1LO3H

Retro-diels-alderase catalytic antibody: product analogue
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
220
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFSFRNYGMSWVRQTPEKRLEWVASISYGGLIYYPDSIKGRFTISRDIAQNILYLQMSSLRSEDTAMYHCIRGDSFLVWFTFWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTQVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords If kappa light chain
publication title A structural basis for the activity of retro-Diels-Alder catalytic antibodies: evidence for a catalytic aromatic residue.
pubmed doi rcsb
molecule tags Immune system
total genus 40
structure length 220
sequence length 220
chains with identical sequence Y
ec nomenclature
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lo3H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lo3H01
2R4RH 1A6TA 2PTTA 4EEEA 4RGOL 4PRDA 3WMSA 5DRZA 3VW3L 2XWBA 1BBJB 5L9DH 5CILH 3T0ED 1T1XA 1XGQA 3IXAB 1PKQA 5I8EB 2WWKO 3CZFB 1J88A 4RMVA 4ZAKA 5DA0B 1DN0A 3SDAC 2FJGA 3QHFL 1JNJA 1FNGB 2YC1B 1P1ZB 2E7BA 3MLVH 4P3WA 3I75A 5J1AA 1C8PA 3CFDA 4JPVH 3WFCL 4PY7B 3GHEL 3B6SA 25C8L 2BY3A 4M93B 4YDLC 2Q6WA 5SX5K 2EDRA 2YBRB 3KPSB 2VLRD 2L0DA 1R0AH 4O4YH 1YY8B 3PNWB 1MREL 1XR9A 3KG5A 4B41A 2FR4B 1N3NB 4ZODA 2LTQC 1F6AB 3VD9A 1RFDH 5I16A 1QFWL 1Q9WB 1T1ZB 2F53D 5DMJB 5JNYA 4PRHE 3S36H 5CUSL 3ILPA 4LOUD 3BOVA 1GGIH 5FYJU 1INDH 5LBSL 4YPJA 3D2UD 3Q1SH 1TVHA 7FABL 1Q0XH 3S34H 2DTSA 3BMWA 4OF6A 4RFEB 3O45A 4M9OA 3LIZL 5KSBE 4CMHB 2XYCA 5EU3B 4O2EB 4PJBF 5DJDA 2VXVH 2FH6A 2CUHA 4AENB 4Z9KB 3MBXH 1H3WM 1BVKB 1K8IA 4YEFA 1JPTL 1I3UA 4OD3H 3JTTA 4LPYA 1UM4H 3BZFB 2EC8A 4WEBL 5F1OB 2FGWH 3JBG7 3PDOB 3H3PL 2GTWA 3DROA 2C3XA 1G7JA 4P5MB 1NFDB 1VFUA 1IRAY 3P30H 4NQVB 4UV7H 2P24B 1QFOA 2NY4C 5CEZL 2ENYA 5D2NE 4FQLH 3T04D 1KN2H 5C9JB 1ZLWK 4PJBA 4LDLB 4UUJA 1I3GL 4ETQA 4XC1H 3PHQB 2R2EA 4HC1A 4IIQC 4JRXA 4XMKH 1UA6H 3UZEA 1CXEA 1EA9C 3O4LB 3SDXB 4DZ8B 4NWUL 2AV1B 1U92A 3BWAA 4OLVL 4PJFF 1HHGA 4PGEA 4LCYA 2E8YA 1INQB 3MRLA 2HT2D 1MJJB 4K7PL 3SDDC 2R2BA 3N0PB 3IFNH 5ICXA 4U6VL 4P2OA 1UCBL 3T1WA 4ZUSA 3C6LC 2GI7A 4WGVB 5DS8B 3GBMH 1PVHA 4X7SH 2AJXH 1GH7A 3VXQA 2Y7QB 3H7BB 2E9JA 5C3LD 4GLRH 2YZ1A 5J9PA 4ODSH 5HGDA 3EYVA 4Y2DB 1CDCA 3BH8B 5C0GB 4KI5D 1YEIH 4FXKB 1OOAA 1RJYB 3DO7A 4NN5B 1D5IH 3PG2A 4M1DH 2A73B 1N6UA 4YHZL 1RZGB 5L88H 4HGWA 3ROLA 2NY0B 5DHVA 5BOPA 5ABDE 4AM0A 5T1DL 2Z31A 5IGXH 3DURA 3MRFB 4RGNE 2ZUQC 3DVGB 1EMTL 4NQCB 2HH0L 3B2VL 2UUDH 2NY1B 1HEZA 4KJQC 4WO4C 1P5VA 3HR6A 1JPGB 1N8ZA 3AC0A 4F9LA 5DMKB 1AIFB 5IMMA 2H6PA 3RGVA 3WL9B 1VADB 3FCTA 4PGZA 2VAAB 4IOIA 3NPSC 4QYOB 4YIQA 3NA4A 4QGTA 1BFOA 5HHQA 2HTKD 1D5ZA 4YBQC 4ODUB 3TT3L 1S7TB 3L5JA 3BE1H 2C3WA 5FOBB 5JO5B 3O3DA 3PXHA 1NCCH 2R1YB 1N64L 1E6JH 1MNUH 3IDNA 4KRPC 4CMMA 2BVEA 3H9SB 1JGUL 3G08A 5T33L 1F2XK 1U93B 3DHMA 3QRGH 5FUOL 3QUYA 1T22A 3CK0H 4G8IB 5E2TH 5EIQA 1K2DB 3FOLB 2VDKL 5FAAA 1NCDH 5FO8B 3WFZA 4XPGH 4BQ6A 5C0IA 3OR6B 4MCZB 5T3ZH 5CJ5A 2V17H 1NAML 1R3IL 1LO3H 5EPMA 3EOYG 2GY7B 2X4TB 1RI8A 5JPMA 5C09A 2IPTH 3D85B 4KKAC 5B3JE 5LWYH 1BAFH 4XWOC 4XVTL 5BRZA 2Y5TB 1LWRA 1V7NL 1A14H 4XBPB 5JDSB 1D5XB 1K3ZA 3AM8A 5IFJA 1MCDA 4P99A 4PJ5A 3ULVF 4NT6B 43C9B 3PE9A 1OTSD 5FDWB 1CIUA 5I8OH 3N1GC 4DW2H 3NZHH 4Q9QH 3M1BB 1AFVL 4LCUA 1D6EB 3GI9L 5LCVH 3PWVB 3IS1X 2R8SL 4NFCA 1CGXA 4I2XE 1KBGH 1NGZA 4FG6C 4PP1C 5CJQH 4MD5A 4S1DC 5CZXD 5D7LB 5DD0H 2R23A 5E1AA 3WFDL 4R7DB 4W4OC 3H0TA 4I18C 1IAII 4OZIB 5I15L 3N9GH 4MS8D 3V6OA 2DIAA 4ONGL 4UV4L 3KPPB 4OD2B 3IS0X 5GGRB 4LCIL 3QXDA 4YHKH 3KLHC 1BF2A 3VG9C 4JREB 4YXHL 4AEIH 4K8RD 2AJSL 4WV1B 1ZA6B 5I8KH 2YXMA 5EC2B 1HYSC 3SQOH 4NBXB 3CPLA 4OFYD 5KVEL 2EC9U 4Z76B 3KR3H 2C5DC 1X6NA 5EC1B 2KL6A 4EDXB 1NBYB 5BRZD 2Z35A 1E28A 1FVCA 3VWJA 3ARGD 5FHBH 1EEYB 4GKOA 1P7QD 4U0RB 4PJ5D 3WS6A 1AXSA 5C07B 1FYTA 3UC0L 5TPWL 4WRLA 1FNEB 1G9MH 5TDOA 3V8OA 5FGBA 3V5KA 4FMFA 4LHUB 2FD6H 5H35A 3ZYZA 2D7QA 4ISVA 4X4XB 3DV4B 1CDBA 4TTDD 1RUPH 5HY9A 3RL1B 1G6RL 1OCWH 3PQYB 1CICC 3HMXL 2XZZA 4H1LB 4LVHB 5DURD 2EYSB 4OCNC 1T4KB 1FHGA 5HGAA 1XGUB 4J12A 2APTA 4DKFH 3QUMH 3OAZK 5DGRA 1OWWA 2AEQH 1TZHA 1K4DA 1S5HA 4YAQB 3RVTD 2RB8A 4GBXD 1N5AB 4JO2H 5D1ZD 3RP1A 3TCXA 3HZVA 2I07A 4U1GC 2Q86B 2VL4A 1KCUH 3JV5A 4NC0B 3O3EB 3PUCA 5AWNH 2X2YA 1A3RH 3T4AB 2AJUL 1UKSA 1FFQA 2XZAL 1GZQB 1OTTD 3C8HA 3TVMA 1UT9A 4G6KL 4BZ1L 4KTEH 3UYPA 3LCYA 4HH9A 3VFRB 3KDMA 3VWJD 1FL3A 4YQXL 1XAUA 1YMMB 4OBRA 1LK2B 3L3KB 4ZSOE 3NPZB 3QO0B 2PF6A 1U91A 5DJYA 2ITDB 3QCVL 4OCRL 2UWEF 3O2WL 2FECI 2YD8A 3X14B 3JWOC 4HFUH 5ADOL 5T3ZE 4F7MA 3SE9H 1D7FA 5JW3H 2CO6B 1LEIB 2VDQH 4WO4B 1WK0A 2W92A 4BSJA 3CVIL 3L7FB 4S11A 2VXQL 1QR1B 4KVNH 3UDWC 4Y4KA 3QFDB 4HUVA 1ZHNB 1AGEA 1NC4B 2PXYB 1JIBA 3NPSB 1WITA 2B5IC 2DLIA 5HVHC 5D7JD 1WBXB 2F74B 1UG9A 1MFBL 2WP3O 3K3QA 3GMNB 3BYTA 2E27L 2UWEA 3HS0B 1OAXH 4K23H 4H0GA 3IXTB 3RNQA 4L4VE 2UYLA 4CGTA 1A4JB 1CD8A 1CD1B 2GCYA 1DJSA 2AJZB 3K2UH 2ZUTA 4A6YH 5CEYA 5K9OA 1HHHB 5I76A 1ZT7B 2VXTH 1B90A 2DMCA 4HT1L 5I19H 3VGAC 3GRWH 1H8SA 2D0GA 4K8RL 1KLGA 4JHWH 3IAPA 4N0CC 3OB8A 1SEQL 1HHIA 4RMQA 4FXGA 3EYSH 3DHJA 1GGCH 3QG6B 