3FB5B

Kcsa potassium channel in the partially open state with 14.5 a opening at t112
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/metal transport
molecule keywords antibody Fab fragment heavy chain
publication title KcsA potassium channel in the partially open state with 14.5 A opening at T112
rcsb
source organism Streptomyces lividans
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2008-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fb5B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fb5B01
3U48A 3L3JA 3I50L 1ZS8B 4B41A 1PSKL 5JXAH 2OSLA 1A7BA 1JPST 2A6IA 2WWMD 4KQ4L 4CU8A 3KXFD 4POZC 3T04D 2BNRA 1QRKA 4RX4A 4BFGA 1NDMB 4QXGL 1A1NA 1RUKL 3DETC 3HZYA 1J5OL 4OLEA 1IVLA 4F57L 5CWSB 1JI1A 2HTKC 3P9MA 4NCC2 1N8ZA 2NXZB 5ERWB 3IJSB 1LK2B 4GQ9H 1CBVH 3AY4A 2VC2L 4WU7B 1A7PL 3GIVB 5EOCH 1Q9WA 4KMTL 4ZSOA 4JB9L 3EJYD 4OGAC 1FN4B 4ZPVA 4BFBD 4J3TA 5KAQF 5I1KL 5D72H 3BPCB 5EOQH 3QBTB 2AJXH 2M2DA 2Q8AH 3RDTB 4PJFF 2NR6C 1P7QB 4PGDA 3EO0A 1PJ9A 2IQAB 4PLKD 4QHLA 2UYLB 3DHJA 2BHZA 3HE6D 3ILPB 5JNYA 2GSGB 5IBUB 5JR1L 3OB8A 5K93A 3WEXA 4LF3A 2DWDB 3WO3B 3SGJA 1GAFL 4RFNC 1PLGH 5F96H 5GGTL 2MNUA 4L4TB 3O9WB 4M7KL 3WFCH 3DURB 5TE4H 4KJPD 5BV7B 3X14A 4NRXA 4KXZH 3ARBD 1IKNC 3KXFA 3X3GL 3TPUB 4ZYKB 3MLZL 5J8OA 4BKLA 4LAQL 4KUZH 5GISL 2EDXA 4JKMA 3MBEB 1KPRA 3EYOA 2DBLH 4J8RB 3B2VH 1X9QA 4HH9A 3VXOA 4PG2C 1MCOL 2CDGB 3TBSB 2R2HA 3VWJD 3IXAB 5EZOH 4YC2C 3TBVA 1V3JA 1RZIB 3BJ91 2H32A 4HKBB 1AD0A 4I5BB 2IANE 1JVKA 2X4PA 3RL2A 4Y7MA 3U4EB 3FZUD 4KMLB 4X6FB 1I7ZB 3J7HA 3P0VH 4Z7OE 4WW1A 4J1UB 4R96A 3EFFB 3HE6A 4X9HA 1OSPH 5IR1A 1NCAH 1RUAH 5GRWA 2P8MB 3MGAA 1KLFA 4JRXB 4I18C 4PJ8D 3P40A 4XPAL 1CLCA 3WNPA 2EDEA 1C16A 5HYQA 5I8OH 1ZV5A 5EOTA 2IG2L 3LQAH 3QHZL 4PJ9C 3ARBA 3ARDC 1KIQB 5HHQB 1A1OA 1FNGB 4KI5E 3B9DA 2E6JA 1CDBA 5E24E 1HHIB 4ORGB 1CDHA 4LLAA 1ZA3A 3HHRB 5JXEC 3MLVH 4X7SH 1X5IA 1IAOB 3QCVH 2ZUTA 3WLWC 1JK8A 4UOJA 1UT9A 3BWUC 1JF1B 4HEPG 3ZKXB 1IT9L 2W0LA 3IU4L 4NOBA 3SDYH 4GUPA 1HXYB 4FTVD 5F9AC 5IIEB 1ZHNA 4LKXB 5DD0L 1U8PA 4OD1H 3WYRA 4J7RA 5BRZE 4XP6H 4GRWH 3UMTA 5IB3B 5DJ8A 4WUKH 3WS6C 5DJXA 1AHWA 1QFWI 3RTQB 4YZFF 1AP2A 4G80A 4PD4J 1U8HA 3IKCB 4MNGB 3D18A 5INCA 5I1CH 4PJ8A 4OKVB 2NXYD 3UTTB 5D6CA 2AKRA 1ZHBA 1SYVB 4TUOB 1CF8L 4QRQA 3I75B 3FKUS 4GRWF 2ESVD 5DI8B 1VDGA 1T80A 4HLZG 4GW4A 4MD5B 2EDFA 5E94A 4P99A 3UTSB 5HDBE 2R69H 3FHQA 1QLRA 4MJ6B 2I25N 3DO7B 1FZMA 4QT5A 1EHAA 2DLTA 1Z6JT 4LPXA 1IC1A 1ZLSH 2N7BA 5F7HA 3LN5A 3AREC 1S9KC 5KN5A 1OT2A 4AMKH 4Z76A 4LCYB 5T3ZH 2ZNXA 4F7TA 4Y4HA 3VA2C 3WIHH 1R3JA 4FG6C 4JR9H 5DD5H 2CKBA 2ZP0T 3HNVH 4TPRL 4Q9BA 2M26A 1NBYB 4KDTC 1DL7L 3QULA 4LQFH 4ELMF 2IPKA 3U30C 4NKQB 4PJEF 4GAJL 5KSBA 3AS2A 2VB5A 1OQXA 3F7YA 4OLXH 3V4UH 4AENA 4YHML 3MJ9A 5CHNA 4ZUSB 1NUNB 4PV8A 1NGPL 4Y8AA 4TULL 2YA0A 5GS1A 3FN3A 4OF7A 4U6HB 2YUWA 4GMSL 4HAFA 4YDLB 1RZ8B 2DLFH 3KLAA 4WW2A 4F7EA 1B6UA 2ESVA 2HLFD 5FGBC 5IT2L 4M5YH 4ENED 3QO0B 5T1MA 3I3EA 4ZXBC 3RGVA 4NN6C 3JV6B 4FFWD 3MLSH 3HRZB 3N1MC 3QPQC 4PJGB 5DD1H 2VN7A 4AYFA 5F1IB 2AJZA 3GKWL 2ZJSH 5HHMB 5CEZL 5C0RL 2DQFB 4WO4A 1X7QB 1NEZG 2DS4A 2VDLH 2XOTA 3IXTB 2FGZA 2A0LC 2PW2B 4X7CC 4ACPA 2L0DA 2BHUA 1EEZB 2GHWB 4NUJA 4XHQA 4D3CL 1LEIA 4I2XA 3HE7B 4P3DB 4R9HA 4LASL 3TJHC 1NC4D 4DUVA 2YPLE 1ORSA 2AXGB 1QBML 3RVUC 2W9LA 5L7XH 3GHEH 3ZO0A 4WNQB 5MP6H 4KKBD 5T3XH 2NLJB 2BC4B 3GSVB 2K9UA 3CMOL 5ACZB 3BEVA 3GB7A 2WV3A 2GTZA 3RI5K 1Q9LB 2PXYB 5F7UA 1A2YB 5I1JL 1JBJA 4CMMB 3C60C 2OMNA 4IRZL 4XXDB 2HKHH 2O5XL 3QXUA 5EU6E 1A0QL 4PGBB 1FYTB 1HCVA 1WICA 1U3HC 2XNAA 4U3XA 4KZEH 3ZE0F 2D7NA 3RPKA 3IJYA 2DOCA 2BX5A 4YX2H 3QXAB 5F44A 3Q5OA 5EU3A 4XCNB 3G08A 3IGAA 1X4ZA 1RJYA 2BSSB 4QTIH 5MI0B 4BZYA 1GGIL 1WQVT 4OIIH 1D7FA 4HGWB 1GOGA 3G6DL 5I74B 4OCSL 2VDPL 3OBAA 1XGYL 1T04A 1AQKH 4Y5XC 3T3ME 1DN0A 4UIMB 3M17A 3RIFF 3DARA 4D9RD 4WHTB 2SEBA 4G8IA 4Q9RH 1UKTA 1CS6A 3OXRA 3KPQA 3DVFA 1DLHB 4XPGH 2VLJB 3RL1B 1T2QL 1GGBL 3KYMB 1Z5LB 3LPWA 1J05B 1KF9B 5J13B 3GJFK 3QDJA 3BN9C 5IWLC 1BX2B 4W4NA 2VZ3A 2F54D 4MXQC 4LCWE 5D2LB 5KSUB 2CK0H 3FFDB 5EA0H 3FRUB 1FGNH 3GMNA 4M43H 1PEZA 1KB9J 5F70A 3P2TA 1LE5B 1WSST 1VFUA 2BNUA 4Q6IC 3GGWB 3PHOB 1AO7E 4P5MA 4PRNA 1WFOA 3HNSH 3VFSA 2G5BA 1QLEL 4YBLB 2OL3H 4OZGB 3NIDF 3WDJA 5IESH 3D85B 1F6LL 5A3ID 4H0IA 3QFDB 4JKPL 2J8UA 3DUHA 3ZKQD 4C56A 4L8BA 3SN6N 5I8CB 1G7IB 1HH9A 5IVOA 2C3GA 1UKQA 1FL3B 4HKJB 1IAII 5I9QC 2ICES 4HIIB 4GAYB 3MGOA 1VB9A 3LN4B 2F54A 4FXLA 4I77H 3MJ8B 3P4OB 4MCZA 4R7NB 5C0BB 3MMEA 4L1DA 1CT8A 3GRWL 3IF1A 1KG0A 5BVJB 3PHSA 4XVTL 5IJVA 2NY6B 1BF2A 1CL7L 3R0NA 3C5ZC 5B39A 1IILE 2RHEA 4CN6A 3B9AA 2X4UA 5JHDD 2W0FA 5C0AB 3KS0H 4ONFL 5FYJE 2J4WL 1KEGH 3D1MC 4YBHA 1FORH 2DF3A 2CUHA 2D4DA 3BZ4A 2W9DL 3RKPA 3B5TA 2D4FA 3MRFB 4ODVH 4I3SH 4B53A 3MRGA 1K6QL 1CFSA 5DRXA 4NQSB 3WO4B 4HUKB 1RZGA 2NY4C 3V6OC 3ALWA 4WWKC 4NO0B 5E2UH 2X4RB 3D69A 3LQAC 5A40E 1OLLA 2OTWA 3E8UH 3T8XA 3GHBH 3QI9B 5F72S 5ICZB 5IBUG 1DBJH 4NHCL 3GSRB 5CSBA 5GGVH 5TPWL 