1KJ2A

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
QQVRQSPQSLTVWEGETAILNCSYEDSTFNYFPWYQQFPGEGPALLISIRSVSDKKEDGRFTIFFNKREKKLSLHITDSQPGDSATYFCAARYQGGRALIFGTGTTVSVSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Allogeneic H-2Kb MHC Class I Molecule
publication title A T cell receptor CDR3beta loop undergoes conformational changes of unprecedented magnitude upon binding to a peptide/MHC class I complex.
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 111
sequence length 111
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kj2A00
1CF8H 1MCFA 3EYOB 4HC1L 2CRYA 2A6KB 3BDXA 5D8JH 4I3SL 1HINH 3U83A 4HF5H 1AHWA 3AFLA 4P5MA 4PJGE 4Q6YA 1K2DA 4F9LA 4EBQL 1JZ3A 2B0SH 3MZGB 1NMAL 1IAII 5BJTB 1EGJL 2UWEA 3QFJB 1YNLH 3X3FL 4H1LB 1D3CA 4HMDA 2Z4QB 3TBVA 1JNNH 5CZVH 1TVBB 3O3BA 4TSAH 3MRIB 4HKJA 3KLDA 3WDIA 3F7YA 4P2OD 3WIHH 4NZDA 3F5WB 1PW3A 1Z3GL 4P9MH 3X14A 1ZA6A 5MEOA 2RBLA 2C3VA 4J6RH 4N0CD 2C7UB 4CMHC 4YIQB 2YC1B 2GI7A 5KG9A 1KCUL 2ARJQ 2Z31B 4OB5H 5ESQB 3TZVB 3VGHA 5F6IB 3O6KL 3K8LA 2DWEB 3ARRA 4JZOB 4GAJL 3EJZD 2K1MA 2YWZA 5DUPH 1J5OL 1U3HD 2LFGA 5HGAB 3HE6D 5KVFL 5E0QA 3VWJA 2YXMA 5AAMA 9CGTA 1UYWL 4G6JL 4XH2B 4XP5H 2VKWA 3MC0A 5BVJB 3KYOB 2IQ9L 4G6KH 5EBLA 5JQ6H 3DROA 1WBYB 5A16B 3C5SB 1Z5LA 3QNYA 5MERB 4Z5RB 2P45B 3C60A 4LLVB 2IWGA 2R8SL 1R3LA 3CX5K 3U0TA 1F6FB 4FMFA 2PXYA 3O6FD 3KYAA 5MENA 4K3JH 3ZDXF 3CVHL 4K7FB 2BSSB 1IJ9A 3KLHD 4DGVL 1YNKH 3QG6A 2VLJA 3NFPA 1XGYH 4HT1L 1OQXA 5E8OA 4M62L 1IEAA 1FGNL 4HBQA 2ICEB 5C0DA 4R2GC 5JO5A 1UM6H 4LLMA 4N1EA 2W0FA 4Y16D 4LSTL 4LBEA 2IANA 3TH2T 2ZOKB 3FQWA 1MCBA 4U0RB 5IWLC 2ZUWA 2ICWB 5SX4I 2DQHL 3MRJB 3FMGL 1UH4A 4R97C 1S3KH 1NBVL 3SDAA 1YEDA 3Q5YA 4JM2A 2WUCL 3EYFB 5DMGC 4CRPA 4PRAB 4I1NB 3IF1B 2HT2D 4H1LG 1I4FA 3ALXA 1JPTL 3D25A 3Q6GH 3O11B 2OXGA 5EPMA 2AVGA 5I17A 4XPGL 1SHMA 2R29L 4FQHB 4ERSL 3OJ2C 1RAMA 5E9DB 4KKLC 1WAAA 4LCWA 1ND0B 5JXED 4MHHI 4IDLA 3QIBA 4JPWL 3ZE2E 2VZTA 1Z2KA 2A9MH 4R4FL 4OIBA 4XCEB 5T1DH 4IIQA 4LKCA 2HG5A 3L7FA 1CTOA 3SY0A 1I9JL 3CVIL 4MAYB 1VFAB 2Z0BA 3UYRH 3X13A 1HH6A 1UWGL 2CIKA 3DYPA 3QWQB 4Q9CA 2CUMA 4Z95L 5EB9A 3UJTL 1CLOL 5K9JH 5CINL 4OGAC 2GKIA 3EYUH 3MJ6A 3MRRB 1CICD 2VXTH 2WNGA 2HKFL 1ITCA 1IGCH 4NT6B 5T3XE 4UNVA 4QXWA 3BYTA 3MZTA 4LHUD 5DJ6A 1OAZL 1K6QL 1B0RA 1J1PL 3VXQB 4CVUA 1YQVL 1T0NA 1V3KA 2BVYA 5BRZA 4D0BA 4FRWA 5E8EA 4Q6IB 5ID0B 4PGZA 4DFIA 3QAZB 12E8H 3DJ9A 4KV5F 4ZUVB 1DQQB 2HLAB 3KNBB 4CW1A 3V6OA 5JXAH 5ERWA 1GOHA 2NW3A 1A7PH 2GTWB 4WU7B 1D9KC 4MNGE 4RGNE 4LCYA 3ARQA 3ILQC 1HHHB 1MCOH 3DSFH 1AQDA 3GMLB 1F3DH 1G7MB 2JJTC 1ZKAA 4HUWA 4OZHB 1DBBH 2KL6A 3FO9B 4NDMB 3S3SA 4PRNA 5K9OB 4PP1D 1SJEA 1AY1H 4WFED 3ZKMC 3W0WD 1GZPB 5EWIL 3BPCB 3FQUB 4YHIB 4UMGA 1YMHA 1M7IB 4DUXA 1N6QH 3NFSL 4P46D 1A7OL 1NC4A 2E5EA 1MHCB 1K3ZA 1R3KB 4OZFB 2JJSA 1R3HB 3I9GH 3OSKA 5TQ2H 4YHMH 4OZIE 5BS0D 1NSNH 2FATH 3RX7A 3CPLB 2KUTA 4MXWL 1LE9B 3KPMA 2VLRA 4ZAKA 3TN0A 2GJ6E 4X5LA 3S98A 4YQXL 2CUIA 1LDPH 2G75B 4JM4L 2K7QA 4UTBH 2VN4A 3C9NB 3DV4A 1S9XA 4YHYB 3IKCA 5C0RL 1MIMH 2PYEB 5JDSB 2RHEA 4PJCF 3H0TA 3T1FA 4DZ8B 4HJJL 3GI9L 4QXGL 4U6XA 3RY6C 1CCZA 1NGWB 3QIWD 1OWRM 2B39A 3U0WH 2Y07L 4P5TD 5C07D 5FGBA 3T08A 3VFSB 3DUUA 4TVSa 3H42L 2H41A 4N0FB 4PD4J 7CGTA 1QOKA 3PF2A 5JTWA 2VSCA 5IMOB 4EKXA 2BJML 5IGXH 5I16A 4NZRH 2WMPA 4OI9A 5C9JB 5E24E 1YDPB 3RY5A 1RZFH 1KLGA 5D1ZA 3WFDL 4YFEA 1WBZB 4C83B 3SBWA 1AO7E 4FQXA 4LPTA 4P3DB 1XCQA 1RJCA 4Z0BL 5TQ0L 1FGVH 4PJEB 3QO0B 1G7LB 3QWRA 1NKRA 4UT9L 4I9WD 4JRXB 2JLLA 4PGBB 5I8CA 3V6BR 1LEGB 1FYTB 1QRNB 1I7ZA 4RZCA 3WIFB 2Z8VC 1CFBA 1T5XB 2M8XA 4QEGA 4O00A 3C5ZA 1UB6B 3MV8D 1GGCL 3WFEL 2DI8A 3SDCC 3W5NA 3B9KA 3T0EE 2YPKB 1QR4A 2WIIA 2GK2A 4FFYL 4OZFG 2HTLC 3LRHA 2WK2A 3DVNA 4OZ4B 1VKXB 1A7NH 4PRPB 5J8OA 1FIGL 3ROLB 4CBPA 4ODTL 1GGYA 1A1NA 2NYYC 3VI3E 2XI9A 2XZQH 1ULVA 4OZGA 1NBYB 2QADB 2Z91A 3P4OA 4HS3A 1YEEH 5HHOE 4IJ3B 3M45A 4ZNEE 4QOKB 4WW2A 3MBEC 5D93B 4KK6D 4Y8DC 3UO1L 4PJ5B 3BISA 4HH9B 3QNZB 3JXAA 4I18B 3SJVA 5J6HA 4CVXA 2DQGL 3TNNA 2WWKT 1MNUL 5FK9B 1S7TB 4OCSH 3ZDYF 5DRWB 5F7FA 1QSFE 4G8GE 43C9B 1ZSDB 4O51B 4X0KB 1RU9L 3VJ6A 3HMWH 5DWUH 3AXLB 3NGBB 2OS7A 3BOVA 2DIAA 1OGTB 3RZCA 5DS8A 3OXRA 4YR6A 3D5OF 3GGWA 2CK0L 1MFDL 2YEZA 3V5KB 4JDZB 3IFPA 5I76B 1EEUA 4TPRH 2OSLA 1F3RB 3IAQA 5HVFB 5IQ9B 5JA8B 2SEBA 2BHZA 4WUUA 2W38A 5DK0B 3AVEA 2V7HA 5JIIA 4YHOL 3SPVB 1AR1C 4NO0B 3CMOH 3ORJA 4EDWL 3I2CH 2J8UF 5F1IA 2NR6C 1SJXA 4R7DA 4NO2B 1PVHA 4P3WA 1TVHA 3IDNA 4WFHE 4JCMA 4KQ3H 1KIRB 5HI4C 4XNMA 3JBG7 2FD6L 4Y19E 5EOTA 5GZND 1U93B 3EDDA 5HI5C 4PJ8D 3T65A 1T21A 4WENB 3BP4A 4AM0A 2R2HB 5FIEA 2FBJL 3QDME 3WYRA 1PKOA 3FAWA 5E94A 1KOAA 3OB0H 5CHNB 4H0IA 3GK8H 2BSRB 3I6LD 4DN4L 3CLEL 4PREB 4PRDB 4XPBH 1DBML 2ZUQC 3V4PH 3IFLH 1F2XK 4L3EE 2ATPB 2IALB 4HKXB 4IRZH 5FOJA 1PZ5B 4M7ZB 5ALBH 1MFCH 1H5BA 4XGZA 4Y5XB 3UTQB 3SOBH 2P44B 1UZ6E 4U1IA 3DBXB 1ZMYA 5GGTA 2IH3B 1NUFA 5F9AC 4I48B 1T7VA 2OI9B 1RZ7L 1NGZB 1YJDL 1TJIH 3MNVB 4HIJA 4OJFH 4MVBC 5J9PB 2GHWB 2OTUB 4KHTL 1KN2H 1INEH 1RZKL 3WHXB 4XVTL 2AEWA 5AZEH 2NY0D 5DD3L 2PYFA 4GMTH 