3DLQR

Crystal structure of the il-22/il-22r1 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
209
structure length
201
Chain Sequence
DPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRARLTLEDIFHDLFYHLELQVQMHLGGKQREYEFFGLTPDTEFLGTIMILVPTWAKESAPYMCRVKTLPDRTWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-22
publication title Crystal structure of the IL-22/IL-22R1 complex and its implications for the IL-22 signaling mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
total genus 42
structure length 201
sequence length 209
ec nomenclature
pdb deposition date 2008-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dlqR01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dlqR02
5D1QC 3FQNA 3SO3C 4YNYB 1A7BA 3Q3GA 4JPKL 1KTRL 3CX5J 1FJ1A 1P7KB 2LVEA 3GSXB 2PCPA 4OCNC 4HC1H 5KVGL 1TNNA 2IMNA 2WIIA 3BAEL 5F3HA 1A3RL 3C09C 4XXCC 3S37H 5AYUL 3IXTA 5IB5A 3KVQA 1F3JB 5HGBB 2KUTA 2HKFL 5F1NA 2AV7B 1I3GL 4JRYE 1MY5A 5F1KC 4KV5E 2I5YH 2YD1A 3MNZB 1FQ9C 1OGTA 4R0LC 3I3EA 2OK0H 4RIRB 2EDNA 2V7HB 4DK6A 5EBLA 3NCJL 4TSBL 1NCNA 4NC1C 4PRHA 4J8RA 2CDFA 1U93B 2AGJL 2VKXA 1WUNT 3R06A 3V4UL 2PO6B 4N0UB 1CDJA 4HCRL 4M4PA 4C59B 2LFGA 4JLRA 3H9HB 2EDBA 4WFGE 1P53A 3OR6B 4HKJA 1XGRA 2HJLB 4MNQD 2APBA 1CE6A 2Q1EA 1CDGA 4JANB 4E42A 5F9WC 3UTZB 3EFDL 4W4NA 4F7PA 4PJ5B 4DWHA 1MI5A 3HAEG 1GIGH 1GSMA 4M6AA 3IT8D 4RFOL 2DWDA 3GI9L 4CJ1A 1WCBB 5ACZA 2MCG1 1U8QB 4NJ9L 4XNQB 4ELMB 3PWUB 4GQ9L 3AM8A 5CMAA 1FZKA 1E6JH 2D03H 1OAUH 4NKOB 1KUMA 3MRGA 1LWRA 5F9DC 5HGHB 5EU4B 1XR9B 4HWNA 5GRWA 1CFTB 2YMXL 2NY5H 1JK8B 2MQ3A 1REIA 4JO1L 2ICES 4G6MH 2WIMA 1NGZA 4P3CH 2VB5A 3SGJA 4RSVA 2VLJE 3P40A 4ZTPL 1WBZA 1PJ9A 1VFAB 2X7LA 4LEOB 2DYPD 3PGFH 1TQBB 1H3TA 4QF1B 2EDRA 3VXMA 2AEPH 3I6KB 5D2NE 3HR5B 2YC1A 3TLRA 3KPMA 4Q9RH 4OQTL 2QJDA 2OXGA 1I85C 5FB8A 1ZVYA 5DHVA 4JJHA 1NBYB 4XBPA 3L7FB 2EXWC 4PGCA 4EN3A 5I8EA 4JFOA 5CEXA 4XBEL 3L3IA 3RNQB 4C83B 1ZLSH 2ICWB 4GKZA 3MLYL 4OT1L 1BFOA 4N8VA 3NCEB 2Y6SC 4FABL 1LP9F 5D71H 3K81A 2YK1H 4MQ7B 3QIUD 2FIRT 1H9VA 3GSRA 3BDYL 1AXSB 2VXVH 1DEEB 4O2CB 5I1JL 2ZOKA 4Y5XB 4XHJD 3F5WB 2DMCA 5JR1H 4PPTA 5GRZA 3IS0X 3QDJD 3WE6A 3NZHH 3ULSA 5IV2A 3HB3D 5DRWB 5JA9A 2AEQL 4JFFE 4N8VG 5TPWL 4OLUH 3WLWC 1YEDB 1RZGB 1F11B 1F02I 3WD5H 5ENWB 5C0AE 3UYOD 5B38G 1FDLL 4PJXF 5F44A 1U0QA 1VCAA 1DUZB 3PL6A 4U6VL 5LCVH 1QHOA 4D3CH 3B9EA 3GFUA 1YEEL 1F90L 4WDIA 2UZIH 3ZE2E 2PR4L 4GRWH 35C8L 4PYHA 1YEKL 1T0MB 4LSPH 2P5EE 3V6FA 3RY6C 2DKMA 4JZNA 1A14H 1MAML 1A0QH 4AM0A 3O9WA 1CICC 1MH5A 3OJDA 3S88L 4QWWD 4HEME 2QTEA 2RIKA 4JPWL 5K59E 4GRLD 2W38A 1JZ8A 3C8DA 4PJIF 1G9MC 4WJ5B 4PV8A 2VISA 4NT6A 4JN1H 2GCYB 2EKSA 3IFPB 5FGBA 3HG1E 1UB6B 4WUUA 4FQHB 2P5WA 4HJJL 4R90H 3WNMA 3LN4A 2W9DH 5DLML 1ZT4B 1MJJB 5FCUH 1U91A 1T03H 3D1MC 2CUIA 3W11D 4HKBA 4M61B 4KV5F 4AEEA 2IBBA 3S36H 4NJAL 2UV3A 1QVOA 5K93A 1AHWA 2YD4A 4TUOB 1DANU 4KRPB 3AXLA 5GRVK 5I6XB 4OCMC 1AQKL 4Z95L 5IFHH 4DZBB 4PV9A 1ZAGA 3IU3A 2UWEB 4KZDH 2HVKB 3W0WA 3CCHB 2HTKD 3UTTD 5L0QC 4MDJA 5GS0C 4X6FB 4N9OB 2CRMA 4BSWA 2IADB 4ZFOA 1RIUL 4HUUB 2LAAA 2FEEL 3F58H 1XIWC 2FLRT 4PGEA 1ORSA 2BRRL 3MRPB 2DJ4A 3S34H 1KNOA 1WLHA 1HYSD 5F7LB 6CGTA 3V2AR 5K9OB 3ZHKA 5F7FA 4PJCA 5BV7B 1CTOA 1S7XB 1OWWA 2HG5B 3MNVA 4JHWL 5SV3A 2EEBA 4Y4HD 1CGSL 3VGDA 1S7SB 1RURH 1P7QD 3ZKQD 4X7CC 5EOTA 1RIVH 2CKBB 3OKOB 5B3JE 1B2WL 3FHQA 5HPMB 5DD3H 4HXAL 1MRCH 2BJML 1II4E 1S7WB 1FAKT 1CGTA 2IPTL 3IDXH 4LAQL 4WI5A 1JWSB 3VXUE 1RUAH 2CLZA 1DQTA 1WAAA 2YOCA 3OB0K 3UPRB 4UUJA 2AV1A 4J3WA 5M95B 1RSFA 4ZFGH 5BS0D 1YPZE 2ORBL 1I8IB 3FKUS 3H8NA 4BZ2H 3UTQB 3C08H 3MZGB 5GIRA 1X5AA 3B8YA 3TNMB 4GS7B 2C4FT 3QYCA 1X4XA 1NGWA 1LE5A 5T1MB 4HUXA 3B2VH 5F21B 4XPFH 2DL2A 1VERA 4GMTH 4JZJC 3PV6A 4F9PA 3QEHA 1WIPA 1OSPL 1NBZB 1K8DB 3CXDH 3R4DA 4XP4L 2Y36H 5DJCB 3HCVA 4ZUSB 3HNSH 3QDAA 4GBXC 2M2DA 3LVEA 4D0BA 5C7XH 1E4JA 3QUYB 2CIKB 1U3YA 1KTLB 3U79A 5GJSH 4H26A 3B8SA 2R69H 5JDJA 3LKRA 3QJFB 1P1ZB 5F88B 3L3JB 4Y1AB 1JGUL 3DMMD 4G6KH 2DLFL 2AJXL 2FECI 4P4KD 4ACPA 4MA3B 5EU6A 1X5YA 5KOVC 5EH1A 2R9HD 4PLOB 4LLVA 1W8NA 5JZ7D 4UT9H 1MHPH 5D93C 5IB1B 5MP6H 1IC4L 1UQSB 1S9XB 3O0RL 3U30C 2HMIC 1T1ZB 2BXZA 3EYSH 1A22B 3UPAA 4OSUL 2DQFA 1YYMH 4I3RL 5FYJU 1UFUA 3T8XB 4RZCB 1FORH 1SBBA 2KQNA 4L4TE 3BP4B 5J6GA 4WO4B 4CW1A 1OM3L 2BSED 3CXHJ 2C3GA 4KJQC 3QUML 3GSNL 4JY5L 5F7DB 3P30H 3DX7A 3KLHC 2HA1A 3JV4A 3OG6B 3BDXA 1YMHB 1KYOK 4PS4H 2L0DA 3RWCA 3WDIA 4M02A 2CSPA 5E5MA 3RVXD 3MODH 1SMAA 5B39B 2CLVB 2XTJD 5EIQA 3T0EC 1QEWB 2LAGB 1MCCA 3HE6C 3NABL 4J4PC 4U1IA 2BERA 3NH7H 4G8FB 2IH3A 5LQBH 5MHSE 3L1OL 3CDGB 1M7DB 3HKFA 4ZPVB 2RB8A 4XPAH 3BWUC 1ADQH 4OI9A 4MS8C 4TN9A 5D7IA 3X11B 5FF6A 2DQUH 4QY8A 3QFJA 1DDHA 4WI4A 3NGBC 3CFKA 3MV8E 4UQ3A 5BOZG 4M5ZH 3BKCL 5MENE 1AQDB 2VDOL 1EGJH 2PUQT 2UZYB 1KCSH 4JHBA 4OAWA 4Z7UB 4ETQB 4DFHA 3KPPB 3U6RB 3KXFE 4P2QA 4NZJA 5CGYC 1AR1C 2VXSL 2EIZA 4MVBC 3H9SA 1WBYB 1AO7B 3MRBA 4H1LH 1WWAX 2AXFA 1QZ1A 3FMGL 3SKMA 1T7XA 3BZDA 4L8SB 2Z93A 1KG0B 3BE1L 4JM2B 1CVRA 2IBZX 3NIGE 2RBLA 4PJDA 1NSNH 3EO1A 4Y16A 5F9JA 5C6TL 2CPCA 3MCG1 3U1SL 4PJHB 3N85L 