTUA 4ACTA 2O6CA 4AX3A 3FT3B 5BZWA 2PWEA 4UT9H 2XV6B 5E5RB 3V7MA 3V6OA 1WH0A 4KY1H 1VCAA 3ESOA 2GJPA 4KUZH 2Y5QA 2QVTA 3GINA 1FFPA 2ZPKH 1BQKA 3HZMB 1O6VA 2A9AA 3RX7A 1WPCA 3HC4H 4ZUTB 4Q7DA 4ODBD 2R0LH 4HYTB 2ZSVA 3O2DL 3DUSB 5HGAA 5GJSL 3VFTB 1V55B 3NA4A 2W38A 3P54A 2KL6A 3DBXA 3L1GA 1BA9A 3ZMRA 2A73B 3G5ZB 2NY1D 4GBXD 4H40A 1HQRA 1WUZA 3MBEB 4UOZA 1HHHA 2ZP0T 5K9JL 1TVHB 4P57B 2CIKA 3VXNA 5JO5A 5E1GA 1XGPB 2NX5E 3PP3K 5B1AB 5TE6L 3NRPA 5D7KE 3AMKA 5CZVL 4P2RE 4OF0A 3AY4C 3HI1B 1ODAA 1J12A 4B50A 5A2IH 1GVIA 1QR4A 2AQ1A 4FXGA 3RA7L 4NAJA 4OZ4A 1L9OA 1JMZA 1AXSB 2K7QA 3X14B 4A63A 1X5MA 2EDQA 3O11B 4LU5H 4P48A 4F7PB 1BV8A 2JI1A 4IIQB 5BV7C 2FX7H 5C6TL 4X98A 3OGOE 4JRWA 1CE1H 1G7JB 4GEJA 3WFHA 3V0JA 5F7DB 2DYPB 1BD2D 4UQ9A 3BUIA 2EUXA 1UXSB 3QPQC 2O72A 5I8KL 3VVVA 1YEHL 4FKEA 3CAFA 3QO1A 5IKCB 4MNQB 4LARH 4MD4B 5D7LB 2SEBA 3ASWA 1D6VH 4PLJC 3GI8H 2HVBA 4MJ6A 3ESNA 2NYYC 4ZMLA 1JNNH 2XNAA 5D1XA 5GRUH 4P4KD 4U4IA 4TSBH 5CGTA 2VDNH 4XHJD 4NNPL 2P5PA 1O5PA 2C7UA 3OPUA 1ZXQA 4RCAA 5DWPA 2X89A 5GGRA 3APNA 2VDPB 4PS3A 1YMMB 1UENA 2XWTB 4G8IA 5EN2A 4EUPA 4CVUA 2E0PA 4KXZH 1N0XL 5H37A 3MN8A 4L8CB 3NFNB 4OKVA 5IW6A 5LHDA 3B1UA 5C07E 3SBWA 3D39D 3F58H 3P0VL 3EOAA 1ZWIA 2FH8A 1QR1A 1UD3A 3NFSL 2PMZA 3K8LA 1DP0A 3B2PA 5CD5C 2DLIA 5BV7L 3N1MC 2JB5L 2KLTA 3LSOA 1YEKL 1JWUA 1I8KA 2DWYA 3OAYH 2XG4B 1FL5B 4P2YA 1I1AB 1F00I 3O8XA 2V9QA 3G08A 5JR1L 4OF7A 3SJVB 2E5EA 3QCTL 2WTPA 1FVCB 3V4PL 3JV6B 4KK8C 4F57L 2FNBA 1NUGA 1DL7H 2YD1A 1J8RA 2CHZA 4H26A 3RLSA 5IHBA 3TO4D 4XMVA 2D3NA 3A47A 2RQ8A 1XO8A 4BFGA 3ATEA 3HC2A 2WBJD 2MFNA 4DN4L 2DLHA 1JPEA 3MRPA 4I5BA 1NCDH 3RE0A 4FMFA 15C8L 4GH7B 2WKLA 4AYGA 2P46B 1Z66A 3IGAB 1SEQH 4XVSH 5I15H 3L3OB 3EJYC 4NQCE 3GK8H 2X1OA 1PW3A 4XVUC 4LL1A 2P80A 4IQHA 1Z9SA 3GSNL 3FT2B 4XNQA 1KJ2A 1U2YA 1L9NA 3TEYA 4ZXBB 1MJ7L 2XIDA 2MKWA 2QGBA 2J1WA 3OKMB 4M8VA 1F18A 4OLUH 3B37A 4M6NL 2VLKD 3QNZA 2X0WA 1LO2H 1EFQA 3PXLA 1AY1H 2YPLE 2Y72A 5FHBH 1ACXA 1FL3A 3G6JA 1KJVA 3BD3A 