1F4WH 3BPLC 1DFBL 2DQTL 2FJGB 4XZUB 3TA3B 1KJ2H 5F3BB 2I60H 3MLXH 3IU4L 4F9LC 4P2QD 1LO0H 2NY3D 1IC4H 4XWGH 2YXFA 3L3OB 2NY5H 4P59L 4JLRB 4X98B 3AREA 3O3UN 3FN0H 2YKLL 3RP1A 1KG0A 3OAUH 3BX7C 2FCBA 1V7NH 4HFUH 4WTWA 1MJ7L 1Y18A 4M3JA 3GUTB 5JW4M 3D1MC 2F5AH 3GJEB 3FOLA 3L3GA 4E41D 3VXOA 3MV7D 1FHGA 2QHRH 3BN3B 1SEQH 4HWZA 2GSIB 1RPQA 1Q9LA 2IPUK 1MI5B 3BZDA 4Y5YA 5IB5B 4BKLB 2IAMB 4RAHA 4KI1A 2FEDC 4UV4H 4PJIE 1MH5B 4JO3H 3QCUL 1YEHL 3VD5A 4HEME 4NRYB 4PV8B 2XACC 4G9FD 1E6OH 1JWUA 4X6FA 3MLZL 3MLRH 1A1OA 1CYGA 4UDTB 3KYMA 1DVFC 4YHNB 2N56A 1N7ML 3RDTA 5FYJH 1MPAH 3MNZB 1JPST 1FDLL 3FFCB 4L4VB 4HXAH 4G3YL 3BEVA 3AM8A 2ITDA 5DVMA 3HUJE 1ZANL 1CQYA 4WEBL 4XBEH 2A6DB 5EA0L 2C5DC 2NMSA 4WGVB 5IHZA 1DQDH 5CBEB 2CMRH 5BVPL 4DEPC 3PWLA 2H3NB 3B2UC 2G60H 3WEXB 5CZXD 3IFNH 5FF6A 4HK0B 3DO3A 4O58L 2UWEF 2CKBL 2CO6B 3VRJB 3BQUD 1NDGA 3MLUH 4JFYA 3GMQA 5E6IB 1NFIB 2B2XL 4N8CH 4PTUA 4WI5A 1QA9B 4H8WC 4X6CE 2JIXD 5C09E 2ADJB 3OJMB 2JCCB 3FO2B 4KHXL 1LNUA 3GSUA 4Z7OF 4Z7VE 1MLCB 5D7IE 4Z8FL 1FCCA 1M6OA 2BVUA 5I1JH 1KIQB 3LDBB 5DA0B 3QIUD 2OTWA 5KS9E 3JTSA 3LRSA 5C0CB 3BFOA 3RUGA 5EZIL 3NZHL 4OCXH 3O4OB 5FAAA 3EYOA 1R5IB 1NAMB 2A6KA 1KCRH 4OF5A 4YUEH 3B4NA 5D1XA 5KANG 1BD2D 5GPRA 2W9EH 1A9EB 4PJXB 2X40A 5D7LD 1UB5B 1BEYL 1O7VA 4RNRB 4NZTH 1HDMA 3P2TA 3MFFB 3K46A 3J7HA 3QFJA 4JFQB 4JN2B 2AK4E 4H1LA 2AJXL 4KUCD 3X12B 4DTGL 1M1SA 2Z4QA 1K8DA 1RIHL 3P40A 4R0LC 1TVBA 5GS0H 1R5WB 3MRHB 3MRIA 2NY1B 2PF6A 4AQOA 3F5WA 3I6GB 3RJDA 2D0HA 4F9PA 2FX9H 5CGTA 4V1DA 4FQLH 2XOTA 4JG0H 4MA3B 4Y2DC 3TYFB 3MRPB 2C7UA 4S10A 4YIQA 5INCB 2YC1A 4O5LH 4M3KB 2AXJA 1BQUA 5GGVH 4YXKL 1Q0YL 2Z31A 5ESQA 2GUOB 4EI5B 2DWEA 3VGAC 3HZYB 1N26A 4R3SB 1WFTA 1SBSL 4OIIH 2P8MB 4JZOA 2P1YA 2VXQH 4ZUWB 3TV3L 4KGLA 4P23B 5HHVH 3UDWC 2CO7B 5JZ7D 2F53E 3B3IB 1TDQA 4XNYH 1CL7H 5HGAA 1WFOA 4LAJH 2XN9E 1CDCA 2ED9A 3ZTNL 3KYOA 4U1SA 1PLGL 4LLDA 3X11B 4WV1B 1FBIL 1OVZA 3IDIB 3MBXH 3V6FB 4PGCB 4MXVE 1WBYA 5A16A 3GSOB 3DECA 3BO8B 3C5SA 3O2VL 4JM2F 4OFVA 3U7YH 1LK3L 5MERA 4LLVA 3VXUE 3MLSH 3W2DH 2B1AH 1RHHA 1RZKC 5KVEH 5IROC 4K7FA 2BSSA 5MEPB 3UJJL 3HPJB 1FO0B 4X9BA 1IGML 3JTTB 5JMOC 2YUZA 4Y1AB 1U58A 4AH2B 1P7HL 35C8H 1SM3H 4Q7DA 1NCBL 3KS0J 2VDNH 3G6JF 2ZOKA 1C7SA 1JZ4A 2XKUA 2JJSC 3LKNB 1AKJB 4M93C 2ICWA 1XR9B 3MRJA 4F7MB 5I1EL 1MCIA 3C8KB 1J8HA 3EYFA 4L5FH 3IF1A 3HNSH 4U7SA 4WTXA 4ZAKC 2OR9H 1SVCP 4XX1G 3O11A 4FZEH 3O2DL 3GO1L 5CSZB 1GGBH 3DRTB 4FQHA 1MY7A 4OD3L 5E9DA 5E56A 3RJQB 4DVRH 3FZUD 3SDDD 1INQB 1RUQH 5GGSY 3BKMH 1ND0A 1JGLH 1W0WB 4N9OB 3OKMB 2X44D 2YD2A 1ZHBB 4XCEA 2EIDA 1EDQA 3QPXH 4DGYL 4WEUD 3TO2A 1FAKT 1MRCL 4MAYA 5C2UB 2DDQL 3JVGA 3V5DA 2H32A 5A2LH 2W07A 3RKPA 4GQ9L 1WF5A 3IRPX 3VFNB 3BESR 5FGBC 5DMYA 5T3ZL 2WWMD 2LABA 4AMKH 5DJ2B 4XPHL 4F57H 3CAFA 1QBML 2IG2L 1QSEB 4PJHE 5BW7A 4KQ4H 3MRRA 3BYYA 3RY4A 4Y5VA 4FQIL 3SCMA 4NT6A 3OPZL 5SX5H 5DK2B 4P5KB 1T2QL 4GAYA 2A73B 5TE4L 3SBWC 4H88H 2AJYH 3VXRE 3FT2B 1RZIB 1IGFL 5IQ7L 1DQLH 5KBNC 1MFNA 3QEQD 4HUUB 4Q6IA 5ID0A 3B9VA 5JUEL 4ZUVA 1DQQA 3QXWA 2HLAA 1UXWA 1CTNA 1NAKH 3G5YB 4I3RL 3WHE0 4EXPX 4MJID 4R8WL 4GG8B 2GTWA 3IU3A 4WU7A 3UCRA 3UTTB 2XNAB 4PJBF 1HHHA 1HCVA 2EYSB 3GMLA 2GJZB 3B5HA 4OCMC 4YBLB 4GKSB 5E2TL 1BVKB 4PRHD 4I13B 4OZHA 3D69B 2C1PB 2IMMA 3FO9A 1IFHL 1CD8A 4NDMA 1RUPH 1A7BA 3G6DH 4ELMB 5K9OA 2D03L 1GZPA 3BPCA 4HH8A 1BFTA 5GS3A 4YHIA 3FAXA 4XMKL 2D9CA 4NQXB 4NZUH 5HHMD 4FQCL 4N0UB 1BVZA 2VAJA 1YY8B 2QBWA 3L5IA 2AXGA 5GS1B 4X6DA 2CQVA 3TBSB 1MHCA 1XF5B 1RUMH 4OZFA 3C2SA 1R3HA 3PGCB 3HNTL 4Z7UF 3WN5B 4XMPH 2X4NB 2AJUL 3DXAD 3CPLA 1OTTC 4HSQA 2F58H 2APFA 3NCYP 4S1QH 1LE9A 4ZYKB 5FHAH 1LHZA 1IKFH 2A6JB 1NFDE 2G75A 1DQTA 2DQIH 3UTZA 1FZKB 2B0SL 3C9NA 1YNLL 2V17H 4NN7B 4JO4H 1HKLL 3F65A 1T66C 3QUZC 4NQVB 1M7DA 5CZVL 2PYEA 4TSAL 5FA4B 4HPYH 3WIHL 1RIUH 4OLVH 1P4LA 5BQ7B 4DZ8A 2BNQE 1N6UA 3E3QC 4LLQB 3REWB 5H37H 1TNMA 3RGVC 1NGWA 4KDTC 3BUYB 4YK4B 5I18L 5K9KB 2W9LA 4M8QB 5HGHB 1RZJC 1RUAH 1F97A 1X5IA 3T77B 2FSEB 3REVB 5IOPA 2V5RA 3VFSA 5J3HD 5F9WB 1TZGL 4N0FA 3AY4A 4N68A 2IFGA 4ZPVB 5IMOA 8FABB 1JK8B 4R2GD 5HTSA 5DUPL 4NKIH 4AENB 5C9JA 5CLTA 1YDPA 3C08H 4JPVH 1WBZA 4KMTH 4APQC 1J7VR 4C83A 1NCCL 4XP5L 3CDGA 2F9BT 4MB5A 4FHBD 2VUYA 1KTLB 4LSVH 1PGRB 4WW2F 3JUYA 4MA1C 3QO0A 1G7LA 4JEGB 5FYKH 4LP4A 1WZKA 4JRXA 5L2KD 4PGBA 1LEGA 1FYTA 1QRNA 3DLQR 3WIFA 3AS2A 2OR7A 3D39D 2C4XA 1T5XA 4K3JL 1R0AL 4X7TB 5D71L 1UB6A 4MMZC 1XGYL 3ARFB 3M8OH 2YPKA 1F4YL 4LF3B 5KVDH 3HB3D 1BECA 5C92A 1I8LA 4OUOA 5GGTH 1EK3A 4OZ4A 1VKXA 4PRPA 5KJRH 3ROLA 1PAMA 2ADGB 1JBJA 4Z7NF 4M7KH 1TQBB 4D9LH 2VXUH 3PHSA 4X4MA 4ZO7A 1J9CT 2UYLA 4PY8J 2YMXH 4D3CH 1JCKA 1HNFA 4QOKA 1S9KC 3O6FB 2HMIC 1MCQA 5BOPA 4WO4C 1EIBA 4L8CB 4PJ5A 4HCRA 4HH9A 3FRUB 3QNZA 4QRUB 4I18A 4IRSC 3V79C 5DRWA 1D5IH 5CS7A 5EN2B 43C9A 1D5MB 2BZDA 1ZSDA 4XC1L 1EJ6A 5JHLH 3AXLA 1NEZB 5E5MB 4OSUL 1OGTA 1S7WB 2A9ML 1YC8A 5T1DL 2HT3C 1FFOA 3EDKA 3QBTB 4LPVA 1EHLH 4OKDA 2LE9A 3V5KA 4JDZA 2AP2A 2YRZA 5I76A 5F7DB 5IQ9A 4WI7A 3CFEB 1AQKH 1FC1A 5IHLB 1MIEL 4PG2A 4NO0A 4QGTA 1D9KD 3MV9E 4P2RD 5DD0H 5EOCJ 1ROWA 