1LO3H

Retro-diels-alderase catalytic antibody: product analogue
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
220
Chain Sequence
b'EVKLVESGGGLVKPGGSLKLSCAASGFSFRNYGMSWVRQTPEKRLEWVASISYGGLIYYPDSIKGRFTISRDIAQNILYLQMSSLRSEDTAMYHCIRGDSFLVWFTFWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTQVDKKIEPRGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords If kappa light chain
publication title A structural basis for the activity of retro-Diels-Alder catalytic antibodies: evidence for a catalytic aromatic residue.
pubmed doi rcsb
molecule tags Immune system
total genus 40
structure length 220
sequence length 220
chains with identical sequence Y
ec nomenclature
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lo3H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lo3H01
4TQEH 1U95A 5GRUL 3VGGA 5IHUL 3FFDB 3JWNC 3IDIB 3QZWA 5ADPL 1FYTD 1ND0A 1HSBA 4Z0XB 4HQQH 4BH7A 1PFCA 2O5XL 4H0HB 4GQPH 5IVZB 4F15B 2IG2H 1QFUL 1CGSH 1CDGA 4YGVB 4X9FA 4G8EA 5HHOD 1E0OB 4RFEA 3UXFA 1T22A 1C1EL 4XMKH 2X5PA 1CL7H 4WUKL 1MCQA 5B8CB 1PJ9A 4FTVE 4GRLA 3TPKA 5I1HL 3S36H 2ICCA 4TSBL 3VFPA 3ARDA 3BGMB 3PQYB 3QG6A 1O5DT 3KPRD 4LLYA 4DKEH 2NW2B 3CFDB 1G9NL 2VDML 3LDBB 4HUWB 3TJEL 1IBGH 1F45A 1KIRA 3G6JE 4D9LH 2WBJB 4L9LA 2BOBA 4RMSA 3ULVC 1INEH 3CMOH 1VCAA 3GMQB 4LLQB 3W2DH 1NCWH 3TESA 4U4BA 4FZEL 2VLME 4MXVE 4WW1A 5TH2A 3NCBB 4XXDA 3ULVF 5DD3H 4HH9B 1E4WL 3BT2H 1T0NB 5CWSB 4LKXB 1DANU 1BZ9B 3DO3A 4OIIL 5DTFA 5IG7A 5C2BL 1F42A 5TJWK 2OSLA 1KFAL 2PXYB 1VA9A 2A0LC 4PJHA 2PTUA 3V4UL 2VDQH 3RL1A 2XA8H 1UEYA 1AJ7L 1KCRH 4YFEA 1Q94A 2EDDA 3H0TB 5D7IF 1EEZB 1UWXH 3BEVA 1YDPB 4R26H 4P46C 5IESL 4H5SA 4JJ5A 5CP7A 4QTIL 2BVYA 3BDXA 4LCCC 1YEKL 3G04B 3VWKD 1TVBA 4XVUC 4HBCH 1YQVH 1QSED 3EYVB 4WU5B 4WGVB 1S9XA 3DUHA 2ZUXA 4EOWL 2YMXL 4J4PD 5GS2D 1YEJH 4U6VH 3X14A 1F58H 5I16A 1RMFH 9CGTA 1CGTA 1T1YA 4ODVH 3SDAB 1C7SA 1MJUH 1MWAL 4X7SL 3DX6B 4JRXA 3TJHC 2GITA 1J8HA 4DUVA 5JA8B 3IDNB 3MRJB 3WJJA 4KRPD 3VXME 4FS0A 3OGOE 4O5LH 1AKJA 1GHFL 2WINA 3QIWC 4PPTA 4XNQB 1RUML 2Q8BH 1EXUB 1KTDB 3GHBH 3NAAL 5FYLD 1FFPB 5D72H 1HQ4A 3IRZA 5CZKA 3ULUE 1B2WL 4WUUA 3OB8A 1A22B 3B9KA 1CI5A 1BHGA 3TBYB 1I7RB 1K4DB 5DD1H 1AIFB 4XTRC 5CUSL 1MIMH 1N5YH 1NCDH 3S7GA 2BVQB 1YNKL 1MCWW 1MOEA 2PTVA 4N0UE 4O51A 4U1GB 3AROA 2BNUB 15C8L 4LPTA 4JQVA 1JPSH 2VABA 1MRDL 1NCTA 2X4SA 3F7VA 4QRRD 4G80B 2BRQA 1I85C 5HDOA 4Q0XH 5GRXG 4WWKB 3TIEA 3WV0A 3HE7D 5GS0D 1MLCB 3HC3H 3OHXB 4P0DA 1MEXL 3MXVH 3ZTNL 1JGLH 2E27L 2PW1A 3D3VD 1G7HB 3S34L 3WS3A 1T7WA 1FPTH 3DETD 2QKIB 4PR5A 2BRRH 4MNGA 5FDYA 3D6GA 3OR7A 4XP9H 4G7YL 5EBMA 2I9TA 3SKUD 3ZT5A 5MEND 1LILA 5IB2B 1SBSL 2Q3AA 1PYWB 1MFNA 2GTWB 3AXLB 3EO0A 2H2PD 3MNZA 4XP1L 1BEYL 1E4JA 1OGAE 2EDOA 2E8ZA 2F5AH 3RVVD 5DZLA 4HFUL 2FWOB 1SEQH 2BSRB 3MV8E 1CQYA 4C56D 4NQSB 4MAYB 4Y2DA 4D9QD 4WUUE 1VFUA 1UM5L 4OFKA 2DQHL 2IPKB 1BBJA 1JGUH 1H0DA 4GMTL 2DLGA 3ROLB 4ETQB 1Q0XH 2WIMA 3I2CL 2Z4QB 3I9GH 2OMNA 4HWBA 1ZT4A 1W72A 3FT3A 4MMZC 5C3LD 5INDA 1FIGL 1SEBA 3ZYIA 1K5NA 4LLWA 3Q2CA 4NO3B 2Q87A 3MRNA 4UDTB 3BD3A 25C8H 1S7VB 2GSIB 4DGYH 5IK3A 2KQMA 4UZGA 3IAQA 4LEXH 1C08B 3D39D 5T1MB 5BVPH 4Z9KB 1TZIA 1N3NA 4GQ9H 3FO9B 3PQYE 4JHAH 1T4KB 2WBJD 3QCUH 3CDCA 4IBLT 3FJTA 3BD5A 3OKLA 3STLA 3V6BR 2YA2A 5IFJA 1Y0LB 2AV1A 1BECA 2DI8A 2GT9B 2PW2A 2QLVB 4U6YA 5FYKH 3V52L 5HVFB 3OAUL 3NABL 5E9DD 3TNNB 2D03L 2XACC 3FQRA 5ACMA 1RZIB 1UWEH 1KJ2H 5DK2A 4XH2A 4OZHF 2KBGA 2VXTH 3BO8B 2PXYD 4L3CA 4B50A 1AGBB 4N8VA 4F37K 4MXQD 2UWEB 5DK3A 4M8QB 1EUUA 3M17A 2YEZA 3BP4B 4JKPL 1EEYB 1NGXA 4X4YA 5HGGS 3WXWH 5DRNB 2E9WA 4YDJB 3OKYA 3QI9C 3VXOB 3BUYB 4XGZA 5DWUH 2ENSA 1Q0YL 1JN6A 1KIQA 5GGUA 3UZQA 3U4AA 4GW1A 1QD0A 1H3WM 5F7EH 4BQBA 3D9AL 3FRPA 1LE5B 3MCG1 1RK0B 3EDFA 4U3XA 4LCYA 1P4BL 2QJDA 3CXHK 3PL6C 2V2TA 3HE6C 2VMFA 2E7LC 1R5IA 4NCC2 5DD5H 2HJKB 3SDAD 5GGTH 3JTSA 1UYWH 1F4WH 4WFHE 3VD9A 1MQKL 3WYRA 3UX9B 1ZVSB 1K8IB 3DVNB 3BMWA 3FT4A 4HAFA 5FDWB 2VXVL 5L88L 1UVQA 2VRAA 3VI4E 4H26A 4BQ6A 3TNMB 3E3QC 1R0AL 1RZJC 1REIA 4DK6A 1MFAH 4I0PB 5E8EB 5IJKC 2D7OA 4M7LH 4J3XA 2BNRD 4J1UB 4CDHA 4L4JA 3RI5K 2DAVA 3VWJC 5DZNA 5F1IB 2IBZY 5BZWA 3MNVA 4Q97A 5F71A 4G3YH 1QRND 1F3JA 4LSTL 1IC1A 4HGWA 3CIQA 3G5YB 4R7DA 2AJ3B 1YC7A 4GAJL 1BAFL 4KJWC 5LGJB 1PQZA 4WWKD 5ALCL 2D7NA 5F7DA 4P57B 1Y6KR 3CFCL 1WTGT 3MRQB 2NXYB 3TN0A 3S9DB 3K0WA 1TENA 1Q9KA 3GKZA 5KTEL 2ADJA 4KI5C 3T77B 4UQ3B 2DQIH 5L2JA 3A67H 3LRGA 1IAIL 3IXAA 3DXAB 3BWAA 3HNTL 4PGBA 3MJ8B 4M6MH 2VUOA 4NM8H 3O3EB 4YXHL 1IEHA 3OV6A 1S5HA 4I0KA 4KI5F 4NN5B 3OMZA 5CJ8A 2RR3A 3MUZ1 1GL4B 2X7LB 3WFDH 3T4AA 3BW9A 3TH2T 4NQCD 1JWMA 4P2RA 1UQSB 4Z7OF 1GVIA 1JHKL 4JE4B 5F1NB 2XZCL 3D85B 3FQWB 1YMMA 2C26A 1AGCA 1J0YA 1IAMA 3F7RA 1KPVB 3L3GB 1VFBA 1HH6A 2IBZX 4JPVL 3T3PE 5FYLL 3IDXL 1KIPA 5JXED 2Z9TA 1G7IB 5EUOF 5ISZB 1BLNA 1H5BC 4UINL 3HLAB 3PDOA 2BVOA 3QXVA 4OZGF 1CLOH 3DMMA 3UJTL 1DQTA 1K2DB 3KPLB 3U7YL 3PGFL 1QFWL 5KG9B 3FOMA 3IGAA 1X4XA 3AU1B 4BFGA 3CFEA 4K23L 3NFPA 4UMGA 3NH7H 1JWSB 1ADQA 4EZMA 3S8WA 2NY5C 5C0CE 1EHXA 4XHJC 4KVNH 2NY2B 1TJGL 4QRQA 3PUCA 5IT2L 4RDQG 2J3SA 