4WHCA 4Y16B 3MRMA 4PGDA 5F7HA 5JOPD 2MHAA 4XWGL 5GHWL 2ID5A 4MX7B 5HI5C 2FCBA 1WISA 2Y23A 5C92A 3PDGA 2FJHA 2Z4QB 3U7AA 3MGTA 2VIRB 4FTVB 3QH3B 1NFIB 1PG7L 5FV2A 3TNMB 2ZNXA 4X7DC 1J1OL 1XZ0B 4LSDA 2R56L 5IB2B 3DX8B 3F7VA 2HT4D 3S35X 1NCNA 2P46B 3Q3GA 3B9KC 3V0WL 3H3KA 4IOFD 2HFEA 2X4NA 3KWWB 2XRAL 1BFTA 2FEDD 4DVBB 1C1EH 1N5YL 1T0NB 4RISL 1G7PA 1PBYA 4KKLC 5D5MB 3MO1B 1GIGL 2FSEB 1MVUA 1QNZL 2ITCB 3D39E 1HHKA 4Q6IB 4HAFA 3VXNA 4D8PA 3T4YA 1V7ML 2BOBA 1CN4A 3MRCB 2WWMC 3V6ZA 4OUUA 4P57B 4R7NB 5I1IL 2FBJH 5JIPA 3QHZH 1EO8H 2P5WA 1OSZB 4ZFOL 1RHHB 5MI0B 1NAKL 1IM9A 35C8L 4UI2A 5I1EL 2BVOB 3MRDA 1NLDL 1TXKA 3KJ4B 3U83A 3VWKB 3QQ4A 1R3LB 4R26H 2D03H 3O6FA 4MLIA 2PW1B 1NGWB 1LEKA 2YPLE 5IW1B 4M4RA 3BGAA 5E7BA 3HB3C 1IZJA 1IBGH 3NOIA 2C26A 4KK5C 5CSBA 3S37L 1N6QL 4D0CA 5DK0A 1AR1C 1OP5H 4JVWA 5C0AD 4M6ML 3ZDYE 2EEDA 1OY3B 2VDRH 4OZGE 5DMGC 2BSTA 4XPAH 3DETD 5F6IC 3V6FA 2HKHL 3ZO0A 1YNLH 4HKXB 3BP6B 5K9QG 1A7PL 3LDBC 3UYRL 4NPYB 4Z7UB 1GGBH 3L3GB 1CICB 3TNNA 3RZCC 1VFBB 5C0FB 3MNZA 1T3FA 1B0GB 3SCMA 1F5WA 4PRPE 2J12B 1J1PL 2CXGA 1X6LA 2CKBB 3CU1A 4HWEL 4TVPH 4P3DA 3EDJA 1NUDA 3BQUB 1VHPA 1E4XH 4L8DA 1NBQA 5D1QA 3U7YH 4KZEL 2XTJB 4PJ7F 3PABA 3RWIA 4QHUA 4GW4A 1RUQH 2DF3A 4FQXA 4X8JA 3FO9A 4WFGE 1FH5L 4GXVL 5KTEH 2OMNA 5IF0B 3RVVD 3QWQB 2MQCA 4WUUE 1KB5A 3QUZD 4FZ8L 1BIHA 1QRNA 4YBHA 4JDVA 4MAUH 2IJ0C 4WU7A 3GSVB 2ADFH 2APFA 4XCNB 5DRNB 3MOQA 2NY3C 2X4RA 1FDLL 4NC2B 3CXHK 3CFJA 1KEML 3FB7B 4QRSA 2FWOB 1QFHA 4M7JH 4L8SC 4X9IA 5J1SC 1ZVYA 2F54B 3OBAA 2RIKA 1Z5LA 1W0YT 4GG6E 4YEEA 1OD9A 3SCMD 4GW1A 2IBZX 4WJ5A 2I60L 4LCCA 3JWDL 2E7LC 2C4FU 1YQ2A 2CLZB 3WHXA 5HVHB 1CFSA 1KJ2L 4JR9L 1Z9SA 2RCSL 4WW2C 5I1CL 4NBYB 2VERN 4I3SL 2AV7B 3E2HB 3QEQB 4O5LH 4Z7WE 1AGBA 5DGQA 2B0SH 3KHQA 1WEJL 3W2DL 3WFEH 3QWRA 1ZEAH 5CIPB 1Q1JL 3NN8B 3MLXH 4MVBD 3FJTA 1A1OA 3OR7A 4Y89A 2YUVA 1MCIA 1A22B 1NEZB 3VFMB 1AO7D 3LD8B 3PGCA 4XVUD 4QTIL 2A1WH 2CRYA 1NLBL 1I4FB 5IJKC 4UZGA 3NCJH 2UZIL 4JN1L 1LO4L 4Y1AB 1PY4A 4G6JH 1J05A 1U8MA 1WCBA 1FO0L 1JGDA 1JZ8A 2A6JB 4CN6A 4Q97A 4APQB 3MNVB 3LQMA 5C0JA 1RUKL 4IRSB 3U79A 4OCSH 2DS4A 3CFEB 2DLHA 1IEBB 4QHNA 5DJ8B 5GGVL 4GKNA 1U9KA 5MP6L 2ZSWA 4QHKJ 3OXSA 2X4OA 3B9KB 5F8RC 3VXPA 2R0KL 1W0VB 4PJHF 2XQBH 4HPYH 2GJZA 1JI1A 4XVSL 5T5FL 5D7KD 1Z0NA 1RK0A 5K9KB 4ZXBD 4J1UA 4LRNH 1A2YA 2J8UF 4LLQA 4O02H 4K3JH 3IJHA 1OGTA 4C56A 2B1HL 4KPHH 4KUCD 4GKSB 3HPLA 4PJEA 4L3EE 4KK9C 3RIAK 4H5SA 1ITBB 1L0QA 1HIML 3B3IB 4CU8A 1BBDH 3HR5B 4QNPE 2D7OA 2FO1A 1OT2A 3DX9B 1CK0H 2AJVL 4P9HH 2OQJB 3EJYD 5EOQL 5EBWB 5KW9L 4PJHA 3ZL4H 4Z7VE 5B22A 3PF2A 4M02A 4K71C 3GMMA 3FQUA 3QIUA 4M61B 1R24A 3IETB 4G8EB 1UM5L 2J8UA 3RTQC 3E8UL 5JPNA 4JN2B 2GHWB 5DEGB 3INUH 5EZJB 1UWEH 4OQTL 5E8OB 3EUUA 1MCQA 2G75A 2X4PB 2AK4E 3I02A 4TNWF 2ZOKB 1Q9LB 4P23C 4PRHB 5INDB 2BVTA 5TH2B 3LN5A 4O51A 4QRPE 4V1DD 5F6IB 2IEPA 4OAWB 5F7DA 2JK5A 3AAZA 5F44A 3RIFF 3U9UB 1CFBA 3PV6A 4C56D 1UWGL 4MA8H 1WZLA 2HFGH 1KCSH 1TPXC 5KSBB 1M05A 1RMFL 4DN3L 3OKKB 1GC1C 2R0LH 5DUBA 3GBLA 2D7TL 4Y8DC 2C1OA 1F11A 1EFQA 3SGDH 5FK9A 1NC2A 3SKOA 4LIQH 4UQ2B 1I9IH 1YECL 3HE7A 1ACYH 4S0TD 4UAOB 4KDWA 2R0ZL 5DJZB 3MNWB 1VGEL 1UZ8B 3B9EA 3NABL 2AXFA 2BNUA 5CLWA 4JPIA 1BEYH 3SKJL 1CGTA 4P2RD 5F7KC 4P4KB 4PLNC 3UTTA 3UBXI 5IB3B 4BFBD 3A6BH 2X44D 2C1PA 3HZYB 3I50L 2DQUL 5K59E 1OLLA 3BGMA 1P4BL 1MJUL 1U8QB 3IDXH 3BUYB 5D2NB 3BKCL 4N0YH 4AMKH 4KVCL 5D71H 1MHEA 3QI9D 3G6JE 4KJPC 2C9AA 3OB0H 3D18A 2HWZL 4M43L 4JFQA 4OCLC 2DTML 1U0QA 3HPJA 4ONFL 1DBAL 1IQWH 1FC2D 2K3TA 3OKEA 1T20B 4EVNA 2BNRE 2VDOH 4JY5L 2FNBA 1XCQA 1JGLH 2NY3B 2MMXA 3VRLE 1FNHA 3UX9B 3QQ3B 1VERA 1JNHA 1CU4H 2BSED 4QT5B 1YDPB 4PV8B 5CBAA 1MHCA 1S7VA 3QFJE 1PEWA 3BP4B 3GSNA 3SBWA 5EU7C 4BFIB 3FAXA 4B53A 3FFCA 3QJHA 1P4LA 1IZKA 4NN6C 4KY1L 1NC2D 3MOAL 3HE7D 2WV3A 3HC0A 2LFGA 5BVPH 2Y06H 2NLJA 1C08B 2AERT 4M7ZC 4CVXB 3T65B 5GRUL 4OKVA 1FL6A 4XTRD 3D3VD 4MMXC 1CFNA 1I85A 1WBZB 1KEGH 4NKIH 2YD2A 3IGAB 3QDAA 4ONHB 5J56B 1AD0B 4GG8B 5I1GH 4RGNB 4PGJA 1ONQA 4FQJL 4TSBH 5BV7L 1S7QB 4GQ9L 2BC4B 4ORGB 1G7HA 4LPVA 4JKLA 1X5YA 2IADB 3L7EB 1D5BB 2Q8BH 3V4PL 4NRZA 5F93C 3U0PA 2R1WB 3TO4B 4TOYH 25C8H 1DE4A 5FGRA 2FJFB 4CNIB 1JV5A 1T1YB 3BPLB 2NTFB 2MJWA 4PG2C 5DC9B 1M7IB 2FX7L 1PSKL 4NJAH 4KMTL 2V7HA 1MREH 3GMQB 4KJYB 4YFLI 3QHTC 5CP7A 2KDGA 2P7TB 4LNRB 1TCRB 3WDJA 3FFDA 1ZLSH 4XAWL 1J9CT 1SM3L 2IQAB 4QHMA 5DFVD 5ID1A 2ZUSA 5EFIA 1QFWH 3CLFH 1VACB 4G6AC 3MFGB 4L1DA 2HRPL 1MFCL 4EJ1C 1FORL 3VE0A 1HQRA 3RWJA 3C8KA 5I17A 4I0CC 1P84J 4QY8A 2BVYA 3MJ8B 5J6HB 1MH5B 4Z77B 3TYFB 2ZOLA 1N4XL 1G7MA 3QWOB 1UKQA 2MPAL 1RIUL 1DEEB 3JVGA 5GRJH 1DBKH 1SJVA 2GSIB 1RK1B 1TZGL 4P48A 4R0LC 5SWZD 1A64A 5KN5A 4OIBA 4X9BA 3RX5A 5GSRA 1MQKL 4G8GA 1OGAE 3KLAA 4U6TA 1S5IL 5C9KA 5FO7B 3FB6B 4WWKA 5INCA 4WEBH 1JUFA 1T7YA 3VU2A 4X6DF 3TZVA 3VD7A 4CW1B 5IOPA 3H3PH 3GJFK 4LIQE 2VLJE 1MPAH 5C0CE 5HGBA 2V2TB 3GIVB 1IC7L 2CDFB 4KHXL 1UWXH 1CL7I 3O4LD 4K71B 1T21B 2CUMA 1RURL 2NY6B 3BDXA 3DOSA 5BS0E 4XNZC 4I2XB 2E6QA 4E5XA 1A47A 1I3GH 3FRPG 1BPVA 4NKOA 5EIIB 5F7YC 3TLRA 4EXKA 5DWUL 3RJDA 5GGSY 1U3HA 3GIZH 1FCCA 2Q3AA 