3DLQR

Crystal structure of the il-22/il-22r1 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
209
structure length
201
Chain Sequence
DPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRARLTLEDIFHDLFYHLELQVQMHLGGKQREYEFFGLTPDTEFLGTIMILVPTWAKESAPYMCRVKTLPDRTWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the IL-22/IL-22R1 complex and its implications for the IL-22 signaling mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
molecule keywords Interleukin-22
total genus 42
structure length 201
sequence length 209
ec nomenclature
pdb deposition date 2008-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dlqR01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dlqR02
4ALAH 4M1DH 3ARVA 4TOYH 3MRJA 1NGPH 2E6QA 1OM3L 2JELH 2Q86B 1A7QL 1JTPA 4TUOA 3O6FD 1HHKA 3GSOA 1B0RA 4HPYL 3R8QA 4WDIA 1PKOA 3DRTB 4ZOAA 3M1BB 1G6RL 4HAFA 1I4FA 5DUPH 5KW9H 2OSLB 1TZIA 2FECI 3W0WB 3WJLC 4JM2B 2OR9H 5DS8B 1MCLA 4ELKB 1K8DA 4NSKB 2HTLD 3DVGA 2BOCA 4YXHH 5EC2A 4Z5RB 4KZDH 1N6VA 1WLHA 5HGDA 5EO0A 4B0MM 2DI9A 3S3JA 5I1JH 4M62L 4O5LH 4PJ5B 3RVTC 3CFKB 3ARGA 5I0ZA 4PJFF 2N4IA 2OTPA 2QTEA 3T4YB 4FFYL 4HWZB 5DJ6B 1HH9B 1T21A 2VDKL 1MFCH 5MENA 3QCUH 4KROC 1KCRL 2QEJA 2NW2B 3MRIB 1JNNL 4EUPH 3RP1A 3QUYC 5A1AA 3C60B 1UJ3C 3MNVA 4GXVL 4KV5F 4LVOB 1KIPA 4E0RA 1S5HB 2JJWA 4UOW0 5I76A 4RAUB 4M3KB 1Z5LB 1K4DB 1Z9SA 1CYGA 2SEBA 1LP9F 3ROOA 3X11B 3P9LB 1UQSB 5F3HB 2BFVH 2NY6C 2PW2A 3EYQD 5F1SA 3LD8B 1CT8B 4L4TD 2JE8A 1MCJA 3GMRA 4KI1A 3AMKA 5BXFA 2IQAB 4M4RA 3S34L 3ES6B 3KG5A 1CFQB 2HJLB 4CMMB 5JW3H 4H1LH 5C8JA 1JNLH 5I30L 3UTPE 1NFIA 5F7NC 1ORQA 2GQHA 7FABH 5DZLA 3WDIA 1I7ZA 4I3GA 1IAOA 1UWEH 3E6FA 1LILA 3IU3A 2I07A 4I0CC 4YAQA 4I2XA 1RZKH 4L29A 1F8TH 4FFZL 2FH6A 3PP3K 4Z7UA 3KJ6L 3HAEB 3WDJA 3UC0H 3B83A 5KVFL 5FECA 1QYGL 3SE9H 1H3PL 1YPZE 3X13A 3DMMB 4X7SL 4WUKH 3QEQE 4ORGA 1JGVL 4HS6B 2HN7A 2ZNWA 2DQTL 4NYLB 5ETUB 25C8H 2IADA 4PB0H 2VLLA 1LE5A 5IFJA 1CE1H 3TO4A 4D9LH 5ILTL 5BVPL 2JJTC 1UZ6E 3LY6A 4ZNCD 2HMIC 5I1GH 5FYLL 1J88A 3MJ7B 4FNLH 3NPZB 3SO3C 5I1AA 1KGCE 1BEYL 2ICWB 2Z31C 3SDAD 3ZE2F 3S5LG 3MXVH 3HRPA 2RR3A 1QVOA 1WQVT 4Y4KC 5TPWH 3TBYA 5IBUB 4UZGA 1IM9B 5DJ0B 1G0XA 1SHMA 5D7LA 5FA3A 2I5YL 4JFXB 5H35A 1MNUH 3MRFA 4OD2A 5DHVA 5IBTH 1U8IB 4A6YL 1GYAA 4FS0A 3N1GC 5MEQB 4NO0D 2BY1A 1KC5L 1OWWA 5C08A 3W0WD 2GTWB 1KENL 2X4PA 3UROR 3ZYZA 2I5YH 2VDOH 2NZ9C 1SM3H 5ITBL 1IGFL 3WMSA 4FQJH 5HSFA 4U33A 2VTFA 1LP9E 2DQFB 4XPAL 1K8IB 3I6LD 2R4SH 2FGWH 5JW4N 3UAJD 1KXVC 2OI9B 4LSPH 5DD5L 3ZDYF 2B1AL 3MROB 3QXAA 3TCLB 1VGEL 4KAQH 4KJPD 4OZGB 1F42A 2WNGA 1FL6A 3IF1B 1OSPH 5JDSB 5C9JB 5GGTA 2LTQC 3OGCB 4JZJB 4X83A 4QXUL 3S36H 2RCSL 3CVHL 1KCLA 4XGZB 1EO8L 1YZZA 4XVTH 3BRFA 5GS2D 1H0DA 2BSTA 1RIVL 4WUKL 2XTJD 1ACYH 5AUMB 2YD3A 1R3KA 5A2JH 1J8KA 1BX2A 1IC5H 3T0BA 5AAMA 3QQNA 1FHGA 3E6HA 2DQEL 3H9SB 4ZO6A 4MCYB 4H1LA 3BDBA 1TVBA 1RZFH 4QRQA 4WU7B 4OI9A 5IEKA 3C2AH 4KDTA 2XG5A 3NCJL 4GAJL 3SGJA 1IC5L 5KS9A 5I74C 1NAKL 1IM3A 3VGDA 3LS5L 2CGRH 3TVMB 4HUWB 4ZQKA 4K8RL 1QFWH 4P9MH 4P9HC 5HYJD 5L8JB 3D9AH 1IGTA 3QFDA 1FH5L 4YDVA 3EJYD 1TMCB 5BXFB 2FNBA 1JMZA 4R4BA 1FO0L 4IRJA 1INDL 1E4KA 3UP1A 1LEGB 1A6AA 2EDNA 1DUYA 3ZT7A 4BSVB 4PY7B 1BGXH 1C12B 3QUXB 2PNDA 3WHE0 3QHTC 5D1ZA 1KCSL 1MFAH 3NCEB 5HGAB 3V4UH 4NUGH 2X4TB 5J11B 3DXAB 3SDXF 5KZCD 4L29B 3UX9B 1YEHL 4ACPA 5FO9B 2PYEE 2YKLH 3FO1A 3PWPA 3QAZC 1IBGL 1F00I 1CLOH 3RNQA 1G7MA 1CDUA 5KVGL 3D0VB 4ONFL 1F4XL 4E0RB 2QBWA 5F1IB 1F11A 5IB3A 3HC4L 1OY3B 1FNSL 4C4KT 4X9BA 4X9HA 4JM4L 2ZUVA 5ETUA 1X4ZA 2UYLA 1AHWA 4JB9H 3OKOA 3V5KA 4PS4L 3MUJA 4S11A 4TPRH 1A4JB 5I6XC 4WWKC 3LRHA 4HF5H 4ZFZB 4Y19E 1RIVH 3BN9C 2G5BB 3BQUA 2OR7A 5C07B 3RUGB 43CAB 2MCG1 5E8EB 3UPAA 4WI3A 5DJ2A 2XRAH 1MJJB 4JO2H 4R7NA 2BVOB 3VXRD 2OM5A 2PETA 2FO1A 2VH5H 2C7UA 2FATH 4U6VH 1H3WM 2EDTA 2FBOJ 4LPXA 4U2ZA 3S37X 4U1NA 5JPNB 3QUZA 4LSPL 2ADJB 1OTUD 5EU5B 1C5CH 1NGXB 1IKNA 3PWJA 3KYMA 5BV7B 1B4JH 2IWGA 1QFWL 4P9ML 3UYOD 3EO0A 4KKNA 1IC1A 3QZWA 4NZUH 3HFMH 5FOBA 3EBAA 1QBLH 3IKCA 3REVA 4Z78A 3UJJL 2KBGA 4QLRA 3VFNA 3IJYA 3BE1L 3EZ8A 5DUML 1VFBB 5C0BE 2LQRA 1FL5A 4RNRB 4WO4D 4KH2A 2NR6D 1DUZB 2R0LH 4NM4L 2ZCKH 4QT5A 4CDGC 1K4CA 2CRYA 1SY6H 4OLWH 4HGWA 3TN0D 3V8CA 1DBBH 2NW3B 5IFAL 1RK1B 1ZVSB 4EBQL 2ICEB 1A6ZA 4WGWB 5ENWA 3QWOB 4D3CL 4AQ1B 1Z3GH 4HC1A 3O4LA 4J23A 3VGGA 5L2KE 2AQ3A 3WLBB 2RGSA 3I6LE 4JKKA 1CXEA 1U8IA 5BVPH 4NGHH 5JQ6L 3TVMD 1UEYA 3SDXB 4JR9L 2ZKHH 4PRHD 1BF2A 4DOHE 1KB5L 3HG1A 1ED3A 2O61A 4E5XB 1A3LH 4M6AA 3W0WA 4J3UA 1MPAL 2BY2A 1MRDH 2FEEL 4HV8B 2R4SL 3VJ6B 3D0LB 1QHOA 1E4XL 2FX8H 4P2OD 1I9RH 4WRLA 4X80L 1H3GA 3CXDL 4QOKD 1WICA 3KPLA 3CVHA 3RWDA 4WTXA 3CH1B 5H37H 4L9DA 2JIXD 4G3YL 5E8NA 2A6JA 4YZFF 1FL6B 3IF1A 3QDJD 3QG6B 4GG8B 4NRYB 4PJIE 2AK4E 4FQQB 4OF7A 2B5IC 4JRYA 2W91A 5HGBB 1VDGA 3PGDB 3WJJA 4YC2B 4AJ0A 1DLFH 3I3DA 1X5JA 4PJDB 5DLML 2X4RB 4YBQC 4ZPVA 5I76B 4PLKC 1PQZA 3MRHA 4DEPB 4F2MB 4MJ2A 4U1HA 4LF3A 5EBLA 1XGPA 2YPKB 4HLJA 4KY1H 1NUNB 1RIUL 2V7NB 2CDEA 1ZXQA 4P4RA 1F11B 1MEXH 2D2OA 5T3XH 3BHBB 1AQDA 2ATPA 2MCPL 3DURA 2NY1C 3H9SD 1MFNA 4KDWA 