5B3JF 4KDVA 3MR9A 3L5HA 5CILH 4MZ3A 3BH8A 1NMCC 5EUOE 1VHPA 1QFHA 3IKCB 3GMPB 5ILTL 3LIZH 5D9SA 3DXAB 3NIFE 3WFZA 4K23H 2FJFA 1D5MB 3BHBA 2F54A 1CBVH 1R5VA 2B1HL 3DGGA 3G6JB 4NSKB 3SDCD 2ARJQ 1IKFH 4MNQE 4JO2H 3MLUH 5I8OH 1HIML 1S7UA 3TCLB 1YPZF 5C0CA 5ICZB 4L3EA 3X13B 4OCRH 5EOCJ 3OKKA 1B3JA 5HHOB 2NY7L 5BVJA 3KPQA 5C0EA 5E8EB 3ULVL 3S35H 4UNVA 2DJUA 2ZSVA 4BM7A 1P4IH 4JE4B 4IRZH 4FXKA 4NQEA 1WWBX 3PJSA 4P9HL 2XKNB 1HKFA 2X1QA 4FQXC 3GSQA 4IHOA 4EN3C 4P2YA 5EPMB 1FLRL 4F57L 2BVOB 5IESH 1NJ9B 3FJTA 5D6DA 5D7SH 4Q97A 3PDDA 2BHYA 2V5MA 4PRIB 4M43H 5DJ6B 4XCYA 3LQAL 4DTGL 3PWPA 4Y8DC 2FR4A 2WV3A 4WUKH 2EE3A 3MBEA 4AENA 4JKMA 3MV9E 1CGXA 2B4CH 5KANI 3BMVA 4UDUB 3VG0L 4ORGB 1D5ZB 4HIJB 4KU1A 3MO1A 3TV3L 1D7FA 4X0KA 5J0BA 4WCYH 5IUSA 1KFAH 2Q7YA 1JPFA 4OV5B 4X7TB 2P44B 5SV4A 2H32B 4QHKI 3JUYA 4KI5D 2XZAH 4LCYA 5I1EL 1B0RA 2VIRA 2BVQB 3T3MF 5FKAB 3BZEA 3O4OB 3VDCA 1S7TA 4E41B 1NDGA 1UADC 3WIHL 1GHFL 3L5WA 3DYMA 4Z0XB 4XC3L 4CNIB 1PX3A 2VDQH 1U8IA 3LKSA 4IRJB 3ARGB 4AZ8A 1L0QA 1FIEA 1N5AA 2GUOB 1TQCC 5IBUB 4HK3N 5GGRA 3U83A 4OB5H 4G8GA 1JHLH 4PJ9A 5H35A 3QDJE 2V2TB 5DD5H 4XPBL 1T7ZA 4UOW1 4OLXL 1QRNA 2D31B 3O9WC 1LQSR 5HPOA 1FV1B 4HWBA 1J0JA 1JRHL 2AJSH 2ED7A 3DUSB 5EUKA 4NBZB 2VDRL 2VTFA 1EHNA 4I5BA 3AY4A 3GBMH 4PP2A 2ILLA 4OZGB 4G9FD 5BZDB 4NZDA 1P5UA 1BD2D 4MXVE 4P57A 4IDLA 5IKCB 3OWEA 3UTSD 1WIUA 5J12B 3RIAK 3O4LA 4KHTH 5FGBC 1Z9MA 1R0AH 1T0NB 3RWGB 3ARDB 4FZ8L 5E1AB 4F33B 1YYLH 4OLWH 3UJJL 5FOJA 3KYKH 2J8UB 2WBJA 1DLFL 1JZ4A 5JW5A 4ENEC 5KSBB 5FYKU 2NXYD 4HUWA 5EFIB 3PWLB 4LDEB 4RDQF 2NR6C 3EYUL 1WC7A 3S5LB 1IEAA 5C3LD 1T2QL 3T3PF 1MAKA 1A1MB 4HKZB 4MA8L 2ZCLH 5HYSG 1SEQL 3WKML 5EC1B 4PR5A 5DJZA 4CN4A 4XVUC 5C0FA 4L3CB 1URLA 2AQ2A 3OAZK 1FL3A 4FFVD 5F9OL 1MJ7H 1R3KB 1IMHC 3M17A 4JFXA 1LDPL 4N0RA 5CKGA 1I7UB 3MUZ1 4TQEL 5CP7A 3NIGF 1UWXK 3IXAB 5JLZA 3OHXA 1V7MH 2R0WH 3TPKA 5JMOC 1M05A 3PABA 2A2QT 5I16A 4WU7A 3WNOA 3VXSA 3O3AA 1NL0L 3BZ4B 4KAQL 4KJWD 2JF1A 1AD9A 4Z0BL 5BRZD 2QSCH 5HDQL 4XPGH 1RPQA 3BPCA 4A6YH 2VWEC 1GOGA 1KN2H 1U6AL 1U8LB 1P84J 5EUOF 2UUDH 1N2RA 5D7JC 1P4LA 1KJVA 3UTTE 4D0CB 3GZKA 1ITCA 1CLZH 4ERSH 1IARB 2FD6L 4JFPB 2FLBT 3D9AL 3C60C 3MOBL 4F7MB 1QBML 4MA7H 1JGEB 4PRDA 1J8HA 3P77B 4K3HA 3CZFA 2PW2B 2J4WH 4HKJB 2P43B 2ESVD 5D1ZB 4GT7A 1VGEH 3O6KH 1MVFA 4LQFH 1KIUA 5A2FA 3EOYG 4GRWB 4P0DA 3QI9D 3N06B 5DJ2B 4FNLL 4JKWA 3QIBD 2FYYA 4O5LH 2NY2C 1ED3B 5T1KD 2RJMA 1QA9A 1BREA 4M1CD 4LVOB 3F62A 2EEDA 4LCCA 1I75A 2NXZD 1OB1B 1VEOA 4OD2B 2BP3A 5KAQF 3G9VA 2NY1D 3KYAA 2EDJA 4LBEB 3HRPA 2CGRL 5IW3A 4U1GB 4TSAL 5C07D 4O58L 5ISZE 1SM3H 5HGAB 5EZIL 4HUMB 2NYYC 3ZKMD 1I8KB 5BS0E 4OF0A 1YEHL 2D0GA 1SVZA 2DIBA 4Y4FC 2DM2A 3JBG7 1S5HA 5FO7B 2EXYC 2EIEA 3WEXA 1IVLA 2NCMA 4L8DB 5IFAH 3TNNB 5GS3A 2YEZA 3GJFH 4ONFL 3SJVB 1KC5H 2QQLH 5IB3A 2ARJA 4ZAKC 1HEZA 3EJYD 2X1XR 4N0FA 4Y2DB 1JNLL 1ZV5A 3V79C 5IEKB 3SE9L 3QEUB 5KSAC 5E24E 4R2GD 4KUZH 4HPOH 3ZTNH 1MOEA 4JJ5B 1TCRB 4ZOCA 1J0KA 2K7QA 3V6BR 1NFIB 5HHQA 4AEIH 4J2XA 15C8L 2CQVA 2WANA 1KTDA 2I07B 2KL6A 1LO4L 5E7BA 1QNZH 1QSVA 1ZGLA 1AKJB 4X5XA 1MHEA 1J87A 1EJOH 3ULVD 3F7QA 1DQQA 5EOQL 1IGIH 3CDCA 4IMLB 5BQ7A 2ITCB 1F13A 3OF6A 2EDEA 4MXVF 3QPXL 1RK0A 3VXRD 3PL6B 1BVLB 5F97E 2CDGA 1A8JH 1T5WB 3EZ8A 4XAWH 5E8PB 3STZB 4WI3A 2X70A 4MD5B 4ZG1A 1KIRB 5JPNA 2CK0L 3OZ9L 1H0DA 2VLRB 4KROB 2YPLA 4RCAA 1DBAL 4X4YA 1FZOB 3H7BB 3WL9A 1BP3B 1C08B 4NQXA 3RHWF 1HCVA 2DQEH 2X4RA 2CRIA 4NDMB 4DKDC 5F93C 5A1AA 1RUMH 1CIDA 1CD0A 4P59H 4X4XA 4HIIA 2NTSP 3DRQB 5E4EC 1OTSC 3AMKA 3RL2A 4NHUA 3TIEA 3JV6A 3T4YB 4YQXH 2YWYA 5SX4I 3VH8A 2DD8L 4Q58C 4S1RL 4XP1H 4XC1L 1T7VA 3B3IA 3JTTA 3QUZB 2XTJE 3BW9A 5IBTH 5IFJA 5EULV 1IGML 2BNQD 4UB0H 2X4TB 1QTYT 1RZ7L 1SYSA 5E6IB 4CL7A 3TZVD 1KB5L 2W0LA 4G43A 4QHUA 3MCLH 5J1AA 3I75B 1B4JL 1G9NH 4JRWA 2V9QA 1KJ2A 1Q9OA 1U91B 1RFDH 4JFEB 4KMTH 4JDVB 1NKOA 4JO3L 1A7QH 5E8OA 2F53B 4L4VD 1JHTA 3ZDXE 2J8HA 1RUKH 2X4PB 5FA4A 1QVOB 2XKUA 4P5MB 1RJZB 1CFNB 3BH9B 1NAKL 1C16A 1X4ZA 2YUZA 4R3SB 1ZK9A 4LMQE 4IS6A 4OIIH 2D0FA 5DVNA 1AFVL 3LEYL 4NWUL 3ARXA 1JVKA 3MGOA 2A77H 1TZIA 3MRLB 4MNHB 2AEWA 3MX0A 4OZHA 4LLUB 1WEJL 1IGTA 5HYJA 2VLKA 4HWEL 4ZQKA 1EEUA 2C3VB 25C8L 5I75C 2YD7A 2BVTA 2CO6B 4N5UA 3L95B 4GW4A 5E2TL 2JB5L 5DJYB 2NLJB 2E8ZA 1RUPL 3ORJA 1AGFA 5IG7A 1UACL 5DQ9A 2IH1B 4PJIB 1CU4H 3D39E 3GI8L 1WZLA 3QULA 1JWMB 2VJXA 3GHBH 3RDTD 5TDPA 4BSVB 3SE8L 4PJFE 2Z8WC 4PG2A 2GSGA 4AG4L 3P4NB 4M8VA 5ID1B 3ZDYF 1N64H 5FYLL 4M6NH 2F9BT 1S7RB 4GLRI 1CT8B 5JMRA 1LO5B 1SBSH 5IGXL 1GH7A 2R0ZH 1N0LA 3ZZ1A 4YR6A 5KVFH 3RWEB 3EO9L 3WV0A 4MLIA 1L7TL 3G5VB 4ZS7H 5D6DC 3MA7A 5J9PA 1EAPA 2J7LA 4ZNEE 1V3KA 4NCC2 1C5CL 2HFGH 1DQLL 3PP3K 5IMOA 5LXGL 4FZEH 1D6VH 1YNLH 2XZQH 3QXAA 3HR6A 3ESUF 5EB9A 3QO0B 1S3KL 3WFBH 2DDQL 2DQDL 4JG0L 4TULH 1L7IH 4KDWA 2C26A 3AMLA 2X40A 3S9DB 4OKVA 5IHBA 1WV7T 1AJ7L 5CP3H 2G75B 5CBEB 3SPVB 4WW2B 4KKNA 2P8PA 4GMSL 5D8JL 1MCOL 3KDMA 1B6DA 2J5LB 4HWUA 2ID5A 5C08D 4JRXA 4XNZB 4WI7A 3W81A 5GSRA 1FAIH 4RMUA 4PJ7A 3TA3D 4YZFE 3MJ9A 4R7NA 4H1LB 4K9EH 1IBGL 2B5IB 4MHHI 3BX7C 5T1LD 3P0YH 5IB2A 3DUUA 2NY4D 4DJMA 