5DQDH 1LMKA 5K9QG 5D6CB 5KANI 3MRLA 4H1LB 3L3HB 3MLXL 1S7QA 1HH9A 2FX9H 1GC1C 1J05B 4OQTA 2QQKL 1LNUA 4Y4FC 4ERSH 3IXTA 1F3DJ 3P0YL 5F3HB 5C0AE 2WV3A 2NY4D 5BS0A 1UFUA 1EVTC 4LDLB 5EIIA 1XF2A 1EAPB 4JAMA 4JFYB 1J8KA 2R0ZL 4HF5L 2E7BA 3JSSA 3MUGB 5B38A 4ZUVA 2ORBH 3GHEH 4X6BA 3VMNA 4AZ8A 1L7IL 4HGKC 1CLZH 4ELMB 4OGXH 1CU4L 4Z7NF 1FZKA 2EH7H 1XEDA 1IL1A 3QUMH 5D7IA 1NGYB 2C1OB 1J11A 1BZQK 3OF6A 1I8KB 4HK3N 5FOJA 1I3RB 3H9YA 1RVFL 2DLHA 3QDGE 3ZE2F 2XI9A 2H3NA 3X13A 4QHNB 4XHQA 1DE4B 4YZFF 2ERJB 2DICA 2EC9U 4NQEA 1AGFA 1FNGA 4BZ1L 1FRGL 2EXWC 1TTUA 4BFIA 4UILH 3NCJH 3P30L 4M93C 2WWKT 1WICA 2W9EL 1U8QA 4MA3B 2WUCL 5HDQL 4PRBA 1KC5H 2D9CA 3EJYD 4MAUL 1MY5A 5E2VH 2VE6A 4QOKB 4ZSOB 3MLVL 3MV7A 4TUOB 3MXWL 1P4LB 2VXQL 4RGND 1CE6A 5I8KL 3F5WB 1NCAL 2R4SL 1CR9H 1M7DA 3MV9B 5DEFA 3PHQA 2I07A 2GCYB 1IM9B 1SQ2N 3T0EE 2MFNA 4FFVC 2YD7A 1QVOB 2C3XA 1MCPH 5CSBA 4I0PD 4NNYA 2SEBB 1KN2H 3I6GA 5D7SL 3UBXB 4PLNC 4NQDE 3RTQA 3MA7A 1CK0L 3BI9X 5IW6B 2QHLA 1ZLVK 3IDJA 4LPWA 3BZEB 4LIQL 4HG4J 4E0RA 3RPIB 2HT2D 1FGNL 4RMQA 2ZOKB 1FZMA 1HXYB 1YN7A 1LO0H 3VXTA 3IFNL 4LAJH 4OCSL 2J5LC 3O3BA 1NDMA 4F2MB 5IROA 5JIIA 3ULVH 1BJ8A 3PABA 3VG0H 3TO4A 2AGJH 1IQWL 1A6WH 2YR3A 4N8CH 4YBQC 5KS9B 5E70A 5FKPB 2HRLA 4NGHH 4PJEF 2NXYD 6FABL 2QQNH 4L8SA 3L3OB 4NRXA 4XC3H 5E7BA 3WLWC 1J12A 2YK1H 5BO1L 1JZ3A 4KZDH 5JO5A 1N26A 1U3ZA 3DXAE 3GMLB 4Z6AT 1QBMH 1X5FA 4NKQB 4NO5B 2JCCF 4PRPB 4RDQF 2DQEL 5EOQL 3VRLF 4YHNB 5EO0B 3WNOA 1D6EA 2AEIT 4K7FB 3JV5A 3U4EB 3HFMH 4ELKA 2OJEA 1IKNC 2PO6D 3VXNA 1KEMH 1QR4A 5BRZB 3D85D 1U41A 3L95B 4AMKL 1EEQA 4N90D 3LHPL 3ZTJG 2ED8A 2HKFH 1LO3L 4X4ZA 2Y1VA 4NQVA 4LSPH 3V7AG 1KLGB 4RISL 3L6FB 1EERB 4NZTL 3CUPB 4WI4A 2AJVH 2NY1C 3L3JB 5ISZD 3UC0H 5DUMH 4G42B 3O2DL 4X6CA 3E8UH 1VKXB 1UCBH 4TOYL 3WIHH 3ZMRA 5E8DH 2YXMA 4JHWL 3D2UB 4U33A 4K3JL 3EYUH 1CGUA 3P4OB 4LASH 1OF2A 4LQFL 4X6FA 4Q6IC 1C12A 3LKRA 3LV3B 1NPUA 4JR9H 4ZYKB 2F58L 4JM4L 3P11L 3O4OC 2NY2D 2A9ML 4MCYA 5L8LB 2BDNL 4DGVL 4PLKD 2VLJA 3QWRD 1MPAL 1IT9L 1H3UA 1QYGL 5CKAA 3TFKD 2EIEA 4N5UA 5C70A 2BXYA 3WIIL 4J3UA 2EYTA 4U6HB 3NN8A 1ZKAA 3QO1B 1Y6NR 1D5ZB 1R3JB 1HYSD 4HWEL 1MFCL 2DQCH 4PP1D 4ZUTA 4GKSA 5CBAB 3NGBC 4JY6B 4YHYC 4G5ZL 4ODWB 4S1SH 2ITCB 1U8HB 2PYEA 2X41A 4Y4KD 1EUTA 3QXAB 3W0WA 1FG2B 2YHGA 4ZFOA 5EORH 4MDJB 4XPTH 4H25B 5KVGH 2WAHA 4NO0A 2VLRB 2DWDA 2UZIH 1NCCH 3QG7H 5JOFB 2K3TA 5C07A 5C1MB 2OQJB 4M7JL 1PG7X 5A2FA 2NR6D 1MCRA 5E4IA 5I8CA 3GSOA 1A4JB 3TCLB 2H8PA 1F8TH 1KJ3H 4AG4L 2DQJH 4XCFH 3KYNA 2ZUTA 2HFFB 3T0XA 1CD1A 5DMYA 4PJGE 2Z92A 4MCZB 4QOKD 3C5JA 5EU6E 4MJ5A 4LP5A 4EN3C 4KU1A 1CFNB 3L3KA 5KSUB 4LP4A 4U1MA 1EFQA 1UZ6F 4Y5XB 3TA3A 3JVGA 3U82B 2C4XA 4Z7UF 2X70A 1IM9D 3DTXB 2HVJA 5KSAB 4P3DB 1M71B 5J89A 1AI1H 3MV9E 2EDKA 2GEEA 3EFFB 4PG2C 2A6KA 4IRSB 3WKML 2G5BA 1VEPA 1FL6B 4CBPA 4M7ZC 4HK0B 4HKBB 5MI0C 3QDAA 3QEHA 4PJ7B 5DR5L 2QHRH 1AGDA 1CQKA 2FBJH 4KJPC 2DIJA 4PJBE 3N50A 3OPZH 5TFSH 1U2HA 1MCOH 2Y7QA 3BPOC 3RJDA 35C8L 2ADIB 4H88L 1S7SB 4O2EB 3ZHLA 4XRCA 5H35A 1QSFA 1RIVH 1A2YA 1WBYA 5CJQL 3W9DA 4WDIB 3DSFL 3IDYB 3P77A 1CN4A 4YO0A 4PJ5A 5SV4A 1BF2A 3CMGA 5FK9A 5F9JA 1QEWA 3GK8L 3LMJL 3TBVA 1FVEA 4IJ3C 2IQAA 4Y19A 2C1PB 3V6ZB 5DJZA 4JRYA 2AJUH 1YUHB 5H2BB 4XB7A 1ZK9A 2VDNL 1TMCB 5F21B 1JZ8A 1XF4A 3ARFA 2DTMH 1TVHB 4I48B 2V9TA 4XT1C 1TJIL 4PRPD 1XR8A 3CDGA 4LF3B 1VFAB 4XAKE 5LAXA 3HAEG 3QXTA 5J12C 1RZGA 3C6SB 4YHOL 5D2NA 3PWUA 1I8IB 5BRZD 5EA0L 1XCTB 2HN7A 3Q0HA 4QGYA 2FSEA 1ZWIA 4NJAL 5D7LA 1KB5A 2MMXA 4IMLA 3NBNA 1QFWM 2AXJA 3D0LA 1MLBA 1KLUA 4U7MA 4U31A 2OR9L 3CVHB 3KS0H 2BCKB 2O5ZL 4M1CD 4LCWB 4PJ8A 3D2UD 1OB1B 2WWMD 5I6XB 2K1MA 4XBEH 2Q8AH 3DX8B 1DBBL 3UDWC 3MCLH 3BWUC 2A74B 1DSFL 3RU8H 3QNXA 5FECA 1FNFA 5HYQA 4GRWE 2J8UF 4XX1G 1K8DA 4I2XA 1JUFA 4JN2A 4I18A 4Q2ZA 4YFLI 5CLWA 4OLYL 4HKXB 3P73B 2DQGH 4NZUH 2Y07L 4ODXA 1YEHL 3SPVB 2ARWA 1YEEL 5E6ZA 4YLQT 4DZBB 1U8KA 1GCFA 4FQHB 1GZPB 4W70A 4ZNCD 3P4MB 2IBGA 2FD6H 5EFIA 2OS7A 3FAWA 4Y8DC 4QHMB 4JFHD 4XZUA 3E1F1 3KPNB 3IDGB 3KLHD 2CRIA 3ARRA 1IQDA 2VLRD 4KKBC 5SV3A 1P2CA 4Q9RH 4AL8H 5E6IC 1OP3K 3L5WB 1ETZB 4AEIL 2HKHL 5HVGB 2Z8RA 3QDJE 4G43A 5L6YH 1Z5LB 3FN3A 1T0MA 2Z31A 4RMTA 5A16B 3ZZ1A 1YY9D 4EDWH 3STZB 1AO7A 3BH9B 3QHFL 4LEOB 4P23D 5I1LA 1D9KD 3O8XC 3C9NB 1FIEA 1WISA 1Z6JT 4L3EA 3P9MA 3BOVA 1KSRA 5GGSB 2BK8A 3AREB 3MLWL 3I6KB 5F96L 5EBWB 1CIUA 4OV5B 5KSAD 4HWNA 1QLEL 5C09E 1DUYB 1JGEA 3NTCL 1WCBA 4HIJA 1MRFH 4IRSD 4YIQB 4BH8A 3B2VH 3B83A 1FVDB 3PHOA 4MNQD 5C0IA 3U0WH 2F54B 3PXHA 3QXDA 2ICWJ 3DGCR 4NQXB 1RURH 1XR9B 2AJSH 1HOCB 1X6LA 3GM8A 3KXFB 2NY5H 3U36B 5C0GA 4HWZA 4IRJC 3EYFA 5DEGA 2QSCH 1FL5B 3VGAB 3QUYA 3B2UD 5AD0B 1JMZA 5AUMB 1BFVL 3F7QA 1JF1B 4EI5A 4HUNB 1FC2D 4CN6A 4PUBL 1BVKB 1KG0A 1QFPA 4J6RH 1P6AB 1YC8A 3RWDA 1FSKB 1U3YA 3L9RB 1GC1H 2O61B 4GKZA 1FZJA 3PJSA 3U4BH 3OKKB 4AH2A 5GZNC 2ADGA 1LP9B 4MQXD 5IIEA 1KPRB 1U95B 2DQUL 1BMGA 4S10A 4LSDA 3PNWB 4HC1H 2YN5A 1L7TL 3TZVA 4NQUA 4Q9CA 5BOZG 1ND0B 4BH7B 4FZ8L 4TSAH 1BD2E 4XNXH 4U1KA 4X9HA 1UM4H 1U93B 4XNZC 2JCCA 1OAXH 3FT2B 1WCQA 4MQ7A 4NNXA 3S5LA 1RZ7L 3MGOA 2W9DH 1ZHBA 1T6VN 4APQC 4XWGH 