1A8ZA

Structure determination of a 16.8kda copper protein rusticyanin at 2.1a resolution using anomalous scattering data with direct methods
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
LDTSWKEATLPQVKAMLQKDTGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLDIPAGATVDVTFINTNKGFGHSFDITQKTPPFAVMPVIDPIVAGTGFSPVPKDGKFGYTNFTWHPTAGTYYYVCQIPGHAATGMFGKIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUSTICYANIN
publication title Structure determination of a 16.8 kDa copper protein at 2.1 A resolution using anomalous scattering data with direct methods.
pubmed doi rcsb
molecule tags Electron transport
total genus 34
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 1998-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1a8zA00
1N70A 1GW0A 2P80A 2XXFA 2J56A 3OD3A 1FFTB 4DP2X 1IKOP 1A8ZA 3BQVA 3QJTB 1PZBA 3JT2A 4HHWA 3CVBA 1ET7A 1JZJA 1L9OA 4KO5A 4Q89A 2VW7A 4FAAB 2DYSB 2HX9A 2X88A 4N4YB 2IAAC 1SNRA 2CJ3A 4Q8BA 1AQ8A 2FQGA 4GP5B 4E9XA 3TBCA 4ZK8A 4E9VA 4G72B 5B1BB 3WG7B 5AZUA 1T5KA 1ETJA 1N68A 5B1AB 4G7SB 3T71A 2EIKB 3X1GA 3NJGA 3PPSA 3TBBA 4KO9A 2QT6A 4KNTA 4YSRA 5I28A 1KCWA 1GSKA 3TU6A 1KDIA 4A2HA 1SJMA 2XU9A 1JZFA 4MFHA 3T6ZA 2GB2A 1BQRA 4QLWA 4YSEA 2HRGA 3FPYA 3OM3B 3PAVA 2CUAA 1ZIAA 5B1JA 1MZZA 4BWTA 2YXWA 3QQXA 4PAZA 1BXUA 1KDJA 1VLXA 2IH9A 4W9ZA 1L9PA 4NAJA 4A2FA 1PLBA 3NT0A 2RACA 2OJ1A 1AAJA 1J9SA 2VN3A 2QDVA 3TA4D 1PY0A 2E86A 1OCRB 2P80D 1AZBA 3QJVB 1AZRA 4L0PB 3ZX1A 4DP5X 1AANA 2HX8A 3ABLB 2YAEA 4DP0X 1KGYE 4YL4A 3AY2A 3CVDA 2EIJB 1AG0A 3QJSB 1XB8A 4BDVB 2FQEA 2IDQA 2GHZA 5A7EA 1OCOB 8PAZA 5D4HA 4YSCA 1BQKA 1AS8A 1TKWA 5I6OA 1BYOA 3N55A 4YSDA 3S3CB 2JKWA 3ERXA 1NIEA 5B7MA 1OCCB 2UXGA 4EF3A 1ZDSA 1JXGA 2ZXWB 1KV7A 3T6XA 1BXAA 1ASPA 2ZWNA 1V54B 2J55A 3IN0A 1J5DA 2Q5BA 4KOCA 1XB3A 2I7OA 3BVDB 2J57A 3CDZA 3ASOB 4M4RB 4KOBA 3TASA 5FC9A 2BP8A 2GSMB 3QJQB 1NPNA 4HHGA 2BP8B 4WKXA 2XV3A 4K9JA 3AG3B 5I6LA 1MZYA 1AZNA 1NZRA 4F2EA 4NERA 3HEIB 2BP0A 2IDTA 1JZHA 2BP0B 1JXFA 1E67A 1JZGA 1AIZA 1AS7A 4UANA 4JHVA 1ILSA 1WS8A 1AOZA 2HRHA 4HCIA 4DP1X 1MG2C 1OE3A 9PCYA 3FQ2A 3ABMB 4HALA 3PAUA 4GY4A 5I6KA 2HXAA 2YARA 2VW6A 2FT6A 4GXFA 5I5MA 5B7EA 3FPXA 3MX0B 1RZQA 1J9TA 3CVCA 1M57B 2PPAA 1XB6A 4G7QB 3PLYA 4DP4X 1EHKB 2DY2A 1R1CA 1HAUA 2VMJA 3OMAB 5D4IA 2MRYA 1OV8A 1YLBB 2H47C 2HLEB 2YAMA 3NP4A 4DPBX 4A66A 2UX7A 3NJFA 1SDDA 4CSPA 4AKPA 4E9QA 2XVBA 3PCYA 4A2GA 3EHBB 1IC0A 1A4AA 1GY1A 7PCYA 4F2FA 3IN2A 3NJMA 3WNIA 1ASQA 2NRDA 2AFNA 2Y1AA 3NP3A 4HAKA 3T9WA 5TK2A 2N0MA 2EIMB 3DTUB 2PP8A 6PAZA 3V9CA 1IUZA 1ZDQA 1KBVA 1NWOA 2H3XC 1CURA 3T6VA 2I85A 3NSDA 4DP7X 1E30A 4F7KA 1ILUA 4YSQA 1WAEA 3FSZA 2YAHA 1PNCA 2PPCA 1E65A 3FQYA 3NJJA 2PLTA 1ZV2A 2UXVA 1L9SA 2JXMA 2CBPA 2FJSA 2UXFA 4DP6X 4UF7C 2FT8A 3AG1B 1BEXA 1ADWA 2EILB 1TU2A 1OF0A 2J5WA 3IE9A 2QDWA 3EH3B 2IWFA 3FSWA 3ZIYA 1IBYA 2GC4C 3IBOA 2YQBA 1JOIA 3FS9A 1NIDA 4YVUA 1AG6A 2YAPA 4YSTA 3OMNB 2H5UA 1NDTA 3AW5A 1E5YA 2UX6A 2ZONA 3QJUB 1KYAA 3EH5B 5IY5B 1GYCA 4E9RA 2VSKB 4PCYA 2HZHA 2HX7A 3UAAA 1SHXA 4BK5C 4P5SA 3X1BA 4WTQA 1SFDA 3G5WA 2PCYA 2XX1A 4JHUA 5F7BA 4AI7A 3GDCA 1JZEA 3L45A 2I7SA 3X1NA 1HFUA 4DP8X 3FU7A 3GYRA 1NWPA 3JTBA 3MBWB 1CUOA 3X1FA 1GS7A 3AG2B 3U25A 3OQRA 2MTAA 4DPAX 1TEFA 3FYEB 4DPCX 5B1KA 3FU8A 1MDAA 2PPDA 1V55B 2XX0A 3NJKA 4KNUA 2GI0A 1PAZA 3WIAA 2IDSA 3V9EA 1PMYA 2PP7A 1ET8A 3CDZB 4BXSV 3ZDWA 1QHQA 1A4BA 1NPJA 3FYIB 4ENZA 1AZUA 5AKRA 4E9YA 1GS6X 1QLEB 2DYRB 1NIFA 4M3HA 1PLCA 1DYZA 2GIMA 1XMEB 2QPEB 4E9WA 3AG4B 5I5JA 3CZUB 2XV0A 1JXDA 4HCFA 3S3DB 1KCBA 2XXGA 3S8FB 4YSOA 3PAZA 5PCYA 3N2JA 1ID2A 1IBZA 1NIAA 2EINB 3SBQA 3NJNA 3X2QB 2XWZA 3NSCA 4A68A 3FQ1A 3DKHA 3FT0A 1CYXA 1HAWA 2BW5A 3UGEA 4YSPA 1SF3A 2BW4A 4YSUA 2CCWA 2XUWA 2AANA 1JERA 1OCZB 1W8EA 1UATA 4GYBA 4TXVB 4DP9X 2LLNA 2YXVA 2YAOA 3NJHA 1TEGA 3ASNB 1SDDB 5ANHA 4P5RA 3EH4B 4N8UA 4BWWA 2DWSA 1A3ZA 5D4JA 2JFCA 3KW7A 3UADA 1F56A 2B3IA 2WO2B 4HCGA 1ZIBA 3NSYA 3WI9A 1FWXA 3FSVA 5F7AA 2BHFA 3HB3B 1FA4A 1GR7A 1CC3A 2R7EA 1MG3C 1PF3A 2WO3B 4FA7B 1X9UA 2VSMB 2ZOOA 2CAKA 1PZAA 1ASOA 4G71B 1GY2A 3X1EA 2WSDA 1W6WA 4W1TA 4AKOA 2CALA 2VM4A 3SBRA 1L9TA 2AVFA 2QPDB 1AACA 1JVLA 4G70B 2BZ7A 2IDUA 2TSBA 2BZCA 4QKTA 4YSSA 2UXTA 3PXLA 1NTDA 4G7RB 5E9NA 3WKQA 1X9RA 4YVNA 4AX3A 2GC7C 2XV2A 5I6PA 3SBPA 6PCYA 5I6NA 2Y69B 1KBWA 1PNDA 3ZBMA 1GS8A 5B7FA 3S8GB 2PCFA 2AZUA 4KNSA 5PAZA 1I53A 4UAHA 1SHWA 4BWUA 2FT7A 1M9WA 5B1JC 2PP9A 1A4CA 1WA1X 4A2EA 3NYKA 1SF5A 3QPKA 1ZPUA 1JZIA 1AR1B 2FQFA 1BAWA 4KO7A 4CSZA 4YSAA 1RKRA 2IWKA 1V10A 1EZLA 1J5CA 3FU7B 2IH8A 1BQ5A 1NICA 3WKPA 3H56A 1L9QA 1CYWA 1OOWA 4NB7A 2VM3A 1M56B 2VW4A 2AZAA 4BDVA 3FSAA 1RCYA 1AS6A 2W88A 1JVOA 3H4HA 4RH4A 1L9RA 3ABGA 5EHFA 3S3BB 5I5IA 1PCSA 2X87A 3FU9A 4HIPA 1B3IA 3SQRA 1QNIA 4A67A 1AZCA 1J9QA 2BO0A 3D12B 2GBAA 4E9TA 2PPEA 3OMIB 2XYBA 4AZUA 1URIA 2FQDA 1E5ZA 1NINA 4AKQA 4E9SA 1RZPA 4GP8B 5I26A 3UABA 3AZUA 1SFHA 2Q9OA 3IEAA 5LDUA 2A3TA 2W8CA 3QJRB 3C75A 2IWEA 2PPFA 3T6WA 2DV6A 2TSAA 3NJLA 2BWIA 2BWDA 2FNWA 2OCCB 5TK4A 3KW8A 3ABKB 3UAEA 3WNJA 5B3SB 3RYMA 5AFAA 4HZ1A 2YAQA 3CG8A 1OE2A 1BXVA 1PLAA 3DIVA 2B08A 5I6MA 2XLLA 3NJIA 3NSFA 1J9RA 3H4FA 1NIBA 4X4KA 1DZ0A 2FWLB 7PAZA 2DWTA 1WS7A 1OE1A 2IDFA 3EF4A 3UACA 1PZCA 3GXUB 2FTAA 1W6LA 2R7EB 4GP4B 4A2DA 1BYPA 4KO6A 1WA0X 4JKNA 1ET5A 4BXVA 1WA2X 2YAFA 2OV0A 1A65A