5ADPH 4ZD3L 5L0QC 4OQ1A 5I1GH 4NO2A 3O8XC 4Z7WB 3P4NB 4F58H 5K9JL 3VFUB 1JHKL 1KIRA 2I24N 3EYUL 3HE7C 2BRRH 5ADOH 2VXTL 1U93A 1IGCL 5FO8B 4HIXL 1K85A 2VR9A 5JW3H 3WE6B 4QNPE 2R2HA 2C3XA 3H3BC 1OAYL 3I84A 1LO4H 4OM0L 5CHNA 1FL3B 3ULUC 4HWNA 2BSRA 4K07A 1FNFA 1KELH 5I6XC 2AJVL 1A9BB 5I66B 1YEIH 4PREA 4EEEA 4WRLA 1ZA3B 3VFPB 5C8JB 5FUOH 2ATPA 3VXMB 4P4KC 4HKXA 5JXAL 1CICB 3C2AH 5T3ZE 4UINL 1PZ5A 4JFZL 1OSZB 1FPTH 4ORGB 4HIEB 4FP8H 4Y5XA 3OGCB 1NMBH 1FP5A 4LHUB 1HXMB 3DBXA 2IH3A 3P30H 5SWSB 4I48A 4QHLA 1BQLH 1DBBL 1NGZA 3MNVA 3OAYH 4GH7B 5CJ8A 5DO2C 5H8DA 2OTUA 2VLKE 4FZ8H 4ZOBA 1P7QD 1QYGL 4K9EH 4HIIB 1SVZA 4OUUB 3GMRB 4XZUA 3TA3A 1N6QL 5F3BA 1E28B 4JFEE 1OQOA 1NEZG 3HKFA 4LOUD 1EMTL 5ITFB 1JGVH 5EUOB 4GBXB 1AGDB 4X98A 3TESA 5ELIA 4YHML 1MCWM 2X89D 4RISH 1F4HA 4MAUH 3VG0L 2ESVB 1A4KB 1OAXH 2X4RB 3GUTA 2X1XR 5EOQL 1LDPL 5CBAB 1E4XL 3GJEA 4UTBL 5FO9A 3ARDB 4LCUB 3KJ6H 2Z93B 1X4YA 2VDOH 1IMHC 1R5VB 2GSIA 1ZVHA 4JFPA 1ADQA 4H1LH 5I75C 1P9MC 2BERA 1MI5A 3D9AH 5IB5A 3TZVC 4PD4K 2RIKA 2IAMA 5F6IC 1V3MA 2FIRT 4A2MA 1X5YA 1MH5A 3GSXB 1A3RL 1JHTA 4M4PA 5BS0B 4YHPB 5EU6E 5IIEB 4NRYA 5TF1L 4PV8A 3GNMH 4QHMA 5HPMB 5E2UL 1UACL 2B1HH 3U0WL 1GRWA 5BV7B 4UDTA 4FG6C 5FDWB 3A6BL 3KXFB 3T3MF 4JRYB 4YHNA 1BMGA 1VACB 3SDCD 5GGVY 5L7XH 2JJVA 5FO7B 2P5WE 4I0PC 4M7JL 2HTLD 4RMTA 3MNZA 3MA9H 5IGXL 3BVNA 4L4VA 2VLMD 3MODL 4NZRL 1CBVH 5CGYC 3QXAB 2QQNH 3RUGF 4ONOA 4ELKB 2NYYD 5J1SC 3KPRD 3VGEA 1KB5B 4LHUG 4BK4A 3ZDXE 2Y23A 3TVMB 2A6DA 5C0BD 1I7UB 5CBEA 1I8KA 4NHCL 5C07B 3VXNB 2HJKB 1YEFH 4HK0A 5DRXA 1SY6A 3QB7C 3RWCA 1U8KA 3VRJA 4OFYA 1UCBL 3CXHK 4ZFOB 2R15A 3B8YA 1UVQB 2V5TA 5E6IA 1NFIA 1QA9A 2HTKC 3FFDB 2O26U 2ADJA 3FO2A 3CCHB 1EHXA 4OFKA 1KCKA 5F3HA 1WITA 5C0CA 2XZQL 3NA4A 3MRLB 4Y4HB 2EDDA 2O5ZH 1JGEB 3IGAB 3MRNB 3IXAB 1NAMA 1ZLWK 1AR1D 5FDYA 4PR5B 3SGKC 3MRQB 1G9EA 3HS0B 4J7RA 3V52H 4PJXA 3DETC 4J3XA 4WDIA 4XP6L 5JHDB 4RNRA 3KVQA 5T5NG 4XHJC 3KYNB 4MAYC 3C6LB 3DX7B 4JFQA 2JF1A 4OCSL 3X12A 2FBOJ 1UWEH 2VOTA 1R5WA 2VL5B 2ZKHH 4POUB 5J12C 2JTDA 3I6GA 2F8OA 4JQXA 1CGXA 2LVCA 1GCFA 3PGFL 4IOFD 3NA9L 4MA3A 4Y0GA 1B9ZA 3MRPA 3TYFA 4OF3A 2FZ3A 1P4BH 2HJFB 3TT1H 4EI5A 4AT6A 2GJJA 3UTSB 1Q72L 1QFUH 4FMKA 4R3SA 4NNPH 1BAFH 5ANME 2HLFD 3CMOL 3I2CL 4ZUWA 4OQTL 4HBCL 5SWQB 1JNLH 2V2XB 4P23A 3B3IA 1X44A 2MCG1 2J5LB 2YA1A 4KRNA 1U8MB 4Z0XB 2MSPA 1ACYL 4U31A 3X11A 1EJOH 1G9MC 3IDIA 4KV5E 3V6FA 4PGCA 2IPTH 5L6YH 3MOAL 1PFCA 3GSOA 1ZT1B 3BO8A 1YMME 1KEMH 1FL6B 2R2EB 4FNLL 3ZHKA 3CFIC 2DJ4A 4IOIB 3MUJA 3O4LD 4TOYL 3ABZA 5CEZL 2DICA 3V4PL 1X5XA 2HFEB 3HPJA 2XA8H 4IRZL 5JNYA 3JTTA 4KXZH 4Z77B 5ALBL 4Y1AA 1DUZB 4AH2A 4HGMA 3RHWF 1CFVH 5IW6B 1WWCA 1T1XB 3LZFH 2QSCH 5H2BB 1TJIL 1Z9SA 4YDVA 3BDYH 4QXTA 4OJFL 2XTJE 4GUPB 3LKNA 1KN2L 1INEL 3RX5A 4F7MA 1YNTB 2COQA 3MYJB 3C8KA 4K8RH 2FEDD 2JB5H 1F4WL 2Z35B 4L29B 4RIRB 1PG7L 1IM9A 2GITB 4F3FB 2I60L 3MLXL 1XGTB 5CSZA 3M17B 4XWGL 2NY5L 1RUKH 5DJXB 3VWJD 4OZFH 4TTDC 2DKMA 1INQA 4PJ7A 3BRFA 3L5JA 1PX4A 1T1YB 3FN0L 1EO5A 3I02B 3OAUL 1I3GH 4YHYC 1DVFD 1W0WA 5CJOH 4P3CH 4KJPC 3OKMA 1ZHBA 5ETUB 3I6KB 3E8UL 5E08H 4PJCE 2D7NA 3N50A 4Q74A 3GB7B 1IEBB 4RMUA 4OFPA 3GHEH 4GRWB 1XT5A 4N0RA 4EVNB 2QHRL 3TCLA 5MEND 1LO2H 4PLJC 4YAQB 5D96B 5GZOC 3QQ4A 2VLJD 5DJ2A 4UV4L 1QSEA 4JO3L 4UILL 2BNRB 4TVPH 2Q7YB 3F7QA 2ICES 5D2LB 5JW4R 3ZKNC 3ZYZA 5DK2A 2DLFH 2BNUB 4ONGH 2A73A 4UT6H 4IM8A 1KCVH 3UAJD 1L9NA 4LVOC 3FT2A 5F93C 1TLKA 1RZIA 5GSVB 4PRIA 5FYJL 4X6DF 1F6AB 3ET9F 1GHFH 4HXAL 4Z7QF 2YZ8A 2O5XL 5DA4A 3G5YA 3BP6A 2VMFA 3ARGC 4HUNB 4GG8A 2WBKA 1B2WH 4LCWD 4G9FB 3UTTA 3MO1B 5GS0D 5F96H 2XQBH 3N0PB 4XBEL 1EBAA 1IC5H 2QQLL 3H7BB 1J0HA 1DQDL 4LU5H 2GJZA 2CMRL 3WV0A 5C3TA 1BVKA 3JV4B 2G60L 2C4FU 3D69A 2C1PA 4GG6A 4CN6A 1R3IH 4ELMA 5CP3A 3MLUL 3HAEG 3KGRA 4N8CL 5F7UA 4NRXB 2QADC 4NQXA 2X1OA 4N0UA 2BC4B 1YY8A 1ES0B 5SWZE 3FJTA 3D85B 5GS1A 3SGDH 3TBSA 4RFOL 2A0LC 4MJ6B 5LQBL 5I1JL 2VERN 1SYSB 2Y5TB 2VTFA 1E4XI 1HILA 3PGCA 4PFEA 1ZEAH 4JQVA 3WN5A 3LQAH 3ZDYE 3KR3H 4OCXL 2IGFH 5C0ND 1CXHA 4ZYKA 3VXSE 4M1CD 1KCRL 1I85C 4ALAH 4YDLB 4YUEL 4YDIH 3WUZA 2QTEA 2W9EL 2A6JA 4HCRH 5IVXF 1FZKA 4NZTL 2B8OT 3FONB 1YUHB 4F7EB 5DDHA 4NQVA 1P84K 5GS0L 4NQDE 5FA4A 3QIUB 5D70H 1MVFA 4XTRC 5D4QA 3GIZL 3EO9H 4QGYA 3T4AA 5BQ7A 2J8UE 2FX9L 2FHFA 3REWA 2BMKA 4JG0L 4AG4H 4DGIH 3BUYA 3QUYB 1A02N 1U91A 4P4RB 4M8QA 4O5LL 2HT4C 4U1KB 4NPYB 5GGVL 5HGHA 5K9KA 4OD1H 3T77A 2DN7A 3WO4C 4NKMB 2FSEA 4LSQH 3REVA 1U8JB 4HWUA 1H3TA 1HKFA 1I8IB 1HHKB 4OIIL 3C87A 4ZPVA 3S37X 8FABA 1JK8A 5SX5K 3BKYH 3N85H 1J87A 4P2OA 1T83A 1NC4D 4BJLA 2NNAB 1B88A 5TE6H 3TO4B 1NFKA 1IGYA 1KTLA 3MBXL 3F62A 1BIHA 3I3DA 3ARZA 3OKDB 5ACMA 4I4WB 3TBYB 4LPUA 5IM7B 3U7YL 1FVCB 4ZAKD 3TH3T 4Y5XC 4IDJH 3S34H 4H5SB 3QZWB 4XPFL 1JZ7A 3LN9A 1RMFH 5HYQB 2OI9C 3HI1B 5KVEL 4X7TA 2EIZB 2AJ3B 2JE8A 4HPOH 4PJAB 3HE6A 5IVNA 4Q97A 3ARFA 4QRRB 3OKYA 4L4TB 1OP5H 4LF3A 1DJSA 4K7PH 3K4AA 4TYUA 3IKKA 1C08B 2ADGA 3JV6B 3VFMA 4NZJA 1CGTA 2MQ0A 1OF2B 1WBXB 4ZMAT 5I1KH 2WV3A 2VDPH 3L9RB 3O6FA 1I8MB 5TH2B 1JP5A 2VABB 4NBZB 4L8CA 1DEEB 3HNSL 2DQJL 3B9AA 