5IR1B 2F19L 1HKLH 1BJ8A 4TSCL 3FB8B 2BVQA 3PWJA 1AY1L 1UENA 4M1CD 3W81A 2YA1A 1TETH 3L3HB 4WFED 2ADGB 2WINB 4X4ZA 1RJLA 4MA1C 4M8QB 5D72L 1FGNH 1ORSA 5C8JA 4RBPK 4EI5A 2FATH 4HAGA 4LP4A 2ATPB 2LU4A 4F15C 1SJEB 1XGRB 4YXLL 3QPQC 5DD6B 4O9HH 2VDLH 5IBLD 5CFHA 1DBJL 4F58H 4NQCD 4CAGA 4PPTA 3ARUA 5F1NA 5C0BA 2NY2C 4BSWB 4NNXB 3C60C 4PY8I 1Q9KA 2DM2A 5EA0L 4Z8FL 3MGAA 5KS9A 1Y0LA 2VLKA 4R2GB 4L4TE 4NM4L 3MRRA 4HGKC 3GSXA 4EN3A 2CPCA 3F6IA 3VXSD 3B2VH 5TF1L 3MCKB 4J8RB 4O58L 3GMOA 2E7HA 2CDEB 5DRXB 1EHXA 1FZMB 4XCCL 3JV4A 5AYUH 4G8FB 4BKLA 1NL0L 2C3VB 5T1KB 3BFOA 4LSVL 1YMHA 1NGYA 5I1AB 3C9NB 4OM1L 3TT3H 3CSYB 1VDGA 4XHJC 3LEYL 3ARBB 3BX7C 4DUXA 4MDIB 1MUJA 2Q1EA 4WHDA 1QA9A 1FNAA 2VQUA 3FKUS 5D6DA 1OM3L 4AEEA 4KZDH 4NQEA 1YPZF 3VGGA 4KDTC 3IJYA 1X4ZA 1YNKH 5DSCB 5TGBB 2W9LA 4S0SD 5FUOH 1NMCC 2YN5A 2D0HA 3RWCB 2D4DA 2DQTH 1NGQL 2X1PA 4M7ZB 4U4BA 4ZSOB 3SDAD 1WFUA 4EZMA 1NDGB 5EU6E 3S97C 1YN6B 3I9GL 4MNGE 1XGPA 1JNNL 1H3GA 2AQ2A 2VLME 5BW7C 4XMPL 4N1EA 3WYRA 1S9YA 3MYJA 4F2MB 3QEUB 2DM4A 5DQDL 4JG1L 2O26U 3I3BA 1YPZA 3TBYA 1FSKC 5IB5B 1CBVL 4K3DH 4XNXL 5EBLA 2MTPA 4ZS7H 3VFSB 2DKSA 5MENA 3P9MB 3L95A 3U36B 2AABH 3SOBL 2J2ZA 1ZLWH 4NGHL 3T09A 3GK8L 2EH7H 4P46A 5LGHH 1A1NA 5ACMA 4OF0A 4MJID 5E56A 2EYTB 4P4RA 1PZ5B 4L4VB 1OWRM 4YDKH 3KVQA 4F7TB 5D9SA 5B38G 3U6RA 1P7KA 2JJWA 3S88H 5IP4A 3UTZB 1WT5C 4P0DA 2A77L 2NZ9C 5I9QC 3O41A 3C6LA 4C55A 2GJ6E 4UV4H 3TJHC 3TO2B 2DMKA 4ZDHB 3HE6A 1IARB 2NW3B 4NQDE 2G60H 2VL5A 2FRGP 3OX8A 4OKDA 4X6BA 1AHWA 1FFOA 4PJCF 3T1FB 5C07D 1QVOA 1A5FL 3EOAB 4YO0B 2HTLC 3BI9X 3VXTB 3AREB 3DVFA 2J4WL 4OIAA 5JQ6L 3OKDA 5IG7A 4Y4FB 1CR9H 4IJ3C 4F80A 1YZZA 3UC0H 1NCWH 4M6AA 2FHBA 5IEHB 1BX2A 5MEND 4MNHA 4JFXA 2EIZA 1TQCB 3PQYD 4LCWA 1EAJA 3T3ME 2BRRH 5L7XL 3FT3B 3PL6C 3S5LB 3ALWA 2XA3A 3NIFE 1Q94B 2EO9A 4HC1H 5E2VL 1IGCL 5FYJL 1AKJA 4XNZB 1G7LB 3D39B 3IAGC 2A6KB 1A7RH 4GJTB 1OP3K 1AGFB 1CFTA 3G5YA 1UQSA 4M5ZL 3SDDD 2VN7A 4LKCB 1I7ZB 1RZJC 1YEJH 1JRHH 1XF2A 2X42A 4J23A 3C6LD 2VLRE 4M8VA 4IS6A 2LVEA 2WUCH 1M6OA 5IK3A 3BKJL 5TDPB 4A2LA 3I2CL 1CDIA 3ARPA 1A7QH 3G9VA 4X4MA 1BD2A 5DD1L 4OUOA 3QUMB 1ACZA 4XRCA 1Y6KR 1YMMD 2X4SB 4J2XA 4KI1A 4LSQH 4L8CA 2OXGA 2CMRL 1KPUB 3U30B 3ZLQC 5CWSA 5L2JB 5C2UB 2ICEA 2F53E 3GFUA 4TUJB 1A8JH 1KUMA 4U6XA 4JVPA 4H26A 1EEQA 4KRLB 5BZWB 3QUKB 43CAB 1T5XA 5DHVH 4HLJA 5DJXA 3BAEL 1KB9K 1EHAA 3O3BA 4WO4D 5AZ2L 3U1SL 3QO1B 2O5YL 2C3GA 3M07A 3LQAH 4HGMA 3NCCB 3MR9B 1MLCA 3EW3B 2NXZC 1PKQE 3V0AC 4JFEA 5BZDB 4O2FB 1UFUA 1IC1A 4G9FA 3TPKA 1FNSH 4M48H 4ZUWA 4FQ1H 3GDBA 3HNTL 4Z0BH 4BQ9A 2LU3A 1ZA3B 3MCLL 3DYMA 1BZ7B 3SGEI 3V0VB 4E0RA 3LN4A 2FB4L 2JIXA 3ULSB 2HVJB 5DD3L 3ARRA 3M8OL 5IROC 2IAMC 2COQA 4KRPD 4PRPB 4YPGB 5SWSA 4NHUA 2A2QT 3U4BL 4G7YL 4FZEH 3I6LD 4NDMB 1F3JB 2YZ8A 1JHLH 5J0BA 4W4OA 2E27H 4YWGL 4I18A 2XZQL 4UT6H 4QXGL 3OHXB 2D7NA 1K4CB 1LO5A 1S7SA 2LAAA 3NFSL 4GRLC 3LVEA 3D69A 5IBUB 4U1KA 1S78C 1FJ1B 1OD7A 3G04B 4A6YB 4CKVX 3D0VA 2AJYH 2FIKA 3RWHB 3TA3C 1DZBA 4K94H 2NXYC 4WUUB 4GMTL 5CP3A 4OZFA 1NBZB 1F4XH 4S10A 5H2BB 1A9EB 2DQGL 1C5CH 1UXSB 1WQVT 1FBIH 4GXUN 3S7GA 1E0OB 4P2YA 1SY6A 3RUGE 1RQ5A 3FO0H 3RPKA 5BXFA 4UINL 3MRNB 4E42A 1J1OH 4QRRB 2YOCA 5E94B 5HDQH 4AG4H 3Q6GL 4KI5E 1IFHL 2PYFA 3V5DA 1FSKB 3B9VA 1Q72L 4QHLA 4FG6D 4PP1D 1F02I 4S1DD 1WIOA 1AI1L 3P0YH 1DL7H 2IQ9L 2XRAH 4JHAH 5CAYB 4S1SL 1A6AB 4Z5RB 3F8UB 4PJ8B 1WLHA 4PJIE 3OZ9L 2A9ML 1QNZH 4PJBE 1KJMA 3OAZH 2D3VA 4Z7WB 1VPOH 3MLYH 5EUKA 3KLHD 2BVPA 3GO1H 1KIQA 2DMBA 2OJZL 2ADJB 1I9RL 3KLSA 1KELH 1A1MB 1HYSD 5M7QA 1OL0A 4Q2ZB 2FO4B 4GSDL 3HNSH 1A0QH 4MA3A 5GGQL 1AP2B 35C8H 4I0PA 1E27B 1J7VR 4M6OH 4JFOB 4YHPA 5FOJA 3VH8G 1OAZL 2R29L 4EKXA 4M3JA 1EAPA 5CGMA 4CN4A 5EOCL 4NRYB 1AXTH 3QJFA 4Y4HC 4MSWB 3VFNA 3S4SA 2EICA 4FQHB 1EBAA 4AZ8A 1S7WB 2NQCA 1F8TL 3CCHB 3VXMA 5J11B 1KENH 4OGXL 1N6QH 4PJDA 3IAQA 4LU5H 2XN9B 3GMLB 3ME0A 1CICD 3VA2C 3RL2A 3HI1B 1UB6A 1U3YA 5I2IA 4HKZA 2AXGB 1MAMH 4ELKB 3MREB 2DQJH 4Z7NF 1UH4A 1JFQH 1T83C 3OTTA 4J4PC 3X3GH 3L5WA 5SX4I 3BN9C 5KSUA 4CU6A 1SBSL 4L3EB 3X12A 3BQUD 5CD5D 3AY4A 3OF6D 2VTFA 5BO1H 3UXFA 1A6WL 5JXEA 5FM5M 3SJVA 2QHRL 3MJ9A 3PP3H 3ROOB 1QKZL 4I5BB 4X6FA 1BLNB 5KJRL 2X4QB 3WV0A 4XVJH 4KAQL 1HH6A 5T1MB 1RJZA 4OZ4A 5I8CB 1MJ8H 3NBNA 4Z7VB 1MRCL 5LGJA 1JBJA 2DQHL 2VR4A 1OB1B 1H5BC 1MRDH 1FVEA 4KKBC 4M4PA 3MA7B 1IKNA 2R0WL 5IMKA 3WHE1 4LSSH 2XWJB 4Z0XB 3MV9A 4KV5F 4CRPA 5EUOF 1T66C 2AK4B 2RR3A 3G5VA 1NMAH 3TN0A 2F54D 2B39A 3DIFB 4E41A 3BH9A 2VOTA 3FOMB 3VDBA 3VG0L 4IMLB 1D9KA 3PWPA 2B4CC 2BX5A 1IGIH 2ADIB 2X70B 1HZHH 2XWTA 4RAUB 4QRPB 1ORQB 1MCRA 4KXZH 5TE6H 3ARDC 5BRZE 5IVZA 1FRGH 1K9TA 4JO4H 4OZHF 4LSUL 1MRFL 1DLHA 4OIIH 3QUXC 4PJ5E 2DQCH 1UB5B 1IGYB 2VR5A 3QEQD 2IG2H 4JRYA 1JZ2A 1U8HA 3QQNA 5HJ3B 1IGTB 3SJVD 2YA2A 3EO1B 1ZT1A 3BPNC 3QDJA 4R6UA 3K80A 3WO3B 2HFTA 2EIBA 3LSOB 4HIJB 5C08A 5EUOA 2I26N 4KFZC 4I3SH 1OP9A 5ESAA 1IGFL 5IMLB 4N0CD 3S5LG 2D31B 1PG7X 4RMUA 3QIWA 2QKIB 3W82A 4IHOB 3RWDB 3AS1A 1SJXA 2GSGA 4XC3L 1EJ6A 4HEPG 3V6OE 3VFOA 3QA3B 5HI5D 1IAOA 3LMJH 3T3PF 4Y1AD 1HQ4B 3G6JB 3SGJC 3NH7H 3LKQB 3MV9D 1QFUH 5JORA 