3VXMB 3KZ8A 1DBML 1UWFA 4N0YH 3P4LA 4QRSB 5CJOH 2EDOA 2ZUYA 4WKZA 4OLZH 2GT9B 4R97C 4XNUH 1CZ8H 2LAGB 1CFSB 3E8VA 4G9FE 4QJ5B 1BWWA 5CU5A 4WUKL 3S4SG 1QX1A 1IB5A 5DVMA 2K9FB 4RMRA 1SJXA 5F7MC 3Q05A 3PQYE 3F8UB 3EG9B 3OG6B 5D1ZB 2Z1PA 3HMXL 1S78D 3HS0A 4HWZA 2VDLL 4FYRA 5E95B 5C0EA 3BE1L 3AB0B 2GFBB 3PDOA 4Q97A 2OP4H 1SXZA 4NKMB 2AI0L 5FB8B 2EIBA 3DLQR 1I3GL 1JTTA 1NCBH 2JKWA 4FMVA 3UTSA 3PIQA 1KTBA 4P5KB 1VFAA 4X42A 5FYJD 5K93A 3UOAB 1E8YA 3BDXA 4YAQB 1ZMYA 4JM2B 5FHAL 1GGUA 3ZDXF 1EO7A 1T4KB 3B83A 3GZOA 2C9UA 4MMXB 3VWKC 2X70A 3TA3A 3VSTA 4AE0A 2V8MA 1F90L 3QR1A 3BLKA 4HXAL 3VDBA 3VFOB 1FG9C 3IETA 2ZKHL 2VWEE 1NGWB 3OX8B 4L1HA 3HRZC 4Z18A 2QSCH 1XGZA 3AG2B 4E9WA 1PMYA 1A6UH 1T83A 2KUTA 2F53A 3S35X 3BAIA 4ADGA 2X6CA 3T09A 5GGUB 2KKQA 2PXYB 4FLQA 3B6SB 3DI3B 4WWKC 4AQ1A 5JXAH 3NEXA 4GKOA 4CGUB 4K3DL 1JPGA 2DOCA 5IHZA 4JQIH 2NNRA 3UBHA 1AI1L 4Y1TA 1XL6A 3X1FA 4Z76B 3BQUA 1N64H 3WKML 2CO3A 5SWZE 4D9RE 2QQNH 2BC4A 5F7WC 5IQMA 1Q1PA 5HYQA 3IAQA 1JNHB 1T5XA 3C12A 4XGZA 3IM1A 5IB4B 3GSXA 4XCNA 4ADIA 2WV3A 3LEXB 1NGQH 4WUUD 2XWRA 2E4TA 4CU7A 2ZSWA 3GLDA 1XR8B 3OPZL 4YEFA 5H2BA 1PLAA 1HN1A 2P8MA 2VOTA 2ZE0A 4HS3B 1MG2C 3WJJC 1T0NB 1MCRA 2RHEA 4GIPD 2FJFA 4KKNA 5MHSD 3DX7A 3OKNA 5BOPA 4AQZA 2MTPA 1KPVB 3O4OC 2VXTH 2DYSB 4D3CH 3Q13A 1MW1A 1ZDQA 1WUNT 3NN8A 4L1LA 4MMYB 2VXUL 2H1PL 4IDLA 5KVFL 1FDLH 4OGZA 4BFNA 1TMQA 3EJQA 5D7IF 4Y5YB 3RGVD 2EJ1A 2DQ6A 3TNNB 3EF4A 4NSKA 4Y2DD 1IVTA 4L37B 2HG5B 5C0DA 4UT7L 3NJVA 5FOBB 4A1RA 4JFDD 4UQCA 3O2DA 1NKGA 2R2EB 2VO8A 3WNJA 3K1DA 3LZLA 1S6NA 3DUHA 4OCWH 2VH5L 2C4FT 4NIKB 1QSEE 5IEHB 1OOAA 4B9ZA 5BS0D 1I3RA 1G43A 3MO1A 5TPWH 4ZBJA 4AXWA 2Z91A 1D9KD 1LO4H 1BIHA 5AVZB 1S7RB 3BT2L 4UBDC 2WXMA 1MRDL 1KCVL 2CR0A 3GMMA 2J2ZB 3NIDF 2TRHA 3DX3A 4MA8H 3F7LA 4JM0A 1VFOA 3SN6N 1U8OA 1XGUA 1HZHL 2HFTA 4HJJH 3EXJA 2XACC 3BSZH 3AU1A 1CXLA 3Q1EA 3M1OA 5C07A 4BELD 3IU4L 2XN9D 3V79C 1IGIL 1PAZA 1LO0H 3FRPB 1ID5I 3DDGA 4N1EA 1Q38A 5ANMB 5IJKC 3KMDA 4LHUB 3TBVA 