3DLQR

Crystal structure of the il-22/il-22r1 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
209
structure length
201
Chain Sequence
b'DPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRARLTLEDIFHDLFYHLELQVQMHLGGKQREYEFFGLTPDTEFLGTIMILVPTWAKESAPYMCRVKTLPDRTWT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-22
publication title Crystal structure of the IL-22/IL-22R1 complex and its implications for the IL-22 signaling mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
total genus 42
structure length 201
sequence length 209
ec nomenclature
pdb deposition date 2008-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dlqR01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dlqR02
3B83A 1DBJL 2C3HA 4KTDH 4XC1L 3BSZL 5D2NB 3LRGA 2ZJSH 3DV4A 3MMEA 4NJ9H 1AXTL 1CLCA 1BJMA 2XY1A 3CSBA 4X5WB 5EUOE 4PJ7B 3SN6N 3GBLA 3MNZB 4KK6D 3T2QA 3ZLQC 1T1YB 5E24E 4APQA 3P9MA 3IF1A 5D1ZD 3CGTA 3T2OA 5DFVC 3CSYB 4P2RD 1UA6L 3B43A 3U83A 2VZ1A 5I8EB 1IGCH 4LMQE 3C6SA 3DX8B 2WIMA 1RJZB 3A6OA 1A2YA 1JNJA 5D5MF 2AW2A 3QCTH 2OSLA 4W4OA 2OTUA 3VFRB 1KG0B 5E94A 3UC0L 1RURL 4UNVA 2OM5A 4LCWD 2X40A 4FQ2H 1GAFH 2EIZA 1JGDB 3SQOH 3GMOA 1R5VB 4J3UA 3VXUA 4MDIB 3L6FB 5LCVH 2JK5A 3MYJB 4KZEH 5CCKL 3RVTC 1UXSA 2LAGB 5C2BL 1Z9MA 4JN1L 4OCWL 2ADIB 4X98B 2YEZA 4EI6B 3MV9D 2B4CH 1MF2H 1R3JA 4FFWD 1T0MA 1WFNA 4KMTL 3CH8A 1YPZB 3AS0A 5HYJD 2XZQL 1A64A 4OGXH 2QADB 5D1XA 2DB8A 1DEEB 5F9OL 5FCUL 1U91A 3T1WA 1T20B 3EDEA 3NCJL 3O2WH 2XQBL 1RUPL 3LAFA 3WUZA 3NA4A 3UTSD 1DN0B 4DFHA 5CD3A 1KJ2H 3F6LA 3EOBB 3WFDL 1G9NH 3TA3D 1OCWH 1ZSDB 4NNXA 1AO7E 5GS0L 3HG1B 5HJ3A 1DLFH 2XFXA 3IDMA 1BVLA 2OBGA 2NY7L 1BVZA 2V2XB 4NZUL 3DGCR 4HH9B 3CDYA 3B2VH 4C56B 3VH8B 4XPTH 1AGEB 1D9KB 5CAYB 3RA7H 6CGTA 1N5AA 1GPOL 5EC1A 4KVCL 3RI5F 1EVUA 3X3GH 3GDBA 3GHBL 4WUKL 3KJ6L 5DGRA 4OZIF 4X7TA 5T5FL 3OZ9L 3MRCB 2FR4B 4L5FL 3N06B 5E8OA 1XZ0B 1U8JA 3AY4C 3ALXA 2X89D 3TCLB 7FABH 1KLGB 4ONOA 2VUOA 4M62H 5CJQL 5DLMH 5D71L 3VXME 4P3WA 2XWJB 2WUCH 2JIXD 3JUZA 3V0WH 2FX7L 3ARDA 3BH9A 4PG2A 1UVQB 4Z7WE 3FN9A 2XZAL 1BX2A 2H3NB 3JV4A 1HHGB 4WNQB 4Z0XA 3NIGE 2ICWA 4XNZB 3LN5A 4UTBL 1XR9A 1KTKE 1J9CT 4G8FB 1KYOJ 4GS7B 2IPUG 2AQ3A 4LGRB 2B1HL 2D4FA 5ID0B 3H6JA 1I85C 1HSAB 2HLFC 3F12B 1R3KB 2IH3A 3CUPB 3K8LA 3FO9A 5F1SA 4E9LA 4YR6B 1R5WA 3IAGC 1RUQL 1T1XA 4KFZC 1EH9A 1P7QA 1QBBA 3P4MB 3QHFL 4HJGB 5AYUH 2R0ZL 1SYSB 3MJ7B 1TVBA 4ZUWB 4X6CB 4RA0C 2B7DT 1C12B 1N64H 3MGOB 1F4XH 4FQLL 5BXFA 4HLJA 3S37L 1XR8B 4F7EA 1RIVH 1C5DB 4H5SB 3BP4A 3EYSH 4ZS6D 2V5YA 2CGRH 3OKYA 4MD0B 4DKEH 3EUUA 1IEBA 1WTGT 1KPUB 1A6TB 5E5RB 3QQ4A 2HFFB 4W6WB 2PETA 1ZGLP 4WV1C 4QRRB 4FFYH 1MFNA 5F1IB 5E03A 4FP8H 1FZOB 3NZ8B 2EDWA 4MJID 5IGXH 3QI9C 5DTFA 4GW1A 3PWUA 1WWWX 4R90H 3KPTA 3MLWL 3M8OL 2YBRA 3V2AR 3PP4H 3LPGA 4Y16C 5MEOA 3FT2A 4EXKA 3C8DA 4M03A 2R0LH 5CEZH 2IAMC 3FQRA 3CK0H 3W39A 3LKPB 2QKIB 1XCTA 5TE6L 4S0TD 3UDWC 2QJDA 1FH5L 2AKRA 4G6ML 4GMSL 5CEXA 4JRYD 1MJ8H 1QBMH 2WP3T 4ZOCA 5F7LB 2P47B 2VITA 4NOFA 4OLZH 2BFVL 4DWHA 1IC7H 4MA3A 1E4XL 2H1PL 4NZJA 3L3KB 3I9GH 5T1MB 1B4RA 1C7SA 3SDDA 4IIQA 3ZT5A 5IEHA 5F9WC 5EH1A 1SYVA 3C60A 3S37X 1X4YA 5DJ0B 4LLMB 1JFQH 1LK3L 3K8MA 3RWDA 2DQUH 5J57B 3BZFB 3P73B 3ZDYE 4LSTL 5DDHB 5GJSH 2HRLA 4DKFH 5ID1A 1YQVH 4XVUD 5F3HB 2Z4QA 4OLEA 1NDMA 2EDHA 3LHPH 4C4KO 1NCAL 2MWCA 1NMAH 2IQ9H 2IALB 4TUKH 4OQ1A 5FECB 1JYXA 3RJDA 4HMEA 3VXNA 1JGVL 4WI5A 3U82B 1E6OH 3QEQD 5GS0C 1OGAA 3MRDA 4JZNB 1ED3B 5IIEB 2VDMH 4G7YL 5KSAC 3DRTB 4PJIA 4MJ2A 3HPLA 3WO3B 3U6RB 1DVFC 4NNPL 4WV1B 3MV8B 3TBSB 4LHUB 4NQEE 5BRZB 5CP7A 5SWSE 4ODSH 4KHTL 3CZJA 1MIMH 1TFHA 3U7WH 3BMVA 5E8NA 5BMFL 3MLZH 5FYJD 1GC1H 4MZ3A 1UB5B 4JY4B 2XPGA 4EVNB 1J0HA 2WV3A 1YYLH 2P5EA 1P7KB 1QBAA 32C2A 3AM8C 3O6FC 4EDWL 3SKOB 1RIUH 5KG9A 4YGVA 1BFTA 4OZGB 4QXTB 2JLLA 4XAKE 4CKVX 3L7FB 2QL1A 1F45A 3LMJH 2R56H 3PL6D 3SDXE 1CZ8L 3QCVL 1NBVL 4IMLB 2VAAA 3MCKB 3RBGA 3TO4D 2Q8AL 3QIBC 4NM4H 3VMPA 1MI5E 4KJQD 3THMH 3V5DB 2XRAL 5F9WB 5EOTB 2GAZB 3PWPB 1HEZA 5DQJA 4RGOH 3VFVA 3A6CH 4H25B 2W65B 3KLAA 2JE8A 1JRHH 4PR5A 4JGJA 1G7HA 3D25A 4QHMB 1JRHI 2X4QA 4ONGH 3BWAB 15C8H 2EH7H 2Z91A 1I4FA 1J10A 2R8SL 2ED8A 1ZGLM 1FGNH 3X12A 5D7LA 2VXTH 1FVEA 1Z0MA 2ZG2A 2D31A 3QHZH 3DPBA 1NEZB 3VG0H 3VWKA 3ZTNH 1CU4L 3QPXL 2DD8L 2I07A 4JFFD 2FX9H 5DYOB 4HUXA 5ETUB 3W9DB 4G8GE 1FFQA 5ILTL 4D9RD 5KSAB 5IB3A 4NUJB 2PW2B 1F58L 1TIUA 4WW1B 3FB8B 1TCMA 4R7NB 2HKHL 5CJXC 3DRQB 1UGNA 2X9XA 1KTLA 4FQXA 3V5HB 4M7JL 3W0WA 3H9HB 3NGBB 2BY3A 4U1KB 4PJXB 4PGZA 4QOKE 1BZ9A 2D7QA 3JV5A 4OF6A 1IGFL 5I0ZA 4O58L 3BE1H 4TVPD 3PE9A 4LSRH 1NCCL 4X80H 4PP2A 5I1IL 1QFWH 3W82A 2V7NA 4PS4L 1QFWI 2B39A 3BGFB 2VDQH 3LRSB 4P5MB 5I1CH 3QULB 4LHUG 2B0SL 8FABB 2WUBH 2R1WB 5L2JB 4I18A 1UCTA 4YDLC 1RUKH 4KQ4H 2FEDD 3SE4A 3O4LA 1JF1B 3WCYA 1BAFL 5E6IC 2EZ0D 2ADJB 3N85H 2KPNA 3D39A 1EJ6A 5DRZA 2J6EL 3JTTA 4MXQC 3QEUB 5HDLA 4WGVB 4Q9RH 4CADA 1R3IH 1I9JL 1NAML 5JW4M 2WMPA 2F74B 3DLQR 4JG0H 5DJYA 3BH8A 2VABA 3SDYH 2EDXA 4L4TE 5D96C 1WGOA 3CDFA 3EKCA 3PHQB 4G9FD 4UB0H 1T2QH 1UM5L 4BH8A 4JM2D 3NBNA 1H3XA 5C0BD 2EC9U 1J0IA 3PWNB 