4NM8L 4O2FB 1AXIB 1TJHH 1NBQA 4H1LA 4WHYH 1RK1B 4H26A 2ICWI 3K1DA 2H3NA 2L7JA 4YHIA 4PREA 2H2SD 1EBPA 1P6FA 1FO0L 1IEAB 1Z3GL 4E5XA 2WP3T 2LVCA 1JZ5A 4Y5YC 4MJIE 5JHDA 1NGZA 3W11D 5KS9E 3KPNB 3WHXB 4QRRE 5F7LB 5IMLA 3MRMB 4JREC 4N90E 5GRVL 5JDSA 2NY3D 5CAYB 4RDQF 1UJ3C 4M6NH 3X11B 4U1IB 3IFOA 4RGNE 2CIKA 4OGXH 1MF2L 1U93B 5DJZB 5KANG 3QWRD 3TBWA 1M4KA 2NY0D 2R2EA 4S1SL 3PNWA 4XCCH 3VWKD 5EC2B 2FSEA 4DW2L 4S1RH 5CILH 3FCTA 4YHYB 5JO5A 4Q9CA 2YRLA 2FIRT 2ZSVB 4NO2A 3G5ZB 1NC2B 2F8XC 1JNHA 1ONQA 3T0ED 1A64A 3K80A 1IC7H 1T2JA 4JKLA 2VR9A 4J4PD 3TZVB 5C0EA 3GMLB 1DDHA 1V7MH 2MMXA 1RSFA 3KLSA 1HSBA 4X7TA 3GI9H 3QPXL 1IMHC 3ARFC 4M8QB 4G7VH 1FNSH 3BHBB 3QEUA 1TIUA 4QKXB 5FM8A 3MXVH 1KUMA 3RNKA 3I9GL 2FD6H 5HHPA 1ZHLA 4JN1L 3E6HA 2D0FA 2NX5B 3QUXD 4PJHA 5FGCB 5AUMA 1RZKH 5C08E 4JQXC 4LHJB 3CSYB 1SM3L 3F7VA 3S3JA 2Q86A 3LV3A 3BQUC 1DSFL 2F74B 3TO2B 3SDAD 3GSNL 3QWRA 4B7LA 3BXNB 3OGCB 4FOMA 5LCVL 3C5SB 1AGFB 4KJQC 3PXHA 2O26U 3OB0K 1OGAE 1RIHL 1KIRB 4OD3H 1C08B 3L1OL 3NIGE 4KTEL 4Z7VF 3S96B 2P1YA 2B39A 3V5DA 4OFDA 5AZEL 1DBAH 3QFJD 1ACYL 1NKRA 3CXHJ 3MA9H 1SJHB 3REWB 3SDCC 4XP4L 1S5IH 2XWBB 3EYSL 1V5JA 3GIZH 1W2KT 1YMHA 4HUWB 4N1EA 1CXIA 1KCVH 5CSZA 3AFLA 4L1HA 4V1DB 3OPZL 2FDBP 3IVKB 1A6UL 1MEXL 1YNLL 1NFIB 4I4WA 1LDPH 2XZAL 1A6PA 5FCUH 2MKLC 3QUXA 5FO7A 4JPWL 1CZ8L 4O02L 2B0SL 4KRNA 4UTBH 3KLHC 5C0FA 4BSVB 3RI5F 2VKXA 2DQDL 2A6DB 5F7EL 3RX8A 1NEUA 1OAUH 1L7TH 1T7ZA 3BZFB 3QZWA 4Z0BH 1KGCD 3EOTL 3L7FA 5F7FA 4OCLC 4R3SA 2IH1A 3OF6A 1LD9B 1LE9B 2GUOB 3VRJA 3RUGA 1P4IH 3CFBA 4EI5D 2GQHA 2IH3A 3OKDB 5C0IA 4K3HA 3O3BB 5I8KL 4JFZH 3MV7D 1T7XA 4PFEA 2JJTA 4JFOA 3EOBA 5C09B 3UJIH 1WEJH 3E3QC 1V3MA 3IDYB 4MGXA 4XI5C 4CGTA 1OP3H 1EBAA 2QQNL 4OI9A 3GJFH 1G7PA 1N7ML 4YBQC 1F11A 4GBXD 3EDEA 5IW1B 4MQXC 4X4YA 4Y4KC 1ZT4A 4IRSD 4PUBH 4QNPF 2VAAA 1XGRB 3NH7H 1UXSA 2H32H 1NAKL 1KIUA 1XCQB 2BOBB 4XCYA 1NCWH 1YECL 4OCMC 1KPVB 2FECI 3UC0L 3WKNA 1CD1A 3BH8B 1OW0A 5F3BA 1JTPA 4NZRL 5ICXA 4B50A 3V0VB 2J1KA 4XGZB 3P4MB 3D3VE 3NCCB 2A74A 4G8EB 2KZWA 3MRCA 4OLUL 2FATH 5L88L 1XZ0B 1JFQH 1TDQA 2BRRH 3H8NA 4EI5A 1H15A 3I3BA 5DC0A 1QBBA 4FQ1H 2OLDA 1W0WB 4MWFA 2DTML 4WJ5A 3MCKA 3BUYB 3QIUC 3MV7A 5GGTA 4IS6B 3RZCA 4NFCA 3I85A 2WUBH 4XP9H 1X5XA 5EBLB 3RQ3A 4NT6A 1U9KA 3ZL4L 4KK5D 5ETUB 4G9FB 3F5WB 3AM8C 3U7WL 5FB8A 3P4NA 1QZ1A 1ZAGA 5F9OL 4BQ8A 3ARWA 4XZUA 2W92A 5D2NA 2YK1H 1HHJA 2VLKA 4J23A 5LGJA 1NGWB 4GBXA 4DVBB 2DWEA 4RNRB 1NH6A 1BJ1H 3IS1X 3IETA 5SV4A 4LCCC 4IRSA 4LU5H 1E4XI 1GVIA 3SE3C 1MQKH 2GJ6D 4E9LA 3T4AA 1FFPB 5DT1H 4M6ML 4WEBL 2JIXD 5TFSL 1WFTA 3TIDB 5HPOA 3BESR 1GCFA 4Z5RA 2Q1EA 3MV8E 3UTOA 6CGTA 3RNQA 5C2UB 3V7AG 4YZFE 1UKSA 2DMBA 1ERNA 4UOW1 3WSQL 5BV7L 3MJ6A 5E8NA 1C12B 2JCCB 5JDJA 1R5IB 3LKPB 4N0FA 5TDNB 4KRPB 1A6TB 5IFHH 1G0DA 4WFFE 3QUZC 1RZ7H 3C5JB 4KY1H 4ODTH 4UT6L 1WAAE 4ISVB 1NGXB 2APXA 3O6FD 2WQ8A 1FVDA 2X89A 3X17A 5GGQH 2DJSA 1E28A 5AWNL 1X3DA 4M6OH 4PRHE 4Z78A 3L9RA 1MJJB 4I13B 4NM4H 3DTXA 1XIWB 2VH5L 1R24B 4U1JB 4KK9C 3OAUH 1N6VA 4X9BA 1B0RA 1Y6MR 1CDIA 3NOIA 4Y4FA 2JJSA 3S37X 1ZSDB 1WBZB 4NNPH 1S3KH 3O0RL 3GBML 1HINL 1J7VR 4LFHD 2Z92B 3JV4A 4JPVH 3TT3L 1I4FA 4PTTA 3RZWA 2WW8A 3TYGH 4JFXA 5JPMB 2GJ6A 5IVXF 2W38A 4AZ8A 1TQCC 4ZUVB 2CKBH 2JIXA 4ELME 3CDYA 4X0KB 3WIFB 1QSED 2R29L 3C8HA 2FRGP 3L5XL 3MRBB 5DHVA 5L0QC 4P46C 5I18H 5JLZA 5D7IF 4HDIB 4PJAA 5T3ZE 4RMTA 3NIFE 5BW7C 4NN7C 3SCMC 1OWRM 1A6AB 2D0GA 3IDIA 2J8HA 1FAKT 2GTWA 4M61A 1A02N 1HYSC 5DXWA 1NFDB 5L2KD 4H20H 3NFSH 3N85L 1CFTB 1KLGB 2C7UB 3TC9A 2PCPB 4KHTH 5FDYA 2OX5A 3KPRB 4LSQL 3KYNB 1J86A 3HMWH 2Z4QB 2AK1H 1S7RA 4U1NB 3S97C 2AXHA 2EO9A 2P5ED 3RP1A 4R26H 1EZVY 1IC5H 3MLYH 4X98B 1G7QB 1E4KA 1HHGA 1TQBB 4OZHA 3HUJE 4U05A 4H8WH 4I3RH 1QVOA 1IQWL 1CGWA 5CEZD 1VERA 3HI5H 1ZGLM 3VI4F 4GLRI 4JCLA 1B90A 1AR1C 1QSEA 1WTGT 1FZKB 5EU4B 1MCCA 4NFBA 3R06A 4G9DA 1PYWB 4O51B 4LLUA 4HLJA 4L8CA 5LWYH 1GGCH 1FRGH 4HCRL 4G6ML 3OSKA 4IOIA 5D1ZD 1II4E 3S4SB 4BZ2H 3MRHB 1MI5B 3VW3H 4EKXA 1F3JA 2Z0BA 4P4RA 4HBCH 4JO3H 2HMIC 3C6LA 5K9QI 3RPIA 3R0MA 5L2KA 3LRSA 1NDGB 2HH0H 2DQHH 3OB0H 4GRLD 4JZJA 5CGYD 1A7RL 3D2UB 3U1SH 5ESAA 2IAMC 4K9EH 4PTUB 5D7LE 1QHOA 4WY7H 2AXFA 2E6PA 4HJGB 4ONOA 5CEYB 2VE6B 1TENA 2Y25A 1RZKC 3OGOE 2P5EA 3WNOA 4NQEE 3VJ6B 5C7XL 4AT6B 1DFBL 3E2HC 4QY8A 2N4IA 1UACH 3L6FB 4RA3A 5KW9H 2HFFA 5SWSD 5AAMA 4X6DE 2PO6D 1PG7W 2PW1B 3O4LD 3CCHB 3HFMH 1MVFA 3VD3A 4EVNB 3U9UA 3EUUA 4OCWH 4O58L 4PBWD 1YEKH 4OF6A 3C6SB 4LVHC 5C0DB 2R0ZL 1NBZA 2PYEB 4XXCA 3ARXA 5DMKA 4D0DA 5DQJB 4WUUB 1M71A 1L9NA 1UEMA 3I6LE 3O6LH 1G6RB 3EAKA 4HS6A 3STLA 1F45A 8FABA 3EKCA 4GW5A 2XZQL 4GRLA 3AY4C 4ZUTB 4XHJC 5LBSL 4IRJB 1BQHB 4UT7L 4NKDB 1EO7A 4Y88A 3SJVB 4OLYL 4CKVX 4CJ1A 1MCPL 4KRMB 3UZVB 4GQPH 2Y6SC 5DVNA 5ESVB 2XQBL 5CD3A 4RFEB 4Y1AE 5D5MA 2FJFB 5ACMA 3NN8A 1JWUB 1P4LB 4YWGL 4ZO8A 3DRQB 5DJDA 3P9LB 1V7NH 4UBDD 2PO6A 1DEEA 1NAMB 5FF6B 5JW3L 2QADD 4YEFA 3V79C 3KNBB 1SJVA 5E99H 1KFAH 3B6SB 2YKLL 2BNQD 4P4KD 4U6YA 3SGJC 4RZCA 2ICEB 