4P3CL 5BVPL 5IMKB 4EQ2A 5MHSE 4PJ7F 3OXRB 2EDRA 2UWEB 3QIUB 4OCMC 4EO5A 2QQQA 4AV0A 4FG2A 1AZUA 1KXTB 1XGTB 3FUHA 4W70A 1BHGA 3VFSB 3EHBD 3R4DA 3SGJC 5MEND 2GTZA 1A0QH 3FHAA 5B1BB 1PF3A 2E6QA 1KENH 5C0BB 1JZGA 3IN0A 4M03A 4PREA 1RUPL 1R5IB 3O6KH 4JRYB 5JA8B 2XPZA 5D1QB 4HDIA 1NFIB 5DRZB 1S7UA 2YOCA 3S3SA 5CSBA 2M8XA 4FXKB 5IK3B 2XCMC 4YK4C 1I9RL 3S48A 1U4FA 3MRFB 1SBSL 1DJSA 4LNRB 4F37K 1VKXB 4HMDA 4B53A 4K8RD 1X4ZA 2AJVL 3KXFE 4LCYA 1CXHA 2CJUL 4KKLC 2NZ9D 3DJZA 4FA8A 4NQCA 4B60A 1OTUC 1TJGH 2VYRE 5HXMA 4R9HA 5IVXF 3AWGA 4G5AA 4IMLA 2WPGA 5TJWK 2GCYA 4PBVC 3WHXA 3AW5A 5CWSB 3ZLQC 1BLNB 3H9HB 1A6PA 3EJZD 1A7RL 4CKQA 1N2RA 2WQSA 3O2VL 2LR4A 5AZ2L 3BRGC 3TL5A 5I73B 4GMSL 1T1YA 4ISVB 5PCYA 3V0EA 3V4PA 1WBXA 4HMCA 3VRLF 3L54A 1ES0B 2D9QB 2ZXBA 1UJ3A 5DI8B 4KNUA 1ZDSA 5F44A 1BX2B 4KK9D 4JFYA 2WGXA 3TXAA 1S7VA 3TZVC 3FOLA 3JWDC 4XCCH 4NM8L 1T7ZA 3O3BA 2DQCH 3IXAB 2FIKA 2G5UA 4YWGH 1KIRB 4AYEC 2YD8A 1F56A 3ARYA 1M9SA 4TV3A 2RBLA 2IALB 5B8CA 2JH2A 3VI4F 5JW3L 3FFOA 1RERA 2X12A 2QVFB 3QAZB 3CXDL 1DUZB 2R0KH 3NFPB 4DF9A 5I6NA 1WZAA 2PR9A 4AVIA 1YC8A 4H8WH 2ENPA 3GSNA 1IGFH 4NBZB 1GSMA 3PPEA 3KPNA 5E6UB 1JZ4A 3WIAA 2WXJA 1IEHA 1I7TA 5F7UA 1R3HB 5DVNA 1IBBA 1INEH 3U0WH 2Z9TA 2N4IA 2CKBB 4HPYH 5TH2A 3T8MA 3VMOA 1S9KC 3OR7B 4GJTB 4M6ML 5I9QC 5EBGA 2H1LM 5BVJA 1O9VA 12E8H 3KH4A 3J7HA 2D0FA 3MLXL 2A9NH 3IDIB 2D2OA 3MUHL 5DHDA 1RVFL 4I48A 1Q94B 2RCSL 4PRNA 4UMGA 4LOUC 4YR6A 3SE3A 5IW1B 2I9TA 1S8DA 3QJHB 4OFIA 2R0ZL 4N8VB 4PJCF 4PMEA 4U6VH 4JM4L 5E8PB 1OAUH 3HZKB 4I3RH 4TQPA 3M7FB 4JBSA 2JMRA 3CVIL 4Y2OA 1T1XB 2BP8A 3HMXA 2HKFL 3V0HA 4TVPE 3NK4A 1ZA6A 1OAKH 4PD4K 5C09A 4JO3L 3GFUA 2YGOA 3DXAB 4JG5A 3SYPA 1WSST 2DS4A 3CVHH 1PIGA 4PJAB 5DC2A 5CBEA 2MQ3A 1F13A 2AV7A 2BK8A 3MV8E 5F96H 4OSUL 4WO4B 1EFXA 3L6FA 2WUCL 3GRWH 4POUB 2VLJD 3AJ7A 1LWRA 1MNUH 2WXPA 1U6AL 1R46A 4OIIL 2ZG1A 5T5NG 1D7BA 1B0WA 3N0PB 3DTXA 3ILQC 2BZDA 5D70L 4JVUA 4GQRA 2HVKB 4UINL 2FBRA 1W15A 5E94A 2YAMA 3ZE0B 3ZRCC 4OB5H 