1LO3H

Retro-diels-alderase catalytic antibody: product analogue
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
220
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFSFRNYGMSWVRQTPEKRLEWVASISYGGLIYYPDSIKGRFTISRDIAQNILYLQMSSLRSEDTAMYHCIRGDSFLVWFTFWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTQVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for the activity of retro-Diels-Alder catalytic antibodies: evidence for a catalytic aromatic residue.
pubmed doi rcsb
molecule tags Immune system
molecule keywords If kappa light chain
total genus 40
structure length 220
sequence length 220
chains with identical sequence Y
ec nomenclature
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lo3H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lo3H01
2Z4QB 1U91B 5D7KE 2DIBA 5LGHL 3VW3H 4UB0H 1X5ZA 5DJ0B 2VAAA 5HI4C 3F7QA 2R4SH 3QA3B 1X5LA 4PJ5B 2ICWA 4PJCB 5EUOB 2ERJB 2P46B 3CDGA 2R2BA 4CBPA 2VDQH 1IAIH 3V4PH 5IG7B 4GS7B 3RWJA 3TP4A 5H37H 1KELH 4JRXA 4OLXH 1I1YA 1P4LA 3QEUB 4JDZB 1ORSB 4NZRL 3U46B 1D5BB 2J1KA 2JJTC 3L7FA 2A73A 2DQCL 1O7VA 1QSFA 1J8HB 5MP6H 3ULVD 3FN0L 1FVEB 3S36X 2V2TA 2O5XL 4N1HB 3LKQB 3DUHA 4QRRE 5GGSB 4K3DH 3GI9H 4ZUUA 2HLFC 2ZNWA 2FJGA 1TENA 5F6HI 1GYAA 2CR6A 3BZ4A 4I77L 4QRPB 1I7RB 1E6OL 3OZ9H 5HHPA 5C07A 1IQWL 3RUGB 4ZUSA 3LKRA 3C8KB 4XNXL 3VFWB 1RFDL 4PLNC 4QXUL 43CAB 4LCWA 3HC4H 2OXGA 4XT1C 4KJPC 2DQDH 3SDDC 1HQRB 3QRGH 4QGYA 4OQTL 2JE8A 1ERNA 3MZGB 4OLYL 4JFDA 3MBXH 1K3ZA 3PDGA 2VZOA 4M1CD 3BHBA 1RIVH 1EPFA 3ET9F 4LU5H 4MA8H 3IGAB 4UINH 1KLUA 3FQTB 3BT2L 4LAJH 4LNRA 3B9VA 2K9UA 2EEAA 1QBML 1BFVL 5CZXC 4BQ8A 3V5KA 1ZK9A 1PKQE 4KV5E 5IB1B 2XKNB 1U8LB 4MNQD 2SEBB 3RL1B 1LMKA 1PYWB 5I75B 3WKMH 1UVQA 4F15B 5T3XD 2UVEA 1W72B 2VE6B 2X9WA 3TIDB 3DMMA 3D0VA 2VISA 7FABH 1J86A 1B0RB 3AXLA 4ZPVB 5I19H 1AIFA 2CD0A 2VMFA 4KUZL 5F1IB 1KTLA 1TQCB 4K07A 3QWRD 4U3XA 1V3MA 3QUXC 5EO1A 1CE6B 1EHXA 3U1SH 4L3CA 5BRZB 1H3PL 1BVKA 1E4KC 1R3HA 5SX5H 3SDAD 1JMXA 5ALCL 4XNMA 3SGEH 3D85D 3TFKC 1SEQH 4KKCC 5MEQB 5IFAH 2YC1A 4Z78A 1IGML 2AXJA 1TVBA 1T7YA 5J6HB 2J3SA 4P2RD 3FOMA 1S5IL 3OR6B 4GUPA 3LKPA 5KOVC 3OKMA 2VXVL 1IM9A 4CW1B 3AVEA 2Q6WB 1JFQH 2MKLC 5GIRA 4HAFA 2V5YA 4YXHL 4KHTH 2ED9A 3WO4B 1KJ2A 1RUPH 3JUZA 4U0QB 2V5TA 1S3KH 5DURB 3J7HA 5F3HB 4I4WB 4NQCE 4NO0D 1NCWL 2JK5A 3NIFF 43CAA 3CAFA 4XCFL 4MJID 3J8F7 5D7JD 1NANH 4XWGL 3T8XB 3OGCB 1TJIL 4TNWF 5IVZB 1OSPL 2DMKA 4U3CA 4F2MB 1YQ2A 1BIIB 3E2HB 3SJVD 2R29L 4PREA 1ZT1B 2E6QA 1S7XA 3MZTA 3HUJE 1QBMH 2BCKA 3DBXB 4QWWC 5FFLA 1DUYB 5DUMH 4KH2A 1I1AA 5ISZB 2F15A 3MODH 1XGYL 1ORSA 2UWEF 5ETUB 1YEKL 5DJCB 1IILE 3G5XB 3PHOB 4POZC 3I2CH 5IMMA 4KC3B 1RMFL 2Z8VC 3QIBA 5TF1H 3RKDC 1JWMA 3TN0A 3O3BB 4WWKA 2FD6L 4JM2C 4IHOB 3RWFA 3BP5A 2EYSA 3JV6A 4MA3B 2AXGA 2VLME 4HIEA 4IOIB 2N7BA 4LVHC 3VD5A 5EU5B 3VXNA 2B5IB 3G5ZB 3MRKB 5A2IH 3FO1B 3TBWB 1DE4B 2CDGA 1INQA 1NCDL 1RU9L 2IEPA 2Q76A 5C0AD 1NSNL 1Y6KR 3U7YH 4XVUD 5HGBA 3N1FC 1RVFH 5F9WC 3VXPB 3GSNH 4AL8H 2BMKA 4N1EA 2R23A 4GBXD 3WFZA 3WLWC 4M1GL 4MNGE 5FUOH 4NZTL 2VR5A 4LGSB 4GG6B 4OLXL 2C9AA 3BXNB 2ADJA 1G7JB 2ZCHH 4OLEA 4UV7H 4HKBB 2NX5D 4JFQB 2Y23A 4KFZC 1XF1A 3HMXA 1I8IB 2BHUA 5DHYA 1W0VB 1OY3B 1FRGL 1UKSA 4YHIA 2BK8A 4GRLC 4HWBL 4I9WE 4LSRL 4AEIH 1HQRA 1EGJL 5JLZB 3DYOA 4EDWH 4OB5H 5D2LA 35C8L 4F7MA 3RNQB 2UY7A 1FAKT 4ZUVA 1J0ZA 5JIKA 2FL5A 4AYFA 4XP4H 2ARJA 3CX5J 4XC3H 5EO1B 2ZOLA 2Y5EA 1C08B 2DQIL 3TBSB 3NFNB 4AT6B 2V2TB 2HFEB 1T0MA 1LO4L 5JW5B 5EN2A 4MS8D 3CFEA 1GL4B 3C5ZA 1U8KA 1UC6A 1UVQB 2XWJB 1OP3K 4QO1A 5GGTH 5C09E 3SE4C 1T1YA 5D2NA 1Y6MR 4KUCD 1FL3A 4PJXE 3VWJB 3QFJD 4JHWL 4MCZA 4OSUH 3OQ3B 4MXVF 2W1NA 4AIOA 3WEXB 2F5AH 3O3DA 2RIKA 1A6ZB 5C6WH 3OX8B 1IM3A 4JFZL 1KCLA 3H7BB 3UTPE 5C0BB 4P5MA 5E0QA 4IMKC 4MD0B 4D9QD 3LN4B 5HVGB 3KLHC 3WJJA 4U1JB 5GZNC 1G7PA 2OR9L 4U1MB 4XP9H 4S1DC 5DD3H 5K9KA 1IRAY 2X4TA 3WIFA 5L2KA 3FQNB 3HG1D 2J2ZA 2APTA 4L29A 4P2CG 3KAAA 4L3EA 3GSRB 4PLJC 3IF1A 2K3TA 2YHGA 5EZLB 1MUJB 4D3CH 4OT1H 2J8UE 3CSGA 5AWNH 3PQYB 4GMSL 4LCUA 5T33L 1XGTA 2J5LC 4GG6F 5J3HD 3MUHL 4MX7B 3MRBA 1KPRB 5D1ZB 3ARGB 4WO4A 1D5IL 4JFEB 2ENSA 3HCVA 2XTJD 4HK0A 2ADIA 1JPSH 4Q2ZB 4OI9A 4P5TA 5MI0B 4APQC 1BECA 4PJ8D 5B38B 1V7ML 2FDBP 2E7BA 4PJDA 3ZSSA 1XIWB 2DJSA 3WIFB 5L2KB 1OT1A 1GJIA 2P5ED 1YA5A 4L8DB 5C2BL 5DQJB 4NKQB 4TPRH 1P4IL 4OFKA 4XNZC 3UPAA 2CDGB 3PABB 5BJTA 3H7LA 1MVUB 3DRQA 3HZVA 15C8H 5I18H 4QRSB 2DJ4A 3LKQA 1IC7H 3O6LL 1T3FB 4X9FA 5LGJB 4OCSL 3ZDXE 1FZKB 4OGXL 3T0VA 4J8RB 5EC2B 5KSVB 3OJMB 1S7SA 2FIKB 2D9CA 5KW9H 4G9DA 3SE3A 4P4RB 2HAZA 3WV0A 4QRTB 3WNPA 3GSXA 1QSEE 4Z7NF 2G5BA 3ARZA 3LQAC 2F53E 5DYOB 3I6KB 3P11L 2CLZB 4AEIL 3BZEA 1BQUA 3RI5K 4HC1L 3TO2A 1PKQB 4FQHA 4APQB 3LH2H 3TO4B 4Z7VF 1Z5LA 5FYJU 5A3IC 1MY5A 4KGJA 4MD4B 1W0YT 4NZUL 2FX7H 3ZDXF 1QEWB 3MRFA 1CDBA 2YOCA 4LLDB 2JELH 4U0RB 1ZAGA 3RL2A 5MEPA 3EJYD 4DWHA 2NY2B 4G8GA 1G6VK 3C5JB 3MGTB 4U05A 2MCG1 3VGBA 5LWYL 3HRZA 4LVNC 3FO0L 4GW4B 4R97C 3MRGA 3PWJA 2FBJL 3IT8D 5HDQL 1X5IA 5H37G 5GIRB 2H2PD 3MRBB 2GHWB 4QHLA 1IFHL 5CJBA 4GFTB 3UTQB 4X4MA 1MCEA 5FUZL 2MJWA 2VLKE 