3BOVA 4NNXB 2DDQH 1FO0A 2GCYB 1WUNT 4NRZB 3SKMB 4OIIH 1K9TA 4ZTPL 4ZO9A 3T0DA 4PYHA 4IRSD 2YPVH 4LEOA 5EBMB 5FUZH 4FQCH 4FZEH 4JLRA 1QBML 4L4JA 1RVFL 1T04A 1MI5B 4PJ9A 1UKSA 2EZ0D 3QXUA 3L3OB 3GIVA 5DHVH 5C0EB 3PV6A 3LVEA 3T1FB 4Y19B 1Z9LA 4HKJB 1J8HB 4DTGL 4ZFFA 5FM8A 2J88L 4LLYB 3NZHL 3GI8L 3RQ3A 2Z4QB 5DMGD 1IC4L 4X6EA 3QH3B 4AG4L 5BS0D 2NY5H 4DZ8A 2VZSA 2IAMD 2C1OB 3QUZC 1FZMB 3QI9D 3K2UL 2FEDC 5I8CB 4NO5A 4OGZA 1AIFB 4OB5L 1FV1B 4EDXB 4YBLC 4NZTL 2NY5C 1FIGL 3G9AB 1CFVH 2LVCA 3O3AA 5DJDB 4KROD 3V5KB 1UC6A 1CZ8L 3IU4H 2C3WA 4K55A 3W2DL 1ITCA 1QSFE 2OZ4L 1DQLL 2QL1A 4JN1L 3RZWA 3U30C 1T5WB 4PJXE 1QQDB 3IDIB 1A3RH 5I1GL 2MWCA 4I18A 3UTTE 4LGSB 5DJ2B 1S7QA 2YUVA 4MJIB 3I50H 1U8NB 3T4AA 4X7FC 4LVHB 1FQ9C 3A67L 3RWHA 3TESA 3QR2A 4G8FB 4WUUB 2KH2B 4JFHE 2CDGB 1T1YA 3CFJB 3K3QA 1KJMB 1X44A 3U7YH 3HCVA 5D7LE 3PHQB 1K2DB 5CFHA 1I8MA 1UVQA 1WFOA 5FUOL 3GRWA 3RTQA 4M93C 1I1FB 2GK2A 4XCCL 1FZOB 2X4UB 4M03A 1VEOA 3PJSA 4NN5B 5ALBH 4LLUA 3ZKQD 3LKOA 1I1AD 1VFAB 3GMMA 4OCNC 4DK6A 1A6TA 2HFGL 1CBVL 2VIRA 3AM8C 2VXSH 3NIGF 2WQ8A 2CLZB 4NQTA 5DR5H 1J0YA 2VXVL 5CJXA 2VDNH 1WAAE 5DWUH 3U82B 4LCIH 5HHMB 4YX2L 5TE7L 1RJYA 1M71A 2W1NA 2J6EA 1Q0XL 2IFGA 4LCWE 5E8OB 4QRPB 2GUOB 4OZFG 4OFYA 2KQMA 1GCFA 5FK9B 3BEWA 5T33H 5IBLC 3E6HB 1CGSH 1V3JA 2OJEB 4CKVX 3BPCB 2NTFB 3BE1H 1NBYB 3CDGB 3DYOA 1N3NB 4IIQA 5F7KC 5C09B 4PB0L 4OCSH 1Q0XH 3D1MC 5C6WH 3B6SA 4LCUB 1ZE3C 2Q6WB 4M93B 3FRPA 3TVMA 2PTTA 2ESVD 1KN2H 3GUTA 4MNGB 1RUQH 2I60L 3AC0A 2EIBA 4DW2H 4JQVC 1DQJA 1GZQA 2Z93A 4HJJH 4PJGB 2BMKB 2DQEH 3FT3B 5EU6A 5GRVL 4XB7A 3S5LA 4L4TB 1KLGB 5EN2A 4DGIH 3F7YA 1AGBA 2PO6B 3EYFB 3OKYA 5DT1L 5IFHL 5IIEA 4DVRL 3QDAA 1KNOB 1X5YA 3M1BA 4U7SA 1IC4H 3ARFA 1C08B 3INUL 3VGBA 1BQHG 5HHNB 4S2SB 1MCWM 4RFEB 5DJCB 4M7JL 4KMQA 4OD1L 4YEFA 1HYRC 4ODSH 3FCTA 2Q76B 4NKDB 3EGSA 3KPSB 3IRPX 5EUOB 4P5KB 3U4EB 3FTGB 1G9MC 2J7LA 3B9KC 5IM7B 2P43B 2NY4C 2OTUB 1UM5L 4LLAA 4NC2B 2AJUH 4QTIH 3U9PL 5CZXC 4KRPD 4LLQA 1NLDH 1ZHLB 2GTZA 2Y5TB 5I15H 4I4WA 1QBBA 1UB5B 4LPYA 2FWOB 2EDLA 1BECA 5FHBH 2ICCA 1OSZB 1I9JL 1KIQA 3A0OA 3DX9B 4P46D 3W81A 2HJFA 1WISA 5D1QC 2DQHH 5D9SB 4RWYL 5C0CB 4ZXBA 4FFYH 4MLSA 1MCCA 5KG9B 1TPXC 3J7HA 3O3BA 4U1SA 4QYOB 4Z7VF 5J6HA 3EFFA 3QUML 2FJGA 4JJ5B 3QQ9D 1JNHA 5D1XD 1EAJA 3DECA 3UYPA 2IMMA 4PG2A 4IRSA 4HBCL 4N9GA 2JJSA 4TVPD 4X4ZA 2VLME 4UAOC 3UO1L 3LPWA 3X11A 1QR4A 3H3PH 3MSPA 3MLYL 1MWAA 3GSUA 3D18B 4HIIB 3TCXA 3OHXB 3L7EA 1NAKH 2UZIL 3MJ9L 5HI5C 1FFOB 1X7QA 3DV6A 4MMXC 3G5ZB 4GT7A 1NMAL 3IU3B 3RWIB 1G84A 3VGAB 2AEQH 4JO1L 3JWNC 1ORQB 4JFPB 4U6TA 1U91B 4DZ8B 1KB5A 3ARSA 4Y16C 4WU5B 3HRZB 5DQJB 3SDAA 3RDTD 2IBGA 4F7TA 1I1YB 1X4XA 2C3GA 3PQYB 4QGTA 4YK4B 4UTBH 5MEND 5DTFA 4LL9A 5ISZA 5JIKA 3HE7C 2L7JA 4G8EA 4DUXA 2A38A 4NQCD 1FNHA 4QRTB 5LQBL 3PXHA 2IAND 3T0XA 1C5DA 4JB9L 4MNQB 1K4DA 4DOHB 3BH8A 2A6DB 1JFQL 4KGJA 3IXTB 1MLCB 1YEGL 4K3GA 3CFIC 5F1OB 1T20B 2F5BH 4MWFB 5IFJB 2EYRB 2X1QA 4Y4HC 4AK1A 2ID5A 3H9HB 1NBQA 4UIMA 4L9LA 1QLEL 2OJEA 2BJML 2W0FA 3DRQA 4PJFB 4XNUL 2WWKO 5I1HH 5J56B 1YN7B 3QQ3A 2VLJB 4YJZL 4DN4H 2VE6A 2X9WA 1BPVA 5CGYD 1WIUA 3UTQB 1NFIB 1FFQA 4GKSA 5ICZB 1J10A 1ZT1A 2ZG3A 3HC0B 4CMHC 2HVJA 2FJHB 3P30H 4J3VA 4YO0A 1E27B 4DGYH 4KQ3H 3M8OL 4JM2F 4XI5C 1EIBA 4GXUN 1MHHA 2AXGB 1B0WA 1CFVL 1DBML 1OARH 4MQXD 4JM2A 4JAMA 5LGKA 1MPAH 3HB3C 4KDVA 3RVXD 2ADFH 1CGTA 1UYWH 1MEXL 4LDLB 2Q3ZA 5E5RB 1IL1A 5DJAA 5FAAA 2QKIB 3PF2A 5ERWB 2A0LC 3GMLB 3VXMD 5GS1A 4HBQA 5F89A 1WCQA 4P2RD 5E08H 4U0RC 2VXTL 3TA3A 4LAJH 4WI2A 1AQKL 1K6QH 4D3CH 1U2CA 1RMFL 1TCRB 4OZ4B 2GTZB 1KIPB 4APQA 3IJSA 1OF2B 3ARBA 3GMQA 4QTHB 2D03H 4V2BA 5CS7A 2BC4A 4K3JH 1H0DB 4F80A 1MI5E 4FG6C 2RCSH 2Y5EA 3TPUB 5GHWH 4MJ5A 1OCWL 1IQDA 2HJFB 3MCKB 4JY5L 5A43C 3ZL4H 1BVKA 3UZEA 1BOGB 3QEGH 1I4FB 4NO0A 1BZ7A 1AGEA 4MA7H 4P5MA 1LDSA 1TVBB 4QRQB 4WU7A 5DK0B 4S10A 1XIWB 4EXKA 5CIPH 1ZANH 1CR9L 3KR3H 1NCNA 3LKNB 4M61B 3EOAA 1AO7E 2DQFA 4GBXC 5F97E 5HGGS 3RA7H 2XG4A 1LO0H 1Z6JT 5HDQH 4P59L 4Y4HB 3T2PA 3QYCA 4ISVB 1T5XB 2EC8A 4HWUA 5ID0B 3HZMB 1F6AB 1EO7A 3CMOH 1NCDL 1S9WA 2L0DA 4HCRH 3GO1L 3BAEH 1BEYH 4KC3B 2W9EH 4MAYC 4G3YH 1KCVH 3AXLA 1ZHBB 4TSCL 4OM0H 1Z9OA 4PGDB 4R90L 1UWGL 4W6WB 1E4XI 5BZDB 5KVEL 3MRDB 4Z7QF 3RWCA 4Z7NF 3OJDB 3X3FL 1PLGH 1JPSH 1T2QL 3KPMB 4PLKD 5LWYH 5DJZA 1G9NH 3RDTA 4JY6A 1A6UH 3VGEA 3WNPA 4UDTB 1HYSC 2D7QA 2JLLA 3BUYA 4EN3A 2IC2A 4M1GL 4BQ8A 1A7NH 5DMKA 3EAKA 3L5XL 5C0BA 2ITDB 4FOMA 5D7JA 3H3BC 2HAZA 4KPHL 4X4YA 1BREA 3OR6A 1CXIA 1D5BA 4YAQB 5GS0H 3BKYL 4HZAA 1A4JA 3LEVH 1GGCL 3LN5B 3NZ8A 2BVQA 3M45A 3TO2B 4JFEA 1NLDL 3E6FB 3RNKB 4FRWA 4OLXH 3TN0B 1S7UA 5CEZE 1NMAH 5CBEB 3C60D 4NUJA 1G1CA 5BOZG 2AJSH 5D2LF 1A1MA 3L5WB 3G6DL 1F02I 5DMIH 5E6IA 1D5MB 4Q6IC 4NKMA 3MRBB 5IEHA 3VXSE 3MLVH 3OXRA 1O0VA 2G2RA 2BERA 3KYMB 4P4KA 2GAZB 5D1ZD 3QPQC 4MCZB 2MTPA 1RJYB 4GMSH 3SDCC 5DMGC 2XTJB 5FOBB 1T2JA 1IE5A 2PXYD 4TVSa 4R96A 3VFNB 2R2EB 1QLRB 4FQXC 1A5FH 4OIAA 1D9KC 4L8SC 3QRGH 4HPOL 4TVPL 4Q9QH 5GGQH 3UTSD 2XFXA 4NHUA 3QRFM 3SE3A 5KSBB 2E27L 3SE8L 3HMXH 2VRAA 4PJXF 3B9DA 1AY1L 1GOGA 1J8HE 4LEXH 3PDDA 