1YVLA 3WELA 4BK4A 1NMAL 4OQ1A 3UG3A 1TZGL 5H8DA 5I1JL 4MRBA 5FECA 3L81A 4G6AC 3KWXA 1T89C 3CFKB 4IMKA 4R4BB 2FECL 3SPJA 4HJGB 5EC2A 5IEKA 3HI5L 1MVYA 1ZVSB 3ERXA 1IGJA 2KDGA 3F6IA 3IT8D 4FX5A 2HYMA 1GRWA 5BZDA 2OXHB 1Z9MA 4NO3B 5AW2B 2XWBA 2GC4C 4ZDHB 3OM3B 1TR7A 5H94B 1AP2A 4J3SA 1F1AA 1OD9A 4AQOA 3L3DA 5JW4M 1QSEA 2WNKA 3L7EA 4QGYA 4BUHA 4YXHH 2X4PA 5K9OB 4LL9A 7FABH 5LN8A 2G9HB 4NC1C 1MI5D 1Z3RA 4W93A 3BGMA 3A23A 3KPQA 1V3MA 5DQ9B 5FYKD 1G84A 1N8ZB 4LPCA 3FB5A 2NUPA 3R8BB 2WCPA 3HHRB 2KQNA 1FNAA 2WOBA 5D7SL 1T2JA 1S7TA 2K4AA 1OF2A 4KTDH 3RVVC 2VLJE 4Q58C 4F7KA 2Y6SC 4GXUM 1KTLA 2PP7A 5T1KA 3BH9A 3ZKND 5C0AB 4LLYA 3VH8B 1L7IL 3AM8A 1UA7A 2EXWD 3U36B 1TPXC 2OA9A 3LNHA 1ZLWH 5D8JH 1F11B 2X2YA 4LSSL 1YNTB 4LVNB 1RZ7H 1YNLL 4O5LH 5MEQA 4WEEA 3Q8CA 2VAJA 2JJUA 2UX7A 2E46A 1VERA 1MAKA 4KMQA 3VXRA 1E4XL 4GRWE 3MVSA 1P1VA 1E7UA 2DQUL 4IOFD 3KLHC 2QADB 3QUMH 1CCZA 2OW7A 4BE5A 2ZAHA 1RZ8B 3DX4A 1PPIA 4FNLL 4DWHA 4JDTL 1A7QL 4C4KO 2ZUXA 3T1FA 5TK2A 4POYA 1SVBA 2IQ9L 3VTTA 2EVIA 4TSCL 4AG4H 3DOSB 1BYPA 1RPQA 1E9PB 3NCXA 3ARZA 4GO8A 5ACZB 2Z7YA 1BVZA 4FP8L 2XBDA 1P0SE 7PCYA 3FXIC 3K4ZA 5E08L 2HTLC 1HCVA 1IO4C 1TTAA 3ZXAC 3HB3B 4FFTA 5KVGH 1AXTH 2RACA 2MSPA 4H20L 4XCEA 3VGHA 4E36A 3GS7A 2HRPL 4HJ1A 4N0CD 5AB9A 3KWWB 1YEFL 2YKLL 3D6GA 3GD1C 4CC1A 3U46B 1OGPA 2CCLA 2WAHA 3VYNA 3FSAA 1DO6A 2IAMC 4UB0L 1AXIB 3WNMA 1JZJA 4X5WA 4XWOC 1MW0A 3DJTA 4L4VA 5DCCA 2OMUB 3CTTA 2QKIA 1CTMA 1HSAA 3BVWA 1PD1A 3VG9B 5KSBF 1A1MB 2F58H 4KO9A 4P23C 3QQ4A 3HG3A 2P48B 2PCXA 3QORA 4XPBL 2N0MA 3I2CH 4YSQA 2YQBA 3P0YH 4DGIL 4QRTA 2HH0H 4HHWA 4AZ8B 4ZZKA 2EUVA 1IMHC 1NIAA 3IB4A 2D7PA 3RWIA 2VC2L 4AMKL 1PEZA 1JTPA 4Z5RA 3LS5L 3GIZH 4XOCA 4I87A 5EV7A 2MMXA 4LIQE 3GUFA 3BD4A 3TBSA 2LU4A 5C7ZA 3UBXA 1BVLB 3ZTNL 4R2GC 1AFVL 4G71B 4IKLA 2OSXA 3FAWA 5JIPA 4ZW5A 4YX2L 1FZOA 2ITDB 1XH3B 2JKLA 1BQLL 4QI3A 1NZRA 1KBWA 1T1WB 2CCVA 5KYWA 4L8DA 1AMYA 3PNRB 1DBKL 4QY8B 3GUTA 5F1SA 1AGFA 4DP2X 5A43C 3NA9H 4NQEE 2NT1A 5JOEA 2PTTA 