4Q6IB 3VXUB 4P9HL 5EOTB 1QHPA 4E41A 4QHMA 3QHFH 1QOKA 3EAKA 4EOWH 5HHME 2KBGA 4NQDD 3V8CA 3RHWK 4PRPB 4KK6C 4L29B 3BAEL 5EU6D 4P5KB 5EO9B 3UEZA 1T4KA 2DM2A 3R06A 4BSWA 1DDHA 2OX5A 5E2JA 4JRXE 1GRWA 5D1QB 3KYOB 3K8KA 3H9HA 4MQXC 1UH2A 2VLLA 2VLKD 1G7IB 2C3GA 3O0RL 1REIA 4MLSA 1KIPB 3OSKA 4UQ2B 5EWIL 4R4BB 4GXUN 1W0WA 4XVTH 1AKJD 5KAQG 1R3IH 1CF8L 2GYSA 3OR7B 1AP2A 2C1PA 2PW1A 3B8SA 3I02B 4K23H 5TH2A 1NDMA 2HJFB 3REWB 5CBAA 2QSCH 2V7NA 4NNXA 5T1KB 3TJHC 1R3JA 1W72A 1CL7I 3MJGX 3QUXB 2GQHA 2F54E 5GRWA 5D7JB 1UACL 4XHJC 2YBRA 3KLHD 1HHHB 4PV9A 4E5XB 4CVUA 3IJYB 3SDAA 1F00I 5DRXB 4XVUC 4X7SL 3F62A 2X4QB 3KGRA 5K59F 4P23B 5D2LF 1VESA 4MD0A 4RGND 3NH7H 2DQTL 5CEZE 1J05B 4J4PD 3NAAL 1ADQH 4RFEA 3CMOH 2BX5A 4L3EB 3FRPA 3ULUE 1YEHL 3QNXA 3RVWC 3X17A 2XRAL 3SKMB 1CICD 1S5IH 2HMIC 1DLHA 2HTKC 1LO5A 5I15L 1OGAE 3S4SB 4F57H 5HGDB 5IFAL 4LLYA 1KPRA 5D1ZA 1L4IA 5F7WC 2R2HB 1KTRL 2G9HA 5GGQL 4YHNA 4BJLA 2AJUH 2F19H 4OM0L 1WWCA 5CP7B 4X7CC 1RI8A 4RQQB 3QXDA 5D1XC 5DS8B 3RKPA 1H15A 1TQBB 3SO3C 2X4RA 5FGBC 4FQCH 4G9DB 3KPRB 2FJFA 1MIMH 5JORA 4P2OC 5ACMA 3RWHA 4OZIB 3ARRA 1BFSA 1CVSC 4F7MB 4WW1A 1T4KB 2OQJA 1KULA 4WNQA 1NCWH 4LF3B 2EKSA 4JAMA 3ARVA 4EUPG 1RJYA 1PKQA 1YEJH 4MAUH 5IM7A 4AG4L 1RIUH 1UM6H 2P45B 5D6CB 2IFFL 3E8UL 5IT2H 4QHLB 5DK0A 4MX7A 4YO0B 2GK2A 4BFIA 3BJLA 2C5DC 2NXYD 4LGRB 4HUXA 4MA1C 2ED8A 5IMMB 3NZ8B 5T1MA 3S34H 1CDGA 3LKNA 3QDMD 4ONFL 5FKPB 5JHDD 3S34L 1NQBA 3SHSA 3W39B 1N5YH 2W9EH 3H6JA 4PJBE 4HMDA 2EZ0C 1MCDA 2DQUH 2IPTL 3CK0H 1DQTA 5D7LB 1IQWH 1QD0A 3FB7A 4DGVL 1MVUA 4J2XA 1AGFB 1OT2A 4K8RC 4OIBA 3B2VL 4Z7WA 2Z8RA 3P77B 5CHNB 3NGBC 1RURH 1VGEH 4K7PL 2BOCB 2MHAB 4RRPA 2WP3O 3HR5A 1NJ9A 4HWEH 4N8PA 4R0LC 2H32A 1WWBX 1F6LL 4ZUWB 1EBAA 3QJHB 3ARFD 1JZ5A 2DLTA 4ZUUB 4S1DD 4OFDA 4XPBL 2JB6A 4Z7NE 2OCFD 3MV9E 4M7LL 1DBBL 5CEXB 1EGJA 4HIHB 3VXSD 2FEDD 2ZG3A 3WFEL 3LMJL 1OAQL 2X4SA 4KI1A 2ILLA 4IRSD 2GI7A 2APFA 2ZUQC 4X0KA 2A6JB 1OP5H 5T5NF 5LGHH 5C0RH 3VW3L 3DXAE 3PDOA 5GHWL 3OKKB 4KPHH 4U4BA 5DFVD 5JPNA 5TPWH 4LLDA 4CGTA 4KK5D 4QXUH 2DBJA 4NO0A 2RGSA 1JHLL 5AYQA 4L4TA 3LQZA 2XTJC 4POUB 1LDPH 4ZOEA 1CXIA 5DJXB 1MH5B 4N9OB 1UZ8B 5C0ND 5CIPH 3KPNB 3G6AA 3O2DH 5D71L 5DJ2B 3QDJD 5FXCH 4Z77A 2BSRB 2KQNA 3EDEA 3O9WD 3FQUA 4FN0A 3BQUA 4UNTA 3FN0H 4XTRC 3BPLC 3PP4L 5CZXD 3QAZC 3IU3B 4XVSL 4JG1H 4G6FD 2XNAA 5EG6C 1UJTA 1TCRA 2NZ9C 2WUCL 1S7VB 4FTVB 3R4DA 3VCLB 2XQYK 1MNUH 1J8HE 1VKXB 4F9PA 2FB4H 1KLUB 1NC2A 1L7TH 3OR6A 3LN4A 1AKJB 3OXRA 4NDMB 3U9UA 4Y1AD 5I75C 4ZS6D 1EUTA 5DJ8B 4OFYD 1TPXB 1Q0XH 2D7NA 2PCPA 1T0NB 3RBGA 5DA4A 4EI6A 5GS1C 4JFFD 4AENA 4F37F 3SBWC 3U9PH 1F3RB 3O3EA 4RISL 5E24E 5ADOL 1CT8B 4P46D 3PHOA 4JR9L 3NFSH 4OIIH 4U6TA 4X8JB 1VSCA 3NFPA 4K9EH 4G6AC 1EEZB 2EYRA 5DK2B 2XICA 4U6HA 1RUML 1KV3A 3WFHB 5CP7A 5IHZA 3OKDB 1L0XA 5B8CA 1L9NA 4NUGH 3C5SB 5D1XA 3IU4L 1S5HB 2BZDA 2YPKA 4WEUD 5D2LE 2Z35B 3NIDE 3SE4A 2P1YA 2AXHA 1PG7W 4Z7WF 1UH4A 1KN2H 1MHPH 3GHBH 1FNEA 5IQ7L 5C0EB 5KG9A 4QHNB 1KCSL 1JHTB 2Y7QA 4YFDB 5C92A 4F33A 2OK0L 3TVMA 2FCBA 1UCBL 2X1OA 5DGQA 4PJBF 3ALPA 4PS4L 1FFQA 5C3TA 2M8XA 1NCCL 5FF6A 3BRFA 3EYSH 3I84A 2R1YB 3ARQA 3K2UH 1MJJB 4DQOH 4JFPA 2VR4A 4JFOB 1J1PL 1X5GA 2PO6D 3KPLA 1RZ7H 1LEKB 1U42A 5T3XL 2AABL 4LCCB 4JJHA 2F53D 3GI8L 3OKDA 1F6AB 2FX8H 2CRZA 4HBCL 4ODHH 4GJTB 4Z76A 5LBSH 2JK5B 3DUUB 2YRPA 4DW2H 3PP3H 5J1TC 3C6LB 1WBZA 3EYVB 5DD5L 3EOAA 3W9EA 1SBSH 4JRXB 1BOGB 3EGSB 1HXYA 1GC1L 4POZD 4OBSA 5F96H 1NBYB 3GHEH 4NO3B 3VDCA 4R90L 2XN9E 1RJZB 4UDTB 5DJDB 3HNVL 4KMQA 2PR4H 4MMZC 4XHJD 1FNFA 1TNNA 4G9FE 4PJAE 1RUKH 3QQ4B 1I1YB 1J5OH 3PWPE 3PGFL 3HZMB 3ARPA 3U30B 1BJ1H 1CFTB 4NFDA 2VXUL 2ZPKL 2VE6A 1J12A 3B43A 4WV1B 2AJVH 1N6QL 4TQEL 4LGPB 3WLWD 2AI0L 1MEXH 3BWAB 1NPUA 3EJZC 5IBUG 4XPTH 4HMEA 3G5ZA 3MRKA 3SDCC 4PLKC 2XQBL 1Q94B 2D0HA 3FZUD 4LPYA 3RVWD 3WCYA 4NKMA 4JKWA 1ES0A 4HUMB 4HX1B 1SY6H 3PP3K 3WLBB 2Y06L 5I1JL 4M8VA 4K55A 2FBOJ 1HQ4A 2AKRA 2F58H 3O4LD 4N5ED 4BELD 4EN3B 5E08H 4PR5B 3DX8A 1NMBL 2YXFA 4YDJA 2CXKA 5IB5B 2B39A 5I18L 3TFKD 2NY5H 1C8PA 1ZHNA 1ZGLM 4XCCL 1P84J 1UJ3B 2OR7A 2AJVL 4U1IA 1N6QH 1KEGH 4ENED 3LZFH 2VITA 1WFTA 2R56L 4QTHA 2X1XR 3TIDA 3FQRB 1S7TA 4EKXA 5C7XH 3TT1L 4JEGB 4JHWH 5FKPA 4WI8A 1MRCL 5DJZA 3TVMB 3MRJB 3BUTA 1J1XL 2NY0D 3MREB 4L4VA 4MJ4A 4HBQA 1IEAB 1NGPH 5B4MC 3NCBB 3TYFA 3Q6FB 5IW1B 4FQQB 4K8RD 1JI1A 5EOCJ 1R3HB 5LXGH 3LKPB 3NACL 4DZBB 3TF7C 1YNTB 1H8NA 4O58H 2Z93A 1JHKH 2O26U 4OLWL 2HFFA 2B4CH 1OWWA 4JDZA 3VXOA 4RGMC 5TE4L 1FCCA 4MDIB 4S2SB 1VFUA 5HDBF 1AD9A 3X14B 4WUUE 3RVXC 1MCIA 5CSZB 4UU9A 1TLKA 2AI0H 5B38A 1M7DB 4LSVL 1OB1A 2OR9H 4XP9L 1OF2B 1QQDB 3T04D 5I1EL 4HDIB 3FQXA 1X7QB 1NAMH 3IDUA 4S1QH 5EC1B 3RY6A 4QHUA 2D31B 1I3RB 1MFAL 2FYYB 5D7LE 3QIWB 4P5TC 1A6UH 4EUPH 1H8OA 4PJXF 1A1MA 3FMGL 1R24A 4PIRF 5EPMA 5FYJH 1NMAH 4ORGB 5GSVB 2FX9H 2ZSWB 4QT5B 1N7ML 4JM4H 2JCCE 5FO9A 1WEJH 1H5BA 4KXZH 2V5SA 3INUL 3RPKA 3QUKA 1PEZA 4PJFB 3LS4L 1VFBA 4JO2H 3GUTA 3QP3A 5IKCA 3MOQA 1E28A 3O3EB 3BH9A 5CSZA 2VC2L 2XA8L 3MRRA 1O0VA 2OP4L 3IDGA 5DVLA 4D9LL 1AGDB 3SDYH 1TTFA 1JTTA 3K8MA 4ODUB 3HNTL 1U8QB 3O2DL 5D7LD 4EBQH 