1ETZA 1OB1B 4HKXB 4G8GB 2VAJA 2OXGA 4L8SB 5ECJE 3OKKA 3MRDA 4G8FA 4M9OA 2ADJB 1GHFH 3GMPA 4HXAL 3I2CL 4R0LC 1MNUL 4LPCA 1R0AL 5EO0A 2Z35B 4TSBL 3U36A 2J8UF 4QYOB 1BBJB 3LKSA 4PJ7B 3KYOB 1BJMA 1XGUB 3QUMA 4Z7WB 1JZ7A 2YA2A 3K4ZA 3ETBF 1MFAH 4M1GH 4AEEA 2G75A 2OK0L 1HI6B 3HLAA 3QYCA 4OQTL 3EJYC 1ZE3C 1YMMD 5H35B 4JG0L 3CGTA 3DJ9A 1TCRB 2P7TA 1RY7B 2Y36L 3HTLX 2EDQA 1VEOA 4QHMB 3H3BC 1A7OH 3DX6A 3MRQA 3W0WB 1MJ7L 4Z8FH 4G7YL 4H5SA 3HCVA 2AW2A 5E1AB 4Z7UB 3FN0L 3VI3F 4K07A 1KCUL 4PLKC 1CTNA 5DK2B 3HE6C 4JRYE 4XX1E 1AE6L 4NUGL 2G60H 5ESQB 2Q8BL 3HNTH 3IDNB 4X4XB 1J8HE 3HG1D 5L6YH 2Z31B 1L7IH 3RY5A 1DQML 3F62A 5KSAB 4MAYB 4LP4A 2E27H 2XWTA 4L3CA 1CDCA 4W4OA 3ARBC 1WWCA 4NCC1 1XAUA 5E4EC 1DQJA 1OF2A 2E7CA 4H1LH 1U8IA 4OSUL 3I6GA 4YPGA 3EJJX 5CBEB 1I75A 2MCPH 3ESVF 3K2UH 1ZEAH 5F1KC 3WD5H 1MHEA 1CLOL 2UWEB 4ZO7A 3GUTA 4P2RE 3D87B 2APWA 4NKOA 2JK5B 2OS7A 1ZANL 4UV4H 1J9CT 3CX2A 3VWJC 3AGVA 5D9SA 3SDCB 5IB5B 5FKAA 1JF6A 1YMMA 1QACA 1UB6B 2C26A 3MCLL 3RWEB 5I76B 4BQ9A 4HFUL 5E9DD 1IGYA 4O2EB 2CMRL 5D7SL 2X70B 3HB3D 3FZUC 4DZ8B 3NZHL 3O2VL 4XTRD 4DGVL 4ZAKD 4TUKL 3ZSTA 2NW3A 1NMCC 1DQQA 1OTSD 3SKNB 5DD6A 4PJ8C 1KTDA 2I60L 1FLRH 3RAJL 1BD2D 4NO5A 1DE4A 1N5YH 3BKCL 3VMOA 4JFHE 4KTDH 2UY6A 4OB5L 5C0CD 1J12A 1LO5B 1KXTB 5FA3A 4ETQA 3NGBC 3MYZA 3FRPA 4GKOA 4WI5A 1KBGL 4BJLA 1XF5B 5DD3H 5EBWA 3L5WA 4ZQKB 1MRFL 4M7LL 2VZ1A 1YA5A 2BK8A 3PWLA 2OTUB 1YYLL 1HZHH 2BCKA 5JUEL 2YD4A 5DWUH 2C4XA 5E9DA 4YK4C 1LQSR 4X5WB 4NOFA 2AQ1A 2X4NB 2F53B 4OFVA 5D1QB 1NMAL 3EZ8A 1OAZL 1W8OA 3R1GH 3WE6A 3X12B 1IM9B 1CVRA 4ZAKA 2EKJA 3HAEG 5DZNA 3PE9A 5JQHC 2F8VA 4MXWH 4YXLH 4JFFE 5J4MA 3KPSB 3P11H 4Z7VE 4BFIB 4ODHL 3ROLB 4MDJB 5DFVC 2NXYC 1LO3L 2HT2D 3GM0A 1KNOA 4K55A 1BD2A 2F9BT 2J2ZA 2VXSL 1PVHA 3I6KB 1FAIH 4LLYB 2DJUA 3L3HA 1N6UA 2DI7A 1MCQA 5C0CA 2IFFH 3ARYA 3MO1A 1JN6B 2VYRE 3BSZH 4RWYL 5F9DC 4P2OD 4QWWD 5E2TH 3TNMB 1A4JB 1GH7A 5ADOL 5I75B 3CLEH 3HMXL 2C1OB 5D93B 3QUKA 2APVA 1PDKA 4FFZH 4XP5L 1QHPA 3HR5A 4G6JL 2APTA 4H8WC 3LS4L 3MODH 2BNRE 1EIBA 3VE0A 5SWZB 4GSDH 1RJZB 2EE3A 4MZ3A 3RJQB 1JGUL 4WTZA 4JY5H 1IGCL 4C59B 2DQCH 1YNKL 2DYPD 4KTYA 3KWWB 1J1XH 4OZIB 4X83A 5I16B 1CXLA 3HC3L 4XNMA 3BOVA 4X6CA 1QRNE 3VCLA 4Z7NE 3PQYD 5E6ZA 5IFAH 1C5DA 2EICA 3Q6GH 1T0MA 4JFPA 1MRDL 4RMRA 5DRNA 3IRZA 3BT2H 4Y16B 2D2OA 1M6OA 1NGQH 1S9VB 4EOWH 2AJ3B 2HLFC 3I50H 4ENEC 2FO4B 1JWSB 1W0VB 1SEBB 1EJOL 3D39E 4K9EC 4P2OA 3QQ3A 4KQ4H 4ZDHA 1TZGL 3BI9X 4ZTOH 4X5XB 4D0CB 2CLZA 2VQUA 4QXGH 3CH8A 5DUBB 1RUKH 1SY6L 1T83A 3RUGF 5LQBH 1U8JB 4NQCD 4NQVB 1KENH 4F57H 4J3VA 5GRYA 2E8ZA 3VXMD 4QNPE 5IMMB 4JG1L 4V2BA 4KC3B 2VC2H 1A7PH 5FECB 4KMTH 4FMKA 4HXBL 5CJOL 5DMGD 4JB9H 4KROB 2DYPA 4MHHI 5EFIA 3HS0A 5DJ6A 1YEDA 4MDIB 4IIQB 1P7KA 1YEGL 4X9IA 5I1KH 4MD4B 1XR8B 4U1MB 4F2MB 4JDZA 4NBXB 4PRAA 2NNAB 1CGUA 1MCBA 1Q9OA 4HV8B 4PP2A 3PQYA 5HY9A 5J11C 2H45A 3DNKA 1X44A 5JR1H 5DHYA 3JV5A 4LLMA 1GAFH 1UXWA 5EG6C 5EBMA 1T20B 5GGTH 3VXSB 2Q7YA 2NXZD 1HKLH 2BVTA 1UA6L 4GKSB 2AEQL 1KLUB 1CXFA 3QH3B 3X3GH 4NQXB 3MLZH 3QNZB 2C3XA 1CFNB 4HKZA 1FBIL 5GISH 4NQCA 3SQBA 4YIQB 3FB5B 2Z93B 4LOUD 5IK3B 4FN0A 3FL7A 3DSNA 4NC1E 5C6TL 4WFHE 4YHPA 5IOPA 2B7DT 3RDTD 1MCOH 4P9MH 3V4VL 3V9FA 43C9B 1RZFL 5GIRB 4WFGE 1U95B 4HX1B 4AIXA 1Q8MA 3UZQA 4PD4K 4Q2ZA 4OCNC 3MREA 3QQ9D 4JFQB 1DVFB 5TGBA 2VABA 2WLZA 4OD2B 2R4SL 3T77B 1INDL 3T2NL 1ZGLB 4L4TD 1YYML 3O9WD 4Y89A 3TH4T 3ULUL 2F5BL 4HUXA 2ZPKL 4ZO6A 1T1XB 4XPAH 4KXZI 5CWSA 2ICWA 1UZ8B 1Z0NA 3MBED 3BP6B 3VGBA 1LK2A 1LO2L 2IG2H 1D5ZB 3WUWB 4WU7A 3GIVA 3QHZH 1FZOB 2K1MA 4PRIB 5IMKA 3JBG7 5D1XB 1JGDB 1RIVL 3B5GA 2W1NA 1FN4A 4WVRA 3U83A 1WFUA 4BH8B 5BCAA 1BQHG 5A3IC 1KACB 1X5KA 4DCQB 3UYOD 1V3KA 3RDTA 3ARZA 2DQJL 5J6HA 1FVCB 1BPVA 4XNYH 1UVQA 3C09B 1YJDL 1K4DB 2IQAA 4MNQA 3E1F1 1IFHL 3IU4H 3ILPA 2GSGA 4AIZB 4JRXD 5DD0H 5DHVH 2DWDA 4NN5C 5DJYA 2IANB 1ZT1B 4JLRB 3P77A 4YNYA 1KJ2A 1J10A 2VITB 4L4TA 2FBOJ 3L95B 4FZ8L 3DURA 4L3EE 4TN9A 1X6LA 1IC4L 1MH5A 3BPOC 4ZYKA 4YDIL 2DTSA 4RQQB 4NDMB 3QIWB 1U8NA 1FFNB 5KSBE 2GJJA 1F4XL 4XPTL 3MBEA 5FO8B 5DJCB 4FFYL 4J8RA 1CF8H 1JYVA 3VDCA 5B38B 2CDGA 3TBSA 3IJHA 4BH7A 4PJBE 3IXAA 1H3XA 1MREL 5CEXB 4I5BA 1BQLL 2VZTA 3B2UD 4LLWB 1R3IL 3EYVA 4OZFB 3U4EA 2WINB 4X6FA 1I7ZA 3BIKB 4K8RL 2P24B 5INDB 3CVIL 4PBVC 2ITCA 5CS7A 3RTQD 1HOCA 2P8MA 1B6DA 5GGRY 4TPRH 1E0OB 5ALCL 3KDMB 3RWDB 4RWHA 3V52L 3B8YA 4RGOL 3WJJC 1DL7H 2EDHA 5EIIA 2IEPA 4CADB 1UYWH 4OF8A 4OZHF 2FYYB 5BRZB 4M7JL 4I2XE 4KPHL 3M1BB 4YHMH 1KIQA 3NPSB 5DMIL 5HHQA 4FXKA 1BIIA 1NGPH 2B4CL 2H2SC 3MJ7B 4JHBA 4TULH 3REVB 1YNTA 3UTSD 4UU9A 4ZS7L 2PUQT 3QP3A 1HHIA 3PP4L 4GMSH 1QFWL 5I1DB 2KKQA 3W11C 3MR9B 1IAOA 4FQJL 4JJHA 2ATPA 3EDFA 1JF1A 3BGFB 2PTTB 2NY3C 3VFTB 5IIEA 4LKXA 1JYWA 2Y06H 4OI8A 1FCGA 5DGRA 3GKWH 1HE7A 5CEZH 5C0RH 5IB3A 5F88B 4QRPE 2X9WA 3VWKC 4D3CH 3LDBB 4UAOB 1TXKA 5TE7L 2YA1A 3RWGB 4LASH 1QBMH 2A1WL 3HC0A 5BMFL 1NBVL 4BYHA 1MFCL 1I9EA 3ZTJG 3CMOH 3T0EC 2GW5A 3I75A 4HCRA 1KB9K 4J4PC 5DI8A 5I1JH 1AXSB 1U91B 