1DQDL 1FV1A 1A3LL 4UBDD 4DOHB 1KENL 1PKQB 4JZNB 5GSRA 2DOCA 3QISA 3QIBA 4GRLB 2P42B 3SCMC 3VFPB 4OJFL 3RWHA 3ARDB 3T3ME 4PV8A 4LCWD 4X4XA 3QEUA 3NCEB 2BXZA 3QG6B 1JTTA 4LLYB 5F44A 3WO3B 4PJCA 3H9SE 4TUKH 4YFLF 5E00A 2IPUK 1KIRB 3NA9H 4WV1A 5LQBH 4D8PA 5FA4A 1XIWD 1QOKA 3HZYA 2XTJB 4JG0L 4WW1B 5TH2B 3DECA 4XXDB 3W9EB 3QQ4A 4YC2C 5E2WH 4D0DA 2WBWB 5JA9A 2LTQC 3QP3A 1U3HA 4HD9A 1S7UA 5EOCJ 4LKCA 1FGVL 5IG7B 3K1DA 1T2QH 2N7AA 4TVPE 2VUYA 2OSLB 3H42H 4I0CC 4PJHB 3OAZK 3A6BH 5EZIL 5CD3A 3PG2A 4XXCC 1VFMA 3RL1B 4F33B 3IFLL 4H20L 4LSVH 4ODHH 1S7TA 5FF6A 3HUJA 2Y4SA 1LEIA 2P8LA 5SWZA 5D5ME 1Q94B 1P9MC 1J86A 2VC2H 3WD5L 4H5SB 5CP7B 4N5ED 4YX2H 1TVBB 4DFIA 5KAQG 3KR3L 4XCCH 5B39A 1A5FL 3VD4A 1S9XB 1F6LL 1BM3L 1G0XA 1MRCH 1G1CA 3Q6FA 4NOFA 1IGML 3VA2C 4PJAF 2NCMA 3X14B 2APWA 4OCXH 5I16B 3BRFA 3RNKA 5KVFH 4HZLB 1EHLH 5GGSY 3LRSA 5T3XH 2HH0L 1P7QB 4JRXB 5J6GA 2GITB 1J8HB 4PJCE 4IIQA 5KVEL 1DZBA 4LLAA 2WINB 4TSCL 5IQ9B 1WAAF 5ADOL 2DD8H 3CFBA 1EHAA 1TPXC 1NLDH 3KYOA 3BIBX 2ZNWA 3G6AA 4Y89A 1MFEH 3LCYA 1X5JA 4K94L 4X4MA 3ARED 3UO1L 3B9KB 4JHBA 3TPUA 2CJUL 4LSSL 2NLJA 4DK3A 1ED3A 4YHKH 3RVTD 3UAJC 2NNAA 3WXVL 2CLZA 5F7FA 1YEGL 4Q6YA 1L4IA 5TQ2H 3E6FA 1JZ7A 3RKDD 2VABB 1WZ1L 3T04D 3ARXA 2X4SB 3F7VB 5D1ZC 1NGZA 1NQBA 4OGZA 3KXFD 1JPFA 3TIEB 3HTLX 4ODSL 1AHWC 5HHVH 4HIEA 4XPGL 3ARBB 3PP4L 4WW2C 4X80H 5HVHB 5DO2D 2F8XC 4POZC 4YXLH 3TYFA 3WS3B 2PW1B 1CXEA 1DVFD 4PR5B 5A2JH 2XRAH 1A7PH 4ZFFA 4XMLH 2MTPA 2AEPL 2JB6B 4X99B 1IAII 3O9WC 3OR7B 5EBMB 2Q6WA 5HD8C 5HHPA 3BDBA 5MERA 2I9TB 5DMIL 2VITA 2P5WA 5C7XL 3EO0B 3MNZB 5FHBL 2VDPH 1X4ZA 4I3RL 4P9HH 3C08L 5EPMA 4G7VL 3AC0A 1CFQA 3EFDH 2VLKA 5CGYC 1U8NA 2KZ1B 4YWGH 4Y2DB 4KMTH 4KROC 3MOBL 4NWTL 1SJEA 2OBGA 3LKQB 2OCFD 5JOPD 1H0DB 2K7PA 5ICZA 3GSNH 2B0SL 4GS7C 3VI3E 7FABL 1I8MA 5C6WH 5D93B 1MAKA 3U6RA 1W72B 3FT3B 1OM3H 5INDB 3B9DA 5HI5C 1SEBB 4BUHA 3GRWL 5EC2B 4LLWB 4HMEA 3MRNB 3WN5C 2MCG1 4U1LA 1V7NL 2XKNA 2IGFL 3ARDD 2V6HA 4FQXA 1PKQE 5IK3B 2EYSA 2QR0A 1YEFH 1CD0A 1EFXB 5IB3A 5KAQF 4ZO7A 4JN1H 4M6NL 1N3NB 3QNZA 1Q9LA 3WS6A 2HJFA 4PB9H 3OKLB 4OZIE 5IFJB 4P3CH 4M62L 4Y88A 2XTJD 2PW2B 4U6YB 1HHGA 4I1NB 3ULUD 1K3IA 5I1JH 3OAYK 3PWNB 2NXZB 3O6KL 2HYMA 4IOSD 3RGVA 5ACLA 4W68A 4JZJA 4OZ4A 5DK2B 3RHWK 4XI5D 4NO2A 4QHKI 4XH2B 1NJ9B 4L3CB 1JHLH 4N8VB 2ZPKH 2YSSB 5DS8A 2VLKE 4U6XA 2RB8A 1JGVH 1OQOA 2F19L 4OCMC 2YEZB 4F9PC 2DMCA 1FO0A 3X3GL 5SX5K 4FXLA 5ETUB 2CLRA 5E8OA 3FB7A 2I9LB 4U3HA 2VAJA 4I77L 4XGZB 2D7MA 5DURB 1KIQB 3KNBA 5GGUB 1IGYA 4NHCH 4OF0A 2DJ4A 4XPHH 5DJ2A 4LCYB 1I1FA 3ILQD 2V2TB 2OTUB 3VFMA 1DTUA 1R5IB 2XKUA 2A9NH 4Y16A 5LVEA 2NPLX 4OI7A 2JELL 3G9VA 3WFZA 5I19H 3JTSB 4JRXD 1J8HD 1DQQA 5BW7A 4J8RA 4HT1H 1AKJD 5KOVC 5TDPA 1VGEL 4CKVX 4X7DC 5D6DC 2VQUA 4YBHA 1FN4A 2FIKA 2ESVA 1LO2H 4H26B 5JHLL 4KY1L 4JY5H 1UM6L 4ONHA 4R8WH 3U30C 3CU1A 1IZJA 1MCJA 2EE9A 4TYUA 1AC0A 4WUUD 3B9KD 5FIEA 1HNFA 1MNUL 4QXTA 3KS0J 2CRYA 4X8XA 2LAAA 4L1DA 5C0RH 2ICWB 3T4YA 5HHNA 4KVCL 1ZV5A 3MOAH 1NBZA 3VH8G 5BZWB 1AP2A 3BPLC 5HDBF 1X6NA 1YPZF 2R2CA 4HGWB 4WI5A 4R7DB 1Z9LA 5I74C 5JHDA 3BGFC 5FYKD 3VWKC 1A9EB 5HGAA 4LRNH 1PQZB 5IVXF 3HAEA 1UGNA 4Z0BH 5LXGH 1DBJH 3T2NH 1RU9L 1FH5L 4J4PC 4M5YL 4WWID 3TN0B 1G7MA 3O6FA 3EAKA 5L2JB 1YYMH 3QYCA 1D5XA 3IXAB 4KUCD 3BWAB 1FO0H 2DQFA 4PGBB 2XZAH 1WZKA 4FOMA 1DQJA 5E4EC 4TQEL 1R3LA 4KRPC 1S5HB 2B5IC 2ZOLA 2HVKB 2F8OA 1AXSA 1Q1JH 1ZT1A 3V5KA 4BFEA 5J8OA 3T4AB 4U0RC 3BW9B 4HQQL 4JJHA 2ESVE 1TFHA 1U36A 3EO1A 1RJZA 3O3DA 2IG2L 1CGSL 3K7UA 3QQNA 4K71C 4RWHA 4Y2DD 4FQIH 3MRFA 1T7YA 1P7HL 4V1DE 1AGCB 1VFBB 1HH6B 4M00A 4G9FB 4XMKL 1CL7L 3KHOA 3VDBA 1GH7A 2WQRA 2ED9A 5HHQB 4M9PA 1BLNB 5IWLC 2DTSA 3G5ZA 1NGQL 3PDOB 3S36L 2BVOB 3T08A 2NMSA 4JFQA 4ZPVB 2R4RH 1A6ZA 3DMMB 1IGFH 3VG9C 1BIHA 2I60H 1HQRA 4K8RH 2FL5A 1CXKA 4DKEL 2YA0A 4XPAH 3C2AH 3FOMB 3IGAB 3RAJH 4GJTB 3CFEB 4JM2A 1IBGL 2OM5A 4WY7H 3TVMA 4NCDA 1WJ3A 3HE7C 3RY4A 2VTFA 5GS0C 3M45A 5JMOC 3DYOA 4D9LL 4ZS7H 1N64L 4DUXA 3CMOL 4HXBH 2HG5B 4Y2OA 4CVWA 1NCWL 5ICXA 4BQCA 3WO4C 3MRLB 3DETC 1AY1H 3CX2A 5DD3L 1O0VA 3BT2L 1HH9B 3NCMA 5K59F 3K3QA 5JPMA 1XCQA 3LAFA 2HLAA 2X09A 3LB6D 2AK1H 3HAEH 1LNUB 1NAMA 3IXTB 2H2PC 2I5YH 2NXZD 2EIBA 2VDQL 5IQ7H 2XA8L 5BS0B 3RVVC 4ZPTA 1KCRL 1XF2B 1WBXA 4JAMB 2V7NA 4ZUVB 4NP4H 3UTSA 4R26L 5J56B 4F15C 1WK0A 1FNEA 1A1NA 1FZKB 2CDEA 4HBCL 1IL1B 1YQVL 5D7IB 5DRWA 4WHYG 3TC9A 4XXCA 1DR9A 1CFBA 1YEJL 3PWPE 2FECL 4U6VL 5DURD 5B8CC 5L2KA 2Z35A 1F58L 3EBAA 1RMFL 3DPBA 4NQEB 1AGFB 1FNGB 5IVOA 4ODVL 4R0LA 1MJUL 3GSRA 2FYYA 5E24E 3SE8H 5DJCA 1OTUD 4LHUA 1U8QB 4PRBB 4O5LL 5I8EA 2F74A 3LDBC 2VE6B 3MV7B 3MRIA 3GSUA 1JK8A 2Q8BL 3GHBL 1CE6B 2WBJC 4KK8D 1M7DB 4FXKA 5DEFB 2ZG3A 5D72L 3DUSB 3MRCA 1BX2A 2OXHA 2LU3A 1WAAA 1A1MA 1QSVA 3VD3A 4PLJD 5DD1L 3ARVA 4NNYB 3I6GB 5CEZH 1MIML 4LVOC 3QIWB 1N5YL 1NCDL 3RTQB 4YDVA 3MA7B 4RFNC 4Y4HA 3IDJB 2PXYC 3QIUA 5DMJB 4E0RB 4MXQC 4F7PB 1N0LA 3O3AA 3BIAX 2X05A 1JPSL 2GAZA 1FZMB 3ET9F 2DLTA 1YN7B 3VXTB 3O3BB 5IOPA 2NTSP 5CHNA 2CPCA 2JLLA 3C60A 3HB3D 1RZFH 1NAMH 3HC3L 2UZXB 3PABB 3TO4B 1CTNA 3MXVL 2P5EA 5DVKA 1JGLL 2XQYG 2DI7A 1FPTL 