4QRUA 2PN5A 5DR5H 2CR6A 4WHTB 4F7TA 1GGBL 5CEZE 4BZ2L 2IJ0C 5D1ZD 1I9RL 5EN2A 1RUQL 3GSQA 4KK9D 5E7BA 1NEZA 4ODSL 4ZS6D 4CNIA 4JFXB 2NTFB 4PPTA 5C86A 1NEUA 3MROB 3SO3C 3WJLA 3QPXL 4HS8H 4Q9RH 5JLZB 2VQ1B 3OR7A 1ZLUK 2V9TA 3QRGH 1HOCB 2RQ8A 5F7DA 3D0VB 1LILA 1IAKB 3CFEA 1TZHB 2BXYA 1PY9A 1JIBA 1ADQH 3IDYC 4LSPH 3NPSC 1GZQA 4YXLH 3BHBB 3B9KD 1WGOA 1HHJB 4Z7WA 4QTIH 3VFUA 2AI0L 3EOBB 4KQ4L 4PJGB 2E8ZA 1W8NA 2AEPH 2IFFH 5GSRB 1NCAH 3T2QA 4OLWH 4WUKH 2IBGA 3TPKA 3EYSH 1S5IH 3V0WL 1T3FB 3WE6A 4M61B 2LAAA 4H88L 4E5XB 2J2ZA 1BBDL 3QQ3B 1UA6H 2CRMA 3L6FA 3QZWG 4JZJC 2NY2D 4PJ9C 1U0QA 1J05B 3AROA 1A9BA 5I66A 3NPZB 1MJ8L 5LG1A 1ZA3A 3SJVD 3QEGH 4KAQL 1C5CH 2UWEE 3VFPA 5C8JA 5ICZB 4UNUA 1NAKL 3VXMA 1CICA 3B2VH 2DLIA 1OTTD 4PUBH 1N3NA 5E6IC 2A9NH 5CJBA 1OSZA 4ORGA 4HIEA 1X4XA 4L8BB 1FZJB 4LHUA 1HXMA 4O2CB 1OPGL 4NWTL 1N0XH 3L1OH 4TSCH 4WFGE 1YYMH 4FABH 1I1CA 3KWWB 3P4MA 5DFVD 5AYQA 3F8UB 3Q3GB 1SY6H 3VWKB 1RUPL 3OF6D 4YGVB 1T66D 3QEQB 4JDVB 1L0YA 3WXWH 3QUZD 2VXSH 4HIIA 3RWIB 4OUUA 3GMRA 2JKXA 5FYJE 1A4JB 5FYLD 1E28A 4OGZA 5F7EL 5CJXC 2LU3A 4UQ3B 4KJWD 3RGVD 4M5ZL 1GYAA 5ITFA 1RUML 1MFBH 5EUOA 4FQ2H 1AGDA 3DIFB 4ZPTA 3T0BA 4XMPL 2OJZH 2ESVA 5EC1B 1BF2A 3MUGB 4S1QL 4PGDA 1NAMH 1XMWA 2X4RA 5FHAL 1T2XA 1IKFL 5CBAA 2HJLB 5HHMB 1FIEA 4LCUA 5IVZB 2Z93A 1F90H 5F97E 3ZMRA 7FABL 1R5VA 1JRHH 1NCDH 4JO4L 1KV3A 5IKCB 1EZVY 4O2FB 1H8SA 3GMMA 3HRPA 1JFQL 4IOSD 2D7MA 1RIUL 3FKUS 3QEUB 3GSXA 5BS0A 3Q48A 4AIZB 1Q9KA 2X4TB 5IIEA 3K7UA 2E9JA 5HPMA 3F6IA 4D9QE 2I5YH 3RU8L 4HKZA 1RUAL 2ADFH 1RULL 2Y4SA 2IANE 3VW3H 5FDWA 3KXFA 4JRYA 2F8VA 4WV1C 3DX9B 1VACA 3LCYA 2ZUXA 1KSRA 5FO7A 3SE3A 5CCKH 4OTXL 2AKRB 4NKIL 3ULVH 1NGXA 5JMRA 4ELKA 2DS4A 1KB5A 1BQHG 3WNLA 2F19H 1XF4B 3QIWA 1HI6B 2NY6C 4LSVL 3TVMA 4JZNB 1I7UA 1RJYB 5DJAB 4PJXF 5FYKL 4WO4D 5C07A 5C7XL 2HJKA 2RFXB 2XG5A 3RTQC 3IB4A 5C0IB 1BJ1H 5DGRA 4ZFOA 3IDJB 1CR9H 5D7SH 1UVQA 2ZUUA 3G6JE 3FFDA 2XRAH 3UPAA 4ODWB 1FO0H 4WNQB 1NGPH 3CCHA 1L7TH 3JZ7A 3OAYK 4WI2A 2O93L 2AXFB 3GJFB 2BVOB 2HT3D 1QFWL 5E2JA 4M43H 4R97B 4GXUM 2MMXA 2VDQL 1X5KA 5TGBB 4D9LL 5M7QA 3UTPE 5ICYB 1JGEA 3MRNA 3IXAA 4PR5A 1EBPA 3MRQA 3T8XB 3HS0A 4MNGB 5ICXB 4NO5B 4P9HH 4KY1L 1IGTB 3ULVF 4NKQB 3O8XD 3BP7B 2BY3A 3G9VA 5GS2D 5JHDA 5BRZE 1N2RB 3HE7D 2VO5A 3C6LA 4FQ1H 5CSBA 5DRNB 5BMFH 3LIZH 1D5IL 2X05A 2C4FT 5L9DH 2VL5A 3V6OE 5JHLL 5FUCC 2NX5E 3O3AB 1AGBB 1XGPB 3RL1B 4D0DB 3V5HA 3ULUD 4GW4A 4PYHA 4G8IB 3T3PF 2GW5A 1YQ2A 2I9TB 1PG7W 3F7RA 1EUTA 4KZEH 2FGZA 3PV6B 15C8L 3PWVB 1AQKL 1H3PH 4PP2B 5T1LD 3UTSA 4P4KD 4NUJB 5C0GB 4OZIB 2ATKA 4OF6A 5IEKA 5DD0L 5SWQA 2V2XA 3TFKC 5ADPL 3QI9C 1DBJH 2DKUA 3L3DB 1AGCB 4OAWB 4S2SA 1FE8H 2GJ6B 1Q9OB 2BRRL 5ADOL 1U8MA 4N8VB 4Z0XA 2YBRB 3WIIH 3RI5F 3BKCH 2EO9A 3EJYC 3MX0A 4ONFH 1FL6A 2DJSA 2R2EA 2VLRE 1LO4L 1MHEB 4PJBE 3CFCH 4IOIA 3D3VE 3QDGD 1A1MB 1KELL 1L7IL 4YBLC 1D9KB 3L3JB 3VFTB 4NFCA 3QEHB 4N5EC 3O6MH 4PJ7F 1K9TA 3IT8D 4GMSH 3BMVA 2R2CA 1VPOH 2HFEA 4HJ0C 2HWZL 1NC2B 3CX2A 4Z77A 1DUZA 1KCSH 1FPTL 4QT5B 3MCKB 4G6MH 5FUCE 3VMNA 1NMBL 3MR9B 4GKZB 5IW6A 1IT9L 5EU4B 5HJ3B 3V6ZB 4OGYH 1BQLL 3GZKA 5H2BA 1DQML 3FQXB 4GUPA 4NFBA 1IILE 4DKEH 5MP6H 3CDYA 2Z31D 1AO7B 2E27L 4Z7UE 3TZVD 1YNTA 4MDIA 4K9EL 3BH9B 4MCZA 1KLFA 4GSDH 3ARTA 1MCPH 2Z35A 1YY9C 4RIRA 3HAEA 3OZ9H 5DJ8A 4F3FA 1XGTA 1FVEB 1T89C 1VEOA 1JGVL 3M17A 4OD2B 3RVUC 5DJXA 4K3HA 3L95B 1KPVA 1T1YA 3KPNB 3I02A 3SE8L 3MLTA 1FFNB 5C0AE 5ETUA 3I6KA 4Y89A 5AEAA 2B4CC 3GB7A 5B8CC 1IEBA 1QBLL 2DTMH 2PW2A 1WISA 5EOCL 1OTSD 4Y4FC 4MZ3A 5TDPA 3KJ6L 2C9AA 4KKNA 4YK4C 3BD4A 3LSOB 5HDBF 2VDKL 1KC5H 3LEYH 3ZSTA 3D9AL 4YAQA 4P2QA 4GRLC 3TJHC 2GAZB 3RHWK 1FN4B 5HD8D 5IB4A 5F9WC 4N8VG 2VDLL 1CE6B 5J0BA 5ISZE 1TIUA 2FO4B 1FV1B 2Q7YA 4AZ8A 3CFBA 4GG6F 3TIDB 5D2LA 4G7VL 2B1HL 2DQCH 3IRZA 5HHXL 1AJ7H 2BNUA 3V7MA 1QSFB 4G8GB 1FFRA 3B43A 5ECJE 4PGEB 3MV7A 2C26A 1ZLVK 4C56E 3CXDL 1F6AA 5FKAB 1JYVA 1CBVL 3EO1B 1XF3B 4S1DD 5IVOA 5IFJB 2QQNL 1IBGH 1PX3A 5FGSA 3PGDA 4Z18A 5E9DD 2OP4H 3J8F7 4JKLA 4G9FA 3BT2H 3WFZA 1UXSA 2Z8RA 2VZVA 1MVUA 5FM4A 5ITBH 3DETD 3JV4A 5EH1A 3VXPB 4LDEB 3SDCB 4I2XE 4XHJD 1FH5H 4MAYD 1B90A 2DD8L 3JSSA 3O41B 4JHBA 4Y19B 3O3DB 4Z7NE 4WUUE 2ADIB 2A74B 4NRXA 4TUOB 3BZFB 1A64A 1KGCD 2BC4A 3WDJA 3VI3F 3KPRB 1ES0A 1DL7L 3QDMB 3D85A 1ZTXL 5C0BB 3MBEB 1SYSA 2Y5TA 1JWMB 4Q9BA 4KZDH 5E1AB 4JFDE 1XIWB 5E2WL 4XPAL 4K7PY 5E2VL 1W0YT 2O5ZL 2R0LL 4L3EB 4YE4L 5FYKE 4R96A 2J6EH 5B4MC 2WBJC 3V52L 2EC8A 1CK0L 4BSVA 2EH7H 2EE3A 4IMKC 3GRWL 3L5XL 2JIXA 4YDKL 3FONA 2IBZY 2AQ2A 1IAMA 1YUHA 1IKNA 4QRPE 4F7EA 1UWEL 2ZKHL 3QIUA 4XCFL 3WDHA 3X17A 1GC1L 4XXCA 1G6VK 3EAKA 4X7EC 5LBSH 3VG9C 5JOFB 4NC2B 3EIFA 1KJ3L 1AIFB 4P4RA 3MLYH 4OLZH 1LO3L 2WSKA 1B4JH 4U1KA 5TE7H 1BD2A 4NBXB 3WLBB 3EFDH 5E6ZA 3TT1L 3TM6A 1U8JA 5IBUB 1E4WH 3EDFA 1QFUL 3R8QA 1I8IA 1HHKA 1BAFL 3MJ8B 4K8RD 3VFGH 5EUKB 5LGHH 2B20A 4WW1A 1MCKA 2DOCA 1M7XA 2VUOA 1NANH 2NNAA 4N9GB 3MRMB 3CDCA 2VLLB 3V4UH 3G04B 2DM7A 4NJAH 3MRCB 3S9DB 1KLUB 3TBYA 1M4KA 3E6HB 4HXBH 4I4WA 5IM7A 4X5WA 4G42A 1E6JH 1UM4H 1FVCA 4G7YH 1BZ9A 1OW0C 3BWUC 4PJIB 4H5SA 