4IRZH 2O5XH 3RWCB 2BRQA 4F7CB 2X7LB 3GEWB 5FDWB 3K4DA 1R5VB 1EEYB 2I26N 4PJCF 2COQA 2NY2C 3QDJE 5HHMD 3X13B 2DI8A 5GSVB 3PWVB 4CW1A 1JTOA 2KUTA 1K8IB 4OLZL 4LVOC 4LCIL 4HZLB 3HE7D 5C3TA 2MSPA 4DN4L 1IE5A 3QIBD 3SDAC 1DANT 2H8PB 4Q6YA 1BM3L 1GGIH 3LPGA 3G6DH 1MCWM 4HJJL 4OCSH 2VDPH 1XGYH 2N56A 1A14L 2PXYD 4YHZH 2X41A 2ZUQB 4Z7QF 2ZKHH 4UNTA 1AIFB 1BZ7A 4X4ZA 4POYA 3QQNA 1T2QH 3MRPB 3THML 1TVBB 3D0VA 3KAAA 1UM4H 5EUOF 4C56E 4QEGA 2IMMA 3BYYA 3UCRA 3JV6A 3T1WA 3HRZA 5TJWK 1UFUA 4JDTL 5EU6B 2K7QA 1QA9B 3KPTA 5IQ9B 4X80H 2XFXA 2DQFA 3CLFL 1X7QA 5B4MD 2F54E 4AEIL 3IXTA 4APQD 1MCWW 5DC4B 2PW2A 4XT1C 5DYOA 2GK2A 3HE7A 4P3DA 1DJSA 2AXGA 2EYTB 3QIBA 4R2GB 3CSBA 1QLEH 4AEHH 1OAKL 2XACC 3CFDB 2NLJA 2VLJD 3GSVA 3GK8L 3PDOA 5ACZA 3VGFA 4JKPH 5H37H 1PZUB 5C3LD 2PXYA 5GS0L 1A2YA 3MRKB 4EI5C 4NQUA 5GRZA 1G6RL 3G04A 4XXDA 4JCMA 3TV3L 4PGBA 5IMOB 2YD8A 3DGGA 2Q76B 1QKZL 3QWQB 4U1GC 4F8QA 3TCXA 1F4HA 4LDLB 1FNAA 3KPOB 1VFOA 3ZDXF 3FQTA 1BFOB 4ONGH 5D2NC 4XCNA 3GRWH 1EVTC 5LAXA 3TO4C 4LCWB 3WN5B 1SQ2N 4XVTH 4KKAD 3N9GH 1CL7H 4L9LA 5DLML 3QEQE 1O7VA 3SHSA 4YJZL 4HGWA 3TN0B 4WI9A 4APQA 1NAML 3D85D 3LS5L 2VDRL 3RWFB 4UIMA 3Q5TA 3ULVL 3TBYB 1AO7B 4U6XB 4HWBA 4LVNB 35C8L 3KJ4B 1DLHA 1H5BA 5B8CB 2VLJA 4PG9A 5ALBL 4QXUL 5D96C 3ZE1F 32C2B 2W9DH 3K8LA 3KYMA 4JEGB 1F5WA 5E95B 5JOFA 4K2UL 1XF4B 1J05A 2MHAA 1K6QH 1TNMA 1M7DA 2M1KA 4F7PA 5FKPA 4HLZH 4ETYA 2E9IA 3PGDB 2GAZB 3AS0A 5FM5M 3DBXB 5C0BD 1G7JB 4PB0L 3FRUA 2NYYD 5HYJA 1CICB 2NY6D 2D7TH 2CLRA 4KK5C 2XV6B 3C8KB 4U1SB 1RIUL 4NHCH 1NKOA 3PWJB 1FP5A 3GGWA 3PHOA 5TPWH 4NM8H 5C0AD 5T33L 1EO8L 5HVHB 1IAIL 2X9XA 4U3CA 3DLQR 3UJJH 3C2AL 2BSTB 4FP8L 4HS3B 2KQMA 1MCKA 1EO5A 3OJDA 1FO0H 1QSVA 1Z3GH 4HH8A 3CPLB 4OZGA 2AJVH 2YWZA 5HPMA 5DJ0B 5F9WC 5FUZL 1V8HA 5KG9B 4O5LL 43CAB 3MLTA 4QXTA 1QLFA 1EGJL 3JVGC 5GSRB 4U1KB 1A6WH 1G7IA 1K2DA 4PRDB 3JTTA 3U7AA 2NY5L 3FFCB 1FL3A 1OAXL 3DUSA 4IMKC 4HGMA 4JVUA 4HIIA 2D0HA 3CXHK 3QI9D 3B3IB 4PJHE 3FO0L 5H2BB 3MJ8A 4FNLL 4I48B 4R7NA 1BOYA 2ZSWB 5C0BA 4DW2H 3FT2B 3U4BL 3O6FC 2FH6A 3OZ9L 3VFUA 3PDGA 3ALXA 2ZNWA 5J1SC 4JAMB 2D9CA 2B5IB 4DQOL 1OARL 4K7FB 4M5ZL 1MHPL 2Y5TB 3S35L 1RAMA 1YEFH 4LHUB 1HXMB 2LTQB 1E4KC 3ZMRA 3QPXH 3WUWG 1AGCA 3L3GB 4MJIB 3MRFA 4JN1H 1GJIA 1G6VK 4HIHB 1P5UA 4LEXH 4Y2DB 3DHMA 4CRPA 5KVFL 5EC1A 1SM3H 3CZFA 4PLOB 3PL6B 4KJWD 1DSFH 2X4RA 3GSNH 5ICZA 3LKNB 3QI9A 4JN2B 4M1CC 5DS8B 5LCVH 1EFXB 2BERA 5IBLD 2NMSA 4O2FA 2OQJB 4KI1A 1RK1A 4GOSA 5HBBA 3L1OH 2I5YL 4KTEH 2XICA 3TZVD 4YXKH 1KOAA 4JZJC 2X9YA 1XFPA 2XKNB 1ACYH 1IEAA 5C9JB 2N1KA 4CU7A 1T2XA 1UZ6F 1BGXL 4JE4B 1A3LL 3RUGE 4XP4H 4WEUD 4LEOB 3VXRE 2R0KL 3DECA 3MRMA 2XTJE 2NX5D 3HMXA 1EEUA 5D7JB 4ZUUB 1E4WH 5B38G 3OPZH 3X11A 4U1IA 5EO9B 1TVHB 3KPPB 1JPTH 3GMMB 3H7LA 3MLXL 1A6UH 2VL5A 5DJZA 1YNLH 4OT1L 1N3NB 4PJDB 3QAZC 1KTKE 2QL1A 3DMMB 1CZ8H 2YC1B 2IADA 4OZFG 2B0SH 4K3EH 2LVEA 2ERJB 5D1ZC 3GSWB 5C08B 2AV7B 3O2DL 2DQDH 1LDSA 4MS8D 2YUXA 3V6ZB 2BVQB 1D5IL 2ZSVA 1MUJA 3EOTH 3TGXA 4XXCC 4BUGA 3G5ZA 4I0PB 1QFPA 2IPUG 3QNXA 5MERB 2R23A 2WBJB 5HI4C 1W72B 3TZVA 3GMLA 5CGYC 1OGAB 1LP9A 5KTEL 1WK0A 5GGSB 2Z91B 5I8KH 4V1DD 3DGCR 25C8H 3MROB 3BHBA 1IKNA 3MOBL 4IHOA 3UYRL 1AJ7L 1RHHB 2FNBA 1BVZA 2RGSA 3H7BB 4P2QD 4XVUC 1M7IB 3P4LA 2ZCLH 4DWHA 1LEKB 1SVCP 1R6VA 1SY6A 2XWJB 2JKXA 3CSYA 3W5MA 2PO6C 2F74A 2P8LB 3OTTA 5EU5B 1MVUB 1QSFD 5GJTL 4F15B 1JZ8A 2GCYA 4S1DD 4OFIA 1NAKH 4QF1B 5F89B 2VLKE 3FOLB 1YECH 1VACB 1A5FL 3UC0H 1C08A 3FT3B 5CSGA 3HR6A 1C5CL 2D31B 4NZRH 5K9QG 3GJEB 4X6EB 4UIKH 2R2BB 4J12A 4B5EA 1GZPB 1SJHA 4OLUH 3DV6A 5DQDL 5L88H 4I18A 5C09D 2XWBA 3ULUD 1NCDL 4PV9B 4HUWA 1YY8B 3QDAA 1JYNA 3VFPB 1MLBB 3QRGL 5BZWB 4V1DA 4MAUL 1RJCA 2VR5A 3ZL4H 2V6HA 3DUUA 1TJGL 4P2QA 1NFIA 2GY5A 3VH8A 2NPLX 1P1ZB 3U7WH 1VGEL 5F9OH 1KPUA 1YN7B 2J6EA 3LKOB 4XH2A 1CR9H 1YPZB 2DJ4A 3GO1L 5F6HI 5FYLL 4BSVA 3CXDL 4LRIC 1U8MA 1S7XB 2QADC 2X5PA 3NCYS 1QSFA 2X1WL 3BZFA 3VRLF 4P4KC 4WI6A 3K74B 1LD9A 5HHNB 3A0OA 4WEBH 2GUOA 4EUPB 1EH9A 3F6IA 1EDQA 2F58L 3V95A 1U42A 4W4OC 2O5ZL 3B9KB 1FDLH 4BK4A 1VADA 5EWIL 5ILTL 3GMOA 3UO1L 4LNVA 3BPNC 5BV7H 1JPFA 3QG7L 5KJRL 3D3VB 5EU7C 5C09A 3W9DA 5JIHA 5JW5A 2DMKA 3OKEB 2EDJA 2J7LA 4G9FD 4Q58C 1S7WB 3SKJL 2A73A 4PJAE 2DM7A 2V5SA 4X9GA 4LSUL 1J11A 4RFOH 1HQRB 2UUDK 4AEFA 3QQ4B 1XGRA 2MJWA 3LD8B 4GG6E 4A6YA 1KIPB 5DMYA 2BOBA 2H6PB 2VH5H 2P47B 1FH5L 4ZFFB 4QRSB 4B7IA 2CXKA 3BH8A 1FNEA 2RBLA 3O0RH 3V0VA 3GBMH 1HINH 1OP5K 3TT3H 5J3HD 4M02A 4XAKE 4CMHC 5FA4A 1KXVC 1T1WB 5GJSL 3ZKSD 3HRPA 1S7QA 2OR9L 1FC1A 1XZ0A 4K8RD 4KKNA 2R29H 4KRPD 1W0WA 3P30L 3L5XH 1J0ZA 4FXGA 5L8KB 1B2WL 3BUYA 1PG7L 1ED3B 2DKMA 1K9TA 3MV8B 4IS6A 3DSFL 5EBLA 1QSEE 3VGAC 5ETUA 5EDXA 3G5YB 5BO1H 4W6WB 3F5WA 1INQB 3T0WA 4JFEA 1KCRL 1KXQE 3P3YA 1MAML 2VDQH 4OAWB 1EXUB 1NGWA 1RUML 1T66D 3N85H 4RNRA 5FGBA 4DVBA 3H3KA 3BP7A 4EN3C 5IM7B 2AS5M 1RI8A 3TVMB 3NFNA 3MNVA 3UTPE 5TDOA 4LSQH 3HB3C 4FQXC 1U8OA 4XTRC 4ZAKC 3BMVA 4HFWA 4NSKB 1I1RA 1OTSC 1P84J 1XR9A 4R4ND 5E8DL 