1OAKH 4RWYH 1CXLA 3TN0D 4NSKA 1FNLA 3CAFA 2BRRL 2IANA 4NRXB 3NPSB 4XP9L 4Q7DA 3SDAC 4JKKA 4RMVA 5FCSH 1SMAA 1NH6A 4IMKA 3AS1A 2CDFA 5JO5B 5T3ZD 3VU2A 3REVA 4OD2A 5F70A 2F5AL 1GYAA 1SEQL 4TNWF 4R9HA 3M07A 3O4LA 5KOMC 4PJXA 2AEQH 4XVSH 1D6EB 3GMOA 3EOYG 4P2RD 4LGSB 5GRJH 4ELKB 1S5IH 2EDFA 2OJEB 4L4TE 3VXNB 1JGUL 5DFWH 1X5ZA 2Y23A 4P2QA 2EE3A 5GGVH 1YMMD 1Q0XL 4N1EA 3V0AC 4WEMB 3I9GL 3KPSE 3FB6A 1Q38A 4NQVB 4OKVA 5F6IB 3PGDA 3GIVA 1BJ1H 4DKFH 3J7HA 2FO1A 5FGBA 3QHTC 1QO3A 4X6CB 2KUTA 4G9FE 25C8L 4A2LA 1RZ8A 1WT5C 3DMMD 3CXDH 4Z7VE 3RY5A 4DGYL 5E08H 1AC6A 1TLKA 4LEXL 4ZFGH 4WWKC 5BVPL 3GIZH 1OF2B 4X6FB 4ENED 4GQ9L 1C12B 3QO0B 1OHQA 3LKRB 4JHAL 1AE6H 3QCUL 5F6HJ 2P5EE 4N0CD 4FP8H 4MCYB 1GGTA 3ZE0E 1ZLWK 1LD9A 3ZE1F 3SGDI 1MAMH 5FYKL 3EYSH 1DCLA 2X1XR 5DQ9A 2EYTB 4ZFZA 3NN8B 3OB0K 2WUBH 3I6LD 1VESA 1UWEL 1KJ2L 2AS5M 2R1WA 4WCYH 4TNVK 4LSRH 2VXTL 4OSUH 4ZUTB 3FOLA 4GKSB 5BS0D 5F1KC 2LU4A 1F90H 4LCUA 1G7PA 4PJXE 4EVNA 1A8JH 2PYEB 5TF0A 3QCVH 3W0WB 4LMQE 3PDGA 4OZHB 4ZFOB 4LLMA 3ULVE 5I2IB 3UPRA 4KDTA 3H2WA 5IB5A 4P2QE 3KLSA 2ZCHH 5DUPH 5TDNA 4L5FH 4NO0B 2E3VA 5DWUL 2DWDB 2CO6B 5JXEC 5ILTH 3KPQA 5F7EL 5I1GH 3OF6D 5C07B 2RBLA 4F7EB 4KGLA 3W5MA 2GYSA 5I8CB 1A7NL 4NQED 3GSOB 5DD5L 2H8PB 3IJSA 1CTOA 5GGTL 1UYWL 1DLHA 1F4WL 4JFDB 2IBBA 5BMFH 2YUWA 3JV4A 4MX7A 4FQCL 1CD1B 5F3BB 3C5JB 4XP6H 3MV7D 4MJ5B 1G6VK 2V5TA 3PL6B 3L3KB 1I4FA 4QHUA 2F5BH 3TA3B 2FB4H 1N4XH 2DKUA 1MFAL 2X70B 2PNDA 4P4KA 1MFBH 4X0KA 3MRPA 3NIDF 3QH3A 2HVJB 3VXUE 4M7LL 4AQOA 3ILPB 1JZ5A 5AG8A 2NY4C 2A6KB 3RTQD 2G5BB 5FOBA 3BYYA 4PJIA 4WHDA 3H3BC 2ZSVB 4WHCA 1E4XH 2EIZB 5K9KA 3QEHB 5A3ID 4G3YL 2OX5A 4S0SD 2VR5A 5SWSB 3RJQB 5ENWA 4YHPB 1HHIA 2APXA 4U2ZA 3DURA 1IAOA 5AYUH 2RCSH 4URTB 1T03H 1T04A 2UYLA 2Y7QB 1A7RH 1YPZA 3VWJB 2P45B 5H35B 4QRPA 1A2YB 1MVUA 3W9DB 3TO4D 3P77B 2DQIL 1L9MA 4YO0B 3A67L 4PJ5B 5IVXA 1X44A 3C6LA 4PGCA 2YPLA 2YBRA 4M6ML 5FK9B 5CEXB 5F9JB 5HYJA 4NM8L 1QEWB 1I9RH 4AQ1B 3TBVB 1FVEB 2IQAB 3UTTE 3WFEH 1H8OA 4JRYB 5DJZB 3WUWA 4G6FD 3OR6A 2FJGA 4UT7H 3WFDL 5CJOH 3ZSTA 1Y18A 1C5DA 2EKSB 4RGNC 4WEBH 5DHYA 3ELAT 1NL0H 1XF4B 3ARFB 1VACA 3HRPA 3DX7B 3QUKA 3BFOA 3HPLA 3JTTA 3MRGA 1XR8B 2YOCA 3CDGB 1JYWA 5LAXB 3CD4A 2YXFA 3QJFA 1RZGB 2X10A 3PWUB 2MCPL 1UT9A 4I0PC 4Z7WF 5F88B 2AK4B 5CIPA 3RQ3A 2HN7B 5GJSH 3V6OA 1UXSB 4HBQA 2FSEB 5D7LB 1KB5B 4IMLB 1B90A 4PJIE 5F89A 2HT2C 1CLOL 2B2XH 3D0LB 1J5OH 1MLBB 1I7ZA 1KLUB 4X6DA 5EUOB 2BMKA 3DHJA 3ZT7A 3K46A 3NH7L 4PD4K 3MLTA 4PJ8B 4LPUA 4PY7A 5FO7A 5DHXB 5HVWA 4KVNL 2HTLD 1H5BB 2VN4A 3KJ4B 5HHME 5DQDL 5TE4H 3V5DA 1K9TA 3QNXB 3K8MA 2NXYC 1PAMA 4XCNA 4LAQH 3MUHL 2VLJD 4WTZA 3FKUS 4I2XB 2FX9L 3P9WB 4I13B 1R5VA 4JN2B 4I18B 3EYOB 4K3DH 4Q2ZB 2ARJQ 4ERSL 2YRZA 4U1HA 3VFOB 1ZTXH 5FM5O 4ODXB 1LO4L 4XB8A 5EO9A 3QQ9D 3D3VA 3GKWH 5FCUH 2A1WH 3CFJA 2ORBL 3F7YA 1FFOA 3GHEL 5BQ7A 2ZG2A 3NIGE 2C7UA 5EFIB 5J13B 3QBTB 3R0MA 1CLZL 1T1WB 2DQTH 2PYED 2PO6C 4OGXL 4NKMB 3W0WD 2MKWA 1AD9A 3LN9A 4XZUB 1YNLH 3QUML 5EU3B 3STBA 4NO0D 3DIFA 5HYSG 4OZHE 4C56A 4LOUD 5DQJB 4JO2H 5C07D 4XNUH 3RDTA 1TNMA 5DEZA 3ARYA 4UILL 2BX5A 3NCJL 3C5ZA 4JPKH 1QTYT 4RNRA 5E5UB 1KC5L 3VH8A 5E2VL 1T0MB 3GGWA 4MJ4A 2Z31B 3HMXA 3O41A 1N2RA 3VFGL 3LKSA 1DUZA 1CR9L 2NY2C 1T66D 4PLKC 4L3EB 4J12A 4K7PY 3P9MB 1KT2A 5IHLB 3TFKC 3WLBA 3TA3D 1RHHB 1MCPL 1PW3A 1U58B 1KN2L 3FO2A 3D39A 4QY8A 1HYSC 4YEFA 1FFRA 3MODH 4P2YA 4PP1C 1QFOA 1WCBB 1HHJA 1CDHA 3LQAC 4HIJB 3NZ8A 4Y4KC 5C0IB 1LO0L 1OP5K 1M4KA 2B20A 4GFTB 5EU7C 4DQOH 1CG9A 1IFHH 1I3GH 5GS0H 3QPXL 5C0GB 4HWZB 3CSYB 3QB7C 4GLRI 3ULVL 1ZHKA 3E3QE 4OUUB 3SE4A 2AGJL 5SWSE 1A6WL 4ELMF 4N8CL 4C57C 1B6DA 2NR6C 4NGHL 1KG0B 1QSFD 3RWDB 1XZ0A 2QQNL 4JFXA 4KKLD 1G1YA 2J5LB 4XC3L 4PJ5D 5D2LF 1MHCA 4GKZB 1DLFH 2YK1L 2Y5EA 4PJEB 4AH2B 4KZDL 3HI1B 3B4NA 4Y19D 3WCYA 4K7PX 4JRYD 4PLOB 3CNKA 1J0IA 1QBML 1G7LA 1F3RB 3R8QA 3ROOA 2EZ0D 3CSBA 3SDDD 2QBWA 3ARFD 2X4TA 3X3FH 1RIUH 3HFML 3IDUA 1KEML 2PKDA 4U1KB 2OR8A 2JCCB 4JO4H 4MQ7B 1G0DA 4KI5E 4NNXB 1N6QH 3S5LB 3MGOB 3HMXH 3IDMA 2HKFL 3VGBA 1ZHBB 1ONQB 3BN9D 4LSPL 3QR2A 2F53E 4PFEA 1ORQA 3MRDB 1PDKA 4JZOB 2AJVL 5C0BA 4HUKB 3IETA 1FV1B 3UC0L 5DUML 3C8KA 5D7LD 3E8UL 3FFCA 1UCBL 3WIHL 2YKLH 5E8DL 5GSRB 1Z9MA 3QIBB 2AK4E 3EOBA 5IBTH 2NY6D 3U79A 4WI8A 2E6JA 2JIXA 3IB4A 5BVJB 3KYAA 3EYUL 4X4XB 3SDCA 2O5YH 4LASL 4WFEE 4PJ8D 3PWLB 1NCBH 3SBWC 2ZUWA 4JR9L 3CVIH 1MCDA 2NY1B 5EUOE 5E00B 5TE7H 2VXSH 2XXMB 3LN5B 4WV1B 4OZGE 3AS0A 3SJVE 5FA4B 4CL7A 1CYGA 1OSPH 1E4KC 5JQ6H 3QQ4B 4D0DB 2GIYA 2WW8A 1U3HB 3G6DH 3HCVA 2DQCL 1EK3A 1NUGA 4LKCB 1KPUB 3VFSA 1IC5H 3SDXF 3JV0A 1MCWM 3UZEA 3B43A 5GHWH 4S1SL 1NMBH 1S7TB 4OGYH 5EORL 5FF6B 2VJXA 3GM0A 2P8LB 2VR4A 3TYGH 4XPTL 5C08A 5KVGL 3U0PB 2AABH 1ZA3A 4L4VA 3DRTA 1JNLH 2UZIL 1NCCL 4PRHE 1KGCD 4JVPA 3QG7L 4OF6A 1Y6MR 5D96C 1JNHA 4JFEA 5IB4A 2VDRH 5B39B 5ACZA 3REWB 3BZFA 2JE8A 1F13A 1U6AH 1F8TL 1KJ3L 5EUKA 4M1CC 2D0FA 2DQJL 4XCFL 3RNKB 1LEGA 2P1YA 3LRSB 4A6YA 4AIZA 3T1WA 4Z7NE 4HCRH 4FG6D 2WWMC 1ZEAH 1HI6A 3V7MA 1TITA 2BOCA 1TJHH 1X5AA 1UWGH 2Z31D 4CDGC 2HFGH 1M6OB 1WWWX 3GSNB 4RAUB 1AO7D 1A0QH 4PG9A 5M95B 