4U2YA 2P7TB 1YECL 4LSUL 2ZUSA 5EU3A 2Q87A 3U46B 4Y5XC 4G42B 5DD6A 1MY7A 2VLJB 3OKLA 4KI5E 4UV4L 3CFEA 5K9JL 3ZO0A 4QRTB 1FNGA 3OAYK 1HXYA 3VMOA 2BVPB 4U1NA 2EYSB 3MRFB 4WHDA 3O45B 2YZ1A 5D2NB 4JG1L 5KVEH 1NLBH 4YGVB 4HS3B 3SKJH 4C54A 2Q76A 3QXDB 4I1NB 3MMEB 4CW1B 3KPRD 3VRIB 5DUBA 5F7WC 3KPLA 2R4RL 1MRFH 5ID0B 5ERWA 3WFEH 2XQBH 1A7PH 4ONHB 4YBQD 5ESAB 3MV11 4ESKA 2VAJA 5C09D 1AGEA 4J3UA 4G9FE 1BD2E 5DF0A 4JKLA 3UTSE 4IRSA 1IGCL 5IMMA 4LHUB 1JYWA 2IPUG 3H3PL 4NBXB 2AK1H 2Q7NA 4JFFB 5IBUG 3BD3A 3DROB 3ZDXF 4PLJC 3I6GB 1FIGL 4MMXC 5C0AB 1TZGL 1ZHBA 5IJVA 4QEGA 3PNWA 4QY8B 3SOBH 3VWJB 5IBLD 4X8XA 1GJIA 2VLLA 2WWKO 3MV01 3VFRB 1A3LH 1KIQB 3DSFH 1BOYA 2FJGA 4CBPA 2D9QB 3NFPA 1I1AA 1T1XA 3BVNB 4DUXA 4XH2A 1PSKH 1J1PL 1T83C 4JCLA 2P5EB 3KYMA 3MRKA 4KRPC 1HH6B 4TVPL 4MAYB 5I6XC 1F4XH 3QUXD 4XNMB 4TPRH 1EDQA 3PGDA 4NN5B 4LF3A 4MJ2A 4X7SL 5LGHL 2R1YA 4JPKH 1G0XA 4N1CA 3MLSL 1BFVL 3S5LG 2Z31D 4PJDB 4F7CA 4PJFF 4FQQA 2H45A 3MLRL 1GC1L 3OKMA 1RZKC 4KKAC 4P5TA 3MRRB 3FFCD 3V6ZB 1U8JA 3BAEH 5KVGH 3HG1B 4LMQI 3VFVA 3BRDA 4O2FA 1A3RH 3K0WA 3VWKA 3FB8B 5AYUH 2HKFH 1P2CB 4JFDA 1I3GH 2F5AL 2IPKA 4Z18A 2K3TA 4H25B 4MJIA 5FFLA 2BSTA 2I25N 4UAOB 1A2YA 1N6QL 2Z4QA 5IWLA 4Y88A 4YHML 1DLHB 3NCJH 4LCCC 4TSBH 1DVFD 4Y0GA 3IGAA 1Z0NA 2AGJH 2O61B 2O5ZL 2CKNA 3VXTA 2ESVE 1G0YR 3V4UH 3FFDA 2XNAB 4HCRH 1QKZL 3O8XB 4OZFH 1EXUB 4P2OB 4NQCD 4HG4J 2OMBA 2ZUWA 2ZSWA 2FZ3A 1PG7X 5INCB 1YY8B 1P9MA 5I1AB 3EFDH 3DOSA 1XZ0B 4FXKB 4J6RL 4MD4A 4NQEB 4I48B 1LEKB 5D7LD 3OB0H 4HMEA 4RFOH 1J11A 3UAJC 2VDML 3GI9H 2W91A 1Z5LB 4XMKL 3VFOA 4NJ9H 1H3XA 3MFFB 4GQ9H 3VFTB 4MLSA 5IB4A 3GMQB 5HHMD 1DQJB 3F6LA 2J2ZA 3RGVB 4YZFF 2YMXH 4V1DD 1CG9B 5C0BA 3SGDH 4DVRL 2FR4B 1OQXA 4JPIB 2GJJA 4JO1H 4OUOA 3LEXA 3UCRA 2OZ4L 5JDSB 3QUYC 4NM4L 2DLEA 1SJEB 2I9TB 4X9BA 4ZTPH 3AS1A 2X1PA 4PBXA 3X17A 4KI5F 1A4KB 1KSRA 4C4KO 3WFCL 4WEMB 3QNXA 1LEIB 3E6FA 4HFUL 5DMJB 2C1PA 1MQ8A 43CAA 5FYLD 4A6YB 5JHDD 1YPZB 3D25A 4OQTH 1XF5A 2P45B 1YZZA 5F89B 5D96B 2K7PA 4XBEH 5I9QB 2LTQB 2FEEI 3LKSB 3TIDB 4N0CD 5HGDA 3MLYH 2YPKB 4OT1H 4WTZA 5IVXE 4KK6D 3SKNA 3V6OE 1HHIB 1M1SA 4ZXBA 1W72A 3MYJA 4FABH 2R4SL 2GHWB 1GXEA 3ZYIA 3MRQB 3ULVE 3BDYH 4OCSL 5I1JH 5C0GB 3V4VL 3OKDB 1DN0B 5EUKB 4HJ0C 1EK3A 3VXRE 3IYLW 5CEZL 3F7VB 4I5BB 4G80A 5DQJB 3PQYD 2AEQH 2IANA 4P57B 5TPWH 2I9LB 1JV5B 3K4ZA 5SWQB 5KS9B 3RWIB 2DLGA 1FDLH 2MCPL 3RPIA 3MLWL 4U6VH 3VFPA 1CDUA 3L9RA 1YEEH 1F90H 1NFDB 5ELIA 4QO1A 5KBNC 2PR4H 1BFSA 4WTXA 3GMNB 4HUWB 35C8H 4V2CB 1YEKH 3OKEA 5C1MB 1WVZA 1BIIA 3ARUA 3OGOE 1B0WA 3SDAB 2R2BA 4DEPB 1MAMH 1SYVA 2BNQE 5IIEB 2BSSA 3T0AA 3S88H 1LP9A 2CH8A 3AS0A 4HX1A 3FB7B 5J13B 4JPWH 5L8JB 1F8TL 3EYOA 4HGWB 4P23D 5E99L 1M4KA 3GJFB 5HI3C 3RTQB 4KC3B 4CVZA 4DUWA 4FFWD 1E4XL 1O7SA 4L4VE 5CP7B 1ZEAL 1MIML 3WNKA 5L6YL 1J8KA 3FTGA 2V17L 3MROA 4N68A 2GW5A 4HJJH 2H26B 3OKNB 1I7TA 2Z8SA 4I0PD 2FX9L 2GSIB 1QO3B 1PQZB 5DLMH 5DMGC 3ARFB 4U1SA 2DQIL 1QACA 4L8SC 4YHIB 2EDFA 3O6FD 2IAMC 4DVBA 1HXMB 4PJXA 1CGUA 4JGUA 4NJAH 5BCAA 4WRLA 4P99A 3UBXA 1J05B 1F2XK 4PG2C 3RKPA 5E6ZA 4U05A 1FNEA 4X5WB 1AQKH 4EI5A 5I2IA 3MV8B 4Z95H 2P47B 1D9KD 5GSVA 1MHHB 5MENB 1AGBA 3EYQD 2YSSA 3DJ9A 3LPGA 2W9EL 4DKAA 4R4FL 2CRZA 3GBNL 5IR1A 4WENB 3KXFB 1YC8A 3TP4A 2ADGA 3E3QC 3IU4L 5FK9B 3VRJA 2ICCA 3UBXG 2E5EA 1QLFA 1PGRB 1RIUH 5EO0B 3DO3A 4NP4L 4O2EA 2BRRH 1D5IL 1TNMA 2P8LA 3EDJA 2NY0D 1OTUD 1G6RB 3BQUD 3UDWC 4FP8L 3PP4L 3OBAA 1CCZA 4O4YL 1JP5A 1XF2A 4YWGL 5C6PB 1YUHB 2EZ0D 3PWJA 3TO4D 4JHWH 3U4EA 4ELKB 4RGNE 4RX4D 1IFHL 4JRYA 4Z7WE 4TVPD 3MBXL 4LRIA 2ICWJ 1OLLA 2GJ6A 2XWTA 4NO0D 4M1DL 1WCQA 3D69A 4JDZA 4PTTA 3IDGA 4YHOL 3MGTA 1B2WH 4I2XA 1TVHB 4HXAH 2BJMH 1LMKA 4LPCA 3GJEA 4U4BA 5FYJL 3UYPA 4XP6L 2R1XA 5EUOB 5GS1B 2IPTH 1RMFL 3RVTD 4LAQH 1S7QA 4YBLC 3EGSB 4XGZA 2OTWB 3BIBX 1I8MA 4XI5C 1ADQA 4MNQB 3SGEH 1GZPB 2VQTA 3VD3A 3I6LD 3U7AA 1OGAA 2ORBH 4JFQA 2A6DB 3QDHA 1HQ4B 4NRXB 1BQHB 4M7LL 1MNUL 2AABL 3MRDA 5E00B 3HHRB 3RUGA 5E94A 5C08E 2IEPA 5EZLB 5L8LB 2QL1A 4L29B 5JPMB 2DMBA 2LV4A 3ZDZF 1OSPH 4XP4H 2XQYG 1MCPL 3O4OC 3VI3E 5JNYB 3ULVF 3HN3A 3FQRA 1PG7L 5CWSA 3ARGC 1AXTL 4MZ2A 4RISL 4ODWA 2JK5B 2VXQL 3KG5A 1MHEB 3P73B 5IMKA 1UWEL 1JGUH 4DCQB 4LRNL 3MV9B 4LK4A 1MJ8L 2AJXH 2DLFH 2DYPB 3O3EA 4OF7A 3IF1A 5FHAL 3C87A 3SE4A 3NN8B 5CZVL 3IDJB 1DQML 1BLNA 4M6ML 2Z91A 1BZ7B 4YXKL 4H1LG 1IKNA 2C1OB 3O3BA 1IC4H 2PO6D 3TO2A 3O0RH 2ZUTA 3KPRE 1BWMA 3GNML 5J12C 2FEDC 1EIBA 3ARDC 4X4XB 1YN7A 4I3RH 4L4JA 4RFNC 2DRUA 4NHUB 1H5BB 5A2LH 3TIEB 3QIUB 3O81A 4K7PX 5C09E 3N0PB 4KK8D 1OM3H 1AGDA 1Y18A 1HHJA 3QUMH 3GSNH 2ED9A 4JY5H 4HV8A 2PKDA 1Q94B 3QDJB 5T1DL 3T0XA 3VXPA 3ZHLA 4BFEA 3SN6N 4JDTL 4O00A 4KMQA 4U3XA 3NABH 4NCC1 2G60L 3L1OH 1HSAB 3OAZH 2B1AL 3RBSA 5F1IA 1D3CA 3U9UA 2LU7A 1M6OA 2UYLA 2XZCL 3CMOL 4P5TC 5EU7E 2JCCF 3ARQA 1V7NL 1UWXH 3AS3A 3MGOB 5TFSL 4LHUG 4RAVA 3HZVB 2MPAL 2A9NL 4UBDC 3QXUA 3BKCH 1IGTB 3W5MA 2VDOH 1H3WM 4ZQKB 3E8UL 5DRXB 1U8PB 5CEZD 1VGKA 2J88L 1KJMA 1OT1A 4O51A 2ICEB 4GRLB 4PGDA 3EJZC 3OV6A 4QTHA 2AXHA 2VXSH 3KYOA 4Y5YA 5IHUL 1NEZB 4NQSA 4X99A 1BAFL 4LPYA 4XXDA 1TZHA 3FFCE 4M7JL 