1AHWC 4CMHC 2AEPL 2BS9A 4OGYL 5HJBA 1A6TA 3Q3GB 4U6XA 3BP4A 4MB1A 4IK7A 4K71C 3O9WD 1IC5L 1X5XA 1KELH 3Q8BA 1YZZA 3QEQD 1CXKA 2JJSC 5B4MC 1UTDA 4OZFG 4LF3B 4MTMA 2BO0A 4ZX3A 2XI9A 5BMFL 4M62L 1FJ1A 4KQ3L 4WWOA 1J8HE 1MH5A 1XH1A 3H4FA 4BFKA 1HHGB 4PJIF 2NW3A 2V9RA 2NZIA 2V8LA 2CAKA 1KFAL 1W0WB 2J8UA 3KYAA 2DIEA 4N0FB 1I7UB 4Q9QL 2X3CA 2L0DA 2BIMA 4ODXA 2ADGA 1ED3A 2VB5A 1NC2B 1EEUA 4GLRH 2ZWSA 1DVQA 3C60A 2XOTA 2RAMA 3RVWD 5IWLC 2PLTA 1KF9B 2EIZB 3D0LB 4NQDD 4AT6B 2A3TA 1FIEA 2IH3A 2NDFA 3JZ7A 2PYEA 3DJSA 4GAYB 4UAOC 1CTOA 3PGCB 1H0DA 3GMPA 2PCPA 2WYIA 3MCYA 5D6DA 4GSDH 4M48H 5D93C 1Y6NR 1G6RL 3RTQA 4GT7A 4O00A 5DUBB 2BMKA 3U2JA 5J12B 5L8KB 1HIML 1JPSH 2VLLB 2XC8A 3PL6B 5JPNC 1ZSDA 1A14L 1G0YR 3AT0A 5FO7B 5J1AB 1FZMB 1P7QD 1TZOA 2L3BA 1PEWA 3IPBA 4P5MA 3RDTB 3F7VA 4PJDE 1XMEB 2C9AA 4MXQC 4QRBA 4XP4L 4H13C 1UCBL 1Y6MR 3QI9A 1A6VL 1X44A 2YZ1A 5ACLA 1BAFL 3B2XA 3HPLA 2BOCA 3UTTE 4J8RB 5K1JA 3EZJB 1XSKA 1PSKL 1FYTE 3SD5A 3T3MB 2MTAA 4NEHB 4MZRA 3MZGB 5F9WC 4CMMA 3IAPA 1IAKB 1QI4A 2K8QA 2H32B 4A6YB 3ZO0A 3B3IA 4S1RL 1AO7D 1DUYB 3GMOB 4S1DC 5B1JA 4DEPC 5FWRA 1JHKH 5DT1L 1MIEH 2C1PA 3E6FA 5E51A 5ESQB 3WDHA 1NOAA 5E2JA 2PYFA 4IDJL 1K3IA 4Z7NE 2EE9A 2VXVL 3NDYE 4J28A 3N41F 1X5LA 2BNRE 4EI5A 1MIML 4YBQC 3ME0A 5DLML 4PVNA 5HI5D 5KBDA 1JK8B 3ARBB 5FK9A 4H1LG 2APSA 1VEMA 3VXPB 1EEYA 3DGGB 4X7FC 3BQVA 1DQJB 3GWJA 4FQQB 2DWDB 4O02L 1R5VB 2NY4C 4KJYA 3RWFA 5GS0L 4XP5L 3MUUA 4XOEA 5CN1A 2X9ZA 4HWBL 2GITA 4LQFH 3UPCA 3OL2A 3RWJA 1PY0A 1HHJA 1SM3L 3KCWA 4XXDB 1G9HA 3ARDD 1PLBA 4OCSL 3QXAA 2CK2A 2WB1A 3N42B 4OT1H 1OAYL 3WUWG 5A16A 3FK3A 4OZHA 5L8JB 4WI9A 1P7BA 3FT9A 1NDGA 2MCPL 3SKOA 3FT1A 3P9MA 5EMYA 1NBVH 2OBGA 3ARFD 4GW1A 3V5KA 1QLEB 3W9DA 4PJXF 1J0JA 4W9CC 3ULUD 2DQIL 1Y0LA 4UAHA 5E8OA 1QPKA 5T1LD 3VFMB 5AAPA 3WLWD 5F7HA 1WS8A 5F3BA 3FQ4A 4PJ8C 2GY5A 3H2PA 2DYRB 4PS4L 1P84J 4W9FC 3ZO9A 5DYOB 1ET5A 4YUEL 4ZAKC 2V0AA 4RBPK 3BFWA 1U8LB 2V33A 4OAWA 1HE8A 2KBGA 5AOZA 3U0PB 4QAWA 3A6BH 1LDSA 