5FUCE 2Z92A 3NTCH 2X89A 3PWLB 2BZDA 5E95B 1F3DH 3ZDZF 5F1SA 5L2KA 1R3HA 1HYRC 5DJ0B 1B6UA 3NA9L 3ESVF 2BNRB 3R8QA 3B9KD 1B0RB 2HT3C 2DIBA 1R3JA 3G5ZB 1T1WA 5IHLB 3WIFA 3MA9L 2OTWA 4ODWA 1RUKH 2EDBA 3EAKA 1E6OL 3O9WC 3QFJB 1FYTE 3KPRA 2EIEA 4KKLD 5MP6H 5KVDL 3UPCA 4ETYA 4OCMC 4WY7H 2NY5C 2W91A 2VSDA 3MBEC 5F72S 4QOKD 3W39A 1I8IA 3LHPH 3RZCA 5T5FH 5ID0B 2VITB 2WWMD 2ZUUA 3D9AL 4D0DB 3FO2A 4N68A 2AAVA 3ORJA 1LK3L 4WCYH 4QGYA 3MXWH 4YBLC 4YHNB 4KK6C 2D7MA 3T0XA 4MA7H 1YYLH 4IDLA 4QCIA 3A67L 2DJUA 4UU9B 5ETUB 3S37X 1ES0A 2VXSH 2X9XA 3RWGA 2G5BA 3N85H 3AU1A 1LDSA 5IIEA 2AJVH 1T5WB 1UJ3B 2FYYB 4NYLA 2X89D 5EOQH 5D7IF 5KW9H 4MXWL 3FN9A 3MLWL 1KNOA 4CADA 3HB3D 1GOGA 3T0WA 3JWOL 2AXHA 4KK5D 5TQ0L 2APVA 4YDJB 4Y4HB 4HQQL 1JWMA 3PJSB 5DMGD 1NCBL 1TENA 4UBDC 4X7TB 1DDHA 2IALA 1J1XL 4LHQB 3QYCA 4HWBL 1T03H 4HIHB 2WBJA 4ZFZA 3DVNB 3ZTNL 2FLBT 3JTSB 1MCKA 5ITFA 2VWEC 5SWQB 4L8SA 3UBXA 1FG2A 2NR6C 3RZCD 5F96L 4P2CG 3QNZB 4XNQA 5DT1H 3WNPA 1C12B 4MLSA 3UP1A 4PJ9A 3DMMB 1UWGH 1QG3A 2V5SA 3O6LH 5F3BB 1RMFH 1I1AA 4WW2A 3MRQA 4JDZA 2DWDA 4P9ML 4P4KD 1CS6A 3HUJF 5E6IB 4NZTH 2AJ3A 1OGAB 1IL1B 2V5RA 5D2LE 5JA8B 3PHOA 3NABH 5D1XA 1U8PB 5BMFL 4F9PA 3SPVA 3VXUA 3MXVH 1IEAA 3Q5YA 2VLJB 1DVFB 5C0CB 2GUOA 3F5WA 2GYSA 1TNNA 4IRJC 2DQUH 4D9LL 1KB5H 1P4BH 3BDYH 2V5YA 2NMSA 3EYUL 3SDCC 5BS0B 1I7UA 5IJKA 4N9GA 2NY3D 4HPOH 4GRWF 3ARFB 5GGSB 1GPOL 1KIUA 4YFLF 4XH2B 4AH2B 2IBZY 3HUJA 1CXHA 5FUZL 2OX5A 1HWGB 5CBEA 2W65A 1EJOL 2PTVA 4S1QH 5CHNA 4NUGL 3LV3B 1E4JA 2XY1A 4K9EC 3HI6L 4JY5H 3HCVB 4HUUA 1FPTH 1HCFX 3GUTB 1V3JA 3ARDB 4XZUA 3C5JA 4JZJA 5E9DD 4JANA 5D96B 1U8LA 2RBLA 5IVXF 4JQXC 5C0AE 1EX0A 1G0DA 3THML 1CGYA 1FFPA 3MQIA 3S6CA 3QEGL 1NDMB 4RFOL 1JYVA 3HMWL 1RZKH 1SYSA 1VFMA 2DKUA 3MLSH 1H3XA 4TNVK 2VISB 3QDMA 4MQ7B 4PD4J 1F45A 4LKXB 1CVRA 4KUZL 1PW3A 4WHTB 3W9EA 1U6AL 4BUHA 5IEKB 5I0DA 3O0RH 5F7LB 4Q0XH 5DQJA 5BV7H 2BNQD 4KQ4L 2GW5A 5HHMD 4PJGE 1AGDA 5CJOL 2P5WE 5EBMA 4BELD 1QSZA 2VZOA 5ESVA 5IVXA 8FABA 3UZQA 4X80H 5F3HA 2E9WA 3QAZC 1DBBL 4RAHA 1ZANH 5DDHA 2FX7H 5EH1A 4JKPL 3OXRA 3CVHA 5FECA 5KANG 2Q20A 4LSPH 1YEDB 1I1YB 1TFHA 1WWAX 1I8MA 5I30L 2HG5A 2UVFA 3WFHB 4P23A 5DTFB 3DUSB 2JLLA 2DWEB 1A6PA 1S7UA 3SO3B 3QIBA 5CGTA 2HRPH 4M1GL 5DD5H 1MFCH 5A2KH 4JQVA 2N56A 5ISZD 3D6GA 4NO3A 4HULB 1AR2A 1IGJA 3VGBA 4FXLA 3NCEB 2BSSB 5HD8C 4KK9D 1R5WB 4OLZH 5DJ6B 4JG0L 4HWUA 3MJ7A 2B1AH 5EU6B 4KKCC 4MNGB 4PJAA 1TZGH 1A6VL 1QFWM 5E8NA 5EO1A 2HFFA 4U1NB 2OL3A 1DQDH 2EDFA 5EWIH 4OV5A 5FKPA 5E8EA 4PBXA 4TUOA 1BVLB 1A4KB 1FLRL 1WAAF 4PLOB 4XP6L 2D7PA 1ZWIA 2NY6D 4X7FC 1J8HA 2EKJA 3QEHA 4Q9CA 3RTQD 3Q0HA 5GZOC 5IQ7L 4RZCB 2JTDA 3T8XA 2QSVA 3MFFA 4CDHA 1CE1L 3VGHA 3C5ZB 1RURH 3CFIC 1Q9OA 4LEOA 1ZS8B 2CLVB 2ZUYA 4HIEA 2KH2B 4X4YA 3GHBL 3DYOA 3VCLB 2Z93B 4ZUVB 3S3JA 2FZ3A 2X7LA 1A3LL 1CZ8L 2OR7A 1AO7E 3O8XB 3IDIB 5E5MA 1ZSDA 3DSFL 1GVIA 4LEXH 4OM0L 3JV6B 5EOTB 1FN4B 4YHIA 2GJ6B 3GMPB 1CD9B 2R4SL 3R0MA 4NO0B 4TSCH 4BH7A 2IBGA 4NQDB 2ESVA 5DLMH 1WWWX 1F4YH 5FYKH 2QR0A 3OKMB 3P9LA 2H8PB 4LDEB 4NQTA 1BZ9B 4F7CB 2ENSA 2R4RL 3H42H 3IXAA 1FCGA 4R2GD 1OF2B 2BFVH 2Q76B 2DM7A 4KWUA 1DBJH 3TYGH 5JHLH 2X5PA 5CILL 1WBYB 3D5OF 5TE7L 3REWB 4PY7A 3T2NH 1EH9A 3F62A 4BJLA 3MV01 5IW6B 2X6MA 4MJ2A 3F7YA 5DVLA 4S2SA 3MLVL 1FFRA 4PRIA 4KJPD 3KPSA 4HXAH 5B3NA 1LE5B 2Z31C 1YY8A 2ZCLH 3VMPA 5JOEA 5HYSG 1KC5H 3DO3A 5K9JL 2UUDK 3CJJA 5TF1H 3FTGA 3LQAC 5MEQA 5GISH 4O4YL 1R0AL 4PG2A 4UB0H 4F9LC 3AS3A 1GGYA 1LDPH 3RGVC 1T1ZA 1FC1A 2EH8H 3VRJB 1KT2A 1L7TH 5FGSA 3BEVA 5CJXA 5B39G 4P5TB 1WTLA 3M17B 1ZHKB 1CYGA 4LSVH 2VLRB 3UZVB 4UTBH 1PYWB 1XT5A 1NFDF 3STZA 1W72A 4NQSA 3D1MC 3S36L 2OZ4A 2ZKHH 4QTHA 1INDL 2DI7A 4H25B 2CRMA 4XMLL 5EU3A 3Q1SL 3BT2H 3C6SA 2NPLX 3QUYC 1Q0XL 3ZTJG 2F53B 5D8JH 2XKSA 3UO1H 5I1DB 4DK3A 2VABB 1BVKA 3SDXF 1H3TA 5JHDA 4R0LA 3BZFA 3UJJH 2VXVL 2HVKA 3LS4L 4P49A 1OQXA 3MBXL 3MLRH 3D2UB 5GQBA 3K0WA 4EQ2A 4JRWA 5DRZB 4C56E 5I6XB 2XWBB 4PJEE 4XMPH 2FGWL 4CJ0A 4K94C 2I27N 4HDIA 5IVOA 1T1XB 1PKQB 5T3XH 5AZEL 2NW2B 5DQDH 4ZS6C 2P8LB 4LLAA 1DN0B 3P77A 4ZAKB 4EQ3A 2FJGB 3GJFH 1NAMB 3AM8C 1LVEA 5J1AB 3P30L 5A3ID 2PETA 4UV7L 5B8CA 3OG4B 5C9JA 2Q6WB 4XNXH 4ZFFA 2LU7A 4L4VD 4P2RE 3SDXA 3KPNB 3F6LA 1J0HA 5GS3A 1INQA 4XC1L 3NCFB 4G6AD 1MCFA 1UA6L 1F3DJ 3DI3B 4K07A 3GK8H 4GS7B 4J6RH 3O11A 5GRXG 5JW4N 2PYEA 4H88H 1MHPH 5IHBA 5HHVL 4LVOB 3RNKB 1G9NH 4I9WD 3IFNL 5HYQA 1FYHB 5JNYB 3V6OC 3IVKB 2FBOJ 1E4KC 2GAZA 2H9GA 3ILPB 3GBML 3ULVC 1ADQA 4X7SL 4Y2DA 5EZLB 3U0WL 1LEGA 5F9OL 5C0GA 2AJXL 1PX3A 4FXKA 3MYZA 1RJYA 1GZPB 1TVHB 4ODSL 2A73A 3O45B 1IQDA 1RZGA 2HA1A 2JE8A 1A9BB 4YFDB 3OPZH 1A5FH 5DJDB 2VDPH 2VR9A 1D5IL 4U31A 4M1DL 2YD4A 1I8KA 3DVGA 4RNRA 5FYKE 5LXGH 3RUGB 1K8IB 1TJIH 2AS5M 5L88L 4JJHA 2EC9T 3ZT6A 4YNYB 3JTTB 1LO0H 3WS6C 1JPGA 3WLWD 3ZHLA 2NX5D 1MCPH 1AIFA 3D3VE 5FGBC 2GTWB 3UTTE 3CH8A 5L7XH 1W8NA 4P59H 1BQHB 3VFTB 4ODUA 4DGYH 1NGXB 2YWZA 2M26A 2OTPA 4GLRI 4TUKH 4MXVE 2BK8A 1MHHA 3KJ6H 4ODBD 3GZKA 4Z95H 3C87A 5F97E 1X7QA 4PJBB 4LQFH 4UUJB 2R2EB 3BE1L 4M5ZH 4DUVA 3H9SA 3QZWG 2I5YH 3U82B 1NCCL 1QO3B 3BWAB 1HHGB 1SBBA 4LCYB 5DHXB 4NFBA 