5DJ2B 5C0CE 2YK1H 1HILB 4LF3B 2RQ8A 4YHZH 2RGSA 4Z77A 1C16A 3TC9A 2VSCA 1M71A 2J1KA 5DC0A 1LE5A 1H5BC 3TIDB 4NKOB 4TSBL 5H35A 1CT8A 5B38G 4EI5A 2IEPA 4JKKA 2OQJB 4QT5B 5GRXG 3T2PA 4J23A 4JPKH 4ZG1A 4I77H 4KROD 1ZMYA 5DR5H 5HHVL 4N9GB 5HGAA 4HS3B 3MRJB 5EBMA 1VDGA 5MENE 1ZVYA 1LDPL 1MFCH 4Y0GA 3SO3B 4IOFC 1JK8A 3MGTA 3LV3A 1RZ8B 1SJEA 2YKLL 3U0TA 1EPFA 2F5AL 3CPLB 1DBMH 2N56A 3S96B 3VI3E 5FCSH 1XH3A 2E9WA 5HGBA 2BSTB 4IOIB 4MB3A 5KS9A 1NGXA 4NT6B 4QNPE 2E6QA 4AJ0A 2OL3A 4R8WL 3SDAC 3DO7A 1WZ1L 3GMQA 4DOHB 1CLYH 3U1SH 3HI6L 4XCEA 3VRLF 2ZUQC 3RVXC 1HE7A 4I0PD 4P9HL 2VDPL 2CO7B 4XNYH 3ZYIA 2R4RL 2DLGA 3ULVD 5I30H 5L7XL 2BNRB 3DI3B 3MV7D 1N8ZA 3U7AA 2I5YH 1CFTA 4HBCL 4ZS7H 3CFCH 4XNQA 4PRIB 2YOCA 2BNQE 5AAWA 2WWMC 4NQVA 4Z7WF 1B4JH 3O8XB 4CNIB 1GHFH 2O5ZL 3NIGF 3GBNH 2HLAB 2YPLB 1XF2B 4AENB 3B9KD 3M45A 1VCAA 3BISA 1HDMB 1W0VB 2B2XL 2I26N 3QO0B 4XCYB 3FAXA 5IV2A 3EHBC 1YC7A 1HKLH 3RWFA 4EEEA 1H5BB 3L3IA 1KCLA 5HHXL 5HHOE 1YECL 1OAZL 2QBWA 1KJMB 4L4VA 2ZCLH 5KSUA 2VLRB 3FB7A 3MLTB 2FJHA 5GGUB 4OFDA 4PGEB 5EU6D 5I15L 5INDB 3MJ9A 4JQXA 5HHME 4D94A 1NMCC 1CLZH 1JVKA 4JO2H 2ATPA 2H6PA 2Y07L 5ALCL 2AERT 3F58L 1N5YL 4OLYH 3TN0D 1ND0A 1K2DB 3AS2A 1UZ8A 4KC3B 3KPSD 5JLZB 3EFFB 1KXTB 3R06B 4Z9KB 5AWNH 2CRMA 5HGHB 2OR7A 1WISA 3DURA 5C0ND 2IC2A 1YEFH 2YMXH 4K7FA 1UCBL 1FG2A 2EEBA 4G5ZL 3ARWA 3OX8A 2CO6B 4PJDE 5GGVH 1IBGH 2VDKH 2X1QA 3VGHA 2IBBA 4QXGH 5EC2A 2IAND 2ICEA 2YZ8A 3SDAB 3SKUD 4PTTA 3B8SA 3QDJE 2HN7A 3RWGB 3ARBC 5EFIA 1QRND 4JLRA 2X4SB 2ORBH 4OI9A 4Y1AE 4N0RA 4HKJA 2HTKD 5JDJA 2NXYD 5KVEL 1S9KC 5FYKD 1TVHA 4BJLA 4YDJB 4XCCL 4JPWL 3UJTH 3L1OH 3BN9C 5FM5M 3GSUB 2VC2L 1KCUH 1M7IB 1XGYH 4XAWL 4J8RB 4JRXD 5FM5O 3T65A 1FNLA 1E4KA 1A1MB 3AS3A 5HHNB 3RNQA 1WFOA 5SWZA 4G42B 4PJ8C 3D2UB 3ZDYF 2BNUA 1VFAB 1IZKA 3G6DL 4J3VA 4OZHE 5FM4A 1OAXL 1IQWL 2BMKB 4ZO7A 1U95A 3PGFH 4MXWL 2A6IA 1BJ1J 3Q1SL 4P2RA 2OR8A 3C5ZD 1DP0A 3QUMH 3WUWA 4NBXB 4TPRL 1NANI 2DYPA 3ESVF 1LWRA 1QSED 5I19L 4QEGA 1HSBB 4R0LA 4U4BA 4KUZL 5FUZL 1NMCB 2E27L 3H3PH 3H9SD 4R4BB 3TGXA 3SCMD 1PAMA 2YD3A 3KPQB 4HIJB 2EEAA 3MRFB 1FP5A 1DBBL 5DMGC 3FFCA 4P4KC 2IADA 1QHPA 5DMKA 4RNRB 5TQ0H 2HTLD 1JHTB 3OMZA 1DBJH 4M61A 4UNUA 4XC1H 1CD1A 4HUUA 5FB8A 3G6JB 2IGFL 5T3XD 4RWHA 3SGKA 1AXTH 4XCFL 3QIWA 4XNUL 5DEFB 4EN3A 1ZXQA 4P9HC 1J18A 3QB7C 3ARBB 5I66A 2ADGA 5TFSH 1R3LA 1UA6H 2HT2D 1CGTA 5KZCB 5EO0A 4PJGF 3VE0A 3SDXF 1VEOA 1EEUA 5JXEC 3QZWG 1VACA 4XBEH 4M43L 5HYQA 5EO9A 5ACZB 3HI5L 1QYGL 1FL6B 3G5ZB 3CCHA 3IDUA 4U1JA 1A4KA 1EAPA 3C5SB 3H9ZA 3BZ4A 3ESUF 3U4BL 2C3VA 1MOEA 3BDBA 3AAZB 5F7WC 4L3EE 2XICA 5JOFB 5H37H 5CCKH 5FYKL 3HAEG 4CGTA 3BN3B 4HGMA 4JN1H 1ORQB 3GM0A 1F2XK 2OR9L 1IJ9A 4X7CC 4TQEH 2XN9D 4W4OC 4DQOH 3V4VL 1UFUA 4PGBB 1QNZL 1YJDH 1UKSA 5T3ZL 3JXAA 2BZDA 4NO3A 4X6DA 4OCRL 3IVKB 4WDIB 4PRAA 3D3VB 3E3QE 4JQVA 5F9OH 3TJEL 2BDNL 2AJUL 2SEBA 4S0SD 3T0BA 3T3PE 5JIPA 1KEML 2NNAA 3BP7A 5DURB 4X5XA 5F7YC 5IBTH 1MFBL 2WIIA 1KEGL 4UZGA 4RISL 1MLCA 3WHXB 5E56A 3MV01 3NPSC 1K3IA 2JIXA 1X7QA 3WFDH 4X6FA 5C0AB 1JGUL 4TUJA 2DWEA 2QHRH 4HGWA 1A7OL 1PY4A 4RX4A 2BC4B 4P4KB 2C3GA 4PB0L 4R2GC 3QDGD 1FGVH 2EDEA 1RZIB 4DGVL 5LQBL 3FB5A 3ARSA 4NZUH 5D1XC 3H8NA 1U3YA 4HWEL 4KKCC 1OTUC 3JV0A 4FQIL 5JHDA 2Y06L 1PYWA 1PEZA 5E0QA 4NKDB 4F7CB 3O3UN 3QNZB 1GPOH 1U58A 2K7PA 1GGCH 4OT1L 5F7EL 1OAKL 5T5FH 2FH6A 3OZ9H 1ZT7B 1J5OL 1FFOA 3QFJD 4B0MM 4PGCB 1XIWD 4NN5C 5JW4N 2VUYA 1PSKL 1P84K 2BP3A 3QDMD 1L6XA 3DV4B 3FQTA 3MMEB 1LEKA 4HQQL 1YNLL 4U6XA 4NO0A 5C6PB 1BECA 4APQB 3P9MB 3IF1B 4G6AD 4XP5L 3O6ML 5KN5A 1DL7L 3GB7A 3IFNH 3C6SB 4MGXA 4OLXH 1LE9A 4KWUA 1H15A 2F19L 2OSLB 4NKIH 2B1HH 2OTUB 3MBXL 5E94B 5JW5A 2DBLL 1TTFA 2YRPA 1FVCA 4MAYB 5I1EH 5KW9H 3QHFH 1YEDA 3MUJA 2YD2A 3GMOB 1JMZA 4PY7A 3ARDC 4PG2C 4MHHI 4ZSOA 4F2MA 2W59A 3VXUB 2JK5B 3UTOA 1UXSB 4E42A 4L3AA 1FYTE 1WBYA 4OKDA 3GSXA 2YEZB 5BJTA 1MJUL 1R3JB 2HJKA 3DVNA 4ZUSA 1T0MB 2IPUK 4MNQE 1MPAL 4MJ6A 3VI3F 3FN0H 4FQJL 4LSQL 5D1XB 1F6LL 1U91B 4JDTL 1RZ7L 1ZKAA 4QNPF 2IBZX 4WWID 1OPGH 1NLDL 2BSRB 2OYPA 4Y19E 1IM9A 5HYIA 1A6WL 3AC0A 4P2YA 1A7NH 5CD3B 4CVUA 4A2MA 5D70L 3SJVA 1T5WA 4ZAKC 3MLWH 1HXMA 3FFDA 3M8OH 3KYNA 4P57A 3UX9B 4NNXB 3W2DH 5DQDL 3Q5OA 2LQRA 5A3IC 5HJ3B 3IDMB 1BVLB 4NN5B 4PLKC 1RD6A 2WANA 1I8LA 3EGSA 5TE6H 4JFDB 3QNYA 2YSSA 4O4YL 4GMSH 1MVUA 4G6MH 3RZCC 2WBKA 2JJTA 5F1NA 1E4XH 2H1PH 5DFWH 1A1OB 1N5AB 4NDMA 5EC1B 4LCUA 1EHAA 3NCBB 4KKLD 1IC4L 4RFEA 3BYYA 5E8OB 1U8JB 2C7UA 2AEWA 2R2EA 3MACL 2AI0L 4YQXL 2JCCF 1WCBA 2M1KA 5K59E 1G7PA 1MLBA 4ORGA 1S78C 1PLGL 2XIDA 1G7JA 4ZQKA 5FGRA 3TP4A 3TF7C 3QQ9C 1G9ML 5EWIL 4OIBA 3MBED 5CGYC 3CFKA 3S35L 1YMMD 2ZKHL 3ARDB 3BH9B 4RAVA 5EZJB 2O93L 1Y6NR 3SDDC 1BX2B 3JV4B 4V1DE 3GSWA 4O5LL 2WW8A 3ULSA 4Z0XB 2ICWB 3LN5B 1XR9B 4EIZC 4JHWH 1KIUA 3W11D 4OJFL 3T0WA 2JJVA 5C08D 4G7YH 4XPAL 2VLJD 2FBJL 2YUXA 2IH3B 3BPOC 5FYLD 2V7HA 5C1MB 1T1XB 1P7QB 2XA8H 4NNPH 4U31A 3PQYD 4NP4H 4PJDF 1T89A 4D0CA 1LO4L 1BQSA 4KHTH 3DVIA 4RWYL 1TVBB 1SY6A 4J7RA 1CQYA 1W8NA 4AMKL 2BOBA 5CIPA 4OI7A 5T1LD 1LEGB 2ADFH 3BMWA 5HD8D 5BXFB 1CLOH 2AJXL 1XFPA 3O6KH 4F7EB 5GQBA 