4YZFE 1KLFA 1WZLA 5AWNH 3KYOB 4L3ED 5BV7C 4JCLA 3O0RH 1ZE3C 3CX5J 3NZHH 2J2ZA 4YNYA 3RNQB 1BJ1J 3RIAK 5DRZA 3O6ML 1AI1L 3TPUB 4ZUUA 4M48H 5T5FH 1DDHA 4XBPA 3L5JA 1I1CA 3FQXA 1ED3B 3S97C 3K8KA 3KJ6H 1PVHA 1J18A 2CLZB 4CN4A 3ETBF 2QHRL 3BD4A 4O00A 1QLRA 2FBJL 3D1MC 1A02N 5DVNA 5C08E 3K74B 4MNHB 2BJMH 1MELA 3OPZL 5IFAL 2OTWA 3GUTA 1YNTA 5TFSL 3KLHC 4WI2A 1U8OA 1MCOL 3BP7A 3SO3B 1RIVL 3QUYD 1GPOH 1FHGA 2F9BT 3H7LA 1JCKA 4Y5YC 4EI5D 4Z95H 4HIEB 3SE9H 2Q86B 4ZFOL 3TYFB 5A2IH 5I71C 4LNRA 1FL3A 1V5JA 2AJUL 5B3NA 4WRLA 5HHPB 2Q6WB 4PY8I 5MERB 3FCTB 1YY9C 4C4KT 2GHWB 4XAWH 1FLRH 4P23C 1R3KA 4J23A 2P5WB 1D9KC 1SVCP 1CLYH 3JWOC 2DTML 3IS0X 3C8DA 5GXBB 2BVTA 4PJEE 5EPMB 1CFQB 4Y5XC 3TZVD 4NM4H 4IJ3B 1U8NB 4HHAB 2EDNA 4A6YH 3O6LH 3TP4A 3HMWH 5KSAC 3B9VA 5T3XD 5ICZB 4PRIE 3GSWA 3R06B 1P5UA 2X4OA 4IRSC 4Z7WA 1I8MB 2X4PA 1AQDA 2ATPA 2W60B 4RGOL 4JPIA 1J0HA 3DROA 4PIRF 2MHAB 4WI9A 1JMXA 3QIBD 2QV2A 4HIIB 4U1LB 1IGIH 1BQHG 5JIKA 2XKNB 1UACL 3MGTA 4R7NB 1XGYH 2Q8AL 3B2UC 4K7PL 1IARB 3MCLL 4MA8H 2QR0B 5IB3B 3RU8L 2GUOA 2H32A 4LHJB 2VZTA 1WITA 5IJVA 4KPHH 2XN9A 1Q9LB 4AEEA 4ZUSA 5C8JA 2DQGL 1HHGB 3VW3H 4MQXC 4NZUL 4CNIB 5LJYH 5CZVH 1U3HD 3RGVB 3RVUD 4ZODA 1B0GB 4JZJB 4OZ4B 4NO2B 5SWQA 2FD6L 4MZ2A 1OVZA 4KV5F 4U6XB 3DYPA 2I27N 5SWZD 5IM7A 1FO0B 4PJFF 5F9DC 5MEOA 3QA3B 4Q9RL 5E8OB 3FB7B 1JTPA 4AL8L 1K85A 4UBDC 1HCVA 3KNBB 1EVUA 3MRHA 1IGYB 1HHHA 2IH3B 4R3SA 5DJ2B 3CLFH 4G6KH 1EDQA 1I1FB 2AQ1A 2CIKB 2FECI 3KVQA 5ESVA 5L6YL 4M5ZH 3VFMB 4F7TA 4X5WA 4Y16B 4CGTA 4EDWL 2KZWA 2QEJA 5I6XC 1DQQB 2R2BA 3JZ7A 4J8RB 2MSPA 3GMPA 4MJIA 1N0XH 4BK4A 4EXPX 1XIWC 1FN4B 2XA3A 1HYRC 2JJTA 3QPQD 4UOW1 3QFJA 3P9LA 3ZT6A 1W0WA 4WNQB 2DF3A 3QZWG 3ARQA 2G2RA 2X42A 4QXTB 5EU4A 2H6PA 1MRFL 3B2VL 3T4YB 1IM3A 5HHNB 5DRXA 3VXSA 3U0WL 3CCHA 4CU6A 1NBZB 2ZJSH 1AP2B 4GG6F 4ZD3H 1TZGH 4Z7UE 1RURL 2AJSL 3DVFA 1EH9A 4Q9QH 2IAMA 2NY5L 3UP1A 1AR1D 5E99H 2QSCL 5JHDB 4N5EC 4KJYA 1RFDH 5HGAB 1RPQA 3HAEB 4WO4A 2EICA 4LPXA 4WFGE 4J6RL 1G6RH 3OJDA 5I15H 1GC1L 1NEZA 1QUNA 3S6CA 1D5XB 3U4BL 2DQFB 4D9RD 1O7VA 4AEFA 1DQJB 1R3LB 4MA7H 1QG3A 2WZPD 4HC1L 4YBLB 1AXSB 1ZT1B 3MACH 3V5KB 3W81A 3LS5H 2P5WD 2A2QT 1VEMA 2FR4A 2APVA 3G08A 3GJEA 3EGSA 4P5TA 5TPWH 2YRPA 1RJZB 2Z93A 4TSAL 2R69H 3AREC 4XNXL 1UM4L 3LKOB 4N0RA 5FV1L 2VLKD 5TGBA 1OAXL 1ZXQA 1MREH 3MRFB 2W9DL 4UT6H 4XWGL 1G7JA 2HTKD 4KJQD 2XFXA 3RVTC 1YN6A 2BNQA 4J3OC 4LL9A 1SY6A 4J3SA 4ZS6D 3MRKB 3MRMA 3N1FC 2Y36H 4HS6A 3G5ZB 5CP3A 5F7KC 3BXNB 4JFQB 4XNZB 1A6ZB 4NRZA 3RKDC 5JNYA 1HQRB 2FL5B 1GOFA 2VO5A 4G8FB 2DIBA 3OJVC 2NW3A 4FQXD 3TVMB 4CMMB 4TUKL 4F9LA 3NA9L 1I1YA 4LPYA 2IMNA 5DO2C 2XT1B 1KOAA 5ICXB 1FSKC 5IHBA 3EJJX 1T3FA 4N8PA 1DVFC 2V5RA 3VXRA 5E2WL 4JDZA 5E2TH 2X9YA 3MROA 5GS1A 5DDHA 5JPMB 1XCQB 4Z78B 2HLAB 1T2QL 4E41E 5DD6B 5DHVH 4EXKA 1XH3A 1NAMB 3H42L 4GRMA 5FO9A 3A6BL 4JB9H 1H8SA 3RGVD 5JW4R 4OLXH 4LSVL 2EDJA 1WBXB 2V7NB 5FHAH 4QHKJ 1S7WA 2J8UE 3BKCH 3BX7C 4UTBH 5CZXD 3EO9H 3SDXA 4YC2B 3UTSB 3FB8A 4M4PA 3ZL4H 1I7TB 2X9WA 2VC2L 1EMTH 1ACZA 1FNEB 1A1NB 5J3HD 3ZDYF 1ITCA 4OQ1A 4GKNB 4C83A 1KJMB 4YX2L 1HKLH 2CDEB 1LDPH 4XCCL 5DRWB 4LVHB 4YHLH 1MRCL 2W0FA 5KZCB 1WWAX 2ICEB 4OCXL 5L2KB 4U1IA 2Z35B 3DUUA 2HJLA 5KVFL 1EHLL 4BK5A 2D3VA 5T3XL 2FYYB 3ARDC 5DJCB 2YPKA 4XBGB 4PJAB 4LHUB 4X9IA 4Y16D 2JF1A 2NX5A 5KSBE 5I8EB 2F74B 3ZDXF 1EA9C 1CS6A 3MRIB 3GSVB 1JK8B 3CPLA 3D18A 2DD8L 2CR3A 3LKPB 3AGVA 1E28A 1WC7A 1NLDL 1VADA 2AI0H 2XICA 2PETA 4L9LC 3PDDA 3PP3H 1MFEL 4UNTA 4FXKB 5FAAA 2ZUQC 2ESVD 1LWRA 2NTFB 4PJ9A 2XTJC 3R4DA 5L9DH 1A1MB 3ULUC 1K6QH 4K8RD 4JGMA 4KK5D 4FQQB 3FRUA 3QULA 2BC4A 1OP9A 3NFSH 1Z2KA 3FN9A 4YHKL 4XI5C 2DBJA 2DJUA 3P4LA 3ULUF 3T8XA 2C9AA 3NCYS 4L8CB 4FQLH 5IW1A 3QIUB 2FJHB 3O3AB 5TQ2L 2GAZB 4PJHF 2C4FT 5FEBA 5CHNB 5DA4A 3RWCA 4F7CA 1FAKT 3C60B 3MV01 2X89A 5JHDD 5DJYA 5HHVL 3U83A 4HUXA 4HS3A 4X80L 2HT3D 1W0VB 4YXLL 4MD4A 2FEDD 3ILQC 3KPOA 2JJSA 4GKOA 5D9SA 1GXEA 3BIKA 4NSKB 1TQBB 3O6FD 4NZJA 5D1ZB 2XRAL 1LEKA 1A7PL 2IANB 3X12A 4XMLL 3F58H 1TTFA 1YA5A 4CUCA 3WJJC 2CDFB 3N1PC 4QO1A 2VDPL 3S37H 3REVB 4KDWA 1RZKC 1NAKH 4P9HL 2A73A 3RZCA 3EFDL 1RUAH 4TVSa 2VXUH 4YWGL 4KMTL 3GMOB 1HDMA 1MI5A 3FQTA 2CLVB 2D7QA 4OFDA 3RUGE 3B9KC 4JANA 3GSNL 5IHZA 2A83B 4KKAD 1KNOA 3FB6B 1OM3L 3HG1A 5FM4A 1A4KA 4OKVB 2OK0H 3PGDB 2YUVA 3GIVB 5DJXA 1BJMA 5C0DB 3OKEA 4GUPA 1P1ZA 4XX1E 4G8GA 4ONGH 3TWCH 5D1QA 1RZ8B 1F11A 4JQVC 4JFFA 3MJ9H 4E42A 3FRPG 1J1OH 4HJJH 5IMKA 1T2JA 1YEFL 5F1SA 4JM2D 4JN1L 3TGXA 3TVMD 4HLZG 5T5NG 5BV7H 3AVEA 4PB9L 3WN5B 1MWAA 1LD9B 3BPNB 4P3CL 1H3VA 4D3CH 1I9IH 5CEZE 2VQTA 2H9GA 3RGHA 2VL4A 4RGMB 4GLRH 1ULVA 5DQ9B 4AT6A 2X44D 4BSJA 3ARSA 4ZFZB 5ANME 5FGSA 4KUCF 4LBEA 2HFEA 4R4ND 3FOLB 4EQ3A 1JHLL 2ZPKL 2VZVA 4XPFH 5AYQA 4LCUB 1G7PB 4EVNB 1JGVL 4NKOA 4Y2DC 4PRDA 5AAMA 3UTOA 3S35H 4LLMB 3P0GB 3UTSD 3UPRB 1HIMH 4NBYB 4XC1H 3W39A 5EU5A 3KPQB 5GGVY 4NHCL 5D93C 4XPHL 4LCIH 3GJFA 5KZCD 4W81A 2FX8H 4HULB 2N1KA 5L2KD 4G8GE 5HHOB 3MX0A 3INUH 4JLRA 2BERA 1T1ZA 2R8SH 4PJDE 2A9NL 4HUMB 2L7JA 5GS3A 3BMVA 5I19L 2FEEL 4RCAA 3JWOH 3JV4B 4P2CG 4M3JA 4LHUD 4MX7B 2X4NB 3QXUA 4HT1L 