1E6JL 3CXHJ 4G8IA 1UM6H 3FOLA 4C83B 3R4DA 4QEGA 4RX4D 1YA5A 4NIKB 4KDTA 1OAYL 2R2BB 3QPQD 5DD1H 1BREA 5ICXB 4EUPG 4P2OB 3EGSA 3QRGL 4OFIA 4MCZA 3CK0L 4ZUSB 5E2TL 1NCDL 3HZKB 3LEXB 4XPGL 3TVMC 2NY2D 3TBVA 3F7QA 1MAJA 3VXQB 2X4TA 5MEOA 3C60D 5J9PB 3MJ6A 3QG7H 3D85A 5HGDB 3WNNA 2V17L 2A74A 3DPBA 1LO3L 4OZIF 3OQ3B 2XT1B 2Y5TA 2K9UA 4XBPA 2IPTL 5JDSA 2RHEA 4U1LB 3DO7B 2RFXB 4LQ1A 4XCEA 2DQDH 5LWYL 3U1SH 43C9A 1BAFL 4XPHH 1KYOK 4HGWB 1YYMH 1A14L 4JCMA 3ROLB 2W0KA 5DHVB 1MCEA 4AM0B 3M1BA 4PLKC 4MWFA 4X9GA 5SWZE 1UEMA 5ENWB 5A2LH 2Z8WC 3PWVA 5I8OL 4KJWD 1HEZB 4PRBA 3BD3A 4DW2L 3HNTH 1CDUA 3NZHL 5C0ND 3BWUC 5ELIA 1N8ZB 4N0UE 5LCVL 3MCLH 5IMMB 4XHJD 4C58B 3TBTB 2WBKA 5D7LA 3FCTB 4IOIB 4R7DA 1HNGA 1KBGL 2V2WB 3T0DA 4YIQB 4RMWA 5CJQL 2O61B 1QLFA 4OZIA 3U4BH 1NCAL 4BH8A 5HHQB 2BY2A 3PGDB 5DD0L 4W70A 2X9WA 3Q48A 5DJAB 4LAJH 3N9GL 3O3DB 4WWID 2N4IA 2B2XH 1M71A 1WT5A 4ZOEA 4WV1A 1VB9A 3IDNB 1C5DB 4CMMB 3G08B 4YHKL 5EC2A 3NFSH 2ZP0T 4UTAH 1J87A 4AEIL 5EC1A 5I8KL 1NUGA 1LQSR 5LQBH 1NBYA 5K33A 2APXA 4NWTL 1FL5A 5C0IB 3KR3L 4QRRD 2ZUVA 1G7IA 5JA9A 1G84A 5FHBL 4HBCH 4WFEE 4LHUA 3B43A 1HKFA 2EEBA 3OV6A 3IRZA 4G8GE 4X4XA 1DQJB 1IT9L 1MWAL 1G9ML 3G6AA 2ZG1A 3RL1A 5BRZB 3VFGL 4I48B 4NQCE 5IFJB 1P7QB 4PJ5B 1IFHH 5TDNB 1IGML 4PBVC 1EV2E 3DI2B 1XGUA 1OCWL 4Z7OF 2JB6B 2ZCKL 3LQZA 1R5IB 2IQ9H 2OSLA 5DC4B 3CLEH 4S1SH 5BVJA 4LRIA 3UTSD 4YAQA 1OP3H 3U7WH 3VXSE 4DKFL 3OZ9H 1NGZB 2NZ9D 2AEQL 1JWSB 1MIML 1EERB 3TJHD 5E4EC 4JO2L 4WNQB 3T4AA 2R23B 3P4NA 1GZQA 3BESR 1KCUL 3GB7B 2XG5A 5AWNL 3VFRA 5I73C 1ZGLB 2VLLB 1J0ZA 4GAYA 4PG9A 1KFAH 4GSDH 3QXDB 1QSFD 1CFVL 5E0QA 4KTEL 1LK2A 3RY6C 3L3KA 4K55A 1FAIL 3QO0A 4ORZC 1F42A 4M7KH 2ITDA 4JO3H 4ZFOB 1ZGLM 3CPLB 2MKWA 2V2XB 3O6FC 3SE8L 4POYA 2XN9D 2R69L 5HVGB 3DGGB 3GGWA 3VWJB 1D5MA 3PL6D 3O4OB 3O2VH 4HFUL 2PO6C 2W0PA 3VXRA 1OP5K 4JLRA 3SE9L 4WFFE 1FYTB 2O5ZH 3B9AA 1QR1A 5KS9E 2VDQL 5TDOB 2VLKE 5DVNA 1NC4A 2PXYA 3V5KB 3BZEB 5H35B 6FABH 4ISVB 4KVNL 1AE6H 2EDEA 5HY9B 3GMNA 5C86A 2CGRL 2J8HA 3I6KA 4K3HA 3H6JA 5JXAH 1I9JL 1MEXL 3IXTA 4G6FB 2VZ3A 1P4IH 1CD1A 4X6CE 2AJZA 5HGAB 1OAXL 3WLBA 4K23L 1MSPA 1K4DB 1CDJA 1QOKA 4TVPD 4PRAB 4DCQA 1N6VA 1RAMA 1PKOA 2HKFL 4A6YL 2VXTL 4QXTA 2FEEL 3U4EA 5I19L 4MJIE 4Y16A 1I3RA 5D1QC 4JHWL 4QRQA 2CK2A 5D5MF 2VB5A 2ED9A 3EYSL 1TVDA 3TVMB 5CCKH 5JLZA 3KDMB 1NFIA 1FL3B 2KQMA 1QACA 4OCWH 4KROC 2NXZD 3DX8A 4KTDH 2VC2L 3DUUA 4QRPD 1HI6A 1Z3GL 2Y9RT 1U91B 1U8KA 3GSRB 5DJYB 2ARWA 5KVMC 2QHLA 4MJ6B 3V4UL 3VG0H 4PLJC 3AMLA 4XBGB 5HHOD 3KWWA 1DR9A 3NFPB 4R9HA 5CSGA 1LP9A 4X6EA 4DVBA 4HMDA 1MAKA 1VSCA 2PNDA 3LRSB 3KYAA 3LH2L 2IAMD 3MO1A 2EYRB 3FQRA 1C1EL 3K8KA 5HYSA 4Q6IA 4NN7C 4Y4KB 3WBDA 1MY5A 5MENE 1HE7A 4LCCC 4Z6AT 1J5OH 4DQOH 2QQKH 4R7NA 3UEZA 5D2LB 3S96B 4I1NB 4HLZG 1X44A 4UDUB 2CRZA 4GRLD 1OSZA 2OI9B 3RNQB 5B39A 5ICYA 4L1HA 2UYLB 1IGFH 2FBJL 2BVOA 3QHZL 1S78D 1EO8L 1KJ2B 2GCYB 5F21B 3WUWA 1QSED 4FFWC 1XFPA 4EDWH 3TA3D 5CEYB 3MACH 3VWKA 4YHYC 3L6FA 5K9OB 3ULUF 4Z7UF 2NXYD 4O2CB 1S7XA 4UNVA 3VI3E 3S8WA 5CP3H 4FQPA 5A16A 1NFKA 1KLGB 1KGCD 2OJEB 1HWHB 4FXGB 1TMCB 1HOCB 2D03L 1VFAA 2YXFA 3VDAA 3MRMB 3WCYA 1SY6H 4YZFF 3QFJD 2FJHB 1JVKA 1IBGL 1WTGT 1UZ6F 3HN3A 4LLUA 4HKXA 3BP6A 4KH2A 4W6XB 2VDRL 3WUZA 3RI5F 1X5GA 4XPAL 3F7VB 2H1PH 4YUEH 1RD6A 4Z7UA 1YNLL 4GMSH 3Q3GB 1P2CA 2PR4H 5KVDH 2JELL 4LCWE 1RZJL 3ZE0F 5C0FA 1V3MA 1CXFA 4YGVA 2YD1A 5HHXH 1BM3H 4NRXB 2DLTA 3ZT5A 1G7PB 2CKBA 2EIDA 3BPOB 4IM8A 5DXWA 4RAVB 2YPKB 1MVUB 1H8NA 4WEUD 2XI9A 2FL5B 1HHKB 3AUVA 1LK3H 3HRZA 1EHNA 3FAWA 2J5LB 4BM7A 1U95A 4TVPL 5E4EB 4FQIL 4D8PB 3EZJB 4OLYH 3ZE1E 2A6DB 1BP3B 1B9ZA 4OUUB 1E4XL 5D6CB 3CX2A 3U7YL 4PJGB 3I6LE 2P5WB 4X4ME 4QXWA 4Y4HD 2QADC 4NUJB 2W07A 4NJ9H 1A7OH 1IM9B 3D25B 4U1SA 2FHCA 5KTEL 4FQQB 3QIUC 3NCMA 1IC4H 3JWOH 4G9DA 4RA3A 4MB4A 4XCNA 1BF8A 4MAUL 5DZLA 4ZMAT 1U58B 1LEKB 5B4MC 1NCBH 2MWCA 2FWOA 2DL9A 3MGOB 3X13B 3X17A 4JO1H 2HLAA 4HWBH 1ERNA 4D0CB 2B7DT 3DMMD 4J4PD 2BSTB 3FO1A 5I1LA 1I7RA 4G7VH 3V6FB 2CLZA 1EGJA 3AXLA 1OGAD 2C4XA 2AV7A 3TCLB 3ARXA 2EXWC 4ALAL 3TNNB 1MY7A 2B20A 1JPSH 3QPXH 5JW4M 3MJ9H 4XCFH 1IC5H 1EBPA 1KPVB 1MFEL 1T3FB 4O5LL 4P9MH 3SCMB 3EFDH 5AYQA 5C0CD 5SWSE 1OPGH 2M1KA 2B0SL 3E1F1 3VGDA 3WFEL 3TFKC 1G1CA 3QZWA 4M9PA 2Y6SC 4KQ3L 2DI9A 4P3DB 4KKBD 4I4WA 1H15A 5BS0D 3VFMA 3MLXL 3EJZC 4KGLA 2ZUWA 3JSSA 5JOFA 4NHCL 5EORL 3ARFD 1I4FA 3SGJA 5GZNC 3RWIB 1J8KA 1T66D 4EUPA 1CGVA 2A1WL 4FQXB 3FO9B 3KYOA 3NCJL 1JZ4A 3V7AG 4AIZA 3OB0K 3F7RA 4APQA 3K74B 1VENA 4G6JL 1GPOH 5DJ8A 4EXPX 1U8IA 4NKDA 2YD3A 3ARDD 5FUZH 1Y6MR 4WU7B 4KDVA 3QCUL 3QUXD 2F58H 3QR2A 4JY4A 4HWNA 4HIXH 4JDTH 4OCSL 3Q6FB 3EO9H 3O9WA 3CFJB 5J13C 3BPCA 1DSFH 2XQBL 3ZYJA 4HPYL 1KACB 3SBWC 3MBEA 3BUTA 1D3CA 4TTGA 3EYOA 1IVLA 4PB0H 4GW1B 4LRNL 4WJ5B 3KHOA 3CFKA 4KPHL 2ICWI 1CFSB 1GYAA 3HR5A 4IMKA 2W0FB 2E6JA 3HMWH 2P47B 2YUXA 3MX0A 1I85C 4N0FB 4UIKH 4XPFH 3GJEB 1S9VA 4MJ4A 2OQJA 5BQ7B 4ZPTB 1BBDL 1T2XA 1FLTX 2WSKA 4P9HL 1CK0L 1AC0A 5FYKU 3MJGX 1YEGH 2IGFH 4BSVA 4HV8A 4M61A 3U4AA 5J3HD 4UT9H 5KSBF 4M6NH 3RWEA 4JN2A 4Y0GA 3ZE2E 5CJOH 2XXMB 2BHUA 5EZJA 4RIRB 1XH3B 4RGMC 