chains in the Genus database with same CATH superfamily
3BKCL 5I18H 3OD3A 5A2FA 5DEGB 1F8TH 1RUQH 2CDGB 3BQVA 4FNLL 1A25A 3U7YL 5GJTH 1N26A 3WTSA 4G8EA 1FUNA 3MQIA 1PCXA 2AJXL 3QIUB 3ARBB 1MHHB 3RZCD 3MOQA 2X88A 1WBXA 2YUXA 1I9EA 5EIIG 3QEQA 1CFNB 4PJBF 3IMUA 1D7DA 3PWLA 4UT9H 1E8WA 3BKML 2A1WL 5IR1A 3MRGA 5EEVA 1N68A 1A7NL 4JHAL 3T2QA 2R8SL 2MJWA 4MMZA 3B7SA 3LNEA 3W9DA 4UOW0 2DH2A 4YSRA 2ID5A 2P24B 4DEPB 1RZJH 5F7LB 3TM6A 2R56H 1KDIA 5F7KC 2AQ2A 4LVEA 3FOMA 4C47A 4JG1L 2W95A 5C9KA 1X5YA 2VO5A 1DBKL 1L6XA 4KMLB 1U8OA 2WN2A 5DRWB 3WSQH 4D3CL 4FLSA 2FEDD 2C1OA 1QKZL 2KYIA 4P2OB 1X3DA 1ZK9A 3D48R 1FAIL 2VKXA 4H20L 4R96A 4APQB 4YDLC 3L95A 5F7DA 4TOYH 3SKOB 4NAJA 3GEFA 4HWZB 4HP5A 3GBMH 1HWWA 4PRPA 1D5BA 2Y6SD 2A6DB 1MI5E 2GKIA 4HDIA 1AZBA 1IGML 2B9AA 4IOFD 3EHBD 4LLVB 4OGYH 5DZOA 2XKNA 4LLYA 5FYJE 1BAGA 4JM2C 5DD0H 3VXOB 3JV0A 3FFDA 4LAQH 3KXFE 1P9MA 1T1YA 3MFGB 1ZHNA 2D2CC 1NFIB 4DUWA 1U4FA 4PTTA 5BNXD 2KS0A 2VLRA 4ISVB 4LVNC 1AS8A 3CH1A 3GRWH 1Q9WB 2H45A 2F7PA 4WSGA 2YXFA 4X9GA 2OMUB 4TUOB 5DO2D 5GRUL 3RWGA 5EUKB 5IJCC 2UXGA 2X2IA 3CFJA 2VXQL 5B8CA 5BVJA 2Z91B 2WZ0A 2VLLB 2ZWKA 4PUBH 5AYUH 4ZOEA 5IQ7L 3WDIA 1OB1A 4JGJA 1ZLWH 2OZNA 2BSRB 4LRNH 3BVNB 3KYOB 1A47A 1TJXA 4H8WC 3CSYB 1UZ8B 5CHNB 5J5EA 1DJIA 3D85D 3WEOA 1U8PA 4OJEH 3QJQB 2ICWA 2VL5A 1T03H 2HVJB 4M00A 3ETTA 2DLFH 4IHOB 5BOJA 5J7CC 4ELMF 3SB3A 3QZWA 2BZDA 3SKUD 4KITB 5F9OH 4M29A 3DROB 5C0GA 2NDGA 3HI6H 1NGPL 2FSDA 4LSTH 5EZPA 3LSOA 1TNMA 1PD1A 2E74C 1IFHH 1NLBH 4XNUH 3BKCH 4XZUA 2OI9C 3WKNA 2WGNB 3MCYA 4MQ7A 4FNLH 4KJPD 3SN6N 1U3HA 2V3EA 2M1KA 5IMLB 2VLRD 2AJXH 4ONGL 1U92A 5JLZB 4G8GE 4LSDA 1ZJAA 4V1DB 3UTQA 2XV6B 4OD2A 1U8NB 1N59B 3T0WA 1HAUA 4QXUL 4PCTA 2WQVA 3K2UL 3FUFA 4H26A 2QMKA 3BKMH 2A1WH 4NZRL 1QP1A 2ZOWA 2FR4A 4JDEA 4GAAA 3LH9A 3LN5A 4YL9A 2ZF8A 1A7NH 4JHAH 3ZKND 2R8SH 3HI1A 2XWRA 4YGAB 3VXSA 1XD0A 3O2VL 1WIPA 4WEUD 4WO4C 2KDGA 5IMOB 3O3AB 2CLVA 4CJ1A 4TQ8A 2CA3A 2LOEA 2VH5L 4JG1H 1DBKH 2FRGP 1URLA 2N0MA 1KY7A 1T0NB 4D3CH 4Z7AA 4PJ7A 4A1RA 1QKZH 1I82A 1KBVA 4H20H 1PX4A 2YBRA 4YDJB 2DKSA 5J56B 3FONA 3KL5A 2CU9A 2R69A 3MOAL 1KIRB 3L4VA 3TA3C 4D2NA 4XWOC 2QLVB 3PWPD 3GSUB 3LAFA 1TT6A 2W0FA 5D1QE 4HAGA 1WQVT 4XE5B 2MWCA 2YAHA 1IGMH 5HDBB 1G7LA 3RPIA 2E7MA 3NGBC 1U3HD 3CAFA 3QJFB 1ZGLP 3UH8A 3S2AA 3ULVD 4UF7C 1FVDB 1SXNA 4IMLB 4C55A 4ODWB 3Q2VA 1CN4A 4JHZA 2SODB 4OCLC 2QQNL 1UKSA 2ED9A 3UYPB 3SKNA 5F1NA 4KUZL 5D7LA 5EZJB 3SDAC 1XF2B 1F4HA 2QELA 4ZUUB 3RVTD 5IVXF 3PHSA 4JFDB 1QFWL 3DNKA 2WXRA 5GRUH 5GSVA 3VXSD 1EFXA 3EJQA 2VXQH 5D71L 2LGNA 1U9KA 2W92A 1P7QA 2CRMA 4ESKA 5FGCE 5IQ7H 3LXAA 3AGVA 3O6KL 5FUCE 4LL9A 3UC2A 1OAZL 4Y4FA 4BK5C 4WU7A 3RFRA 4UV7L 5BZDB 3RJOA 2J3SA 1RUAL 1M1XA 2YEVB 3MV7A 3VFSA 3VD9A 4G43B 2HFFA 3P77B 5F7BA 3IJSB 2D7TL 1JZ4A 1Q0YL 4AI7A 5E0FA 4U1KA 1W9XA 1KB9K 3C60A 3L45A 4PV1C 3W5MA 5IWLA 3QUMA 1NWPA 5DDHB 3HVNA 1YN6B 2NYKA 3CZNA 4JG5A 3VFUA 4PJAE 2IF7A 4MKTA 2LFEA 2EAEA 3MV8B 2NNAA 1UJ3B 4LESA 1EFQA 4ODXB 5EBWA 2DIJA 4RETB 2CGRL 1N5YL 4KZDL 2HN7B 3DI3B 3QDGB 3CDZB 2X4TB 5H4ZA 4HUMB 5KUMA 2P49B 3WNLA 5A2LH 5AKRA 5KANI 1YY8A 5E8EB 3A6CL 1AGBA 2JV6A 1ZXQA 4OF0A 3T8MA 4JPWL 3VXMA 5A6LA 3V4VL 2WQXA 3B6SA 1WISA 3MMEB 4KROD 4QXUH 1A1OB 1EANA 5ALCL 3K2UH 3MRLB 3VI4B 3ZTEA 1N0LB 1OO2A 4N28A 4NZRH 5DJDB 1R3JA 4JFPA 3BJ91 1WZLA 5GZOC 1CQYA 1CCZA 5L2KA 1P7QD 2YLHA 2YPKA 3EFOA 4J8RB 1O9VA 1O5DT 4PP2B 5LBSL 3SE8L 3DX7A 3I6KB 3NZ8B 4HF5L 1K85A 3O2VH 1S7QA 3A4FA 3MV7D 3P11L 1OAXL 4GW1A 4QHKJ 2VH5H 1MFNA 1MFDL 1K5NB 5EO9A 1CYXA 1SEBA 3C60D 3GIZH 1I31A 3Q2LA 4ZFFA 5T3ZE 1Z5YD 3DSFL 3BZ4B 4NN7B 1VGKA 1A1NA 5ALBL 5HHME 2FO8A 5BCAA 1E3XA 3O4OC 2H0PA 2DPKA 4L8CA 4FNUA 5IJKC 3MOAH 1SQMA 5FDYA 3AXHA 2IPTL 1RZ8B 3OXSB 3UEQA 4X83A 2CLRB 4ZUSA 4JPVL 4RZCB 5TDOA 4AK2A 1MI5A 5FCSH 1QA9A 3R06B 3PIQA 4JKWA 2A9ML 4QRPB 4BZYA 5I1HH 3KXFA 3BN9D 4Y9EA 2X4RB 3HFFA 3QQ9D 3ALPA 4JS7A 3UTSB 2QQNH 1ACXA 3VXMD 1UXSB 3OKLA 1ASOA 2BVOA 1QBBA 4XCYB 3JUZA 4KUZH 1XZ0B 4AKOA 1UM5H 1AO7B 5F7MC 3W2DL 4U2ZA 4PRDB 1QFWH 5L2KD 1L9TA 1U6AL 1KGCE 1CFSA 1AACA 3L1OL 4R2GD 3ZDYE 5BUGA 1PEZA 4NM8L 5D71H 3I6GB 1ADQL 3QO0A 3S3JA 3UAJA 2VR9A 1I85C 4OZHE 1CIUA 3O6KH 1OAZH 5DURB 2ZUUA 4UV7H 3QORC 1JHKL 1M2VB 5KYXA 1S9VB 2DQCL 1RUAH 1LD9A 4HJ0D 3UDWC 2GEEA 2D7TH 1M7UA 1Q0YH 3S4SG 4N9GA 1R3HB 3SBPA 3T1WA 2WNKA 1V3LA 4JK0D 5HI4C 1HX0A 1MUJA 1TQVA 2Y69B 4JZJB 5FHBL 1QFOA 32C2B 5JXEA 4N5EC 2KMWA 4TTDC 1MI5D 2RCSL 1A21A 4M6OL 5FYJD 2X2HA 1FI8C 3A67L 4KXBA 4GG6A 3AVEA 4IGBA 4MD4A 1HJBC 3KXFD 3A23A 4FFWD 1W2KT 2CGRH 1N5YH 5D6CB 4KZDH 1ZPUA 4XMKL 4PJDA 1JK8A 5FFOA 2PWEA 3DECA 4Q9QL 1PTZA 3UG5A 3FAWA 5A16A 1JPGA 3A6CH 5IK3A 2EDWA 2B2XL 4FTDA 1UEYA 5LGJA 3ESOA 4MD0B 4MCZB 4JPWH 5BRQA 4QRQB 1OGTB 2WBXA 2X9WA 3V4VH 1MLCB 4KKRA 4JZNA 5ALCH 1IE4A 1B3JA 4M7JL 3LTVA 3R4RA 1J8HB 3T3MF 3FSAA 1WVZA 2P8PB 2XWJA 4EN3B 1KGIA 1DL7H 2G4EA 5EZLB 5LBSH 3SE8H 