1WJ3A 2GI7A 3FMGH 1QQDA 3W39B 3S4SA 4GXUM 1Q9KA 3FL7A 3BE1H 1UXWB 5CSZA 5CHNB 5DZNA 2VZUA 3F7YB 3GMRB 1JRHI 1P9MC 5C6TH 3RX5A 5GZOD 4QHNB 1I7ZA 4Z7WF 3U1SH 1MVUB 2QSQA 2VAAB 5EA0L 3MGAA 3LD8B 4LVOC 3G5YA 3N85H 4LNRA 1T21A 3SE3A 3U0PB 1YNTB 4TNVF 4HIHA 1IILE 2R1WB 2OI9B 4KPHL 3S4SG 5GRYA 3UTTB 4NQCE 1OAYL 4U1GC 2B1HH 2AK4D 3A0OA 4UIMB 3GMOA 5I76A 1DL7L 4KQ3L 3CXHK 5JORB 2QSTA 3BT2L 3GIZL 1UWGL 1HIMH 5TH2A 5F3BA 1HDMA 1IQWL 3SHSA 1FCCA 1W8OA 2W0FA 2NY7H 5JIHA 4OKVB 5EC2A 3ULVH 4OKDA 5CGTA 2Z35B 3QRGL 1DZBA 1ZMYA 1J0YA 5HHME 4NM8L 4P9HH 3EBAA 1RZIA 5HI4D 1BQSA 4J3VA 5EBMB 1A9EB 3MLTB 4S1SL 4FMFA 4V1DE 1P7QB 1VKXA 3VI3F 4Y2DC 5JTWA 1I9RL 1FLRH 4F57H 4Z76A 3BXNA 5CUSL 1C5BL 5GGQL 4OI7A 2AXGA 4NC0B 5FYKL 5JOFB 2HWZL 3LQAH 4DTGH 4ZXBC 4X6DA 3NCBB 3CH1A 3WUWA 3G6AB 1U3ZA 2AEIT 5ISZB 2HRLA 4LSRH 3MREA 3B9KA 3BP7B 3VG0H 4B41A 5FYLE 3FB6A 5JHDE 5BS0B 3HMXA 3TV3H 4BUGA 5ITBL 3TGXA 3ARRA 3TN0A 4WIQA 1KPRA 4Y19D 1KIPA 4ZO8A 5DK3A 4KRLB 2YS4A 3MRNA 5C0DB 5HJ3A 1GGCL 3FRPA 3DV6B 5I1EH 4XCNB 2Q76B 3RI5K 4E0RA 3MXVL 3OGCA 4WFED 5FYJD 3WIHH 2AQ3A 2B0SL 1GHFH 4XC3H 3N1QC 1CLYL 2XA8L 4OZFB 1QLRA 3QNZA 2XWBA 3EHBC 1ZHNB 5IOPB 5C0IA 1AGEB 3CIQA 3KNBB 3BIKB 2F74A 4XPBH 1T80A 3PQYE 5DK0A 3FRPG 4OLXH 3RY5A 2FH8A 2VDNL 3DMMB 2CUMA 1T0PB 1JRHH 2VDRH 3ROLA 4F15B 3T2NL 5ICYA 1CGWA 2V2WA 1JNHB 4XWOC 3GRWL 2FIKA 4OGAC 5IJVB 1UZ6E 2XN9A 3RNKA 1X6LA 1U36A 2VLLB 2VOTA 3NPSC 4FZ8H 4ODSH 4X98B 3TH4T 4F8QA 1ZHKA 4GSDL 5TGBA 1VPOL 3UJJH 3BKML 1DLFH 4UI2A 4GG8A 3SDXE 5CS7A 5A3IC 3EZJB 2R0LL 2FNBA 4YO0A 3V8CA 2B39A 4LVNB 3KYMB 4L4TA 3EYUH 4N5EC 5FM8A 1T2QH 1H3PL 3PE9A 3D5OF 4MA8H 4NRYA 2H2SC 3QHZL 1SEQH 4QRRB 3WKMH 4LF3B 2H3NA 5SWZA 3VXQA 1U41A 3KLAA 1R5IB 5C9JB 1EEZB 5F9OH 5A16B 2XTJB 2P4AB 4ZD3L 3O2DL 1LDPH 1DBJL 4NQUA 4TQEH 4B50A 1OOAA 4P46A 4K7PL 3G6DL 3VWKB 5LBSL 2X4OA 4J1UA 3O3DA 1NL0H 4Z7VE 2VN4A 4KAQH 4Z0BH 3O2VL 5F7MC 5HDQH 3KYNA 2XFXB 5IVZB 3WS6A 1U6AH 4PJGE 3TVMA 4YPGA 4XCEB 1HINL 3IGAB 4GFTB 4X6BB 2BX5A 5E8NB 1WIOA 5TF1L 1K4DA 2FD6H 2NNAB 1MFBL 4LRIC 3V0VA 3D9AH 5L2KA 2JJTA 3HLAB 3MOBH 1G1YA 3DETD 1QBMH 2Y6SD 1MF2L 2RQ8A 3RX8A 3HPJA 3H9YA 3ZHDA 1LE9A 3Q6FA 2KKQA 4MD0A 4DKFL 1WT5C 3HE7C 5A2KH 2HLFC 4WO4D 3ZKND 2E6PA 3CSYA 2NX5D 4FNLH 1JYVA 5F8RC 5ICXB 3T09A 3E0GA 3D39B 4TVPE 4RDQG 2P46B 4NKMB 4I4WA 1RULL 5J89A 2DN7A 3ZSTA 5GISL 2AJZA 4XZUA 4BK4A 4LGRB 3SCMB 4XNZC 2CGRH 4TSAH 3LEXB 2EDQA 3DIFB 4O58H 4MNGA 1FFRA 2V2XB 4Q6IA 2EH8L 4FN0A 5EZIH 4F7EB 3IFOA 3CSGA 3I6LE 4D8PA 1YEHH 2AKRA 3QZWA 4WGVB 5CD3B 1TTUA 1MRDL 2C1PB 5E2WL 4ZO9A 5LVEA 2AJ3A 1XF5B 3NTCL 1S9WA 1W0VB 4S1DD 5J3HD 4RMSA 1FL5A 2H6PB 3K2UL 4ONFH 4GW1A 1ZT1A 2HFFB 4OF8A 4HXBL 3RZCA 5JXEC 5HGDB 2BOBA 1BZ9B 4JPVL 1PG7W 1JNLH 1ES0A 5D2NC 3SE9H 3OAYH 3VFGL 3QFDA 2PYED 2W9LA 3LQZA 5BJTA 4U0QB 3VD9A 2HJFA 4EJ1C 15C8H 4OFDA 2CR3A 1JIBA 3FT3A 2VYRE 4JM2D 2XV6B 1LO4H 4OUUA 5F1OB 3MRMB 1XGPB 4ZUWB 2GK0B 1EHLL 4U1JA 4UU9B 1J7VR 5EOQH 3GKZA 1KCUL 4JO4L 5DC9B 1Y0LB 1U95B 3D18A 1UA6L 4QLRA 2BXYA 3QPXH 3EOAA 3TPUB 1UZ6F 3FO9B 1OQOA 2QR0B 2UY6A 3C6SB 5KAQG 3CFDA 5DK2B 1MWAA 4E5XA 1IM9B 2X89A 1R3JB 5DJ8A 2EYTA 1T3FA 2E9BA 3P0VL 2FDBP 1L6XA 2CK0H 3OZ9H 3TH3T 4AQ1B 1XGYL 1PFCA 4P48A 1DBAH 2ZOLB 3DVFA 4OCYL 5FYKD 2XRAL 2ERJB 4AT6A 2WLZA 3S96A 4NO5B 4ZFFA 5HSFA 4KJYA 1CN4A 1WQVT 3KWWB 2B4CC 2X44D 2ZUVA 3QCVL 3EYOB 1DQDL 2DD8H 3DX8A 4PRPD 4S1RH 4XC1H 1MCWW 4IMKA 1A5FL 1NMBL 4MAYC 3MNWA 1IGMH 5J1TC 5E9DA 2V7NA 1I4FB 3REVB 4FQ2L 5CIPH 1NAMA 1RZ7H 1PD6A 1KB5H 4AIOA 4IOIB 1DBKL 1MLBB 4AMKL 1BD2B 1B4JH 2A6JA 1LK2B 2H2PC 4UT7L 3UTSB 1CL7I 5KG9A 1R3HA 1FHGA 4JO3H 2NQCA 3IDXL 1QPPA 1CXHA 1XCQB 3C6LD 4Y4KA 4F2MA 2DQCL 1FZJB 4LPWA 1OP9A 4OZ4A 4PJGF 1NAKH 1MFDL 1I1FB 5JHLH 2NXYB 1IZKA 3G5ZA 1GGTA 1CWVA 1WFNA 1PVHA 1AFVH 3LEYH 5CEZE 1C7SA 4EI5B 5I2IB 4NRZB 4NWUH 4JQIL 1XGUB 4NPYB 4XT1C 4UAOC 1RZ8B 4ZMAT 3OXRA 4OCWL 1WEJH 4EKXA 1H8OA 3RKDC 4HWEH 5AUMB 3O11B 5IK3A 25C8H 5C86A 2ZJSL 5CCKL 1XF3B 5EO9B 2FHCA 4YFLI 5E2TH 2EEAA 2JB5H 5D5ME 5EZOL 3VRJB 1RUPH 4OD1L 1QLFB 5HHXL 3D6GA 1JNNL 5CEYA 1UACH 2P8LB 1S9VA 3HZMA 3O8XC 2ADJA 4IRJD 1YDPA 4P2OC 3FONA 4ZUUA 3REWA 2W60B 2L7UA 4MJ5B 2PTTA 4CADB 3GI8H 3M45A 4YDLB 2C7UB 4HWZB 1Z9SA 2XWJB 5FUCE 5AEAA 1GAFL 4HSQA 1MCDA 2APXA 3SE8H 4I0KA 2EECA 3T65B 3TCXA 2HFTA 4AG4H 5BRZB 1JI1A 1Y6MR 1NEZG 3PGCB 1G7IA 5FYLH 1D5XA 1U3HB 3QUMB 4ZPTA 3GSNB 1X9QA 3QEQD 1CD1A 4UTBL 1TTGA 5FAAA 5IGXH 2XICA 3CFBB 4QOKD 5EBWA 3VFNB 3KPOB 4NUJB 2AK4E 3MJ8B 1HKLL 1MFAL 3T1FB 5B4MD 1ZE3C 3FO1A 1HILA 4ZFOL 5J6HB 2XOTA 1YY9C 4ODHL 2P48B 3JWDL 2VL5A 3EO9H 2ZNWA 4ZDHB 5DI8B 1L7TH 4W4OC 3EYVA 2BNRA 5EU5A 1C5CH 4R4ND 1DQLH 4FTVA 5LXGH 3OMZA 3RWHA 4GKSA 1S3KH 4BH7A 2DDQH 1S78C 1IM3A 2DKUA 2DQDH 1OAQL 3QI9B 4JG0H 4OM1L 3QIBB 1NQBA 3IETA 1T5XB 3ZT5A 4BUHA 1FYTA 3QWQB 1AJ7H 4ZYKB 4Y4HA 2NXZB 4GMSH 5D8JH 2AI0L 1MCOH 2E8YA 2HLAB 3LSOA 1XGTA 5C0NC 2XKSA 4X6CE 1T1YA 1DTUA 5D96C 2ITDA 5ADPL 4DGVL 5I9QC 2LTQC 8FABA 1ACYL 1UM5L 4LLQA 3FQTB 3B5GA 1UCBL 4EZMA 1JTPA 1U92B 1OTTC 1IBGH 4JVPA 4XRCA 2QKIB 1AR2A 5JW4N 3IRZA 1TVBA 4U1HB 1YMMA 4F9LC 1ND0B 1YECH 4LSUH 