1IQWH 2CO7B 4UTAL 2J5LB 2LAGB 2IMNA 1C12A 2QQKL 2JCCA 5DUMH 1R5IA 5GQBA 5TDNA 1A6TA 4HULB 4ISVA 5CIPB 1NGXA 4HCRH 3WDHA 1U2HA 4G6MH 1JGLL 2AVGA 2VQ1B 4DN3H 2IALA 1MCSA 3Q5YA 3BN9D 1MJJA 4XMKH 4MXQD 3KPRD 3O6ML 1JUFA 1JL8A 1R24A 3CK0L 2YD9A 4JM4L 4Z95L 4OM0L 4OFYD 3MRRA 5ACLA 4DKEL 1YUHB 4U1GB 4YFEA 2VXTL 1WBZA 5F9JB 1UJTA 1A7RH 5IW3A 3D25B 3L3IA 5MEOB 5EPMB 2UZIH 4LPTA 1FIEA 4U7MA 5FO9A 1NLBL 4G42B 2P48B 3CFKB 4X0KA 3QR2A 3WIFA 4HF5L 3MRBA 3UYPA 5C7XH 4ZD3L 1DFBH 2FX9L 4Y5XA 3OKLB 3T09A 2HT2C 3GSXA 3HUJB 2EDRA 4O4YL 5D5ME 1A6AA 1MI5D 2JLLA 3FQUB 1CLYL 1TETH 5I2IB 5DEGA 4JZOB 3KPLB 4JFDE 1MHHA 4BQBA 3JTSB 4LSRH 1NFDA 4R8WL 4O58H 1CQYA 1NL0L 4QWWC 4KAQL 4OIAA 3D2UD 2WIMA 3IFNL 2PCPA 5J12B 4HC1L 2R0ZH 1I8LC 3KPRA 2WIIB 3KYNA 1AGEA 4PJFA 2P49B 3BWAB 4U1NA 4P48A 2XZQH 3TWCL 4X98A 4XCFL 4UT7H 1UC6A 5DSCA 1CWVA 4OLYH 1MCPH 2BY2A 1FL5A 1GSMA 2Y7QB 1WIUA 4LHUG 4BM7A 1FNFA 2XQBH 3QHTC 5D7LB 1FZKA 3P73B 5F9WB 3Q6FA 4PJGF 2WK2A 3TBTB 2VWEE 1PYWA 4R4BB 4NQEB 1CG9B 2XN9B 4HD9A 4LSPL 4JJ5B 5JW3H 3S4SA 3MRHA 3GZKA 1MI5A 2MOVA 1Y6KR 4P5TB 3QDMB 4D9LH 2PYED 5GS0D 4X6DB 3QDGA 4X5LA 3IRPX 4RMQA 2R8SL 4WU5A 1WT5A 1NDGA 4YDJA 4K3JL 3LOWA 1Y0LA 2LV4A 4HXAH 2PYFA 2V9RA 2AJYL 4IRJD 1R0AH 3N1FC 5MEPB 3HN3A 3SJVD 4TSBH 3PDDA 4LAJH 4PTUA 4HJGA 5CEYA 2FBJL 3VXTB 3STZB 3F6LA 3H9YA 4AQ1B 3C5ZA 1SBBA 4Z0XB 5HJ3B 2OK0H 4AT6A 2ZOKB 4OQTH 2PF6A 2H2PD 3QUYB 1HK6A 4GKZB 1U8LB 4BQCA 4JG0H 4NQDA 1JWMB 1UWXK 1CFQB 2PW1A 5E2VL 2Y36H 1FC2D 3CCHA 5IHBA 5LGKA 3ECBB 3ZE1E 1MJ7H 1JMZA 4G7YH 4EVNA 1HHHB 4Y1AB 4G8GD 3FN0H 1KCUH 5I1LA 5JHLL 1A9BB 5FHAL 3C6SA 1AE6H 3IDMB 2VXUL 3MV9E 3MUZ1 1QD0A 1NCNA 2D03L 5C0DA 2Q8BH 2PYEA 4TVPE 5DQJA 3H9HA 3LPFA 1G6RA 2DQUL 1DQMH 3JSSA 3HI6L 2NXZC 3V6OA 3KGRA 5HHOE 3WJLC 4ZUTA 2OZ4L 4DUXA 5FM4A 5JW4N 3JXAA 3ZKMD 3LZFL 5I17A 2P5WE 3S5LA 5J6GB 4OSUH 4NC2B 3MRJA 3G9VA 1VENA 4LOUC 4HSQA 1JGEB 4AM0B 4RFEA 5D2LF 2J8OA 1I9IL 1JNLL 3W0WD 5KVMC 3RDTC 1ZANH 1JMXA 1AI1L 2YPKB 3DRQA 3S34L 1ODAA 4ELKA 1J0YA 3ZYZA 1NAMA 5FF6A 3MCLH 4X7FC 1JZ3A 3KYAA 3QQ9C 2DICA 2CMRH 3B6SA 3MTRA 5D7SH 2DKUA 3O2VH 4PGCB 4LSVL 3RKDD 2Z31D 2LU3A 2UUDH 1OB1A 4MJ5B 4DGVH 4G8GA 3PABB 3BQUD 4L8SA 2HN7B 3DVIA 5KSAD 3O9WC 4MAYD 2ADJA 4TUKH 5BV7C 4OZGF 1RZJL 5ITFA 4LPYA 4MA3A 1IL1B 1MJUL 5KAQG 2AABL 2AAVA 1OP5H 5MHSD 1BBJA 2I60H 4K3GA 3KYOA 1UQSB 2DLIA 3RAJH 3MBEC 1XGUA 5C0JA 1J8HB 3BKCH 1TZIB 4Z6AT 4P59H 4OB5H 3GI8L 3VFRB 4UMGA 1HI6A 4G6AD 3ZHLA 1U6AL 1MFBL 1Q9KB 3SDCD 2EDBA 2B1HL 1KBGH 2GJZB 1AXTL 4QHMA 5D7KE 3MLRL 3T0AA 3ARFA 1MRFH 1AKJB 4M7LH 2X4OB 3HPLA 3LEVH 5E1AA 3DXAA 4Z7UA 1YYLH 4J3WA 2UZYB 1ZK9A 4P2RB 5DK2A 3T0VA 2UV3A 5E8PB 4CVWA 1I8IA 2DIJA 4XPHH 4X4XA 3VRIB 4JQXA 1GGYA 1NMAH 1IAKB 1OAZH 5SWQB 4LLQA 3BQUA 1RVFL 3WS3B 3QNYB 5KSAA 1MLCA 4MAYA 2DLHA 5BS0A 4CUCA 1ZVSA 2R1WB 1BVLA 4EUPG 4ODHH 5F7MC 1G0YR 3MXWL 5DC9B 1LO3H 5A2IH 5K9KB 5CBEA 2VXSH 2PTUA 3EOAB 3O3AB 4JPKL 4M93B 4QO1A 4X6CE 1UZ6E 4YUEL 4P57A 2UWEA 3AAZB 3T0BA 2JK5A 3SDCA 5BOZG 4RWYH 3ZKXC 5HI5D 1UB6A 2DQEL 1A7NL 1QFOA 5ADOH 3RWEA 5I76A 2FL5A 4KVNL 3B2UC 4IJ3B 5CMAB 3IT8D 3HMXH 4O2EA 5FYJL 1DCLA 2F53D 5D1QD 4DZ8A 4XP5H 1JZ2A 3LKQB 1OGTB 4FFVD 4G6JH 3LRGA 1IM9D 5AD0B 4JO2L 3LS4H 4OV5B 4OUUA 3RTQC 3KPSD 5TE6L 3VU2A 4OF3A 3U0TB 1IGCH 2IC2A 1HNGA 1YNKH 3LEXB 3DX8B 1CFVL 3AU1B 1BOGB 5IVZB 3K7UA 4G6KL 3LQZA 4RRPG 2AI0L 4YDVB 5EUKB 1G7LB 5GS3A 3PIQB 1K3ZA 3DVNB 1T7WA 1Q0YL 1XF5A 2CLVB 3AMKA 1MRDH 2APFA 2YS4A 2RCSL 1TMCB 1DTUA 1CXKA 1EJOH 1OL0A 3DX9B 3VD7A 1I1YB 5ENWA 1IEBA 5C07A 3TM6A 4X5WA 3L3KB 1SY6H 2X4NA 1VA9A 2F53A 5D1QA 3QEHA 1IQDB 3H0TA 3CDFA 5KOVC 2V7HB 3X12A 3ZT7A 1IM9A 4X8JA 1HILB 3EFDL 3QJHB 5CJOH 2CKNA 5I8EB 2BMKA 3ZDYF 4NQCE 2BNRB 1SVZA 1TJIL 1GIGH 2QSQA 4MDJA 4I0CC 1LILA 4YDLC 4LLYA 1YEGH 3P9MB 1N8ZB 4Y16D 4QOKB 4LLDA 5L9DL 4K7PL 3BKYH 2ITDA 3VG0L 1Q9WB 5GZOD 2ICCA 1JN6A 1QRNB 3TNMA 3WIIL 2NTFB 4WGVB 1M05A 1YQVL 2C1OA 2NY7H 4M48L 1N2RB 4G43A 3UBXA 3U9PH 2VISB 3S3PA 2XA3A 4CN4A 1UA6H 5KSVA 5HGDB 2AEQH 4DKFL 3EO0B 3AM8A 4QHLB 3HE7C 2XQYG 1RJZA 3D39B 2A77H 4KROD 2J6EH 1FBIH 5K9JH 4ZFGH 2OL3A 2CUIA 4RGMB 3KWWA 1ES0A 4OZIA 5I16A 1F6AA 5C6TH 2RFXA 3VRLE 2O5YL 5C6PB 5FYLD 2PXYC 3MFFA 4FQXB 3SE3A 3V4VH 5CGTA 4NRXB 1RZFH 2VDKL 1I9RH 1A4KA 4BKLB 2NTSP 3GBNL 2ED7A 4Y16A 1KPRB 1MWAL 1QP1A 1UWXH 2BP3A 2R4SH 1IJ9A 1NUDA 1B4JL 5J06A 3VXOB 3VXSD 4GXUN 3T2NH 2DIAA 4XVSH 1JWSA 1W0VA 1XCTB 1YYMH 1SEBA 2R2HB 1U3JA 1MCDA 4LRNL 4MNQE 4TUJA 3BP4B 3ULUH 2F5BH 2Z8RA 5E7FA 2XZCL 1MFEH 1CDUA 2ZPKH 4DGIL 5FM5O 5JIPA 5MI0C 1U8JA 4NQVA 1T22A 3MUGA 3RL2B 2DM4A 5B4MC 4GRMA 4LGSB 2ADGB 5IMMA 1PW3A 2JB6B 5I74C 3BP5A 1LO2H 3VFGL 4D9QE 1UCBH 4OQ1A 4R96B 1FL6A 4NNYB 5IR1B 1RIVH 3ULUF 2X4SB 3EYFB 3RY4A 2BDNL 2ZG1A 3WHE0 1JRHL 4IIQA 1C16B 4MD4A 1XR8A 4U1MA 4F2MA 1DVFD 4PGEA 3D5OF 5EOTB 1SYSB 2DQJH 5J13C 2KPNA 4XMLH 3S36X 3T1FA 1A1OB 1YJDH 4H25B 1ZHKB 2OXHA 2WUCL 4RMUA 2ZUYA 3RBGA 2WWKO 4XMPL 4N0YL 5J56B 3N1QC 5JW4Q 1T20A 1SJEA 3VXSA 3BGAA 2YZ1A 1Z2KA 5BW7A 