2NY5L 2VE6A 3BP4B 1UADC 4ONFH 3TVMD 4NZRL 5BVPL 3O4OB 1IEBB 3P2TA 1G1CA 1SEQH 1ZA6A 3QQ4B 3NVQA 1GOFA 4S1RH 1CXHA 3BT2H 3PDOA 3QCVH 2D0HA 4XMPL 1IGIL 2BRRH 3O2VL 2E7MA 3S35X 5KSBF 2AK4D 5DTFB 4GW1B 3PWUB 4JZOA 2XV6B 4N8CH 1IRAY 2YBRB 3V5KA 5MEOB 4OZHF 3FT2B 2VZSA 2NX5D 4MQXC 2BVPA 3ZYJA 3FQRB 2Y23A 1ZHLB 4WUUD 3W39B 1KYOK 4E0RA 1XCTB 2VH5H 4JO1H 1C5BH 2AKRB 5CEXB 4D3CL 3BKYH 4M02A 5TE7H 2VITB 3BKJL 2R8SH 4MA3B 4Q0XL 3LB6D 4PJ5E 4YEEA 5BV7L 2CKBA 3SDDB 4LEOA 4IIQB 3WIIH 5IEHB 1K6QH 2NR6C 2L4OA 4XPGL 4JQIL 5CZKA 4ALAH 5FDYA 3C60B 3PABA 3RVVC 1A7RL 4KK5D 3QPXH 4M9OA 4WI3A 5IBLC 3WNNA 2J3SA 4ZFOA 4NYLB 4ZOBA 3LKOA 5ID1B 3DYPA 2G60H 1S7UA 5DK0A 3REWA 1F58H 2Z4QB 1NDMB 4W4NA 1FDLL 2HKHH 5GRYA 3HC0A 2EDLA 2IH1A 3FN3A 4I13B 3TV3L 1B88A 3VXNB 3RDTC 5IHZB 4JREC 1TENA 3VWKC 5E99L 5I8KL 3ROOA 5J4MA 4F57L 3REVA 1OGAB 1NCCH 5I1IH 2DM4A 3VFTA 5HY9A 1BOYA 3ZSTA 4OCSH 4PJIB 3AXLA 2V17H 3HPLB 3MNWA 1INDL 3SQBA 1PJ9A 4HPOH 1Z2KA 3MJ9L 4KQ3H 4LSUH 3WXVH 5EPMA 1A0QL 4FQXC 5CP7B 3GRWH 1J0KA 2GW5A 1V05A 1VHPA 5EA0L 2CQVA 1FYHB 4KJWC 5E8NB 2XTJD 2P5WB 4QGYA 3G9AB 2NY0C 3F6IA 2XPGB 2P5EB 2DQTH 32C2B 5A16B 5KG9B 5GPRA 3D9AL 5ESVB 5GZNC 5JXAH 5HDBE 3DX7A 4LRIA 4YGVB 5EU7C 4B41A 3CDGA 4NHCH 4OAWA 1G9MC 1S9YA 1UM5H 4YHML 4WEMB 4UOW0 3QAZC 4YDVA 3CD4A 4BZ2L 1QG3A 1X3DA 3WBDA 1RZKH 2D9CA 2VAAB 4JFQA 3B4NA 2E7HA 4XZUA 1HHHA 4P3CH 3GSNA 3PP3H 5E8PA 3T3PF 1RSFA 2JJUA 5E2TH 4LQFL 3C5JA 4HUKB 1HEZB 1QFWM 4TSBH 2GJ6E 3IGAA 4JDVA 3VFVB 2EO9A 1QR4A 2RJMA 3KLAB 4KI1A 4PR5B 1G7HB 5HHVH 4OCMC 2X4QB 4JKMA 1DE4A 1TCRA 4M1DH 2VXUL 2Z91B 1MEXL 1I4FB 1KIQA 2R69H 4JFED 3X12B 2HT3C 5CJ8A 5D7LB 1FVEB 1DQQA 2YKLH 2ESVE 3B9KA 2D31B 3CU1A 4RFOL 5IW1A 4OCXL 2NY5C 4JREB 4K7PY 3VWKB 1DLHA 1YMHA 2YUWA 5IM7A 4HLZH 2QQNL 4N5ED 2R29H 1OQOA 2I07B 4EI5C 2AJYL 4HUXB 5JOPE 4NN7B 1VGEH 4IDJL 5IB3B 1MAML 4PV8A 3UCRA 5KJRL 3HI6H 5EU6A 3K2UH 4K94L 1KTLB 1M7XA 4PLJD 2KBGA 2VDPH 3NCMA 4FZEL 3QFDA 4ZODA 5L7XH 1BZ9B 2NY0B 1N0LA 2DRUA 4P9MH 3BD5A 4NWTL 2FEEI 4PP2B 2V7NB 2DOCA 2AXFA 4LPTA 2O5ZH 2IMMA 2PYEE 4I18B 3QAZB 1F11A 3V6BR 2UV3A 4KKLC 3D39B 3RWCA 1QRNA 4XWOC 4Y4KD 4CDHA 4NC1E 3JTTB 1U8PA 4ZPVA 3FOMB 3MRKA 1A6VL 1V7NL 4J3XA 3RAJH 5KAQF 3C2AL 4WCYL 4CADB 4GXVL 5HHXH 1YECH 2VABB 35C8L 5LG1A 2X05A 2ZNXA 4BH8B 5I15H 4TRPL 3LQZA 4MNGA 3BEVA 4JFXA 1HHIA 2XZCL 2P4AB 4LFHG 5KTEL 1BOGA 4I3SH 4YDKH 3OSKA 2E6PA 4OSUL 4Z77B 3T0EA 1C16B 4M93C 3QCUL 1FIGL 1LVEA 1M71B 1S7XA 1LE5B 1WTLA 1YY9D 1P9MA 3F7YA 4HMCA 1OP3K 2XNAA 5H35B 1CT8B 4FTVE 4GRWB 1O7VA 4IRSD 4Y2DC 1I9RH 4G5ZH 4EI5B 2W0FA 4WFFD 1KPVA 5TF1H 4ZUVA 4JQXC 5HGAB 2EC8A 5EBMB 2DQHH 3MLUL 5CINL 3WNPA 4X8XA 5IHUL 2BSED 4JKPH 3MGTB 4B7LA 4WO4A 3KPMA 5JR1L 4ETYA 3WO4C 1SJEB 3U0TB 1EERB 4EXPX 5HD8C 3CC5A 4X7SL 3Q2CA 1EX0A 3H9SA 5HXMA 5ISZD 3SCMA 3IDJA 1U3JA 1OWRM 4JPWH 5HGBB 5GJTL 1KULA 1NGXB 5E4IA 3NCEB 4XPHL 4XAWH 2VN4A 2OL3B 5B39B 3DO7B 3M17B 5FAAA 1WIPA 4M7LT 4CVWA 3BRGC 4XCEB 3MRRA 1WBZA 4CN6A 4QHKJ 4XHJC 4M1GH 4NZDA 2F58L 4ZOAA 4UDTA 1J1OL 4S11A 1N8ZB 25C8H 1CFTB 3WEXA 5CZVH 3HI1B 3FRUA 5IVXE 4XNQB 4MXWH 1QZ1A 3Q1SH 4PJ9D 3VWJC 4NQVB 4P46C 1FLRL 1MUJB 1NDGA 2DQIL 1WAAE 2EDQA 2Z8RA 4PJEE 4J6RL 1CGVA 3FL7A 1R0AH 5HYEA 5TDOA 1E4KC 5FUCC 2UY6A 4Z7VE 2J12B 4JFYA 4TSCL 5FYJU 5TDPB 2E27H 1INQA 5DUPL 3ARGD 3ULUH 5D72L 5J3HD 4KAQH 1WK0A 1HZHH 2EH8L 2R4SL 5IV2B 3KLDA 4M93B 2Y5EA 3HRPA 3RWFB 1H3PH 3L3IB 1DBBH 3UTTE 1UENA 3OAUL 4L4VB 5KSUB 2PTUA 4G8IA 4U33A 3FB7B 2FJHB 1T83A 2ICWI 1NKRA 3QJFA 1MCHA 2XN9A 1RAMA 3TPUA 4U1MA 1CL7L 1OTTD 2IGFH 3SGEH 4R0LC 4K94C 1BEYL 3SGEI 1GZQA 3KXFE 2ATPB 2I27N 2H6PB 2HRPL 1KIPA 1ND0B 3WO4B 1UZ8B 4RDQG 3DECA 1MJ7H 4KMQA 4YZFE 3DURB 1L0QA 3EO9H 1U8MA 1HHKA 1P6AB 2YD9A 2NTSP 2ZUYA 2FB4H 2YD7A 3LS5H 2RCSH 4K7FB 4PRPE 1FG2B 2LV4A 3OX8B 3WFBL 5FKAB 4DK3A 1J8HA 4ZD3L 5I8OL 3HI5H 4YGAB 5EC2B 2ICEB 3V4PH 3SGKC 1QYGH 4EN3C 3QIWC 2HN7B 1KBGH 2PUQT 2BSSA 5EBWA 3KPRE 5EFIB 2G2RA 2IG2H 4JLRB 1FC2D 4OIIL 1OF2A 2IWGA 4J3TA 1WV7T 4I3GA 4HKJB 3KPOA 1TVHB 4ZFGL 2FGWH 5IVOA 3FT4B 5E7FA 1UKQA 1NL0L 1LK2A 1YA5A 4HKZA 4P5TD 3V4VH 1QNZH 1Q38A 3A6BL 3FKUS 1MCDA 3T65B 3LEYH 4J4PC 2QV2A 3RNQB 2AJUH 4N0CC 2YN5A 5SWZB 1KEMH 2PXYD 1S7RA 2BNUB 1MFBH 1MFAL 1JHKH 4LVNB 1EBAA 4RISH 1PVHA 3BPCA 4U6YA 1KTDA 1ADQA 3BYTA 1JGUH 1U95B 5D1ZB 2A6IB 4LCWE 1F00I 4P2RB 1A7OH 1H8NA 3CSPA 3JWOH 1O5DT 3I2CL 1NFDB 1ZVHA 3AUVA 3WUWB 1GGYA 2DYPB 3OAZK 3A67L 5I8CA 4DGVH 5LQBH 4OFKA 3MZTA 4MCYA 4JQVC 1YPZF 1NGWA 4R0LB 1DQLL 4HWEH 3OKNA 2Y06H 3B9AA 3MC0A 4CMHC 1CD0A 3VFGL 3MRPB 3MV9E 1JZ3A 4AG4H 3VI4E 1MCRA 2H32A 3HFML 5HYJE 4O02H 3FFCB 5D5MA 3RTQD 1T7VA 2IADB 3GSOA 1RUML 5IB4A 5IFJB 1I1AA 5DMKB 4KKAD 4LSSH 5C09A 4LVEA 4M61B 1PSKH 5FUOL 5B8CB 1CD1B 4ODXA 5JHLL 2Y1VA 3I3DA 4HUUB 5FB8B 3UTSE 3KLSA 4EN3B 4KVNL 3B9EA 3GZKA 3VMNA 3STBA 5GRWA 1KFAL 4HQQH 3WSQL 5HDBF 4H8WL 5I66B 4NQED 1K9TA 2P49B 3Q6GL 5SWSD 5BZWA 1JGLL 2ADGB 4YXKL 4UBDD 3U9UA 1R3LB 1CDHA 1SY6L 4UV4L 5EO0B 3SOBL 3O6MH 5GRJH 3ILQC 2BERA 1VACB 3D0VA 4OKVA 3U7YL 5HYQB 5EO9B 2DQDL 1NAKL 4TULL 3CCHB 2XZZA 4U1SA 1Y0LA 3G04A 4XAKD 5B3NA 4U1JB 1A4KB 