3TBWA 1RJLA 2YD9A 2BSED 2J12B 5B4MD 1LO2L 1I4FB 4PJAE 4QHUB 5EBLB 4DVBA 4JY5L 4R8WL 3NA4A 3P0VH 4RQQA 4P4KB 3E6HA 1DL7H 1ZLUH 3UJJH 1FFNA 2DMKA 3LB6C 2VSDA 4RMWA 3VI4F 2NXZC 4MD5B 3DJ9A 5C0RL 3GFUA 1AXTH 1XIWA 3BKML 3MOAL 4Y4HD 3JUYA 4YJZL 5FOBB 4PYGA 4QWWD 3QIUD 4J3WA 5K9KB 2H1PH 1DFBH 5K93A 1RSFA 3RWGA 4H8WC 1H8NA 4DAGH 3DURB 1IAOB 4JCMA 4YR6A 4DZ8A 4LRNL 1TVDA 2XPGA 2UYLB 1G84A 3C60D 4Z0BL 1DBJL 2W1NA 3MPCA 3T2NL 1YPZB 3RIFF 1ROWA 1I3VA 5GIRA 3MBEA 4QRPB 1MVUB 1YYML 3HRZA 2P5ED 5IVXB 3EYQD 4PGCB 2V5SA 1FO0L 2YPLB 1NFDA 5HYJB 1D5IH 5I74B 1OTUC 2IAND 2XZAL 4FN0A 4MD0A 3R0NA 3O3UN 3RWIB 1NFIA 1CT8A 1Q1JL 3OR6B 2FJGB 15C8H 1BQHA 5GRWA 1CGVA 1C5DB 3VFVB 4OIAA 3GJFH 5T5NF 5DHYB 4KK8C 4FQ2H 3QUKB 3VGDA 3H8NA 3JTTB 4PGZA 3O4LD 3MRGB 4Y1AE 4FQIL 3TIDA 3QJFB 4PLJC 1ZGLP 2GJ6E 1SYVB 5B38G 1MEXH 4UNVA 4WTXA 4P2QD 3EOAA 1OAUH 3THMH 5HGDA 1HZHH 5EZJB 2ITDA 3CVHH 3ECBB 1ZHLB 2R4RL 1IGFL 3MBXH 2I60L 1N5AB 4K71B 4K8RL 1I7ZB 4M43H 3EOTH 4XPAL 3C2AL 3RAJL 3JWDC 1VEOA 5T33H 5LGKA 1RV6X 3HB3C 4WY7L 5H94A 3MLTB 4WIQA 4HFUH 2MQ3A 4PY7B 5FO7B 4ZS7L 1QHPA 2FNBA 4HXBL 5CJ5A 2AXFA 1WTLA 3CK0H 4X5XA 3V5DB 4FTVA 4K2UH 3TN0C 1AY1L 2P8PA 1RQ5A 4WFFD 1NFDE 1R5VB 3OKDB 2YZ1A 4KTEH 3MJGX 2AK1L 2I5YL 4U1HB 4HG4K 5IQ7L 5DFVD 4X7TA 2FJFA 3G6JA 3LH2H 4ODUA 2ATKA 2Y6SD 5GJTH 5EO9B 3D3VB 1PZ5A 4PRAA 3WFBH 3CFJB 4NP4L 3F7YB 4NOBA 5BQ7B 4GBXA 1OLLA 4LFHG 4P49A 2GY7B 5EN2A 1AD9B 1SJHA 1D5MB 4J3VA 1IGJA 3WL9A 3QWOA 1A9BB 2PTTA 3D48R 3DIFB 2HWZH 2OXGA 3QDME 4C56B 5KW9H 4B5EA 3IAGC 3FMGH 1A14H 4NUGH 3RDTB 1ZSDA 3OX8A 3C5ZB 3DMMC 3SE8L 1TQCB 4BJLA 2EE6A 1FYTE 2N7BA 3LSOB 5DD0H 1UWXK 3VH8B 3OQ3B 1YMHA 2CK2A 3GGWB 4Z77A 5HHOE 4ENEC 1N2RB 5M7QA 1B0RB 4N0CC 1DUZB 3OJMB 1UEMA 3HN3A 1KT2B 1HEZB 2JK5A 5INCA 1JHTB 2E9JA 2XQBH 3WLBB 5FO8A 2R1YA 3F6IA 2AQ3A 3D25A 4P4KD 5CEZL 3FO2B 3D39B 4QY8B 3VXMA 3KLAA 5IBUG 2VAAA 4GW5A 1CFTA 3KPRE 4HFWA 3B8SA 3RY6A 3QFDA 3NZ8B 1SJXA 5E9DB 2WWKO 3GBNH 4ZQKA 3U9PH 1CG9B 3ALPA 4ISVA 5F7HA 1KCUH 1RZFL 4LVOB 1NAML 4X7EC 1HILB 4HMCA 4RFNB 5L88H 1OGTB 4CVXA 1CICA 3E2HB 5LGHH 4I9WD 4N0UA 4RAVA 1OAKL 4QRPD 4X9GA 4RWYL 2E7HA 5J4MA 3MJ7B 4JFXB 4JEGB 3D0VB 3C6LD 1KJVA 1DEDA 4F8TA 2YPLD 4NHUA 5HYJD 3ALWA 1E6OH 5KJRH 1ZT7A 3UTZA 3LKNA 4NC0B 3ROOB 1KXVC 2AEQL 4XVSL 4YE4H 2B1HH 1QSEE 5DMGD 5GRJL 1S5IL 1QHOA 3QCTL 2HT4D 5BJTA 5EOTB 2L4OA 5GGVL 5F7UA 3QEQE 3B5GA 3OXRB 4PP2A 1MCFA 2CRZA 3RTQC 1OGAA 1ORQB 4DKFL 3K80A 5C0BB 5F7MC 3IETB 3EIFA 3C8KB 2IFFH 5DC0A 5C9JA 3MV8A 2CUMA 5A3IC 1U8PA 3VDAA 5L8JB 3EOBB 2UUDH 5E08L 1OSZA 2Z8WC 2JIXB 5FYLE 1TZHA 3FFDA 4MQTB 4ZFGL 2XWBA 5IW3A 5IROC 3GIZL 1L6ZA 2BNRB 3HC4H 2W07A 2FHFA 3MFFA 1AE6L 1IEAA 2G75A 4FP8L 3TO4C 4K9EC 1QRNB 5E7FA 1MAML 3EYSL 3ULUH 4L8SC 3VGFA 4M1DH 3NPSC 2WUBL 2X4UA 3MJ6A 4YAQA 4D94A 4WCYL 2FGWH 1D6VH 4LSRL 4OSUL 4YHZH 2P47B 3VFSB 4QRRE 5HYFA 4R2GD 1KCLA 5FYJD 4BSWA 1OAZH 2OL3A 1YYLH 1F90L 3BRGC 1BVZA 1NKRA 3PQYA 1PY9A 3QCVL 3B8YA 4HUWA 1PD6A 1PLGH 1FAIH 1XGTB 4L29A 1AFVL 5JW3H 5DUPL 5K59E 2OJZH 4L5FL 1ZA3B 4L4VB 1DN0A 4LLVA 3DRTB 5ILTL 3NIFE 5I17A 5I1GL 3PIQB 2DL9A 4LU5H 1QR1A 4JFEB 4NQCB 5F6IC 5ACZB 5MENE 3S88H 4Z7QF 3BZFB 1T0NA 1B0WA 1IAKA 3RDTD 5EUKB 2BZDA 3BP5B 5FFLA 2GK2A 3C5ZD 2B39A 1LEGB 4AIZB 3IU4H 4A6YB 1KN4H 5BMFL 1RZKH 4X6CF 1HI6B 4D9QE 2BOCB 1X3DA 2HTLC 4XP6L 3VMPA 4WI7A 4AEHH 2F5BL 3O11B 1UJTA 2FB4L 1N4XL 3U7WH 5F7LB 1SYSB 1GGBH 1MFBL 4PJGF 4WU5A 4YNYB 2AP2A 5DRZB 4AIOA 4HEPG 4I3GA 4ZUUB 5T1KA 1IMHC 1DDHB 1RUKH 1CFSB 2CH8A 4JGUA 3FQXB 3QQ9C 2DWEA 5IFHH 2D4DA 1E4XL 3BZ4A 2CO7B 1MY7A 4MZ3A 4G6MH 5DF0A 2QADB 3HZMA 1QLRB 3ZKND 3MLRL 4FABH 3V4PH 3WFHB 5AYUL 2RCSL 4OLWH 1EXUA 1T03L 2OTWB 1YNTB 4GG8A 4LIQE 1U8OB 2NY4B 1FFPA 1A7RL 4AENA 2H2SD 3O2DA 2OL3H 5LKNA 4X6EA 4LOUC 3FAXA 1Z3GH 3GSQA 4PJBF 1KACB 1LK2B 5ID0A 3T0AA 4QNPE 1I9RL 4N0YH 1NBVH 4YPGA 4LNRB 3WFEL 2UY7A 2HLFD 3TT3H 8FABA 1FL3B 4S1DD 5F8RC 2ARJA 2H26A 2R1XA 4UT7L 3WBDA 5CJOL 1N8ZB 2XZQH 4WEBL 1F5WA 3CJJA 1R3KB 4QCIA 5D1XA 1NL0L 4IOIA 1A3QA 1T66C 2CDGA 5JQHC 3MNWA 3TA3C 3JVGC 1BVLA 1MLCA 2W9LA 5IMMA 3OKMA 5F1OB 2Q3ZA 5GJSL 4WEUD 1H15A 4HWBH 4RGNB 1W72H 2RFXA 3P40A 2V17H 4FFZH 4XCYA 1GAFH 2X4OB 4Z7WB 5C0EA 2B2XL 2X4PB 1J5OL 5C0BD 2ATPB 5I66B 1A7BA 4JPIB 4BYHA 3DROB 3FFCD 3KYMB 4DW2H 1JJUA 3AXLA 2QSVA 3DGGA 2JIXD 2OZ4A 1Q72H 2FWOA 1E27A 3MGTB 2BSRA 1JRHI 3SDCD 1JYNA 4MAYA 2FX7H 1JNJA 5TE4L 2JB5H 2QQQA 4O2CB 2GUOB 2H32B 1J0JA 4LAQL 3EDDA 3TBSA 4KKLC 5HI3D 4QGTA 5IJVB 4KMQA 3IF1A 3ROLA 3L7EB 2BNRE 2XN9B 4ETQA 4K3DL 2Z4QA 2BHUA 4ZUSB 3MSPA 4M7KH 5C8JB 2YPVL 1ZTXL 5I1AA 1QRNE 5DVMA 5C0CA 2BHYA 3V8OA 1S7VA 3GKWL 5FCUL 3QUXA 1BFTA 4H0GA 1WF5A 2A1WL 4IHOA 2EZ0C 2GSIA 3SDDC 3CDYA 5SWQB 1G6RB 1IGTA 3ARFC 1CBVH 4FA8A 3ZE1E 1KXQE 2DQTL 1D5BA 1C08A 4H8WH 2Z8SA 5DT1H 1MCLA 4CJ0A 4W4OA 1YNLL 3KPPA 1TDQA 3WJLA 5D2NC 3FO9A 2WLYA 3L5XH 5C08D 3QDHA 4JRWA 4L4VD 2A9MH 1Y0LA 5C0AA 3BN9C 3JXAA 1QYGH 2ZKHL 4JO2L 2ENYA 4XNUL 4JFED 4ZG1A 3MRHB 4NFDA 1HHHB 4NQTA 2ZCKH 3OTTA 1ZS8A 2PO6B 4JPKL 4HLZH 1RZIA 2AXHA 4R3SB 2NY6C 1OCWH 2EDQA 4F7TB 4NQCE 1AGBA 3DWTA 4X5WB 4PJ8C 2UWEA 5K9QI 1MJ8H 3K4AA 