3SCMA 4GKSA 1L0QA 3FB6B 1IC4H 1JCKA 1KLUA 2F8OA 4JY6B 3PWPB 3QH3A 3U46A 4NQXA 4PRID 5D1XD 2H26A 2CR6A 4KKAC 4YBLC 1ZWIB 4YIQA 1U8PB 4DTGL 3O45A 2Z93A 4XPTH 1MIML 3VFOB 5IK3A 1KYOK 1S5HB 4FFYH 5I71B 5DJ8B 3TIEA 3WFCL 2IAMD 5DJXB 5HGHA 1AHWB 4O2CA 3ZDZE 1MREH 4HX1A 4N0UA 2OJEA 1MPAH 5INCB 5FUCE 2FX8L 1R3IH 4JFQA 1DVFA 3MOQA 2AKRB 4OD2A 2IJ0C 4ONHA 1T21B 1T89C 2EH7L 2EXWD 3PXJA 3VXNA 1ZGLA 5EBGA 4K8RH 2PTVA 5K33A 4GW4B 3CVIH 5E94B 4E42B 3WUZA 2NYYC 5ALCH 1X5YA 2OYPA 2NY6C 3QIWD 3V52H 2VDML 1FZMB 1T1XA 1TTGA 4RGOH 1UZ8A 2X1OA 1EJ6A 3QCUL 1H0DA 3GSOB 2PETA 3BP6A 3G5XA 3P0VL 1QEWA 4M7JH 4KPHH 5KN5B 3C8DA 1FZOA 4PRIA 5DMIH 4F7TB 4L3EB 5D1XA 4Y4HB 1JGDA 2JCCF 4ZS7H 5IB1B 4BH8A 4KI5D 4ZNCD 3PP4H 5GGVY 4XHJD 3QULB 3VD4A 2NY1B 5I1AA 5HDLA 3GDBA 3TA3B 3WNMA 5I8OL 5KSBB 2WBKA 2IAMA 4AENB 3HC4H 1FVCA 3LQAL 4FQJH 5CHNB 2QHRL 3MQIA 2BY3A 3H42L 3WO4C 4PV8B 4PJBB 1MHCA 5AYQA 1I85C 5GS1B 2IQ9H 2FWOB 3CVHB 3U4AA 3AC0A 3KLAB 4WW2B 1ZT1A 3QI9C 4JLRA 3R8QA 4UT9L 3L95A 5C6WH 1S7UB 5BRZD 3CH1B 4N8CH 3A6CL 3LRHA 3RGVB 2BSRB 4NKIL 5TE7H 1BMGA 4OCRL 3SDYL 4RQQA 12E8L 3QIWA 3UPAA 5BMFH 1NBVH 1AGDB 1DUZB 3LH2L 1MFCH 4YFDB 4WO4B 3BRDA 4F33A 5K59E 4XX1G 5JPNA 5B38A 2CH8A 4MCYB 4UB0L 3HZKA 4I1NB 4I2XB 5FCSH 5HGBA 4KJYA 1Q38A 5T1DH 1Y18A 1YZZA 5DF0A 4OZFA 1NFDF 2FLRT 4H0GA 1BFVL 1CD8A 4WDIB 3GB7B 3FB7A 3BAEL 4LCUA 4S0SD 2P24A 4IMLB 3W5NA 4OLZH 1PFCA 4LCIH 1KC5H 3F12B 2ZUVA 4YHYC 4KJWC 4DN4H 3KDMA 1BM3H 3D9AH 1ZA6A 1GL4B 4CADA 1J0HA 3IDUA 1ZLSL 5IBLC 4HJJH 2FYYA 5BRZA 1LO4L 1ZGLP 4WHYG 1A14H 3M1BA 3VGDA 1X6NA 4QRPB 1YY9D 2CGRH 4RDQG 4Y5VB 5T3ZL 3TZVC 3NA9H 5EU3B 4R90L 2FZ3B 3MJ7A 3DVGA 3REVA 1J0KA 1RJYB 1I7TB 4HT1L 4JKKA 3Q0HA 2AEPH 4R0LA 1XF3B 3BD4A 3MR9A 1JHKH 4WI2A 1DN0B 4HC1A 2BSED 3M17B 1FIGL 5CJQL 3GJFA 1TNNA 1JGVH 3KPQB 4JDTH 1U3ZA 1UGNA 4WIQA 2A38A 1UH2A 2VLME 5ANMA 1XGTB 5FEBA 4UQ3B 4HBQA 3CLFH 4AEIH 3BZEA 2CPCA 4M5YL 1SBSL 3QDJB 4JO4H 3WFZA 4U3HA 5HYIA 4S0TD 1YEJL 3RWGA 1AY1L 4PGZA 4MS8C 5DD1L 2ZG2A 2BNUB 2MCG1 2X09A 4NKMB 5GS0H 5B3JE 1QOKA 4PS4H 1AXSA 1U91A 5T1KB 1G6RH 4YQXL 3TV3H 3VFSB 4JM2B 4F7CA 3SE9L 2X7LA 1KTLA 5FDWA 4U0RB 5MP6L 5EU6D 1QKZH 1R5VA 5CJ5A 1EEYA 3GSUA 3V5HB 2EO1A 3PWVA 1PY9A 4C56B 1K8IA 3SGDH 4HHAA 4L8BB 5CGMA 2E7LA 4FQHB 5HYJE 2ORBL 1BWWA 3VWJA 1HH9B 1VFMA 4R2GD 2H8PA 5GRUL 5DLMH 4S1DC 1U36A 1NAMH 2OM5A 1HH6B 2VDRH 3QXWA 1XT5A 2RAMA 1A8JH 3EIFA 4MCZB 1S9XA 1CT8B 2EC9U 3IF1B 1KG0B 3BO8A 4P3CL 1WZ1L 35C8H 3IB4A 1U2CA 3MFGB 5ALBH 4QXUH 3MRPA 1TVBA 4UILL 4K2UH 3U0WL 3ULUC 5DJ2B 3IDYC 5DFVD 3NCYP 1NCTA 3DRTB 1WWAX 3NACL 2VKWA 4Q9RL 2R0LL 3ULVF 4PB0H 2A6KB 1DLFL 5IVXA 4XPGL 4OLVL 1WBXA 3O4OB 4LCWD 3BZ4B 5IQ9A 1U0QA 3ARVA 1RIUH 1YEHL 3TN0D 2JELL 1ZMYA 2EZ0D 5L8LB 2BVOB 5C0BE 3MRGB 5T33H 5HDQH 3ULSA 1CL7I 1RZGB 4TTGA 3C2AH 4PJ7F 5D7IA 1AO7D 3T0DA 5DGQA 1FGNL 2G9HA 4Z7WF 4WCYL 3CFDA 1EUTA 4L4VE 3D69B 1VESA 4PY8J 1REIA 3CU1A 3L5JA 5FUZH 4FTVA 2FIKA 2ZOLB 1J1OL 3QEQB 1WVZA 1KN4L 3LMJL 1YJDC 4O5LH 3JWDH 3ZE2F 1KSRA 3MRKA 4DK3A 1EGJH 4H26B 4XC1L 3F65A 2D3VA 4YHIB 5IMOA 5ITBL 2AJUL 4QTHB 1SHMA 3ORJA 1BAFL 1OAXH 2DQGL 1BECA 1BREA 2L4OA 3Q1SL 4NHUA 1CICD 4Z7UF 4ALAL 5ICYA 1U92B 4LIQE 3ARUA 1S78C 4U1LB 4GW1B 2HYMA 3T4YB 3KPOA 4MZ2A 3QCTL 4DOHE 1CVSC 4FNLH 3NBNA 4XNQB 1BFOA 5A1AA 3MCG1 2BY1A 4MYWB 3OZ9H 4YH6A 3IFOB 1VFBA 2E7BA 3IFPA 3SO3B 2CIKB 4IM8A 5DR5L 5JQ6L 1A3QA 2W0KA 3WFDL 3TN0A 4KK6D 4PJXB 3CDGA 4DQOH 3F7QA 1OARH 3RWFA 3EOYG 5CJ8A 1MHPH 3S35H 1FNHA 1AO7A 1E6OL 3FCTB 1NJ9A 5J3HC 4UDTB 5JO5B 3CIQA 4EDXB 5B8CA 3FQRA 2UWEF 3FFCD 1BF8A 4ODSL 4K8RC 3OR7A 1XF4A 1JNHB 3H9SD 2W07A 3PWNB 3TYFB 3QG6B 4KRPC 5C0EB 5T1LB 1DDHB 1I8MA 2GAZA 3CNKA 2Y9RT 1HSBB 4X7TB 3V6FA 1GZQA 1A47A 4I9WD 1CICA 3QEUB 1BZ9A 4U1SA 5JA8B 2GSIB 3PWJA 4ODVL 1XIWC 5T5FL 5C8JB 1ZHLB 2B4CC 4ZOEA 1K4CB 1BJ8A 4DVRL 1DBKH 1EPFA 4PJHB 2I5YH 1QFWM 1T66C 4HS3A 4MNHA 3MX0A 4LHQB 4LHUD 1JPSL 1S8DA 3LV3B 3CPLA 2NCMA 1UG9A 5DJ0A 1BGXH 3SQOL 3CFCH 4DEPB 3NCFB 5KG9A 1VKXB 1A3LH 3U6RB 4NJAL 4MJID 2NY0B 3FT4A 4Q0XL 4L8DA 2D7OA 1LP9E 1QFHA 4AY0A 3TP4A 1FFQA 5DURB 5CD5D 4R4NC 3VXQB 4Y2DD 5EO1A 5J9PB 1U8QA 3FFCA 4N90D 4OKDA 4X6BA 1A6ZB 3PL6D 4JVWA 5EN2B 3UDWA 3EO1B 2AK4E 1NC4A 4E0RA 3MJGX 3SDDB 1JF5A 1H3PL 1S7VB 3H9SA 2VSCA 4OT1H 3LSOB 3B3IA 4NZDA 1EFXD 1YMHB 2E6QA 5F7KC 5H2BA 1ZXQA 3CFEB 2ZSWA 5ISZE 2P42B 3FT2A 3I3DA 5I19L 3NFPA 4ZFZA 2EDTA 3O2DH 4M62H 4JVPA 1CD9B 1I3GL 1ND0A 4N1HB 4JAMA 2Z8VC 4Y0GA 4I4WB 4K7FA 4NWUH 3QUXB 4WWID 2Y5TA 3TPKA 5J57B 4CNIB 2DBJA 2ZG3A 5CILL 5C0FB 1TQBC 5KTEH 1O7SA 5D7JD 5JORB 1VPOL 4KMQA 3QZWB 4FQQA 2V2XB 3L7FB 4YGVB 5GRJL 1AJ7H 1F4WL 3L3GA 3U0PA 4MJIA 4Y8DC 4QRTA 1QFUL 5CBAB 3CFBB 3UTZB 3V8CA 4V1DE 3O3EB 3VXRB 2CK2A 2R39A 4Y2DA 5C0IB 1UWGL 1T03H 1OHQA 4RISL 2XTJB 4JGUA 3PL6A 2HP4A 5C08D 4G7VL 1DEDA 1AGBB 4P2QE 3T3PF 5GJTH 4K94L 2YWYA 3MA7A 2HJKA 4I0PD 4IOSD 2WBJD 2OQJA 1H3VA 5C92A 2XZZA 1WT5C 1HN1A 1C5CH 4I3GA 1OGAD 2YD6A 1QSFE 4HGKC 2XKNA 2QTEA 4OZIF 1T7VA 5C9JA 1GGUA 3W9EA 4X4YB 