3UPCA 3TO4A 3PV6A 1RULL 5FOJA 4QRRE 4A7SA 4HF5H 2FDBP 1J0KA 1EK3A 1WWBX 1OAXH 3HZMB 3IDNA 4Z7VE 5F0MB 5CGBA 1MFDH 1HNYA 2NLJB 5AVTB 4OZIF 5GGQL 1G87A 3JZ7A 2IANB 1JNHB 3DSFH 5I16A 1CI5A 5JXED 1J8RA 5ALBH 2GG1A 4LPWA 2RBLA 4N1EA 5KJ7E 3EAKA 4GKOA 2NPLX 1PFOA 4U1JA 3FT3A 1ZLVH 2EP6A 2XCMC 1JHTB 5IBTL 3TZVC 2IPTH 4IGBD 3NSXA 4JPVH 1S9XA 1MCQA 1XH0A 3S3SA 1UQSB 3UZQB 5I26A 2ITCB 3V6OC 1A4KA 2A9MH 1T66C 1B6UA 1G0DA 1QPPA 5E8PB 1U8QB 1O6SB 4G9FE 4Y1AB 1L5GA 1QZNA 4FQQA 4HSCX 4FXKC 2ARJB 4XGZA 3C6EA 1EO5A 4JDVB 1R6VA 1BVLB 3B8YA 3DO4A 3HKFA 1D5RA 3SY0A 3IJ8A 1SY6A 3CZFB 4NJAL 3W2DH 1DE4A 2EO9A 4PB0L 3PG2A 2DOCA 4K94L 2EYRB 2R0WL 2PMZA 1U6AH 1RIVL 3TO4D 3L1OH 4NXKA 3RURA 1W91A 1ED3B 4NM8H 2WIMA 3FTGB 1OE1A 4PLKC 1ADQH 1ZS8A 4Z0XB 3HHSB 4WDIB 2ENYA 3A5VA 1Q1PA 3JVFC 2YA2A 3ZKXC 1JHKH 3WLBA 5C0AE 2DQCH 5IV2A 1TLMA 3HE6C 3U4BL 3KR3L 3RBGA 4N0CD 1YNKL 2RHEA 2UWEA 4KK6C 4DNLA 5FB8A 2A9BA 4DGUA 2B1AL 4RAUA 3BRGC 1N70A 3FCTB 3D08A 4K9EL 1G1OA 1WD8A 5DC4B 3DVGA 1JI1A 3MO1A 5E7FA 1PZBA 5JO5B 5FHBH 4I9WE 4UQCA 2RCSH 1BVKB 4XOAA 2PXYC 1TFHA 3LZPA 4M6OH 4CC1A 4AK1A 3KLDA 3A67H 2J1YA 4I1NB 2A0LC 1FQ9C 2WLZA 1LEKA 1ZV5A 2NY3B 1QRNA 4E9VA 4XMKH 2W0PA 4D8PA 1U8IB 1G0XA 1DJGA 3STLB 4Q9QH 3VG9B 4PMFA 3GD1C 3TBBA 2B2XH 1MEXL 4AXWB 4FFZL 3IVKB 2QT6A 2ADIB 1WLHA 4OUUA 4ZFOL 3ZE1E 4MFHA 4UYQA 1J8SA 5GJSL 3T6ZA 4M7JH 1MAKA 2NQ3A 3T0EB 3UMTA 4OIIL 4N86A 1BECA 4W6YB 4C4KT 3SSGA 3AWFA 3ZGHA 4BWTA 3L4TA 1SJHB 3UERA 1RULH 5HHPB 4EZKA 3EIFA 1KYDA 1B2YA 1ZT1A 1ZV9A 2HRLA 4W4OA 1NMAL 2J2ZB 4GI9A 4QWWC 5D96B 1KBBA 4OLXL 1OCRB 2WOBA 3BKYL 1G7IB 3JV4B 4ZNEE 5GGQH 4EXKA 2VAAB 2BSBA 1SYVB 3FH8A 5DVKA 3WN5A 4FC3E 4JO2L 1BQSA 3VXRA 4FQHA 5JPMB 3DX3A 5DK0B 3P9LB 3QJSB 4G9DA 4BDVB 5IBTH 1INDL 3TFBA 3WAJA 2G5BA 2H32B 4HJGB 5HYSB 2A99A 1UFGA 5C07B 2ZKXA 1QRND 3I84A 4IBSA 2MNUA 5CP7B 2LU5A 1MCSA 1NFDB 3DX2A 1EEQA 1T83A 4J3OD 3S5LG 4H1LH 5KSBA 5CIPB 1JSYA 2YPLB 5BVPL 3NAAL 4JRYA 5FM5M 3RWFA 4PJGE 2VQTA 1JXGA 5GIRB 1UWXK 2E7LC 4GBXB 5AG8A 5E5UB 1OWWA 5T33H 3L3OA 4FFVC 4GQZA 5KSVB 4E0RA 2FJGA 3MJ9A 4NJAH 3RVXD 2YD9A 3IMVA 1BZ7B 1CT8B 4AWJC 4PB0H 1NUNB 2PCPA 4K94H 2R0WH 1M7XA 1TTCA 5JOPE 4XP1H 5F89A 1RIVH 2XSKA 4OF7A 4PSRA 3OVUB 2OAAA 5SWZA 3CE1A 3RZCB 1YEDA 4U6VH 5FLVA 2V4LA 1LO5B 4DKTA 3U2IA 5J1TC 5J4MA 1KELL 2APXA 1YG9A 4OZHA 1A6AA 4K7PX 4PJ9B 5ETUA 4B9YA 1HILB 1DZBA 4XCFL 4E5XA 1WAAE 1SJXA 1YA5A 3GQFA 3KR3H 4H40A 3E1ZA 1YNKH 4ZMLA 3H3PL 3VXRD 3TBYB 2B1AH 3TNNB 2Z4QB 3KYNB 2WWKO 1I8KA 4K9EH 1WHOA 4LVHB 2YARA 3ZE0E 2L3BA 4PRBB 4PP1C 1R5VB 4KVPA 1ZCRA 2ZOLB 1UJTA 5B7EA 3SJVE 1VFMA 1D5MA 3GRBA 2BP3A 2XY2A 3Q6FA 3FO2B 4LSQL 4X6FA 5F9AC 4BHUA 2AJUL 1Q9KA 2X2UA 3C8KA 2WJ7A 3MLYL 4MB5A 5EV7A 4L3AA 4BD4A 2J5LC 1KB5L 3RX9A 2IGTA 4FXTA 5DFTA 5FGBC 2NXYD 2D7QA 2I9TB 1QI4A 1LE5B 3VSQA 4JRYD 5IIEB 1SUJA 5T1DL 3DPDA 4YZFE 4N3UA 3RY4A 5JZ7D 4YDVA 4AKPA 5HJGA 1IQWL 3EHBB 1YPZA 1MEXH 4FFZH 1KGWA 5JIHA 1H19A 5KN5A 4Q2ZA 1JHLL 3CSBA 4UM9A 3QZMA 3TO2A 2IFGA 4G8EB 4OIBA 3N40P 1ZE3H 1QFUL 5GJSH 5DCCA 5SWZD 3F00A 5TK2A 4L4VA 5KSAA 1ACCA 1WBXB 4KTEL 3WJJA 1NCWL 4OIIH 4I2XA 4APXB 1ITCA 4Z7QE 1U36A 3QEQB 5IQ9A 5D7KE 1NCHA 2RD0A 3MRGB 4BINA 1ZANL 3LQAL 3T6VA 5J8OA 1YSOA 2NYZA 1NMAH 2VUKA 3GLEA 2DWXA 4MMZB 1GAFL 3W9DB 2VQUA 2R4RL 4OLXH 4PS8A 4IIZA 4P23C 2PPCA 1B9KA 3BYYA 1IC7L 4JO2H 3JWDL 3FOMB 3VXQA 3GINA 3SYPA 1U8OB 5GGUA 2GEQA 5K59F 5AOJA 2J8UF 4YJZL 5CM1A 2C1OB 1INDH 3Q2WA 3EH3B 3H6JA 4R96B 4LBEB 3L95B 5F7DB 2D31A 5CGMA 1SVCP 2V2XA 1KGJA 5CJBA 2JI1A 1TTUA 1NIDA 4YVUA 4KK5C 5KYWA 1W80A 4PRPB 1D5BB 4HDIB 5BVPH 2RQ8A 3AW5A 3NAAH 3UTTA 2BDNL 3CQFA 4LLYB 5E8DL 3DVFA 3FFDB 4JM2A 1ML0A 3DK2A 4UM9D 1J0IA 1DQQA 2XY1A 2Q1EA 3NCWA 5DZAA 5ADOL 1T1YB 4ONFL 4HSAC 4WTQA 4L4VD 3AT9A 4PTTB 5BUAA 2EDNA 4N0UA 3S5ZA 2FECL 1CGTA 2BVUA 1Q9LA 2VLRB 4NIKB 3CLEL 2IPUG 3BISA 3CH1B 4HX1B 1JJUA 5LNEA 4DP8X 1XWVA 2C3GA 1KELH 5KVMC 3S9DB 5TH2A 2HKHL 3RWGB 4CVXA 4XCFH 3CFJB 4YO0A 5B8CB 5BVJB 4LRIC 3DUSA 3SBWA 2ZNXA 4FNPA 1GCFA 2N7AA 2AAVA 3H3PH 2IOOA 1TTBA 2Z8RA 4JCWA 5E56A 1WBYA 1GJUA 5IQMA 4KNUA 1EAPA 5J11C 1PZ2A 3KBEA 5AB9A 3ULVF 5DUBA 5GS1C 1U8PB 2ESVE 2ICWB 2VL5B 1G9NC 5LGHL 2P42B 4LSQH 1Q4NX 3FTUA 2AJUH 2WC7A 5SX5H 3ZZQA 5EF2A 2MPVA 3MLYH 3QZWB 4ZI8A 3OB8A 4W9HC 1KB5H 2Y2WA 4NKDA 2GIMA 4G9FD 5C0GB 3UTTD 5KANG 2CR3A 2FBOJ 4ONOA 2XXGA 3LSOB 1WJ3A 5T1DH 1MJJA 3V5HA 2VDQB 4JM2D 2J6WA 3APMA 1IBZA 3HHRB 1UH3A 4XZUB 1F5WA 2WKOF 4NCDA 4F8QA 1NBYA 1IQWH 2D9CA 2JVUA 4KGLA 1M1SA 1I3RA 4MQ7B 1JHLH 1U3HB 2XWZA 3ESUF 3VQLA 4Z23A 2FEEL 2CLZA 4JGUA 1U92B 3PNWA 5I6XB 1E9PA 1QFUH 3U1SL 4OD2B 3UTQB 1I3GL 1KG0A 4YBQC 4KTEH 5C6WH 1NCWH 1TQWA 2CK0L 1E4JA 4KKBC 4MJ6A 3U4EA 4H26B 2HA1A 1VEOA 4ZMAT 5BV7L 2FR4B 4JDEB 1ZANH 3LQAH 4QI3A 4AL8C 3LN5B 3WY4A 3HI1B 4S1DC 2ZKWA 3V0FA 4M5YL 1GAFH 4TF4A 4K3HA 1F1AA 2R4RH 2HT4C 4NN6C 4CBPA 1FNSL 1YAZA 4H44C 1CL7L 1NGWA 2CLVB 1IC7H 2YUVA 3AMLA 3OV6A 4MMXC 5KSUA 4BJLA 4I18C 4FG2A 1JE6A 4KU1A 3VGAB 2DM4A 4PJ7B 1CPUA 1IILE 4K3JL 3SPGA 5AW6B 4NO3B 2YBRB 3TLRA 1KYOJ 1FL5A 1PYWA 2WD0A 2FIKA 3FONB 2R29L 4DAGL 4A7TA 3TA3A 1G5GA 2VDOB 2VZTA 4FXGA 3IK2A 