4NGHH 3QZWA 1Q8MA 2NZ9D 4PJDA 3STBA 5HYQA 2WP3T 3HI1A 1QFWI 1K5NB 3EOAA 2EIZA 2AJ3A 4PJAA 1CGSH 4NOFA 2P7TB 2VE6B 1RVFL 2XA8L 4QRRA 5KSBF 4JGUA 3EFFB 4KJPD 2PYED 3H9HB 4LCCA 1CFVL 1C08A 4BQ8A 4TVPD 3LZFL 3JV6A 3MRKA 3LS4H 3PP3H 4GBXC 3FHQA 1WBXA 3O4LB 2FJHB 2ZUYA 3SKUD 5GZOD 4WWKC 1WUNT 3L9RA 1I8MA 4K8RL 2VABA 3HUJB 1KACB 2MNUA 4PJFB 2JB5L 4RFNB 1ZGLP 4JFFE 3QCTL 1FNSH 2KZWA 4JGMA 4WHTA 3UMTA 3HI5H 4BUHA 4Y4KB 3ARDC 3P0VL 3ZKND 1YA5A 5HBBA 3L3KB 2CGRH 3SGJA 2XZCH 3MLWH 3SDXF 1I3GL 1NLBH 1YEKL 3I50L 4X6CB 3CH1B 3F7VB 3MROA 3MGOB 4EI6B 5C09B 5D2NC 5JLZA 2VQ1A 3U9PH 5IBUG 4JRXD 4Z7VB 3NTCH 5D7IB 5KVGH 1FYTD 1HOCA 1QRND 4MGXA 1WIPA 3WLWC 4ZDHB 1QLEH 1IAKA 2VAAA 3VFOB 4CU7A 1TZHA 5KS9B 1ZE3C 1LO2L 5F72S 5BV7C 5GGRB 3T3ME 3BHBA 2VITB 2A77H 3EOBA 3RIFF 3ESVF 3KPSE 5GSRA 1VSCA 3TYGH 5LXGH 4PRPD 1QEWB 2YD9A 3CJJA 3RUGE 2AK4B 4ONGL 2DQEL 3HN3A 4E5XA 2QADD 4MXQC 4DJMA 3CU1A 2QQKL 1J05A 1HH9B 1C5BH 4NBYB 1A7QH 4PJ5D 1TVDA 3HG1D 1GHFL 1R6VA 32C2B 2R0KH 1OSPH 3QFJE 4DEPB 5ICZA 4HWEH 2ZG1A 1NMCC 5F7NC 1N4XH 1U36A 4ODHH 4YPJA 4CVWA 1KB5H 4M5YH 1B2WL 1OAKL 2Q3AA 1UC6A 4FFVC 1DSFH 1VFBB 1FZJA 4L8BA 1GJIA 1ZLSH 4LU5L 2YD7A 4O2CA 1BQHA 1L0QA 1QUNA 4V1DE 1GGIL 4P2YA 5EBWB 5EZLB 5TDNB 3S97C 4M1DH 5D2NE 3VWKA 5E00B 1U2CA 1OP5K 1R3IL 1T7YA 2XN9B 5I19L 5T5NF 4HQQH 4MD4A 3QEQA 2BVQB 4JDVA 3U6RB 1SMOA 5JOPE 4Y4HC 4ETYA 2E7LC 4UOW1 4Q0XH 2EYTA 1E4KC 4XTRD 4NO0D 1A4JA 3T1WA 3MUZ1 1EEYB 5JQHC 5KZCD 1T80A 2HH0L 4H20H 4UQ3A 1JPFB 4EOWH 3VXUB 1IEHA 2HT4D 1UZ8B 4RBPK 1A7RH 3MCLL 1GC1C 1ZEAL 2Q6WB 1OD9A 3LQAL 4PRHA 5EC1A 3KR3L 5EU5B 5EZOH 1WC7B 3ZLQC 1B4RA 3MUGA 4MD5B 3LKRB 2IGFL 2XKSA 1K3IA 1EHNA 3P0GB 3L5WB 1S5HB 3BZ4B 4R0LB 1P5VA 4HCRL 2HJLA 5E5RB 1J18A 4XRCB 5K33A 2RGSA 5IVZA 2OBGA 2GIYA 4JFHE 3WHE1 4PB0H 5HYJE 4FN0A 4Y2DB 3WD5H 4O2FA 5I1HL 4K3DH 3H3PH 3QEUA 1AD0B 2EDQA 4AIZA 3VGAB 4ZOAA 2DLTA 4AG4L 2X4TA 2PO6C 1MELA 4MA8H 4DGIL 1CIDA 4OD1L 5CWSB 1KN4H 4K55A 3PIQB 3ZYJA 3DX9A 3HFMH 1U41A 2EDLA 1J8HE 2OL3L 3T09A 5ABDE 1W72B 2AKRA 2VB5A 3C8DA 1RJZB 1INDH 4MMXC 5TE6L 1A3LH 4JKPH 3T4YB 1HI6A 1DBAH 4L8DB 3QP3A 4MDJA 5DXWA 1RJYA 5DJAA 5F9DC 2KQMA 2BSTB 2QJDA 3ESUF 4QTHB 2RFXA 3HC0B 1T04B 5BZDB 2FB4H 1U95B 5C0IA 3S34L 4PJHB 3LY6A 3JWOH 1JMXA 1KCLA 3IDJA 1AGEB 2Z8WC 4OCNC 1U8NB 1YEGH 4Z76B 4X9GA 2BY2A 2X9WA 2AS5M 3LVEA 4ODWA 1MI5D 1L9MA 4WNQA 2IBBA 2IAMD 4DK3A 3ILPB 1F02I 2AXFA 3FL7A 3GJFA 5IEHB 5IWLA 2BVOA 4K7PL 25C8L 4M93B 3W39B 3U82B 4YXHH 4H0GA 1DBKH 2QLVB 2BDNL 5TGBA 3DMMC 5ICYA 1A6TB 3PWUB 3O6LH 5I1KL 5HHNB 3MRGA 2XFXB 5FOBB 3T8XA 5ICXA 4NO5A 3RWFB 4AEFA 1IGTA 3BP7A 3KHQA 2DMKA 1N2RA 5DR5L 3FFCD 4L4VD 4AIXA 4X6EB 5DRNA 2WZPD 3MJ9L 1D6VL 4ZFGH 1KBGL 1A14H 2YD5A 1QBBA 3WSQL 3IDXH 2X1PA 1AGBA 5D96C 1XGPA 3RL1A 4WI4A 4D0DA 2D4FA 4LEOB 1U6AH 4UB0H 4HS8L 4G8IA 4KK5C 4YNYB 4LNRA 2I9TA 2EE9A 1ZGLM 1A6PA 5JORB 1QVOB 1T0PB 2LQRA 1MWAL 2R1WB 4GRWH 2YRPA 3PWVA 4MD0B 2X4QB 3RPIB 4XMLH 5D7JC 3QDJE 1ADQL 4NUJA 5C0GA 4OZIA 2R56H 3ZE1E 2F54E 4KVCH 4L4JA 5E6ID 5KSAC 3VFVB 4YXLL 4U1HB 3W5MA 4L3AA 3L3DA 1AGCA 1MQKH 4OAWA 3W82A 2GJ6A 5HDLA 4X6DE 1KFAH 1CXIA 4XVSH 4N8VA 4Z7QE 2YBRA 4BSWA 5I1LB 3G5XA 2I9LA 2QSQA 1DLHB 1S5IL 3VD3A 5C0CD 3DI2B 1CFQA 1F8TH 4MSWB 3P73B 1UA6L 4WVRA 5KN5B 1OY3B 5JW4N 4Y7MA 1UJ3C 1MHEA 4XP4L 1GXEA 1BLNA 4JDTL 4KXZI 4POYA 2BNQB 1D9KA 4P2RA 3L3JA 3VFTA 2ICCA 2CDFB 3QEHA 1K4DA 1D5ZB 1NDMB 5EU7E 2YPLD 4K3EL 2JJTA 1CE1H 2WWKO 1NC2A 2Y06L 4PUBL 1HCFX 1XAUA 1P4IH 2A9NL 1KPUB 2DIBA 4JJ5B 2H1PH 4QT5A 3MCKA 3RAJH 2YK1H 2VKXA 3MR9A 1N59B 5E8NA 1GIGH 3V4VH 4GKZA 4FABL 4TSCL 1YYML 1P7KB 3SKOB 3LKSA 4GRWF 5EU4A 5HJ3A 3V6ZA 1CVSC 1HYSC 1N5YL 1SY6L 4ENED 1EGJA 3FQXA 1XGRB 3NAAL 4BQ9A 3CSYB 1AO7A 4EI5D 3BH9A 2VXSL 5DC4B 4LAQL 1F4XH 1E4JA 4X4XA 1XR8B 2EH8H 1ZT4B 2R0ZH 5GRYA 1L4IA 2N7BA 5AWNH 4P23D 1S7QA 2R4RL 3U7AA 3RI5K 4OF7A 5D2LF 5L88L 1ZV5A 5IVXE 4OD2A 1T1WB 1MFBL 4RGOH 3TJEL 3L95A 4YEEA 4XVUD 3KHOA 1QPPA 2OJZL 2APXA 3KPNA 2AJSH 1NAML 2VRAA 4XXDB 4W4NA 1P7QA 5BOZG 3QUZB 4LNVA 1F4AA 3P11L 3CZJA 3VRLF 3QUYC 1F90L 3LSOA 5IMKB 5HDQL 3FCTB 4NQED 3LMJL 5C6WH 1NCDL 1A8JH 2MWCA 3RVVC 1F42A 3RY6A 4QHNB 4IRJB 3UBXI 2NY6D 4A2LA 1FN4A 2Y7QB 2F8XC 4HK3J 4NOBA 2X89A 1O5DT 1CE6A 1BZ7B 3RTQD 1HZHH 1FV1A 1PKQE 4OCLC 3TIDA 3U0PB 3R06B 2I5YL 1C7TA 3FB7B 4EIGB 4XVJH 2ADFL 3K2UH 4U1MB 1QSFA 2CDEB 4X4ME 3TO4C 3N9GH 3GHBL 1AXSB 4PGEA 5A3ID 4APQB 2EXWD 1AKJD 4QOKE 1NCNA 5DHVB 4JHWH 1BX2B 2EXYC 1A6UH 4FTVD 5FKAA 3L3HB 3VH8B 3EO1A 4MA1B 1XF3A 4CDGC 3ULVL 5IFJA 3E6FB 3CSBA 4UIKH 4XAKD 5DD5H 2DLEA 3WS6C 1JZ5A 2NQCA 1AP2A 1OLZA 5B21A 1OCWH 1A0QL 1IQDB 1T0MB 3ULSB 3SDCA 4ZTPH 1JWSB 5KOMC 2YN5A 4Q9QL 1BPVA 5CGMA 4Y19A 3O3DA 2VISB 1NGQH 1IGJB 2UVEA 1CR9L 3SGDI 2ADIA 3T2PA 1AC0A 1WTLA 4L9DA 1CXKA 4RAVA 4TUOA 3VA6A 3QCVH 3JWDH 1CLYL 1NGPL 3KPRA 2JELL 3QDMA 3TNMB 5C0BA 3MBEA 3VFRB 1JWMA 3T2NH 4WO4B 2YOCA 5DQJA 3CLFL 4LASH 3K4ZA 4M48H 1DCLA 3MV11 4CGTA 4IRSB 1SBBA 5T33H 1I1YA 4KUCF 4WI8A 4ISVB 4MNQE 2ZUSA 4RMWA 1QKZH 3TFKD 5EIVA 1C16B 3NH7H 3QI9D 4P9HL 5IB3A 3LKPB 1FZMB 1TITA 1T4KB 3QHFL 4LPYA 3QPQC 1DN0B 