5I0DA 4ODWB 4S1QL 3O8XB 1B0GB 4D94A 3WLBB 4OLWH 2ADIA 4QLRA 5DQDH 1UXSB 4LEOA 5EIVA 3IFLH 1G0XA 1NCDH 4OD3L 2H9GB 4RIRA 2HA1A 3SDXE 1MELA 4LSTL 5IV2B 4R97B 3I02A 3QRGH 4U2ZA 4UINH 5AAWA 5EO9A 5C09E 2DN7A 2J88L 2A74B 3MA9L 1TJGH 1VGKA 1J1PL 1AC6A 1N3NA 4PJDA 4Y19D 4MJ4A 4N0RA 1H15B 2YC1A 2EDDA 3GO1H 1H8SA 3MCKB 4XBPB 3BKML 1D6EB 5FYLH 5C08A 2AV7A 3CXDH 4NYLA 1J18A 3WFBL 3RZCB 3Q3GA 2DM2A 3LIZH 5GS0C 4NT6B 2EYSB 4I0PA 1LDPL 2WBJA 3H2WA 5FB8B 3P4NB 1W72A 4A2LA 1KELH 4N68A 4XZUB 5F3HA 2VLKB 1OGAA 2F58H 3ARGB 2O5ZH 4GBXB 4IRJC 1AR2A 4JRWA 4JO1L 5ILTH 5GGSA 2Z91A 3UO1H 3QA3A 3IETB 4M00A 4IRSB 1OAUL 3MROA 3QG7H 3DI3B 3VGGA 3SGEH 5DJAB 3TLRA 4POUB 1M7IA 1HHKA 3ZKND 1E27B 1LEKA 5IF0B 5I6XB 2VZUA 1SJXA 5FOBA 4PBXA 2XWJA 1PKQE 3RNQB 2F5AL 2H2PC 1MRCL 4LSUH 5T5NG 4N8PA 4JFZL 4MQTB 5DTFB 1P84K 1I8KB 5E8NB 2P8LA 1MVUA 5E08H 3MYJA 1CE6B 1A9EB 3INUL 4JFEE 4Y19A 1J87A 4QF1A 3ULVC 4N0FB 1IZJA 4Z18A 3O2WH 3FOLA 4L8SC 1RQ5A 3FT3A 2W91A 3SO5A 2D31A 3B4NA 1RJLA 3B9KD 1FVDB 3GJEA 5M94B 5IJKC 4Z78B 4PJIA 4PUBL 5GJSH 3DTXB 3NH7L 3NA4A 4PV9A 1B0RB 1YY8A 3WJJA 1I9JL 4PB9L 1HQ4A 4Y4FB 3L3DB 1LO0L 3P30H 4GXUM 3VFPA 5IG7A 1MLBA 3ZKMC 1B2WH 5BZWA 5GRXG 1PG7H 3MACL 4PTTB 4JQVC 3S6CA 3DSFH 3FQXB 1IAIM 4MSWB 5JOEA 2VLRE 1JFQL 2JIXB 4M1DL 1P1ZA 1JNJA 1KCRH 5HHVL 3TFKC 2RB8A 1MAMH 2KH2B 5GGSY 1YPZA 3O3UN 1MAKA 1RFDL 1EV2E 1RUMH 2NY2D 5KANI 1A6VL 1S7XA 4PJAB 3SGKC 4PYHA 3JWDC 3ROOA 4XP9L 5J1AA 4GXVL 4C57C 3RKDC 2Z31C 1JTTA 3FO1A 2GTWB 3NCMA 4LMQI 4NZTL 3KHOA 4GG6B 1QPPA 5KSAC 4MAYC 4N9GB 2HVJB 4EIGB 3ZT5A 3O6KL 3OAYK 4EBQL 5FYKE 1ITCA 5E8DH 4UTAH 3VWKA 1P7HL 3MV8D 4OCXL 4UDUB 4WV1B 1OWWA 3IDXL 1UH3A 2QQKH 4F58L 2PR4H 1F3DJ 1OSZA 3UAJD 1S7RB 2JJVA 2VIRA 1S7WA 3D48R 4G6AC 2A6JB 5FHBL 4HUVB 3T0EA 3DV4B 3KR3L 1HHGB 5IHUL 5IHZA 4J4PA 4WFFD 1JGLH 2ARJA 4DAGL 2ZCKL 3TVMD 1T4KA 3S36H 1ZVYA 4AG4H 4MD0A 2C3VB 4Z7OF 4HUMB 1KIPA 2H6PA 2A9NL 4LLVA 4ZFFA 4PYGA 4JM4H 1RPQA 4QHNB 4QRSA 4Z95H 1P6AB 4OZFH 5F8QC 4DKEH 2VXTH 4G9DB 2G2RB 4LLUB 4L8CB 4JANB 4IOIB 4DFIA 4M6OL 4PJFE 3QT2A 1T1WA 2O61B 1KT2B 1NLBH 2Z8WC 3RHWK 3C6LB 3OAUL 3SDAA 4JY4A 3D0LA 3RPIB 4ZNEA 4KI5F 1NMBH 4HF5H 3VFNA 2ED9A 4PR5B 1JHLL 3EJZD 2W0PA 4ZD3H 1WC7B 2FX9H 1ZLWK 4YE4L 1MIEL 5BXFB 3MV8A 5ESAB 1K8DA 3RWIB 1JYXA 4CVUA 2A2QT 4O4YH 1F02I 3QFJA 3G5YA 1UM6L 2CKBL 4XRCA 2DIBA 5F1NB 1F42A 2C4FT 4KU1A 4ODUB 4U1HB 4R8WH 1EXUA 2WSKA 4QY8B 5GZNC 5HI5C 1R3HA 2XG5A 1NL0H 5IM7A 4KAQH 1MI5E 3MJ9L 3IFNH 1QO3B 4HC1H 3TVMA 4NQTA 3RWHB 3QDGE 1PD6A 5D1QC 3Q48A 5FOJA 3WL9A 1WZMA 1BQUA 1CGVA 1FFOB 2DLGA 4M3JA 3TO4D 4FFVC 3QEGH 4G5ZL 3CVHL 3U9UB 3F7PC 5E1HB 5HVGB 3TWCH 4XCFH 4FQCL 2K7PA 3M8OH 4KHTL 5KVDL 1NBZB 1FG2B 1M71B 4P23B 3STLB 4HS6B 3CUPB 1G7HB 5DFTA 1EERB 4GW5B 2EEDA 3VGHA 4GRLB 5HDBF 4OI7A 5CIPA 3DYMA 2WANA 4NQDE 4YEEA 1F2QA 2VQ1A 4LSPH 1U3YA 4WFEE 5I75C 1BP3B 5BVPL 3S3SA 5D93C 4G6FB 5A16B 5D5MB 5C70A 2R8SH 2CRYA 3F58L 3OX8B 1FGVH 1G7MB 4K3JH 2IF7A 4JFDB 5IW6A 5HD8D 1UM5L 1GGCL 3SY0A 2AJYH 4GMTL 5MEOA 5EPMA 1DEEB 1O0VA 5I15L 1NUFA 3V6OE 4G42A 3IU3A 3PWUB 2FBJH 3CFKA 3TO4A 4HBCL 3OXSA 3RU8L 3BDYH 5D7LD 3HAEB 2Z9TA 3MRDB 15C8L 4G8FB 2DQHL 5E6YA 2W65A 2HRPL 1L0XA 3OKLA 5HVWA 1WBYB 4GAFB 4KGJA 2XN9D 5EO0B 1WTLA 2EEBA 4K9EL 4WY7L 2MPAH 4P5TD 4Y16C 3QDMD 3QUMB 3UROR 5I2IA 2EIZB 1OM3H 3KPLA 1QTYT 2AP2A 4DZBB 2CIIB 5GZOC 4HK0A 4BA8A 3UEZA 5JOPE 5J0BA 4BSJA 2HT3D 5JHLH 1IGTA 4W70A 3LHPL 5FHAH 5HI3D 3TCLB 4JHWL 2VXUH 2D03H 2WIIA 4GRWE 1A1MA 4KVCL 5TH2A 3BWAA 2DQUH 3HI6H 3LZFH 4JQIL 4KROC 4QCIB 3QUYD 4LDOB 1HNFA 3CC5B 2IPTL 4IIQC 5D7LA 5CP7A 4YHOL 1I9IH 1JNLH 4GFTB 3QZWG 1H8NA 4J3OC 3TBTA 4Y1AD 3ZE2E 3GSQB 1AI1H 1WWWX 4KDVA 4R4BA 2MQ3A 3S34H 5FK9B 2XN9A 5TF0A 4PJEE 3JVGA 1RMFL 1U8IB 3I6GB 4GJTB 4YR6B 4P5TA 2P8PB 3QDMA 4YXHL 2Q6WB 3DXAE 4LSVH 4XNXH 1JNNL 3GUTB 4OJFL 4NKOB 4IMKA 3K46A 5E5RB 5D9SB 1RZJH 4M1CD 2E9WA 3BPLB 1MJUH 4CU6A 2AABH 1GC1L 5E0QA 3O6FA 1C5BL 1HSAA 3MV9B 3VXTA 2FX7L 3G6AB 3STZA 5BS0E 4XNUL 4Z0XA 5HJ3A 3ARPA 4W81A 2I9LB 1MY5A 3GI8H 2HWZH 4F8TA 2CSPA 1U6AH 1MFBH 1Q0XL 1DQQB 2ZOKA 5BQ7B 5HHOB 3MLWL 3QUYA 5J7CC 2YBRB 2DQTH 4GKZA 1U8LA 5HYSB 5DD6B 2EDNA 2B1HH 4X99B 1JWMA 2P5WB 3VXPB 1KTDB 3NABL 1AQDB 4WI7A 1DVFC 3MLRH 4NBYB 2B1AH 3GNML 2E9JA 4Y1AA 5HHXL 1MFDH 5FA3B 1A9BA 4ETQB 2DL9A 1PQZB 3IDMA 3O11B 2VTFA 2ZZUT 3L7EA 2CJUL 3O3DB 4L5FL 5EBWB 1OAYH 4FQ2L 2C4FU 4Z8FL 1RVFH 2R0WH 1J8HD 3PWLB 1X5AA 5DDHA 4YGAB 4N0CD 5HI4D 3ZE0E 5D1XC 3G5VB 1AFVL 5C9KA 3U2SB 3JWOH 3MXWH 3OAYH 5T3XE 3LN9A 2GKIA 4FQLH 1RUPH 1RU9L 4AM0A 4YUEH 5J1TC 4PRPE 1AKJD 4PJ5E 3S98A 4X4MA 2E9BA 2QKIB 3C09C 2Y23A 4P2RD 1PKOA 4V2CB 2DQEH 3HPJA 1A7NH 4NJ9L 4XVUD 1INEL 3RGHA 3V4PL 4KVNH 1EX0A 2MCPL 3VDBA 4ODXB 3L3HB 4MJ5A 2FR4A 2EXWC 2ZUWA 3PABA 2HN7A 1FYHB 4JO2H 3E3QE 4UV4L 4AK1A 3MO1B 5JA9A 5A2JH 4EI6A 3MRNB 5C07E 4XPBL 1YEIL 5TE6H 4M7ZB 3QIWC 3OKNA 4KH2A 4PJCA 1CYGA 3QRFM 1QR1A 5D1ZA 3EHBD 5BZDB 2F19H 4G6KH 4LNRB 2WWKT 2AI0H 3VFRA 3QXDB 1Q9KA 4JFHD 3N50A 4NP4L 4HMCA 1ZLWH 4JPIB 