1EZVY 2AVFA 3DBSA 2W0FB 3WUZA 2V8MA 4KKLC 4LVOC 4BSJA 4G70B 4QHNA 2BDNH 1G7LB 3RPIB 2TRHA 3L2NA 3V6OE 1MW1A 5HDLA 4UZGA 3SD5A 3WL9A 2NX5E 1G84A 2RIKA 1SM3L 3BGAA 4OD1L 4ONFH 4TVPL 5GGSA 3ARRA 4ZMYA 3MLTA 3SKNB 5EDSA 5CSBA 3NSJA 2GC7C 5F1NB 1AJ7L 2PO6A 3CLEH 5D7LB 1T1XA 3SDAA 2EADA 6PCYA 1KFGA 3OWRA 2IC2A 4KROB 2HKHH 5GSVB 1EFXB 1WAAA 3MLVL 2YKKA 2JWYA 5DJ6A 4AITA 1P7QB 4YPGA 3PWNA 4BWUA 4WO4D 4GSDL 2QGEA 3ARVA 4Y4FB 3WO3B 1JGVL 4WLCA 1M1XB 4K2UL 3MV7B 4DKFL 4L1BA 2DI7A 4YDZA 2HFFB 3A24A 4AQEA 3STBA 4U1KB 2X7LA 5DFAA 5LGHH 3B2DC 3MLRL 3OHXC 2FBRA 5DVPA 1EGJL 3QUMB 2EVIA 1C16B 3TA3D 4NQCA 4XWOD 3WKPA 5F0JB 4IKIA 1UCTA 5AD0A 4QRBA 3VFUB 4P2RE 1ZLUK 2NNAB 3EGXB 1P6FA 4PGZA 5EBWB 2YSTA 4YZWA 3ZYZA 3C8HA 3GT6A 4ZZKA 4BUQA 3KGSA 2QR0A 1TVHA 2WXMA 5JOPD 3L4CA 4FQLL 1BZDA 2PO6D 1YY8B 3TC9A 1AGBB 3SDAD 3U1SH 1I3GH 1DSYA 4OV5A 3VXMB 5HYIA 4W9CC 3B6SB 2CGZA 2CK0H 5BV7H 1R3JB 4JFPB 2YD7A 4AZUA 2DLIA 5L2KB 4Y2NA 2YPKB 1E5ZA 3EFOB 5JHMA 4M5YH 4R2GB 4WFED 2OMZB 4NZTL 4CU6A 2WXIA 1GGBL 1K5WA 1S7QB 1FNSH 2DZEA 2P48B 1BZOA 1CL7H 3PS6A 2P26A 4G80A 4GW1B 5EO9B 1LO0L 4PFEA 1OP3K 1LNUA 1SEBB 1UURA 4JY4A 4L3CA 1IRAY 1DQJA 3WAKA 4K3JH 1VGKB 4NQCD 2GUYA 1K8DA 1KSRA 4AOFA 3WTXA 4L8CB 2R29H 4DAGH 3FUHA 2B08A 4ZUSB 4EEEA 5TDOB 1MI5B 3GI8L 3DOIA 1QA9B 4JKLA 3WO4B 4QXGL 1BMWA 1DZ0A 2CNZA 2OMVB 4YFLI 5LJYH 2WWNA 4HKXA 1PZCA 1Q1JL 3VWKC 3NOIA 1CVSC 4KRLB 5IROA 4BFFA 3HS0A 4OGZA 4X6DE 4EDXA 1UOWA 4QTIL 1GTNA 1SM3H 4OD1H 4TVPH 2RFXA 4O4YL 4Y8DC 3OKLB 1AJ7H 1S8DA 4OZFH 2VE6A 3FSOA 1THAA 4D9RD 1MHPH 3CFUA 3N41F 2K3TA 5C09B 5GZOD 5IFHL 3BWAA 1PAMA 4XCEA 3FULA 4OY9A 2FNBA 1CFSB 1I7ZA 2XVGA 4X6CE 2H6OA 2VW7A 3MLVH 1PZ5A 4G6JL 5JHAA 2IGFL 3MNVA 1DUZA 3QO0B 2XN9E 1NOLA 2UZYA 3B2UC 3P4LA 4GSDH 3IDJA 1R3KA 1I85A 5CJQL 1AVAA 1MCEA 2EABA 4ZK8A 1JGVH 4P4RA 4HOXA 1CD1B 3QORA 1LD9B 4K2UH 4DKFH 2ESVA 2F53A 4N9GB 5IP4A 4RGNC 3MLRH 2V37A 4WNQA 4DO4A 1EGJH 1MUJB 1VPOL 2QSTA 5EC2A 4QIRA 4A04A 2VABA 4AQAA 2YK1L 3BWUC 4K71C 3B2XA 4ADJA 4FL4B 4AYDC 1XIWA 4ANWA 2NNRA 3OM3B 4GG6B 4M56A 4IGBB 1YECL 4MD4B 1ZIAA 3H9SE 4XXCC 3ZL2A 5MHSD 4BQBA 5F97E 1OAUL 1M6OA 3MU3A 5JYLA 2CHXA 1LMIA 1JK8B 3NT0A 4PJDB 2OW7A 2GTWA 4LEOA 4FQLH 5A16B 1JDDA 1JPGB 3EBAA 2YGPA 1PG7L 5IK3B 5AW4B 3WMSA 4BK4A 3CZKA 1AANA 4WFFE 5LGJB 1ZPLA 4UYPA 2Z8VC 1GYUA 2FJHA 2OR9L 4LHJB 2YAEA 4JZNB 3D52A 2A9CA 5GRVK 2AVGA 2YR3A 2XWJB 5I74C 2DL9A 1EXUA 4MCYA 2QHLA 2ZT9C 4KMTL 2GHZA 1EDHA 4JRLA 3PV6B 3TO4B 4NZTH 3SDXE 1GGBH 1TKWA 1NAKL 3QORD 4YHOL 1O9WA 3WIFA 3VQMA 3IDNB 2ESVD 2VDPB 1LO0H 1R9FA 4PJFE 4QGYA 5FYLE 2HLFC 2P5WE 3B37A 4XH2A 3AJ7A 2DKUA 1ORSB 2HVKA 3KLSA 5HI4D 3W81A 5I16B 1ZLWK 4WCYL 5ABDE 1GTFA 4PR5A 2EE9A 3KPNA 4AENA 1J0JA 3IN0A 5FOBA 4N5ED 1XIWD 4TTDD 4U1JB 4X98A 3AQZA 2V2TA 3QXAA 2IXQA 2XWEA 3TZVA 1U3JA 2Q2EB 4YHYB 1S9XB 5AZ2L 5CZXD 3GI8H 3PUCA 1DQVA 4Q58C 1SVBA 2XV3A 4QXGH 5J1SC 1S3KL 4OAWA 4ZOCA 4YE0A 1CFBA 1Q1JH 2Y24A 1JZHA 1CFMA 4KDVA 4QTIH 4C59B 1L5GB 4FQQB 1JZGA 4R26L 2CD0A 2UVFA 4O4YH 1TR7A 2BVTA 2Y2YA 2CO2A 3OGCA 3M7OA 2PTTA 3DXAA 3EG9A 1DE4B 5IFHH 4AIOA 4MVBC 5DFVC 5F3FA 3U30B 1MJUL 4PJAF 3D0VA 5LCVA 5KYUA 3RILA 3CVCA 2EYSA 4F7EB 2LU4A 3AREC 4G6JH 4FQIL 1E3ZA 2IGFH 2YBGA 1A3RL 2X09A 2ZNWA 4ADGA 5CJQH 3EBGA 5IEKA 2MRYA 3WHXA 1JF6A 3WLBB 3AACA 5IV2B 2WLMA 3L16A 3VNZA 3GSVA 2UWEB 1IC1A 5FB8B 1BFVL 1QFPA 4RAUB 5I1EL 4JFYA 1NAMA 4B9JA 2WSKA 5CD3A 2ENSA 3L1GA 1B2WL 4OQ1A 4PS7A 1M4KA 1ACZA 1VPOH 2XN1A 3DVGB 3MO1B 4FNRA 1BA9A 1FCGA 2YK1H 3DGGB 3TZVD 5ACZA 2AFNA 3VH8B 4P2RA 3B5TA 1I9JL 2UUDH 2PXYA 3DTUB 3EO1A 4NKOA 4X0KA 3LRSA 1F90L 1NWOA 4FADA 1LEKB 2DI8A 4KJYA 3UG4A 1QRNB 3GS4A 1OAUH 2I85A 4D8PB 3BDXA 4PWHA 3W0WE 1R3IH 2Z8SA 3Q44A 4PBWD 2WLJA 1PG7H 1RK7A 2L04A 3CVHA 3EYFA 5B39G 1MCIA 1BM3H 4OUUB 1ZV2A 5J12C 3BPNB 2OR9H 5DJYB 3II3A 3G08A 3ZHKA 1KTCA 4XHJC 1ADWA 1OTSC 2J5WA 1AQHA 4TNWF 3KH3A 2OMWA 1N8ZA 3TCLA 1Q9OA 3IBOA 4PGEA 1QSFE 2AS5M 1NAKH 4GFTB 2Y22A 1ZT1B 2WKLA 5FKPA 3HE6D 1S7SA 2KC0A 4KK6D 3CHOA 2IBGA 2AV1A 3WN5B 3TEXA 4XO3A 3OPZL 3QA3A 4WCYH 4LIQE 3VXRB 4FQHB 3FC8A 4P2RD 4G9DB 1E8ZA 2PXYD 2G5BB 4UTBA 4N2EA 3ASWA 3ZDYF 2BHZA 5AZ2H 4WUKL 3LZOA 3WEXA 1S3KH 4OZHF 4QOKA 1NL0L 5CLTA 5KSBB 2NXYB 3QDME 4NHCL 1JYNA 3JTSA 1QG3A 4R26H 4JRYB 3RWFB 4HWEL 1AC6A 1HCZA 2EZ0C 4ZQTA 3LPOA 2GI0A 3L3OB 2X9YA 4E0RB 2FJGB 4U1SA 5EC1A 4QYOB 3KWUA 4K8RL 3VW3L 1MRFL 1UD3A 2O4EA 4JQVA 4QHKI 1MJUH 2IOMA 5F89B 2GQHA 5JW4M 5KVDL 5SWZB 2ZTBA 2GBTA 4UQEA 5T3XL 4E9YA 5KEZA 4EO5A 1JWSA 2NY2D 4FQIH 5CUSL 1A3RH 1AC0A 3CJJA 1A6AB 4OJYA 5LG1A 5HYSG 2CK2A 3N44F 4PJ5E 4E5XB 1KZYA 2CHNA 2OQJA 3BMWA 3V0DA 3N50A 4YPJA 3V7AE 2D7NA 1WGOA 5DHVA 1BFVH 1NCUA 2BY2A 1NIAA 2W9DL 5I1EH 1I8KB 4AYFA 1B2WH 4HUWA 1U2HA 4IJ3B 4P9HL 1G1CA 1U8CA 8CGTA 4EZJA 1D5MB 4ACPA 3Q6FB 1FFOA 4X6FB 1GGYA 3KL3A 1I9JH 4QOKD 3IETA 3C8KB 3BC9A 4YSUA 2XUWA 2A83A 4RMRA 1TO5A 1F90H 3J7HA 5H35A 3BRDA 4KUCF 3T65A 5BS0B 4Z7VF 3NK4A 5D1ZC 3SPIA 2X3AA 2FJFA 2RMNA 1MRDL 4IOSA 4YDVB 4P05A 3EH4B 3KWTA 3WMQA 4MZIA 1YPZB 2DIBA 3KW7A 1T0MA 4FFVD 3HR6A 5KN5B 4Q2ZB 2VMEA 1AI1L 2MEJB 2FATL 3TO2B 2AXWA 1P6WA 1FZJA 1MHCA 1DDTA 