4CN4A 5AUMB 2BY0A 5D7KD 3RVXD 4K94H 5I30H 3SN6N 4XBGA 1MRFH 5ENWB 2MPAL 2CIIB 4LLWB 2OK0H 3UTTD 1MLBB 5JOFA 2AJZB 4PLKC 2O61A 4XNXL 1AIFA 4PJDF 4GO6B 5HHPB 1PQZA 4JFEB 3WLBA 2EDWA 2QHLA 5L0QB 4ZNCD 4WTZG 2ZOLB 2R0WH 3NIDF 1H3PL 4HJ0D 3VH8G 2BCKA 2DQFB 3MJ8A 5DQDH 2LTQC 3NCYS 1A47A 4IS6B 4FA8A 4F80A 5C6TH 1IQWH 3LOWA 2NTSP 3WIIL 3DO7B 4HV8A 2VLLA 3G04A 4PBWD 5MEQB 1KLUA 1G9NH 4FXGB 5DUMH 5C1MB 3GBNL 4K2UH 1ETZB 2R39A 3O9WB 1JVKA 5T1LB 3CFJB 1FG2A 3HMXL 2NXYC 4P4KB 3CFCL 4UU9B 1C1EL 1LVEA 3RVUD 5EU6B 3ZL4L 5FKPB 1EUUA 1FNGB 2EDFA 1K5NA 4KK8C 4C4KT 3ETBF 1BOYA 2X9XA 2P7TA 2VE6A 1GH7A 3GSNL 5J6GA 4N90D 3EFFA 4HIHB 5TFSH 4AEHH 3H9HA 5GJTH 1ZGLB 1KCSL 1I1AC 1A5FH 1MCCA 4QLRA 3O0RH 4G6ML 3UX9B 1PSKH 2P5WB 3X3GH 1FZOB 1WV7T 2W9DH 4RDQF 4Y4FD 4OGYL 5J7CC 3S5LB 4YJZL 1WZMA 3QDGB 2VJXA 1V7ML 3O4LA 5SX4H 3DNKA 4UBDC 2FJHA 4QXUH 3PWPE 4GRLD 3TJHD 5LGKA 1MCWW 2V7NB 3HUJA 4GSDL 4GKNB 4PJFA 3V7AE 1MCPL 4PRBB 3P9MB 5EORH 1TETL 2XZZA 3MUY1 3PABA 3UJIH 1KT2A 2YD4A 3QULB 1A6VH 3L3KA 1F3JB 4G9DB 1I7TB 4NKDA 1RZGB 5CKAA 3QUMA 5KANI 2KZ1B 3CH1A 3F7VA 1RQ5A 3MGOA 4EI6A 5ACZB 5I75B 5C09A 3PNWB 3O81A 2DTML 2DM2A 3LV3B 5D7IA 3D2UB 4ZDHA 3MXVH 1F58L 3LQMA 4ZOEA 3SKJL 1NL0H 1XH3B 3OKLB 4X7SL 4ZS7H 1U3ZA 4YX2H 1E27B 4I77H 4YLQT 3QQ9C 5DMKB 3ARFD 2E6PA 1YECH 1FVDB 2VITA 4LRIC 2DL2A 2P4AB 1DVFA 1G84A 1XGUB 1ZHKB 1J1OH 1AR2A 4KJYB 4EN3B 3BGMA 4I0PB 1QEWA 4OBSA 3ZZ1A 2YSSB 3GBMH 1AJ7L 4KROB 1IRAY 1F5WA 1IARB 4QWWC 4RFEB 3GSVB 3RZWA 5IHBA 5JPMB 1HH9A 4R9HA 4PJXE 1JI1A 4MB4A 3BUTA 5KSVB 32C2A 2XWTB 5E6YA 2FHBA 1RK0B 1IBGL 1MUJB 2GT9B 4LSSL 4KKBC 5DZOA 4S1RH 4XX1E 2OP4L 3SDYH 1VGEL 3BT2L 1CDHA 1G7HB 3U46B 4EIZC 4NN5C 5B4MD 5ANMB 2WBJD 3MCG1 3S5LG 5ITBL 3WJJC 1G0XA 5EZLA 4OLXL 5EBWA 1F3DJ 5GRVK 1T5WA 4XC3L 1BGXL 3DI3B 1UM5H 4JHAH 1DTUA 3DPBA 4BELD 2BVQA 1KJMB 1LP9A 3U6RA 2HRPH 5T3XH 2FLBT 1IM3A 3WNPA 3VD7A 3RIFK 1YMMB 1C5DB 3NCEB 3GJFH 4RGNC 3VGBA 4HHAB 1JYNA 1JPFA 3Q6FB 3ULVE 3VXUA 3C09C 4UZGA 3RKDC 5GRUH 1UZ8A 1SYVB 1DN2A 2Q6WA 4DQOH 1G7JB 5EU5A 1WC7A 1Y6KR 4MX7B 4MD5A 3LKRA 5DEFB 4CMMB 2X4OB 1KENH 3AU1B 1S5HA 3OX8B 4R0LA 2EH7L 4XRCA 5J12B 5FB8B 1H3GA 3T3PE 2Y36H 2Q87A 2O5YH 3MACH 3PQYE 4Y2DA 4G8EB 3VXMD 2Z9TA 2FO1A 1MHPH 1ERNA 2IADB 4Y1AE 1FL5B 1AD0A 5F1OB 1VEMA 1PZUB 5EZJB 4O2EB 3PXHA 4U6YB 3MLYL 5SWSD 4OLZL 3SE4C 3UDWA 3EFDL 4PS4H 5CWSA 4JQIH 4C59B 1T20A 3PIQA 4DWHA 2H9GA 1E4WL 4N0YH 4OF8A 3PDDA 2VWEE 5MHSE 4LSDA 4V2CB 4EQ2A 5FV1L 1W72A 1QQDB 4JY5H 4E0RB 2IH1B 4PJCB 1FFQA 1RJZA 5F9OH 1CDGA 4O4YH 4M6AA 4AYFA 4GBXD 3OAZH 1D5XB 3RNKA 4PJ7E 4X9HA 1OTUC 4NJAL 3QUXC 4L8DA 2RB8A 2XZAH 1OOAA 2ESVD 4HXBL 4F8TA 4MCYB 5IROA 2BSTA 1EFXB 2BHYA 4QTHA 4G7YL 1WZ1H 1DEDA 4NGHL 3NCJL 3HZVA 4M6MH 1AGEA 1FG9C 2PKDA 3ARDD 5AZ2H 5MI0C 4J3VA 4Z76A 2WAHA 1CGSL 3UXFA 2MJWA 5GRVL 2YR3A 3CK0L 3WNKA 3EHBD 1WICA 4WI3A 2R4SL 3LPFA 3ILPA 1N5AB 2E6QA 4JREB 4LLYB 3W39A 1QSEE 2X6MA 4R4NC 2XPGB 5IJKA 4NNXB 1UCTA 2APVA 1TJGH 3FB5B 4HGWB 5EFIB 3L3IB 3WLWD 1NMAH 2XG4A 5H35B 1EGJH 1A6TA 2L7JA 3PWUA 3X3FH 3G6AB 3MREB 1EZVX 1EERB 5HHNA 1RFDL 2XFXA 1KEGL 3H9SE 4ETQB 3KXFD 4JRYD 3A0OA 4URTB 1J10A 3RWFA 4PRIE 1JGDB 5F7LB 1Z3GH 2FECL 3T0EC 1JGUL 1FNSL 3BIKB 4E42B 5C08D 4X6EA 4NNYB 4G6AC 5E8PB 5HDBE 2EKSA 2XZCL 3MLWL 3BSZH 1LEIA 1NLBL 2YD3A 4OT1H 3FOMB 3TVMD 5DC9B 4R90H 4LEOA 2FDBP 3NACL 3MOQA 5SWZB 1OWWA 4GJTB 5JORA 1QVOA 2R1WA 1QLEL 4GG6E 4KTDL 2X4QA 1UYWH 1CLZH 1J86A 5DMIH 1X5GA 4U7MA 2IQ9H 5IF0A 5A2IH 5FYJU 3VFVA 4LVNB 4U1HA 3VXSB 2DBLL 5J1AB 3FO1B 3UZVB 5HI3C 4LVOB 3ZYIA 2FWOB 3TYGL 5LXGL 1HHGB 5I1LA 1JF6A 5B3NA 1DLHA 2VXVH 1N6VA 2DLGA 3IVKB 3EOYG 1XCTB 4MSWA 4LGPB 4Y4HD 4DGVH 5KN5A 1OGAD 3S4SB 1FAIL 3KPLB 4M62H 3ARGB 3MXWL 1C5BL 1FGNH 3TEUA 2BNQA 2J8UB 1A7QL 2P8LB 4QRSB 5E95B 3BZEB 5JHDD 1U3HC 4NJ9H 1D5ZA 1OSPL 3C6LD 3BWAB 3F12B 4ZXBC 1N4XL 1QLRB 4ODHL 4ZFFB 1KB5L 1V05A 4M5YL 4ZO9A 2DAVA 1KPUA 1N8ZB 4ZUSB 1BFOA 4JJ5A 4TTGA 4HMEA 1DSFL 1XZ0B 3FMGH 4QF1B 5DYOB 4DUWA 1ZLSL 3BIBX 1N59A 4LPWA 3CXHJ 3INUL 1P7KA 4ODUB 4M1DL 1JPTH 2VZ1A 4BFGA 2HFGL 1CVRA 1XGRA 2R29H 4ERSH 4HQQL 3CSYA 3HG1B 1XIWC 5I8OH 1TZIB 3OJDB 1JPGB 2F5BH 5FM8A 5DSCB 3UTSD 1ZT4A 1B0WA 1ZT7B 3IDMB 1ZWIB 4R4FH 4H20L 4KWUA 4XCNB 1I9JH 1T1WA 1K8IB 4AL8H 1T6VN 3IXTB 1DLFL 1X7QB 5FM5O 1A7RL 3NABH 4Y16C 5EZOL 4U2ZA 5DLML 3OF6A 3RVWD 4DKAA 4XXDA 1TQCC 3N06B 2QSVA 3UJTH 2H6PB 3QUZA 5JW5B 2HT2C 1NLDL 3N1QC 5CINH 1UH3A 3SQBA 5IMKA 3FCTA 1CQKA 4PB0L 5KZCB 2Q7NA 1ZK9A 4QHNA 4IRJA 5DJCB 3RGVA 3WD5L 4KDTA 1S9VA 4D2NA 4NFDA 5JXEC 3WO4B 1MJJA 4WFFD 1BZ7A 2BFVL 1CT8A 1J1PH 3IYLW 4CVZB 4LVEA 3DGGB 4ODBD 3E1F1 3R06A 3CFKB 3U4EB 1GL4B 4U1MA 3EO0B 2CDEA 3QHZL 1KN4L 4JANB 4D9RD 1AXSA 5IP4A 4APQA 1A3QA 5DHVA 4R4BB 4WTZA 5EU3B 1BX2A 2OMBA 5CILL 5LAXB 4MJ5B 3HR5B 3VH8A 1KTKE 1OT2A 1HXYB 4U1JB 3E6FA 3KDMB 5DEGB 4NQUA 5GQBA 5CKGA 3RNQB 3FQRB 2GFBB 3DMMD 1A3LL 2GCYB 2DQUH 1WCQA 3RX8A 3UPRB 1DBAL 4QRTB 5CEXA 2Q1EA 1IQDA 5FHBL 5KSBE 4G80B 4F37F 1RSFA 3ULSA 4J3SA 2FB4L 3NFSH 3G5VB 4HKBB 3O2DA 2PR4H 3JWOL 3VRIA 4NQCD 2VISA 1CXFA 1IGJA 1YEGL 1C12B 4MXWH 1TTGA 4BZ1H 1BM3H 