1R6VA 2DIJA 1EAPB 5TF0A 3BZ4B 5INCA 1LILA 2C3VB 5GS3A 4Z7UE 3WFCL 3TYFA 1HIMH 1CBVH 3NTCL 5J8OA 3K74B 4ELME 4D9QD 3BESR 5IQ9A 2ZG1A 2VRAA 2WWKO 3DV6A 1MI5D 2DQGL 3ZHKA 1EEZA 1QPXA 5ACMA 3TWCH 4KHXL 1GIGH 4JAMA 5DI8A 2X09A 4NO3B 1B9ZA 3R4DA 1G84A 4PRAB 5ESQB 4K8RL 4LSQH 4NRZB 4PJCE 2SEBB 3ARFA 4R4FL 1PKQA 4JDTH 2K7QA 3Q3GA 1NLDH 4X5XB 3VW3L 4H0IA 4WIQA 1A6WH 1T0NA 4E41A 1FCGA 2JIXB 1X7QB 3CFEA 2CKBL 2F54D 4KK9C 4X6FB 2VLRE 3OB8A 2DWEB 1TZIB 2P44B 4HGWB 3VGBA 1N4XH 3F8UB 2FDBP 3KYKL 3X3FH 5BS0D 4UDUB 5DQDH 2OTPA 2OXGA 4JHAL 4ERSL 4ZFOL 3FB5B 1NBZA 6FABL 3BKML 5JHDB 2EDRA 5DQ9A 1CXKA 1LNUB 1PYWB 4OBRA 1IC1A 2ILLA 1BFOA 1U42A 3LQAL 3B2UC 2X4PA 1CFVH 1I1CA 1KOAA 1VFBA 2EDTA 2FECL 3PQYA 1E4WL 2Q7YA 3L5IA 3PWVA 5I1AA 3EJYD 1VEMA 4QOKD 4TUOA 1IC4H 2BJML 5JO5A 1FFOB 4BKLB 4Y4HA 5HI5C 2AJSL 2FJGA 3MACH 2AI0H 4Y4FA 1AXIB 1MNUL 4K3EH 4PV9B 3FQTB 4KRPD 1LEKB 4M5ZL 2VZTA 2OXHA 1BF8A 2X2YA 1JWSA 4KRMB 2JJTC 4U6XB 4NO0B 3QNXA 4JJ5B 1J1PH 4NQDD 3HZYA 3TM6A 4GXUM 2DMKA 5A2FA 3GK8H 4GKZA 1H3VA 5D7IE 1CFSB 1FVDA 5KN5B 4KDWA 3GB7B 4O5LH 3N9GL 3TCXA 5E9DA 1LE9B 4MJIB 2AK4A 5C07A 1H15B 2QHLA 4Y5XA 5IFAL 4LCYB 3OR7B 5CUSH 4OJFH 5IMLA 4XTRC 3OJVC 5ALBL 3ZT6A 2FBJH 2WQRA 1FVCB 3QUKA 4ODHH 5B22A 5FYKU 3CX5J 1YEDB 3WDHA 4WGWB 3NIDF 2CR3A 4PY7B 1ZTXL 3GI9H 4ZSOB 4F2MB 4JRYB 4RWYH 2MTPA 2EYRA 3QRGL 4Y5YA 1KV3A 3QQ3A 4AMKH 3MRNA 3OAYK 4RGNC 4WTWA 3RQ3A 4E42B 4X8JA 3BX7C 4QF1B 4QRTA 5KVFL 3GSNL 3GSXB 1NUNB 1CYGA 1NGPL 2JB5L 2Z0BA 3VGGA 4NGHL 5BJTB 3EDDA 1NFIA 3DVNB 2HJKB 3ZE2E 4ZUSB 4NZRH 5BVPH 1WFTA 4P2OA 4GRWH 1P1ZA 5I71B 3HPJA 1UJTA 4H8WC 4BFBD 1ZT4A 4LLQA 4AIXA 5E8DL 3VXRE 1T89C 3S5LA 4FS0A 4OBSA 1X4XA 4PJAE 3QEQE 3O2VH 2LFGA 2P8MB 4BSVA 3ALWA 3TESA 4PY8J 1FNSL 5CBAA 4XP4L 1N7MH 4YE4L 4MB4A 3SJVB 1T5WB 3GSRA 4PRHD 3GUTB 1HXMB 3FFDB 3KYNB 4P57B 1EZVY 4URTB 3S3SA 4GG6E 2PTVA 4YAQA 2AJ3A 1BQHA 4QKXB 3EGSB 3VFMA 2FHCA 1MVUB 3MREA 1PGRB 2OL3H 4DTGH 2R2BA 2H9GB 4HCRA 5I1KL 3BKJH 4YEFA 1WAAF 5F1NB 1K3ZA 4Q0XH 4RZCA 3NACH 3IDNA 4PJEF 4NDMB 3GNML 5FV2A 2EDDA 3MA9L 1YEIH 2IFFL 4LCUB 3NAAH 4Z7VF 3T4AA 1ZANH 1OP5H 4G3YL 4RFEB 1U9KA 4JQIH 4L8BA 2ZPKH 2EDKA 4N8VA 1ZA3A 3QJHA 3RKDD 2C7UB 2ZUXA 4LHJB 5ICZA 2R2EB 3QUZA 3KPLA 2BNQD 5D7JD 3QUYD 1WCBB 4K8RC 1G7PB 4UINL 1MLBB 4GAYA 4ORGB 4D0DA 2XT1B 4NQCE 5C6WH 5DEGB 4ZQKB 4S1QL 4EKXA 2J8UE 3X17A 5CLWA 3V6OA 1F3JA 2XG4A 1S7QA 3NA9H 1FDLH 3SBWA 2DLEA 3CFKB 4NQTA 4S2SA 4Y2OA 4RAVB 3TV3H 4R97C 4RGNB 4MD4A 3GSWB 1OSZB 2CDFA 5E99H 3ZHDA 5E08L 5JXEA 1P2CA 2MQ0A 5HHOD 5IQ7H 3H3BC 4JANB 2X1XR 4XVSL 2HG5A 4YZFF 3FQUA 3VXQB 1I3RA 1INDH 1J1XL 1ODAA 5KANI 2V7HB 3MJ9H 3X13A 3V6ZA 3LQAC 4M7LL 1A0QH 1CGWA 5D7SL 3H42H 1KCVH 4D0CB 3QP3A 4HKXA 4JFFE 4KDVA 2BOBB 3BKCH 3CZFA 5CIPB 1G0DA 1AI1H 2E9BA 4D9RE 3OGOE 2X5PA 4ELKA 1RVFH 1WITA 5DK3A 2HVJA 1FZKA 1S7WB 1Q72L 5D8JH 4FXGB 2AAVA 3OGCA 5EU4A 1LD9A 3D9AH 3HRZA 4MMZC 4OF5A 1ZHNA 4MSWA 3VU2A 1E6JL 2W92A 1T5XA 1ZA6B 4YHMH 3LY6A 3MRLA 3IJYA 5E2WL 1AHWA 3VDBA 1MCPL 3SDCC 3JWDL 4BZ2H 4PGDA 3MOBL 4EDXB 4IMKC 2FO4A 4JZOB 3LCYA 1K4CB 2C3WA 3EOTH 2IBGA 4QRQA 3V5KB 4GSDL 4LQFH 4O2EA 3STLA 3RKPA 1IAIH 3KS0J 3TYGL 3TLRA 2MCPL 1IAII 4M1CC 2X1PA 3I6KA 4H26B 1KENL 4YC2B 1B0WA 2BVPB 1NMBL 4LLDA 4E0RB 3MNZA 5FA3A 1I1FB 1X9QA 1OB1A 1DUZA 3QBTB 1WT5A 2MSPA 2OK0L 2VXUH 1MAKA 2V5SA 2ZG3A 4G7VL 4I3RL 1CGUA 4MD5B 5SV4A 2NW3A 5FO8A 4E5XA 3KJ4C 5EUOA 4RFOH 4R97B 4G9FE 4FABL 3P3YA 2VYRE 4OCYH 4K3JH 5HYSA 3NN8A 1AQDB 3PABB 4Q9BA 4MQSB 3CIQA 2H8PA 3ZKND 4Y4KA 2A9ML 2AJYH 4RQQA 1T22A 5GGRY 4ZFOB 4BK5A 3VI4F 4LQ1A 4BQ8A 3DIFA 3LKOB 3PV7A 1S7UB 5DK0B 3REWB 2DMBA 2DM3A 3RGHA 5KJRH 1M4KA 4FMFA 1OAUH 2AK1H 2BY1A 3UBXA 4ZXBA 5GGQL 3HC0B 1UACL 3TT3L 2NY6C 4Z95L 2IH1B 1OL0A 4ZPTA 4X99A 1MELA 4ZO6A 4GLRH 4X98A 5B4MC 1NCTA 4FZEH 4GLRI 4LSPL 5K93A 2WLYA 5SX5K 3REVB 3OXRA 4K2UH 4NWTH 4WTZA 4WU7B 2B8OT 4ZO9A 3VFTB 1P7HL 2GSIA 5MERA 4U1HA 1MCOL 4HG4J 3E6FA 1Z9LA 3MNWB 1JN6A 3ZL4H 3P30L 4IRSA 2Q3ZA 5KOVC 1A3RL 1PG7W 1MCCA 5EPMB 4KROB 4WHYH 3ABZA 1UM6L 1RK0A 4YBQD 1QA9A 5C0GB 5GGTA 2BY0A 3CFBA 4HWBA 3WJLA 4XVTL 4Z7UF 1F4WL 1LO2L 1SJHA 4TTDC 3VG9C 3C2AH 4WCYH 4GXVH 1JI2A 3HC3L 1V3JA 3DX7B 1T4KA 3I6GA 3CDGB 4OAWB 1S9YB 4OD1L 4HPYL 4UT9L 4YDVB 1AO7A 2XACC 4UAOC 5I6XC 2XZCH 1U8LA 2XKNA 1FNFA 4J3WA 3O3DA 1G7IA 1KN4H 4QXUH 4JFQB 1ZEAL 2VL4A 3B5TA 5F71A 4XZUB 5HTSA 1HHHB 1RU9L 4I0PB 5E8PB 4GG8A 1PZUB 3TCLA 4CN1A 1DQJA 1KLGA 4NJ9L 2R1XA 2A0LD 1TJIH 4HIEA 4JDVB 4FQQA 5HVHB 1YEHH 4HHAA 4QRPD 4QHUA 3V0VB 4I2XE 3SKMA 5CINH 1DE4B 1TCRB 4WFGE 5KSVB 1KIQB 2H3NA 5HSFA 5J1SC 1DQQB 5K9JH 4HIIA 3FZUC 3T0EC 3ARED 3B9KB 4X7SH 1N2RB 3QCTL 1FN4A 2CIIA 4ZYKA 2Q87A 3VXMA 2F8XC 1P9MC 5E2UH 5AYQA 1YMHB 5IM7B 3EZ8A 4M00A 3R0NA 1EEYA 3EYFA 3DXAD 4FQ2L 2HH0H 4GRLD 1GAFL 3CUPA 4Z7WA 43CAA 1CK0L 3SQOL 3P4MA 2ARJQ 5TGBA 4XPHH 4PV8B 3JWDC 3IJHA 3T3ME 3MJ7A 2LU4A 3KPSE 3VD4A 4KZEL 5EU6B 1C12A 1EZVX 4WO4C 1J11A 3IETA 3UPCA 5HDOA 5IVZA 1CICD 1RIHL 3TO2A 1J1OH 1MF2L 4GXUN 1JTTA 5I74B 1MVFA 2C1PA 3L9RA 2WNGA 3OR6B 4OGXL 5JW3L 3MODH 4HW6A 4QTIL 3FCTA 4LCCA 2AXFB 5D7IF 5B21A 2HFTA 1DJSA 4P99A 3O2WL 