2HLAB 4K9EL 4ZFGH 4LRIA 1C1EL 1RIHL 2OP4H 3B9KB 1EJOL 3G9VA 4PP1D 5D7LB 4GH7B 5EIQA 4HUXB 3MA9L 2YEZA 1QKZH 4U05A 5LGHL 4JO1H 4IDLA 5IJVB 3REWB 3GHBH 3GMQB 4ODTH 2FATL 1A1OB 4K9EH 5ECJE 3ZHLA 4X5XA 1ULVA 4FQ1H 2DF3A 3G5YA 4Z7VA 2AKRA 1NFDA 3HG1B 4Y1AA 4Z0BH 3ZHKA 1EHLH 2ED9A 2ADJA 5JA8B 3KYKH 4LSQH 5E00B 1ROWA 4G6AC 5CZVL 1IRAY 5D71H 2VITA 3BPOC 5LGJA 4I3SH 4UU9A 4WTWA 4EVNB 4UDUB 2FX9L 4K2UH 4CU7A 4OZFH 3CCHB 1DBKL 5ELIA 2UVFA 1XEDA 4PJ8D 5TFSH 1ZHNA 2IMNA 4ZFOB 2QKIA 1WT5A 1ZEAH 2GSGB 1S7RB 1ZT7B 2W65B 3DVIA 1CF8H 1EGJA 4MS8D 3MZGB 2AXHA 1W72H 4L3AA 1TLKA 4AH2A 5J57B 4C56D 4LCCC 4OM1H 3TBVB 2R2HB 3WXWL 3FONA 3PP4L 4OCWH 1GVIA 4E41B 3VE0A 1R5WA 5E5MA 1I7UA 2CXGA 1BX2B 4ENED 4I5BB 4MGXA 2W92A 1ZLSL 5JMRA 1QFOA 1ZVHA 2C3VB 5AZEL 3LKSB 3QZWG 2VLKD 2YXFA 4LSVH 4XP5H 5L6YH 3EJZC 3OKOB 3EOBB 1PX3A 2C5DC 4FFWD 4RAHA 2C4XA 4ODHH 3SY0A 3SCMD 3HMXL 1WZLA 3FFDA 3HTLX 3SKOA 5JXAH 5F3BA 1NFDF 2YPKA 2O5YH 2XZCH 5GISL 2ZUUA 4LHJB 5JXEA 2ATPB 2UVEA 3RA7L 1OPGL 4JQXA 4KUZH 1HINH 4HXBL 2B1HH 2NY7L 1PY4A 4ONGH 4DW2L 3LD8C 1U3YA 3MREA 4JN2A 3E1F1 4DN4L 4L8DB 2A77L 1XCQA 2VL5A 1NCDH 4XPTH 3VFTA 5IGXH 3QDMA 3QDJA 1CXHA 3DETD 4ZFFB 4LCWA 1KFAL 4LPWA 2EYSA 4CNIB 4K3EL 3QXVA 3OKDA 3FOMB 4NKOB 2YK1L 1F4AA 4XVJH 1BBJB 1U8JA 3VRJA 2FR4A 3ABZA 3SJVD 5AZ2H 5E94B 4DCQA 3RAJH 2VXUL 1P1ZA 5IMMA 4G6JH 1EEZB 1PAMA 5EBLB 1KIUA 1TNNA 1W72L 4PD4K 5JOEA 1WZ1H 1T22A 3WUWA 1HQ4A 3BUYB 4I2XE 3PP4H 2P5WA 4MDJB 2H9GB 1EEYB 2F19L 4P46C 2AJXL 1T1XB 4JGMA 3OB0H 4ZMAT 5HVHB 3PNWB 1ZLWK 3V8OA 3UTSA 3C8KB 2XN9D 3NFPB 2IG2H 1V7NL 3BPLB 3RNKA 1KACB 3X12A 5FGBC 1IVLA 2NX5B 1DQDL 1NUGA 2W9EL 1FJ1B 2DRUA 4TUJA 2VDRL 1OP5H 1AGFA 5F9WC 4NT6A 4WUUA 4M1GH 4X4XB 4HBCH 3RZCC 1F4YL 4N0YL 3P9MB 2YD7A 5IB1A 4Z78B 3D3VB 1AJ7H 4LKCA 3TO4D 4R7DA 4AMKH 5EZIL 3V0VB 5L9DH 3WXWH 1SEBB 3WEXA 1QFWM 3CCHA 3FRPG 4FQHA 3RIFK 3HN3A 2HWZL 4N90E 4RGMB 1TXKA 1JI2A 4LPTA 3ZZ1A 4JRXA 1DVFA 4L8CB 4HJGA 1LNUA 4U6HA 3Q6GL 4XCYB 1F3RB 1BHGA 4ZS7L 4QXUH 4MD0B 4F3FB 3VRLE 5FYJL 1J11A 4TUKL 4V1DA 1A4KB 4X7TB 2F5BL 1XR8B 2H45A 3W82A 2DLHA 3H2WA 4RFOH 4M7ZB 4ZUUA 5C09A 3I6GB 1BQHA 3BQUD 5C3LD 3VI3F 1S7QB 1CGWA 1XT5A 1T2XA 4J3WA 2Q6WA 5C0IA 3MRLA 3RVWC 4WUUE 4X8JA 2OXHA 3U0PA 3AS1A 4DFIA 5E2WL 4LSQL 4HUVB 3WSQH 4HV8A 3DRTA 1IGIH 4OCMC 1FFNA 3VWJB 4Y1AD 1R3JB 5TDNA 3DI2B 3L9RB 4XBPB 3DSFL 4TUOB 3DXAD 1ZGLA 4O2FB 5IR1B 3AGVA 5MERB 4QHLB 1OCWH 1D5IL 4MNQE 5CGYC 3GIZH 4YHYB 3ARDB 1MAKA 2BFVL 3S96A 2IQ9H 3WKML 4BUHA 2OL3L 3RY6C 3PV6B 2BY0A 3MUY1 5FXCH 5DO2D 4OIBA 4DGVH 5IB3B 4HS3B 4DFHA 3OAYK 3NH7L 1TZHA 4I77H 2V9QA 3RZCB 4D0CA 5FO8A 1GSMA 1CZ8H 3MOQA 5B38A 1NSNL 4Z95H 1K85A 1A7NL 4ZDHA 5ICYA 1HH9A 1RJLA 1T21B 1EV2E 1A7OH 3C9NA 3IFPA 2QV2A 1FL3B 5IQ9A 1CGSL 4KTYA 4WI4A 5FGSA 3TH2T 4RAVB 4N0FB 3GMNA 1YYML 2DIAA 2BZDA 4JGJA 3OV6A 4DQOH 4YNYB 1HNFA 3MJ6A 4YHNB 1NEUA 4NNXA 1JWSA 4Z95L 3FN0H 3OKKB 3HKFA 4HCRL 2VDNL 4L5FH 2N7AA 2YC1B 3TYFA 1YEFL 3FQTB 2ZJSH 1RVFH 4E41E 2DQGL 1FRGH 1KIRB 4PY8I 2VQTA 2ESVA 5I2IA 3P0VH 4ODUB 1ZEAL 4GRWE 1NCWL 1BBDH 1Z0MA 3KPRB 1FVCB 4UV4L 3GJFH 1X5XA 4KMTH 2ZUWA 1B2WL 4NN6B 3RL2B 4EQ2A 4XNZC 3BP5A 3FB6B 4X4ME 5F44A 4X6EB 1BF8A 3L1OL 1F2QA 2GJ6A 4O00A 3MLRL 2QJDA 1IGYA 2V5SA 4LLYA 4BH8B 3OHXA 1DQQB 4PY8J 3V0WL 1WBYB 4PJHF 1EDQA 3ILQD 4P23D 4QTIL 5FV1L 3GSQA 4LSUH 1YQ2A 4PG2C 3TIDA 3RVUC 4IBLT 3UBXI 3RPKA 2BNQE 5D93C 4R4FL 5B39G 1JYNA 4L1HA 1HIML 3S37H 2X2YA 4M48H 3MOBH 4CMHB 2EIDA 1BMGA 3OMZA 1OAYL 3OQ3B 2F74B 2VL4A 4JFDA 4P5TD 3CZJA 3J8F7 1J1OH 3NCJH 4FN0A 4GAJH 4WU5A 3BAEL 4WJ5B 2AV1A 2ZOLA 3B3IA 1A5FL 2D4FA 4N1HB 1UCBH 4Z7WE 1P6AB 1UWXK 5KG9A 1DVFD 3KR3L 3ISWA 4OUOA 3PUCA 1ZTXL 3O0RL 4XVSL 1JNHB 2DTML 4O02H 2EH7L 1AE6L 4IJ3C 5ICXA 2BRQA 1AGDB 3GSNB 3P0YH 1HYSD 4TSAH 3KYNA 3X3GH 4BZ1L 4OF6A 4MJ4A 1F8TL 3RWDB 1NDMA 1B4JL 2DIBA 1MRFH 1EHXA 3C5JB 3IYLW 4NT6B 5TE6L 4JO2L 4KZEH 3QDMD 2VXSL 4PJ9D 2OL3H 3C6SA 5AEAA 1BWMA 2LU3A 4IOFC 3VWKD 1F2XK 4ORGB 4AY0A 2X9YA 3V4PL 4AIXA 1I9EA 4NN5C 4NDMA 3ARPA 2QADD 3ILPA 4FQHB 4Y5YC 3CDFA 4NWTL 1YJDC 3TO4B 4JZOB 5D71L 4LQFH 4GRLC 5C6PB 3KXFD 3GMOA 4R8WL 3FB8B 1GAFH 4JRXD 4N5EC 1QUNA 4XNQA 3QWRA 5GGRA 3BP6B 5FYJH 1BVLB 3VXOB 3CVIL 3N9GH 3O8XC 5H37G 4EOWH 4RFOL 4XX1E 1DN0B 2DWDB 4POUB 5AD0A 1U8KB 2IBZY 3QUYA 5IVOA 5I18H 5F89B 2IH3A 4JFXA 5H35B 3I3EA 3L3IB 3O8XB 3ULUE 4TVPH 5HHOA 4ZXBB 5C0CA 2Q1EA 2P1YA 4O2CB 4D0BA 1F3JB 2VLRA 5HVWA 1KSRA 2D0FA 2YWYA 3CUPA 3D39D 2BC4B 4KI5C 1MFCL 1PGRB 1EZVX 3EOTH 4L4TA 3M8OH 3GFUA 1LO5A 4Z9KB 3SDXA 4Z77B 5DD6B 4NO0B 1BP3B 1CFNA 1OB1A 2BXZA 1MJUL 4L3EE 1H8SA 1ZSDB 2ADGB 5JXAL 2QQKH 4O2EA 3QT2A 5DVMA 4U49A 3ZTJG 1RJZB 4PPTA 3IFLH 5C3TA 2Q76A 4NKDA 1P2CA 3ZL4L 1A0QH 2CUMA 5DVLA 4Y0GA 4CBPA 1MAML 5MENB 2UUDH 1LEIA 3TGXA 4WIQA 1AXSB 2R4RL 5C7XH 3AAZB 3DUSB 4QHUB 3UXFA 1LWRA 1DQQA 1U2HA 5GZND 4OQ1A 2PTUA 3HNSH 1NGWB 4YGVB 5DRNB 1I7RB 2C9AA 3RFZC 1KCSH 2HT4C 4HIXL 4MDIB 4KKAD 1KPVA 3MV01 3CLEH 3MLUL 43C9A 4NQED 3MR9A 4NRXB 2O5ZL 1S9XB 4UI2A 3QXDB 1UXWB 4L8BB 5EBWB 4NHCH 2VZOA 2NZIA 3LSOA 3MV8D 1KJVB 3R0MA 2PW2B 2X4QB 3O81A 5SWZB 3O6KH 1AP2A 1FAKT 2UZYB 2FB4L 