4K9EL 1MI5E 3GZKA 4Y4KA 5C08E 4NOBA 1FGNH 2I07B 3ARTA 5BO1H 1II4E 1Q72H 3UPRB 4PJIA 3H9SA 1I3UA 5JW3H 1P4LB 3R1GL 3SGDH 1FRGH 1KJMA 1R5WA 2AW2A 4NM8L 2PXYB 5E8EB 1PLGH 5E8NA 3W9DA 4DCQB 1UCBH 1F90H 2APXA 1YECH 4QKXB 1T83A 4WENB 2OK0H 4D0BA 3ROLA 1FVEA 2A6KB 3IDMA 1KFAL 1KF9B 3VG0L 4HFWB 3RFZC 2IC2A 1U41A 2VLJD 2BXYA 2DMCA 4UBDC 5EBGA 4MJ6A 1WWAX 1G9MH 5C09D 2ZNXA 4N0UE 4X6CB 5C08A 5JXED 4E41D 4PP2B 1JJUA 2RJMA 4LSQH 3HTLX 1JE6A 4PJAF 4G8FA 1F4HA 4MXWH 5JLZA 1P2CB 1IL1A 4FTVE 1ZS8B 4Y19B 2NLJB 1F58L 4L4VB 2EH7L 2FO1A 1CFSA 1KPUB 4JR9H 1I1AD 1YUHB 1KB9K 2J12B 3BMWA 1A6VL 3BZEB 2ZJSH 1JN6B 3U6RB 5E99H 3QHZL 2RCSL 4DVBA 5D1XB 4YBHA 1R24B 1ADQA 4D0BB 1J0HA 4X99A 4JVWA 2H2PC 4A2MA 3IDIB 5IQ9B 5DRWA 4BQBA 4G8EB 2EDKA 1N5YL 3OBAA 1QR1B 1WZLA 1YY8A 3CGTA 3NZHH 3EO1A 4KDTC 4UTBH 1CQYA 3QUYB 1B4JL 4R7DB 1PX4A 3K81A 4KJQC 3HHRB 3DHMA 3LKOA 1C5CH 3SDXE 2KPNA 1XGQA 1NC4D 5DJAB 3SQBA 1A3LH 4NRYA 5L88H 3OJVC 3Q1SL 4HPOH 3W11D 3C8DA 2BFVH 3BN9C 1KLFA 1JNLH 3KPOB 2BSED 3BYYA 2JIXD 3GSXB 4AMKL 1QNZL 1NBVL 4WFGE 2C4XA 1IEAA 2GTZA 1U8MA 2P8PB 2D31A 3DO3A 1EAPB 3U0TA 1MRFH 3EDKA 4ONGH 4L9LA 5CBEA 1XF3B 5ID0A 4DFIA 3DXAA 3CSYA 5C0RL 4Z95L 3KPMB 2D7TH 3MLUL 3L95B 5GGSY 2X10A 3PHSA 4LEXH 1UKQA 1AHWA 3VXQB 1EAJA 4Z0BH 3WD5H 3MBXL 4C83B 3C5JA 3MGTA 2MFNA 2NY4C 4YK4C 3KXFE 5I6XC 4PGBB 1YPZA 5J3HC 4ZFFA 1FYTB 3PGDB 5BVPL 1MQKH 3MC0A 4PJDB 1L6ZA 5KSAD 5BZWB 5ACZB 2NY1D 3IFPA 4NBXB 1PVHA 5EA0H 1NAMA 1T7ZA 2IANB 4JKPL 3PGCB 1ZGLB 4AG4H 5F7FA 1A6VH 2V2WB 3GGWA 1CICC 2NYYD 3ULVF 1GGBH 3QDAA 3P9WB 2CDEB 4ZOCA 1DEDA 2A6KA 3IDMB 3CFJA 1RHHB 1AGBA 1K2DB 3OTTA 2BVOA 4FFWD 4U6VH 3HG1A 3ZDZE 3ZKQD 2IPTH 2Z8SA 1IKNA 3ESUF 1GXEA 5JXAH 4U2YA 1IGFH 2WIMA 1FVCB 2A2QT 3QIWC 3VG0H 3KPSB 4ZFZA 2VDPH 5IJVA 5A3ID 1I7TB 4GRMA 3KYNB 3PGDA 4M93B 3ILQC 4FFVC 1XZ0B 3BGFC 4HD9A 2BRRH 2WIIB 3QZWB 3HZYB 3GJEB 3HMXL 2J7LA 3OWEA 2Z9TA 1CXEA 2IMNA 3ILPB 4NKMB 5IMLB 1ZXQA 2XRAH 2XFXB 3BPCA 3WMSA 4RZCB 2Y36H 4NCDA 1XIWA 1FGNL 3DVGA 3OKEA 1A9BA 3EYQC 1UA6L 4PRPA 1X3DA 1FDLH 4FP8H 3EO1B 2P5WB 2WUBL 3T77B 1BLNB 2W65A 4LHUB 5D5MB 4XBPA 2VL5A 1T2QL 5CS7A 5GRUL 4OUUB 4OCMC 4PTTA 2BCKB 4N9GB 5CSBA 3PL6D 3AREA 4W4OC 3ZHKA 3P4NB 4FFYL 1BWMA 3GSNB 3MRNB 3RVTD 1D5MB 3UJIH 4A6YB 4JO4L 1I3GH 3FT2B 1KFAH 4F7CB 1BQLH 3OKNB 4WI3A 2JJUA 3FN9A 1MI5A 2Z31B 3AAZA 4IHOA 1IAKA 5C0JB 1INEL 2NW3B 2YUXA 4JHAH 4G43A 4I3RL 4NZUH 2BOBB 1VERA 4TSAL 2A6DA 4TSCH 2VDLL 5HHXL 3VXUA 3AS0A 2DICA 3RVXD 3SKJL 4DZBA 4H8WH 1G9NL 1UM4H 3V6OC 1AGBB 5FA4B 1G9EA 3ROLB 3WXVL 1TTUA 3FONB 1SM3H 2NQCA 2EIZB 4O00A 2G2RA 3ZKND 4NSKB 5JMRA 4BZ2L 4X7SH 5I1KL 4P9HH 2BVQA 4WVRA 1M7DA 4D2NA 4O58L 4UUJB 2W9DL 2YPVL 1BFOA 2VC2H 5F7DB 3ZKMD 4AK1A 3TA3B 1EHLL 1UZ6F 3CVHH 4C56E 2DD8L 3VXQA 1W0VA 3RUGF 1NGQH 3H7BA 2IBZY 5KS9A 5FB8A 4GG8A 5C0NC 1HINH 3LEXB 2P49B 4HUUB 5F7KC 4KKAD 5EWIH 1DVFC 3LIZH 5D2LB 4LHUG 1MFBH 2QSQA 4RAVB 1MLBA 5IK3B 2ESVE 2ICEA 1KCUL 4K7FA 2HJLB 5EUKB 3QWOB 1IT9H 5HHQA 1D5IH 5JXEC 1T22A 4U7KA 5T1KD 3P9LB 2OBGA 4OLVH 4Y8AA 2BSRA 3L3GA 3UYOD 4OLWH 2R9HC 4BUHA 1F2XK 3S5LG 3RTQB 2M1KA 4OD2A 1IC4L 4OLUH 3S3JA 2H6PB 4CVXA 1GGTA 1I1AC 1SJEB 3G04B 2B20A 1FZMA 2BSTB 4KVNH 2N1KA 1GAFL 1JVKA 2VXSL 2A9NL 5ALBH 2FNBA 1EV2E 4PJ7F 1U93B 2AJXH 2NXYC 4NQXA 4PPTA 2NY6C 3IAPA 5E2UH 2Q87A 3TZVC 4P5MB 4OJFH 4LKXB 1IEBA 3ARUA 5I1GH 1X5JA 2E27L 4PJHA 4X6CE 1LD9A 4LCIH 3MLTB 3QXTA 5FYLD 2MPAL 4OGYH 5BVJB 1F4XL 1AO7D 4NNPL 1T1YB 4QTIL 2YRZA 5J56B 1MUJA 2OI9B 5F9AC 1JPGA 5HPMA 3AM8C 2EXYD 3WUWB 4F7EB 2WBJD 5EU6A 1XGUB 2NW3A 1NMBH 3WXWH 1WGOA 4BSVA 1T6VN 3GHEL 3MNWA 3P9MB 4PJGB 1WZMA 2F8OA 2A9NH 2E9WA 1VFAA 2W9DH 3FQUB 5ANMB 3EYQD 5EFIA 3FTGB 2VR9A 1IC4H 1FYTD 4TYUA 5IP4A 5CEXA 2GJJA 4QNPF 4IRJB 3P0GB 1ETZB 2PO6C 3VRLE 1KB5H 2XQBH 1OAYH 3JVGA 3PL6C 2HYMA 1JNHB 5DZNA 3L7EA 3OKKA 3TNNA 5FHBH 1UM4L 2WWKO 3KNBB 3RWDA 4L9LB 5CBEB 2GUOB 4LASL 4OZ4B 4XPTL 1UB5A 5ICXB 3VGAC 4POYA 3K2MC 4OI7A 5C3LD 4R0LA 4UQ3B 2P48B 5IHBA 1YNKH 1RK1B 2RAMA 4MVBD 3TV3H 1EMTL 1TZIA 5DC4B 4ZYKA 3BEWB 3LRHA 4LCCA 5AEAA 3IJHB 3MRMA 4TNWK 5JHLL 1MWAA 5DSCB 1FPTL 3UJIL 3AXLB 3LHPL 4AM0B 5KTEL 2NY4B 3UC0H 5E00B 1TZHB 3C09B 4KVNL 5E03A 2DMBA 3IFLH 4XP5H 1N64H 4H0IA 2QQNL 3SGKA 1HI6A 2KZ1B 5FGSA 2X4RB 1CG9B 1BZ7A 4PRHA 3HMWL 5DD5H 4Z7VE 1DBJL 1FO0A 5DFVC 4XNQA 3C87A 4LQ1A 4PJHB 5KSAC 1DQML 4QEGA 3T2NL 4JPIA 1G9NH 5EOQL 3L3DB 1QSED 1PW3A 4TTDD 2EDLA 5TF1L 3P40A 5EUOF 3G5XA 1RZFH 5I0DA 3DO7B 1S7RB 3IDNA 5T3ZH 3VMOA 4ZS6C 2EICA 5FOJA 2IANE 1VA9A 4JZOA 1EO8L 1BFOB 3KS0H 2WK2A 6FABH 1UT9A 1N3NB 2R2CA 1DVFD 1Y18B 5BV7C 2O93L 5HY9B 2NX5E 4LVOB 5B39A 4JO4H 2ZUVA 1EERB 1GC1C 5EOTA 4E41B 4Z7VA 4UT9L 2EDBA 5LQBH 3TCLB 4PYGA 5I1DB 2Z93B 3MBEB 5FCUH 5FKAB 4BUGA 3V5DA 3QEQA 4JN2B 3RA7H 4X6EA 3M45A 3ARDD 1TCRB 5IW1A 3VXSE 5DQDH 3U46A 4HWZA 5ID0B 2GT9A 4HJ0D 1A6PA 3T0AA 3V95A 1RUMH 3TA3C 3HPLA 3HRZB 1V7NH 3AGVA 4JFDE 4LAQL 3MRPB 3U82B 1E0OB 4YK4B 3JVGC 5I6XB 5H94B 3MOBH 1QLFA 4NN7B 2PYFB 4XP6L 4P2QB 5MI0C 1G6RH 4PGZA 2GK0A 1U58B 4Q0XH 1ZLVH 4IRZH 4YHNB 3L3IB 3H3PL 1CGVA 4J23A 2FD6H 4C83A 1TDQA 3X3FH 4M6ML 3FT2A 5F71A 2VZ3A 