2DI9A 4L4VB 5KSAB 1G7HA 1FIEA 3UJTL 3DJRA 2DD8L 1TCMA 3AB0C 2HLAA 4I2XB 1ZSDB 5JIKA 4G82A 5KAQG 4KBPA 2IQAA 4LOFA 2CALA 4JO8A 3DJZA 1IBDA 4O58L 4BM7A 2QPDB 4HUXA 4ABQA 2P5WA 2DQJL 5JIDA 5D5MA 1SEQL 3PV7A 4JM2F 3GIVA 3TTSA 3WIHL 2C3XA 1DVTA 3OPZH 2Z6FA 1SOXA 4PP1D 3VXQB 3E8VA 1E5AA 4WJ5A 4QKTA 2WB7A 2WWKT 5KBPA 5ENWA 5GGUB 2FYVA 5F88B 4GO9A 3ZPDA 3QQ4A 2XN0A 4HKZA 2BY0A 1OW0C 4MB3A 4TN9A 4WUKH 2V2XB 3QJOA 1FFRA 2D0HA 1QABA 1NL0H 1PNDA 5KYWB 1ZHBA 1UKTA 4IOSD 5B7FA 4NHCH 2PCFA 3ZE2F 3UTTB 5ICYA 1DUYB 3KJ4B 5TQ2L 3V5DA 4ELDA 2BP5M 2FT7A 4JM2B 3O4LB 1A4CA 1VB9A 3ISRA 2D3VA 2Z9TA 2ADGA 5D2LA 1JRHI 4Z76A 4K8RH 4L8BB 3VW3H 2ADFL 1BAWA 1FNGA 1MRFH 3BUDA 3KPSE 4GINA 4KO7A 4N0UB 1Q9LB 5DU7A 1P6AB 4ODHL 4ZAKC 2VLKA 5IMMA 5KVDH 3M17A 5T3XH 2H1LM 2F5BL 3EADA 2BCMA 5CUSH 4UOQA 4YHNA 3MNWA 1DANT 3CU1A 5TH2B 2P5WD 1IEBA 1G6RA 2VZ3A 2ZUXA 4YO0B 5C0BA 2BWQA 1NCOA 3DUSB 3ZE2B 1GKEA 3DIDA 2WVVA 5AW2B 1WBYB 1L9RA 2HPOA 2A9DA 3ABGA 3BMVA 2W9DH 1EAPB 3OLGA 4G8AC 1LE9A 4PB9L 3HVDA 3N85L 4P9HH 1OKEA 3ZE1F 5DUBB 3QNYA 4KI1A 4D7BA 4F7TA 3CLWA 5C7ZA 4CBZA 3SQRA 4F15C 2P46B 4GUQA 4RGNE 1HYSC 2XVKA 1UACL 5INCA 4JRXE 5DVMA 5C0JA 3OAZH 4NKDB 1GRWA 1MLBA 2JQAA 4X7EC 4OBRA 4A63A 4XI5C 4FTVA 3L4WA 1JIBA 3WENA 5EF3A 1IJNA 1RXLA 3HN5A 3OMIB 3ARGC 3EW3B 1Y18A 4BZ1L 1MJJB 3V5HB 3LNGA 4EUPG 1MRDH 2QZQA 1NBYB 5D1XC 2IGLA 2VXUL 4LPUA 1I3RB 3W11D 3WNOA 1AI1H 1EZUA 2FATH 4N5UA 5DJ8A 1UOVA 2PW1A 5LDUA 2JKNA 2CLZB 1HKFA 1OOAA 3PNWB 5FA3A 1L7IL 1E9PB 4JMNA 3UJTH 1KG0B 5ACMA 1HQ4A 2DD8H 3KW8A 3KGUA 4MJ6B 4XT1C 3U4EB 1KCVL 5KVFE 1JGUL 5C0BD 4DGYL 4PLNC 2DTML 5BW7A 4M6NL 1L3WA 4O58H 2X5PA 1N3NA 1KJ2A 2CXGA 4A55A 2DQJH 3FQRA 5H37A 1YQVL 5C7XL 1SEQH 2VSDA 4OF6A 1WS7A 2K45A 4I13B 1NGWB 3IJEA 4S0SD 3WIHH 5KSUB 1DVFC 5DS2A 4MMXA 1A7PH 2FHFA 2J4WL 4I18A 1WICA 2P47B 4GUCA 1WA0X 4HW6A 4JGMA 2P43B 1ET5A 5CJ5A 4M93B 2QV4A 3EJCA 3RTQC 3U83A 1FL5B 2JI2A 4O00A 1ZGLA 3ENEA 4FTVD 4LL4A 3QZOA 2P8MA 1PZSA 3A6BL 3DVIA 2Y3AA 4KK9C 2BINA 2ZX7A 4FXGB 4ZRGA 3TA3B 2AK4E 1WAAF 2GABA 3CN1A 3DRTA 3LXUX 5C3IA 3PPEA 3ZL4H 4G6KL 4QHNB 5C8JA 3N91A 1RJZA 2VAJA 5TQ2H 3BH4A 5LN8A 1TJGL 3NGBB 2ICEA 3SE3C 4EVNA 4J3TA 5ABAA 3ZE0F 3WL9B 2AJSL 4JFEE 3K4ZA 1U8HA 1YAIA 1IC4L 1RZKL 5GGSB 4DQAA 1Y7VA 2ADFH 3MLTB 4Z3HA 1FZOA 4ODHH 2PO6B 3PXJA 1RQ5A 4Z3GA 1V7NL 1QSFD 2EDDA 4H5SA 2V9UA 4KKBD 2F5BH 1B4RA 1GW6A 4MA8L 3RKPA 4F1SA 1RZFH 3GZKA 4PJ5A 4S11A 3U0TA 4S1DD 2AITA 1P1VA 4OZGB 2F19L 5JMRA 3MJ7A 2HT4D 3LN9A 2YN3A 3PWNB 4UUJA 2VC2B 4YPGB 3TWCL 5AALA 2B8OT 1BIIA 3T5WA 5AYQA 1U2YA 1EUTA 4PB9H 4Z3FA 2VIRA 2QEJA 4BFIA 3N85H 4PJ8C 4AY0A 4B9FA 2NZ9D 5EU6E 1EAJA 2RACA 2OJ1A 2X7LB 4HD9A 2P5EE 4AGQA 4Z7QF 1IAOB 4IRJC 5E2TH 4JO5A 3KLHC 3S5YA 1RMFL 4NQCB 4ICXA 2OZ4L 3ZQXA 4DOHE 4F57L 3QDMD 1KGYE 1GOGA 5AD0B 3AY2A 2Z34A 4QCIA 2QMJA 1AG0A 4KKLD 3LV3A 4L5FH 2FQEA 3EDEA 4BZ1H 1BM7A 3TVMC 4KRPB 3FUIA 4M8QA 1MFUA 2DMCA 2EQDA 1WIUA 5C2UB 2VXUH 1BQKA 3IMWA 4J4PC 2L7JA 1GGCL 4OI9A 5KW9L 3SODB 2SEBA 2QR0B 4OUOA 5J89A 4J3WA 3V7AG 4ZTPL 2YXMA 1SN2A 1UT1A 3HMXA 3RI5K 4EIBA 3VFTA 4OV5B 1GH7A 4JFSA 1ASPA 1HS6A 4PJ5D 1KCVH 1H8OA 1JGUH 4DGYH 5CBAA 1XB3A 2DTMH 4DFIA 1RJLA 3ASOB 5HYFA 4N2NA 2ZWSA 4M61A 5EEWA 2BP8B 2W81C 3QDJA 4P07A 1MZYA 1YQVH 3L81A 5C7XH 1FVCA 1SQ2N 3FQWA 3WE6A 4G80B 3OLIA 4CRPA 3WKML 4DZ8B 4HUUA 2J4WH 3HC3L 1I1CA 4JY4B 4L3CB 1DQJB 1KC5L 3VVVA 3T08A 2AXFA 1CF1A 2HRHA 1K8DB 3NPZB 1J1XL 2LABA 4LMQE 3ZHNA 5ESQA 3IPFA 3A6BH 4YS4A 1VCBC 2C9VA 2WZ6A 2CRIA 3PU7A 4HK3N 4G6KH 3RUGE 5E2VH 4HKXB 1T04A 4F2ME 1ACYH 1TJGH 3VWKA 2DY2A 2JMRA 3HS0B 2RAMA 4EDXB 5D4IA 2A77L 4LSRL 4BSWA 4UT7L 2AJSH 4TL4A 4DPBX 5IT2H 1IC4H 1RZKH 2RFXB 4OLZL 2UX7A 4M9PA 1H3XA 3H9ZA 4TQHA 5AW9B 4FYSA 4OZ4A 1S8DB 3WFDL 3US0A 4PLJC 1V7NH 4JW3A 2VE6B 4A2GA 3NCXA 4UOW1 3CWGA 4MA8H 2C9AA 7PCYA 3MZTA 3BWAB 1ZE3C 3FQTA 1TSRA 1ODUA 1I7ZB 1L0XA 4NWUL 3MI6A 1PZ5B 4HAKA 4L8SC 2F19H 2R1YA 3IU3A 4NPKA 2EEFA 3QDJD 4X6EA 1DUZB 2UZYB 3BAIA 3I50H 1IUZA 4HZLA 1G9EA 3IDJB 1R3KB 4UT9A 5DUML 3MODL 3VFMA 3Q05A 4TVUA 4XNAA 1EZVX 4ACTA 1MW3A 4P4RB 3QORB 4HPYL 4K5OA 4HS3A 2X6BA 3NSDA 2JTDA 2F53B 5DMKB 1P5VA 2X70A 1FE8L 1UH2A 4G6ML 3TBTA 2EDRA 4WNQB 3RQ3A 4JRXA 3O6FC 4Q74A 3ULVL 3ARWA 2N1KA 3OB0H 2VABB 5IOPA 2ITEA 1V5JA 1DFBL 2OZ4H 1EDQA 3QJHA 2AV7A 4F57H 2DAVA 1XIWB 4DP6X 3C9NA 5DC0A 4CU8A 2BOLA 1S7VA 4K7PL 3IE9A 3RIAK 3VWKD 2IWFA 3EYUL 3FSWA 3TT1L 4XXCA 4FMVA 5F1KC 1M6OB 3QHTC 1GGCH 5KW9H 3IFOA 1Z7JA 2GTWB 2VDML 3L7FA 1T89C 4LEOB 4WWKC 1S3RA 4F8OA 4QJ4B 4D0CA 4JVWA 1WDAA 4ZTPH 3II1A 4WTXA 2VOTA 2FJHB 3ULSA 4JFQA 2EEDA 2IWGA 4HEMA 1U8MA 1H3GA 1TYJA 1ZTMA 2XG4A 4QRTA 3MJGX 1DANU 4MCYB 3S37X 3MXWL 3B2UD 4NSKA 5F9DC 1OALA 3GRWA 4MNGA 1XGTA 3WIFB 3VXNA 3EFFA 3O11A 3X1FA 3WKMH 4I0CC 3OQRA 1QSEE 3MV9A 5INDA 3HC3H 4XH2B 1JI2A 4JRXD 1KC5H 2HVKB 1ES0A 2W91A 3G9VA 4KKQA 1X5KA 3CFDA 1KLGA 4PR5B 4HHAA 1J1XH 1S9YA 4E2OA 3KPNB 4KHTL 4AENB 3SO3B 4F80A 5FOBB 5I23A 4X98B 3QXAB 2IXQB 3QQ3A 4I7ZC 3FTWA 4QXTA 4P0DA 3BVWA 2AK4A 4ZW5A 5EU3A 3TYGL 2E27L 4H0GA 3SPHA 3RFZA 1A22B 3H85A 4OAWB 4OIFA 1FG9C 3DRQA 3L5WA 2YMOA 5EEYA 3FFCE 5I19L 1WITA 1A7QL 