4Y19E 5DFWH 3D3VA 1OD9A 2UWEE 2Z91B 4UV4H 5E95B 3VFUA 4C57C 5F7NC 4C58B 5K9JH 4ZFZB 4KXZH 5C92A 4NNXB 2HVJA 2HJKB 4PJEE 3NCMA 1HCFX 2NZ9D 5CJXA 4HLZH 5GHWL 4AJ0A 2LE9A 4WFEE 5FYJE 4U6XA 3MUY1 4S2SB 4JG1H 3C5JB 5ETUA 5H8DA 3CUPB 5D1ZD 2EDXA 4HK0B 3LY6A 5BVPL 3O6ML 3AAZB 3WDHA 5IVXB 2R4RH 2J1KA 1MI5D 3HZKA 4DN3L 4HJGB 1QBBA 4AH2A 5ESVA 2WSKA 4B5EA 5MEOB 4OQ1A 3QQ3A 3SDAC 3BGMA 4KGLA 1DUYB 3KHOA 4DEPC 4P4KA 5DEFA 2VC2L 3GSVA 1WICA 2VITA 5FM4A 5J57B 5DWUL 1KPUB 4XVTL 1QFOA 3VE0A 1IGCH 3ALXA 5CZXC 3RWDA 3DTXA 3H3PH 2Y9RT 1FG2A 3PHOB 2FECL 3VXRB 4OZFG 2JKXA 3RTQC 3Q2CA 1G1CA 2Y1VA 3BP5A 1A4JB 1CR9L 1FIGH 2UYLB 3MQIA 3VG9C 1TZGH 1D6EA 3FO0L 2KZ1B 3QBTB 3GUTB 1Y6NR 1TPXB 4KQ4L 4ZSOE 3IJSA 1A1NB 3ARFC 3W5NA 4XBGA 4RAVB 5TE7L 3KJ6L 5H37H 1EUUA 1OWRM 2YBRB 5KW9L 3ARBB 5KTEL 4JY6A 5JOPD 2XPGB 3HFML 2GAZB 1J1PH 4TVPH 3QDGA 1W0WA 1BJ1H 5E03A 1LHZA 2BNQB 5T3ZL 4OQTA 1MFCL 3WJLA 4D9RD 3TZVB 4YDVB 5HHPB 1T04B 3AREA 4GKNB 4X7SH 5LGHH 4ZO6A 5DMYA 1K2DB 2FL5A 4MAUL 1BFVH 1ONQA 3MLSH 4MQTB 2JIXB 2OJEA 3MLRH 1GC1H 2W65B 2QQQA 1LEGA 3QQ4A 4LDLB 2R0KL 4QHMA 2FJHA 3F6IA 1AE6L 4AY0A 3VXNB 1QLEL 4RA3A 2F5AH 5I1LB 2DJSA 1N6QH 3P9WB 2MTPA 4YHMH 4LIQL 3QH3A 1EEQA 2V5TA 3N1FC 4PTUA 4AYFA 2RCSL 3PL6D 1MCQA 2O5ZH 5HGGS 5I76B 3GMOB 1U8KA 2WBKA 3F12B 4LNVA 4M8QA 5JW4Q 5BXFB 1EH9A 3K8KA 2B20A 1QKZH 5TH2B 2VLRD 1HDMB 1G9NC 2XACC 4HLJA 3JXAA 2NX5E 1ZSDA 5GZND 1I9EA 1IAOB 2ENSA 1B6UA 3MRIA 3O9WD 2X9XA 5KZCD 1Z3GL 4NYLB 3RDTB 4X83A 1RQ5A 4J6RH 4K3DL 4OZIE 1ZA6A 2X4NA 4PG9B 7FABL 3BI9X 4HZLB 2VDMH 1MLCB 5CBAA 4PJFA 4XMKH 3QUZD 4X6CF 3D2UA 1XMWA 2BSRA 5E6ID 5ACMA 3EFFA 3FQWA 1UJ3B 4HEPG 4WUUD 1IZJA 4RGNB 2ZKHL 4XMPL 4Z7WB 4DVRH 3WUWB 4PJ8A 3SDCA 4Q2ZB 3P4MB 5HHNA 3W9DB 3HS0B 2OZ4H 4HIXL 4TUJB 4NM4H 1PY4A 1X7QB 2UWEF 3TN0B 4Z7UE 2Z8VC 3WFCH 3MV7E 1LO2L 4GW5B 5J4MA 5AYQA 3WN5B 3AB0B 4HFUH 4PJEF 3GMMB 4EXPX 1QOKA 3W0WD 2D7TL 4KGJA 3BP6B 2XY1A 4L3AA 3LH2L 1JPSL 1Q72L 2A0LD 3B9AA 4XCCL 3D85A 2FSEB 2PYEE 2ENYA 3BO8A 1VFMA 3CDFA 3LKPB 1E27A 3KPSB 5EDXA 3QWOB 3SDDA 4UQ2A 3TA3B 2R4SH 3ECBB 3I85A 1VEPA 3C5ZA 1VFBA 3QDMA 3IDNA 3QIUC 4I18A 4OCSH 5T1LB 1C12B 3AROA 3WYRA 3CMGA 3V4VH 1ZANL 4PJBA 4RAUA 4WWKA 1E4KA 4XHJC 5CEZH 1VADA 3EO0A 4E9LA 4IMKC 4XVSL 3X3GL 3HB3C 5D1XA 2VZ3A 2FIKB 3TYGL 2ADIB 2NMSA 3OX8B 2A83B 4HG4K 3RI5F 4ZUVA 2MCPH 1U8NA 5D1QA 5JOEA 3MLWH 3LRGA 4WNQA 3TESA 3DV4A 5FYKE 4LKXA 2GIYA 1FFOB 3RWJA 1RHHA 3NZ8A 2EO1A 3WHE0 1TVDA 5LGJB 1X3DA 1F6AA 3KPRB 3U2SA 3ZTJH 5IEHB 3T77B 2FBJL 3QHTC 1CI5A 5IT2L 1D5BA 4PRPE 3T0BA 1BEYL 4HWBL 1HHGA 5LAXB 2KZWA 4BQCA 4O5LL 4TOYL 3TBYA 3VXQB 1A6PA 4QWWC 1F8TH 5E99H 5DJAB 2R2HA 2OM5A 5B8CB 2BC4B 4GRLC 5F7KC 1OAXL 3DECA 1FO0B 3A6BL 4G9FA 5E2VL 2P24A 5MEQB 1E4XH 1ZEAH 1MIMH 5L6YH 3JTSA 2V17H 3NCYP 1RJLB 5CD5D 3ZKSD 3UPCA 2FX9H 3Q5YA 3IJYA 2DQIH 2Q6WB 1QYGL 5CSBA 4QRPB 3W11C 1I7RB 4A2LA 4U1MA 3TVMB 4OGXL 1DP0A 4OI8A 3LKNA 1VACB 1LNUB 2MWCA 1HHHA 1BGXL 4ISVA 1KENL 2IG2L 3BN9D 3FQXA 3BSZL 3DBXB 5IHZA 2OI9C 2W9EH 4R4FH 2PNDA 3GBNH 2HTKC 1CQYA 4L8BB 4M4RA 4JREB 4LSDA 3IU4H 1X5XA 5KN5A 3CSYB 4JVUA 3VXOB 4NP4H 1QFPA 3NFNA 4OZIF 3HZYA 3FFCB 1KT2B 3VGBA 4FP8H 2H8PA 4EUPB 3PP4H 1JF1B 4O4YH 4RA0C 1HYSC 4CVXB 3HC0B 1XF1A 3QEQE 4YWGH 1J0HA 2EH7L 1V5JA 4QOKE 1N59B 2E7MA 4QHLA 1IFHH 1X44A 4DZ8A 3MBXH 4Y4HC 4M1DH 4U6HB 3QJHA 4YHOH 4APQB 1RJYB 5T3ZD 2E6QA 2CDEB 1PY9A 4Q6IB 4QRQA 5CIPB 5FYJH 4MA1B 4QXTB 4PJAA 4XP6H 1PZ5B 1TLKA 4XPHL 1WFTA 2ZCKL 4IM8A 1AIFA 1RMFH 1OSZA 4Z78A 4NQCB 4Z7UF 3QFJD 5I18L 1G6RL 5SWSB 3MCKA 2NTFA 3JUZA 3G08A 3P11L 5DD1L 5I17A 2Y25A 3I02A 1G7MB 12E8L 2EC9U 2X4QB 1FL5B 4QXUL 5T1KA 4UDTB 4M7LH 1MNUH 1R24B 2AABH 2WQRA 5IMLA 5ITFA 32C2B 2VE6A 2BOBB 4PB9L 1WZ1L 1JUFA 5FO8B 3H9SD 3S3JA 5FA3A 5CJXC 3E1F1 5HHMB 2BMKA 4HKXA 2JJUA 3VJ6B 4JM2F 2C3XA 1MCPH 1U8MA 1HSBB 3WHXA 5CJ5A 5C07A 3FCTA 1PG7H 1FVCB 2Y7QA 4MWFB 4EVNB 1AXTH 1N8ZA 4Y16D 4RISH 3S98A 1KXVC 2E3VA 2VXQH 3M1BA 4J3OC 4PRHE 4RRPA 4PYGA 5D6CB 3ES6A 1XH3A 4LRNH 1MJ8H 1CICA 4H5SA 3BESR 3ZE0F 1CFQA 1IAKB 1A7OL 3G6JF 4P4KC 5FHAH 4HDIB 5CZVH 4M6MH 1DQMH 3PWNB 5HY9B 4E5XB 2R9HC 1Q38A 2EYTB 2F54D 4YK4C 3K46A 4YXKH 3L5JA 4D0DB 4F15C 5JZ7C 1QR1B 1MUJA 2DKSA 2J8OA 3GNMH 2NW3A 4N1HB 4L3ED 4HMDA 2VN7A 5TDOB 1MI5E 4FOMA 2BNUA 5DR5L 2WWKT 3X14B 4ZFFB 3HRZA 3DURA 1NDMA 4JAMA 3GHBL 1BX2A 2GY7B 3IFNL 1AP2A 4NQED 3L5IA 4HH9A 1IL1A 1OP5K 5E56A 3QQ9D 6FABL 2NY3D 5T1DH 3PQYB 3BMWA 4P3DB 5IF0A 1HN1A 4JY4B 5AG9A 3RGVD 3RVXC 4JDTH 3L3DA 1G7JA 3WJLC 2DQGL 2XTJC 3PWPD 3GSUB 3UMTA 3CK0L 3MBED 4Y4KB 2G60H 2B1AH 4NO3A 1LD9B 1IQDB 1XIWA 2WMPA 2XZCH 3HI5L 3CMOH 4PREA 5JOPE 1F00I 1V7NH 5TFSH 3MUGA 5LKNA 4PY7A 4U1LB 4BFGA 2MPAH 2A9NH 4HFWB 3MJ6A 2X4UB 3OXRB 3SDXB 1A6VL 4L9LB 3E8UH 4OJFL 2D9CA 2HFEA 1MCSA 5DRZA 2J88H 4D9RE 1KJ2L 4MQXD 1JI2A 4P23B 3GSOB 3DX6A 5H2BB 1U8OA 2AERT 1RU9L 5IHUH 4P5KB 4XX1G 1G7PA 3BD5A 1BAFH 1XCTB 5I73B 1I8LA 1AD0B 1XEDA 1UH3A 3C2SA 5CEXB 3AU1A 3STLA 2P42B 4M7JH 4L4VA 5SX5H 2X9YA 4I0PB 4PJ9D 1FNFA 1R5WA 3VCLA 4OM0L 5DMKB 3O6FB 3MFGB 4HHAB 4YIQB 2HT2D 2ZG3A 1OF2A 1ZHLA 4LSQL 2F58L 4J12A 5EA0H 4Z7VB 4FQCL 3CFJA 