4Z7VB 3W0WD 4HH8A 2BRRL 4MD5A 2H3NA 2P5WD 1KGCE 1IJ9A 5EU7E 1J0YA 3VJ6B 5D5ME 2VDRH 4H0GA 2N4IA 5INCA 4M1GH 1Q0YH 5KZCB 2MNUA 5HGAA 4HLZH 3QPQD 1ZHLB 3TM6A 4L9DA 4QXWA 3AREB 1AP2B 3OR7A 3HE6A 1NUDA 3KDMA 1E27A 1MHCA 1QNZH 3VFSB 5IJKC 4PJCE 2VDMH 1CR9L 3T1FB 5I66B 5DHVH 4HIIA 2FR4B 3DIFA 3ZKMC 4GG6A 1P6FA 4ZTPL 2AXFB 4NC1E 5IFJB 4G9FD 4DK6A 2APBA 3WL9B 1KIRA 4MYWB 3T4AA 4P9ML 3KJ6L 1NBQA 3X3GL 5GHWH 4P57A 4QRRA 2XXMB 5IOPA 1ZANL 3D2UB 4P2OB 3PIQB 3NN8B 2C26A 5IHLB 4MB3A 3S3PA 3K1DA 4YXLL 2AJZA 1KNOA 4LU5L 3HCVB 1W72H 4MA8L 5DSCA 3DXAD 2RHEA 1U36A 1LK3H 3GBLA 3FB7B 1RJZA 4KTDL 1AQKL 2QLVB 3O45A 4TVSa 3LQMA 4FTVD 4NT6A 3PWPA 1SEQL 4L8SA 3JUYA 1XF4A 1KBGL 4BFGA 5BW7A 3FO2A 3F5WB 2W65B 4LHUA 3FOLB 5E99L 5D1QD 3O2VH 4GBXA 3BGFB 1NBVH 2XZZA 3QQ3A 3AY4C 4LVHB 4PB9H 1KCVH 1UXWA 1QR4A 1JK8B 3I50L 3KXFA 3GI9L 1WBXA 1PY9A 4GS7C 1ODAA 3HAEA 2X41A 5FECA 4H5SA 3QFJE 4NQDA 1Q9KA 4JGJA 4KRLB 2K7PA 4N0FB 4F7TB 1A3LL 4O5LH 1XR8A 2YWYA 1J10A 5MEOB 1P5UA 3FAWA 3FCTB 4ZQKB 4NBYB 5L8JB 4RWYL 1R5VB 3BT2H 2J8UF 1OHQA 2NY2D 4XPGL 3QQ9C 4YGVB 3EYUL 5FO9B 2YKLH 3ES6A 4LSPL 5C0CA 3RRQA 4PRAA 5K9QG 3C60C 3HE7D 3VFUA 5IVOA 1E4XI 3WS6A 1JYWA 3H9ZA 4LMQI 2ITCA 4LAQH 5TDOA 3RJQB 2JCCA 2IF7A 5D7JA 2ICCA 4B5EA 5C0DA 1VEPA 3LV3A 1U93A 5F7UA 1NDGB 5E5RB 2VJXA 1TZHA 3MLYH 1CLYL 3BGMA 1Q9OA 4Y16A 3RWIA 1XT5A 4M6OH 2ICWB 4Y2OA 5DT1H 4NJ9H 5E5UB 5T5FL 4QHMB 5FGCE 5DK3A 1G9ML 5DJ8A 4XI5C 1K6QH 2R4RL 4ORZC 1KELL 4XC1L 4H0HB 2CKBH 4MVBC 1F6FB 4F57L 5HJ3A 1PAMA 4K23L 5I15H 4PJGF 1R3IL 4P3CL 5I16A 2IPKA 3IVKB 1QRKA 4HS8H 2V7HB 2P5EB 3MJ6A 3L3KB 3MJ9H 3FHAA 2UWEA 2ENYA 3MRCA 1T20B 3UYRL 3HAEH 5GISH 5TH2B 4EZMA 4ERSH 1XH3A 1QO3B 3BO8B 4I77H 1F5WA 3S8WA 3V0AC 3BOVA 2FZ3A 3CUPB 5FYLE 1ADQL 3VRJA 4NQDB 2OTPA 1P4BH 3SDYL 4P5TD 2XWTA 3PWVA 1EUUA 1X7QA 1HIMH 1ZHBA 2QJDA 4IMLB 4JY4B 3MUZ1 5DYOA 3LEVL 5E7FA 4I0PB 4D8PA 5INCB 4BSWB 1JGLH 1UM5L 1FHGA 2DKMA 2DRUA 4HKZB 1E4XH 1R5WB 4PJBB 2W0FB 5IVNA 2NTSP 1ONQB 4NRXA 3KPTA 4X98A 5EO0B 4K3HA 3FO0H 3SDXF 3QO1B 2OSLA 3IXTB 3WBDA 3CVHB 4X5WA 3T4YB 5HSFA 2X44D 1EMTH 4ACPA 12E8H 3MRGB 3PWJB 5FO7A 3JV0A 4ZUWA 3NCJH 4HKJA 5GJSH 3O8XB 3WN5B 2MWCA 1AXTH 1M6OB 4NO5B 4DVRH 1AGDA 1MCOH 5TJWK 4MB4A 4KQ4H 2NLJA 2J8HA 3QNYB 3D25A 1L6XA 4Q58C 1Y18A 1G7QA 4ZO8A 3CFCH 4JRWA 3MCKA 3GSQB 3SCMC 4EOWL 5IVXA 3ZHLA 3HB3D 5E08L 5IEHB 2RR3A 4MXQC 2FJHB 5BRZA 2PKDA 5GGTA 3MLXH 4JFFB 3R0NA 1OD7A 2EDXA 4LLMA 4LMQE 5DJDA 2DQFA 1FAIL 3B9AA 3UC0L 3VFGL 3KDMB 5L8KB 3BN3B 3IFOA 3AS1A 3EOTL 5JZ7D 1FYTE 1E28B 5E8EA 4PGJA 5FUCC 3FB5B 2C3WA 4NN5B 2V7HA 3RGVA 1CVRA 2MPAH 3MV8E 2JIXB 1YDPA 3MYJB 3QDMB 4JZJA 2BSSA 1JV5A 4YWGL 3W0WB 2NCMA 2VNCA 5DHYB 1MCWW 4YDVA 4BFIB 1H3UA 5ERWB 4HEME 5EULV 3VXTA 5K9OB 4FG6D 4DVBB 1SMAA 3ULUF 2X05A 3LH2L 2VN4A 3D18A 1R3KA 3TPUB 4I18C 1IC5L 4JGMA 1V05A 4FQXB 1CFSB 2YEZA 4KVCL 1O7SA 5FM8A 3ZDYE 5FF6B 2VLRE 32C2B 1GAFH 3S37L 1I9IL 3TC9A 3ZT7A 4ZXBB 2YD8A 3GSWA 3VFGH 1ROWA 3CZFA 3UTZA 4UILL 5HYQA 1FAIH 4RGOL 3QEHA 4GRLB 4GKZA 4H25A 4UOW0 5E6IB 5DRNA 1ZA6B 5LVEA 1A02N 2OYPA 1SVCP 5GZOC 1W2KT 5I0ZA 3MXVL 4NQCA 5FK9B 4MCYA 1U8NA 5K9JH 5FIEA 3ZSTA 5CGYC 3L3OB 5A2LH 1F4XH 3S4SA 4LVNB 1EEZA 3DJ9A 2YS4A 2YMXH 4OCWH 4IIQB 4HWBA 4G6JH 4K94L 2MKWA 4PD4J 2FO4B 4Y4HB 4DVRL 4GT7A 5B21A 4L9LC 3CC5B 4OLZL 1V7MH 1A4JA 4MSWB 1BGXH 5D8JL 2VQ1B 1RQ5A 2VUYA 2PYEA 4KK5C 4OF8A 4WJ5B 5HYFA 4JDTL 1HINL 1C16A 1D6EA 2HFFB 4NSKA 1S9KC 4R8WH 3VH8B 2ARJB 2VXSH 4M7JL 1CGUA 1FZOB 2R1YA 3O9WC 4NUGL 1DQQB 3T65A 3JWOL 1DTUA 4X8JA 2JJWA 4X6CF 1NKOA 3GK8L 5DXWA 2FHBA 3PXHA 2BVUA 3QIBD 3BQUB 4YC2C 1A1MB 1ZTXL 3C6SB 3DPBA 3PHQB 3ULVH 4R4FL 3HG1E 8FABB 5GJSL 1HILA 5AG8A 4EDXA 2X4UA 4DQOL 1C16B 3U7AA 1QSVA 3ETBF 3D87B 3PWUB 5E94B 4ZFOB 4RMVA 4KAQL 1YEDA 4JHAL 5IHUH 3I6LE 2FHCA 2EYTB 3VCLA 4ONHB 1RUKL 2ZP0T 5DUBA 1HNFA 4X7EC 1CGWA 3O4OC 5I8CA 4CN6A 2FLRT 1VHPA 2QKIA 4FQLL 1PZUB 1B6DA 3CFKB 4LL9A 3V0VA 1LO4H 2W60A 4V1DA 1U3HD 3M8OL 5FK9A 3LDBB 5E6IC 1OAZH 5GGVH 5CZVH 5GRUH 4BKLB 2IANA 2HP4A 2WIIA 1JZ7A 5IEKB 4O2CA 4DN3L 4OFYA 2YPLA 4QCIB 3IJSB 3C60D 3HE7C 2L4OA 4PRIA 1G7MA 4MMXC 3QH3A 4GXUM 4OB5L 3BKCH 43C9B 3U30C 1Z5LB 5FHAH 1IKFH 4G7VL 1AFVH 5TPWL 1EXUA 3CPLA 4I0PD 1IEHA 4ODXA 1AGCA 5SWZA 3UTTE 3IDYC 3IXTA 1HHIB 1XGPA 4XC1H 1RJCA 2EDEA 2QV2A 4JG1L 5E2VH 1J18A 4QRTA 5GRZA 4X83A 2ADGA 2NY6B 1Q1JH 4XPBH 4PJDF 1OTSC 3C9NA 2BOBA 4MQTB 3QXWA 3SGDI 3T2OA 4NNXB 5T1KA 3CFBB 3L3JA 1S9XB 1L7IH 2YPKB 1U92A 3UTTD 3EW3B 3BSZH 1MFCH 3SE8H 4IS6B 4LCCC 1NGWA 1KJVB 2F5BL 2WV3A 4XNUH 5HD8D 1MCPH 3WDIA 4LLMB 1HHKA 3BESR 3TNMB 4NN5C 2FSEA 4U49A 3R8BB 3U9PL 5EZOL 1CDCA 2DQHL 4HQQH 4EXPX 3DARA 3EBAA 1U8PB 2GAZB 2R1WA 3F65A 3P73B 5GZOD 1CS6A 3SE9L 3QDJA 5LG1A 2VL5B 4PLJD 3VRLF 1MQKL 1DLFH 4YHOH 3MV7B 4PJIF 4L4TD 3U7WL 3U83A 3EYUH 3RGVB 2YD3A 1WUNT 1FL5B 3FT3B 3OAUH 1I4FA 3NOIA 1JMZA 4JFEA 1AR2A 4M7LH 2NMSA 3CVHA 3ZKSD 3C6SA 2LTQC 1ED3B 4YBQC 1DBBH 3QNZA 3VFOB 4WUUB 2OMBA 5DRZB 3SO3B 4XVSH 3MLUH 1XMWA 1JF6A 2C4FT 4IRSA 3RDTB 5MEND 4NWUH 4PGCA 1MRFL 5DK2A 2FYYA 4M7KH 4PJ8C 5CGTA 3Q3GB 4U6VL 3BEVB 2ICEB 3VFPB 1DDHB 1QHOA 2XZAL 2R15A 3C08L 