4J6RH 5HHPA 1BD2D 2HFGL 3NZ8A 3TZVD 2PO6D 5F7MC 3MV11 5FYKE 4TSCH 5CGMA 1F11B 5FOBA 4UAOB 4JY6A 1WIUA 4LIQL 5DUPH 5ITBH 3VXSE 4MQ7A 3RWCB 1OCWL 1QRNB 4QTHA 2EH8H 1U8PB 4ZPVB 5T3ZE 1H3TA 4JRXE 3MRKB 5CEZD 4DZBA 2MHAA 4LCIL 4AIZA 3ZYZA 4DVBA 3ALPA 3ZTJG 1F8TL 4GBXA 4XPTL 3GMPA 1C1EL 3LQZB 1CL7H 4JFXB 4KDTA 3MXWL 4XPFL 2OI9C 1HHIB 3ZE2F 3X3GL 4JFZL 1GCFA 1AKJD 4OGAC 1BOGB 3FTGA 5D1QD 5IMKB 1OW0A 2V9TA 3T0EB 3QUMA 1QFOA 4PJAF 3F7YB 5DDHA 5L2KD 4N9OB 2XNAB 2WQ8A 1FYTD 4HMDA 4N0UE 4M62L 5F3HA 1Z9SA 1X5ZA 2W0FB 5DLML 5FEBA 3RGVD 1KPVB 4ZUVB 2NY1C 1F4HA 1S7SA 4F3FA 2WBJD 4CU7A 4M9PA 1G7MA 3D18A 3U0WH 1B90A 4D0BA 3ZE0E 1QSEB 3KPMB 4WO4B 1VGKA 4B53A 4Y19D 2G5BA 3CC5B 3H9SB 5T1DL 1ED3A 3HNVH 3SCMB 4ZFGH 3IDJB 5DGQA 3ARQA 1KN2H 5T3XE 1U36A 1NL0H 3HS0B 1A6UH 1W8OA 5L6YH 3MRRB 1WBZB 5F6IB 4YX2H 1F4XL 1UB5A 1IGML 4YO0A 3KR3H 1MFAH 1RIVL 1P7KA 4UDTB 3DETD 2J8UF 3KLHD 1JYVA 3WEXB 3FRUB 5SWSA 3LEVH 4PB9L 1A02N 4WEBH 3AMLA 3L7FA 4X5LA 4NFBA 5F1KC 3I2CH 1MHPH 5FYJH 4FP8L 2AVGA 3A67H 2GYSA 5TDOB 3TIEA 3JUYA 1DQLH 4JFYB 2OI9B 3RVUD 1INQB 3WIHH 1ZK9A 5CZXD 4C83A 4HJJL 1U3HC 2HVKB 2Q7NA 3GMMA 3PP4L 2X4OA 3SDXA 4Z18A 4OUOA 4MWFA 5IHBA 1RUMH 2M26A 4QHMA 4G8IB 3HE6D 1QBML 1MCIA 1MI5A 1IAKA 3QJFB 4RMVA 4OLZL 1UJ3A 3MRBA 3RI5K 2XN9B 3D5OF 2NY1B 4LASH 3IDGA 3EYQC 4PJBE 2FHFA 4XRCA 3TPUB 4KVNH 1OAQH 2F53D 1T6VN 4ISVA 1IILE 3I9GL 1GZQB 4JN2A 4UU9A 5IKCB 2BY2A 4H8WH 1KIPB 3V79C 4H88H 1JGLH 4YXKH 3QDGE 2ED9A 2P43B 1HNGA 5CIPH 1DEDA 2A38A 1A14L 1U8MB 1HHKB 4DKFL 3MROA 1I1AC 1YQVL 5EBGA 2Q3AA 1J8HB 4R9HA 4M48H 1NAKH 3MYZA 3GMRA 1FORL 4TULH 4TUKL 2YN3A 3RY6C 3W0WE 2BSSB 5EBWB 5FO9A 4HJ0D 4HZLA 4HULB 2G2RB 4G8GA 5ANMB 1S9XA 1OF2B 3NTCH 1A1NA 3S36H 3KPOB 1TETL 2PNDA 1UB6A 1FHGA 2VDML 3QDME 3QPQD 4JEGB 3TJHD 1LK2B 2B1AH 2CK2A 4HKZB 3V4UL 1LDSA 2R1WA 4QOKA 1S9WA 3DVGB 2AEPH 3KHOA 3QFJB 3O4LE 4FFVD 2UUDH 4JM2F 4FQ1L 4K8RH 4XMLL 4TVPH 3U7WL 4OV5A 4R4FH 3PF2A 1J86A 2DQJH 1GC1L 1S7RB 3VW3H 2JELH 3I6LE 3BPCB 3P0VL 2NY3C 1KTDB 2KUTA 3KYMA 3PWLA 4XP6H 3KYKH 2R56L 5DJ2A 5D93C 5I8CB 2O5YH 4OUUA 1B6DA 1NGWB 3ARFC 3DUSA 3P9LB 4FRWA 3KG5A 3AB0B 3OKNB 3T09A 3E2HB 2NY2C 2VXQL 4L4TA 3THML 5JPMA 1I3VA 4OLVL 3QRFM 3V7AG 3MRHB 4MA8L 4NKOA 1FZMA 1OTSC 2EE6A 4I0KA 4O2CA 1U93A 4KV5E 1I1RA 5C0CA 3A6CL 2H32B 2OQJA 5L9DH 1JRHL 5D5MB 4N9GA 5DJAB 2DKMA 3GSOB 4Q58C 5IB4B 1TVDA 4U7KA 2N1KA 15C8L 1DTUA 5C09B 4YBHA 2QADD 1XGPA 2C3XA 1S7VA 5BVJA 2NYYC 1MNUH 4ODXB 1RULH 5GGVY 1KLUA 4WWKC 4XNMA 1M1SA 4NCDA 4P2QA 2VNCA 4TYUA 4ZO8A 2VZVA 2ZOLA 3ZTNL 1AD0A 5BZWB 5TE4L 3U9UB 5MENA 1I9EA 1PD6A 2VKWA 4IOIA 2I9TA 5KS9E 4L29A 4NT6A 1AR1C 3HG1D 1JTPA 3N9GH 2FD6L 5EO1B 3MUZ1 4Y4HC 1HKFA 4BFEA 4MJ5A 1FO0H 3T8XA 3D0VB 4OKVB 4Y4FC 1ZLWH 3ARVA 4U1SB 4LLYB 2CDGA 3HZKA 4POZC 1Y0LB 3G04B 1F6AA 5JQ6H 5FHAL 3TYFB 3RWIA 4MYWB 1K5NA 5DFVD 3OKDA 4LKXA 4WHCA 5I1HL 3T04D 4X9BA 4LSRL 5IQ9B 1YQ2A 4X80L 1QFWL 4GFTB 2NY3B 3DV6B 4HUMB 5KVFH 2VDQL 4PBXA 1EEZB 4CNIA 5I1CL 4Y5XC 4AM0A 4KI5C 4X9IA 4EUPA 2HLAA 2EYTA 3ULVH 5DI8B 3SPVA 1RUKL 4KQ4L 5JZ7C 1CR9L 1IKNC 3VGAC 5D93B 1CXFA 1YMME 4X6BA 3GKZA 3N85L 5FGCB 2DTSA 1PKQB 5C70A 1A7QH 1HWGB 4Y89A 3MCG1 5HGGS 3RVTD 5TPWL 2UWEE 1T0NB 4Q9RL 3T3MF 4E41B 4JG0L 3MBEB 4G6FD 1FNSH 3CFEB 5C08E 1JPGA 4JO3H 4R6UA 1HN1A 4YE4H 2VLJE 4NRYA 3VA2C 4UB0L 3BPNC 5FYLE 4WY7H 5FHBL 1BQLL 5E2JA 4DUVA 2PCPA 3NH7H 4P2OC 5IW6A 2YK1L 1NBZB 4AQ1B 4KUCF 5SV3A 4IRJA 5HHOA 3TBTA 5DQ9B 3WJJC 1EAJA 5I1KH 1YUHA 3R06A 4W6XB 1BFOB 5HGHA 1MCBA 5TQ2L 2X4PB 2DLTA 4HEME 1VFBB 3GNMH 4X6EB 3MA9H 3PQYB 2Y72A 2Q7YB 2NY4C 4LVOB 3PWVB 5I1AB 2ZCHL 3VGDA 4TUOB 1NJ9A 2VQ1A 3QUXC 5JO5B 2RFXA 3Q48A 2R9HC 4Y4HB 1PQZB 4OZFA 2FIRT 2NMSA 4QRRD 4UINH 4CBPA 2X4TA 3C09C 4YXHH 3K7UA 4V2CB 1GC1C 4S1QH 3FHAA 3HLAA 4PJDA 5DJCA 1CD8A 3QNXB 3CSGA 3SEPA 3HZYB 2IPKA 5K9QI 2OMBA 4GKZB 3QDJA 1FVDB 4OLUH 5GGTL 3UJJH 2J88L 4WUUE 4I5BA 4HWBL 3QYCA 2J5LC 2LVCA 5E08H 5E9DB 2AK4B 5C07B 4Y1AA 3QUZC 4LLWA 4Y5XB 2KL6A 1S7TB 1CLYL 1A1MA 3U1SL 5IMLB 3FHQA 5L8KB 3VGAB 1MCFA 1J1XH 4XNYL 3QUKB 3V6OC 5DSCA 5ADPH 2VXVL 3ARPA 3SBWC 1I7ZA 1LEIA 1Q1JL 3GI8L 1OWWA 4LNVA 2I5YL 1YY8A 3MTRA 5ERWA 1MQKH 1QSFE 2EYRB 1JPTH 3O3BA 4Y5YB 3QQ3B 3VXPA 3MRNB 5EZIL 3O9WA 1UM4H 3LZFL 2VQUA 4X8JB 1AE6L 1B4JL 4QRTB 4ETQA 4IS6A 3ZE0F 5J13B 1GHFL 1Q72H 1NFIB 5MP6L 3SGJA 1XF4B 3GBNL 4GQ9L 3OB0H 2HLFD 5T33L 4P2OB 3HUJE 1P1ZB 4ZUUA 3HPJB 1LMKA 4HV8A 3K4AA 1ZT4B 5F9JA 4LLQB 5E2WH 4W6YB 4I48A 3S5LB 3JWDH 1BZQK 4HIJA 5IOPA 5I2IA 4HUVA 1W72A 2JB6A 3UP1A 3MOBH 4JDZA 2H2PC 4Z7QE 2NY4B 3GSRB 1KF9B 3MCLH 5IMMA 2ZNWA 4XCNA 1RFDL 4GSDH 4R96A 3TYGH 4YAQB 2MCPH 2AJ3B 1BQHB 4IBLT 2R15A 1OLZA 2UZYB 3VFMB 4LHUD 4OLYL 2XTJE 1HXYA 3MREB 1FAKT 2R2BB 5JMRA 1RI8A 2NXZC 2ZWLT 4G7VH 3WL9A 4RZCB 2DM7A 3MA7A 3QI9D 2LTQC 3CX5K 5T1KD 1YEFL 2YMXL 3T4AB 4F7PA 4K3DL 1IBGL 4FABH 1YNKL 2FH8A 5ACZA 4L8BB 4N8VB 4Y16D 2J5LB 3I84A 1ZA3B 3QJHB 1UH2A 4AYFA 2DS4A 1P53A 5ICZB 2IAMD 3KPLB 2C4XA 3B9VA 1WICA 4DK6A 4GAYB 2EEDA 3HA0A 4D0DB 4NSKB 2ORBL 1WT5C 2ZUTA 5JOFA 1F3JB 5GIRA 1OGTA 1S7QB 4OFIA 2XA3A 4S2SB 5F9AC 4AL8L 3QR2A 2HFEA 3TT3H 1ORQA 3SO5A 