1MHCA 3ULUF 2Y9RT 1HI6B 2ESVB 3UEZA 2EKSB 43CAA 1WV7T 4BA8A 1MWAB 1NGZB 1AJ7L 2P7TA 1G1YA 3PGFH 3EJZD 5D93B 4J1UB 3NH7H 2EE6A 3JUYA 4P9HH 2K3TA 1YEEL 4RX4D 3GJEA 5CCKL 2CLRB 4Y2DA 4ONGL 5IW1B 1YJDH 4UMGA 1QBAA 3ME0A 1VPOL 5HHVL 4CDHA 2NXYD 3WFCH 5LKNA 3HE6A 4DN3H 3KPOA 5DQJA 3QIWD 4U3XA 1HXMA 1R3HB 2CPCA 3ZTNH 1MI5A 4F7TB 1TJIH 2HP4A 1UM6H 3IDMA 1DP0A 3S37L 4WFGD 4HJJL 5I75B 2EXYD 2CSPA 4IRZL 4N0CC 3UTTD 4KRPB 2JJVA 4WHCA 4TQEL 3JV4A 1FIGH 1CR9H 3B2UD 3RX5A 3VXTA 2KKQA 4A6YB 3C5ZD 3WS3A 1WWCA 3QHZL 1DE4A 4P5TA 5DEGA 1NGYB 2VLKE 5JQ6H 4CU6A 2FGWL 3RPIB 5JQHC 2ZNXA 4EXPX 2E8YA 5CINH 5C0AE 2CUHA 3L1OH 3CFCL 1ERNA 5F6IC 1UM5H 4NPYB 4RQQB 2EDBA 1BFVL 1NDGA 1JNNH 5T1LD 5IW6A 1GHFH 2XZQH 5T1MA 1CICC 3QUMB 1MFDL 2HVJB 4RGNE 3EDFA 1YNLH 5E9DB 3O3EA 2RBLA 2A77H 2LABA 4HUXA 1EXUB 2VDOL 3FN0L 4W4OA 4NWUL 2BOBA 3L3IA 3M17A 3O8XA 1FNGB 2JTDA 2GSIB 1CICB 4PJ8A 4M7LT 3L3HA 3L6FA 4KRNA 5GJSL 3FB7B 4CVWA 1REIA 3A67H 3QXAB 3UJJH 1LE9B 4POZC 4LMQI 4OZGA 3R06B 1JGDB 5IV2A 1IGJB 2R23A 4OLZL 4YXLL 3ZTJH 4B41A 3P0YL 2F8OA 3OXSA 4JFHD 4IMLB 5HPMA 5IVNA 2ZCHL 4CVXA 1OQXA 1GGYA 4YDIH 5J12C 4KJPC 5HI3D 2R69L 4PJ5E 3CXDH 4NC1E 5IESH 2IQ9L 5K9QG 1U3HC 3W2DH 5F9JA 2A1WL 3QWRD 2NY2B 1M05A 3V6OC 4NRYA 2ZCHH 2YPLE 3QWQB 3OAUL 5KVFH 12E8L 4L3EB 4PGBA 4PJBF 4HS8L 2RJMA 3ARQA 5IT2L 1TJHL 4PTTB 1CK0L 2WINB 1D6EA 1QNZL 5ADOL 3GSNL 1OAXL 2X4OB 4XAWL 1BVKB 1J1XL 4QNPF 5ITFA 3CUPB 3WFDL 5BO1H 4E41A 5KSUB 2Y36H 2VLRD 3MUGB 2DQDL 3BZDA 1VEPA 3D39A 5CEYA 3MX0A 4HH9A 3HNTH 2F9BT 4WI8A 3HI1B 1XIWA 2H32H 1G9NC 4JFFB 3B6SB 3PE9A 3QJFB 4LCUA 3QA3A 5IGXL 4LSTL 3CX2A 5C0RL 5JUEL 3TYGH 3HHRB 5CZVH 5DJYA 2XA8L 4YC2C 3VXRA 3VH8B 3O4OC 4XCNA 2VDML 5B8CC 3KXFB 3ETBF 4Y5XC 2ZKHL 2B4CC 1R5VB 2EDEA 4PV8B 1F13A 2PW1B 1P7QA 2DBLL 3VW3H 4MA1B 2IGFL 4ZNEA 4ZG1A 2CMRH 2DQCH 1MUJB 4XPHH 4ODTL 1G9EA 3F6IA 4NQDD 4BZ1H 3QFJD 5B22A 4RDQG 4L8DA 1F58H 5KJRL 1NGWA 4YGVA 3N85H 1LO3H 4HIEA 5C0GA 3IGAA 4K8RH 4LEXL 3TIEB 3DX8A 1FGNH 1S5IH 5ESQA 1RZGA 1KCKA 2J4WL 2OTUA 3U7WH 2CDFB 1N4XL 3OGOE 2EH8H 4GMTH 1FYHB 2FB4H 3MNVB 4UAOB 1V7NH 4N68A 4XNMA 5HHQA 1YMME 4LP4A 1WIPA 1FC2D 2DM3A 2XN9A 3UJTH 5BV7H 1TNMA 1I1AB 4NKIL 4TNVK 4ONOA 3BSZH 5FF6B 4XXCA 2FSEA 3P4OA 2X89A 4MA8L 5DFVD 5LXGL 2ED7A 2JB5H 3GSNA 4M00A 2BVOA 3B9KA 2X9XA 3WL9A 1KV3A 3IAGC 2FYYB 2P5ED 2VN7A 1DSFL 5D2NC 4P46B 1QR1A 3FZUC 4KI5F 4U1GB 1Q0YH 4URTB 3LKPB 5IJKA 4HFUH 4P3CL 4KJYB 4JDVB 4HG4K 4WI6A 4GG6F 4XMKH 1U58A 3B8SA 3G5YB 2LTQB 4JZJC 2JK5B 4IOIB 1TVHB 3FO2B 4JN2B 4G8FA 2ADIA 3QIWA 1AD0B 1LDPH 4LSTH 4XZUA 4JFYA 3T09A 3RKPA 5IB5A 4TQEH 4XMKL 1EMTH 2E7CA 1X6NA 4X4XA 3S4SA 5CEZH 3IKKA 4GQ9L 4QXGH 2V2XB 4PG9B 2CRMA 3PQYE 2XWBA 4OF8A 1WAAF 3P40A 1FNAA 4EIZC 5FYKD 1CDJA 3QHFH 3ZDXF 32C2B 1NCAL 4GUPA 4J3OC 4ODBD 1FNEA 2CLZA 3JTSB 3RVUD 3P0VL 3SDYH 4H5SA 4P99A 1TJIL 3T0EC 2P8PB 1T5WA 3DGCR 4GLRH 3OKLB 1HDMA 4OD3L 2GI7A 4HUMB 2Z92B 1QA9B 4F8TA 4UV7L 2XQBH 4S0SD 2B7DT 4V1DB 2D7MA 1NCCL 3FFCB 1OVZA 3G5XA 4JQIL 3SE4C 4QRRA 3SGKC 5CILH 4EN3D 4G9DB 3LMJL 4POYA 4KKLC 5DMYA 1A1OA 4ZPTA 2BHYA 2DYPB 1DVFC 3VA6A 4WDIB 1GOHA 1YQVL 4X7TA 4Z77A 1QYGH 3SE9L 1AI1H 5HI4C 3MYZA 1KBGH 1QSFA 2Q8BH 3TFKD 1RZ8A 5CZKA 4Y4FD 5SX4I 3QAZB 5A3IC 5C0CE 4HWEH 5E2VH 1R3JA 5ESVA 1CL7L 4WUUD 1XIWD 2CK0L 4YUEL 1Z0NA 4ODWA 3PHSA 4PJ9C 3P4NB 2CD0A 5MENE 5TE7H 1BIHA 1GL4B 1YPZF 1QRND 2JCCE 3FL7A 4LIQH 5HHNA 1IEAA 3HPLB 3VXUE 2BNUB 4OZHE 1U95A 1KEGL 4HWBA 1J7VR 1IKFH 4ETQB 2ICWI 1T89A 4KI5E 4Y89A 3CDYA 3T2QA 5F9DC 4XGZA 1JHKL 1WCBA 4KY1L 4KJQD 2UY6A 4GRLD 4OZHF 3CLFH 1BQLL 3LIZH 3VDBA 1YC8A 3ZMRA 2KQNA 3ALWA 1JNLL 1KB9J 5I30H 5HYJE 5SX5K 1R3KB 1JGLH 3OG4B 5B39B 4OGXH 4AENB 2ED8A 2WUCH 1EHNA 4IS6A 4C55A 1B88A 3TO2A 4PJGA 3HC3L 4UTBL 4WW1B 1MQKH 1FFRA 1YC7A 4HS8H 3TEUA 5GS2H 1A9EB 4IMKC 4JVUA 4MNGE 1EH9A 3MREB 1ZS8B 1EFXA 4KI5D 1RSFA 2J88H 5KANI 4AM0A 2JCCB 1CTOA 3L7FB 5J7CC 2AW2A 3UO1H 2FZ3A 4JPKH 1YEEH 3U2SB 5FECB 3L5IA 2NTSP 1J0IA 2V2TA 4R2GB 3H6JA 3RL2A 5D5ME 4LCWB 3GGWA 1M1SA 1QFUH 2EYSB 3SBWC 4CNIA 3CZFA 2G75A 2VLMD 3P2TA 1HHIB 4GAGL 3RGVB 5BO1L 3WFDH 4NQCE 1JGEB 2E3VA 3VCLA 5BMFH 1F4WH 1WBYA 5TE4H 5CEXB 5EC1B 3MGOB 3NACH 4W6YB 5IK3A 2V5RA 3D48R 1BM3L 2YEZB 4U6XB 5C1MB 1TZGL 3ARXA 5BZWA 2D7TL 3UMTA 5HHXH 1F58L 1G7IA 8CGTA 5KJRH 3KHQA 2A83A 4JE4B 1L9MA 3GM8A 4XVTL 4Y5XB 2XI9A 4LPVA 4EDWL 1BQSA 4UBDD 2NXZC 3N1FC 1QR1B 1TQCC 2GJZA 3KPPA 3S98A 1WWWX 4GKZB 1CDCA 3QB7C 1SJXA 2ENSA 2WUBH 4Z7WF 2IFFL 2ZSVB 4N0YH 5DHYA 5EOQL 2ICES 3ULUL 3KNBB 3NCYS 3FB6A 2DWEB 5IBUG 5KSAD 1E27A 3MUHL 4I3RH 1XGTA 3DVNA 2VSCA 5E7BA 2HKHL 2E7BA 4LASL 1QSFB 3IXAB 4YBHA 4XHJC 4NO2A 4JO4H 1HQRA 4QHNA 3MZTA 4HJGB 2Y06H 3F7PC 1PYWA 2B0SL 1VPOH 1DJSA 1LVEA 3LZFH 3B9EA 4OT1H 3BDXA 5JHLL 4WWID 3BT2L 5F7MC 4F9PA 1F6LL 4FXGB 4OGAC 3VFRB 4MXQC 4S1DD 1R3IL 4N0CD 4OCYH 1G7JB 3SJVA 5L8KB 1EVTC 1RJLB 1PZUB 1D6EB 3ILPB 3PGFL 3B9KD 2XT1B 4HJ0C 4RMWA 5C0JB 5IHZA 1GGTA 2PYFB 4FABH 4YGAB 3L95A 5I1JL 4APQB 3QCVL 4X6DE 3MBED 4G5ZH 4GAYB 3TBTB 1ONQB 4PTUB 4R26L 1QSEE 4Q6IA 1YN7A 3BJ91 3BH9A 3BXNB 1A3LL 2P5WD 1Z2KA 1HZHL 2VZUA 3NACL 3WUWG 2AJUL 2J8UA 