5F1KC 3FT4B 4RFNC 4Z7WE 4KK5D 1KB9J 4YQXH 3VFRA 4WO4A 2BNRD 3HI6H 3R0NA 1UADC 3ELAT 2Q86B 3SQOH 5IJVA 4Y4KC 1JHLH 4IRSA 2UWEB 4PP1C 1IZJA 2KH2B 1YPZF 1CZ8H 1SJHA 4K23H 5KSAD 5F7YC 5C0RH 3SDXE 1TFHA 1YN6A 4HDIB 3MMEB 2A1WL 2UVFA 3LEVL 3DHJA 1G7QB 2APBA 3LKPA 1FZMA 4QY8A 4HJJH 5MEOB 1T4KA 2C3VB 3IJHB 2VDML 4NC0B 3GI9H 4QXGH 3SO3B 1QD0A 1DN0A 3B9DA 1GOGA 5AUMA 4LQFH 2Y07H 3IDXL 3OKEA 5HHQB 5F6HI 5ENWA 2CIIA 4LLWA 5FM5M 2EDEA 3QUMH 1MLBA 3DOSA 3H42H 2R1YB 2AJZA 2P42B 5F44A 2Y6SC 3IDYB 3HC3L 4OGXH 2BJMH 3NPSB 1ZS8B 5A2JH 4JFEA 3QA3B 3MLVH 3EDEA 2EIBA 3ZKSD 3O8XA 3WFDH 2X4UB 4OLUL 1EO8L 3HE7A 1KIPB 1TCRA 4TUJA 4KVCL 2DQFA 1OP9A 2YA0A 2DI7A 2I26N 4Z0BH 5TQ0H 4YZFF 3S37L 3GBLA 4IS6A 1AFVL 4S1SH 3JWNC 1MQKL 2W0LA 3D85D 1KFAL 1R3LB 4JZJB 1HYSD 1A6WH 4XVSL 1KTDB 4PJ9B 2HFFA 43CAB 3IJYA 1CGUA 3DO7A 4KJQD 2PXYB 3U48A 5MEQA 1F8TL 4FXGA 4P5TC 4OM1L 4PJFF 2ZUVA 3QG6B 1ETZA 2ZP0T 3O9WA 3WFEH 3QJHB 4WFEE 5T1LA 3CFJA 4P4KA 3W0WE 4KI5D 4FFYH 4UU9A 4U3HA 4HZLA 4EXKA 4F7PB 4JN1H 5CAYB 3S88H 1FNGA 2P5EB 3N1MC 4HW6A 2WIMA 4K7PX 3ZE0F 5A43C 4DUVA 2YUVA 3QRFM 4HIHA 1P4IL 3U36B 1Q9WB 2HFTA 1ZGLA 1JMZA 2H1PL 2YK1L 1YEDB 4JM2B 3V4VL 5FCUL 2P5WA 5BS0E 3UO1H 1FZOA 5GJSL 4H8WH 5DT1L 3QUYD 3S5LA 2FECI 1MNUH 5GHWL 3TLRA 3QDGA 2GEEA 4TUKH 2IBZX 2EDXA 3RVVD 3S3PA 3SGEH 2EZ0C 5BJTA 2V7NA 1U8QB 1F4XL 1HEZB 2X4SB 2YPLB 3RIAK 2R0ZL 5AWNL 3P9MA 3L7FB 4RGOL 3QULA 3QXUA 1URLA 5J11C 3VI4F 1F3JA 1QFWM 4G9DA 3TO4D 1I7TA 1RZGA 2AJSL 3G6JB 1P9MA 5C07E 1X9QA 1OAQH 3TZVA 4GQPH 1CDIA 3LV3A 2J3SA 4ZSOE 2ZNXA 1P84J 3W9EB 4OCYL 4WU5B 4M7LT 4F8QA 1AE6L 2FD6H 1XH3A 3PJSB 1WWBX 4U3CA 4OLYL 3MOBL 5DMKA 1KULA 4QRRD 1FVDA 4XH2A 5BVJA 4NWUH 3B5TA 4L4TD 1UKQA 3U7WH 1P6FA 3EYVB 2IC2A 4POZC 1HZHL 1ZHKA 1T0NB 4KJYA 3CC5B 5BRZB 3SE9H 4EN3A 3RFZC 4I0PA 4DN4H 4D0BB 3CLEH 4Z5RA 1LP9F 2YSSA 4I9WE 1YJDC 2QR0B 2MHAB 3N9GL 4RX4D 5FYKU 1OB1B 4RFEA 1ORQB 4NQEB 3QJFB 2NX5B 3GSVA 1WAAF 5JPMA 2NY6B 2RCSH 1W72H 3MV8E 5F21B 5KSVA 4TSBL 1RK0A 1V8HA 4HUWB 2GT9A 3ARXA 4UIKL 1RZ7H 2ICEA 3AGVA 3RTQB 1W8OA 5LKNA 3FO0L 5GZNC 5DD5L 2V2TB 4PJ8C 3VD4A 4NC1E 4AQ1B 1G7HA 1J12A 5ANMA 1RZKH 4JO2H 3SKMB 1UENA 5BXFB 3MRBB 1FSKC 4UAOC 1DFBH 2DQTH 2NXZC 3BJLA 4YPGB 5IJKC 3TCXA 1TCMA 1X5FA 4PRAA 4FTVB 3RRQA 3K74B 1NGQL 1N64H 2J7LA 2Y5EA 3PHOB 2EE6A 3IDUA 1ZHLB 5JA9A 1YMMA 2BXZA 5DFWH 4KKCC 3W9DB 5EBGA 1MJ7H 4LGRB 4PLKD 1MREH 2A6IB 4PJBB 2W65B 3Q6FA 3D3VB 3SGKA 2J8OA 3T2NL 4U6HB 1SYVA 5DK3A 3BD3A 4M48L 1G7JA 4KRPC 4MX7A 1VFAA 5DEFA 5T33L 3BGAA 4CMMA 2X4OA 5IK3B 4XNQB 1QKZL 3AU1A 4LVHC 3OX8A 2NY0C 3NH7L 1L0XA 3T1FB 2LU7A 4WI9A 3QCUH 1YEHH 2IEPA 4UOW0 3THMH 1J11A 3TGXA 4XB8A 4G8EA 2FX8L 4K94L 4ZUUB 3QYCA 4Z7UB 1MRFL 2Q3ZA 5IG7B 4BH7B 2OK0L 2IADA 4HFWB 1FL5A 3NCMA 5DC0A 5H94B 4WWID 2NXYD 4O2EA 5I16B 1FDLH 4U6YA 5J13B 2YWYA 3QI9B 4G3YH 3VXQA 3VWKD 1KLGB 4KK8D 1V3JA 2R0WL 5JR1H 3I6LE 2DJUA 3NIGF 1WZLA 3HC4H 5DQDL 1QSVA 4NHUB 1ZANH 1DZBA 2HA1A 4WEBH 3RL2B 5C0AB 3KNBA 1QQDA 3ES6B 5I71C 3HR6A 4KKAC 1MCRA 5BVPH 4PJCA 3KJ4B 1J0JA 4O02L 3BE1L 1IQWL 2E7BA 5JW4Q 4O58H 4RZCB 4LK4A 3BJ91 1D5XA 3WFBH 4UBDD 1G7MA 1CXLA 1G9NL 5DUML 3C5ZB 4G6FB 4MCYA 5INDB 4K2UL 4KRMB 4ZFZB 1WCBB 1EFXA 1MCLA 4KHXH 1CDYA 2JJWA 1AGFB 3FQUA 5ISZB 4Z8FH 1QTYT 4S0SD 1PJ9A 4GRWE 1M7IA 3WKML 3NCFB 4RA0C 5I1CL 1A22B 2W60B 1A1NB 3V95A 5EZIH 4P2QE 3NZHH 1X4ZA 4W4OC 1E0OB 4GT7A 2Z91B 3P4OB 1JZ6A 1R3KA 5GJTL 1N5AA 4WW2B 3O0RL 4LLYA 4C56B 4NNXA 5DJZB 3FB5A 1BEYH 1CF8L 5EFIA 5LWYH 2FX7H 3FRPG 3L3IA 5CZXC 5D8JL 5H35A 5D2LE 4CVXB 1HINL 1SJVA 3TNNB 4DOHE 4HF5L 3BQUC 2J88H 3G6AA 2AJXH 3MREA 4PYGA 4DTGH 2D7PA 1RIHH 4ETQA 4E41E 3QQ9D 5I73B 3MV7E 1JGDA 5DS8B 2DYPB 1JNNL 3D0LB 4LIQH 2M2DA 3BIKA 4H0HB 4E42A 3O2WH 3UJIL 5JDSA 2X41A 4GKOA 3T2OA 4I2XB 3VRLE 5B8CB 4P9ML 1Q0YH 2BOCB 1UKSA 4HAGA 4MWFB 1L6XA 2D0FA 4J6RL 2SEBB 4Y4FB 4JKKA 5BCAA 3RPKA 2P8PB 4IRJC 4G9FE 2V5MA 3FOMA 4YFLF 4Q58C 1SBSH 3ZT5A 4MLIA 4OB5L 5F1IB 5SWZA 4GRLB 4R7DB 4OCWH 3IDNB 4FQQB 5FYLH 4XNMB 3BAEH 4CJ0A 1NL0L 2OJEB 4J1UB 5EOTB 4CU8A 3ZTNH 1ACZA 4JFDB 4YWGH 4YX2L 5T3XD 2Q20A 4FXLA 1X5JA 3S96B 3H8NA 1RZJH 5J1AA 3UROR 4BFEA 4OZGF 1LK3H 4JGJA 4G6KL 4P3DA 5JQ6L 2WINB 4J4PC 4PJEA 4LQ1A 1HHGA 5DMGD 3ZHLA 1AI1H 2BRQA 3IVKA 3V2AR 5HGDB 4QRPB 5T5FH 3UJJH 1TXKA 2ENSA 2MFNA 4DZBB 3KPLA 3ARGA 5DHVH 3NBNA 4KKLD 3OAZK 4YHZH 5FA3B 2CRZA 4RGND 4QRSA 1YNKL 1EO7A 1U2HA 4U1IB 4HJGB 2EDYA 2EDKA 3WFHB 3BWAA 3F12A 5B22A 3BH8B 3LPGA 1QLRA 4NQSB 4ZFFA 6FABH 4S1RL 1UM6L 3NVQA 4Q2ZB 1N8ZA 1EV2E 4ZUSA 5K9QG 4QF1A 5DYOA 1XZ0A 2R69H 5I1EH 1NBYA 5D6DC 4ODUA 4UOJA 2ILLA 3GM0A 1S3KL 3O2DH 4JHAL 1BD2E 1J8KA 5D7LE 2V5SA 4OD3H 3RWHB 3HG1A 1TZIA 2HRPL 3IDGB 4OGAD 3OJDA 3AREB 1JPGA 3Q6GL 5DSCA 5FK9A 1V5JA 1S7TA 2E9IA 3H2WA 4XNZC 1ZT7A 3IDMA 4O51A 4X0KA 1ZWIA 3CH8A 1Q0XH 2FGWH 4DGYH 4YC2B 1I85A 4XCNA 2GJ6D 1K8IA 2B5IC 3IXTA 2WBJB 1X7QA 5GRUL 4LCIH 4DCQB 5GRXG 4KUZH 4DQOL 2OYPA 5HVWA 5FEBA 1Q9LB 3UYRL 2J12B 5SV4A 5T3ZH 1MFAH 1KENL 2XKNB 1H8NA 4LRNH 2H6PA 5JPNB 5DK0A 4XPHH 1Z0NA 1QBMH 2IG2H 3SPVA 3BP5B 5I1DB 2Y36L 4PJDE 3VG9B 3ILQD 2O5YL 3MACL 2L4OA 1JWUB 