3RIFF 4EZMA 4PJBF 3UJTL 3U2SB 1P84J 3MNVA 4WENB 4MD4B 1VADB 1IARB 1YNTA 3PWPD 3IAQA 4CJ0A 2QSVA 2CDFB 4LSPH 1KCUL 1XGYL 2DQEH 1U2HA 4Y88A 5I1GH 1IAIM 1BMGA 1P2CB 4X6DE 3ZHLA 4L3EA 1MJJA 3UTTD 2VISB 4NZTH 1K4DA 4JFEE 2HG5B 1QFHA 3FQUB 1I3RB 1T6WA 5J1AA 1RK1B 5KAQG 4JFHE 3X13B 3V6ZB 2VAJA 4ZXBC 3KXFD 1UM6H 5C0AA 5GZOC 3PGFL 2VLKE 4HKXB 2BX5A 3CZFB 3R1GL 3MXVL 3V6FA 5GS0D 5GGRA 3QUML 4XVTH 4LVHC 3WHE1 3GO1H 2C5DC 2ICCA 1F4WH 1RZIA 3AREA 1J87A 1MAJA 5KSAD 1JGEA 5EU4B 1LD9B 3HC3H 3HRZB 1ZHNB 4MSWB 5DRWA 4KH2A 1T5XB 1DVFD 3H3PL 4PJHE 3OG4B 4GRLA 3MRLB 3IJYB 1AHWB 3VFSA 3AVEA 4XXCA 2NXZB 4PGDB 1T3FA 2LTQB 3WJLC 1ZEAH 2CD0A 1W2KT 3S7GA 4BM7A 5IHLB 5IBUG 1QQDA 5KBNC 4XWGH 2FO4B 1FAIH 3O6FD 1CICA 1VPOL 4QRQB 4O2EB 3STLB 3RNKA 1CVSC 3LN4A 3I6KB 4LOUC 4LLDB 1CFQA 3IXTB 1D9KC 1DANU 5FA3B 1JZ8A 1OB1B 4F33A 4B5EA 1DUZB 4NRXA 2BVTA 5HVFB 1B6UA 3IU3A 5TFSL 1E28A 5CJOH 3WS6A 3QIBD 4NIKB 2NW3B 5FO8B 4E5XB 5C9KA 5EUOB 4N8VG 4OFYD 4XBEL 5D6DA 3EYVA 4LPYA 1ZHBA 5HYSB 3L5XH 3FO2A 3NN8B 3ZKQD 1ADQH 4RDQF 2H8PB 2PR4L 4Y4KB 4UUJA 1MRDL 4RQQB 1T22B 2DI9A 1CK0H 1ZS8A 1QBLL 3DBXA 4MAYA 4KV5F 3DIFB 2D7TL 4TSAL 2QQQA 3QHTC 3UBXB 4ZXBB 3C6LA 3DARA 5HYFA 4M6NH 4XNZC 2X70B 4X99B 4ZPTB 1RIHH 2IJ0C 4GS7C 4TQEL 4CUCA 3TBWA 3WD5H 4DQOL 4WFFE 3E6HA 4N1EA 1SVCP 1NC4D 1YJDL 3K46A 4LVHB 3OXRB 1EVTC 2H32H 5JW3H 4QTIH 2GSIB 4PRDA 5MERB 4U1HB 5HBBA 3E6FB 1N6UA 2Y25A 1BP3B 5DA0B 3D85A 5KS9F 1JN6B 2J7LA 4XBPA 2BSRA 2HFGH 4IRSB 5IBTL 5I73B 2BVUA 1C8PA 4X4XA 4MNQA 5ISZE 1RK0B 5KOMC 3SJVE 2EICA 2QHRL 4GAGH 4KRNA 4LIQH 4OB5L 3VFNA 1QA9B 3L5WA 3SE9H 5BCAA 3CFBB 2EC9T 4RMWA 1FGVL 1UZ6E 1SJHB 4J2XA 4Y19A 3QDAA 1GRWA 1ZLVH 4JFDA 4LCIH 4LCCC 5AG9A 4MB5A 4QHNB 1T4KB 3I6GB 1ZLUH 1V7MH 1F8TH 1HCVA 3IRPX 1C1EH 4HUWA 3AMKA 3MXWH 1AO7B 1RZJH 1A1OA 4XPFH 5DHYA 1HOCA 1JUFA 5F44A 5E6ID 1U8LB 1GGCL 2EE3A 4JFZH 2XKNB 4WI4A 1TQBC 3O3DB 1G7IB 2BNRD 4LRNH 4QXWA 1T66C 4MXQD 3O0RL 2VR9A 4PRID 4OF8A 4QWWC 3VRLE 4GG8B 2R0KL 1JZ2A 1X44A 1DQJB 2R1XB 5E8EA 4HIEB 2UWEF 3ZO0A 4FQQB 4GBXC 4HHAB 1CCZA 4DZ8A 4M6OL 2YPLD 4QHUB 1D5ZA 4PJ9B 5JMOC 4KDTC 3BQUA 3SKMB 2YS4A 4HG4K 3JVGA 5EZJA 1UKTA 3WFHA 4NN6C 3QIUA 2F5BH 3IFPA 3IFNL 1OW0C 5ECJE 4OLXL 1L9MA 1QVOA 4HIIB 4P23A 3S3JA 5HYSG 1FN4B 2CIIB 4NKIL 4ZYKB 5T1DH 3VXMB 4MCZA 4XXDA 4RBPK 4C55A 3F7QA 3P4NA 2VLRD 1OVZA 2O61A 1EEYB 3EYFB 5F70A 4Z8FL 2A6KA 4FG6C 4Z7WB 4H20L 5HI3C 43CAB 3Q0HA 5I1EL 5KW9L 3V0AC 4V1DA 4NWUH 2Z8WC 5TGBB 5SX4I 5L8LB 3IJHB 1T03L 3JTSB 5MI0B 4AIOA 3OJDA 2YZ1A 4IOFD 1YN7A 1YYML 2V5RA 1LEGA 4U0RB 3IETB 2V9QA 5IVZB 1IGMH 4ZMAT 1P5VA 5GS2D 4JPVH 3TO2B 3NFNA 4WFED 4WTZG 1DUYA 3W5NA 3FN0L 3LEXA 4PB9H 4X7FC 2C1PB 3L9RB 1KXVC 3FCTB 5C0FA 4LCCB 4XI5C 3SDAD 3O6LL 1OPGL 1RMFL 5HHPB 3N0PB 3HR6A 1ITCA 3RVXD 1A7NL 3P4LA 5FOBB 3K8KA 1N0XL 4JY6B 4MJ4A 3K1KC 1T04B 1A9BB 1TQBB 4MQ7B 4HJJH 4QTHB 3W2DL 1JZ4A 1DCLA 2ARJA 1RQ5A 4DZBB 4G9DA 5DMIL 1ZHLA 2MHAB 2WWMD 3VH8G 4AIZB 4DVBB 3PWJA 2C1OA 2C4FU 4U7MA 2DL9A 2GK2A 4GBXB 3GMPB 1EMTH 5ABDE 5I16A 1AY1L 4P5TB 4DUWA 1Q94A 5I75C 3B9DA 3HUJF 3FTGB 4NN6B 3T2NH 1BZ7A 5J9PA 3QXVA 2GCYA 2IPTH 4LKCA 1YJDC 3EHBD 3QUMB 1BBJB 2FX8L 1EHXA 1J05A 4NYLA 3U30C 1HHJA 1A14H 4PJ5A 1KJVB 2CLRA 3IT8D 3IU4H 4Z7QF 3OF6A 5DMJB 2BRQA 1S7SB 1X5AA 2DQCL 4R4NC 4F3FB 1FORH 2CRYA 2GK0A 3EDFA 2LU3A 2Y5TA 1CFNA 1CGSH 1G7MB 3D18B 2EDNA 4ZTPH 4D0BB 3VXRD 5IHZA 4R7DA 1KSRA 4JM4H 1K85A 1SBSL 3IAPA 1VGKB 3S34H 1BIHA 2G5BB 1D5XA 2APFA 4JHWL 1TETH 4Q6YA 4Q9QH 3CFIC 1S3KL 3OJMB 4NO2A 4NKMA 3V4UH 2XA8L 1WLHA 2DTMH 1C5CL 2HYMA 4NP4L 3E8UL 3RTQB 1GH7A 4H1LA 5C0RH 4FQ1H 3ARBD 3NGBC 4XMLH 3RP1A 1XCQA 2VDOL 2P5WA 2HMID 2ADFL 1CLOL 1LO3L 3G5VA 3TPKA 4HCRH 3O6KL 4ZFFA 4YO0B 5J06A 1QKZL 4U3HA 5DD0H 4ONFL 1F13A 5A16A 3P0VH 5ESVA 3BZEA 4NQEB 4BSJA 2QEJA 5SWSB 3BGFC 3BN9D 4CVZB 1SEQL 3OHXA 4CVXA 4HT1H 4S1RL 3BT2L 2PF6A 5C3LD 1BIIA 5CGTA 4PJGE 3TIEB 2BRRL 4OLWL 4D9QE 1KC5H 4X6DF 4NQCD 3RPIA 4PJ8D 4WRLA 5HI4C 1ACYH 1BM3L 5I75B 4YUEL 2VXQH 3E1F1 4N8CL 4OLVH 4C83B 3C9NA 4XB7A 4N1HB 2E9JA 2OTWA 4ZNEA 4MA8H 4KTYA 3GMMB 4XP9H 2V2TA 2NTFA 4JVWA 1CDCA 2X4OB 3SDXB 3RFZC 2E7LA 3U30B 5DC4B 2VH5L 4JO1L 4MWFB 1C5BL 4PPTA 3BKYL 4RRPG 5EORH 1MI5B 1FPTH 1IAKB 5TE7L 1UJ3B 3MRBB 1X5KA 3IDGB 4XRCB 1EUUA 3GSQA 2VIRB 5GGSY 5DURD 4ISVB 2MQCA 2GJ6A 4JN2B 4U1NA 5DZNA 5FV1L 3KAAA 4UU9B 1TZHA 1ZWIA 2F54E 5EBLA 3WIIL 3F7RA 1K6QL 3EO0A 5I76A 1JP5A 5F7UA 2HT4C 1HNFA 2DLIA 1P69B 4PJHF 3TH2T 4ALAL 4L8CA 2BVEA 4YFEA 5BS0E 3VD3A 5TE4H 4OQTH 5BZDA 1I3UA 5DMGD 4P4KD 3MROB 2G60L 2FD6H 5D2LE 1DQML 1U8QA 2ESVA 5LXGH 4OV6F 2D9QB 2DLFH 3SO3C 1SJVA 3GMRB 5H94A 5FO9B 2BOCA 3OBAA 4F15B 4WFHD 4HZLB 4G8GB 4S1SH 4LPWA 3R8QA 5J12B 5FHAH 1S9XB 2PW1A 4F7MA 1MY5A 4XB8A 1A1NB 2YXFA 3WNOA 5I1HH 5TDNA 3OKKA 1FIEA 1W72L 2FO1A 1UB6B 3ZZ1A 5DD3H 1OT2A 2ZUSA 4OCSL 4WTXA 2V17L 3VFPA 5JXED 3MRGA 4R26L 3CX2A 4HPOL 4K55A 1DSFH 2GTZA 4KQ3L 4LHQB 4LSUL 4QOKB 3WXVL 1S9WB 2X1WL 4YXLL 4HBQA 4HC1A 1CR9H 3KYOA 4NQDE 3GRWL 5I1DA 4IRZH 2GI7A 3OQ3B 4C58B 4OV5B 1EA9C 4LAJH 5ELIA 3FOMA 1KLFA 5HPMA 2DQTL 5TPWH 1SHMA 2PYEA 2RAMA 3QXTA 2Z31A 3F7VA 3U36A 5JXAL 