2IBGA 4I3GA 2ZZUT 4HH9A 4X6DF 4JRYD 4I8DA 4HPOL 5DC0A 4APQA 1LDPL 4YHYB 3O2WH 3C2SA 1JHLH 1V5JA 4J12A 1A7PL 4S1RL 2OJEB 4PJXA 2EC9U 2CR3A 1N5AB 3Q5TA 4NQCB 4LSSH 1A6WL 3OKOA 4M8QA 1B0RA 1MCKA 3DRTB 1CFQA 5JO5B 3B6SB 4O2FA 4OM0H 4OD1H 3HA0A 5D72L 2DBLL 1ZT4B 3OF6A 1YMMA 4QHKI 3WIIL 4HS6B 2UV3A 3WFEH 4N0YH 4Z6AT 4QRPA 5E9DD 1ZWIB 5D72H 3D3VB 4J8RA 1IAOA 4ZSOE 5ENWB 4WU7A 4I48A 4OM1L 2I07A 5ICZB 1GOGA 2WBJC 3KPOA 3PWNB 3MO1A 1RHHA 2HH0L 1JZ6A 3KLDA 2X9XA 3M07A 2OR8A 1YMME 3OZ9L 1MCPL 3MJ9A 4KK8C 5I9QC 1L0QA 2HA1A 4HGMA 2DQTH 3FQWB 1CDHA 4FNLL 3V4UH 1OLLA 2DJUA 1G7MB 3BH9B 5F9WB 3W5MA 25C8H 1EFXD 4JZJB 2WP3T 2N7AA 1JYNA 3OAZK 1NLDL 2I27N 1YEIL 3RZCD 5FYJD 2FJGB 4NZRH 5E2VL 1BFVH 4HIIB 2V7NB 2LFGA 3F7YA 1I7ZA 1ED3A 2PUQT 4Y4KB 2HVKA 3CX5K 4X6DB 1PLGL 3O6FA 4X9GA 2YSSB 2P8LA 3A6BL 1CDYA 2V17H 5D9SA 1K8IB 1F90L 5CLTA 4J3OC 5DVMA 4PRDA 4PJ7A 3VG9C 4GLRI 3NN8A 5AG9A 4CKVX 2UYLA 4UB0L 5EZJB 4P9MH 5DUBB 1J88A 5CGYD 4HQQL 2AQ3A 1M05B 4PUBL 3CXHK 3CLEH 5D6CA 3VXRE 4S1SH 1DN0A 1NLBH 4LLUA 1F58H 1JF1A 1SMOA 3MRMB 2ZSVB 1M4KA 3HAEB 2KQMA 2OS7A 3KYOA 1V8HA 1NFDE 2VISB 1KOAA 2I9TA 2Z91B 1OL0A 4JY6A 4MNQB 4PRID 4JQIH 5EUOE 4P2QD 3QXAA 4FQ2H 3QUYD 4GKOA 1G7LA 4WWID 3O3UN 2IJ0C 4YHYC 1NGZB 4U1JA 5F3BA 1FSKC 2ICES 5DD0H 5SX4I 1H5BC 3MBEA 1WV7T 1WIUA 1F3DJ 2DTSA 2MTPA 2R4SL 1X4ZA 4JFDB 3D0LB 4R4FH 3O0RH 1IZJA 2M2DA 5GRJL 3BKCL 4M3JA 4MNGB 3TN0C 1DJSA 3KPMA 5GSRA 3T09A 4OZIF 4LIQE 4EBQL 4P4KC 3HMWH 3HNTH 1AO7B 3WJLC 5CINL 2OXHA 5BVJA 4N8CH 1NUGA 4H5SB 3TBYB 1OAZL 1OW0C 4K3GA 3U4BL 3NCYP 3VWJC 3M8OH 4C55A 3BZFB 2P4AB 5CWSA 2VLJB 4LLYB 3QIWA 2B0SL 5C6TH 4L8BA 3VFRA 1JWSA 2FX9L 3MV8D 1LO3L 1EZVY 5TQ2H 2IPKB 1IQDA 2CMRH 5DJYA 5I8CB 4QTIH 4J6RH 5JW4R 1GZPB 1ZE3C 4WDIA 2N56A 4PG2C 4KAQH 1V3JA 4OLZH 5FYLL 1DL7H 5DK0B 2VERN 3STLB 2NY3C 4G8GD 4ZOBA 5CSGA 3RTQA 1WCBB 3GJFH 1QFWH 1CIUA 3RZCC 3U0PA 4RNRA 5A2KH 3VFNA 2X1WL 2ORBL 1ZLSH 4GXVL 1OD9A 1IGTA 1MJ8L 2E9JA 2D03H 3C9NB 1YN6A 3JWOH 1JWSB 5J9PA 4S11A 4KK8D 3QI9A 3I6LD 3F12B 5I1JH 2BVTA 3KYMB 5DJ6B 2B8OT 4X99B 5IBLC 2ZUTA 1QLRA 1K2DA 5FKAA 5C0CD 2OL3H 4B7LA 4DEPB 1NFIA 2CUHA 2AVGA 1Q9WB 1QFUH 4IOFD 2DIJA 3EIFA 2L0DA 2ZSVA 1GIGL 3SOBL 4AEEA 3S98A 1P4IH 5GGUA 1CD9B 2IAMB 5C0IB 1CTOA 2V5MA 3LOWA 4P59H 4WHCA 3GJFK 5D8JH 1OVZA 5C8JB 4HF5H 2YD1A 4UUJA 2P7TA 4HF5L 1QLFB 3DV6B 4B41A 2BNUA 2GKIA 3D25B 4XCCH 2IH1B 2XOTA 4FXGB 1INDH 2AJXL 3ZE2F 4HIHA 1KJ3L 3ULVC 3BRGC 5AD0B 2GTWA 5C2UB 3LB6D 1T7VA 2P8LB 1J8KA 4WUUA 3MNZA 2RFXA 5F1SA 2XKSA 4HK3J 3PWPB 2Y07L 3ARFB 4HLZG 4HPYL 3LVEA 3QCTL 2VKWA 2KH2B 4UIKH 4WO4D 4Q6IC 1KLGA 1MFEH 3FOLA 1OTTD 4PR5A 3RGVD 1IAII 2XG5A 2GFBB 4PJFF 5DDHB 3WFBL 4LRNL 3UTSA 4JN2A 4KVCH 4JPVL 4ZAKD 4ZTOL 3IKCB 5DD3L 4MAYB 4EDWL 3D69B 2IALA 4LPTA 1TJHH 1BEYH 2J8UA 3L5WA 4PD4K 4YIQB 4CVXB 4A6YA 4FA8A 2NY2C 2ATPA 5I8OH 2C7UB 4S0TD 1G7HB 2H32H 3RU8H 4V1DE 1NEUA 3A6CH 3EDJA 1CL7H 4BK4A 2FEEI 2PW2B 4TNVK 2QADD 3VFMA 4I3RH 4TNVF 5DRXA 5DI8B 5JHDB 3GNMH 2DTMH 3W0WA 4MNHA 2DI9A 3VE0A 4CVWA 3FN3A 3GMLB 2FEEL 3KR3H 2ZUWA 1KB5B 3H3KA 3TJEH 1KCSH 3DI2B 1MWAH 3LN5A 2OL3L 1GZQA 3GHBL 4N8VA 3NABH 3HI6L 4TOYH 1NANI 4MZ2A 3AB0C 4ZOAA 2B2XH 2WBKA 4LNVA 3WKNA 2VOTA 5KN5B 1NSNH 1IBGH 3PABA 5D1ZC 3E6FA 1T03L 2J88H 3BKMH 3DNKA 4W4NA 5EZLA 4BZ1H 2DM4A 4KDVA 2MQ3A 2O5YH 4LKCB 1UYWL 4I3SL 3WDHA 5ADOH 3SJVB 4TVPH 4U1NA 3CC5A 4RISH 1A4KA 1FP5A 1CLCA 1GGUA 2XY2A 3O6FD 1I7RA 4ZFOL 5DEFA 1BQSA 3QSKB 2ATKA 3UO1L 5CMAB 3UPCA 4Z8FL 4TSAH 5IR1A 1RZKL 4GAJH 4TSBL 1H15B 4P3CH 4QT5A 1UB6B 3MLWH 4IRSB 1U8JB 5CWSB 5KS9E 5C0AB 4HUUA 4HIEB 1N0LA 3W81A 1Z3GL 2WUCH 1A3RL 4JRYE 1CD1B 5HHMB 5HVHC 2H41A 1BF8A 1LO3H 2VWEC 2ZCHL 1RSFA 4U7SA 4WI7A 3LRGA 5GGTL 1QSZA 1X5HA 4OGAD 5F1NB 4YEFA 1ZLWH 2R8SH 3RAJL 2YPVH 4HH9B 4EN3A 4Y5VB 3RWJB 5EN2B 5CEYB 2W0KA 2WLYA 1HIML 4RSVA 2FHFA 4FQIH 5C0IA 4E0RA 4OD2B 3QQNA 3ZT6A 4F3FB 2VH5L 4OV5B 1A1OA 3BDYH 4PB0L 4X6FB 1A2YA 5E9DA 5C0AA 3WEXA 2AJSL 2VDOL 4Y88A 4YDVB 3WFHA 1WT5A 2JTDA 3GJFA 1CXHA 2YKLL 1UENA 4TSCL 4HS8L 4G80A 5DTFA 5F1NA 4PJEF 3AMLA 1QRNE 2ITDA 5DD0L 3A6BH 1ES0B 1M1SA 3MRDB 4ISVB 4XCYB 3SJVE 4ETQB 1UWXH 3TN0D 1JWUB 3RY5A 5JIPA 5L7XH 3H9SE 3PQYE 2AEIT 3RHWF 3DX9B 4ZODA 4NJ9L 1AJ7H 4MNQE 1QFWI 3MV8B 5I1HH 3GSNL 5CD3A 4WV1A 5EBLB 5IW3A 1CLYH 4MA3A 4XWGH 3P9LA 3U7YL 3HPJB 1Y0LA 3SJVA 3V4UL 1G9MC 1RZGA 4P57B 2ARWA 4ESKA 4TUOA 3K0WA 1P7HL 3Q6GL 3P3YA 3TWCH 1INQB 5IWLA 2XT1B 4K2UL 5BMFH 1HILB 2GIYA 5IQ9A 2HRLA 2IMMA 5IGXL 1T6WA 2LABA 3O8XC 3F8UB 3C8HA 3WN5C 1AGCB 1YEKH 3N1GC 3QDGB 1WAAF 1BZ7B 4FQJL 2QR0B 1GHFL 3VXMA 3MLVL 2V17L 3OAZH 3QWRA 1IM9D 4N5EC 3R8QA 4WDIB 2Y72A 3Q0HA 4NP4L 3JXAA 5JZ7C 2W38A 3RQ3A 1NC2D 4EI5A 4PJEA 4PJHE 3HZMA 4X6BA 4X6CA 2F9BT 1HCFX 1DR9A 5MERB 3P4OB 3G04A 5IT2L 1BJMA 4F3FA 3O2WL 3TYGL 2VLJE 2R1XA 25C8L 3OG4B 5FA3A 2XV6B 5IB5A 3C6LD 5J8OA 4EI5D 5F7DA 2EH7H 3X13A 3OPZH 1FSKB 2JB6B 1LQSR 1UWGL 2HTLC 3DLQR 2O5XH 4EJ1C 2NY0C 4WFFD 4YUEL 5KANG 1SYVB 2Y5TA 2NTFA 5IBUB 4OKVB 1HWHB 4NRZB 4ZXBA 1RZJH 4G9FA 4PJAA 4E41E 1JFQL 4KKLC 1HWGB 4TULH 2DI7A 5L7XL 1JZ2A 4DAGL 2WMPA 3MRIB 5JW5A 3V52H 4D8PB 2AERT 1G0XA 