5D1QA 5D2LA 5EZJA 4U0QB 2Q8AL 5IOPA 2H26A 3AS3A 4NNYB 4X7EC 5MERA 4NZRL 4HUWA 4ZQKB 2HH0L 1KIRA 2AP2A 3KYNB 3ARDA 1DBAL 4XCNB 1MAMH 4BQ6A 1UM6L 1A22B 3VI4E 4XVUC 1MCRA 1MWAH 4JHWL 4BZ2L 3JV6A 3W39A 2YR3A 1U0QA 1E6OH 1F3JA 1FG9C 3MMEA 3O6FC 1MCOH 3VGFA 1E0OB 5I1LB 1JPGA 5C0AA 1NGPL 2A6KB 1QPXA 3F6LA 1JVKA 2HG5A 4Z7VB 3TJEL 5ID1A 4LLWA 2NY0D 4QHMB 1TZIB 1OGTB 1VCAA 1RUQL 3IGAB 2IH1B 4TNWK 5CINL 3KPNB 3IAQA 1OARL 1JPTL 1C5BL 3FB8A 3X3FH 4NC0B 4PRIE 3GI9H 4KRPC 2LVEA 3RKDD 4QGYA 4ZFGL 2ADFL 2LAAA 2X5PA 5J9PB 4YDIL 2PR4H 2P5WB 1U93A 4ODVL 4QXTA 1B0GA 1HHJB 5JHDB 3MA9H 4NQVA 4F2MA 1F97A 1H5BA 1JZ8A 5E99H 4O51B 3Q6FA 2JKXA 1CFSA 3QUYD 3LQAL 1VADA 4MLIA 5MI0C 5C6TL 3MLTA 3MRDA 1WBZA 2CJUH 3HE7D 5DJ8B 4E42A 4EEEA 3FQRA 4N1EA 2UUDK 3BP5B 5E1AA 5DMKB 4U4BA 3UTTB 3DMMD 4RMQA 3ULUD 1AHWC 4F57H 1AR1C 3I75B 1IAKA 2VLKB 3VWKB 2JIXB 3MPCA 5F6HJ 3JVGA 1QRKA 4P2QA 2H32B 4LARH 5HY9B 2FL5B 2MFNA 3C5JA 2VJXA 1QPPA 1MFAL 4ELMF 2WIIB 2R1WB 1GGCH 4WWKB 5J11C 3CC5B 2ITCB 4P3CH 3HZMA 3CZFB 1R24A 3GHEL 3RHWK 4PJBE 4WI5A 4HHAA 5I73B 1FZJA 2Q8BL 4U3CA 3K4DA 3N0PB 2P46B 3BRGC 4KUCF 1J18A 1T7ZA 3U46A 5LQBH 5IEHB 4Q9RL 3KYAA 2BK8A 4PJAB 1EUUA 1MQKL 3DO7A 2AV1B 3QDMB 1BVZA 2LV4A 4PRIA 2VR5A 1T1ZB 4MHHI 1L7TL 3RTQC 5HDOA 3BZEA 2YD1A 3UJTL 1AE6H 5CSBA 2P24B 4L8BA 5F88A 4XMPL 2YPLA 3QNXA 3VFOA 3SOBL 2FJFB 3O45A 2X44D 4GAGH 3LN4B 3SPVA 4KTEL 4G9DA 25C8L 4NOBA 1ZA3B 2D0HA 4X4YB 3IDYB 4LGPB 4DTGH 4UILH 4WENB 4Y4HD 1JZ3A 5J13B 1FLRL 1OGAE 3FQUB 4XTRC 2Z31D 3ARBC 5FB8A 3KVQA 1MJUH 3GI8H 1JWUB 4HUKB 2JJTA 3KNBA 5T1MB 1T7YA 3STLB 4FTVB 2V17L 2H9GA 4Y2DB 4HMEA 4XCCH 3CFJA 3BGMB 3MV7A 5CP3A 5AZEH 4L3ED 1UA6L 4JPWH 5D6DC 5I74B 2HTKD 1OSPL 2F54A 3QUMH 2Q3AA 3MOAL 4XI5D 2AABL 3TZVA 5LGJB 5IQ7L 3FB7A 2ZOKB 1E4WH 2YPVL 3PHQA 3SEPA 1R3HA 2AJ3A 3CVHH 1CICA 3V5HB 3LKOB 1A1NA 2NZ9D 2PO6C 4Q0XL 5DFWH 4QXWA 3FT2B 1Q94A 3HB3D 3RAJL 4RAVA 5DRXB 2OI9C 2IF7A 4CL7A 1KJ3L 2BOCB 3K7UA 2MCPH 5T3XL 2FH8A 3NIFF 5K9JH 3RUGF 1ZT7A 2W65A 3ARFC 1OAQL 3QCVH 2XWJA 1VFUA 4NQXB 4OD3H 4PRPD 4PGCB 4CJ1A 2AK4D 3MODL 3WJJC 5TDPB 1INQA 4QWWD 4NO3A 4YFDB 2E8ZA 3UPRA 1J12A 5KVMC 2XZCL 1KFAH 4PRHA 1R5WB 4R97C 5FO7B 4OQTA 1INEH 4Q9QL 1KJVA 1GPOH 2Q86A 3NPSB 1TENA 3SDYL 1A9EA 1OPGH 1QHPA 3O9WC 1ITBB 5KSAA 1N0XL 5AWNH 3Q1SH 1Q9WA 3MLXL 1YEJL 1W72A 5IHLB 3W5MA 3WD5H 1P7QD 1MCQA 3FFDB 5DT1H 4WI9A 4Y5YB 2XQYK 4RMSA 5ADPH 4NNPL 2R0KL 2HYMA 4QXGL 5CEYB 2DKMA 3QI9A 2I9TB 1WBZB 2VNCA 1A7BA 5HHME 3MUZ1 4JGUA 5C08E 4D8PB 1NBVL 3MRLB 2FCBA 3UTZA 4QF1A 4ZUWA 1CDGA 2H2SD 2VDQH 4L1DA 1LEIB 2R23B 3CXHK 1VACA 4WFFD 3GGWB 2R0KH 2BCKA 1A02N 4P2QB 3N1MC 2YN3A 1TJGL 5E6ID 5SV4A 4P2YA 5AG9A 5DJYB 1WC7B 4F33A 5DVKA 4OCWL 3TYGL 5JUEH 2CXKA 3F58L 1ES0B 3IB4A 3OZ9H 4H88L 4PV8A 1OGAD 1V8HA 3S35H 3TNNB 1H15B 3QUXA 1C12A 1YN6A 4N8VB 4MA3B 3BKJH 4S1SH 5C0FB 1B0GB 1HHJA 4PBVC 2HT3C 3GZKA 1FAIL 4M43L 4FP8L 3ZYIA 1KIQB 3U30B 5DR5L 5C0BD 3GSNH 3HMXA 3HUJF 3T77B 1SVZA 1SYVB 1T22B 4KWUA 3G04A 1ZWIA 1S7WB 2YKLL 1JF1A 3NAAL 1IGCH 4YBLB 3AY4C 3PXJA 1LK2B 5JW5B 4OKDA 2J4WH 2FJGB 2X1XR 2I24N 2FO4B 3EYSH 1RZJH 1IT9L 4JFFA 1UKTA 3NFPA 5FA4B 5E4EC 4HKBB 4JRXE 4BFIA 3ES6A 3PHOA 3WO3B 4G6KL 3RU8H 4P4KD 4ZOCA 4JFZL 4W68A 1FJ1A 1KTLB 5L9DL 4XPHL 4JZOA 5HDLA 4R0LB 1YDPB 1BJ1J 5E2TH 3RGHA 1DSFH 2XRAL 3UYRH 1YEIH 2IAMA 3NCMA 4LCYA 3QUZB 1R0AL 2V2WA 3FFCD 1V5JA 4Q74A 4HQQH 3MOBL 4LDEB 4BQCA 5D8JH 1F3DJ 5C0ND 2HTLC 4JFQB 1U91A 5EULV 1Y6NR 5HYIA 2VZ3A 2Y6SD 5EPMB 3TZVD 1M71B 4UTAH 1N5YH 3LV3A 4FFVC 2VLLB 2EXWC 3MRRA 4FQXD 5E24E 4YDLB 3RVTD 5TDOB 2XZQL 4EI5C 2IPUK 5F7DB 5I8KL 3GSXA 5F96H 5IW6B 2FECL 4GQ9H 2E7LA 2W60B 4X0KA 4X6DB 4CADA 5A40E 4AG4H 5EZLB 5BVJB 2J3SA 1IBGH 1CXLA 1XF3A 2AJVL 4Q9RH 1DQTA 3C09C 2J6EL 1JPST 3KLSA 4IDJL 1G7LA 4Y4FA 3O3UN 4QRPD 3L3HB 1I9JH 4OZFB 4Q7DA 3O4LB 3GHEH 1OOAA 5TE6H 4PLJC 5EB9A 4AEHH 5DD5H 2AK4A 2C4FT 4G5ZL 3D5OF 1JGDA 3GSRA 4EI5B 4OF5A 3LKRA 1QFUL 3HC0A 4GRWF 2FX9H 5KS9E 1KNOA 4XBGA 2QQLH 3C5ZB 2NXYB 5T5FH 1W0WA 1FFPB 2CKNA 4MAUL 4X6FB 3WO4C 2ZSWA 4MD4B 2IG2L 1Y18B 5CKGA 4YHLL 3FQXA 3FMGL 4RIRB 5T1DL 3UTZB 4YFEA 1JZ7A 4MDIA 1E6OL 3JWDH 4JFFE 5A16A 5GS1B 4RGOH 5FCUL 2BCKB 4LASH 2YPLD 4NC1C 5IHBA 4Y16B 4HSQA 5CSZB 3U79A 3GMPB 1KT2B 4TULL 5C0GB 4GLRI 1Z5LA 4DGVL 4CN4A 1XF2B 2X7LB 5GGTH 3ROOB 1ES0A 4GW5B 5E03A 5ANMB 5ICYB 4F58L 4CW1B 4S1DC 4NBZB 5GSVA 3D0VA 1KGCD 5BQ7A 4ODHL 3DI3B 3EYUL 3QNYB 4LOUD 4TVPE 5IMKB 2ORBL 2NY5L 3T3PF 3QHFL 3QUXD 4LCIL 1T0MA 4ZFOL 4H1LB 1GIGL 4B7IA 2CLRA 3EYQC 4LGRB 1JHKH 2VDMH 4V2CB 3O6KL 5ILTH 3MCKA 1OAKL 2PYEA 2D3VA 1I7ZB 4ZAKC 3RBGA 5CBAB 1RURH 5TDNB 3QDGD 3GB7B 2KUTA 1GC1C 1ZGLB 3VG9C 2HVKB 1T7WA 3V4PH 4WHDA 4QRUA 4IS6B 1MLBB 1XMWA 1NC4A 4AT6A 5L88L 1A6AB 5BCAA 1FFOA 3DV6B 2B4CL 2XPGB 4HDIA 3Q1SL 5D72L 2ZPKH 4P49A 2X70A 3QFJE 4ZTPH 4G8IB 5JPNA 3CVHB 1RMFH 2X05A 1EFXB 2EZ0C 1CFNB 2MKWA 4JKPH 5T5FL 4J3SA 3STZB 3WS6A 3CSGA 4OFVA 1U8HA 2H41A 4MXWL 3MGAA 1T1ZA 2EEAA 4U3HA 1FLRH 4GRWH 4G6JL 1J05A 5DDHA 3GEWB 4GKOA 5DTFB 3U48A 1VERA 3PGDA 5E8DL 4KHTL 3UZQA 2OK0L 1RFDH 3O4LE 4KVCH 4ZUTA 4X6DF 4PJ5A 1QD0A 5HD8C 3SDAC 1GZPA 4U7MA 