3O8XC 4QO1A 3KYMB 5IW3A 1VB9A 4NHCL 3PWLB 1JNNH 3UTZA 5FHBH 1BQLH 4YHYC 3BGAA 1NCUA 4MNGE 3HB3C 3NABL 3WV0A 5H37G 5DJ6A 2Q1EA 4OUUB 5FKPA 1FNEA 1RZKL 3DUSB 1KCRH 2KQNA 4LMQI 3VXUD 4OTXH 1NLBH 4L4TB 4KKBC 4P3CL 3SKJH 5JPMB 1Z3GH 5E2TL 5TQ2H 5A2LH 1FZMB 3UTQA 5J11C 4O2CB 3UBXI 2CR6A 1XF5A 5GXBB 1U93B 2H45A 5C0CB 2ZCHH 4WJ5A 1TZGL 3WIFA 1T0PB 2HJLA 2OX5A 3RUGE 4R2GD 1FFPB 5E6YA 1M7DA 4M1DL 1XGPB 5D1XD 1S7VB 3DMMA 3DX9A 4LPUA 5BVJB 2R69L 4KKCD 4OF3A 1UZ6F 4IRJC 1OTUD 1AGDA 2EDYA 2NLJA 4LLUA 1KLUB 4FTVA 1NEZG 3IS0X 4XNMB 4P2QB 4LARH 4PRHE 2YC1A 4JGMA 2ZOLB 2KQMA 3MJ8B 4O9HL 2EXWC 1AD0B 2R29L 4K7PH 5MENB 5JUEL 4UIKH 4AK1A 1KUMA 2I9TB 5GGTH 4L29B 2J88H 1VGEL 4HWBH 4XNXH 3WKMH 5B39A 3M17A 3EDJA 3ARZA 4MJ5B 3T8XB 3UPRB 4Q6IA 4CU8A 5C71A 2F9BT 4KK8C 3K2UL 3VRIA 2CDGB 3HZKB 4O51A 3VD7A 5FO7A 3GIVB 3CH1A 1F6AB 2VXVH 5DUBA 1XAUA 2W0LA 1Q1JH 1MCKA 3GI8H 3RWIB 1K5NB 2GJZA 3OKDB 4LKXB 4P9ML 2FEEL 3HI1A 2Q20A 5EZIH 3LZFH 1MUJA 1AE6H 3QI9A 4YHOL 2WP3O 4AM0B 5MP6H 1QACA 2M2DA 3BGMA 5CHNA 4YHYB 4EUPB 2EYTB 4GQ9H 3SPVB 5TDPA 1AFVH 4Y16A 1J7VR 2JTDA 5IVXA 4X6BB 3GBML 2IAMA 4FMKA 2FBOJ 3ARDD 2JCCE 4WFGD 3V7AE 3KNBA 2XYCA 3RAJL 4PY8I 3O9WC 1QPPA 3ET9F 4Z7VA 2GKIA 2DI8A 1I8KB 5ENWB 1JPGB 5J11B 3GMNA 1A6ZA 4NRYB 1PX4A 4OFPA 2FJFB 5DS8B 1RFDH 3SGJC 2PCPB 3QEGH 3U4EB 5L88L 2D4DA 5C0JA 1MCJA 4RGMC 5IW6B 1OQXA 5B38A 4OD3L 4YDKL 3IJSA 4I3SL 5GRZA 4IRJB 3UTTA 5HHOB 4DGIL 3TBTB 2VLME 3GHEH 1FRGH 1YUHB 1F4YL 2DQFA 5HHMB 1JE6A 1A6PA 2IBZY 2YA2A 1I9RL 3HE7A 3KXFA 4YNYA 4ZAKD 4K3DH 1M6OA 3DYMA 5FKAA 1NJ9B 5DF0A 1YC8A 3FRPG 1YNKH 2VQ1B 2R39A 5TF1L 5A3ID 2RFXB 2H26A 4KUCD 4PLKD 3RWJA 2DQHL 4OZFB 1EO8H 1JL8A 2MPAH 4KJPC 4LL9A 5FGBA 4JKPL 2Q8BH 2X4TB 1P5UA 3RZCD 2HMIC 5IB2B 4PRPA 4LU5H 1KTRL 2ENSA 4GT7A 2HWZL 2E8YA 3HLAB 4PJDB 5DJCB 1DVFA 1XGUA 4AL8H 2EKSA 5IT2H 2IPKB 3FT4A 1JNHA 5CSZA 2GY5A 2LU7A 3QDJB 3VXSD 4NC0B 5C6TH 5BO1H 3KPRA 5T33H 4I5BB 5KSBE 5T3ZD 3BDXA 1KJ3L 4Y1AB 4LLWB 2ZP0T 2I9LA 2P45B 3QXWA 5HHQA 1S78D 3JZ7A 1RZKC 2L0DA 4K23L 1X4ZA 3QQ9D 4M1GL 3HZMA 5CGYD 5DSCB 4KU1A 2GFBA 1LEIB 1I7ZB 4UOW1 25C8L 1YY8B 5ERWB 5ICYA 5CZVL 3SDDD 5D1ZA 3O3BB 2E6JA 3VXPB 3O9WB 3R1GH 5JIHA 3MXVH 4FA8A 4HS6B 3P11L 1NANH 5LGHH 1NFDA 4ETQB 1Q9OA 3QIBA 4IS6B 2N4IA 1R0AL 1ZHKB 3QXAA 4OZHB 4EJ1C 3BO8A 3U46A 4HDIA 1OAYL 2DKSA 4RGMB 4ZUUB 4X9FA 4HV8B 3MRPA 4PD4J 3MLYH 4LCWA 5DJXA 3ULUL 3RWHA 5F9JB 5HGDA 4HSQA 4KAQL 1ZE3C 4J3SA 1HZHL 4I48B 1VKXB 5IOPB 5I2IB 4HUVB 1W72B 2JB6B 1H3PL 1RJLA 3E3QC 4JDZB 3LD8C 1T21A 4DW2L 2HA1A 5IFJA 1OGAD 3QWRD 1VPOH 4XCNB 5IMMB 3DUUA 5B8CA 3MV9A 4R96B 4RSVA 3OL2A 5DFTA 3DVFA 3L3HA 5DHVA 1U8NA 4RFNB 5HYJA 3N1QC 3SGDH 4D9LH 4PREA 1HXYB 2I24N 1VESA 2AXHA 4PRBB 3SGDI 4XXCC 1MJ7L 5C0DA 3WL9B 3G08A 3MA7B 4YHNA 3EO9L 3SE8H 3UTSA 2FB4L 3LS5L 2RCSL 3ZKXC 2ZSWA 2XQYG 4F7PB 3TFKC 3H7LA 1QFPA 1I1YA 3FO1A 3TA3A 3CJJA 4OZFG 5DD1H 2GTWA 3V4PL 4ACPA 1S9VB 1KXQE 2PR4H 4MQXD 4OGZA 1MRDH 1LP9E 2L7UA 3BUYA 3LS4H 1KBGL 1QBLH 4YHIA 5CWSB 3RWEA 2IG2L 2V5TA 1RPQA 4APQC 2D7TH 2ZCKH 4TSAH 2OS7A 5GIRB 1OGTB 1ZVSA 4LFHD 2FGWL 1S8DA 3WS6C 5F6HI 2HFEB 5LAXB 1K8DA 2D7NA 1EJOH 3MNVB 2NR6D 5E6IA 5D6DC 3VDAA 1YNTB 4Z7UA 3RVVD 4UT6H 4QRPE 2X44D 5IBLD 3LEYL 1NBYA 4ELMA 3RVWC 4L3EB 1MJJB 4NQUA 5ESQA 4NRZA 4MAYC 1GGIL 1F6FB 2DKUA 1K4DB 2X89A 4U6HA 2W0PA 5DO2C 5J1AB 5JPNA 3ARTA 1JHKL 4GQPH 5D2LF 5D7LD 4E41E 3C6LC 1L6ZA 1U0QA 4DGYH 2N7AA 1IL1B 1TZIA 3RDTD 3DXAE 4OB5H 4PJCA 1J8KA 1QLRA 3VWKD 3JWOL 3LD8B 3V6FB 1EHNA 3CNKA 5GGRB 1KB5H 4UDUA 1NC2D 4S1DC 3WMSA 3AREB 5C9JB 2G75B 1JGEB 3BRFA 5DRWB 5DHXB 4UQ2A 1KGCE 1LNUA 4GRLB 1A8JH 3GSVA 3VFSB 4FQXD 4KGLA 4RIRA 4BELD 4AG4L 3W0WD 2W9EH 4GKNB 4KJWD 1T3FB 4O02L 3K4ZA 1QFUL 2NY0D 1QQDB 1X6NA 3O0RH 3ZKXB 4CRPA 1MCQA 2VKXA 4BKLA 4LSSL 1CICB 1RUAL 1BD2E 4OZ4A 2R0KH 4PV9A 3W81A 5GZND 3FT3A 4YFLF 3RNKB 3LN4B 1HI6A 4HIXH 4U05A 12E8H 4M6OH 1CFQB 2YD6A 4JJ5A 1NCBL 3QZWA 4PJFE 3S4SA 4F33B 1WZKA 2MKLC 3O4LD 2OJEB 4U3CA 4NRXB 3O45A 3IU3B 3L3DA 1CFSA 5CEZE 3D39D 4U2YA 1E28B 5GRJL 4BFGA 4Q7DA 4HF5L 4JB9L 4MJIA 3PJSA 5CS7A 1F3DH 3I6LD 2Y36H 5IB1A 4LCYA 4RAHA 3OR7A 3EYVB 4KI5E 4U1LA 1ZHBB 3FO2B 1Q0XL 3C2SA 1A7PH 4UUJB 4Z8FH 2YHGA 3HAEA 1S5HB 1ZS8B 4H20H 5D7IA 3DBXB 4WVRA 5LBSH 3ULUC 2YUVA 2QQLL 1HIML 1CBVL 3BQUC 1T03H 3RUGF 3EDKA 4JRYA 1EK3A 2HT3D 4YK4C 3QIUC 5EOCH 1YYMH 1Q8MA 3C6LB 5L2KE 4PG9A 4QF1A 4P23C 5E1AA 1IFHL 3TBWB 1TMCB 2ICES 3TWCL 5A40E 3E6HB 5JIIA 1AKJB 1GIGL 2EIDA 4FZ8L 4MS8C 2ERJC 1CIDA 4KRLB 4EI5D 3EOYG 3UAJC 5ACLA 4PRDB 3L3GA 2CLZA 3O6LH 3D85B 1M05A 4F8QA 1RMFH 4XBPB 4XMKH 4MNHA 2MMXA 4HLZG 3RGVB 2P8MA 1H8OA 4X4XB 4MNQB 3RBSA 1N0XH 3VXOB 3GUTA 5GHWL 1I8IA 1MRFH 3VFNB 2NW2A 3L5WB 1N4XL 3VXRA 3X3FL 2Q86A 3O4OC 4PJAA 3JBG7 3QEQA 1MREH 2EYSA 4Y19B 5DMIH 2FWOA 5GRVL 1RJCA 3D69A 2H9GA 5CILH 1AY1H 1ZLSH 2ICWJ 4HUWB 1CFVL 4GG6A 5DHYB 1HOCB 1JUFB 3DOSA 1ZT1A 1D7FA 1U92A 2APXA 1WZLA 4XWOD 2FX8H 2YR3A 3IFOA 3H9YA 4K3EL 1CVRA 2X9WA 5E8EB 4WHTA 4I8DA 5DEGA 3WIHA 3V6OE 2H2SC 4DZ8B 1D5ZB 1J1PL 4EUPH 2D7MA 2DQCH 4HC1L 3BQUB 5HDQH 1S5IL 2KZ1B 2N7BA 3GK8L 3PL6A 4IIQC 3WFHB 4YK4B 1JI1A 4HWNA 