2V2WA 3BJLA 3O3BA 2WBWB 2A77H 2CWRA 4JFEA 4LSRH 4MRCA 2QSCL 4GSRA 1MVYA 3BWZA 5B38G 1J5HA 4OLZH 1G4MA 1QI3A 2ZX8A 1ODAA 1X4XA 3BI9X 3FDWA 1J88A 3WFDH 3BZEA 3HA0A 1MY5A 3OGCB 2GW5A 4TV3A 2PTTB 3DXAB 1NEZA 1N6VA 3EG9B 2AEPL 1HC1A 3U7AA 3CPLA 3D0VB 1NCTA 3REVA 5KYUB 3FBKA 4NWUH 5I1IL 2XFXA 2EYSB 3AREA 3MNZA 3KYKL 3GRGA 3BE1L 3LRLA 5DUMH 3MODH 4GYBA 5IEKB 3WHXB 4LCCC 3DGCR 3LQAC 3MV9D 3DO3A 3WUWA 4HPYH 3GSVB 1KPVA 5HHVL 4EI6A 5I30L 1Q90A 4P5RA 1FE8H 1NAMB 1XGQA 4G6MH 5CD3B 1JDAA 2MFNA 2WBKA 3ULVH 2WO2B 3FQXA 4I3SL 3NDYE 1ZIBA 5KBNC 3WI9A 2AK4D 4Y4KA 5ACZB 1DFBH 5F7AA 4NPJA 1JZ2A 4OM1L 5AOKA 4NKOB 1PF3A 3AQDA 4K7PH 2DMGA 3LRSB 1GHFH 4RDBA 3ESVF 2APWA 4ZMOA 1FPTL 4Z8FL 3EYUH 4KJYB 3TT1H 1A8JH 4P2AA 4JFED 5EEUA 3WFEL 1D7FA 2VDMH 5HDQL 3UEZA 1BAFL 3CVHB 3EYFB 2WQSA 4XAWL 3K6OA 4JO3L 4X8CA 3FTSA 4JKKA 3F5WB 5IF0A 5DFVD 4EIUA 3G08B 1QZ1A 3ZMNA 4YSSA 4YC2C 1INEL 1RH8A 2ZOUA 1WT5A 4IJTA 2CO1A 3ARED 1QLFA 3MXWH 3V0WL 2OMWB 4G8FA 1N8ZB 3TCLB 1Q9OB 4PGEB 4FGMA 4G6FD 2J20A 4POUB 1T7WA 2NY2B 3VH8G 3WFCL 4URKA 4X6DF 3O8XA 1CR9L 3KM2A 5FKPB 4GUOA 1UM4L 1S7SB 3MACL 5EU6D 5FYJL 5E03A 3IRCA 4G11A 2Z65C 3ZBMA 3TS8A 2P5ED 3MVSA 2VXQA 5AW5B 2AV1B 3JTTA 1M9WA 1A3LL 4A2EA 4KHTH 2WVUA 4R7XA 4RFNB 1XTMA 5DUPL 4X6CF 3M7FB 1EJFA 2UZPA 2O72A 5DD5H 3TYGH 5K9KA 4GG8A 2E27H 2G3NA 3WEXB 4QOKB 1IBHA 5I71C 3SO5A 4IK7A 3GNML 4U1MA 2PCXA 5I19H 5ID0B 1A7QH 1XDTT 3ZUNC 3JTSB 3X11A 2QSCH 3EOBA 4RIRA 1EDYA 1VERA 3L9YA 1F3RB 1OVZA 1FNEA 2GJRA 2N7SA 2WAHA 4E36A 5EC1B 5I5IA 1YY9D 2HUEA 2PN5A 2VT0A 1F4XL 1LMKA 2AEPH 4XHJD 1OTSD 5EG6C 1B3IA 3V0VA 3PQYE 2VUOA 3MUHL 5I1IH 1AZCA 5D7SL 1JWSB 3D12B 3O8XD 3RGVC 3KYKH 3FUEA 1JMZA 1WTLA 3DO7B 1D9KA 1HXKA 3CFQA 4WWOA 3C5ZC 3KYAA 5HVWA 1FZKA 1BJ8A 5HHVH 2GTQA 4TNVK 5DHVB 4M4RA 2K7PA 4IS6A 3IWVA 2YO3A 4AYFB 1DJHA 4HUWB 3ZT5A 4H8UA 1U8CB 4I3SH 2XA3A 1J48A 2ZUTA 4OM1H 3EUDA 4JDZA 2IMNA 1DJZA 4N9OB 3F6LA 3G5YA 1Z6JT 2OCCB 2A83B 1UUNA 2BS8A 2FIRT 4XMTA 1FPTH 3L54A 5H35B 3SDXF 4Z8FH 4EAEA 4GB9A 3T65B 2CJUL 2MKLC 1Z66A 2Q87A 3WFEH 3N6YA 3WFBL 3WIIL 4PJFF 2FJFB 5D1ZA 1KPUA 4QRAA 5HDQH 2EZ0D 5I6MA 1BAFH 1T0MB 2AMGA 4RGMC 1NKGA 2DWTA 4XAWH 4UQ3A 1FZJB 1MHCB 3W56A 3VDCA 4QTFA 4UBDC 5CFAA 1INEH 1G7HB 3OC5A 4M3JA 2HLAB 3QIBC 1CE6A 3G5VA 1KJ3L 2IQAB 3V0WH 4E41A 4PVBA 4TMPA 4KX7A 1D9KD 1F02I 3WFCH 2XXFA 4F20A 3CUPA 2GFBA 3HUJA 4DO6A 1CR9H 4X6BA 1UM4H 3MACH 5F8RC 3K71B 1IM9A 5FYJH 1PD6A 4HUXB 3BD3A 4UZUA 5D5MB 5I8EA 5CEYB 3QXDA 4TNEA 3GIVB 3BLKA 4UWQB 3RBSA 4WJ5B 3RVWC 1A3LH 2UZXA 3HNTL 4OFYA 5ENWB 3MAWA 3QPQC 4NBZB 3QQ4B 5DUPH 5LAPA 1CGUA 1GGIL 4HKZB 5C0CA 2EVFA 1S2EA 1CO1A 3W3BA 2VR4A 3X1GA 3BD4A 3IPEA 4KNTA 2NY6B 3GNMH 2AJYL 4X5WA 5D1ZD 3IDUA 1ZHBB 5IB4B 2VJXA 1IMHC 3GF8A 4LQFL 2PCFB 3NPSB 1CLOL 5ICYB 1J0ZA 4FKHA 3V5DB 3H42L 3CH8A 1DBML 1RZGA 5DJ2A 3ULUC 4FE9A 3EDJA 3FH7A 2ADGB 5D2LB 3ZT7A 2IH9A 2VLME 2X4NA 2F15A 4X7FC 1F4XH 4Z76B 1T4WA 2ZX6A 3MXVL 5CEXB 2XWDA 1AAJA 3TA4D 4P4KC 3WJLC 2VLKB 5IMMB 1B9ZA 3M17B 5D7SH 1F4AA 2EUZA 2CHZA 1DDHA 3TESA 4MKMA 4YHNB 3MNWB 1IM9D 4ZOBA 4JPQA 1QSED 1IEBB 1G6RB 4NLHA 4KXDA 5C0BB 4ZSOE 3SKMA 3KGRA 3NDZE 3ZHLA 2WVVB 3UIYA 1MCPL 5LBSA 4GS7C 4K3GA 2KZ1B 1T6VN 2TAAA 2YMXL 1LE9B 5LQBH 4OFYD 4YSCA 1VFAA 4MD5A 2GT9A 4ZFGL 1M7DA 3QNYB 5MI0C 2G2RA 4F7TB 2F1EA 4HLEA 5AVWB 1EX0A 5JORA 5B7MA 3VFGH 4RISL 4B6ZA 4GNKB 2E8YA 3ZKMC 5INCB 4BEIA 4CADA 4OD3L 3T4AC 5C0JB 4KTGA 5HI5C 2I27N 1XCTA 1MLBB 1E28A 1E4WL 4RMWA 3OJ2C 4FTVB 1KWKA 4BCXA 1TITA 4GQ9L 2CJUH 4AIZA 4XVJL 2C9QA 4KMQA 4W70A 5ITBL 5L4JA 4WWNA 2I7OA 3WFBH 3LD8C 3WIIH 1SLXA 1S78C 4MXWL 5FC9A 2MOVA 1YUKB 5D1XA 1Q72L 4OJDH 3WS6C 5I6LA 4HBCL 4GT7A 1BXXA 4XXDB 1S7WA 4B60A 1HHKA 2PW1B 1GMEA 5T3ZL 3H2PA 5ISZB 2DMBA 4HAFA 5FA3B 5E9DE 4ZAKD 1SJEA 5CR1A 5K1NA 3DHMA 1HQ4B 4UANA 3WJMA 1A9VA 3F8UB 1WS8A 2FHCA 4Y9CA 4NAMA 5BRPA 1KJ3H 5E9AA 1MG2C 5A3IC 1F3DH 1YO4A 3PAUA 2X6AA 4GY4A 2HXAA 4EPSA 2C1PB 1R3LA 3N42B 5EULV 1ZT7A 2FT6A 4GXFA 1N3NB 1KJ2B 3MHZA 4MAYA 2R4SL 2ZUQC 1AQMA 3FQRB 4KXZI 5CJ8A 2EYTB 2CH8A 4XN9A 1ADQA 3IJEB 4UQ2A 2VQ4A 4MMXB 2EEBA 1DVFA 1R1CA 3KPMA 4I18B 3HNTH 1EEYA 3ELQA 3HE7A 3DX6A 4LB8A 1HYSD 4H8QA 3RTQA 1GGIH 1YZZA 3MJ9L 4EXPX 1SLWA 3MBEC 3DJSA 4CSPA 1ZGLB 3QXTA 3HG1B 1E9QA 4HS6A 4XI5D 4KXCA 2P8MB 3OKMA 2FWUA 2XACC 1H5BA 5J9PA 2AJYH 1X5AA 2B9BA 2QVFB 3HFML 4HVBA 2NRDA 4LQFH 1GKOA 2UUDK 1CLOH 5C8JB 1YN7A 1RJZB 1MCFA 5D1XD 2EIMB 5JMOC 3H42H 2ICEB 1DBMH 4EVNB 3QI9C 3LZRA 3SE3A 4GH7B 1PQZB 1U8HB 1N19A 1X5MA 3RTLA 3MJ8A 3MXVH 1FZOB 2CMRL 1A3QA 5DZLA 5J06A 1AQKL 4H5SB 3HNSL 5IB3A 5GQBA 1PNCA 2KBGA 4MNHA 4N90E 3U0TB 1DN0A 2JXMA 3COOA 2GPZA 3PFQA 4MAYD 3UBFA 1U21A 5DSCA 3MJ7B 3V0EA 4UUJB 2JIXA 4A7GA 2IG2L 2IDCA 2ZPKL 1P84J 1BIIB 1MCPH 5IESL 1TZHA 2BPBA 3OZ9L 4F7PA 5IHZA 1IO4C 1DVFD 2YMXH 1IGYA 3C12A 4HU2A 3BPOB 3IFNL 2VIRB 2WVSA 4BFIB 3HE7D 4FG6C 3QQNA 4ZFGH 3AS3A 4PJ8A 4BKLB 1AG6A 5AAMA 3RTQD 3DLQR 3IDYC 2OMNA 1NDTA 3OGOE 2UYLA 2YC1A 4RISH 4EDWL 1E5YA 1JTOA 2E0PA 2UX6A 3T0XA 4CC4C 5I0WA 4OD3H 1KYAA 4AUUA 5JYMA 4AMKL 4UU9B 1OAQL 4N2OA 2EDTA 4GQ9H 4MXQC 4QCIB 4PJ6A 2G5RA 4XVJH 3LV3B 4XAKD 1COBA 5CCJA 3G5WA 