3QDGA 3BP4A 1JNNH 2R2BB 2DI9A 3MOQA 1EEYA 3KJ4C 7CGTA 1FVCB 4XPBH 1OTTD 3GMPB 4MJIB 5FUCC 3UROR 4YDJA 3CDFA 1EEUA 3VXOA 3PV7A 3HI5H 3T0VA 2NY0B 3F12A 3QFJB 1QLFA 2OZ4H 4I18C 3P9LB 4KHTH 1W0WB 3MODL 5E8PB 5F6HI 3B9AA 1LE9B 2G2RB 3QUZA 2CGRH 2H6PB 5EU4B 4HIHA 3FB5A 1IM3B 2HA1A 4Y0GA 5DRXB 3S5LG 3VXSB 3JWDH 3T0EA 2E9BA 5J13C 2QADD 4DQOL 1IFHL 1I3GL 5GS0L 4JGJA 2N4IA 2IAMB 1U8JB 1KCVH 4NQDA 2AAVA 4KJYB 1ZA6A 3TNMA 5DHVB 4OFIA 4WO4B 1EJOH 5CD5C 4Y4KB 3OJDB 4R90H 1NEZB 5EBGA 1DLFL 1XFPA 4YEEA 5T3ZH 4FG6C 5ITBH 1Q8MA 5E03A 2UWEE 4G6AD 4BZYA 2Z31C 2VL5B 5D2LB 4KTYA 4NNPH 4LVNB 4PY8J 5H37G 1GRWA 5DR5H 5HI4D 2B8OT 3G08B 3GJEB 3X3FL 1RIUL 3EGSB 4P5TB 1MHPH 4RMUA 3FHAA 2Z93B 5TGBB 4JO4L 4NYLA 3BJ91 5FA3B 3OKOA 1N6QL 3DVGA 5IF0A 3HMXL 1HWGB 3UMTA 4Z5RA 3DSFH 1FORH 1F97A 2ZCLH 4UQ3A 1G7JB 2PN5A 2XFXB 3DXAA 4N9GA 1YN6B 2BNQB 3GK8H 3FL7A 3G5VA 2YKLL 3LMJH 4OCLC 4S1QH 5DGQA 5IBTL 5AG9A 4HS6B 3HPJA 4RRPG 3B5TA 3SE3A 4RGNE 3A6OA 4P4RA 5B39G 2X7LA 1MCKA 4Y7MA 5JNYB 4KTDH 2O5YL 3DO7A 5I1IH 1ADQH 2OMBA 1RI8A 1NCBL 1IJ9A 2NW3B 5HDLA 4QYOB 3CVIL 1AH1A 4YUEH 5DJ8A 5TE7L 2AXGA 3QUYC 2VXSL 5I9QC 5ALBH 2NY7H 4EI5C 1I1YB 3T3MF 4CJ1A 5EOCH 3LEXB 4DCQB 1PG7W 5HYSB 1OSPL 1GGIH 2XN9D 4OQTH 3VXRB 1MSPA 5JQ6L 1BWMA 1M05A 2X1QA 3V5HB 3G6DL 5GS1B 4HJGA 3QRFM 1IC5L 1A1OA 5T1DH 1U91B 1XH3B 1B4JH 1T80A 4GRMB 4O4YH 5FO9B 5F9WC 5KG9A 2QQLH 5GHWL 3CZFA 2VB5A 1NMBL 4OGYL 3TZVC 1S7WB 1WUNT 4XMPH 3SDXB 3TYGL 4M8VA 5L0QC 1VSCA 3SO5A 2AABL 1GJIA 2ADFH 3FB8B 3N0PB 1FLTX 1JNLL 3LEVH 3MLZH 4P2OA 4C83B 1BF8A 2WP3O 4R6UA 2RIKA 4UV7H 1A64A 5D5MF 3U7AA 2D31B 2W0FB 4AM0B 4NKIH 4IDLA 3LZFH 1U6AL 1MCHA 3V8CA 3A6CH 1KTKE 3FQNA 4U1IB 1J1XH 2HJLB 3QIBC 4PB0H 2CXGA 4HCRL 3VD7A 2LU7A 5GGQH 1EZVY 1ZEAL 3GBMH 4R4BA 1TJHL 3MUGA 1FZOA 1UWGL 2NX5B 5D96B 1MCBA 2HFGL 2FEEI 2VIRA 4MJ6A 1A0QL 3BPCA 4N90E 3D18B 4WV1C 3DVIA 1S7RB 5AWNL 1VADB 1MCNA 4NDMB 3VRIA 2KQNA 4PJCF 1UXWB 4KAQH 3O0RL 4MJID 4NN7C 3NZHL 5ISZE 4PJ9B 5CAYB 2NY0D 5T5FL 3QFJD 5JR1H 2EDHA 3S98A 1T5WA 4IS6A 4KI1A 1U3HC 3SKOA 2DL2A 4OLZH 4PJGA 3FRUB 3QULB 2BC4B 2XG4A 5EU6A 3RVUC 3ZSSA 5CINH 3SN6N 3KJ6L 2W65A 3WDIA 3T8XB 4BM7A 4NC2B 5BV7B 5IW1B 3U9UA 3VXSD 3DOSA 1U8MA 2BJML 4PD4J 2DIAA 3VXPA 2HFTA 1ZGLM 3MV9A 2IAMD 4F7CB 1WQVT 2GCYA 3HUJF 4P9MH 2EH8H 1GPOL 4K9EH 4KK9D 3IVKB 5DJYB 4E9LA 1K4CA 4Z95L 1OAYL 3WNLA 4HUXB 4WO4D 3SE9L 1UZ8B 4RA3A 2SEBA 1J1PH 3UBXA 4P9HC 1WBZA 4HKZA 3KPOB 5D9SB 3BIKB 1JPTH 1LEKB 3BZEA 3NTCH 4PJBA 4ZXBA 1NMAH 3U2SA 3BH8A 2M8XA 3I02A 4XAWL 1PG7H 5GSVA 1FLRL 2IADA 1HXYA 4X83A 1CLYL 4IIQC 5EU7E 4Y5YB 4ELME 4LLDB 4YQXH 2NY3B 5FV2A 4F2MA 4L9DA 1BFOA 1YECH 2LE9A 3RZCB 3VXQA 4NM4L 5I71B 3QPQC 4P5TD 4A6YL 3O6LL 5D2LE 1HDMB 4KRNA 1MUJA 3HMWL 3FQTB 5FKPA 4CVZA 4P23B 4JANB 1D9KB 2CRMA 1UB6A 3L3OA 1KNOB 5J1TC 3MRRA 2EO1A 1C16A 1A4KB 3FTGB 4HPYH 4BUGA 2BNQD 4QOKE 4ZSOE 1P1ZB 1R3IH 5F72S 1TIUA 1IGIL 5MHSE 3VI3F 1F11B 3GMLA 5JXAL 4JFFB 4HEME 3FO1A 1AR1C 4NO5A 1XGYL 4E42B 3VJ6A 5IMKB 3SOBH 4MA8L 1L7TH 3SO3C 4K7FA 3BRDA 3U4EA 4MNQB 12E8H 1L9NA 3WNPA 4KPHL 5BXFA 1KTLA 4I4WA 4EDXA 4PREA 2R23A 4BZ2H 4EIZC 2P44B 2H9GB 2XYCA 4UDUA 3L6FA 3VW3L 3VXRD 3CUPA 3SQOH 2OLDA 3ZHKA 3L3JA 2FCBA 1MCCA 5CZVL 2R39A 1UENA 3MYJA 1VKXA 1LHZA 4LBEB 4OZIF 1FJ1A 2HFEB 1T5XB 1IAIM 4NN6B 1MHEA 1A6VH 4RBPH 5DLMH 1S3KH 4F58H 4P5KA 4LSQH 5I1EH 3ARGA 4RFOH 3LV3A 4PRDB 5KS9E 1C5BH 2DJSA 1T2XA 4KJQC 1I7UA 1C7TA 3SDDA 2EEAA 2UY6A 4OF3A 5EU5B 5DSCB 1U92A 3C5SA 4U6HA 4ZS6C 3SGKA 5AEAA 3GJFB 4PJFB 3CLFL 2X40A 4G6KL 1BREA 5D4QA 1D5ZA 4HX1A 1SVZA 4M5ZL 3FONB 1Z9SA 4JLRB 4OKDA 1T1ZB 1ZHNA 5DJDB 3RWFA 4KH2A 5BOPA 1CZ8H 4PRPE 4FQXC 3ABZA 1VFOA 2AV7A 1OARH 2ITCA 2AJZA 1FG2A 2NX5D 2RGSA 3TBWB 1RJLB 5BRZE 1N0XL 2YN3A 4MDJA 1TTGA 2EDTA 1OL0A 4N1CA 4C59B 3EW3B 2ZP0T 3WS6C 3VFRA 2ICES 3QDJA 3LPWA 1T20A 3OG4B 5JOFA 1PGRB 4RQQB 5GRVL 3ARPA 3WE6A 2AQ2A 3E6HB 1WWBX 4PJ9D 4C55A 2CUHA 5ICYA 1NCUA 3X17A 3UYOD 1A3RH 3RGVC 3RKPA 1G7QA 4NIKB 4JZJC 1XIWB 1S8DA 2ZJSL 4ZD3L 1I9EA 2AW2A 5CZXC 5DC9B 4DKDC 1MCSA 4MCZA 3R1GH 2BSSA 4KDVA 5I1KH 1IZKA 5E99L 4LGRB 4MSWA 5J3HC 3RWGB 2D2OA 5KSUA 5C09A 1RFDL 4YR6B 4DZ8B 3VRJB 4GG6B 4OZFG 3CLEH 2X89D 1G6RL 2Y9RT 5JTWA 3DTXA 4FNLH 1V3JA 1Q9WA 4BA8A 3MBEB 5I15L 1MVFA 1WFOA 3EFFA 2CJUH 2GQHA 2WMPA 4HK0A 4UUJB 4Y16C 4MA7L 4MD0B 5GZOD 1NFIB 4JFHE 3LS5L 5BW7C 2VDLH 2AKRA 1BQHB 1Q9OA 4ACPA 2XWTA 2ZUVA 1EV2E 3TM6A 3SKMA 5TPWL 2NY3D 2VLRE 5JORB 2R69L 3RZCD 4K3EH 1MREL 2F15A 4UT6L 1MI5D 4K8RC 1WZMA 4KK5C 1KV3A 1H3PH 1A6AA 3HZVA 1KB5H 3EOAB 3AAZA 2NYYD 3H6JA 5HGDB 4BKLA 4TUJA 4OI8A 2Y36L 3GI8H 2C1PA 2ITDB 3HG1D 1UB5A 4OBRA 3WHXB 1YUHA 5IEHA 5H2BA 3Q5OA 1OTSD 3MREB 1NGWB 3S35X 1BD2A 4UQ2B 3ZYZA 4G8GD 5D1QD 4JFFD 1TVHA 4QXUH 5H94B 4NFCA 1WIOA 3T65A 2JJUA 2FLRT 5IVNA 2UVEA 3GMMB 5F97E 4IOFD 3C6SA 2WSKA 2HT3C 1I8IA 4LHUG 1MH5B 4X5XB 5ECJE 3OJ2C 2FEDC 4FTVB 1R24B 5I73C 1V3LA 3MC0A 3O6FC 2P8PB 1N59A 4WVRA 4XNMA 2BY3A 5E2TL 4MNQE 3LQAL 4PJ7E 5B3JE 3H9SA 1RULH 4JB9L 5CGMA 4OLXL 3G6JB 4YBLC 4ODUB 2ATKB 4F37F 4P59H 5FHAL 1PZ5B 3BKCL 4PRAB 4UTBL 3EO9L 1DVFB 4TRPH 4KZEH 3ZL4L 4GBXB 5DUBA 5EN2B 5FECB 