4PRNA 1NCCL 4ODBD 5FDYA 2JCCA 3ESVF 3V0WL 5MERA 4NKDA 5I8CA 4PJGB 3VFSA 2J8UF 2WLYA 1K8IB 3O4LD 3DYPA 4KPHH 4R97B 2VLRE 1EEYA 3WIFA 3IDUA 1TCMA 2DQJL 3AC0A 1OAYH 2XI9A 5IQ7L 1I3RB 2WBJD 4GBXA 1DL7H 4KQ3H 4WTWA 3BT2H 3SDCC 3TYFA 3FZUD 3GIZH 4RMQA 4G8EB 5FO9A 3L7EA 3S3SA 1F3DH 1U58A 2DB8A 4QCIB 2DWEA 4CMMB 4C4KT 1IQWH 1S9YA 2NY0B 1I3UA 3BQUB 3FRUA 3EDKA 2CLRB 5TQ2L 3U36A 4KI1A 3QRGH 4M9PA 3U82B 2N7BA 1XGTB 1FZMB 4NM8H 1K4CA 3MUJA 4WUUE 1R6VA 4S1SH 2BFVL 4N90D 4EI6B 1T20A 5JQ6L 5IM7B 1JN6B 4L8CA 1I9RH 2J6EA 4RNRB 5CUSH 1CXKA 5GGQH 1BVKB 5FYKH 2XYCA 2HWZH 4NQDA 3X12B 4BZ1L 3QIWB 5DHYA 2FO4B 4IIQB 4WHTA 2CIIA 5D4QA 3TBSB 2WINB 1HK6A 1A6AA 2DI7A 4FG6C 4I18C 4LPXA 3W0WE 3K4DA 1Y6KR 2BHZA 5ITBH 1TJHL 3R8QA 4GO6B 2GTWB 4Z7QE 1J8HD 1K85A 2BZDA 2OQJA 5GJTL 1ZS8A 4LLWA 4YDJB 1GGCH 4K7FB 3MJ9L 4KI5C 5C08A 1ZTXL 2DI9A 4J4PA 3HE6A 5GRVL 3CFCL 4C55A 3T0EA 2APFA 3KXFD 1BF2A 4IDJL 1JZ5A 1PBYA 1IEBA 1ZT7B 3MXVH 1BQLL 2B0SH 2WW8A 4HUVB 3JSSA 4PJCE 1LVEA 1CLYH 1C8PA 4X6EB 1CD8A 2XA8H 1CF8L 1C5DB 4FXGA 2Y5TA 5INDA 1HHKA 3FN9A 4UOJA 3VGFA 1FGVL 5DEFB 2BY1A 3EDDA 4YEEA 3CVHA 2VDNH 2AJVL 4BZYA 1YJDL 1JGDB 3VE0B 3RWDB 2WUBL 3P3YA 2PW1A 1SY6A 2H32H 1EFXA 3EAKA 4R4BB 1CLOL 3T2NH 1FFNA 2X09A 2J3SA 4QRSB 3HAEA 4ZOEA 3RVUD 3GRWH 1LGVA 1WAAE 3D0VB 2IMMA 4ODUA 1PW3A 4AK1A 4GSDH 1VPOH 3BKMH 3BUYA 2PXYB 2H9GA 1KB9J 4DKEL 3GIVA 3ZMRA 3UAJD 2R0LH 2OSLA 3BDBA 2NXYC 1G7HA 4KJPD 3BKJL 2OL3A 1S7VB 4F3FB 3E2HB 5C09A 1ZWIB 1H3PH 3R1GL 4LLMB 4I77L 3QHZH 3RVWD 4GUPB 3HPLB 3U0TB 4F37K 1KN4L 5DRNA 3BJLA 2RFXA 2FL5B 4FFVC 3O2DH 1UC6A 1DBJH 4ZD3H 3WFHB 3JZ7A 1B0GB 2BY3A 5T5NF 2FB4L 1FVEA 5DJXB 4GAGH 5FOBB 4K7PH 1NCAL 3P9LB 3G6DH 1FFPB 5LBSH 4U3HA 5EU6E 1T22B 5FGCE 5GS2D 4YHYB 1DEDA 4OTXL 3O2VH 3T04D 3OF6D 1NANI 4KJWC 3LKQA 1A6UL 3MV9D 3ALPA 1HINH 4GKOA 5IW1B 4D2NA 3D48R 5TF1H 1HH9B 1MFBH 1T89C 4FQXA 2Q8AL 1MF2H 3RFZC 1MJUL 2YPLD 1ZGLP 1DE4B 5I66B 1Q9WA 3TBTB 1ODAA 1FL6B 3RIFK 5D5MB 3W9EB 4YAQB 3EUUA 2Z31A 5BW7C 3BRFA 4ZUTA 1N4XL 5B38A 4DKFH 1ZLUK 4QYOA 2M26A 3B5TA 3QI9C 3H3BC 5L8KB 2GTZB 5K9QG 3QIBC 2ZUXA 4PLKD 2WUCL 3D2UB 5C0RL 1BJ8A 1RULH 4M1CC 4IJ3B 3NVQA 4Z5RA 1YN6A 5T3ZE 1BMGA 4F7TB 1FC2D 2NXZC 1DVFA 2MKLC 1IGJA 5GISH 3GSWA 5D7IE 4PJ8B 1UZ8B 2G9HB 2H1PL 5I74C 2SEBB 2NY1C 2R23A 3TBWA 5A2JH 4FQPA 2O5XL 3QFJE 4BKLB 5JO5A 4ODXB 2AK4B 5K9KB 2DQHL 4WU5B 1NPUA 2EH8H 3ZYZA 3MSPA 5DS8B 3IVKA 1QUNA 3ZT6A 3ZKMC 5EN2A 5D2LA 2A74A 1MCRA 1QSEA 1MRDH 3ET9F 4Y89A 4DFIA 3BYTA 3GGWA 1GGYA 4JKPL 2HN7A 4V2BA 5E2WH 5C0JB 1ZVSA 3PDOB 1M7IA 4Z7QF 5HYJD 2VLKD 5D7LA 2DM3A 3LN5B 4LIQE 3NTCH 2V6HA 3H9SE 2X4SA 4KH2A 2YKLL 3K2UH 2A6KA 3KPNB 5DT1L 3N9GL 3EOBA 4HXBH 2A73A 4JPVH 1BBJB 4FFYL 4PJCF 2HAZA 3EJYC 3QG7L 3VFGH 1ZA3B 4UQ2B 4V1DA 4KDTC 4PJDE 4MX7A 3VFWA 4R2GC 4X6CB 4LLAA 4WW1A 4Y5VA 1K5NA 2GITA 5C8JA 3V6OC 1AGCA 1FG9C 2PYFA 5MEPA 3FAXA 4JN2B 1EHLH 3V5KA 5DHVH 1I1YA 4WI6A 1KCUH 4LARL 4EDXA 3ULVC 4JO4H 3NCFB 2F54E 3L3HB 3MUHL 4BYHA 1E28B 5JHDA 1UA6H 3ARVA 1CFSA 4Y19B 1NMAL 1WAAF 4MXQD 5E5UB 3SO3B 1IGYB 4QGYA 3C5SA 5HYQA 4P9HC 1FN4B 4EIZC 1W72L 4JHZA 2QHLA 4L3EE 5CLTA 4RWHA 3A67L 5AWNL 5GGUB 1YEJL 1RHHB 2CD0A 4CU6A 3P0VH 4PJEB 4RGOL 3WKNA 1XGYH 4QRUB 1UXSA 3RWFB 4OCYH 1D5BB 2XRAH 1NCDL 1ETZA 1TPXC 4NQEE 3C8KB 3FOMA 5DEZA 4WW2F 5EIIB 3LRSA 3LQAC 5F6IB 2BOCB 4PB0L 4U49A 4R0LB 1HE7A 2ZCHL 3QCVH 4OBRA 4P2RA 3IJHB 1DQDH 1HWHB 4PRBB 3JWOL 3C9NA 5D7JA 5JA8B 2IQAA 1A5FH 1BZQK 1NMBH 1TXKA 4K8RL 4JRXD 2F15A 4YPJA 2P24B 4S11A 1N0XL 4C56A 1T4KB 3PWPE 3C60A 4FQ2H 5HHVL 3J8F7 3IDIB 1DBKH 3TZVC 4AMKH 2VDKL 2BCKB 5KSUA 4LCUA 1KF9B 4P3WA 4UT7H 2G2RB 4R8WL 2W07A 3L3OB 1I8LC 1UB5A 1XR8A 5DEGA 3ARZA 4TUKL 1MCFA 2DQCH 1OAKH 4NN6C 5ISZD 3LKNB 1MFDH 3LV3B 2FWOB 5TE4L 2YA0A 3ILPA 5I1DA 4ZSOB 4JQIH 3FQUA 1SMOA 1EO7A 5DYOA 4FMKA 2YD8A 2LU3A 1UM4L 4OCWH 5BZWB 5BOPA 2A6IB 5DJDA 5TDNA 4YXLL 1VDGA 5CCKH 2ZJSH 1CXIA 2X5PA 3A6CL 4QT5A 1SQ2N 1INDL 1BBDL 2Q86A 5EZOH 2VABB 4OD1H 5HHXH 4G8GE 5DUPL 1JNNH 1F4YL 3WFDL 5FECB 3MRJA 4MDIA 1S8DB 3ZT7A 1QRNE 3W2DL 5I1GL 3TT3L 2F19L 4Y4FA 3MLZL 4WHCA 1GAFH 1FGNL 1OL0A 4MJ6B 2EYRB 5GQBA 1N7ML 4IOFD 4QHLB 1IT9L 5ESQA 2FHBA 4IRSD 5CINL 3G5XA 5KS9E 3O4LE 5D7IF 1PKQA 2RHEA 1XGQB 3DX9B 4UTBH 3BEWB 4ZAKA 3IDMA 3E6HA 1HKLH 1MFAH 3GK8H 5CLWA 1NFDE 1UJ3C 5KSAA 4ODHH 3ZE2F 3JWDH 4U6YB 4PD4J 2IALB 4WV1B 2XTLA 7CGTA 2F5BH 1MCHA 3GB7A 4NO2A 1SJHB 3V4PL 3TBVB 4LHQB 5C6WH 1I1AD 1UVQB 2NX5B 1OAQH 5IMLB 5JXAL 1CD9B 4OM1H 1QSFA 5K59F 2AVGA 3WS3B 4N90E 3TO4A 1H15B 4MB5A 3HUJA 4QRRD 1WBXA 3WHE1 4OZIB 3OR7A 2AI0H 4PJDF 1NC4A 4NO0A 4Z77A 3UO1L 2C4FU 4X8JB 3VXSE 5ADPH 4G9DB 3WSQL 4LCWA 4DGVH 5A2IH 1ACYH 1UM5H 4P5TD 4GRMB 1NC2A 1RK1A 5H37G 4PRAB 1UCBH 3HNTL 2HH0L 1UYWL 3QG6B 3LN9A 3TA3C 3VWKD 5DTFA 2DQTL 3HI1B 4JFDD 3TF7C 3L6FB 1A6ZB 3D0LA 3TM6A 3P9MA 2C3WA 2NY4C 1GZQB 2Z8RA 5CKAA 1J8HE 2JB6A 4R7DB 4HS6A 5HDOA 2WWMD 1QR4A 2D4DA 3MV7B 4YLQT 4LVHB 2IGFL 5DVKA 43C9B 3U4AA 5IJKA 3DO7A 5GHWH 5A40E 2YD9A 2GK2A 3AVEA 4YNYA 3EYFB 4PGBB 1KEGL 3DNKA 3NAAL 3FOLB 1VSCA 2VDPL 2DLTA 2PYEB 1P7KA 5BVPH 3O6MH 3GSXA 3QXVA 1BJMA 1DFBL 5DVLA 4RAHA 4DN3H 