1XCTB 1T1ZB 2Z8SA 4H0GA 1HWWA 8CGTA 1WFTA 4OTXH 2VERN 2XFXB 5HVHB 4RQQB 4K7PX 1MJUH 5DJ0A 3ZQWA 2QMJA 1NANI 3HBQA 4R5XA 4JE0A 4NJAH 2I07B 2QT6A 5F1NA 3BH4A 2ODIA 4FQ1H 2EABA 3FO1B 4PRDA 3DC0A 4OJCA 2UUDK 3PWLA 1OK0A 4QXTA 5DYFA 1J0HA 1ND0A 2A6DA 4JLRB 5D2LB 1GJUA 3RWEA 2NNAA 5E8EB 5KS9B 5IW3A 4WF7A 4CW1A 3EGSA 3SBRA 2R7EA 3TNMB 5KVDH 3QUHA 1GPOH 2BS8A 3TEWA 1UVQB 5JMRA 4Q89A 4JJOA 4NC2B 4RWYL 5FO8A 3IXTB 1LEIB 4JY5H 1E3ZA 2F19H 5B39G 3PAVA 4OLXH 3T6QC 3MXVH 3EYUL 3QRGL 2I32A 3ULVH 2VRAA 1JYXA 1HINL 2K1MA 3ZZQA 5EORL 3B9EA 5AALA 3HG1A 2YEQA 4OZGF 4HUNB 3L2MA 1OL0A 1BOYA 5HHMB 5FCUL 2G4GA 3V5HB 4PRAB 3CIQA 2IOOA 4GW5A 4JFFB 4H25B 2IH1B 1VFUA 4HS6A 1QYGH 3CQFA 2BSBA 4ORGB 3KLLA 4F5CE 1F2XK 1HHKB 3FMGL 3RTLA 2VDNB 2WP3T 3IFOB 4I77H 3GO1H 3Q7JA 2YXVA 4G8EA 3MJ9A 1CVSC 4LE8A 4Y4HC 1CFQA 4JMXA 4DZBA 1X7QA 2IANB 4YOKA 3EBHA 1ZV5A 3HHSA 2B0SL 1NLBL 3VGEA 1R3JA 1Z0NA 2J88H 4DN3L 3D2UA 4QO1B 3F5WA 2YZ8A 3NZSA 4P46A 3RI5K 2FH6A 1BQHB 5AW0B 3PGDB 3MLPA 1N5YL 4L8BA 5IREA 2VSCA 3AAZA 3LPPA 3V6FA 4F37F 5DHVH 2J7LA 3FCGA 3JUYA 2N56A 5SWQA 2NY3C 4DAGH 4HU8A 3A4AA 5HDRA 5CNHA 5GGQH 4FQCH 1TZIA 5E2VH 5E2TL 2FR4A 4LDCA 5EZOL 1T66D 2BDNL 2FCBA 3INOA 4M4PA 3B7TA 4POZC 1LTXA 4BK5A 1T5KA 3GMNA 4P04A 3TBYB 1YJDH 2KERA 2W0FB 3US9A 2WWKT 3AXLA 4WDIB 2UXGA 3VYPA 2F5AL 6FABH 3LRHA 1E9OB 4L0PB 4BQ6A 5D1XD 1GJIA 3BPLB 5HHQB 4FNPA 1CO1A 1WISA 4M3JA 4KMTH 1CD9B 4MHHG 4EUPH 4BH7B 2X89D 2A77L 2LVCA 1WZLA 2OR9L 3ZK0A 1S9XB 1L9PA 2X05A 2JK5A 2ORBL 3ECBA 2EEAA 1BGXL 1Z5YD 5C7XL 1SVZA 4NZRH 4YSAA 4Y5XA 3D4YA 3MROA 1ZHLA 4W9DC 2BP0B 3V4VL 2YK1H 1XTMA 1DANU 4OQTL 4FKKA 2FYYA 2WQWA 2W95A 3OJ2C 3QXDB 4E5XB 3KEHA 1NCAL 1ANUA 4BHUI 1S9YA 1ZE3H 1KT2A 2KLSA 2J3SA 1R0AH 3LV3A 4KKBC 3WTSA 3ECVA 1KCBA 3UTTA 2DQJH 2G3NA 3O8XD 3WS3A 2BZCA 2Z3FA 5DEFB 3D07A 1H8LA 3WFEL 2IEPA 4U1IA 3WU1A 2XZZA 4ELMF 1CG9B 1L6PA 1Z9OA 2PCFB 4AVKA 1QTPA 3BSGA 4YVUA 4ODUB 2JWYA 1DVXA 2K0RA 4UIKH 4YHOL 4HFWB 2WLZA 3HNVL 5F6HI 5K1NA 1WRFA 3K6OA 