3QIUB 3IFPB 1OSZA 3JWOC 4MX7A 1WC7A 3C60C 1ONQA 1QVOB 1SBSH 1JF6A 4P23B 3PIQB 4N8PA 4PJ8A 3TO4A 2J8UA 5I1LA 1N26A 5CUSL 3ROLA 4MCZB 4XXDB 3QDHA 4MA1C 9CGTA 3P4NB 4L4VD 1FL3A 4JANA 4MLIA 1HH9A 2ERJB 4Y2DD 3SKNA 2O61B 5FXCH 1S3KH 3VXQA 2J8OA 3UZVB 2F53E 2A6KB 5IESH 4ODHL 3O11A 4JG1H 4V1DB 4J1UB 1C5CH 4IHOA 3E8UH 4HK0B 3GI9L 3HE6B 1ZOXA 3OJDB 2VDOH 1YN7B 1WVZA 3WS3A 4GAFB 4FQPA 4NPYA 1LO3H 4C4KT 4OCNC 1S7WA 3NFNB 1QKZH 4FXGA 4M3JA 1AIFA 1FFNA 2VR4A 1DUYB 3LEXB 5C8JA 2XI9A 4JFFA 4Z0BH 5C0FB 3BPLB 4OZFH 2J4WL 5EB9A 4OLWH 4FXKA 4GW4A 2YD1A 1MRCH 4XHJD 4L9DA 4EDXA 3VFUA 1BM3H 1N7ML 2LABA 4JKLA 1WCQA 4YUEH 4TOYH 1Y6KR 1K4CA 2MCG1 4F9LA 1NSNH 5D2NE 3HMWH 2ARJB 4FQHA 2Y6SC 4H26A 3VWJD 5A2KH 4G9DB 4PJ7E 4P46D 1LO5A 1MWAA 1YEGH 1I1FA 3SHSA 1CQKA 2C1OB 3PWJB 2OL3L 4DTGL 1GZPA 1HINL 4KJYA 5I16B 3NACL 5SWZD 3T0XA 4JZJA 4MD5A 1Q94B 4W81A 1YEIL 3NAAL 5EU5A 4HZAA 1ZANL 1KELL 4X7DC 1BZ7B 5J9PB 1J0YA 2GCYB 5IB5A 2ZPKL 4EIGB 4LKCB 1AQDA 1D3CA 1QSFD 4LNRB 2E7LC 1J05B 2W0KA 4MA1B 1HHJB 4AQOA 4L8SA 4YPGA 1BREA 4PJ5B 4QY8A 4QRSA 2DYPD 2CLRB 1DQMH 2AV1A 4G9FA 2ZUWA 3NA9L 2A9NH 4UTAH 3HNSL 4JM2A 1JMXA 4XH2A 2GK0B 2Y5TB 3KVQA 1HQ4B 5C0BA 3MOAH 1CFNB 3ZKMC 3L3JA 2CMRL 4KXZH 2L7JA 1WJ3A 4R7DB 4KXZI 1BLNA 3MLVH 1X5HA 4C57C 1YPZE 1D5XB 4WU7A 1B0GA 2VDNL 1W72H 5IQ7L 3FFCD 2X1OA 4NN7C 1UT9A 1VFUA 4NO2B 4NKMB 4R26H 2AEQH 3M1BB 5GGSA 4EN3D 4YXLH 3QIWD 3RY5A 3H42L 1KCVL 4H1LB 3LH2L 1UC6A 1DQTA 1W0WB 4L4JA 1XCQB 3BKCL 4MA7H 5C0GA 1LP9F 1AI1L 4HUNB 5CKAA 2CXKA 4FNLH 5E00A 3G5VB 3HG1E 2Z93A 2AS5M 1RVFL 4ZFFB 1NCWH 3IKCA 4XHQA 3X11A 1FO0A 2F8VA 5D8JL 1F2QA 5ADOH 3BZEB 2XWBB 4ENEC 4C56E 5I17B 3QH3A 2P1YA 3OHXB 4CVXB 4I18C 3NABH 3VD5A 1BIIB 1FZJB 3MUGA 4J4PD 1T7XA 3RX5A 3SE4C 4O2FA 5J89A 1DBAL 4N0CD 3NCCB 3RPIB 1XGRA 3OJ2C 3D0LA 5IF0B 1TQCC 4AY0A 2P8LA 3EOTL 4I0PA 4MVBC 1OARL 3C9NB 2CPCA 2OTWB 5IMOA 1IAIL 4YBLC 5C7XL 2Z31C 5H8DA 1F90L 2V2TB 2NTFB 3MV7A 1U8IA 1TJGH 3UJIH 1TZGH 3EO1B 3F7PC 3OKMB 2FIKA 4FFZL 3L3OA 4QGTA 3V0VA 4NC1C 1JPST 3DGGA 4HH8A 5KSVA 4XP1H 3EOAA 5MEQB 4IM8A 5K9KA 3GSQB 3WLWC 2GJ6B 4U1NB 1TZHB 1ZWIB 5EBLB 4JFHD 2DIAA 1N2RA 4N90E 3EO0B 3FMGL 4GAJH 4WI2A 1UXWA 4WW2F 5I76B 4OIAA 4OCYL 4K3JL 4L8CB 4PP1C 4O9HH 1E27A 4I2XA 3QO1A 2VLKD 5JUEH 5BZDB 1GGBH 4RX4D 1HYSC 5GSVA 4WHDA 1R3HA 3RL2A 1DFBL 4G6FB 1U8QB 2VXSH 2ESVB 3HC4H 2Z8SA 3DMMC 4X6CE 1OAUL 2AK1L 5AUMA 3UO1H 5JHDD 5H94B 5CD5C 1PZ5A 1C08A 1OHQA 2BOCB 1IC5H 2ITDA 3VA6A 3NZHL 3BEWA 3ILPB 2PW1B 4F7MB 4UQ3A 2FSEA 3TN0A 4K2UL 5TDNB 4PJFF 3KPSA 3OKKB 3OR6A 3ILQD 4QRRE 3B8YA 3VFPB 3OKEA 4YHOH 3MRGB 3ZL4L 3RHWK 4ZAKA 4Q6IC 2GTZB 4H1LG 2D0FA 4I4WA 3KYOB 5L8JB 4KI5F 2CRZA 2IANA 5I1DB 3GBMH 1DQDH 4NO0D 1FV1A 2NPLX 3TT1L 1TQCB 3RZCA 3WYRA 3HKFA 5HPMB 2JF1A 2QSTA 2PYEB 4Z5RB 4YLQT 1UYWL 2R1YA 2Z31B 3F7VB 4YBLB 3U36B 3U9PH 1SJXA 1BVKA 2AGJL 1AC0A 4OM0H 3MR9A 2YWZA 1OLLA 3VXSA 3UTZB 3HCVA 4CJ1A 5CBEA 5L88H 3FQWA 4M7ZC 5DJ6B 4JRXA 2Z92A 5FKPB 1FNEB 4OD3H 1AD9A 1KN4L 4QXUL 5IMKA 4DGIH 5JOEA 1NGQL 3LKRA 5J1TC 2P8PA 1DBKH 2YPVH 1F4YH 1L7TL 1A7BA 3JV6A 4X0KA 3UTQB 4KK9D 4ODVL 1TJIL 1PFCA 1XF5B 4NCC1 1FE8L 4YJZL 4WJ5B 4G6KH 1YEHL 3NIDE 2I60L 4N0YH 3WIFB 2HJLB 4CW1A 3BW9A 4X9GA 5EOQH 1M7DB 1IGTB 3Q5YA 3NCYS 3C5ZA 4AH2A 5JW4Q 3DMMB 3DX9B 3FB6B 5C86A 1JPFA 5EZLB 4LLUB 4LSDA 1AGDB 1QSEA 2NLJB 4RA3A 5K9JL 3C87A 4FTVB 2EDBA 4ODBD 4N0UA 1IM9D 2AEIT 2HWZH 3LKSA 5B3JE 3B2UD 2YC1B 5E2UL 1WEJH 4QRUA 3SJVD 4JJHA 2Y7QA 3HE7C 2HH0L 4NNYA 3V52H 2DDQH 3HS0A 3MV8E 1KJ3H 5HI5D 5BRZE 2IQAA 3P4OA 1U6AH 5FGBC 4DN4H 3BVNA 4Q6IB 4TVSa 4LBEA 4U1IA 3QWRA 3BAEH 1XGQA 3VRIB 4K23H 2MKWA 4O51B 5FO7B 3CH1B 1BWMA 3EJZC 2ENYA 3F5WA 4HGKC 5DUBB 2NZ9C 4U6VH 2CJUL 2EXYC 2GJZB 5EU3A 4OZGE 1H3WM 5IJVA 3MODL 3ETBF 1D5IH 3P11H 1B3JA 1QLEL 3QI9B 4JCMA 3W9EA 5T1KB 1J0ZA 1XF1A 2AJVL 4XTRD 3BGMB 5CHNB 3PV6A 3S3PA 4M7ZB 1OAYH 2A1WL 2QLVB 4Y16B 5IVXB 1P4IH 3B6SA 1T7WA 2D3VA 4KMLB 4N1CA 2IAMB 5ITBL 2OLDA 4LVNC 3AU1A 2HVKA 3H0TA 3PWPE 5EZOL 4KK6C 3ZE1E 4IOSD 4PJEB 3KNBB 1C7TA 3O3AA 5D1ZC 4RGND 2BHYA 2DBJA 3U79A 3GEWB 4Z7VB 5J7CC 2AV7A 1QLFA 2VR5A 4DW2H 5LGJB 3GMNB 1A6ZB 3DUHA 1N6VA 1DDHA 2QSCL 3B3IA 5ITFA 4POUB 4GJTB 4HK3N 1QO3A 1EHLH 5F8RC 5C0JB 5IKCA 1CDYA 5B38B 2CIKA 3IJSB 3RIAK 3UTTB 1IGJA 1CXIA 4I9WE 1X5FA 3HMXA 4A6YH 3FQXA 2GIYA 2DQFB 4JHBA 4PJBA 4PUBH 2GSGA 4EBQH 3EBAA 3HE7B 1T1ZA 1YEKH 3KXFB 4YNYB 1PG7H 1M6OB 3VXTB 3O3EA 3RDTA 5B8CC 2KH2B 3LKQA 3DTXA 2H26B 1EGJA 4FFWC 3RWJB 4KZDL 1II4E 4BZ1H 1NC2A 3QDGA 3U0WL 4PJXE 5ANMA 3P40A 4AT6A 4PJ7F 4PRPB 1A3LH 1DVFB 2W38A 4PIRF 3HNVL 5EULV 1XGUB 2EKSB 1JCKA 1KN2L 1JNHB 5CSZB 3HZVA 1GJIA 3KPRB 1AGBA 5B39G 2XQYK 3TA3C 2BVQA 3ES6A 5EUOF 3DVGA 2E8ZA 3QFJA 1A6UL 2BK8A 2I9LB 4K8RD 5L6YL 1XIWA 5HHQB 3O6FB 5CFHA 5J6GA 3TH4T 1XF3A 1GGIH 4K3GA 1A47A 3QDMA 2W07A 4YX2L 5IROA 1MCWW 4Y8AA 1GL4B 1UWGH 3HZMB 3KR3L 2BXZA 4UT7L 1NUGA 1MFEH 2GFBB 3CVIL 5ICYB 5ICXA 3LEVL 3DI2B 4WEBL 3OPZL 1JHLH 4NUGH 1L9NA 1L7IH 1Q9OB 5IVNA 3QIBB 3CFDA 1MHPL 2C9AA 5FYJL 3WE6A 3QXAB 4YIQA 2YUZA 3BO8B 4HXBH 4NO5A 3U46B 4HDIB 3KDMB 3P9LA 2O5XL 3WIHL 3T1FA 1NEUA 4HIHA 5JDSB 4LCWB