5FM5M 1IL1B 5HGBA 1F3JA 3Q0HA 3D39D 2AV7A 4YBQC 4XP5L 3MNZA 5KJRL 2B7DT 2VC2H 4RIRA 2OTPA 2V7HA 3QA3B 4ZS6C 5DWUH 4XVTH 5B8CC 1U93A 5C0BD 3B6SB 4JFZH 4JQVA 3OXSB 1YNKL 3SCMD 1CFBA 4WI2A 1V3MA 4GAYB 5FGSA 4N0UA 1FBIL 3OJMB 4U7SA 4RQQB 1CR9H 3O41B 1XIWB 2DS4A 4KVCL 1OCWL 3FO2B 3FO0H 4KQ4H 2HJLA 5TE7H 3KJ6H 2OZ4A 2VQ1B 4GAJL 4JANA 5KW9H 4PJ5A 4CU7A 5KTEH 4O9HL 4TVSa 4YHLL 3HFMH 2R39A 5EU7C 2H41A 1G7LA 4PRPB 1U9KA 4U7KA 1U8QA 4XNQA 4ELMA 3PWUA 1LK3L 2BRQA 5F7UA 4NQVB 5T3ZH 3QUXC 1UG9A 1EMTL 3IB4A 1T66D 1MFCH 4NKOA 5H94B 1MCLA 4HIEB 4ZXBD 5EU4A 1XR9A 2QQNL 1CFTA 5KSVB 3DVIA 5FV2A 3VCLB 1TIUA 4MAUH 1Q9LB 2FBOJ 5AG8A 1KLGB 3BEVB 4LCIL 1G7QB 4M9OA 5DHXB 3BGFB 3C6LB 2OR9L 2Z31C 3LKOB 3H2WA 3K74B 2R0KH 3V5DB 2ATPA 4LSRL 2GKIA 1VFAA 3LS5L 4LEOA 1AE6H 5KS9F 1QLEH 3C8HA 4NNPL 2OR7A 4I3GA 4D9LL 4KK5D 4QF1A 3VFSB 3I6KA 4JZJB 1JFQL 4LIQH 3MRCB 3HR5A 1NFDF 1P5VA 2R2EB 2YPLE 5BMFL 4K8RD 4N9GB 2RCSH 1NBYA 1JWUB 3L7FA 1DVFC 3OTTA 2Y06L 1IM9D 3DVGB 3RNQA 4C83A 2ICWA 1WF5A 4MA1C 5L2JB 4YFEA 3RAJL 2FO1A 3EHBD 5C2BL 2Y23A 1OAZH 1H8SA 4JZOB 1S9YB 3R8BB 1VA9A 4YE4L 5GGSB 3FRUB 4MQ7A 5I1KL 5GRUL 3VD5A 3RU8L 2F8XC 2CJUH 1AXSA 4NN7B 1DEEA 1F42A 2GJZB 4POZD 4O2CA 1Z3GH 3WLBB 4K3DH 4Y5XA 3RL1A 3DRTB 7FABH 3F5WA 4YHPB 4U7MA 1TJGL 2WNGA 3SY0B 1TENA 2P8MB 5I15L 5D93B 3QEQB 4ZOAA 1YEDA 3U30B 1RZGA 3CDYA 1F11A 4OGZA 3DVNB 4L5FH 5ENWA 4QOKB 5LJYH 1U8HB 2ZKHH 4XMPH 3PIQB 1DUZA 2R8SL 5DGQA 3ZTJG 4K71B 3WO3B 1LDSA 4G8IA 4ZTOL 5HYSA 4S1QL 4ODSL 4HIXH 2KBGA 1U2HA 1A47A 4Y5VC 4OZHE 3CD4A 4HT1L 5HYJE 2VLKE 1T0MA 3SKOA 2JELL 4LP5A 3H0TB 5DQDL 1PYWB 4KFZC 1LO2H 3T4AB 4HZAA 4EI5D 1HQRB 1ZS8B 2VR9A 4LLWB 3BPOC 2D7TH 1W0YT 1L4IA 2MJWA 1PKOA 3LH2H 1JPSH 1Q72H 4WJ5A 3FQNB 2XQYK 4XCCH 4Z9KB 1MCNA 3Q3GB 4I3SL 2RAMA 2GCYA 3K7UA 4KMLB 1ROWA 3IFPA 2AJYL 2W92A 1FJ1B 1UB6A 3AGVA 4X4MA 1IC5L 4FQHA 2PCPB 4KK6C 2WIIB 5F3HB 1MJJA 2GFBA 4ONGL 3IXTB 5IB5B 1EO5A 5F1NB 4M61A 2OMNA 3ILQC 3F65A 1OGTB 5F70A 4TUOA 1ZANH 5EBLB 1U3HD 1T83A 3BPNC 3GBLA 1KEML 4PRHB 4J8RB 2CDFB 2JJVA 4XVSH 3X3GH 3NIFF 4DZBA 3TYGH 3MC0A 3R06B 2UWEA 2HVKA 3O6LL 3CCHA 4ODUB 4X6FA 1JYNA 4JLRB 1XGRB 5AAMA 3GIVB 4OFPA 1MCEA 1CE6B 2IADA 4HUUA 2ZUQB 3MRPA 4E42B 1OGAD 4F7PB 4GH7B 2OL3B 2FBJH 1MI5B 4JCMA 5IT2H 1BEYH 2VSCA 4HWBH 5K9OA 1OARL 4EN3B 2DWDB 4JRXE 5ACZB 4TOYH 4L9LC 1S7XA 4DW2L 4BQ6A 2HG5A 2FX8L 3LPWA 5CMAB 1FZKB 4PJ7E 2V9TA 4LFHD 1S7SA 4LSSL 5DRNB 5EZJA 3MRGB 1I1RA 4P23C 1OAXH 3A6BH 2CKBA 5E2VH 3OKOA 3QUKA 3GMLA 1NLDL 5HPMA 4LSTL 3V7AE 4FFWC 3TC9A 1S7WA 5I73C 1BVZA 1MREL 1NGZB 1BPVA 2UZXB 1JWSA 5JUEL 3WNNA 1INQA 2D7PA 4AEFA 1XF4A 4I0PC 1WBZB 1QYGH 2X7LB 3I50L 3O6FC 5DXWA 4OGXH 3LB6D 3V52L 1I8IA 2Y07L 3VXMB 3R0NA 3UTQA 4K3JL 2YC1B 3KPMB 4U6TA 2DTSA 3HA0A 5FB8B 9CGTA 5DHVB 3TNMA 1BGXH 4XBPB 4H88L 4PGCB 5GGTA 1KENH 1OLZA 2IG2H 3A6OA 3BSZH 1FO0L 3LDBB 4JFOB 4LKCA 5I8EB 3L3IB 5T1MA 3QSKB 3MACL 4GKZB 1D9KC 1KPVA 3EYQC 4R97C 1BFOB 1RI8A 1NBZA 1K8DA 4N8VB 3B5HA 3SKUD 5DJCA 2DI8A 1C7TA 4ZUSA 4ZUTB 3LHPL 4OFIA 4QYOB 3QUYA 2CIKA 3C2AL 3GSRB 1KTLA 3T0WA 4H0GA 2ZOKB 3RA7L 2NY0C 1OTUC 1EVTC 3BQUC 1P1ZA 3QJFA 3UXFA 5F88A 3L3JA 4Y1AA 3WE6B 4YH6A 3ULSB 5IV2B 4Z5RB 2EH7H 2EZ0C 4MA3A 3GSWB 3TO4C 5JO5B 1BWWA 5IB1A 4M3KB 1UQSA 1S9XA 4WDIB 5JIKA 2VUOA 5F7EL 1T1ZA 4XPHH 3VD7A 2ZCKH 1TQCB 3JVGC 5ABDE 1S9KC 4UZGA 2E7BA 3RVTC 4LLDA 5I18H 1G6RH 4RZCA 3T8XA 4IIQC 4XNUL 3V6FB 3BP4A 3P11H 4JZNB 2CRYA 5DD1H 4AM0B 3O9WB 5KZCB 1MH5B 1P6AB 3ARBD 3OJDB 4JEGB 4QXUH 12E8H 4QRRE 5F7DA 3EIFA 5DZOA 3EOBB 2VERN 4PV8B 2VISB 1QBAA 4DN4L 1YMHA 4PB9H 1HNGA 4NT6B 1WZ1H 4RGMC 1IJ9A 5IJKC 3NCCB 2EKSB 2CLVA 4XTRC 4TTDD 3VFWB 1QEWA 5BO1L 4WUUB 3BOVA 2P5WB 1ITBB 1R3LA 4G8FA 4YC2C 3LN4B 3CDGA 2GITB 4JFDE 1M7DA 4Q7DA 4ZPVA 2JIXD 4HKBB 1KBGL 4X9IA 2IQ9L 3X11A 3WCYA 2YR3A 5T33L 1AHWB 5JHLL 5I19L 1FLTX 4DGIL 3AXLB 5B39G 1AQDA 2D7MA 1A7OH 4PV9B 4ETQA 3IU3B 2CXGA 3KPPA 3MXWL 3W0WB 3U6RA 3SQOL 4MDJB 1WGOA 4BSWB 4JQVC 1UXSB 5CJBA 1SJVA 2IFFH 1MEXL 2PO6C 4ZFOB 1AO7A 4PGEB 1ORSB 1T7YA 5DR5H 5JQHC 1KNOB 1KJ3L 3VFMA 4L8SA 4PP1D 2CXKA 2IAMA 4BQ9A 5GS2H 1KG0A 4PJCB 3S6CA 3IFNH 3JV0A 4KK8C 3MNVB 2RR3A 4PJHA 3E2HC 4PY8J 4C56B 3AS2A 3PUCA 5C0BE 3QP3A 1MWAL 3C60B 6FABH 1ACZA 5EOTB 2VKWA 2IBZY 4LCUB 1NCBL 1FFQA 3GMPA 3IKCA 2EDWA 4RGND 3DXAA 5I8KL 2DQGH 1D5MA 1XR8B 4LDOB 1QFWM 3CK0H 3G6JA 4NSKA 2CLZB 4KK9D 3QWRD 4UTAL 1UKTA 4UUJB 3B9KD 2AV1B 3TCLA 1OVZA 2NY2B 3ILPB 5DVOA 3HI5H 5ICZA 5HI5D 3X13A 3UDWA 5HHOA 3TN0D 3FQUB 2UVFA 3K1KC 5GIRB 2DM7A 4AQOA 3T08A 1A6VH 1NAML 1TQBC 4OJFH 2X05A 3TFKD 1NGWB 1QFUL 1LE5B 4HUXB 1O0VA 5ANMA 1YA5A 3VDAA 3PV6B 3QEHB 1KJ2H 2XKNA 2OJZL 5SX4H 2AAVA 3HCVB 2HT4D 4OCXL 5L9DL 1RU9H 5EPMA 3GKWL 2ZPKL 2BVOA 4D0BB 1NJ9A 1T2JA 2R29L 2YN5A 3B9DA 3KPSD 4G7YL 4PRIA 4H26B 5DJ6A 1RZJL 1L0XA 2MOVA 3LKRB 5DA0B 4U0RB 4OM0H 1CL7L 1X5KA 4HC1A 4FQIL 4UDUA 1QFWL 4ORGA 1D5ZA 3G5XB 3P2TA 3KLDA 1RZFL 2F58H 2NPLX 4LSQH 1ZLUH 5EU6B 5GZOC 4LLVB 4FQCH 5FGCB 5FUCC 2ED8A 1NCCH 4OV5A 4IJ3C 3ZE1E 1K3ZA 3V0WH 4X7TA 2H32A 3QCTL 5DC0A 4GQPH 1RV6X 2BVQA 5FKAA 2DQJH 2DQFB 5C9KA 4NO2B 5IQ7H 4E41A 4RMWA 4Z0XA 4CNIA 