4UTBL 4Z9KB 5FGBA 2VZTA 1EJOH 3DGGA 3NCMA 1G6RA 2WNGA 1HE7A 5D7SH 1TVHB 4LEXL 1S9WB 3ESVF 2VLLB 2H32B 3O81A 3DI3B 4X98B 5EO0A 1ZHKA 5EBMA 3BRDA 3QRGL 4DKFH 1YYLL 2VLKB 5F7NC 2DM3A 5IOPB 2DYPD 1RZGB 1BD2B 3MUGA 2Q86B 3D1MC 4QY8B 5HYSG 1A7PH 1MCWM 1WZ1L 4S1RH 5EUOA 4CL7A 1FZMB 4L3CB 4X9BA 4AH2B 2GITA 5DQDL 5T5NG 4XZUB 3ISWA 3RI5F 4Y5YB 1KN4L 1D6VL 4LPWA 2WINB 4BQ6A 5DMGC 4WI5A 3RWEB 2VWEE 3ALXA 1RUQH 3WS3B 3FRUB 2VSDA 4FXKB 1KC5H 4QXTB 4AQ1B 1KUMA 2R8SL 3SGKC 4RMTA 4X4YB 3PNWA 1ITBB 4CDGC 5A1AA 5DD6A 2QKIB 2FH8A 4M48H 1I1AB 2DWEA 2BMKB 3CVIH 1JTPA 1EO8H 1IAIL 4DGYL 4MWFA 2HJKA 3U2SB 2ATPB 2H8PB 2Y4SA 3DX6B 3QO0B 1Z6JT 4UT7L 1DLFL 4Y4HC 4YPGB 4YHOL 5C09B 2CUIA 4ODSL 5FYKE 1NFDA 1YEHH 3HC0A 3KPQB 5C86A 2D0GA 2JJVA 4NFCA 5ID1B 2R2HA 5F70A 3SDDD 1U3HC 4ZAKC 3CZJA 4G8GE 5HHNA 2BERA 4KI5E 5JOFA 3F12A 3UTPD 3MR9B 1VFOA 5C07B 2KUTA 1AGEA 3V79C 4OKVA 1ONQA 3PL6A 5SX4H 5BV7H 3AUVA 3GKWL 5CZVL 3CSPA 1P9MA 4WUKL 5GGVL 3KJ4B 5JW4M 4N0UA 1LNUB 1JHKL 1DANU 3RVUC 2Q8BL 1FZOA 3G08B 4QRUB 2C7UA 1ZVHA 3P30L 2VRAA 3ZL4H 5LCVL 1UZ8A 4P2OD 4ZS7L 1DCLA 2UZYB 1F42A 4EN3D 3ELAT 3QZWA 2JELL 4I18B 5ACZA 1WBXB 4U1NB 3C6LC 5KS9F 4JN1H 3EJYC 2C3HA 1CIDA 3L6FA 2CSPA 4LQFH 4NQSA 4ZUSB 3RUGA 3RTQC 3MRLA 1RZKH 5EBWB 2D0FA 3D48R 3S35H 1NAML 4S1QL 5KG9B 4WV1C 1B0WA 5E70A 5MENB 1A9BB 1WISA 2NY3B 1IC1A 2G2RB 1WIPA 3ARED 1F3DH 3DVFA 5SWSD 3PV6A 1BQHG 3RZCB 3L5HA 3PQYA 3W5NA 4KWUA 5BJTB 4GW4A 4KRPB 3RWGA 2G60H 1YY9D 5T1LA 5FUZH 4LRIA 3GMRB 3LKOB 3QCTH 4NZJA 3UBXB 1BD2A 3MLPA 3MV11 1MHHA 3LHPH 3U48A 3E3QE 3UZQA 1HH6B 4MQXD 3UTTB 1KEMH 4R8WL 3BIKA 3LN9A 3FFCE 1IC7L 1INDL 4P3WA 3RDTA 1AC6A 1YC8A 2X4NB 1QPPA 2GJ6D 3UTSD 3BGMB 4Y16B 1A6UL 4MHHG 5DEGA 4YHKL 1RIHH 5DJYB 4AH2A 3B2UC 1MF2L 3NTCH 4OF7A 2OTWB 3ABZA 2BC4A 3QHTC 1T04A 4ALAH 5JTWA 1NCUA 1PDKA 1PGRB 4PBXA 2BJMH 5E8OB 4CU8A 3T1FA 3O4LE 1A1NA 3VFUB 4S2SA 4HGWB 3GRWL 1GGCH 3ZMRA 2ZUYA 4D9RE 3WHXB 5LKNA 3GSUA 1YNLH 4YPGA 2X1QA 1LO2L 3HRPA 1PD6A 4GMTL 3UBXG 1QG3A 3O3DB 1DBKL 4HUWA 4WRLA 5IVXB 1T7XA 4RGMB 5I76B 1S9XA 4JANA 1A4JB 2CJUL 2CH8A 4ELKB 2M26A 1FN4A 4UNUA 2EIBA 1WFUA 2AABH 3BFOA 5JA9A 1X6LA 1MF2H 3NTCL 4HHAA 1E4WH 4NQDE 4WHTA 5IVXF 5KVMC 3B3IB 3G08A 3B5GA 4QRUA 3JV4B 4KI5F 3EO0B 3BUYB 1N5AA 3FFDB 3GKZA 3HS0B 1JPSL 1C08A 1MCFA 1GPOH 5BZDA 2EEBA 4QHKJ 3GB7B 2IH1A 2D7MA 4ZPTB 5EC2A 4Y5YC 4OZHF 5KSVA 4CUCA 1OOAA 1P69B 4ZD3H 1D3CA 1NBZA 3IDJA 5L6YL 5SV4A 4RMWA 4NHUA 4N0FA 2JCCB 3RTQD 3AB0B 3DX7A 3K1KC 2DQIH 1U91A 2E6PA 2AJ3A 2BNQA 2ORBH 1ZLSL 3PV6B 4XI5D 4LOUC 3ZTNL 3O11A 1FJ1B 2B7DT 4UQ3A 4U6YB 3UJJL 3QCVH 1KCUH 1HCVA 2CDFA 3BPOC 1JUFA 3E3QC 2ADFL 3HLAA 3QWQB 4NJAL 5GGRB 3VXRB 2AEQL 4CDHA 5BZDB 2LVCA 5EIVA 1N2RB 1FZJB 4M7LT 1JNHA 1A7RH 1QBLH 4OAWA 3B9KB 1C5BH 5IIEA 5J13B 4QWWD 5C08B 4J7RA 2WWKT 4NQCD 1G7HA 4LDOB 2JJTA 3BP6B 4M3KB 4Z18A 4LCUB 2EH8H 1D9KA 3G6JF 4KKBD 3DX7B 4U1KA 3ZL4L 5F88B 4JHZA 1FL5A 4FFYH 5CAYB 5E6ZA 4IRJC 3GIZH 4YXKL 2FGZA 5HDBE 2WBJB 3CDCA 5E5MB 4EQ2A 4NQSB 5GXBB 1B0GB 5SWZE 2NNAB 1S9YB 5FYKU 5HXMA 4CAGA 2QQLL 3VGGA 4WCYH 3MRJA 4QHNA 4FP8L 1DFBH 5FM5M 3MLTA 2FX8L 2YUWA 4IJ3C 4OFPA 4FS0A 2CK0H 4WEMB 2NY7H 4QLRA 4BQCA 1J8HA 5EU4B 2H26B 3MJ9L 5L2KD 3VI3F 5HGDA 3NCJL 4JFOA 4OQTA 4ODUA 4FQXD 3I2CL 1BJ8A 3FT4A 2APWA 3D9AL 4HXAL 2HFTA 1PBYA 3MFFA 4NPYB 1A4KB 2VL4A 4L8SC 2XZCL 4WI9A 1C1EH 3MOAH 1MI5B 4M48L 2PN5A 4YHZL 4M5YL 4ZS7H 3T2PA 1KCRL 2CIIB 1R3KB 5HHVH 3W82A 4J3TA 3TT3L 4MA1B 1E4XL 2HWZL 4KKAC 1TJIH 5DQJA 5C0AE 1D5ZA 5HI3C 3QCUL 4YJZL 1QA9B 3FJTA 1PEWA 5CJOH 3HI1B 4YHLH 2WUBH 1LE9A 3GMRA 1A22B 4I2XB 5T1LD 1ZGLP 1X5FA 1UA6H 4LEOB 1OTUD 5ISZA 1VCAA 1C7TA 3VRIA 3L3DA 4HUXB 5CBAB 5FEBA 3UYRH 1B6UA 4KPHL 3X14A 4YXHH 1F3JB 1FFPB 2DQUL 5DHXB 1CDIA 1G1CA 3K46A 4LLWB 3BWUC 3SDDB 3B9KD 1ORQB 3C5ZD 4G6ML 1BHGA 1U6AL 5DQ9B 1WFNA 3NVQA 5ANMA 4Z5RB 5E95B 4YDIL 3V6ZA 3PIQA 5GGVY 3CVIL 1VKXA 3L6FB 3U4AA 5EU3A 4DFHA 4LSSL 3G5YB 2R4RH 3QFDB 3T0XA 5KJRL 5ALCH 1OSPH 1D5XB 4ZAKA 4CRPA 4JKMA 1P7KB 4ZFOA 3WLBA 2PYEE 1OGAA 1H8SA 1R5IB 1N59B 4YDLC 4F58L 2FR4A 2B5IC 3SDCA 4AMKH 2F8VA 3CD4A 3HS0A 1HHIA 3RZCA 2EXWD 3I50H 3SPVA 2BVPB 1BQHA 2LE9A 7FABL 1ZHNB 1J8HD 4KHTL 4M7KL 2A6IB 4BH7B 4O4YH 4OGAC 3AU1A 2IADB 4HG4K 1T1WB 3ALWA 3LEYL 4RFOH 1FLRL 2UVFA 4ODWB 2VITB 3BD3A 4LOUD 4JLRA 4JZOB 4GRWH 5I1AB 1ETZA 1U2HA 4KTDH 1KGCD 2UZIH 3AS3A 4I2XE 1MJUH 3KG5A 4XMPH 4WW2A 2Z31D 1KTLB 4XMPL 1RIVL 5AUMA 2BVEA 3UXFA 2FRGP 1HXMA 5ICYB 4YZFF 1LP9A 3TH2T 4OLYH 1TITA 2X4QA 3QG7L 43C9A 1T1XA 5HTSA 3TIEA 2LAGB 3QQ3B 3UJTL 5HYQB 4LLVB 1SHMA 1WC7B 4I2XA 4OKDA 4KKBC 3ZYOA 3DURB 2H2SD 3LRSB 1PSKH 3VG9B 1MHEB 4TRPH 1TJGL 2LU3A 1IMHC 4C58B 5IMKB 2K7QA 1OTTC 2FH6A 1QBAA 3NH7L 5EORH 3OKOB 4M8QB 1IGIH 3HE7A 1KPVA 2ZCLH 3BDXA 4X5XB 5A40E 5DWUL 5TE7H 3LDBC 4HKXA 2A6DB 1JGVH 2CKBB 1S9VA 5D7IA 1BBJB 1C1EL 5GS0H 3LKRB 2GFBA 3WO4C 3JZ7A 4YDIH 2QADC 1G7PB 4U1MA 4O51B 5JORB 1WSST 3V6BR 1YEGH 4O2EA 3V6FB 1QR1A 4NO2B 1WTLA 3TNNB 1WK0A 4X80H 2NW2B 1K5NB 3HFML 4U1LA 1MAKA 3BUYA 1JP5A 3BZDA 2RCSH 1S7XB 5HHMD 5DD1L 1G7JA 5I1IH 4UDUB 2WQRA 1U3JA 3G6AB 1BP3B 1C7SA 3G9AB 5F9OL 3MRHA 3IKCA 3RL1A 