1TFHA 2V7HA 1T21B 3JTSA 2CZNA 3SQRA 1TKWB 3SGEH 4L18A 1G6RA 4N6RA 7CGTA 3AT8A 2XY1A 1HDMB 3EADA 1XGQA 5IVZA 1DJZA 5F7EL 3BZ5A 5DRNB 4ZD3H 4KNTA 2AKRB 4EN3D 1OAXL 5A1AA 5DRXA 4WK0B 1OSYA 1J11A 4KXCA 3DJ9A 4JDEB 3RX9A 3HAEG 1P2CB 1YNKH 4Q14A 3PWJB 3LRLA 4IIQC 1S9VA 5CZXD 2Z8VC 3MJ6A 3AVEA 3LKNB 4B7IA 1D5IH 1B2YA 5AW9B 2P80D 2WVVA 1E50A 4V2CB 4ZFQA 4MWFA 3FBQA 3MZTA 3PP4L 1EHXA 3WTTA 4MDJB 4Y16C 3MU3A 5FDYA 4R84A 3DYMA 3CUPB 2F74A 5AL0A 4WVRA 5KVEL 4GMTL 5KWYC 2HUHA 3U4EA 1GL4B 4E41D 3VD7A 4DIXA 1A3RL 4Z3TA 1IBGL 3RFZA 4UM9A 1FIGL 1QO3B 3PGFL 2W59A 2AQNA 2P8LB 4XXCC 3O0RL 2IFGA 5FV2A 1NDMB 3KNBB 4HIHB 1F58H 1CL7I 2CGRL 4YXLL 2D73A 3OKEB 3RY4A 2XZQL 1F4WL 4D0DA 5EBWB 2A1WH 4ZSOA 4CDGC 1K8IB 5HGDA 1BVOA 1UQSB 3VGDA 2XTJC 4ABQA 4GB9A 4PJEB 1BZEA 4Z3IA 3D12B 4OCRH 2CLVB 3SE4A 1NUFA 3KG5A 3X12B 4O02A 4XN8A 2QDVA 5KZCD 1CDCA 2P5WD 3QEUA 4ZUWA 3ZTDC 4BCXA 5A2CA 3BVDB 2K3TA 3VFRA 1UKSA 2WD0A 2Z7UA 1I1AC 1YQVH 3EFDH 4M5YL 5CP7B 1IFGA 5LGJB 4KRLB 3T4AC 1CFVH 1JNLL 4LXFA 4RZCB 1ZHKA 5T1MB 3UTSD 1JYVA 3AXHA 2X7LA 2QPFA 2J5LB 1OAJA 1MG3C 1UD6A 2V2WB 4ZNCD 1JZ2A 1IM3A 2PETA 4M8RA 1YY9D 2OAAA 1RHHB 3DSFL 1YEWA 2RFXB 3QW9A 3SDDB 3CMOH 5F3HB 2PR4H 5E7BA 1KWKA 2VDPL 2X2JA 1E40A 4NQQA 3S36L 1P84K 8FABB 3U2SB 4MJHA 3PYCA 3SPVB 3LCYA 4CAGA 4Z78A 5IIEA 1U93B 4FNUA 2CO6B 1JV5A 3RUGB 2EDFA 4MASA 2ZUUA 2F53D 1ONQA 1NBZB 2ZUQB 4ODVH 3RJQB 4E41E 2BW5A 3O45A 4J1UB 5DJCA 3RVUC 3QUZA 5CJ5A 3IKCA 2PO6A 2WBKA 4NOBA 1ZS8B 1MEXL 4JFDB 1JZ6A 2ICEA 5IQOA 5CEXA 2ITFA 2GSIA 1JHTA 3C5ZB 3DMMB 1QWHA 3QWQB 4RIRA 4X6FA 3BQUD 4HV8B 3S5LB 3HE7C 3PDGA 4F5CA 1G9NH 2XN1A 2IADB 3ARWA 4KHTL 5L2KE 4PVLA 4UZSA 4ZTPL 4NT6B 3OHXA 5I1KL 1F1GA 3KPRD 4RGMB 2C8NA 4IRJB 3T9WA 2A4ZA 4P9ML 4PJGE 3D0VB 1AGCA 1MVUA 3HUJB 5CILL 1C5DB 5FV1L 3IVKA 2R0WL 3K3QA 3WIFA 3TYFA 3P4NA 2XN9B 5SWSA 1LHZA 1HKFA 1QSVA 4K5LA 3P4MA 3VXSE 1T6VN 1JXKA 3E3QC 4E2OA 5TF1H 1BEYH 2G5RA 4L3EB 4R7NA 1ZLSL 1ZS2A 4FN0A 3QUYA 2DW5A 4KQ4L 4MCZA 3FUFA 3KPTA 1H3TA 4KKQA 