4XPTH 5E8OA 2VRAA 2HT3D 3EDKA 4HUWB 5BV7B 4ZUUA 3K7UA 1K8DA 3INUL 1UWEL 1DQQB 4FFYH 3O9WD 4PRHA 1J10A 5KVGH 2IMNA 4DTGH 1YEKL 3O3AA 1U8MB 4OAWA 1JGDB 4D0BB 5I30H 2H32A 1KPRB 3ESUF 3H9YA 1EFXD 5C0JB 3U9UA 4QHNB 2L7JA 4PJDE 2ZSWB 5KSBA 3OXSB 3WNOA 1YN7B 5EU6D 1EEZA 4GAGL 15C8H 2HFGL 3HC3L 2GJZB 3RA7H 2XOTA 4YHML 1KCSL 4GKZA 3ECBA 3CH1B 1G9NC 4W81A 3KS0H 4KK6D 2R0LL 3JVGC 5HYJA 1UZ8A 4DGIL 4LLQB 4F7EA 4LIQL 1I9IL 1ACYL 4C56B 3IJHB 1OGTB 4PJEB 1A6VH 5IB3A 2M8XA 2VXUH 3HZYA 3QEQE 5EIVA 4KRMB 1BEYL 1J12A 4WWKC 3IU3A 3SJVE 5D2NA 3A6BL 2LE9A 1FVDA 4QWWC 3TZVC 1A6ZB 1C5BH 2QADB 4LSTH 5J12B 3PP4H 3IDXL 3WKML 4N0YL 1GXEA 5D71L 1IKFL 4P2RB 1VFOA 4XGZB 5AD0B 3FQUB 3QIUB 1CE1H 2B4CL 1R24B 4KMLB 4UNTA 3QQ3A 3SGDI 1IQWL 4QT5A 2NR6D 1KB9J 4NO0D 2DLFL 1Z0MA 1JGLL 5FIEA 3TJEH 3BP4A 2G75B 3FN0H 1F90H 3MV9E 3WIHA 1U3HC 4NQDD 1ROWA 1QBBA 1MCOH 3BD4A 1AQKL 1CU4L 4E41E 1F2QA 1QBLH 3DSFH 1AJ7L 4MD0B 3LN5B 3VDCA 1A7NH 5IFAL 5I1HH 2J3SA 2R4SH 4NQUA 1QRKA 2JK5B 4MNQA 3K4ZA 1P6FA 4JQXA 1INEH 1WBZA 5BVPL 2Y06L 2OM5A 1EUUA 4OF8A 3P73A 1M05B 4EI5C 5DUBB 3P0VH 4JFYB 3IGAA 4XBEH 2YD5A 1KEGL 1HHJB 3RX7A 4LLMA 1O5DT 2C1OB 1F11B 1JYXA 4NKIL 3QDJE 1NC2B 2QEJA 3SKOB 4QOKE 3HE7B 4L5FH 2W38A 2IADA 1N59A 4IRJD 5I1GL 5TE7H 4TN9A 4KHTH 2R1WA 3MV8D 4TSBL 3TO4A 3WN5B 4HF5L 1WGOA 2AEIT 2AXFB 2BNUB 3T0EC 3D3VB 3RKDC 4CNIA 3SDCD 1T0MA 1T1YA 3H9HB 1CG9B 3UTTB 2Q8BL 3PGFH 3TEUA 1M7IA 3TM6A 2C1PB 3ABZA 4J3OC 4EN3C 1X5FA 4TOYL 5JUEL 3GMQA 4LGSB 5K9JH 4E9LA 4OTXL 1ZKAA 2P7TA 3BGMB 4LNRA 4OI9A 1TCRA 4P5TD 5EO0A 1YJDH 4GAJH 4NJAL 3U48A 2IQAA 3A6CH 1CDGA 3H7LA 5B3JF 1VACA 5AUMA 5L8JB 1ZLSL 3ZDXE 4JFQB 4I3RH 3LKNA 4V2BA 2NY5L 5JIHA 3CLFL 3D48R 1NKRA 4RFNB 1XCQB 3TBSA 5H37H 1MH5A 3SY0A 3TBWB 4BZ2H 5J13B 1JNHB 2XG4A 3QWOA 3WO4C 1M4KA 5D6DC 4BQBA 4Y5VC 1MHCB 1S7VB 3NIDE 4GRWH 3KPRE 5I1JH 5GPRA 3FFCB 4MQXC 1YNTA 2H3NA 4XMLH 2IH1A 4X9HA 1H3PH 1FIGL 3GMRA 5GGVY 5GRJL 1DBKL 5T1LA 2D2OA 1YUHB 1DQLL 3NZ8B 4ZAKD 4FQ2H 4OKVB 1FL6B 3LS4H 4OI7A 1CFNB 1KCRH 4CW1A 1MFAL 3UMTA 4HCRA 1C7TA 1QFWI 3GIVA 3BKYL 5SWZB 5AZEH 1ONQB 3K46A 4NKMA 4OCXH 1R6VA 2YSSA 1MPAL 1G7HB 3B2UC 4TQEH 4NRZB 3U0PB 4N0UB 4RGMB 1DE4B 3KXFA 2OLDA 5EIIA 3DWTA 1ZVHA 2EDYA 3GJFB 4LGPB 3BMVA 4PR5B 2X4UB 3ES6A 4W4NA 3L3OA 3W0WA 1N2RA 5BJTA 1U8NB 2PCPA 4KU1A 4G3YL 4NC1C 4XXCA 3K4DA 4WDIA 3FFDB 4P46C 4JFDA 4NFDA 5DFTA 3GIZL 5KZCD 4QHMB 5LVEA 3FB8A 4YHLH 1QLRB 4PYHA 4XB7A 5ID1B 3S9DB 4HWZB 4Q74A 2FIRT 5HHVH 4XHQA 1HKLL 5HD8D 1CL7H 4M8QA 3MMEB 4U1HB 1RZFH 2FH8A 1GC1H 3VE0B 3RWJB 3C8KB 4KKCD 1XGRA 1TETL 1V3KA 3HE6C 5IB4B 3U0WH 4IDJH 1FGNL 5F9OH 5E4IA 1FAKT 1O7VA 2FATL 1G7MB 1KF9B 2OL3H 4BSWA 3GNMH 2CK0H 4NNXA 3MPCA 4S1RH 1AHWC 4YK4C 4O9HL 5F88B 2VDLL 4Y19A 1MCWW 5E9DE 4F58L 3ARTA 3RKPA 1UACH 5KN5B 4PJFA 2SEBA 5GSRB 5FM8A 5GZOD 4G8GB 5F7NC 1PY9A 3HC4H 3MCKA 4WWKB 3RWFB 4J8RA 3RAJH 3KXFD 1JUFB 2CDEA 5DRXA 4F7PB 3TZVB 2OMBA 2ZUXA 1DBMH 3PHSA 4JRXD 2C3VA 4K9EL 1QSVA 3Q2CA 5I1AA 2VAJA 2DYPA 2EDNA 5AYUL 3VXSB 2BNQE 3ARBA 1QBMH 5HHME 2OR8A 5FO9B 5FF6A 1L7IL 5ADPH 4NKOB 3B5GA 3AS2A 5T5NF 3IJSB 4F3FA 1U3JA 4P2OD 5LAXA 2Y5EA 5DRWA 2MOVA 2MQ0A 1K5NA 3I6GB 3GSOA 5DSCA 1F58L 4HUXA 5TGBA 4MHHG 4KZDL 1CQYA 1G7QA 4KRNA 2AEPL 5LG1A 3RWCA 2VKXA 3WHE0 1YNKL 1J18A 1OAYH 3PWJB 4LVEA 4ZSOA 1S8DA 3BO8A 1ZT4B 1K6QH 2ARJB 1VEPA 4Z78B 2DQTL 3WXWH 1PG7W 3BKMH 3DBXA 4AK1A 4NNYA 1ORSB 5C8JB 4U1MA 4EI5B 5KSVB 5FFLA 5ISZE 4F2MA 4Q58C 3QEUA 3KPMB 5F89B 5HI3C 4R3SA 2Z31D 2EDJA 1KOAA 5F1NB 5C0BB 5IJVA 1LO2H 3MCG1 1KCVH 1Q9KB 1TQBC 3G5XA 3SDAB 3FB5A 5KS9B 5CEXA 2VLKB 3RJQB 2G9HB 3RGVD 3MRRB 3U36A 4CDGC 3GSXB 3S36X 4K3DL 4YDLB 4ZS7L 4I77H 2X10A 4PGBB 4CVWA 1ZLVH 1B4JH 3K1DA 3GMOB 3AB0C 2AABL 1CLYL 1PZ5A 2CH8A 3C8DA 4QXUL 1U8OA 3HRPA 2EH7L 4A2MA 3G9AB 4F7TA 5LGHL 2VZTA 2LTQB 4X6CB 4BKLB 3RBSA 1W72H 5F7WC 4WU5B 1T6VN 1YMHB 2OZ4H 1NCAH 1NGYB 3UTZA 1TDQA 4YDKL 2WNGA 4PD4K 4ZQKB 3QUYD 3S88L 1P53A 2NW3A 1MUJB 2CLRA 2CIIA 2P4AB 3MZTA 1ND0A 4MJIB 1E4KA 2YRPA 5I71C 3BVNA 4MS8C 4JJ5A 4OFDA 2OYPA 4B7IA 5E6ZA 2G60L 4MGXA 3EOAA 5ALBH 3VXTA 3AREA 3MLTA 4WI4A 4K8RC 5C09D 4Y4FA 4NWTH 3MUGA 3EOBA 1G9EA 1XF3B 4PJAE 5IEHA 1CR9L 1X5ZA 3FT3A 1S9YB 3MYJB 1NCWL 2KKQA 1IT9H 1MWAH 2BRRL 3VFGH 1TZIA 3M45A 5IW3A 1G7LA 5IWLC 2DD8H 3D39A 4HC1L 5DEFA 5IV2A 2E7MA 5CZVL 1P69B 2JJVA 1IGMH 2NY4B 1X5JA 4LKCA 1WSST 1SMAA 5F6HI 3ZSTA 5MENB 2AGJL 2ZCKH 3FQNA 1FG9C 3RPIA 1A7RL 3IFLH 3L5XH 4IIQB 3ZDYF 4OZGF 1YEJL 2AQ1A 1BQSA 1JRHL 1F00I 1A1NB 3D0LA 4HKJA 5F9JB 2WUCL 1MIMH 3ULVD 3QUMA 3GM8A 1ADQH 5EN2A 1A7QL 1VKXA 3SDDB 1P7KB 3RVTC 5A2IH 4PUBH 2IFFL 1GAFH 3C6LB 1Z2KA 2W9EH 1T7XA 4LSQL 3SE3A 1JYNA 5EU7E 3HE6B 1F97A 5I1KH 2YPLA 3QB7C 4OLUH 43CAA 1CFVH 3FL7A 4I0PC 3RQ3A 1FAIH 2VL5B 3KS0J 3OX8B 4YR6A 4U6YA 1AHWB 1FFOB 2IWGA 4OZGA 3DVIA 3WFBH 3CNKA 1FYTD 1QVOB 3SE8H 1R3KB 4NNPH 2R69H 4WTXA 4ODTL 3OKDB 3LQAL 2UVEA 1JTOA 4I0KA 4UDTA 1ZA3A 4P3CH 3QCTL 2ZUQB 1HDMB 1BZ7A 1FNSL 4M48L 4PRIE 3WIIH 4JFXB 2MCG1 1MF2H 4FQ1L 4G6FD 4LCWB 2W60A 5CD3A 4Z0BL 3BGFC 3NIGE 3QDGA 2BOCA 4YPGA 1PJ9A 1NMBL 4PRPA 5EBGA 2CGRH 4C4KT 3FQWA 3ETBF 1AKJB 4X9FA 1I9JH 1G0XA 