5LWYL 4RMVA 4F58L 4IRJA 5E1HB 3ARGA 5J6GB 5I1CL 1LP9E 2GUOA 3DX7B 4NC2B 5MI0B 3ZYOA 2V2TA 2ATKA 5TQ2H 3JV4B 2DIAA 4HMCA 5DSCA 5DDHA 3VDBA 5SWZD 3RWCB 2D31A 4L9DA 2KH2B 2NY6D 1FV1A 4JB9L 5E5MB 2EDKA 2WP3O 3DUSA 1BQUA 1JHKL 2BFVH 1OD7A 5HI4C 4WHYH 4LGPB 4U1IB 4OZGA 4G5ZL 4NKIH 5BZDA 5JQ6H 1JZ2A 2IH3B 4HW6A 4P46D 5IKCA 1JJUA 4GLRH 4RWYL 5HTSA 1K9TA 4NGHL 3O2DA 1T0NA 5D7IB 3ARDA 5E1AA 3RWGA 5FF6B 4BZ1H 4NZUL 4OBSA 2J8UA 3QFJB 1DDHB 5KSBA 3CFKB 4QRPD 5HDBE 4UQ3B 2OBGA 3TVMD 1A6TA 4RFEA 2JE8A 4TTGA 2YN3A 5EFIA 3PWLA 4OAWB 5DFVD 1TJHH 3S5LA 1A1MA 4HKZA 5L2KD 1PX4A 4P2QB 4HBQA 4CVWA 1YC7A 5EC1A 1MFNA 2EIZB 5GJTH 4L3CA 3H9SB 3MJ9H 1ZTXH 1R3KA 3MRBB 3CFCH 4MCZA 5FV1L 4IDJH 1I7UA 2AXFB 3SKMB 1BQLH 2Z93B 4OFYA 3RVVD 3IXAA 4GG6A 3FHAA 4K94L 4P2CG 1CF8H 3DI3B 3EDEA 3EO1B 4Y16B 5F9JB 4DAGL 3BZ4A 4MB3A 2GJ6E 5F6IC 1FGVH 5K33A 2RGSA 3HI6L 2YA1A 4I2XE 1U8LA 2AJVH 3MR9B 5BV7C 4XCFL 5I75B 1YJDH 2WUBH 3BH8B 4XNYL 4D0CA 2ZNXA 5D9SB 1CLOH 4JFPA 1F4HA 2FJFB 3BHBB 2XT1B 2F54B 5D72L 4APQD 1R5VB 4F7MA 3DGGB 3I2CL 1JGEA 3P77A 2PW2A 5FCSH 1ZXQA 1OGAE 1DJSA 1KV3A 1S7UB 5D1ZA 5C0CB 4L3EB 2APWA 1MELA 3OKKB 5E70A 5SWSD 3RUGE 5BVJB 4DKEH 3KPQB 5C0EB 1RVFL 1WWWX 3B2UD 2ZSVB 5DJ2A 2Y5EA 1G7LB 3BKJH 1ED3A 2BVYA 3EW3B 3PJSB 1VENA 4R96A 3RZCD 3R1GH 4M03A 4I77H 1FNSL 1OB1A 4OD2A 3H42L 2NY3B 4GS7C 4NHCL 2Q20A 4YBHA 4G6AD 3GSQB 4IHOB 1KN4H 1MSPA 3CLFL 4H0IA 4LBEA 1EA9C 4POYA 5ADOL 4XCYB 3PWPB 2FB4H 3MBEB 4AENB 5HGAA 1NCAH 1I8KA 1YEIL 2ATPB 4TNWK 3TJHD 3P4OA 3PHQA 1DCLA 3MO1B 5FGRA 4X0KB 4OTXH 5FO7A 4HUNB 4B7IA 3IFLL 1A6UH 4L8DA 2C4XA 2Q7YB 3ZE1F 1JPFB 3TNNA 2ZP0T 5ECJE 1P6FA 2LVCA 4DQOL 1RJCA 1BJ1J 1QG3A 3LCYA 3CNKA 4WI8A 4W68A 3QPQD 3SJVA 1OT2A 4LCYB 1B0RB 2X89D 2V5YA 4OLYL 3Q1SL 2VIRB 3CX5K 3BZEB 1S7TB 4Y2DA 2Q8AH 1NDGB 2EDDA 3LEVL 5IEKA 1MJUH 3DETC 3L5WB 3QEUA 5B21A 4OD3L 1S5IL 1U8IB 1NBVL 2QADD 3SGKC 4WV1C 1N5AB 4JJ5A 3RHWK 1TCRA 1NFIA 2GEEA 5GGRB 1DANT 3DARA 4G8GB 1N4XH 4PJ9B 5H35B 2I07A 4LASL 3RL1B 2XG4A 4WO4C 4EDWL 3ZKNC 3VRLE 2R56H 4Z7OE 2CK2A 3CFIC 2VQUA 1QRNB 5HVHB 3B9VA 1AKJA 3RZWA 2WUCH 3VA2C 5E9DD 4X80L 4IMLA 5C0RH 5FHBL 2ITCA 4H8WL 4PP2B 2VDLL 2CUHA 1KGCD 1BVLA 2FX7L 3MYZA 3TWCL 4G8IB 1T5WA 5HYSB 3O4LB 2H1PH 5E8PA 4ODVL 1KB9K 3STZA 4MD5A 2O5XH 4Y4KD 1F58L 1KIRA 2WBJB 2DQHH 2VLRA 5T5NG 3VGAB 5HDBF 5JW5B 1FZOA 3H7BA 1C08A 3SKOB 1MQKL 4NDMA 3P0GB 3EKCA 4CU8A 1DSFL 1FNHA 3DRQA 1WC7B 1IEAB 4JKPH 3PXHA 4JHAL 3T4YA 4G6JL 5GGVL 4UILL 4PR5B 5DJZB 1EPFA 2YKLH 5C0FB 3QUZA 5DT1H 4S1DC 5J3HC 4LVHC 1FL3B 3N9GH 4U3CA 3M17B 4JFXB 2X4TA 4HH8A 5E6IA 2MQCA 5DO2C 4FFYH 5EG6C 3QG7H 5E2JA 3I75A 3UBXI 3RIAF 4KKLD 2GFBB 3IKKA 5JLZB 4HPYL 4JFEA 2MNUA 4JDVA 3OHXB 1M05B 3PABB 2F53A 1C1EL 1CZ8L 5I16B 4WU7B 3VXSB 3O3AB 2X4PA 5A43C 1AD9B 4P5MA 1RJZA 1CFNA 3BH9A 3BPCB 1T6WA 4JM2C 4R3SA 1N2RB 1P4LB 1KJVB 2X1OA 4LARH 4LVEA 3MRLA 4MNHA 4LLUA 4X7FC 1NMAH 1G6VK 2C3VA 1J8HB 4PRDB 3KPTA 1WITA 1J18A 3L95A 1W72H 3CZFB 3A67H 5AWNH 5DJYA 2NLJA 3ULUL 1YEJH 2BNRD 2QBWA 4O02L 3RUGF 4FTVD 4RGOH 1BM3L 4OGYL 3WBDA 2IH1A 4PJIA 1NCDH 3QT2A 1JWMA 2FYYB 4XMLL 4BSVA 4PB0H 1KTKE 4M1GL 1FYTD 1QA9B 4UIKL 4MCYA 3P4NA 4LCCB 2ZCHH 5ID1A 5EZJB 2AJUL 2D7QA 5T5FL 3JWOH 1S7RA 4KKBD 1N6VA 4JFYA 4K8RH 1F4AA 2PF6A 4HGMA 1CT8A 3QUKB 1KULA 2HT3D 3GMLB 1LO5A 1N0XH 4X6DE 1K3IA 5HHVH 4LPUA 4ZOBA 1FNAA 2VDKH 1I9IL 3RWEA 1INQB 1XF4B 4R8WH 1A6WL 3G5VA 5EORL 3WXVL 1YEGL 3QIWD 4LQ1A 4TUKH 1YMMD 3LRHA 3ISWA 4K3GA 1WT5A 3HE7A 1S5HB 3BGFC 3C6LC 4R26L 3D3VD 3WEXB 3QO0A 4M7LT 4G7VL 5TE4H 4BQ8A 2EICA 2YEZB 3OSKA 4J7RA 2JLLA 4MYWB 3NA9L 2LQRA 4LKCB 5IB3B 2ARJB 1HEZB 2G75A 4QXGL 1UM4H 5CBEA 4N0FB 4WW2A 1KPVB 1EGJA 3SPVA 5I1HL 4YXLH 3A6CH 5IVXF 1INDH 2IC2A 1BBDH 3KPSE 1UGNA 3WIIH 5DUPH 5HHQB 1F4YH 3L3KA 3WFDH 4BA8A 4HUKB 1KTDB 4FA8A 2AS5M 3I3DA 3VRLF 4Z7OF 4H1LA 4IRJC 5IHLB 3QAZB 3W2DH 5I1GH 2GT9A 3KGRA 3TT3H 2F19H 3TT1H 3H3KA 3MLZH 1ZGLB 4U1KA 4X5XB 1JGLL 4LGSB 4NN7C 1FGNH 4S0SD 1DQQB 2P7TA 2W1NA 5BQ7B 1I9JL 3MOAL 3U46A 1N7MH 1MCWM 1QD0A 4G42A 4N8CL 2QQKL 1IT9H 2VLJA 3GDBA 1RK0B 5CINH 2XN9E 2CDGB 4W6WB 4QRTA 1V8HA 5JXEA 2VUYA 3MJGX 2BVPA 2EYSA 3MRFA 2X70B 3O45A 5D2NA 3UROR 5JPNB 2EE2A 5JW4M 1H0DB 3T3ME 5B4MC 2YPLB 4X4YB 4YGVA 5CSGA 1MCIA 4LLDB 4NQXB 4HS3A 3WL9B 4K71C 2X4RB 3MRHA 4NZRL 1N5YL 3QXDA 5GGVY 1BFTA 3MMEA 4HIIB 3BKYL 3V4PH 2PXYD 5EOCL 2NY5C 3VRIA 3RL2B 3PDGA 4R4NC 5ID0A 3JV6B 3U4BL 4QXWA 5SWZE 1J9CT 5JW3H 4ONHA 5JXAH 3VH8B 3EJJX 3NIDE 3QDGD 4M7KL 5ESAA 2K9UA 1KELL 3B3IB 3JTTB 4ALAL 1NUFA 3BW9B 1EZVX 5IFJB 1EBAA 3UC0L 1SYSB 3ARYA 4LOUD 5HD8D 1HOCA 4G43B 4QHUB 2GY5A 3ARED 4IBLT 4KY1L 5J1AB 4LPTA 1CLCA 3CZJA 4LHUA 1R3LB 4U2ZA 3UO1H 1KJ2B 1Q9OB 4JFFA 3WSQH 2YWZA 3DROA 5E8OB 1X5GA 1JHTB 3I6GA 5FA4B 3U0WL 3HNTH 4QRPE 5C0AA 1IGFL 2HH0H 1UYWH 5F71A 3VWJA 2DQTH 5HYIA 1C16B 1B88A 3V9FA 3VFRA 4IS6B 1KIQA 2BY2A 2QLVB 5F7YC 5CFHA 3ZL4L 5L2KE 2IWGA 1TZIB 4XNXL 3BIAX 4OZHB 3BVNA 5HYJB 2VLKB 3T3PE 2P5EA 1HH6A 3W82A 4MAYA 2IGFH 4GW4B 3RJDA 5IQ9A 4TYUA 4XNMA 4P4RA 4LHJB 3DI2B 4Q9CA 2NZ9C 1AGFB 1CVSC 5IG7B 5DQ9B 1UENA 3VFMB 5FUOL 1KEGH 2IAMB 1P69B 3NAAH 2VDPH 3QULB