2YSSA 2XY1A 1A7OL 3EO9L 5DJZB 1XZ0A 5BS0E 3RWCB 2GFBB 2F74A 5HYEA 1QLFA 4L4VA 4FQXA 3GBNL 5JORA 4CADB 2X09A 1IEBB 5BVJA 5I16A 4YHPA 5IG7B 5SWZA 1BIIB 3HMWL 1FDLL 4OFKA 2CH8A 3SDDC 3WNLA 3UTPD 3HE6D 5I75C 3QPXL 3NTCL 3OR6B 4MXVF 1INEL 5JO5B 3G5VB 3C6LA 3NZ8B 2W9DL 1EAPB 3D39E 1MJ7H 3NCCB 2X42A 3L7FA 1R0AH 2EO9A 3KAAA 4GKZA 4LQFL 5GSRA 1ZMYA 4P2QE 4JRWA 3QEUB 3V52H 3NTCH 5FCSH 2WMPA 2X6MA 3NGBC 3C8DA 4BSWB 2CUIA 1J1PH 1UA6H 2QADB 2ZUYA 4NP4H 5ISZD 3OXRB 4CU8A 4HPYH 4RFNB 1S7XA 4NHCL 1RD6A 3CFEB 1MIML 1YEKL 1M7DB 2ZUQC 2AERT 3P4MB 1IT9H 1XGRA 3QG7H 3H9SA 2YRLA 1NAMH 8FABA 4CVUA 4XNQB 5GGRB 1U8KA 3FO9B 4NUGL 3CMGA 3ARBB 3OKEB 2PN5A 4XHQA 3B9AA 4XC3H 1G7LB 4ZTOL 3RIAF 5KSAB 1RULL 3PWNA 3T8XA 5ICXB 3G5XB 4Y5VC 4L3CB 5F9OH 5CJXC 3RVVD 3RWGB 1NAML 1N3NA 2YD2A 2DYPA 2P5EA 1CDYA 3WNMA 2OJZH 1LGVA 2YS4A 3VFVB 3TV3H 3WJLA 5B8CB 4OLZH 5DK0A 4PJHB 4QRPE 2KDGA 4NWUH 3A6BL 4ZNEE 2DKSA 4R2GD 5D1QB 4S0TD 1NL0L 2R29H 1A9BA 5D7IA 3TNMB 1W8OA 2Z93B 3OKMB 1FIEA 4OJFH 5DI8B 4PJIA 5I15L 1IKNC 5I1LA 3I02B 2AJYL 1EO8H 2AJZA 5J1AA 4JJHA 1KJ3H 3W39B 4XT1C 1FL3A 1VA9A 1L0QA 1K8DB 1BJ1H 1JZ2A 5HPMB 5EIIA 1BJ8A 3SDCB 4P5KA 1JWSB 3U4EA 3CFCH 1HEZA 1C16B 2YD8A 3TBSA 3FONB 5ALBL 3P4OB 4QHUA 1CQYA 4XAWH 5JW4Q 4BM7A 1I8KA 3C60A 1EUTA 2Q7NA 5DDHB 2BVYA 5DURD 3SDDB 2H2PC 4Z7NE 2R0WL 4WHYG 4PTUA 5FCUH 1P69B 1MHCB 1T1WA 3KPQB 1A47A 5CD5D 3HNVL 5F71A 1MJJA 3QXDA 4OI7A 1V3MA 1U58B 4EUPG 4QRRD 4LQ1A 5EBMA 3B5TA 4P2CG 3QDME 4OLWL 1LO5B 3OPZH 4KK9C 3QEQA 4NQEE 5L88H 2EYTB 3L3KA 5B3JF 5KSUA 4Y4KB 4M8VA 1U41A 3EFFB 1JWMA 2JCCA 1JYVA 4L4VD 1J8HA 3LEYL 1HILA 1DBJL 4LLMB 3IJHB 4UNVA 3NMEA 1UYWL 2IANB 5FYKL 4AEHL 1WSST 4X6CF 4HW6A 1MRCH 3VWKA 4UIKL 3L7EB 4J8RB 3SKUD 1T66D 4XXDB 3SO5A 3ZDZF 3KLAB 1NAMB 1U8LB 2Z31B 4PJ7B 2KZWA 3LOWA 5HHXL 2JF1A 1TITA 3DLQR 2CRIA 5HVGB 1GPOL 4JDZB 5I1KL 1J1OL 2AXFA 3BDYL 3LCYA 3NA4A 5DJDA 1FAIH 3R1GH 2ITCA 4NQDB 4KKCC 1HOCA 5EBWA 1KB5B 4K7PY 2VR9A 5DMJB 2IALA 5JIIA 4Y5XA 1T4KA 1TDQA 3TT1H 2QQNH 2SEBB 3IDXL 5F72S 2YWZA 3QXTA 2WWMC 3ARGC 1EX0A 3DX9A 1G7MB 3MA7A 2B4CH 1JRHL 3VFOB 3OF6A 1MWAL 3U0TA 2X4SA 2DN7A 2VXTH 3NCFB 4NN7C 4BFBD 3S34H 1PSKH 3UTSE 5GS0L 1I1AA 1MRFL 2VZ1A 5F88B 1X5IA 3GK8H 3BRDA 4N9OB 1X4YA 5DHYB 5E7FA 5K9KB 3LEXA 1YECL 3QUMA 3OAYH 1W0WB 3DTXB 3GRWH 4HEPG 4C56A 4HT1L 4YE4H 3C6LD 4K8RC 3F7QA 3IFNL 4HAGA 3V4UL 2NX5A 1J0HA 1ZLVH 2X4PB 3ZYJA 1YMHA 4XPBL 4RIRA 4F7PB 5C2BH 1JE6A 4D9QD 2VH5L 4WWKA 4EQ3A 4PJHA 1PY9A 5EUKA 4K71C 5GGSA 4G6KH 1AFVH 4M1CC 1VGKB 2EEBA 4M6ML 5HYQB 2YA0A 4OV5B 2CGRL 3WV0A 5E5UB 1U8MB 1S7XB 3D3VA 5C0RH 1CLZH 2YRPA 1WF5A 3K74B 2BVTA 5JR1H 1CIUA 3AU1A 3BW9A 4PB9H 2VQUA 1MFBH 3NAAH 1J87A 4LBEB 4RRPA 1UJ3B 5ACZA 3QUYB 5LAXB 2EDQA 1JZ5A 1SJHB 1NBZA 2BRRL 1JCKA 3OKEA 4XCYA 3L95B 4I4WB 3GJFK 3WN5B 2XOTA 5TQ2H 5JPMA 1XH3A 4OV6F 5MEOB 1XF5B 3QBTB 3QO1A 5IFAH 2EE3A 4KMLB 1FSKC 3NPSC 2CKBL 5HYJA 1F90L 4QRRE 4RZCB 5ENWB 5EU6B 3GSVB 4X6CE 5GZOD 1UKQA 3VXUA 4JREB 1AKJB 3EW3B 5IIEB 2LU7A 4FG6D 2IQAA 1ADQA 3DROB 4HIJB 4IRJD 3LN9A 1NUFA 2C3HA 4AMKL 2DLFL 3QCTH 3I75A 4N90D 4Y88A 4RWHA 2QQQA 4ZO8A 4XAKD 1XGUB 4YQXL 1Q9LA 1CGYA 3RGVC 1AR2A 5LCVH 3KPNA 3MLWL 3KLHD 3ULSB 4BKLB 3C2AL 4KPHH 2CKBA 3ZYOA 3HZYB 4JAMB 4FQJL 4NNPH 1CDIA 2EKJA 3ZT5A 4D8PA 3IETA 5C86A 2FIKA 4RGNC 2XICA 1UJTA 1Y6MR 4Y19D 2IANA 4HS3A 4PFEA 1UWXH 4NQVB 2J8UF 2Z8VC 3C9NB 5D1XA 2WAHA 3I6KB 4XX1G 5J9PA 1KJ2A 4YHOL 2VB5A 1GC1H 3O6ML 4KJWC 5IMMB 2HKHH 3RNQB 5F8RC 4RAUA 1V3KA 4WW2C 3DIFA 5DRZA 5E4EB 1P7HL 3GMNB 2YBRA 3MQIA 4RX4A 2ICWA 1QZ1A 3FQTA 1MIEH 4FZ8L 4UT7H 2ZSVA 1FN4B 1T1XA 4KVNH 4PRAB 1E6JL 1ZV5A 1MCNA 1WBXA 5IP4A 2C1PA 4M3JA 4Y5YA 1R5IB 3H9HA 1XCTA 2R1XA 4P2RE 2DLTA 2FYYA 4ONHA 4NO2B 4NQCB 1WFUA 2VLJA 1BD2A 2C3XA 4LIQL 3KS0H 1X6LA 2FX7L 4X7SH 4G8GB 5DZNA 5C0AD 4YXKL 3KYOA 1TJGH 3BO8B 4XZUB 3QDGE 4PJEE 3RWIA 3LH2L 1UADC 3X17A 2WP3T 1WC7A 5EOCJ 4HS6A 4KUCD 4BUGA 1I1YA 4PG9A 1L6XA 4FQ2H 4PJIF 1T6WA 1OLZA 3FO1B 3GSQB 3MLWH 2EIZA 1FYTA 5IB5B 4HLZH 2ZJSL 3SJVE 3KYKL 5F7UA 4QRTA 32C2A 5E9DE 2IALB 2OJZL 3HI6L 1T3FA 2GAZA 4N8CL 2NY4D 3K8LA 3QPQD 5IROA 3T0EB 4JQIH 5KS9F 4WHTB 2FSEB 1QLRA 3SPVB 4L9LB 4ZUUB 3U7WL 4LNRA 1DCLA 3FT4B 1KCVL 1JK8A 5HD8D 4PJ7F 1T20A 4CN6A 1XGQA 1VKXA 3MRGA 2UWEA 3A6OA 1G7IB 1QOKA 3VFVA 4Z0XA 5LJYH 3T2OA 4HF5L 4QCIA 5E6YA 1XF5A 1KYOJ 3R8BB 1BOYA 1M6OA 1NLBL 3SGJC 3UBXB 4M9OA 1KPRA 5IV2B 3IDGB 2AK4B 4P2RA 3QQ9C 5CGMA 3KLDA 4NCC2 2NX5D 4RFEA 1P84K 5DJCA 3MGTB 4PR5A 4L9LC 2NQCA 4YDVB 3V52L 4N0UA 5GGSB 3C6SB 3RY4A 4F9LA 2DS4A 4GRMA 2EE9A 1RHHB 3GSRB 1G0YR 4YHZL 1HCFX 2Y36L 3LKRB 1Q94B 3DUUA 3CU1A 3EDJA 1U95B 4J2XA 5FDYA 3GMOB 2EDXA 4YHKH 5DC9B 2XQYG 4ZS7H 1H5BB 3H7LA 1QBMH 1U42A 1DL7L 1G7QB 1DQLH 2R15A 2AGJL 1Z3GL 1BVLA 4PJCF 4PJBA 4TUKH 5ADOH 1QA9A 3LPFA 4LSSH 3HC3H 4FQQA 5C09D 4Y2DC 1MQ8A 3CFBB 5BW7C 1JF6A 4U1SB 3WFHA 3QO1B 1MIMH 1Y0LB 5EORH 1BZQK 4MVBC 3QNZB 3FN9A 3K4AA 2FD6H 2M2DA 5HYJB 4ENEC 1SEQH 5BMFL 5J89A 3DIFB 3AM8A 1HINL 2DQJL 3RIAK 5B3NA 3SKJH 4JY6B 3V4VH 4YDJB 1B3JA 1S5IL 2HKFH 3BZFB 3TT1L 1D5ZB 4P4RB 4APQC 4YHYC 2VZTA 2P8MA 4EN3B 5DA0B 1ZS8A 2DD8H 