4X6FB 5DJCA 3OPZH 3GI8H 1OTUD 3LN4B 3NIDE 3G5ZB 1T2QH 5TE4H 3DWTA 1NC2D 1MHPL 4JY6B 4GXUN 2H8PB 3RDTB 3ZKMD 5EG6C 4CVZA 1CWVA 3DGGA 4JFFB 3CFKA 2YS4A 3U4EA 4XPTH 3PL6B 4PS4L 5GS2H 4JANA 4J8RB 4N0YL 3FT3B 4R8WH 3V0VB 1AO7D 2WQ8A 4R4BA 4PRDA 4MNHB 5SV3A 5EU3A 4QRQB 12E8L 2WWMC 3O9WC 4MJ5A 2DMBA 3HR5A 2IALA 2Q8BH 4JY5L 5IFHH 5DJ0B 5E2TH 1A7PL 3PWLB 5F9OL 2CKNA 3KDMA 5DEGA 3QXDB 3RNQA 4O4YL 3FQRA 2GFBA 4G43B 1IFHH 1MCOL 3DSFL 3ULUH 3UTQA 2ZCHH 4R26H 1NDGB 4MLSA 2GCYA 4WEMB 2D03H 4QRTA 4U49A 2XZAL 5D5MB 4G80A 5C0EB 5J9PA 1WZ1L 1AY1L 3T0ED 3GSUB 1AXTH 3G5VA 4HKBA 4JKMA 2Q76B 3F7PC 3WHXA 5EIQA 5CLWA 4G6AD 4M6ML 5E03A 2UUDH 3KPSB 3NZ8B 5AZ2L 3CU7A 2FJGA 4DN3H 1C12A 4E9LA 3RUGB 2X42A 2AJUH 3L3OA 4NUGH 4JLRA 5HHOD 3FT4A 3I9GL 2IMNA 5TQ2L 1HN1A 3U4BH 2ED8A 5ALCH 4WWKB 5D1XB 1NSNL 2FATL 1TJGL 2QL1A 4U2YA 2Q86A 1XGQB 1HDMB 4YBHA 3BRDA 1NPUA 1HKLH 1QSFD 3QDAA 4G8GD 1K8DB 4GW1B 3DVIA 3VFWB 1T7WA 1KYOJ 2ICWJ 4HDIA 1RZ8B 3MMEA 5HI3D 1G7QA 4BKLA 3BKJH 4KVNH 4V1DB 1MIML 2Z8SA 3IJHA 3ULUF 1WT5C 5D2NB 5I18H 3LEXB 2ARJB 1QSZA 3R1GH 4OV6F 3LQZB 4F37K 5HHQA 3BSZL 4OT1L 4R90L 1TZGH 2R1YA 3UP1A 3U2SB 1BF8A 3RGHA 1FRGH 1ZS8A 2Q8AH 2C3WA 3QA3A 4WFHD 2X4UA 4EN3C 4ZXBD 1ZVSB 5DMIL 1CLZL 1NCCH 4Y19D 3FFCA 3QEQE 4U1SB 1KIPA 5C08B 4KROC 4LLDB 2D7QA 5DHXB 5GIRB 1RZFL 1F6LL 3A6CH 2QV2A 3EGSB 4D8PB 3IFOB 4MJIE 3OB0K 3QDMD 5FGRA 2C3GA 5DD1H 4JZJA 1KTDA 2AK1H 4PJ9A 3MBED 1FGVL 43CAA 4BK5A 1RHHB 2VXVL 2P47B 3VGDA 3DHMA 5HYJB 2H3NA 2CDGB 1R0AH 1XIWD 4PRHE 3WEXA 5D71H 4PY7B 3KLAB 4L3ED 3M1BB 5J3HC 2ZNWA 3QJHA 1VA9A 4TRPH 1NMCB 3P77B 4IEFB 1F4YH 4X6BB 1U58B 5T1KB 5HHME 1FYHB 4OKVB 1VERA 5IMMB 4F7PA 4NJ9L 1S8DB 2JCCA 5IMLB 2P5EA 3GKWH 4U05A 1MLCA 3P4LA 1WIOA 1KIQA 3U36A 4CKVX 1Q9WA 1A7NL 4I8DA 3EBAA 1J8HB 3DXAE 3V8OA 4RMQA 1R5IA 1OGAB 1YEEL 1I3RB 1EXUB 2NR6D 3PV7A 4QYOB 3ZT7A 5C70A 1A9EA 5CJXA 1UB5A 3GMOB 4N1HB 1UWXH 5I8OL 3MFFA 2F5BL 1U8QA 4XC1H 5HI4D 1HEZA 2X4SA 2YPLA 1S7SB 5DD6B 4OSUH 4JN2A 1I75A 5HI5D 3U30B 4XP1H 3HB3C 3MRHA 3HMWL 5DWUL 3TO2B 1VESA 4AL8L 3V5DB 2H32B 3NABL 3Q1SH 3RWEB 4H25B 3G6JA 5INCA 3T0DA 1MIEH 2XTJC 4YBQC 4YO0B 4TPRL 2GUOA 2RAMA 3TBTB 2WM0A 4ZD3H 3HZYA 3GEWB 2P8MA 3W9EA 1JHKH 4WU5A 2DLHA 4FFZH 1JTTA 1JF1B 4U6VH 4N1CA 4Y5VB 3PJSA 2PO6B 3SCMB 2PTTB 4HIXH 2BK8A 4KQ3L 4GAYB 3LPWA 1IAIM 3WS3B 4W81A 1OAYH 4OM0H 2ZG3A 4MVBD 4WV1A 1MCDA 3EYVA 3ARBB 3H9YA 3CC5A 2AJVH 3H9ZA 3VE0B 5L2KE 5KW9H 2QR0A 2MHAA 2DTSA 4OI8A 3GK8L 3AUVA 5C6PB 2EECA 1UXWB 1OB1A 5D9SB 3D39E 1ORQA 4U7KA 4P57B 4NQEA 3QJFA 4UINH 2NX5A 3IU3B 4JFZH 4XPBL 1G9MH 5MEPA 3IFLL 2L0DA 1JF5A 2EEAA 2UZIH 1FO0A 4W6XB 3CSGA 1MFCL 1DDHB 1G1YA 4Y4KD 3RTQA 3SOBL 2V2TA 2DQUL 2EE2A 3QDJB 5EIIB 1MAKA 1QYGH 4KMLB 4XAWH 3K4DA 2F54B 3SKMA 1BJMA 5BXFA 1M71B 2XWBB 3MRBA 3N1PC 4M6NH 1YC7A 1KB9K 5C09D 1MEXH 1AKJA 4JREC 4YPGA 1XR9A 2AXGB 2PR4L 4X6DB 3PE9A 1FNEB 5AZEL 1EMTH 4FTVA 4GMTL 2CH8A 2QQQA 2OQJB 1KJ2L 3D87B 3PHOA 2W0KA 1A6AB 2APWA 1ZHLA 3VG0H 3DRTA 1G7IB 1LO0L 1IC4L 3DMMB 3W9DA 2ERJC 3ZKXC 4BZ1L 1BM3L 5AYUH 2J4WH 2Y6SD 2A6IA 4PJBA 2W65A 5EOQH 3D3VA 5ACLA 2XY1A 1E4XH 3UTZB 3HI6L 1V7NL 1RY7B 4HFUL 1JUFB 4LSUH 4U6HA 3SQOL 4ZO8A 1I7RB 1JHLL 2E7HA 5A40E 2CLVB 2AK4D 3FRPA 1CZ8L 3LHPH 2F5AL 5IK3A 4K23L 4NQCB 4XNQA 1M7DB 4ODXB 2CXGA 1SEQL 5IB1B 3WXVH 4L9LC 1P4LB 5JOEA 1CI5A 3VFNA 4PIRF 1A3RH 4P2RE 2HYMA 4NYLB 4LOUC 5TF1H 3UBXB 5E2UH 1UACH 1WLHA 4KGJA 4GXVH 5DHYB 4LQFL 1Z0MA 1MF2H 2CD0A 3B2UD 1HHIB 2ZSWB 4OZHF 4BQCA 1QZ1A 4NP4H 3ZKQD 4ZUUA 3A6BH 4Z7UA 4BH7A 4XCCH 4HG4K 5IG7A 5IOPB 1E6OL 4HFWA 1I1FB 3QUML 4LVNC 3OKKB 4RSVA 5H94A 1YYLH 3MLRL 2ENYA 5D7JB 5GRJH 4P5KA 4OGXL 3ZE1F 4M7JH 4N5UA 4QCIB 5KSAB 3MODH 2F53D 3MLVL 3QR2A 3H6JA 3QI9A 5IVXB 4MS8C 4MQXC 3O45B 1MPAL 2XN9D 3CDGB 4KRLB 2VC2H 4HUUA 3S36H 4JR9H 4NHUA 3RL2A 1WEJH 5C0AA 4S1SL 3ES6A 4NHCH 3QISA 2XNAA 1A6WL 1RK1B 1UJ3B 3VXUD 2EYSA 4RQQB 1UCBH 1VFOA 4U1NB 4GKSA 3CIQA 1U92B 2EZ0D 3IFNL 2H2SC 3MLPA 5INDA 5E99H 2KBGA 1D7FA 1WCBA 4ZFZA 5HY9B 5IT2H 2CK2A 4JAMB 1AGFA 3ZSSA 5ISZA 1CFSB 1PKQB 4JN1L 3S88L 2ARWA 2W60A 4Y2DD 3OB8A 1XF5A 3E2HB 3R0MA 4R7NB 5K59F 1RD6A 2UYLB 3QNXB 1R24B 2X4NA 2D0GA 4C56A 4WIQA 5DJZA 4B7LA 4H8WL 4XP6H 3AC0A 4OBRA 2NCMA 4GFTB 4TUKL 1NH6A 1T89A 3TBWB 1JPSH 4UQ2B 3SKNB 5L8JB 3UBXG 1MFEH 2DYPA 1CXEA 4GW5B 3D0LA 4POZD 3PGFH 4PJEF 3NA9H 2DKSA 1FFOB 4I2XA 5D1QC 2W92A 5ESVB 5I1IH 5B8CA 3EW3B 2BOCA 4LLQA 4FQLL 3PXJA 4MWFA 4Y4FA 2P8PA 1Q72H 2EDHA 4MJ4A 4OQTH 2OL3B 4HBCH 1OAQL 3LKQB 4GRLA 4WY7H 4FQQA 2VXQL 5HHVL 2OJEA 2XWJB 3P9WB 4J1UA 2VLME 1ACYH 5IV2B 4JFDA 3OBAA 4AENA 2DBJA 4XNYL 1CL7L 1K4CB 4AK1A 3S96A 2WP3O 3MOAH 4RWYH 4UNTA 3KPRE 4MNQB 4NWUL 3ZDZE 1CD1B 3VXRD 3L7EB 2BSED 1GSMA 4FNLH 5AG8A 3U7WL 2NXZD 4IOFC 5C0BE 3PWNB 2WINA 4TOYH 3SE9L 1B6UA 3R4DA 1LWRA 2EIEA 2HP4A 5CEZH 1G6RB 5HGDA 2ZCKH 3MLSL 4QRPA 5FFLA 2G9HB 4DZBA 3UTOA 3W2DL 2B1AL 3PWJB 3BN9C 4NM4H 4KKCD 2HLFC 5FA3A 2RCSL 4NN6C 1W72L 2MKWA 4HJGA 2LAGB 3WFHA 4QHLB 3BH8A 4KRPD 4NQSA 2E9BA 2NY5C 2IPKB 4Q2ZA 4DAGH 1SEBB 35C8L 1SM3L 3VGGA 1NQBA 4JO2L 2VDNL 4QHKJ 3K8MA 5CSGA 3PDOB 3TP4A 4A6YB 2C3H