3U36B 1OM3L 4NUJA 1I8MA 4ELKA 4HS3B 5KOMC 1U2CA 4WIQA 4L5FL 3VFWA 1JNNL 3RBSA 4Y4KC 3AAZB 3HKFA 2F53A 5E9DB 3VI3E 4F33B 5I1HL 2H3NB 3PJSB 4LBEA 4UT9H 1WF5A 1UXSB 5E94A 1GGYA 5F9JB 3OV6A 2QHLA 1G84A 2E6JA 4FQLH 1LVEA 2PTVA 3CFJB 4L1DA 1PQZB 1A8JH 3ES6B 4Y5VA 1CFBA 1EFQA 5JW3L 1FORL 4C56B 1AO7A 1ACZA 3F58L 3EFDL 2ADFH 1EDQA 1Q72L 5D7KD 5EOQH 3F5WA 3DVNB 2I26N 1KG0B 4IRZL 2IFGA 3ULVL 3QIUB 2EDJA 5DEZA 1CFQB 3D6GA 5BW7C 3OKMB 3PWVB 1F97A 3GSVB 4MQSB 4KMTH 2AK4E 3QHFL 3ZYJA 3BKML 5F1IA 2P43B 1FIGL 4KDWA 4C54A 4D9LH 5ILTH 4D94A 4Q9QL 4O9HH 4GAYB 3WE6B 5IEHA 4WFED 2XA8H 1ZVSA 5IBTL 1EFXA 4ZSOB 5FCSH 1DBAH 1SJHA 5JDJA 5FM5O 4OZGA 2VABA 2JF1A 2D7OA 3VI4F 4UT6L 1VADA 1ZHBB 4JY4A 1T66C 2P5WA 3QJFB 1EAPA 4N90E 5L9DH 1MLBB 5IK3A 3ZE1F 1BD2D 2O61A 5HVFB 1HNGA 1NMAL 1MLCA 2R56H 3FRUA 4FXKA 2DTML 4QXTA 2NXZC 3LZFL 1A3RH 2ZKHH 2VLRA 5E9DE 4OCLC 1TIUA 4RNRB 1IM9B 1F8TH 1A7RL 1QBLL 4XXDA 3TBVB 4JJ5A 1RZFL 2K1MA 2RBLA 3OG6B 4Y19D 1I3RA 5ECJE 4J1UA 3GJEA 2I60L 4OCWL 2YN3A 5HYJD 2A9ML 5DEFB 4JY5L 4QRPD 1Q9OB 1ZTXH 3RWIB 1QRNA 1YQVL 1P84K 1Z9SA 2XPGB 5CIPB 4ZSOA 1SJHB 1NFKA 2QHRH 4YAQB 4X6DE 4IMLA 1DBKH 1T03H 1HXMB 1FNLA 4I5BB 1T5XB 5GS0C 2ESVB 4EVNB 4NC1C 5FA4A 3MV7D 1UEYA 1FNGB 4ODVL 4X7FC 2A83A 1ZA3A 1B4RA 1KJ3H 5LWYH 2HTKD 3MFFB 4MQ7A 4NPYA 4KJWC 3RVVC 4BH7A 5F6HJ 2E8YA 4FXGA 4OGYL 1S7SB 5L8LB 5I16B 4XVJH 4OCXL 1XR9B 4HULB 4QTHB 2E27H 3F6IA 1JGEA 2Z31A 4WFHD 4JDVB 2Q6WA 3CH8A 4X8XA 4N8VG 3OF6D 4PRBA 3ZDZF 1OAKL 4D0CB 5DJ2A 1M71A 4HC1H 3QIUD 4XMKH 5DJ0A 1SBBA 5AUMB 2O5ZL 1TJHL 3SOBH 2HRPL 3BE1L 4W6YB 4JPVH 5CP3A 1LP9E 2HT3C 4PJBA 1NGZA 2VDKH 3KPPA 3M1BB 3VU2A 4M62H 2BXZA 2FWOA 3QQ9D 1XR8B 4RGOH 4HIJA 4OF3A 4D3CL 4MJ6B 1MFDH 4NN6C 3DYMA 1QRND 4OCSH 4L4JA 5LBSL 3WHXA 4UDUA 3DRTA 5HGHA 2JJSC 3N85L 4FQ1H 3DOSA 1RHFA 1W0WB 1NCNA 5DMJB 4JGUA 1JK8A 2X4OB 4JY5H 4NNPH 3DVIA 2A9MH 4DK3A 4LHJB 5E7BA 1XFPA 2Z8WC 4Z7UA 1CT8A 5FYLH 3I3BA 1G1YA 3N50A 1FGVL 2EXWC 1K9TA 3ZE0E 1CFVL 4PS4H 5HHOD 5K9KB 2VQUA 2D7PA 1CYGA 3H0TB 1J5OL 2HTLD 3NCEB 5C0DB 3BPNC 2CRMA 5T3ZE 2D3VA 3AROA 1NL0L 3VFRB 1YY8B 4EIZC 1KTDB 2EE9A 1SEBA 3CCHB 1NBYA 4DKAA 4NZTH 1Q8MA 3P0YH 3TCXA 2BNRE 1RV6X 4GAFB 4KTEH 1FO0B 4J3XA 1JWUA 1T22B 1CGSH 1RUAH 5J11B 4X9IA 1U95A 1OGAD 3CFDA 4PJ5E 1JV5B 1FFNB 3STZB 3BH8A 1CQKA 3G5VB 4XCEB 3K4ZA 3WXVH 1T1ZB 2YSSA 4XPAL 3QUYC 5GGSA 1CZ8H 3IXAA 1YQVH 4HCRA 5JA8B 4HWBH 1HZHL 4GBXC 3BHBB 4P9HC 2AV7B 4NQUA 2R0KL 1S7UA 3JTTB 5T3ZD 3BP7A 1NCCH 1U8IB 4K3EL 1FIEA 2VZSA 1XIWC 1QVOA 1VFMA 1UG9A 4XRCA 4ZPTA 2ZUUA 3FB6B 2NYYC 4OZ4A 1FFNA 5ADPL 1OSZB 1BVZA 4GLRH 4WUUD 2HFGH 4WFGD 4JQIL 3VD7A 3IU4H 2BVPA 3B4NA 4D9QE 1FNGA 2HFEA 2P44B 2EE2A 1T2QH 4PJ8B 3CH1B 1GVIA 2NZIA 4KZDL 4BZ2H 2W60B 4ZUTA 1OM3H 4M43L 4R3SA 1CXFA 3GGWB 3SDXB 1BMGA 2ATKB 4Y4HD 4JB9L 1S3KL 4BH8A 4ERSL 1DSFH 4G5ZH 1EGJH 5E00A 5IG7A 3VXPA 1K4CB 4DTGH 5CJQL 3VGDA 4LSRH 5JNYA 3RDTC 2I5YL 3OJDA 4TVPE 1YEDB 1HKLH 4FQXA 2YEZB 4PLOB 2FSEB 3QUKB 3A6OA 4Q6YA 3E6FB 1RAMA 1CLOH 1JYXA 2E9BA 2IAMA 1TETL 4GRLD 4XPGH 1EBPA 3VXUE 4JFDD 1N6VA 3QI9D 3E6HA 3IDGB 4RWYH 4HFUL 2VN7A 1DN2A 4WTZG 3UBXA 3WYRA 4BA8A 5ETUA 4JVPA 3STZA 5C07D 3IDNB 1GSMA 1KXTB 2EDNA 1AHWC 5KVGH 3MCG1 1KC5L 1AI1L 1IL1B 1I85C 4UU9B 3OXSB 3VFMB 4JPWL 1KCKA 1N8ZB 4KZEH 3X12B 4I18A 4UIMB 3ZT5A 3T0DA 2X4NA 4U7MA 3U6RA 4CN4A 1KTDA 3PG2A 1UQSB 4JFXB 3ZTJH 4Y5VC 1KNOB 3CK0L 1JBJA 1CD8A 3MRLB 3DMMC 2VQ1A 3AREC 4W4OA 1FVDB 4GKNA 5BVPH 2VABB 4NN7C 1N6UA 4HUVA 3MRFB 2QBWA 3O4LB 5I17A 2NR6D 3PDOB 1YYLH 5KVDH 1AQKH 5DJCA 1VFBB 3GUTB 3FHQA 5KBNC 4R2GD 3MGOB 5TDOB 5DUML 3GSUB 2RQ8A 3S5LA 4AEHL 1YNTA 4LARH 4HKBA 2BNQD 4NOFA 3KPSE 4PJ8A 3LB6C 3C2AL 4LVEA 3JSSA 4HCRL 2ICWI 2IAMD 4GRLA 5JW4Q 1T66D 2P42B 4Y89A 1K85A 4RMSA 4ONGL 2Y1VA 5I1LB 4M1DH 5EBWA 5DZLA 3THML 5JXEA 2ZCLL 5IUSA 5A2FA 1OB1B 4HUVB 3VJ6A 4AM0A 1BM3H 5ID1A 4RAHA 3QEQB 2YD5A 5JOEA 4PJ9B 2XZAH 3C08H 3PWPD 4NHCL 4Y4HA 5HVWA 5E4IA 1U0QA 5AAMA 7CGTA 5L88L 3TBWA 4YE4L 1N4XL 1KXQE 3JWDC 1C5CL 2EKJA 3U9UB 1Q0YL 1SJXA 3AS2A 4R7NB 4ORGA 5GSVA 1KBGH 4KKNA 1PFCA 4Z7WE 4N9GA 2BNQE 2VDRL 2OTUA 1LO0L 5GGQH 1HEZB 3KLAA 3FFCD 4HJGA 4P2QA 3B9KA 4HFUH 5HI3D 1MHHB 1CGXA 4X9HA 4AEHH 1A21A 1IAOB 2AV1B 5IKCB 2ZWLT 1JPGB 1NUNB 5IFJA 3DO7A 3NZ8A 2DBLH 1K4DB 1DEEA 1YYML 4WFEE 3DUUA 5T1MB 1DQQA 5HYSA 4PGCB 3OKEB 1HOCA 2ZUXA 5EU6E 4NKDB 2PW2A 5DO2D 3X3GH 3DV4A 4OF0A 5TDNA 4TTDC 3ULUD 4GSDL 1MCBA 3GMQA 5C0BA 2AEWA 1CG9A 2ESVD 1AR1D 5HGAB 4GW1B 5J4MA 4FQIL 5SX5K 3GIVB 3LPWA 1M05A 2R39A 3UTSB 1M7XA 4PGDB 3RNQA 1YN7B 1JNJA 4LSQL 1WBYA 5JPMA 5KSAA 2BFVL 3B5HA 4Y2DB 1J0JA 1S7RA 2HFGL 1Q1JL 1S9WA 3O6FC 4J4PA 1BQHB 2QSCL 1XEDA 2AJUL 2F19L 4RMRA 3NIGE 1A7QL 3QUZD 4KK6D 3VD4A 4Z0XA 4YC2B 3RDTD 3UZVB 3UAJC 1LP9B 2GSIB 2EE6A 1Q94A 2DWDA 1JN6A 1WFOA 5IR1B 2X7LB 1I1CA 3PUCA 2WANA 1HKFA 4LCYB 5I1AA 1VPOH 2DQDL 4LLVA 5HHOA 5SWSB 3H3PH 5I17B 4CNIB 1QVOB 3BAEH 1FYHB 3A67H 3P0VL 1UYWH 4XHQA 4M93C 4JZJC 1KLGB 1WZKA 2COQA 4YLQT 4Q9CA 1LHZA 5INDB 4F2MA 3QDGE 4ZNCD 3TZVB 4RGNB 4U1HA 4JM2A 1MRDL 5JDSA 1ZEAH 3BP6A 1HH9B 2H26A 1R0AL 3LQZB 5DJXA 1S7WB 3I3DA 1HHGA 2R2EA 4L4VD 1RUAL 