4ODWA 1TYEB 3RPKA 5MP6L 4JUSA 5D1ZC 5I1LB 4N26A 3BKML 3AUWB 4K15A 2WCSA 1KBGH 1RK1B 1OXYA 3MXWL 3H42L 3U6XS 3OTTA 2VJ8A 3S88L 1N0LB 1H15A 3QO0A 1JE6A 1TQCB 4LKCA 3QJUB 5AW7B 3D06A 3GEFA 2V9TA 2C9XA 4M1DH 3OWRA 4PWGA 1XBDA 2CJ3A 2C3WA 2XWZA 5GS2D 5TE6H 4B7LA 4JM2C 1FG2A 1N7ML 1KLFA 1AIFA 2LT9A 3ATBA 3RB5A 5AVUB 1THCA 3G6DH 4KROB 4RMSA 5HHOB 3A4EA 4W4NA 4B9FA 4I4WB 1AQMA 5ALCH 1V7NL 4PY8J 4BUGA 1NGPL 4HS8L 5I17A 4Y9EA 4X8JB 5LDSA 2ESVD 3FO2B 2WQAA 4GAGL 4YH6A 4I18B 2DJMA 1BQ5A 2HLFD 4NWUH 4PEEA 4JZNB 1IQDA 4MJIA 5KN5B 3O6FB 2WUBL 3LEYL 3WL9B 3CG8A 2PXYC 3F12A 4YSTA 5DMJB 3Q1SH 4IOIA 4JRXB 1L0YA 1QFWM 4NHUB 5I8KH 4PGJA 1UURA 2XZCH 3U4AA 4YPGB 2GSGB 3VM7A 5ICZB 3QVAA 4Z0BL 3CFBA 1R33A 3P1VA 1KEMH 2NCMA 3QC6X 1J9RA 3H8NA 2XICA 5IG7B 3L9RB 3RDJA 1BBDH 5HYJA 3ZHLA 1E65A 3KYMA 4L05A 5FGBC 2FX8H 4AM0Q 4AVJA 1WT5C 2ZXGA 2QQKH 5CKAA 1TIUA 2AK1H 4PJHA 3UIZA 4R6UA 1YN6A 4KKRA 4UV4L 2DBLH 4GPVA 3C08L 3O3DA 1K5NB 5DK2B 1B4LA 3BAEL 3T6WA 2F1BA 2DQDL 3LH2L 4GG6B 2IWFA 1KTRL 3V4VA 3NFSH 5GPRA 5EU3A 1ETJA 5EZIH 3QA3A 1RURL 3QJXA 5DD6A 3ES6B 3MR9A 1XMWA 1GHFH 1OTTC 3VA2C 3HE6B 1N6UA 1K6QH 1N70A 2WY3B 5D72L 2CU9A 3AC0A 5I19L 3CU7A 4NPYB 1QHQA 1I7RA 4GEIA 4W6XB 4Y5YC 5EOCJ 4L0YA 4Z7UE 1NCIA 3QPQD 5F1OB 1E5ZA 1HKLL 2H0EA 3QCTH 1WV7T 4HU2A 3V4PH 4MAYB 9CGTA 4XAKD 4YXKH 3LKQB 2BHFA 4QJ4B 3L5WA 2NYYD 3SKNB 1ULVA 4DOHE 2Z31A 3ETSA 2ZCKH 1HXYA 3HJEA 3QHTC 3U4BL 4AQAA 3PWNA 4EVNB 3B2VL 2VR7A 1DDHA 3EO0A 4JM2F 3RVTC 4KJWD 2W1NA 1Z5LB 5EUOF 3BEWA 3R18A 4FQIH 5BW7A 4CC0A 2ROXA 1HI6A 1GMIA 3ASOB 3P77B 1TZHB 2YIHA 1CR9L 3SKMB 1C08B 2YPKB 5B38G 4EI6A 4C4UA 2PPDA 5GSRB 5IBLC 4WI3A 2AS5M 1FRGH 5GS1C 1K85A 1A3LL 4H88L 2H47C 1E5CA 4ZQKA 3UJTL 2APBA 4P2QD 3BMWA 3E6HA 4LCWB 4O51B 3R7QA 3FT3A 5BOZG 3FFCE 5GZNC 3IAGC 3X13B 5F1KC 5E9DB 4E0RB 2VLRD 4YPJA 3VWJC 4U1GC 1O6SB 3UYPB 4ZUTA 4KHXH 4G7RB 4WAFA 1EDHA 1CLYL 3SZ6A 2XPGA 3VFTA 1UOWA 1T7VA 4MSWB 1GGIL 4BSWB 1RPUA 3UGEA 1DYZA 3JBG7 4RGND 3N55A 1GZHC 2A73A 4PP2B