3HLAA 1BQHA 4M8QB 5ES4B 3QCUL 3ZK0A 3CX5J 4MXWH 1X6LA 2VN6A 1I8MB 1BVOA 4GT0A 1HHGA 3ZSTA 4PD4J 1H8LA 1MOEA 1NCAL 1Q72H 2YWZA 4HBCH 2IAMB 3GMMA 4NP4L 4X2UA 4XVUC 4H1LA 3VD5A 3PL6C 4X0NA 5T3ZH 5MEPA 3CHSA 2D2OA 3X14A 3VFTB 5DVNA 3N0PB 2I07B 1KIUA 2PPDA 3H3KA 3D33A 5GPRA 2O6FA 4ZO9A 5JW5A 5CBAB 1EH9A 2EH8L 3W1ZA 3CXHK 2JIXD 3VGEA 1RJLB 4M02A 3KPOA 1D7BA 2R4SH 2XQBL 3QDJB 2W59A 4TS6A 4KH9A 3FQWB 3WE6B 3VX0A 2K8MA 4PJ8D 1J18A 1EJ6A 1SRDA 4HUUB 2XPZA 4NQEE 2ROYA 5IOKA 2AXFB 1TPXB 4NUPA 3KLHD 3EGSA 5JPNB 2JJSC 1RPQA 3MJ9H 3JXAA 1NEPA 5ESQB 4WVRA 2A6IA 3DYMA 1AH1A 2OTUA 3X2QB 1AR1D 4D9LL 3HFMH 1HH6B 3VFPA 4HJJH 2BRQA 4P48A 1HCFX 1TZAA 1SF3A 1T04B 4FFTA 3I02A 1JERA 3Q2CA 3FK3A 1UATA 4BSWB 3HLKA 2DF3A 5K9OA 4IBZA 3LB6D 4Q4IA 2A6KA 2ZWYA 2YAOA 4QPEA 4DVRL 3QPXL 1M05A 5F72S 4TULL 2CMRH 1NANI 2KHAA 4OZ4B 5AKSA 1AQKH 3IMTA 2Z1PA 3HNSH 4FFZA 1T5XA 3FO1A 2WCPA 3BWUF 3FQTB 4QYAA 3IJHA 4Y5VA 4ZFOA 2ATAA 3FSVA 2ODIA 3CQPA 2KI6A 4X6EB 2R1YB 3IU3B 4KZ0A 4N1CA 4ZSOA 5FHAL 1Z1WA 2IG2H 1YEEL 2ZPKH 4HZLB 4G42A 4IOIA 1JPTL 1MCWW 2CAKA 3OZ9H 2JF1A 3PP4L 3VFMB 5IESH 4YDNA 3TN0C 3IFNH 4ZW3A 4ABUA 3S35L 5M7QA 4XMUA 3MREA 3SBRA 4HK0A 1P5VB 2VTFA 2X70B 3TBTB 5C3TA 2NY5C 4EDWH 2OSYA 1JVLA 1X4YA 4JRXB 4ABVA 3ML9A 4AV5A 4CDGC 3O6FA 1JZ3A 1RI8A 3PDGA 4ADIA 5KBDA 4GRWE 1H9VA 3RWIB 4AMKH 1LK3L 3QJHB 3TF7C 1OAQH 2UXTA 1C5DA 3C9NB 1O0VA 1NTDA 1D3CA 1S7VB 3MLZL 2MCG1 1E2WA 2HMIC 1KPRA 3G5ZA 3QCUH 2YGNA 2PYFA 3H7BA 1VFUA 1NCAH 3KNBA 2ROXA 3IFOB 1DLFL 3JVGA 4F1ZA 3L7FB 2D7OA 2I9LA 2NR6C 4NP4H 5A2BA 5K9QI 1T89A 4WWKA 1GS8A 4D0CB 2F7IA 2WNWA 3SPVA 5PAZA 4PLJD 4ODTL 1SLUA 2CPUA 2QGCA 4MJIA 5I17A 4LDCA 3IE4A 3GBNL 4JFQB 3ULSB 4B0MB 3TF4A 1KMGA 5E1IA 2CA4A 2HUHA 1U8MB 2P28B 4JFZL 4NQTA 1O7SA 2XG4B 3QPKA 4QRTB 5F9WB 2EH8H 1NCBL 3HPLA 1XGZA 2H2SC 5I74B 3NABL 4NSKB 2XQBH 1WFIA 1VFOA 4MNGB 3SE4C 1XGTB 3VXNB 3EFFB 2IH8A 1S46A 3O11B 2DWEA 3BAXA 5T5FL 4FFYA 3MV9B 5INDB 4PJCB 5C0RL 2BNRE 4PG2A 1ES0B 3K5RA 3O6FD 4Y19E 3CFDB 1KLGB 4HHAB 1S9YB 5IVNA 5FIEA 3VG0H 3CHRA 2X40A 1X5XA 1G9MC 5HYJA 3GTVA 1J86A 1JN6A 3QQ3B 2M83A 4JUTA 4QXTB 7TAAA 2VQ1A 2AK4B 5EU3B 4D9LH 3CD4A 5FO8A 1SOKA 3BIBX 3P3RA 5LBVA 3RFZB 3SGDI 2A9AA 1KIQA 3OAZK 4W93A 2GBAA 3DRQB 3L5WB 1KB5A 4FJ6A 2J8HA 2V2WB 3O3BB 4WWKD 4N22A 3RDJA 4DVRH 3QPXH 3F2LA 5CJOL 4ZXBA 4MJID 3ZJAA 1NGYA 1U8LA 1BZQK 4TULH 1I7TB 2VZUA 4TYUA 4EZMA 4CL7A 3ZXAC 2YOCA 3ULUE 3BZEB 2Q3AA 1NEZB 4FHKA 4CA4A 4HIHA 2HT3C 3AZUA 4RMVA 1E42A 3FB8A 3GMOA 3REVB 3QS3A 1DBJL 3QJRB 3MLPA 4Y9GA 5FHAH 1SXZA 2F54B 5F0LB 3AREB 3ZTNL 1WFOA 4OB5L 1YEEH 1JPTH 3PP4H 5LGKA 1J7VR 2GJ6E 2BNQE 3L3IA 2LR4A 2O5NA 4G6FB 3QIWC 4Z7UE 2CCLA 3MNDA 5B3SB 3WUWB 1WH0A 2JTYA 5AOZA 3JWNE 3S35H 1KPVB 1RJCA 4EI6B 1F11A 1I1AC 1EA9C 5EOCJ 4EI0A 5HYJD 3AT0A 2Q3ZA 2CBOA 4H13C 3TWYA 3FQXB 3JSSA 5C2BL 4FNQA 4M8RA 5DQ9A 3VMPA 4Y4KB 1AGFA 4DOHB 2G9KA 1LK3H 2X2YA 1FJ1A 5IHLB 4ZMNA 3MLZH 3CVIH 3OG6B 1AHWA 5GS0C 3ZZSA 3NACL 2OCFD 2V0AA 1A8ZA 1DLFH 1CDIA 3KHOA 3Q2NA 4ZXBD 5HHQA 3JT2A 4OCYL 4L9DA 4YXLL 4YHKL 2Y06L 3M8OL 2TRYA 4ODTH 3GSQA 1SXCA 5IF0B 3GBNH 3L9RA 3DBXA 4JQXC 5I1LA 5E4AA 2CR0A 4JFZH 4AM0Q 3RNKA 4XMVA 4NAQA 3N1QC 1XMWA 2ZICA 4WI2A 1NCBH 3CZSA 2FK9A 1QLFB 3VRJA 5ICZA 3RUGF 1ETJA 3GXTA 3MTRA 2A2QT 3HRZA 4UM8A 3T71A 4KDWA 4YBLB 1A9EB 3O8XB 4POZC 4QKXB 4KQ4L 2W60A 5T5FH 2XU9A 3GUTA 4X5XA 5C0RH 2GB2A 4QHUA 4QLWA 1IGTA 1P4BL 2HRGA 3JTTB 4GXUM 5DLML 2WYTA 4JCLA 1C7TA 4AJ0A 4ZPTA 1I4FA 3LEVL 3VQ2C 4UTAL 5I1KL 1KDJA 1VLXA 2R1XA 5E00A 3ZDZF 1E0OB 3T0VA 1HEJC 4NGHL 3FO9A 2JKXA 5K9KB 4GG8B 4LFHD 1R5IA 1YQ2A 3EJZC 4JFFE 1KXVC 4RMUA 3MUZ1 1GYAA 1R34A 2YLKA 1RK0A 5FUZL 2XJLA 4YL4A 3TX4A 3X11B 2BXYA 1B4JL 3EOBB 3F7YA 4RIRB 5CJOH 4J2XA 4N2LA 2WLLA 1FNEB 5BO0D 3HZVA 2HJLA 2BS71 4AW7A 8PAZA 4R84A 3GLAA 1F2XK 5JHDA 1L0QA 4N0RA 2CXKA 2X42A 3HN3A 3V0VB 2BK8A 3GTNA 3ZDZB 1DBJH 3V4UL 2H0FA 3AQYA 2EIBA 3U2JA 3ZTNH 4OB5H 3RGVA 1JZ8A 4TSAL 3LHAA 1V54B 5EZOL 1D9KB 2J55A 1A02N 2B1OA 1J5DA 2Q5BA 1UWYA 4Y16B 4NENB 3C5ZA 3UYRL 1WC7A 1XX9C 1FZKB 4M4RB 4WFGE 1TZIA 2NY1D 4IS6B 2YD4A 1H9DA 4PJEE 3BUIA 3KJ6L 3VE0A 1KCSL 5F1OB 2Y1YA 5C2BH 1AZNA 1BGXH 1NZRA 5JW3L 1IX2A 1YCSA 2FX9L 4RFEA 3KG5A 2BP0B 1P4IL 2XG5A 4JDZB 1GYVA 3ZDXE 3G5YB 4B5EA 1AIZA 5KJ4A 1ILSA 2GY5A 1AOZA 4MJ5A 9PCYA 2R29A 3NACH 4RGOL 3U4KA 4OLWL 2AQSA 5D1ZB 4OCYH 5EUOA 1FNAA 4YXLH 3EJSA 4YHKH 2Y06H 3M8OH 4D9QE 3GDBA 1TQBC 1LILA 5JHDD 3VACA 4OVUA 3GJEA 4DP4X 1A6ZB 4MAUL 3RE0A 1T4KA 1B0GA 4UQ3B 5KVGL 4FG4A 1YUHA 5HGAA 2EUXA 1TZGL 2D4DA 2J6EL 1A66A 5DQJA 2WANA 1OSZA 2JKTM 3AB0B 2AJVL 2MHAA 3G5VB 3N1MC 3NJFA 3QIBA 4S1QL 3RGVD 4E41B 4G83A 4NEHB 3B1UA 4IQHA 4OZFA 4A7UA 3CUPB 3QG6A 3P0VL 4NQDA 2GFBB 3HUJB 4OCXH 4Y4HB 1EJOL 3FRPA 5GRXG 2HYMA 3C5ZD 5FFGA 3VGGA 1JF5A 3QWOA 4KQ4H 1FIGH 2EVHA 3NIFE 1OPGL 5I8EB 5KS9B 3QXDB 3QFJA 1P4BH 4Y19A 3F65A 3GO1L 5DLMH 3ZO9A 1BDYA 1V7ML 4M7ZC 3K8LA 2Q7YB 5E8OA 4X9IA 4EI5C 5I1KH 3LEVH 4UTAH 1IAMA 1QUPA 4ODBD 1MXDA 3CFKA 4HWUA 2VXVL 1VGEL 3AAZA 4RSVA 5ANMA 1A7BA 3DPBA 4D94A 2XZZA 5C0CB 3V0HA 4NGHH 4P8QA 3TJEL 1ILUA 4UNVA 1ZHLA 4WI4A 5ADPL 2WINA 3I9GL 4HJTA 1EGJA 1FYTA 