5E8OA 4LSTH 2DQCH 3KXFB 3LD8C 5FCUL 1S78C 1DQJA 3CFBA 5HDQH 4JO1H 4A6YL 2IAMC 3DTXA 1R6VA 2X6MA 2UUDH 5HI4D 1FBIL 2MHAA 1VEMA 1N7MH 1ZT4A 3LY6A 4KJYA 1YECL 4OCNC 1EHNA 1Z0MA 4LCWE 1CDUA 4FZ8H 1YNKL 1O5DT 1NEZB 4GW5A 1BIIA 3DRQB 3HZVB 3TCLA 2DQEL 1OP9A 3MXWL 5DHVA 4DUWA 3HAEG 5D2NE 5B3NA 1EXUB 3B5TA 4QOKB 4M1CC 1C12A 4JFEE 4G7YL 1KB5L 3P77A 4HEPG 1BAFH 5FYKD 1GOFA 5I1CL 4QF1B 3EYOB 2AXFA 1ZHKB 2UUDK 5JOPE 2E7HA 2YK1L 5KSUB 2VLJA 3SDDA 4UV4L 2ID5A 4NQEB 2A77L 1CGSL 2BNRD 2Y07H 4Z0XB 3T1WA 1R3LA 1A7NH 1YZZA 3GDBA 1HK6A 1NGPL 2BRQA 2YR3A 1J1XH 1YJDH 1WEJL 4NHUB 2L7UA 2DQJH 4NRZA 2PYEB 3EOAB 3W9EB 3LQAH 4JCLA 2HKHL 5AZEH 5CJXC 5H35B 1MAML 2CO7B 3QPXL 1GOHA 4F8TA 5JPNB 3QNXB 3TLRA 4JZNB 4PTUA 1X6NA 1FVCA 3RZWA 1MQ8A 3WFDL 3EYFA 3WHE1 4Y4KD 3UDWC 2R0WH 2BDNH 3MV8A 1JPTH 4JG0H 4JM2B 5JDSB 1S8DB 1Z2KA 3ARDB 3QIWD 5J7CC 5I30L 3RPIB 4TTGA 4ZYKB 2OSLB 2YD9A 1EHAA 4RIRB 4Z7OE 5DRNB 5EIIA 4M00A 4ODVH 5ENWA 4P2RE 1UFUA 1ACYH 4P4RA 1DEEB 1FG9C 4OT1L 5D2NB 5ESQB 5JIHA 3C6LA 5BZWA 2EIEA 3S96A 2D03L 5H8DA 2KL6A 1GGCL 3SQOL 4I0PA 3WXWL 4P3DA 4KQ3H 4P46C 3BD5A 3ILPA 4V2CB 5BS0E 1WJ3A 5F1KC 5H2BA 4JFPB 4HZLA 4KU1A 5HDOA 3BDBA 5E2WH 5C2BH 4JFZH 4DUVA 1YMHA 4CU7A 1J1OH 2R0WL 1X9QA 3TVMD 3GMPB 2Q3AA 3WFDH 1FO0H 4EI5B 2Q8AL 2PF6A 3PGFH 4NKOA 2HKFH 4MHHI 5IB3B 2P8MA 3OKYA 4GRWB 5DA0B 4XNYH 4PGEA 3OMZA 1TNMA 2ARJQ 4YFLI 4AIXA 2NY4D 2YRLA 3CMGA 3HN3A 5D6DA 1A7NL 3I02A 3OJ2C 2AK1H 4E9LA 2AQ1A 2VLMD 5B8CB 3O41B 5T33H 1QPXA 4KJPD 4LPUA 1DQDH 4PP1C 2A77H 5F7EL 3LN5B 1IEBB 4Y4FB 3BP4A 4NKIL 5I8KH 4JFFA 1CBVH 3T0EB 1VADB 1U8LA 3OJDB 2FWOB 4RDQF 4XPHL 5K9QI 5DFWH 4OLVL 5KSAB 3CFCL 2EYTA 3IFOB 1S78D 5IROA 3ZKNC 2FECL 3Q5YA 3IGAA 3SE3C 5GRJH 1IC5H 4R4BA 1J1PH 1Z9MA 1XGRA 2H2SC 3GFUA 5J06A 2CLVA 3GMNB 3S35L 4UDTA 2VXUH 2ZPKH 3P4NA 5E6YA 1MFBL 2BNRA 4WHYH 2A74A 5JR1H 5GRVK 1U58A 2A0LD 2HLAA 3QIUA 3L3JB 5AD0A 1G7LB 1PJ9A 1XR9A 4CU6A 5GS2H 3RUGE 4Y7MA 4J3SA 3MLZH 3I6GB 4HKJB 2GEEA 4B53A 5DLML 1GC1H 1RK0B 5DVNA 4HUKB 4WFFE 2QQKL 3FQTA 1SY6A 4PREB 4WY7H 4K8RL 3ROOB 5ILTL 3ARDA 3O6KL 2MQ0A 5IM7B 4NYLB 1E6JH 3CPLB 4DEPC 4JRXD 3ULUH 3CLEL 4MAYA 4OCYH 3L3IA 5LGKA 1EO7A 1LNUA 4WNQB 3ARYA 3HI5H 1RZ7L 1QLEL 4HS3A 3HC3L 3VXSA 3BH8B 4MNGA 3VGFA 4EIGB 1AR1C 4U1KB 4JJ5B 5JIIA 2X4OA 3CIQA 1NGXA 1YEGL 1IAMA 3ARGA 4WO4B 5BQ7A 3ARFA 3BPNB 3DETD 4GQPH 2CLZA 4TN9A 4LLAA 1QO3A 1MCLA 4X7TB 3NMEA 3P4MB 4JQVA 1FV1B 4MJ5B 4N8VB 1ZHLA 1V3KA 4PRHB 5IQ7H 4QYOA 4HHAB 5JXAL 3LSOA 3P30H 4O2EB 3MLSH 2YD4A 5ISZE 1JRHL 2GY7B 1KJ2H 3ARFC 3U0TB 1JIBA 3WNOA 1KACB 2Q1EA 3R06B 4CVZB 4U2ZA 2Q8BH 4ONHA 1HQ4B 2GAZA 4L5FH 2CIKB 1NCDH 1RU9H 3RVTC 1WWWX 4LSUH 3IAQA 2LAAA 5L0QB 5HYJA 1AGFA 4UQ2A 1MRDH 4HFWA 1NLBL 4JKPH 1T80A 2EXYC 4PG2A 4YDLB 5EA0L 2V9QA 3CH1A 3HZYA 3S4SG 3BEWA 3O41A 5J57B 1K8DA 1CD0A 3U0WH 4I48B 3DMMB 5L0QC 1AY1H 1OAUL 2WSKA 3IU3A 1XGYH 5HYJE 1OAQH 2IGFH 3QFJB 5T1DH 1OCWL 3VE0B 4LFHG 3L7EB 2FB4L 4H1LA 1AC0A 1EJOL 4LVOC 1MNUL 5HHNB 4PG9B 4Y1AB 1VGKB 4OCRH 1OW0A 3EO0A 3FQWA 1CK0L 1P9MC 5IVXE 2EDQA 2ESVA 2CDEA 4EVNA 1IGFL 5FDWB 1HH9A 5F1OB 5GS3A 4X4ZA 5DWUH 1ITCA 4U1SB 3L3HB 1TMCB 2GK0B 4PJEB 2GJ6E 4ZO9A 5MEPB 5B38G 3OHXA 5KANI 4NWTL 3B2VH 3D85A 5C71A 4XCEA 4EQ3A 1FYTA 3KPSA 4ZFZB 3SY0A 2YBRB 5C8JA 2XY1A 5IROC 3SKNB 3Q1SH 3H9SB 1YMMB 4BKLA 2NX5B 1BJ1J 4XXDB 3UJTH 1M71B 5F44A 2HT4D 4NC2B 1VB9A 4M03A 4FABH 5I74B 3MROB 3QR2A 3NFNA 4LARL 2GTWB 1JF5A 5J89A 1F4YL 1T04B 4GKSA 1MCCA 3LMJH 1P7KA 2QEJA 3MREA 1FCGA 1GHFH 3QEUA 5FGCB 2UZXB 4G6MH 2IH3B 4V1DD 1X44A 4WI2A 5D7SL 4X6BB 2E7LC 2EDYA 4OQTH 2PXYC 3FO2B 1XAUA 2D7TL 1ZANH 4XNXH 1FLRH 5DMKB 1H3PH 5I2IB 4HJJH 2DQHH 3W2DL 1N26A 4QRPE 1MCRA 3T3ME 2C3VB 2EE3A 3TWCL 1IM3B 1RPQA 3RWCB 5B39B 1T21A 1UWGH 3AFLA 1JGUH 5B3JF 1MPAH 1HSBA 2E5EA 1HH6A 1XH3B 2FGWH 3BO8A 4OZGF 4WWKB 1U3HA 3QCUH 5CIPA 4K9EC 1GZQB 4GOSA 3MV01 4LCWD 2NY6D 5SWQA 3WKML 1P53A 5IV2B 1HHHA 4PV9B 4DN4L 2YA2A 1KIUA 5ESQA 4WW2C 5KVGL 1IAIM 3GSRA 1U8MB 2P8PA 3ZHDA 4JM2F 3RIFF 2HT3D 3STBA 3TVMC 2G5RA 1U8PA 2R1WB 3P73A 3E6HB 3QULA 5DVOA 4R7NA 4Y16D 3MCLL 1YC7A 3GMNA 5JOPD 3K74B 4EUPB 5J1AB 5JW4N 1TVDA 5DJAA 3QG6A 3QJFA 3X3FL 1EVUA 3S37X 1ZT7B 4HMCA 4MLIA 3IF1B 4UOW1 1IKFL 4G7VH 3HC4L 2AGJH 2IQ9L 3VXSB 4W6WB 1HYSC 2I5YH 2IFFH 3E8UH 4U6XA 3VFVB 2YA1A 5BMFL 4PB0H 1KIRB 1YEJL 4MAUL 2MQCA 1X4XA 3AC0A 2YWZA 1QZ1A 3MNVB 1DFBL 4TUJA 4J1UB 4X5XA 5CEZD 3H42L 5EU5A 1CR9H 1S5HA 4KZDH 4XAKD 3PWNA 4XAWH 1ZT1A 2YXMA 2LU7A 4JO2L 3RAJH 4WHTB 1UACH 1N59A 3LRSA 4F7PA 5C9KA 2PYED 4L8DA 3BYTA 1CTNA 4FQXC 2GT9B 3RL2B 4PLKD 2EDRA 3EDDA 2W59A 4ZFFB 6FABL 5GSRB 2XG4A 2XA3A 4URTB 4K3EH 1NFDB 4Y2DC 1KIQA 4KI5D 1D5MA 4ODTH 1I8IA 3U0WL 2F54A 1OP5K 1NGYB 3MUJA 5MERA 3IB4A 4LSVH 2HVJA 2XZQH 3VXTB 1LK2A 5ESAB 1QLEH 3QUZA 2NXYB 2XIDA 4Y5YA 5ELIA 5D7IF 3T4AB 5CKAA 3KLSA 3KVQA 4PJ7B 3CDYA 2D9QB 3CJJA 3K8LA 4K7PX 5I8KL 4DJMA 4X4XB 4P2YA 5JOFB 1FJ1A 32C2A 5HJ3B 3QDJB 2F8XC 2PXYD 4E42A 5CJ5A 1DQDL 1JRHH 2P24B 3P4LA 3SPVB 3HI6H 2VLRB 2ADJB 2JB5H 3NABL 2OZ4H 5EBMB 2VXQL 3KPNA 4LHQB 2DM7A 2C3VA 3INUH 2FIRT 1FPTH 2OJZL 1U8QA 3MBED 4QRQB 5C07E 3KPRD 1NCAL 1NL0H 1GH7A