5LCVL 4QNPE 5K93A 1T83C 4Z7VE 3TJEH 2VZVA 4FTVE 5EDXA 5TF1L 3D69A 3V4VL 4NKIH 3GO1H 3LH2H 3HZYA 3S8WA 4LEOB 2RB8A 4ISVA 1NGXA 5K9QI 4Z7UF 4K94L 3TNNA 2X4NB 4KHXH 5M7QA 5H8DA 4M7KL 4WFHD 4HWEL 4U1LB 1IGIL 4YE4L 1S7SA 2M8XA 4LHUA 3U6RB 1A14H 4GBXA 3A6CL 4OCRL 1I1RA 2WBJA 1SYVA 1GXEA 4Q2ZA 3EHBD 4PGDA 1NPUA 2QSQA 4XH2B 3FOMA 3GI9L 3RDTB 3DHJA 4MMZC 5JNYB 5JW5A 2F53A 2E9IA 5L0QB 4WEUD 2FR4B 2NY2C 2EDWA 2FWOA 1UACL 5JHLH 2FRGP 3MFGB 1JJUA 1WWBX 1U92A 2HRPL 1MJ8H 5FYJU 3PL6C 4TULH 1UQSA 1TIUA 1CDBA 2DL2A 1R3IH 2AI0L 3S35X 1CFSB 5GPRA 3JXAA 3QXWA 4NKQB 1TCMA 3HS0B 3SE4A 2FX8L 3FZUD 1UZ8B 5I16B 3TJHD 4TRPL 2AEPH 1PD6A 4C56E 4Z7WB 2HLFC 5CIPB 4HEME 3K81A 1HWHB 2BY3A 4GJTB 4JFYB 3BO8A 2WWKT 3VXSA 4HDIB 2BVEA 5F21B 5FYKH 4KKLD 3FHQA 4A2MA 5D7JC 2WUBL 5IB4B 5L2KD 1IL1B 3U0WH 4MQSB 2Q8AH 1LEKB 1IC7L 5ERWA 4P2RB 3HUJA 1UVQB 3SGEI 4Z7OF 5DA4A 4UT6H 1S78C 1I1FA 4QHNB 3TFKC 1AO7D 5ADPL 3LAFA 3B43A 4JFEE 3QO0B 4MCZA 3IXAA 2Y07H 1B4RA 3FFCE 3SHSA 2VIRB 3BP4B 1R24B 1CI5A 3E2HB 3VXTB 3QIUD 4FNLL 3PJSB 1BLNB 4GQPH 4R0LC 2ARJB 4MAYA 4YDLC 1J0JA 3V9FA 4IIQC 3CK0H 4OAWA 3VG0L 3RI5F 3T0ED 5I66A 3EYVA 1G7HB 3BDYH 5DQ9A 1KUMA 5E8OA 3HPJA 5IVXA 2DIJA 5GGVH 4Y4FB 5C0JA 1D9KA 5AZ2L 1QBLL 4G8EB 5D7KE 4O9HH 2WWMD 4I3SL 5DUMH 5BRZB 4PP2B 3IFLL 4QF1B 1AD9B 2VKWA 4EN3C 3ZKSD 1FO0B 2GCYA 3QFJB 4JFFD 2F54D 5TFSL 2HT2D 4G7VH 1XGTB 1BQHB 5K33A 1CGVA 4CJ0A 1X5AA 1QP1A 4LFHD 4UQ2B 3RHWF 2ZUXA 5K9OA 2HVKA 4NQEA 3O2DA 4OKVA 2NYYC 1OL0A 1ZTXH 3QIBA 3U9UA 1M7IA 1TETH 3W9DA 3KPSE 1C7TA 5J4MA 2A6JB 2XZAH 3ARED 4F8QA 3QEUA 1XIWC 3P30L 1BBDL 2XIDA 4U6VL 1H3XA 4OZIA 1AGBB 4CN1A 4ZODA 1IFHL 5IB1B 2F54B 4OBSA 4GO6B 4F58H 1AGCA 1HH6B 3T2NH 3B8YA 2AVGA 1I8LA 4NZTH 2ZCLH 4P57A 3TCLA 4GG6E 2AJZB 2IEPA 1OTUC 3T77A 5FYKE 3KHOA 5EO0B 3WEXB 5CJQL 4EOWL 4WTZG 1N2RA 2Y06L 4NRXA 1TTGA 2ICWJ 4KZDL 2WUCL 1FC1A 2PXYC 5I8EB 4UDTA 1RPQA 4YIQB 1W0VA 1SEQL 2ERJB 5MP6H 4JM2C 2WBJB 3PGCB 5CUSH 1P4LB 3S3SA 1F4XH 1H3TA 2WLYA 4HH8A 2DICA 4HK0B 1YJDL 3JTTB 4PJCA 3F12A 4U7KA 4WO4C 1KPUB 4OLUH 1SJEA 3SQBA 2NXZB 4BFIB 4LRIC 2Y7QA 4XMLL 2OCFD 3G6AB 1MRDL 4YHZH 3E8UL 1R5IA 3FQRB 1CFBA 1AXTH 3O9WB 4G8GE 4OI8A 4KU1A 3ZT6A 4JFEB 3V6BR 3UTTA 4E9LA 1XF1A 2H3NB 4M6NH 1ZLUK 3RL1B 3IVKA 2OLDA 1CIDA 4QTHA 2VOTA 2F15A 2DQCL 3L5WA 4R9HA 3O3BB 3D25A 5FUOH 4BFGA 3ARWA 2XTJE 2CK2A 2AS5M 4N8CH 1MFEH 1QRNE 4IRJC 3G5VA 2NLJA 4M6NL 1K5NA 2P42B 5HHPA 3VA2C 4P48A 5A2FA 3VFMB 5E2WH 1HHIA 3MBEB 5I1CL 3G6JF 4X98B 5D1ZC 1JZ4A 3KLHC 5TQ2L 1U8JB 3O11A 1NANI 1ZHLA 2Y5TA 3O2WL 2NY3B 3B9VA 1BZ9A 2WBKA 3MLSH 1RIUH 3JV5A 4RGND 2BVUA 2W59A 1G9NL 4OZHA 4WHTA 4S1RH 3AS2A 3KWWB 4JDZA 3WUWB 2CO6B 2GUOA 4YZFE 4BK5A 1CU4H 3RPIA 5JW4R 4FQXB 1RUML 1MCFA 4HFWB 2B2XH 1X5KA 4B5EA 2GFBA 4NPYA 1QSVA 1P6FA 5CP7A 5GRYA 5FHAH 4QHKJ 2BSSB 1UH2A 15C8L 3QRGL 4HPOH 1RAMA 4ZYKB 1ETZB 1U8NA 1KPRB 3T4AB 3RU8L 3SCMB 5D70L 2P8LA 1QRNB 2R8SH 4X5LA 1HNGA 1F4YH 3TVMC 5I19L 5E00A 3STBA 4OD2B 1FVCA 1LK2A 3ARDD 4KQ4H 4HX1B 4OLVL 4Q0XH 1PVHA 1CLYL 3SCMC 2OR9L 3W5NA 1KLGA 5EU6E 1AD9A 4KK5C 4JDVA 5KSAC 4ODSL 4F57L 4FMFA 3VH8G 2NY1D 3RTQB 2OQJA 4GRLB 4JPIB 3O0RH 2X4UA 3OL2A 1H9VA 3TT3L 1JTOA 1KF9B 1BAFL 5HHMD 4CVXB 3WD5L 5A2KH 4XCFH 1B2WH 1EFQA 4C56B 1G7PB 4OGYH 3EO0B 3VFRA 4OLYL 3I9GH 3RJDA 3HRZA 3BP4A 4YHLH 1LQSR 4ONFH 3TBVA 4GSDH 4AEFA 3GDBA 1YMHB 4HK3J 3IJYB 2BSRB 4MX7A 5I1CH 5ISZE 4LLDB 2JB5L 3VXRE 3IS1X 3FO0L 3BEWB 3FQNA 1WVZA 3TBTA 4R26H 4MNQA 3F5WA 3BIAX 2AK1H 3PG2A 1KELL 1GGIL 1INQB 2NY6D 2DMKA 2Y07L 4JDTH 3C08L 3MBEC 1QSED 1HXYA 3HI6H 4YH6A 4NJ9H 2IAMC 4WEBH 3MUGA 2YZ1A 1MY5A 4M5YL 4Y4KD 1T03H 3MV9D 3QFJA 4G7VL 3VDAA 3P3YA 1LDPL 4ZUVA 1ORSA 1P9MC 3HE7A 5KS9B 5SWZD 2A74B 5EO9A 4C4KO 4NM8H 1ZT1B 3BEVB 1P84J 2YMXH 4EI6A 5GIRA 4KDTC 2OYPA 5J6GB 5GQBA 3UDWC 4PD4J 3MLXH 3P77A 1RI8A 4OCXH 3QIBD 3D2UA 2AJ3B 1AO7A 1RZKL 5FGRA 5L8LB 5DI8A 5T3ZD 2AJXH 3REWA 2V17H 3VXUB 3GBML 2DQHL 3GSOB 2FHCA 2EDHA 4WO4B 3VXPB 3CX5J 3HG1E 2DD8L 35C8L 3RZCA 5FKPA 2XA3A 2VDLH 4LAQH 1UXSA 1C16A 3TBSB 4HGKC 2HFFA 3OR7A 2BNUA 5FHBL 3BSZL 3TWCL 1MH5A 5CLWA 2HMID 1MIEL 3WNNA 4JKMA 3DX8B 3NA9H 4Q2ZB 3KLAA 2DAVA 5ID0A 4KVNL 3DVGB 1A6PA 3V5DB 4TOYL 4XNZB 3MRQA 1XGYH 3Q2CA 1JGUH 2F53B 3I2CL 1SJHA 1A7QH 4N0FA 2IBBA 4XRCA 5C6TH 3B4NA 4HK0A 4PJDA 2ZUSA 5FHAL 5KAQG 4K3DH 1EO5A 1I8IA 2DWDA 1XH3B 2ZCLL 3RWJA 2IJ0C 1ZWIB 3QDGA 4OB5H 3C8KA 4HD9A 1GH7A 2CDEB 2CIIB 2DQUH 2B1HL 2NY7H 3IFOA 4D0BB 1XR9A 4QKXB 3U36B 4Z7WA 5GGUB 2CO7B 3WDHA 3DMMC 5IKCB 4G9FA 1AR1D 1RK0B 3AREA 3BQUC 3CSYA 5FFLA 3KS0J 4JANB 4PRBB 2HRPH 1D5BB 3GKWL 4YXLH 1FG2B 3DARA 4JLRB 3RVWD 4AM0B 2EDJA 3NZHH 4QEGA 3DV4A 4LKCB 3HNTL 3ULSA 4M48L 4W81A 3WLWD 4RA0C 5I9QB 1MF2H 4NJAH 4OFPA 5C8JB 4I9WE 2GHWB 1YY8A 5KBNC 2NXYC 4D0DB 5GGVL 2I07B 1A14L 5TJWK 4BQ9A 1UZ6F 4H25B 3LKQB 4TTGA 1HXMB 2AXFB 1D3CA 1E4XH 4NDMB 2GJ6E 4QRSA 4YDKH 3VMNA 3E2HC 3PWLB 4P2OB 1QFHA 2W0KA 2VAAB 4I0PA 2EXYC 3V6ZB 4JFQA 1ACYL 2Q87A 4O02L 5I71C 2FGZA 3E3QE 1IGCL 1UJ3A 5ACZB 3KJ6H 1K4CB 1NC2B 4JFDB 3NA9L 3K80A 4XWOD 4HIHB 4WI7A 4I8DA 2O5XH 3C5ZC 1ZHKA 3B2VH 1UWEL 5CLTA 1NH6A 1NQBA 4GMSL 4I18C 4UB0H 