1MEXH 2J7LA 5AAMA 1EUTA 4FZEL 2DQFB 4X98A 3G5YB 1JHLL 1U42A 3BJ91 3AY4C 4DN4H 4UT6L 1XF2B 4M5YL 5JXEC 4GG6F 5FM5O 1EPFA 3PP3K 1QEWA 2GJJA 3TVMD 4KRPB 4XP9H 1DLFH 2HKFH 1QZ1A 1FJ1A 3NVQA 3SGEH 4ZOAA 3MLZH 3GRWA 5ERWB 5ILTH 4L8CB 2AJYL 1UXSA 3BHBA 3MRBA 4I9WE 3MTRA 4K94L 2ICEB 3BZ4A 4ODHH 4Z7WF 2XPGA 1JHTB 1T7ZA 1F4XL 1HSBA 4H26B 2YD6A 1JHKH 5JHDE 1C5CL 1IKNC 3MRNA 5E94A 1RUAH 3KYNB 1T5XB 4PLKD 2HAZA 1FBIL 5GJSH 2VC2H 5C0EA 1Z3GH 3T0AA 1BOGA 2WLZA 5FB8A 3FO0L 3TN0C 4GG6A 1JZ7A 5HDQL 3CDCA 5IB1B 3V4UH 1D9KC 4AG4L 1RU9H 5DMIH 4Y4KD 4V2CB 3VFPB 4ODXA 2NNAA 2JJTA 5KSAA 4UILH 3TF7C 3UJIH 3N06B 5FYLH 3LH2H 2KPNA 4PJ8A 3P0YL 1DL7L 5JR1H 2YKLH 5HGHA 4JHAL 3O2DA 4ZO8A 4Z7WA 2NX5E 3LN4B 2JIXB 3ZKSD 3IDMB 3JWDC 5SWSB 2ADJA 4NHUB 1VPOL 3MLYL 3ULVL 3GO1L 1B0WA 3ISWA 4I18B 3WNLA 4JHBA 4GO6B 1KELL 1UH3A 2DQIL 4LLWB 3UTPE 4RWYH 3QIWC 1LO5B 5I71B 2OBGA 3HNSL 1A0QL 1M7DB 1S7SB 4MAYC 3SKMB 1KIRA 3HFMH 5DZOA 3R06B 4HX1A 3RY6A 4NRYA 3VG9B 3ARVA 3LEVH 4MD4A 4M6OL 1HH9B 1BECA 1T04A 3MRHA 4PJXE 3D69B 4POUB 4U1KB 1CGSH 3CCHA 2FIKB 1AXTL 2AP2A 3KPQA 4MCYA 1I75A 2GT9B 4L3AA 4QNPF 3LKPA 1Q8MA 1KTDA 4NP4L 2E9BA 1KENL 4GFTB 3MROA 3HI1A 2PO6A 2ZPKH 3OGOE 4XCYB 2AXGA 3QULA 4Z7VF 4LU5L 4L9LC 4E42B 1EVUA 2PYFB 1MAML 4PGCB 3MUJA 2JELH 2DQJL 4QHLB 5A43C 3WDHA 1JFQL 1RZJH 1JGEB 4L3EA 3IU4H 4XNMB 4JPKH 3U9PH 3X3GL 2DDQH 2IANA 3GKWH 1ZHLA 2J1KA 3ROOA 5D70H 3WE6A 1MI5A 5DJCA 5BO1L 1BLNA 2XQYG 2X1OA 5HDLA 1KJMB 4D2NA 2P5WD 1KJVB 4RA0C 4U1IB 3BYYA 2BVPB 1IM9D 4FQIH 4Z7VA 4Y7MA 5FEBA 2J6EA 2WAHA 4U1GB 4XVJL 2CR3A 3P2TA 4HJJH 1UYWH 2WIIA 1MJ8L 2WANA 1FNFA 1CGWA 1XMWA 1JZ3A 4MA3B 3O6FD 3N1QC 3F12B 5SX4H 1QYGL 5GIRB 2BHYA 1REIA 3OGCB 1MRDL 5GGUA 4AT6A 4LDOB 4YHPB 4XNYH 1PAMA 3ZKQD 1X5XA 2OK0H 2QL1A 5FDYA 3QXAA 4YDVB 2EKSA 4XX1G 4LSSL 3QJFB 2ADIA 2X70A 4RAUA 4BK5A 1NMAL 2J8OA 2Y25A 2Q87A 3B9DA 5K59F 1IGIL 2A0LC 1HZHL 3P4MB 5F71A 2VYRE 5TE6L 2WBJC 1IGYA 4PJDB 4QRRE 1FRGL 4JO4L 4JCLA 2GK2A 4OIIL 2EDKA 4PJ7A 4N8CH 2DQCL 3CFCH 3RL2B 5HJ3A 1B3JA 1IGTA 5D4QA 5I2IB 3EO1A 4NZUL 5DYOA 3HG1A 2IG2L 4HS6B 4HS3B 4HIJA 4PJ9C 3D87B 4ALAH 2B5IB 3VRLF 1KXQE 1RV6X 1I1AC 3L5WB 5MERB 2D31A 1MFEH 2LABA 3RWDA 1FZOB 1LE9A 4HZAA 2VH5H 4PB9H 3CGTA 1ZVSA 3O6ML 5D1QD 1T2QH 2F8OA 3SJVB 2Q7NA 2CIKA 3UTSE 4ZD3H 3CFBA 5D1XC 5C2BH 4F9PC 4X6FB 4KQ3H 4FQXD 3RY5A 2ERJC 3VGAB 1HH6B 3C2SA 3L3DA 4KROD 1RJZB 3LMJL 3PWLA 4NHCH 4OZ4B 5EORH 5GGTA 5E8PA 3NH7L 1GL4B 2WW8A 1QRND 5LGJB 1QFUL 4LSRL 3NMEA 5I74C 3NTCL 2BNRA 1WVZA 1FQ9C 5A2JH 1WFTA 5C0DB 1EZVX 2HJLA 4PLJD 5F1KC 3V2AR 4EBQL 1KIPB 4ELME 2ICWA 2P45B 1QSFE 1UXWB 1YJDC 1BVZA 4Z7QE 3MV9B 1NQBA 5GS2H 3G5VB 4E41B 3MLUH 2V5MA 2BXYA 2FX9H 3BH9B 3QCUH 5DK2B 1D9KB 5CLTA 1T89A 2XN9E 1FV1B 1H3UA 4WY7L 5A40E 3T2QA 3KNBB 3MRJB 4JZJC 3X3FH 4IBLT 3KYKH 1MJ7L 5DR5H 3E6FA 3G6DL 3LHPL 3E0GA 1QUNA 4JRYB 3C09C 4YHNA 4OFKA 2VQ1A 2EO1A 3HI5L 1W8OA 3PWNB 2XFXA 1RVFH 3QDJB 4WCYL 4FFWD 4UU9A 3MXWL 3QWRD 4QOKB 5C08B 4MA7L 1YYLL 4MDJB 5ESAB 2P8MA 4FFZH 2VXSL 3HZMA 3N85L 2YK1H 3QIWB 2H41A 2GSGB 3CSGA 3ZTJH 1ODAA 4R4BB 4R97C 1FZKA 3PJSA 4TVPE 2ZJSL 4MB5A 4X7TA 5JW5A 2Z92B 3VXOB 4WIQA 4YHOH 3T08A 3DVNA 4EOWH 4N8VA 1YEKH 2GY5A 1T03L 1T1WB 3QNZA 4OBSA 3WIFB 5J89A 2K7PA 1PFCA 2WQ8A 4POZC 4AEHH 1BJ1H 1WZ1L 3QIBC 3RY4A 2D4FA 3KPRB 4JQVC 5DT1L 5F3BA 2YR3A 1KV3A 4GAGH 4ZG1A 4YC2C 1GSMA 3LDBB 4PFEA 3HC3H 5E6IA 4YHMH 1I1RA 3W39B 2R2HA 3O6LL 5HHOE 1WFOA 5E2WH 3RZCB 3WJLA 1JWUA 2JCCE 1U8PA 4NZTL 4DGIH 5C7XH 4KTYA 4K3GA 3RHWF 1BWWA 2VLJA 4JM2F 2P5EA 2QADD 1MLBB 4BK4A 2BMKA 3FONA 3MXVL 3BEWB 4QCIB 5IUSA 3IFPB 3BP5A 3QIUD 1ES0B 4NO5B 3RWGB 3AU1B 5B38B 4NSKA 5IIEB 4NYLB 3LS5H 1KB5L 3BDYL 1JN6B 2Z91B 4AH2A 3IDYC 3WKMH 1XIWC 1OHQA 1IKFH 2QBWA 1CLOL 4Y5XC 4HPOL 4CADB 2ZZUT 1QSEE 2XNAB 1YEHH 3VFVA 3BRDA 2B4CH 3HCVA 1S9KC 1UKTA 1JWMB 3BD5A 4S1QL 4OCYH 4P2QA 1LGVA 4BZYA 4JM2A 3FQXA 5DMYA 2IALB 2DLFH 3WNKA 3GSWA 1KGCE 5HDBE 1JK8B 1FPTL 3DRQB 1KYOJ 1AQKH 3LRHA 4ZFZB 4HKBB 1CT8A 4JFFA 3W9DA 1EGJH 2EXWD 1AJ7H 3MV7A 3IDGB 1EEUA 4L8SB 4FABH 4PYGA 3OSKA 3SDYL 1LP9E 4K3EH 5IFAH 3L3IB 5E5RB 1JCKA 4XNQB 4OGYH 5FYKD 3OKOA 4OZFG 4PJ9B 1MOEA 3TFKD 3HAEA 5E9DB 4TNWK 2Y6SD 1RZKL 4LKXA 4WW2B 4WHTA 4L4TA 3MRQB 5I66A 2DWDB 3EJZD 3MLSL 5E24E 3UTTD 2AJ3B 2N1KA 4NCC1 1JJUA 2NCMA 5IQ9A 2EDOA 4WTZA 2ORBH 4AIOA 1IM3A 3PHOB 1TJHL 3O0RL 3RIFK 5D1XB 1P5UA 4M93C 4Q0XL 4UOW1 1ZMYA 3SPVB 4HF5H 4EUPH 3GSUB 1BMGA 4EI6A 5JQHC 1RIVH 3UPRB 2GUOB 3F5WB 5J7CC 2E6PA 3P11L 5JUEH 1YEEH 4X80L 2EDWA 4OTXH 1TTFA 3LKRA 5M94B 1CXIA 3DSNA 1I1YA 1ZANL 2GFBB 2BNQB 5HHMB 2VNCA 1OQOA 5E00A 3DUSA 2DWEA 5CKGA 4LSPL 5CJXC 1Y18B 5CBEB 2W65B 5EZOH 2ATKA 2CXKA 2NY5H 2BXZA 1C16B 1JNLH 3FFCD 4CN1A 3GSQB 4HUUB 5DD5L 2O5XH 1R5WA 3LKSA 4XZUB 5DJ6A 2MSPA 3C5JB 4DJMA 4CMHC 4MNGA 3TV3H 5GSVB 1QPPA 5GS1A 4OLZL 3SKNB 1F4WL 3S4SG 1FIGH 4U1NA 2B1AL 1FFPB 1EO5A 2E8ZA 3T0BA 5ISZB 1W0WA 1T7WA 2VZVA 5DQ9A 1DQLH 1BVLA 1A4KA 5FKAB 1DQDL 1SYSB 4HS8H 1I1CA 3PIQB 2WWKT 5EWIL 5IM7B 2Q7YA 1MFAH 1CDYA 4WHYG 5T3XD 1EHLL 3BKYH 3CZJA 4RQQA 5DQJB 2FX8H 3C5ZA 5HHNA 5E08H 1OVZA 2CLVA 1AGDB 5EBMB 1WZKA 1EO7A 2IPKA 4FN0A 