2NNCA 2LFGA 2W1NA 4NQQA 5CLWA 4AQ8A 4X5WB 5FK9A 3BPLC 3ARDC 2JE8A 3ECWA 5FUZH 3SIKA 2Y6TE 4F37K 4HXAL 1B4JH 2W9EL 5F70A 1PG7W 4AEHL 1RZGB 3O0RL 1DQTA 1ZTXE 2QDWA 5DJ2B 3FKUS 1YDPA 4NP9A 2XRAL 2YQBA 2X4NB 1AMXA 3ZRFC 1U3ZA 1QWHA 4UBDD 2WOYA 2AABL 5HPOA 3RPBA 2FWSA 3QIBD 4OM0L 1F86A 2NQDA 3ETBF 3V4UH 1AFVL 4P4KA 1IAIM 2X4UA 4NQDD 3LS4L 4XMZA 1DDHB 4L3EA 4XVTL 3V4VB 1ZVNA 4E9RA 5MEQA 4TSAH 2GSIA 3PP3H 1C5CL 5EZOH 4ZX5A 4S1RL 3GHBL 3QFJD 3SKMB 3UYRH 4WO0A 4Y19D 4F5CE 4PJBA 1MHEA 4QHPA 1FSKC 4AVIA 4FN0A 4GSXA 4UNUA 2BC4A 3KJ6H 4JB9L 4KFZC 2VR7A 1VFAB 4MD5B 2GT9B 5B1CA 2F5AL 1M7DB 2G2RB 2FX9H 1GS7A 3AG2B 1P4IH 1QACA 5JORB 5CD5C 3VXTA 1IBFA 4CADB 3F7VA 1FYTD 3KCPA 4ZO6A 3T4AA 3MJ6A 1E28B 3TEWA 3I74A 2D8KA 4AIZB 4RGOH 4NUGH 4OLWH 3MDJA 5DZ9A 1GA2A 3IGAA 3EJRA 3T0AA 2QBWA 4JHWL 5D1XB 2XQYA 1X7SA 1S7WB 4V2CB 1HHKB 1KCLA 3QQDA 4MAUH 2WBJA 1XF3A 3JWNG 1DYZA 3EJUA 5BJTA 2WXQA 2F8VA 1TZGH 2J6EH 2FO4A 1KULA 4P4KD 1SJEB 1WZKA 3T4YA 3WJMB 2FZ3A 2ZP8A 4A2MA 5LXGL 3QEUA 2AJVH 4BQCA 3DARA 5C0FA 2R9HC 3LJ3A 1BD2E 2MQCA 5HHOE 3P0VH 4LHQB 1EJOH 1R3LB 3SD2A 1UD8A 2VWEC 3UTPE 1OGAE 2RH0A 4R9HA 4ERSL 1ZT7B 5DA4A 4MAYB 3F62A 1OPGH 5AVRB 2OKMA 2FUTA 1F6AB 4AGMA 4YSPA 5DS1A 3GO1H 5CAYB 4UQ2B 1DVFB 1V7MH 4WTZG 1ZKAA 1SBSL 3KPMB 1DCEA 2F7RA 1M53A 2YS4A 1EEYB 3HE7B 3DX6B 2VXVH 1OLZA 3ZKMD 4PRIE 3IXTA 3RTQB 2ICES 4R5XA 1VESA 3TJEH 4WW2B 3LN4A 3MBEA 5ADPH 1E9QB 1MIEL 4HS6B 3I9GH 3OKMB 4JFFA 3VSUA 4NCC1 2B7DT 3S37L 3UADA 3HAEH 1H5BB 4IBYA 1QLEL 1FO0L 1TVDA 3VXUE 3HB3B 1GR7A 1CS6A 4ELMA 4HXAH 4ZT1A 2W9EH 3OL2A 2R0LL 5CINH 2WO3B 2Q3XA 4AEHH 3WDHA 3O0RH 1FNLA 2ZOOA 2DLGA 3TYFA 5FECA 4G71B 1D2OA 5FV2A 3PHOA 4W1TA 2XRAH 3DOHA 3T2OA 2WLKA 3MJ8B 2AABH 2E9WA 2X4QA 4PMEA 5D2NB 1OY3B 3MLXL 4OM0H 4F9PA 1WK0A 1F6FB 1CD9B 3D39E 1AFVH 5IB3B 2DEWX 3LS4H 5I15L 4MNHB 4XVTH 1QFWI 5CEZE 2B15A 1SHSA 3WLWC 4J1UA 2JXMB 1C5CH 1NC4A 2JIXB 2Z1KA 3JV5A 2NT0A 1TZHB 3WKQA 4F7PB 5IHZB 5E6ZA 1IGYB 3CMOL 4JB9H 4AJVA 2F5AH 3FU5A 3NN8A 4WUUE 2UYLB 2Z7UA 2YC1B 2XWCA 3MBED 4GXVL 4JFFD 3RI5F 4Q9RH 3D3VA 3LRMA 3RDTA 3NMEA 1SUHA 5EU5A 1FAKT 3QCTH 4U31A 4CGUB 4N8PA 5DRXA 2P1YA 2MQ3A 3ESNA 1D5XA 5K9QG 4O2FA 4YNYA 4DKDC 1T3FA 4JE0A 5C9JA 1E4XL 2B39A 2VN4A 3VXPA 3HLAB 1AR1B 1BQHB 3THML 3DK0A 3QI9D 1HHGB 4JHWH 1DO6A 3H2WA 1EZLA 3GMMB 1CFQA 5C0EA 5DJ0A 1HEHC 2Q10A 4H1LB 4IBLT 3WBDA 5MEPB 4CMHB 2CJTA 2R39A 1ONQB 2VO8A 5IFJA 3X14B 4AEFA 1HZHL 1N7ML 4FXLA 5LXGH 1KIUB 4AUJA 2K1MA 3BT2L 1JVOA 2X1QA 5F7UA 1OSPL 4H0IA 5TD4A 5JW5B 1I1RA 2WTPA 3MRMA 3FU9A 3NFSL 4ERSH 3ILQD 2QSVA 3KPOB 3AM8A 1KCUL 4PWIA 5IVXA 3HC4L 1JG9A 5CJXA 3UZVA 1WP6A 4FLQA 5EB9A 4WHTA 1ETZA 2GAZB 3GHEL 1SBSH 5L6YL 3BZFA 4E9TA 4HMDA 3D3VD 3RDTD 1UWXH 3WY1A 1EVTC 4G5ZL 1MXGA 4LCWA 3EGSB 3CBKB 1CXHA 2JJSA 4FJYA 4EKXA 4Z7NE 2A6IB 5IFAL 4OT1L 2JJTC 2OTUB 3S37H 3UABA 4U3XA 2FYYA 2OM5A 1QLEH 1FO0H 2XTJB 1FFQA 3VFPB 3UXFA 1A2YA 5JR1L 4BZ2L 2R0LH 4RBPK 3I02B 2BRRL 4P49A 2R59A 1KCRL 1PY9A 5LGYA 3TJPA 4HKJA 2LLLA 2A6KB 3QRFM 5DUJA 2E4FA 1TYRA 1M05B 2YGOA 5E4EB 5F44A 3MLXH 4OV6F 4DKEH 1P53A 5F1SA 3NSFA 4BV1A 1T5XB 3LKPA 1BF2A 1TFPA 5JDSA 4ZYKA 5I15H 3FO1B 3NFPA 4Y5VB 2IDFA 1G9NL 3IJHB 4ZFOB 5EFIA 3NEOA 3GLDA 4IU2A 1XT5A 3KBHE 1XAKA 1WV7T 4WI8A 2K6WA 1KT2A 4NO5B 1CTOA 4OFDA 3T3PE 3ARPA 3NCBB 4F5CA 4N2BA 1JMXA 5EPMA 3RIAF 4Y7MA 1WA2X 4G42B 4GW4B 4CVXB 5F0PB 1B4TA 3CMOH 4NQUA 5IB2B 3VM7A 1UGKA 4PGBA 3QDHA 5J13B 1F1DA 4MGXA 3QJTB 3D18A 4HK0B 4LCWD 1PSKL 3OMZA 5CCHE 3CVBA 4MNQE 4KO5A 4GXVH 3GSXA 2X0UA 4IBVA 3O6FB 1IFGA 1WD9A 4X4MA 1EO8H 5IM7A 3GMNA 5I82A 4O2CA 5E1AA 1C5DB 1DSFL 1E4XH 3AABA 3MYJA 3QUZC 4FZEL 4PIBA 2Y7LA 3BKJL 3S3PA 3VFVA 5IQLA 3AC0A 1KPRB 3THMH 1CYGA 2XKSA 3G5ZB 5AUMA 3BFOA 3E9UA 4HV8A 4JN2B 4AL8L 1ECZA 3KNBB 3ARFA 3GKWL 1KJ2L 4KO9A 4HJSA 5FYLH 2I9LB 3D30A 4WWKB 1DQLL 3P40A 4JM4L 4LIQL 3SPVB 4N8VG 5FX3A 1QRKA 1HZHH 2L7UA 4MJIB 5I17B 4DGIL 3BT2H 1BD2A 4UCFA 1OSPH 4AZ8A 4GI6A 4HIXL 4W9ZA 3HPLB 4MA7L 3NFSH 1DVUA 3I9PA 4ICWA 1BG1A 3E2HC 1KCUH 1KCKA 3BQUC 3ZQ9A 3HC4H 4RVBA 1XBDA 2KZKA 1P1ZA 5D6DC 1TCRA 2NZIA 1R19A 3ZR6A 4CUCA 3SE4A 4NFCA 3VFWA 4GXUN 4AYBA 1XEDA 3F7KA 1JYWA 1AZZC 3QR2A 6FABL 5L6YH 1XF5A 4JFXB 3V4PA 3CVDA 4PRIA 4WI6A 1OM3L 1YEHL 2BOBA 2H2PC 4G5ZH 3ET9F 3KWWA 4PY8I 5HYJB 2ZP0T 1JFHA 5IFAH 1JN6B 2ZKHL 4OT1H 5IG7A 2QKSA 2VQ1B 2H1XA 1N0XL 2HMID 5DK2B 4P57A 4EUPH 5FO8B 1OT2A 5DVOA 1NIEA 5JR1H 4BZ2H 3J8F7 1KIQB 4UB0H 5E1QA 1KB5B 1FF5A 1XVSA 2DYPA 1KCRH 3CDGA 4WV1C 3IAPA 3K80A 2AGJL 4ES8A 4LLQA 4FABL 2CO3A 5C0IA 4ZXBB 1G7MB 1BOYA 1NGYB 4BQ8A 3QAZC 2RB8A 1XGUA 1BD2D 1KEML 4WKXA 4YAQA 3HG5A 4K9JA 2BIHA 2PWHA 4P3WA 4K8RD 4HIHB 3GZOA 3LDBC 1G9NH 3FB8B 3GMOB 1HL9A 2H2SD 3UIZA 1CICC 3LY6A 3LHPL 3D87B 3HNVL 3KLKA 5T5NG 5C08A 1W0YT 4P46C 1CGWA 2JQMA 4KJQC 4YE4L 4ZUTA 3GMQA 4JFHE 1KIPA 3L3IB 4NCC2 3VU1A 1ZA6A 4NPYA 5I1DA 1RSYA 2V9QA 3ABMB 2XZCL 3O45A 3QIWA 3FB7A 4ZX6A 4PRID 4S1SL 5EIVA 1UD2A 4IRSC 1F11B 4QXWA 4U3HA 1PSKH 1MCBA 1VACA 3TTYA 1Z2KA 4PBVC 4LOUC 4UT6H 4NHUA 4L4TE 3WIHA 1CD8A 4XRCB 4ZW7A 5DQ9B 2DQUL 1KOAA 4OZIA 3FTZA 3WNNA 4UDUA 1FJ1B 3E8UL 1DSFH 1GOHA 1T1WA 3NRQA 3HBGA