2R9HD 1J0ZA 1SY6L 5I1DB 4NZJA 2J5LC 2VDRH 1HHHA 4AIZA 5HYSB 3VXQB 1XGQB 1VKXB 3GJFB 3U1SL 4PBXA 4F7PA 1QLFB 1I85A 3DO3A 1EGJH 4XPGL 4LNRB 5EUOF 1TTUA 4Z8FH 2A2QT 4G7YH 4MJIA 3GMRB 5D5MB 1AGEB 4ZUVB 3QQ4A 5JTWA 2IBZX 2OMBA 2R69H 1FO0H 5DVOA 3WFBL 4DN3L 3EO1B 4OIIL 3D0LA 5LBSL 4UT6L 3HE6B 1LP9B 5JO5A 1P9MA 2W0LA 5CCKH 5IBTL 4A2LA 1RURL 3CPLB 3Q6GH 3CH1A 5C0CD 5TPWL 4WNQB 2XNAA 3X13B 3SDDA 1ZLWH 1GRWA 3ZSSA 3ILQC 4P23C 1OGAA 3DYPA 1GGIH 4FZ8H 3QHZH 4NO3B 5L2KB 4H1LG 1DANT 1I1CA 5A2IH 4MSWB 2CKBH 3HLAB 1FCGA 4CW1A 2EEDA 4Z7QE 4K71B 3ZO0A 4RMTA 1OP5K 5FV2A 3MRQB 3V2AR 1QSEA 3HUJE 5EBGA 1IQWH 4QWWC 4GW5A 3BIKB 1DFBL 4S1QL 4L8CA 3O2DL 5TE4L 3EKCA 5E5MB 4FHBD 3OAZH 1JYWA 4I5BA 4L8SA 2H8PB 1OD9A 5F6IB 5MP6L 4OUUB 4X5XB 2A9NH 3MRJB 2B5IB 5E08L 3UBXA 1MI5D 1NGZA 5KN5A 1HHKB 2Z0BA 2FDBP 3C87A 1B6DA 1FVEA 3V95A 4M7JH 2WP3O 3N85L 1C5CL 2HT2C 3TN0A 4PJ9B 4DKAA 2XPGA 5I17B 2VXQL 4XC1L 3CNKA 1X5GA 4R4ND 5EC2B 4ORZC 3BZ4B 1KELH 2APTA 1DEEB 3I85A 3I6KA 3JWDC 3EJJX 4PLOB 4AIOA 1IGTB 2NNAA 4JFOB 3ZHDA 1HWGB 1NCUA 4Q97A 3CDCA 3BGFC 3I02A 4NQSA 3V7AG 1D6VH 1JHLL 4PBWD 4XWGH 4RFNC 3MLPA 5IM7A 4Z7UE 4PJAE 1A6WL 5CD3B 2R2EA 4XP4H 4PJFE 4K3DL 5CEXA 4MA8H 1RZIA 5LXGH 4HLZG 4RMUA 3ESVF 1KEML 4HFWA 4WCYL 5T1LA 3IDUA 2ZG2A 4K94C 1WEJL 2DI7A 1WTLA 1F5WA 2E9JA 4OGXL 2D7NA 2WIMA 4MB3A 3CIQA 4EDXA 5F7YC 4LHUB 3U6RA 1HEZB 3BJLA 2BSSA 3MLSL 5DD1H 3TZVC 2CDFA 2P45B 5I1IH 4DJMA 4ZYKA 1I8KB 2EXWD 4JHAL 1GAFL 4P0DA 5C2UB 1WEJH 2VABA 4PRDA 2C1PB 2J8OA 1ZANL 3RUGE 2M1KA 1D5ZA 2BVQB 1KTLA 3RBSA 4ZD3H 3MLZH 5KSBE 2DWEA 4JJ5A 4Y8AA 3QA3B 5IG7A 1U92B 1GGBH 1H8OA 5AAWA 2AEQL 3VH8A 5E8PA 3VRIB 3WNKA 5HY9A 1X5LA 1NJ9A 2AAVA 3GSUB 4IDJH 3PL6A 1N0LA 2OP4L 1OTTC 4LBEA 5CEZD 1VGEH 3EYSL 1KTDA 2XXCB 1JN6B 2R56L 1MJ7L 1KG0B 3BP6A 1KENH 1BFSA 5JHDE 4DKEH 1DUYB 1PDKA 4PS4H 3QISA 4X9GA 3DYMA 3LB6D 2P48B 1IGYB 5IHUH 4XC3L 4I48B 1LMKA 5L2JA 3BMWA 4MXVE 4O9HL 3FOLA 3KGRA 4NFCA 1A6UL 2EH8L 3O8XD 1L0YA 3QI9C 4QRPA 1QO3A 5DSCB 2E6JA 4HIHA 5GZNC 1JUFA 5D2LE 5J1SC 1XGRB 5F8QC 1JHLH 4XWGL 3WYRA 3TBYB 5IHUL 1E28A 5FK9A 4U1GC 2EO1A 4YHPB 4TSCH 2WW8A 3X14A 3QG7L 1BD2E 4FQLL 1RK1A 1XGUA 2XZAL 5IMOA 5DHXB 1JIBA 3BWAB 2XKSA 4PJ7E 1B6UA 5IUSA 4K7FA 5J13C 5CJBA 4XCEA 2BNQD 4NIKB 3THML 3QUXC 3MGTA 4L8SB 4PR5B 5EZOH 3S5LB 3CXHJ 4U6YA 3BUTA 4UDUA 1JPGB 2CR6A 5C08B 1N59B 1MCKA 4LKXA 1K8IA 3PWVB 1KLUA 1LE9A 4JY5H 1NC4D 2DQTH 5D7SH 4K23L 1FLTX 3MLZL 1AC6A 1DQDH 3OJVC 2C4FU 3SGKA 1GIGH 3OR7B 4GAFB 5F70A 2M26A 3IDNB 1A1NB 3W9DB 2A9ML 4V1DE 1CVSC 4OSUL 1LO4H 3C5SA 3CVIH 4EJ1C 1JL8A 4NQEB 3MROA 4YHML 1CK0H 4JCMA 3P4MA 1I1AC 4UV4H 2RAMA 4HKZA 1NCBH 1OGAB 5FYJD 4MJIE 3OB8A 1BJMA 3SN6N 1HHGB 2F53E 1G9ML 4M6OH 4P57B 4RNRA 3MLVL 4BSJA 3LSOB 1NFKA 1DLHB 2BVPB 4IM8A 1FNEB 4XP9L 5J1TC 1RUPL 2HWZH 5HYFA 1NEZG 4FMKA 4Q58C 3VDCA 4PGCA 3SDXE 4WEBL 4WVRA 4LSUL 3VFGL 2V9RA 1W0VB 4X9IA 5CBAA 3BPNC 4XP9H 1ND0A 1YMMA 3PP3H 3LDBB 2AK1L 2Y7QB 1DEDA 1PG7H 4XPAH 5JOPE 1BM3H 2BSED 3L3DA 3KYOB 1DDHB 2R1YA 4I0KA 3L3KB 2FEEI 4HZLA 5E95B 4UQ3A 5SWSB 4BH7A 3KPOB 5IFHH 5E8EA 4B53A 4OKVB 3D18A 3ZKNC 5CSGA 3P11L 1HILB 4LLMA 3WSQL 1JF5A 4TSBL 1QSZA 4H8WL 3OKNB 5B4MC 3VFTB 2XKNA 4PY7A 2J2ZA 5DURB 3SDDD 4FA8A 4IRJB 1EHAA 1N8ZA 3WN5C 3CH8A 3O6FB 3VRLF 1HH6A 4PJ5D 5EU5A 5ESQB 1U8LA 2Z31A 3B2UC 4PJ7A 2EECA 2AEWA 4H0GA 1MHEA 5D7LD 4KKBD 1ZLUH 5I1EL 15C8H 4TPRL 4ZUSB 5HI3C 2FIKB 5C2BL 3L3GB 1JK8B 3V79C 4KTDH 4JFDE 3ZE1F 3MACH 1YY9D 4C83A 1FVDA 1AXSA 4NM8L 4HC1H 2CR3A 4MS8C 2XN9B 1N6QH 2JELL 1L0XA 2F58L 3GM0A 1RZJL 1I7RA 1A4KA 4OM1L 1K3ZA 1C5DB 3CLEL 3MLUH 2Y4SA 5J12B 1CICD 1AIFA 4OZGF 1U3JA 2NW2A 3TBWA 3ZDYE 5CP7B 4PIRF 2YUZA 2VLJD 5H94A 5C0IB 1OTSC 3X14B 4AEEA 3BYYA 4NRZA 4UT9L 3SKMA 2N1KA 1A0QL 3KPPB 4JY4A 1FFNB 3O6LL 4YO0B 4R3SA 5GRWA 5JA9A 1D5XB 3RVVC 1CLZL 5I1HL 1N5AA 3MRPB 1LEKA 1UM4L 2DKUA 4RMVA 5CBEA 1SQ2N 3TP4A 3WIHL 1BD2B 3P9WB 1IJ9A 1NCBL 4ZXBD 2K7QA 1CWVA 1WGOA 3BKCH 5D6DA 4NZDA 3E3QC 3ECBB 3TIDB 4JHWH 4OF3A 4XBEL 5ABDE 3UJIH 2DLFH 4MQ7B 1RJCA 2KPNA 3P4NA 1NCTA 3JSSA 5J0BA 4Y16D 1Z9MA 4X80H 5EOCL 4ZAKA 2WBJD 4AEIH 4K3HA 3FO9A 1UT9A 3KWWA 5LAXA 4GG8A 3ZE1E 5DEFB 3GSXB 4R96B 3MRRB 1DL7H 4AZ8A 3BW9B 4OGAD 5GRJH 5TDOA 2YA2A 5J3HD 4H88H 4Z7OE 1TCRA 3EYOA 5ANME 4EZMA 5DUBA 3WKMH 1A6ZB 9CGTA 3MRCA 5D1XC 4C57C 4LVOC 4ZPVB 4M02A 2HFEB 1VB9A 2VXUH 3MACL 1MREH 4BQBA 2D31B 4F9PC 1OF2A 4YLQT 4R8WH 4J6RL 3BIBX 4MJ5B 3WKNA 3NFSH 4H20L 4LARL 1CVRA 5DFVC 1MCPL 1IGML 5C70A 3HE7B 4X6CB 3O4LD 1CD1A 4TSBH 4GS7B 3OZ9L 2O61B 4Z0XB 3EDKA 2EIEA 4HKXA 1C8PA 4M6MH 1Q9OA 4LCCB 4R2GC 1INDH 1AGCB 4R97B 1J8HD 5E1HB 4YPGA 2E7HA 1U8MA 4D9RD 3U7AA 4KZEL 5FYLE 3F7YB 4WFED 4UINL 2AGJH 4MNHB 3V6FB 3RWFB 4DZBA 2Z35A 5GGSY 1JGLL 1VEMA 2VXQH 4LLUB 4XC1H 1RHHA 4LU5L 3WIHA 2XKNB 5IMLA 1ADQH 3Q5OA 4LLDA 5GGQL 2AABH 3RWEA 2NPLX 3MRHB 1EBPA 3O6FA 1HK6A 2WANA 3JTTA 3OKKA 5D96C 1T66C 5KSBF 1F6FB 4NGHL 3RIFF 1IAIH 3KPQA 5MEOA 4ODXA 5M94B 2JB6B 2DOCA 3RKDC 4LLQB 5DD3H 2R0ZL 5D7IE 1NBYA 3CDGA 1N7ML 1XAUA 4YX2H 4ODUA 5A2LH 1IAIL 1WAAA 5JMOC 3OSKA 4Y4KA 4EUPB 2BHZA 4W70A 1DDHA 2R0LL 1KOAA 2R1YB 4NM4H 4OZIF