1N7ML 5B8CC 3UJTL 5IVXB 8FABB 4KKNA 4R96A 4F37F 5KOMC 4ZTOH 2Z93A 5F3HB 3RTQB 4L8BA 3O8XA 3IDIA 4OF3A 2H32H 4N1HB 3OXRB 4JHZA 5FECB 4HZLB 4G3YH 2YMXH 1XF1A 4DAGH 5EOTA 2B8OT 3CSPA 2GJ6A 3GMPA 1WIUA 4MQSB 3T3MF 3BW9B 3DX7B 4OLXH 2H2SC 4LEXL 2HG5B 3NIFF 4FA8A 4P23B 4X6DA 3QIBB 4LF3B 1VEMA 3OKMA 5CGYD 2H8PA 4N5EC 4NO3B 2I9TA 2VUOA 4NBZB 4ZYKA 5DLML 1IGJB 1F4YL 2F5AL 4Y2DC 1U3ZA 5FYKL 1OF2A 1I9EA 2ICCA 3EYQC 3T2PA 1ZAGA 1TPXB 1EK3A 4G8GD 3H42L 3RDTA 3REWA 4NN5C 4DFHA 4WWKD 2QQNL 2BFVL 3DV6A 3FMGH 1OT1A 4PJAB 4RMTA 2VUYA 3TYGL 2NY0C 3TZVD 5JHLL 5E8NB 1LE5A 3T2NL 4BQ8A 2OL3B 4JAMA 3T0EA 2NY1C 4PRNA 3IDUA 4OJFH 2EDHA 4HXAL 5E8EB 3ZZ1A 2ZCLL 3VFWA 3IKKA 1KC5L 3QEHB 4PTUB 5CEZD 2WUBH 1CTNA 3B8SA 1JMXA 3VRJA 3LZFH 4WFHD 5GISL 4UB0L 4U2YA 1ZHKA 1LDPL 2P43B 2VLRA 4K9EH 3VGFA 3MFFB 2XA8H 1U3HD 2W9DH 3UAJC 2EH8L 1OAUL 1L7TL 3WIHH 1Q9OB 4HFWB 1PYWA 4ZO7A 2GK0B 3VH8B 1L7IH 4X4YB 2CSPA 3GSNL 1MVFA 3WD5H 1V8HA 4UTBL 1LD9A 2X7LB 3RFZC 1Z9LA 1NBVH 5E5MB 3Q5TA 1F58H 2ZKHL 2F53A 3VD3A 4Y5VA 2AEPH 4EI5D 4XP5H 3BT2L 4BH7B 1S9WA 2ESVB 1QR4A 5D8JL 4NN6B 4LLYB 1PEZA 1AD9A 3EDDA 3UO1L 3D2UA 3LOWA 1NSNH 3U0TA 2QR0B 5C0BD 1H3VA 3P9LB 3VI4E 3NAAH 3UJJL 4Y88A 4BFGA 4WFFD 5HI4C 3OG6B 3RKDD 3MLRL 2XQYK 4H8WC 3P0GB 2NW2A 2VLKD 2P8LA 2WQRA 1B2WH 1NAMA 5SV3A 4EN3D 2IMMA 1LNUA 5IHZA 5T3XL 2EZ0C 3TH4T 3F7YB 3HTLX 4S2SB 4PRIB 5F9WC 5CSZB 2VZ1A 2QSQA 3KPNA 1CVSC 3FTGB 5MEQB 4WW1B 3E6HA 3WSQH 3O6KH 2APBA 1CLYH 4QXUH 3RUGF 2HJKA 5A2FA 4JQIL 4J6RL 3RNKA 1KT2B 2HLFC 1WIPA 4HJGA 3BEVB 3LAFA 4LGRB 4KI5F 4H88L 1MHPL 3WDIA 4NQED 2H45A 3BRFA 3IVKA 2ZG3A 4MQXD 5EZLA 2H26A 1G9NL 2GITA 3L1OL 2JJSA 4X5XB 3STZB 1EDQA 1W72B 4JREC 4NQSB 2VWEE 4WV1C 1GZPA 2OR9L 4WI6A 3DRTA 2OTUA 4HK0B 4OFPA 1SYVB 4QTHB 1JYWA 1A9BA 4PJIF 1CE6A 2I9LB 3C6SB 3LKOB 4FFVC 3RUGA 2FDBP 5MEPA 4HCRH 5F9DC 4U0RC 4YNYA 4R0LB 5JHDB 3OPZL 4GAFB 4GUPA 2BCKB 2VDPL 4KC3B 3T2OA 5HYJE 2HVKB 4HLZH 2DIJA 2EDQA 2YRZA 5LXGL 1TJIL 3UPAA 1QLEL 1TVBA 4H20H 3B2UD 1LO0L 1PDKA 3N1PC 3UBXG 3EHBC 3CMOH 1HXMA 4PS4H 2NY4D 4HDIB 1MCPL 3C2AH 2QTEA 1BQHA 3VFTA 1QQDB 3P77B 1NGXA 4DOHE 4K7PX 3NFNB 2BHZA 1WC7A 4PJIA 4LVHC 1I8LA 4P59L 5B8CB 4P46D 4DGYL 5CZVH 5FA3B 1MWAB 3MV8E 1ED3A 4TUKL 2NX5B 4ZFFB 3QQ9C 3KJ6L 1NJ9A 1KJ3H 4Z95L 2AGJH 5AG9A 1G6RA 1QO3A 2BSRB 4PJCA 5ANME 5IFHH 1I1FB 4LQFL 5MHSE 4LRIC 3HMXA 5ACLA 3MRIA 4FQCL 4C83A 2RQ8A 1QPXA 2I5YL 3O11B 3EYFA 2PYEB 3HE6D 1UM6L 1T0PB 3SHSA 3RVWC 5F70A 3DTXB 3HZKA 3LEXA 1T80A 5E8DH 3ALXA 5HYQB 1T7VA 1BJ1J 4QKXB 3S3SA 4CU7A 1OW0C 2IFFH 2GAZB 2H9GB 4PJXB 3H9ZA 1LEGB 4WI5A 4MA1B 2G2RB 4MNQE 4JPWH 4ENEC 4TRPH 2LAGB 4U1LA 2RFXA 3QG7L 4F15B 2Q8AH 1IQDB 3IDJB 1HSAA 5JZ7C 1CFQB 1SEBA 1JF1A 2DQDL 2NY2B 2R1XA 4KJQD 4LCWD 1UVQB 5ENWA 1I8KB 3C60B 4RNRB 3J8F7 2J88H 1DUYA 4ODTH 4XPHL 1YYML 1VGKA 5DK3A 5H37G 1TIUA 3RGHA 1HXYA 1URLA 3QCTH 5K9QI 1AKJD 3TBTA 2PXYC 3B4NA 2V2WA 4U1JB 2EE3A 4YBQD 4LARH 2O61A 2CUIA 4QRUA 4JM4H 1SJHB 1NMBH 1FE8L 3U2SA 3PGDA 1HILB 4BA8A 5DJAA 2CR6A 1BQLL 4I13B 2E3VA 1ZGLP 1MHHB 2UZXB 2VDNL 2ED8A 1X7QB 1JF5A 1BD2D 3C08L 1C5DA 1DUZB 2NTSP 3HKFA 5DJ2A 2DB8A 3TWCH 2B2XL 4M5YH 4LAQH 3DLQR 3OKNB 2AXJA 5D7SL 3GM0A 3L9RB 2BRQA 3FT4A 3GBNL 1L6ZA 4UTAL 3LY6A 2BVUA 1CF8L 4Y16C 3EGSB 2JB5H 5HI3D 5GS0H 5LQBL 1JPFB 3SE4A 1NMCB 2A83A 2E7CA 3CUPA 3TBVB 5JMOC 4KKAD 5MEOB 4NQXA 4WI2A 4XWOD 1IAIL 4OFYA 1DQJA 2A74B 4HBCL 3WS3A 5ALCH 4JFED 4G9FD 3C5SB 4I48A 3ARGA 4XCEB 5EU4A 2LV4A 1P7QA 5TDNA 2VDML 4PTTA 4MQTB 5GXBB 4B5EA 2JB6A 5F9WB 3V4VL 3LB6C 1R5IA 5IWLA 4MWFB 2HN7A 2JIXD 4XNUH 4Y5YA 4PRBB 5SWSD 1X4YA 4DKEH 4L29A 1JWSA 3CLEL 3UTQB 3GI8H 5EU5B 3KXFE 4Q6IC 2WP3T 3U7WL 1NGPH 4WNQA 3W0WE 4J7RA 4WI9A 1YQVH 3PXJA 4OSUH 1QLFB 3S35H 3UTOA 2YPVH 2A9NH 3GB7A 1NANH 4BH8B 1UC6A 4JRXE 5GRWA 5IESH 1ZGLA 1A21A 3ULVH 2VLLA 3B5HA 3FZUC 4JFDE 3UTSB 5EZIH 5MI0C 4GBXA 4UQ3A 1MFDH 2ED7A 3MODH 5D1ZA 1M71B 2DQIH 3KJ4C 1ZTXH 5I9QB 4ZO6A 3RZWA 3OMZA 4F57H 1KFAL 3VWKC 2W0LA 4XAKD 4ZFOA 2V2XA 4F33A 4AJ0A 4HIIA 4M7KL 4JB9H 4JO3L 4LPCA 3DGGA 5CKAA 32C2B 4R8WH 1GOHA 5TFSH 1FL5B 5IBTH 4ELMB 1I7TB 1OAQL 1QSFB 5E2UH 1G7IB 3KPOA 4Y19E 2JF1A 1XGTA 1G6VK 3O2VL 4NP4H 3REVA 3BZEA 4IJ3B 4OLWH 2GIYA 4PJFE 2O5ZL 1XF4A 2AK1H 1X5LA 4RDQF 3G6AB 4OD1H 3GKZA 5J6GB 4NZJA 3ULUC 5E7FA 3PL6B 3IKCA 6FABL 1AE6L 5BCAA 2DBLH 2Z8SA 3K1KC 3BZDA 5JXAL 3LQZB 3DXAA 2FECL 2OSLB 2K7QA 4LLVA 2QSCH 3P4OB 5BVJB 2KQNA 1P4IL 4HMCA 4PRAA 3MZGB 5D7JA 2KZ1B 3PV7A 1SHMA 1ULVA 4QRTA 2VE6B 3BQUC 5CD5C 2YEZB 3KPLB 2XTJC 3P4NB 4I0PD 5GRZA 2V7NB 2YD9A 4YDIH 1QTYT 4GAYB 4PG9B 1Q0YH 4PBWD 1Y6NR 5IT2H 5CCKL 1QYGH 1L0YA 3DX6A 1UH2A 5D2LF 4X5WA 4OCWL 3MOBH 3VXMD 3GSRA 4WI8A 4PV9A 3AGVA 4MJ6A 4KTDL 3KYMA 4XBGA 1KN4H 3NFPA 4D3CL 3LRSA 3GGWB 1D5MB 1ZLUH 5C09E 5FGCE 2EYRA 4ZUTA 2NXZB 3L3JA 1ZHBB 3VXRB 1KTLA 4JLRB 1RZ7H 2XICA 2M2DA 4B0MM 4M62H 2BY0A 3LRGA 3DXAD 4U7MA 3HLAA 5H94B 4NZUH 5HHOB 5D2LA 3S96A 5TE4L 3I6KB 5JXED 4UDUA 3E2HC 1J5OL 2JCCB 3NGBC 3ZKNC 4DQOL 2QQKL 2IAMB 2VQTA 1XR8A 4PP2A 1KJ2A 1MCLA 3WLBB 3DYPA 5E1HB 3T0VA 3V7AE 3O6MH 4O2CA 1KLUB 3T77A 4DCQB 4EDWL 4NO2B 2DL2A 3MACL 4G5ZH 4MAYA 2OJEA 4QXTB