1HKLL 3CSPA 1LDPL 4KKAC 4LDOB 1IGJB 3WL9B 3QWOB 4YHLL 2PTTB 5EZLA 4POUB 2QSQA 3WFCH 1DEEA 3QZWB 3ZDZE 3MO1A 1HSBB 2OI9B 5T1LA 4NZRH 3IKCA 5D5MA 1ZSDB 4QTHA 4Y5VA 3RWEA 4G8EB 5D7JA 3KG5A 3TF7C 4G6JH 4RFEB 1GZPA 4PJFE 1T22B 1YMHB 1EX0A 2A6DA 4JM2C 1XF1A 3TVMC 1UKQA 32C2A 2IPTH 2AI0L 3EHBD 2APTA 4JM2F 2MKLC 4MVBD 1PEWA 2JK5B 5L9DL 5INCB 5FO8B 2R1YB 1JRHH 1K6QL 5D7KD 5SX4I 3L5WA 3D25B 1KB9K 3VXMB 2VZUA 3NFSL 3KLAB 2WP3T 1HINL 4LCWE 4GW5B 4R4NC 3RI5F 4FQLL 4L9LB 2BOBB 1I75A 3DX9A 4HFWB 5A40E 2CSPA 2ZUQB 5C92A 5A16A 3QFDB 1E4XI 5A1AA 1QBBA 2XWJA 1V8HA 1X4YA 4OV6F 3TH3T 4ZQKB 2JJWA 4ISVB 3HNVH 3RX7A 3S3SA 5DTFB 2VZSA 4NPYA 4FQJH 3SDYH 1CICB 4LVHC 1E6JH 5FUOH 4OI9A 3DHMA 4N0UB 4RAVB 5IV2A 3MBED 3UJIH 2G60H 4GG6E 1ACYH 3F58L 3BEVB 2AVGA 1KJVB 3U46A 1NFKA 4R0LC 4NHUB 4QT5A 4JJ5B 2WIIA 1CE1H 4RRPA 4TVPH 3S37L 1C5CH 3UTZB 1NAKL 3SGEI 3LKNB 1XR9A 4RZCA 5DFTA 3IYLW 1RUAL 5B4MC 2D7PA 2VXUL 3U1SH 1FNSH 5JZ7D 1OPGH 1MF2H 1T1YB 4UIKH 5AUMA 1RUQH 3AMKA 5KSVA 5BJTB 1S9YA 1BVKA 5JUEH 2W92A 4PP2B 1P6FA 1AKJB 2A6IA 2FATH 2OK0L 5B22A 5TF1H 1OGAB 4Y4HC 3OKKA 4QWWC 3QIUC 4BELD 5C9JB 3MV8B 1U8PB 4ONGL 3TWCL 1HQ4B 3MJ9L 3LD8B 1LDSA 1FDLH 4WUUB 1I9JH 1OSZB 3PNWA 4HJJL 1J1OL 5CFHA 1TZHB 3TT1H 3V79C 4FFWD 2XWBB 4M1GH 3V4VH 3C60C 1JFQH 3MFFB 5BV7L 4JO1H 1IEAB 3I3BA 1U93A 4Z7VF 2G75B 3FT2A 5E1HB 3TV3H 4O51B 5DVOA 3SKNA 5H37H 1I9IL 4D3CL 3EYQC 4ONFH 4FTVD 2J4WH 3IJHA 1TQBC 5C2UB 3T1FA 4ZNEE 1PKQA 4JZNA 2X4UB 4ZTPH 4YAQB 2F54E 3GMRA 3ZE0F 2APFA 4X7CC 1NGQH 4IMKC 3GO1H 5FUZH 3KXFE 2K9UA 4BSWB 4XPFL 2OL3B 3S36X 4UAOC 4OAWA 4OZIA 3S35L 3BAEH 4L29B 4MNGB 2VLMD 4JG1H 4GBXD 1N64H 3O2WH 1G9MC 1HIML 1CDUA 1T83A 1DN0B 2K7QA 4LLVB 4PJXF 4XC1L 3HC0A 4JQIH 1DBMH 5I17B 4UTAH 1LVEA 4LCIL 4MB4A 4M4RA 4S2SA 2FX8L 1QR1B 3W9EA 1MJ7H 4HDIA 5HGBA 1DN2A 1LP9E 4GSDH 5FGBC 3INUL 4NRYA 2R8SL 1IAKB 4DN4H 1JV5A 3Q1SH 3LIZH 1B9ZA 3ZDYE 3JWOL 1BBJB 4F33A 2O93L 3T2QA 1JVKA 2Z8VC 2PR4H 1CF8H 1ZT4B 4FHBD 3PE9A 4FQPA 3VE0A 5JOPE 3V9FA 1K5NB 3WUWG 3BPNC 3P0VL 4AY0A 4PRNA 1DL7L 4ETYA 3UJJL 4DOHE 4RGMC 2EYRA 2EO9A 5T1KB 5DA0B 3QEQD 5DFVC 5L7XH 3ZDXE 1AXTL 3P4NA 3VXMD 1I1AA 1J7VR 1TZIB 2Y6SC 4HZLA 4MYWB 1EO8H 2IALA 4IDJH 2DWEB 2MQ0A 1P7QA 3BZ4B 1JF5A 1J87A 3STLB 2DDQH 2H1PL 2AV1B 3I75A 1DFBL 3HZMB 3GNMH 4JKWA 4YXKH 1F02I 3F8UB 4DAGL 5IQ9A 1HHKA 4Z18A 1MIEH 3FQRB 4KDTC 1TETH 2DKSA 4GG8B 2FIRT 1BIIA 2DM3A 4AENB 1BZ7A 4OIBA 2XTJE 4YDLB 4OGAD 1CICD 1QZ1A 2I24N 3ZTJH 1UJ3A 4X6EB 3VFTA 3ESUF 3GSQB 1AD0A 5ID0B 4QXGH 1GIGH 1XF5A 3BISA 3M17B 4BSVA 1D5IL 2YD2A 1URLA 4PJHE 1NGXB 4W6WB 4YPGB 5EZOH 4X4YB 1QRKA 3M8OH 3BDYH 8FABB 5JLZA 4C54A 2ARJB 2H26B 2R1XB 2GI7A 4WTZG 1JN6B 1T89A 4ALAH 3LS4H 4OFVA 4GW1B 4QCIB 5D1XB 4FQ2L 1ERNA 4IOIB 1GGUA 2DB8A 4PGDA 4R97B 2CDGB 5FGRA 5TE6H 4Q74A 1M7IA 3MNWB 3OBAA 2V2XA 1BVLB 4KKNA 1EPFA 1KJ2A 4P4KC 3MLPA 1LO5A 3ARBA 5IMMB 3OKMB 4HS8H 1OAUL 1H15B 5ELIA 3THML 2RFXB 1HZHL 4JY4A 3FT4B 4XCYB 3UYPA 3I84A 3CVHL 1O7SA 5C0EB 4JRXE 1OGAD 2JB6A 4X99A 1J8HE 1UVQB 3MBXL 2RQ8A 4M43L 3EOTL 4GXVH 3K2MC 3MV8D 1L6XA 4OCRH 1NSNH 4HUVA 5T33L 4V1DA 4HV8A 3DGGB 3WEXA 4PJIF 2E7MA 5E56A 1E27B 4QRTA 2VDOH 3RA7H 2W59A 3CK0L 3DLQR 1S9WA 4K2UL 4GXUM 4U1NA 3MNVB 3LKQA 3TBSB 2X4RA 1BWWA 3BQUA 5GGTA 5JIHA 3IF1B 2GSGA 3C6LC 1F3JB 1DQMH 1F4YH 4KTEL 1QNZL 4V2CB 4JDTH 1F6AA 5EC2A 5I1AB 5F7DB 1UG9A 5C0CB 3FO0H 3LH2L 5GJTL 4XVTH 1ZLSH 1S9VA 3QUXB 5FYKE 4IHOB 3WFBL 4ZAKA 5D8JH 1Q9KB 1IGTB 2ADJB 3PQYD 3Q5YA 5DMGC 3MZTA 2EDWA 3HS0A 1D5BB 5MP6H 5C6TH 1EFXA 2HT4C 4F57H 3KPPB 5JPNA 5AZ2H 1CGYA 1T1XA 3NIGF 5C0AB 3SHSA 2HWZL 3O2VH 3V6OC 4MNGE 2PYFA 5KW9L 1IGCH 1QBAA 1CXFA 3FMGL 1A14L 4NUGL 1JWMB 1NLBH 4P2RB 3LQMA 3PWNA 1ZS8B 2VZ1A 1YMMB 5DD0L 1NJ9A 3SGJA 3G5XA 2XV6B 2YSSA 1JYVA 5FB8A 5KN5A 1KIPB 1FC1A 1QBLH 4X6DF 1QQDA 3QDGB 1II4E 3PWPA 4L3AA 1SJVA 3HNSH 1SMOA 4OZFA 1AR2A 1KF9B 5ETUA 3T2PA 2XQBL 2C3HA 5CJXA 2I9LA 1RK1A 4YGAB 3LEYH 5MEQA 1IVLA 1BQUA 3F12B 1QLFB 5GRYA 3NFPB 2VZ3A 2Q20A 4L8DA 5I0DA 4WFHD 4ZOAA 4UI2A 3D69A 1F4XH 5T1KD 2V5MA 4R2GC 1INEL 2OTUA 3QUZB 4QRQB 1A6UH 1XF3A 4HIHB 1A7NH 3FB5B 3W2DL 3NCYP 5ITFA 2XG5A 3T0EB 3GBNL 3AM8A 4OD1H 3RFZC 1S7QB 3KYKH 2DQDH 3U9PL 4FQCH 3RX8A 1WEJH 2V2WA 2R29H 1KCUL 2YWZA 4S11A 3LRHA 4NQDB 2Y72A 3G9AB 2F8VA 1ZA6B 5LGHL 5D70H 3S4SG 5EIIB 2LV4A 4XVJH 2BFVH 5B38B 2Y06H 2XOTA 4OFYA 4X6BB 3RDTC 2DLFH 1FG9C 3H9ZA 3C5ZC 1E6OL 1TQCC 2ICWA 3QJHA 5KJRL 3UPAA 1FP5A 4CMHC 2LAGB 2O26U 4YE4L 2H3NB 3AY4A 2B1HL 3X13B 2XIDA 5D1XD 1EGJA 1A9EA 4OLVH 4BFIB 4HUUA 5E8NA 5C0FA 4NWUH 4PTTA 4J3TA 2XTLA 3A0OA 5B21A 4NYLB 1I8LA 3OKOB 4DN3H 3DVGB 4K55A 5IF0B 4MHHI 4DTGH 5HPOA 4Z5RB 4R4FH 1OW0A 1OD7A 5E1AA 5KVDH 3TO2A 4MLSA 4LPCA 3DV6A 4N9GB 3VFUA 2IFFL 4OZFH 3G5VB 4OCYH 5C0ND 3PHQB 2B7DT 5GRZA 5JMRA 2I07B 5CSGA 3HPJB 4YK4C 5DJ6A 3KPMA 3B5HA 3QUMA 2HVKA 3CU7A 3ZKNC 3VCLA 4L4TA 4P4RB 1IC7H 2X1PA 3DO7B 3HC4L 5FYJU 2H2SC 4RX4A 3KPSA 4GAYA 3F65A 1RUPH 4J7RA 5DJ8B 3SE4C 3E2HC 2AXGB 4MAYD 5EIVA 5F7NC 4LRIA 4MHHG 5ESAA 3E0GA 5C9KA 2MCPH 4P99A 3CX5K 1T7XA 3ULUL 4G9FA 2NZ9D 2CMRH 3V6FA 2DLIA 4Z7VA 3N9GH 4M1DL 3T09A 1NDMB 1UC6A 4Q0XL 1W8NA