4KI5C 1Q0YH 2RCSH 1N59B 3CMGA 2QHLA 4L4JA 3B9EA 4X6CB 2I9TB 4RCAA 3VCLB 1HIML 3RHWF 3NIDE 2ZCHL 1C5DB 1T0MB 5E00A 1JHTB 5DD3L 4JFPB 4CL7A 4OGYH 5EUOA 1IAKA 5SWSA 2QEJA 1M6OB 5E8EA 3QNYA 1R3KA 3VXUB 3O4LA 1ZTXL 1HZHL 2XQYK 5HXMA 1ZT7A 1CDJA 3NPSC 4P2OB 4ZDHB 5E03A 2FHCA 3EYQC 1PAMA 4XWOD 2CLZB 4HUUA 4OUOA 3ES6A 5D70L 1OY3B 3OJ2C 4UQ2B 3O3AA 4NNXA 4C83A 3HKFA 3AAZA 2EECA 5L9DH 4K7PH 3VG0H 1OT1A 3HI1A 3BGFC 4Z9KB 2IGFH 5MENE 1IGIL 3WIIH 2DYPB 5EFIB 1X5GA 1YEDB 1YQVH 4LFHG 3VFWA 4M48H 1FAIL 1PX3A 2BZDA 3LKQA 1OGTA 1NLDL 4RA0C 3FO2A 5AD0A 4PP2B 4U49A 1FQ9C 4DKFH 4WI8A 1O5DT 5GXBB 3LDBC 3IYLW 4UAOC 1T3FB 5C0GB 3OKOA 3U0TA 2BNRD 4RX4D 5CCKL 1MOEA 3LEXA 4LLMB 3DX8A 2AXJA 1UXWB 4LRIA 3MUY1 3AU1A 5EBMB 3BRGC 2Q7YB 1BOGA 4QOKD 1FFRA 2O5YH 3AS1A 1YY9C 2BNQA 4P4KA 4YDVA 5EUKA 1G7LA 2FEEL 1ORQB 3WNLA 2VDKH 3DVNA 3K3QA 4GSDL 1QRND 2VLLA 1W72H 3VDAA 4HKZB 4PJDF 5E56A 2V5RA 2Y5EA 5EZJA 4D0BA 3GBNH 2EKSB 4QHUA 1F97A 1WCBB 2L7UA 3F8UB 2ID5A 1B4JH 4YHPB 4KK8D 3TJEH 5B22A 1I1YA 3TEUA 2XZCH 1QUNA 3GRWA 2E7LC 5IFAL 4R4FL 1CU4H 3D39D 4DGIH 3L3KA 4Q2ZB 3Q2CA 1MCNA 3PGFL 1IQDA 4UNUA 5TGBB 1NGQL 2VABB 5TDPB 1HILA 4EN3D 3UPRB 1WF5A 2EH8L 1ROWA 3NIGF 1H3WM 3VFGH 4P5KA 3BDBA 1W0YT 4PPTA 4NC0B 4FQXD 3QJHA 5LG1A 5I8EA 4HUXB 4ZTOL 2C1PA 2FH8A 2ZUQC 3E6FB 3L3OB 2BDNH 2UZXB 1PEWA 2YMXL 5LQBL 3LKRB 1JRHH 1KENL 4ZFOB 2FJHA 2ICWB 4QOKA 2KDGA 1HEZA 5F6IB 2Q20A 3HG1A 3IDGA 3RA7L 4N0UE 5IMKB 1QRNA 4XBEL 3SKOB 2WUCH 3N1GC 5E6IB 5FGRA 2NTFA 4MMZC 2OCFD 2W9EL 1N2RA 4XMPH 4N0YH 5GGRB 2GI7A 2VISA 5J6HB 5HGDA 3S88L 1RURL 4UUJB 1UVQB 1YC7A 4PJIF 3AVEA 2FHBA 4MNQB 4W68A 4XBGB 3D39A 3BGMA 4CDGC 1NSNH 1EUUA 1FO0A 4R2GC 3TT1L 3RY6A 4DTGH 5DJYB 4EJ1C 1MIMH 4EN3A 4KKCD 2OI9B 4YNYB 3P77B 1HKLL 1KJ2B 4PRIE 4FQXA 1MH5B 3QJFB 3DROB 4WFHD 5KOMC 4EUPH 5I66B 4RMWA 1FPTH 1T0PB 1U8NB 4WFGD 3D6GA 2HRLA 2FX8H 2YRPA 2Z8SA 3T0XA 5IKCB 1YPZF 3T2QA 3SEPA 1RZJC 3PHQA 2EH7H 3BEWB 1VCAA 4P9ML 1XCTA 3IJHB 1D9KB 1JPGA 5HTSA 4BH7B 3BP4A 3FO9B 5GS2D 2YD2A 3PWPD 3OJVC 1GOFA 3GMQB 4JGMA 3WN5C 2CDEB 1G9ML 3C87A 4LKCA 2VDMH 1KJVA 2QQLL 3EYVB 1DR9A 2OR8A 3QCUH 2HJLA 2ADGA 3TN0C 2JB6A 1NEZA 2EZ0C 4HIJB 5CKGA 4AL8L 1JP5A 4F7MB 3V0WL 1XH3B 4N1CA 1ZKAA 4MB4A 2ITCB 4NNYA 5AZ2L 1TPXB 1HOCB 1LEGB 4KGLA 4YAQB 2X4SA 1BFSA 3EYFA 4LVNC 3KJ4C 1KEML 5B8CC 3VMNA 4M03A 5EIIB 5C0ND 5KVEH 3EDJA 5H37G 3F7RA 1SYSA 2RJMA 3ILQD 5I30L 3JZ7A 2QHRH 3H42H 4FXKB 4H25A 1BIIB 1ZHKA 2XXCB 5D6DC 3CFJB 5TQ2L 2XPGB 1R3LB 2C9AA 1YNTB 4QHKI 4UU9B 4ZSOE 1CDYA 2XRAL 3GSNA 1CICC 1RULL 2G5RA 1V3LA 2Y4SA 1X5ZA 2I07B 4UT9H 2ATPB 1Q1JL 3A6CH 3FB6A 4XNYL 3JWOC 1B9ZA 3EGSB 4JY6A 5HVHC 3PWPA 4NKIH 2V7NA 1I7UB 4OCRH 4L3ED 4Y4HD 12E8H 1XGQA 1PSKH 2J3SA 1ZWIA 1ADQL 4JFYB 5F7DA 3LH2H 3VFOA 4KK6C 1S5HA 4R6UA 5CFHA 1OVZA 5JZ7D 2NY1D 4KUCD 3AROA 2ADFL 2X4TB 2X1QA 3TA3D 1I8LA 2D9QB 2M8XA 3AXLA 4OFPA 1QNZL 4HJ0D 4UB0H 1J5OH 5BJTB 4MQ7B 2LABA 4YO0A 1BVKA 3KXFE 3HC0B 1EFQA 2DQIL 2BOCA 3UDWC 4XP1L 4HG4J 1J88A 1BFVH 2YSSB 5HYSG 1T21A 4ZMAT 1WAAF 4RAVB 3BAEH 5C2BL 4E41B 3RGVD 3BVNA 4E42A 4HMEA 3W2DL 5AEAA 2Y07L 5ANME 2NZIA 5CIPH 3G6JB 5GGUA 3SKMB 1DUYB 4NFDA 1HDMA 3FRPG 2B5IC 3GSOA 4U2YA 3JUYA 2HJFA 2VZOA 4WO4D 1LO4H 1MCIA 4CW1B 1S9YA 3V5KB 4R90H 4L3EA 2V9QA 2X42A 3J8F7 4TYUA 4EDWL 5DHXB 2LTQC 3NZ8B 4M7KH 5CZXD 5F21B 5IB1A 1J0JA 4HT1H 1I1FA 1LK3L 1UYWL 3TA3A 3VFVA 4AQOA 4LAQH 1U58B 3VXMA 4OV6F 1N64L 1FIGH 5CJQH 5CD5C 2V2WA 3QO1B 3VG9B 4PJBA 4Y2DC 3NIFF 4QGTA 1OTTD 3PL6C 2FWOA 2CDFA 1BZ7B 1D5XB 1D6VL 3CVHA 1P7QD 3FOMB 3D0VB 4H88L 1I1AB 4HIXL 4F9PA 1JV5A 4RGNC 1SBSH 1S7UA 3PV7A 4MA1B 5FFLA 3CH1A 2BSRA 2A83A 4QRPD 5L2JB 1YEJH 2WM0A 5I73B 1ZS8A 1AY1H 2FB4L 2Y06L 3R4DA 1AGDA 1DUZA 2HKFL 1KCSL 3LVEA 2XFXB 1NDMA 2WAHA 7FABL 4MCYA 5DYOB 3HUJF 5DVOA 2QBWA 2V2TB 4YQXH 5ERWA 3IJSA 5D7JC 4XWGL 2YR3A 4L9DA 3QIBB 5E2JA 3WJLA 3SE9H 1HYRC 5CZVL 3S37L 4KWUA 2HFGL 2EEAA 3PDOB 4FABL 4WTZG 4WDIA 4WEMB 1F90L 4IMLA 3DMMC 4CJ0A 3QDJD 3G04B 3BPCA 5IVXE 4Z77B 3F12A 2ORBH 2ERJC 1P7QA 3WNKA 1CCZA 3DGGB 5GRUH 1I3UA 3MGTB 2UYLA 1IT9H 5E8OB 4I0PC 1JJUA 2WBJC 3SPVB 4QRPA 4HWEL 5D7IE 3FQTB 4Y5VA 4U0QB 2FZ3A 5GPRA 5T1KD 3RVTC 5LAXB 4AH2B 3O9WA 4P3CH 1WZ1H 1I7TA 4FTVE 4JM2D 4L9LB 3MNWB 3CSGA 5DK3A 3TPUA 1FSKB 1XF3A 4TTDD 4APQB 1N4XL 4UILH 4AIOA 3U0WH 5MEQB 4R7DB 5HYEA 4C56D 4YHZL 2RR3A 3NACH 3MV11 4X6DF 2R0LH 1CGXA 1DLFH 2ZKHL 5GRVK 1H5BB 4OLVH 4LSDA 4PG9B 3SGDI 1XGTA 4UQ3A 5IGXL 4F15C 5JOFB 1RZIA 1UM4L 1OP3K 1YEHH 3OAZK 4HKBA 2JELH 2MHAB 1JI2A 1M7DB 4F7PB 1DBBL 5FKPB 2YD7A 2GFBB 2ESVE 3H3PL 3QUML 3VI4E 2MFNA 3MBXL 4ZOAA 5HYJB 4WCYH 4J1UA 3EFFA 2CLRB 4X80L 1IAMA 2VXVL 1J1OH 4JRXA 3LMJH 1KN4H 5ABDE 4WHCA 4NKMA 3UTTD 1CDGA 4OCYL 4XC1H 5T1KA 1XF2B 4GAJH 4JM2A 5ITBH 3OJDB 2AJUH 4AEHL 4CDHA 5HPMB 1BAFH 1IZKA 1FNGA 2DQGH 3Q1SH 4ALAH 1L0YA 1CE1L 3T65B 1P9MA 3V5HA 1FZJB 3ZKNC 1MCEA 5D8JL 3MLTB 4ORGA 1QLFB 3QCTH 4QXTB 3LEYL 3SKUD 3STBA 4HMDA 1K2DB 4FQHA 3ZT6A 3H6JA 3JTTB 1BBDL 5IT2H 4X9FA 1YN6B 2IBGA 1K5NB 3DUSB 5DR5H 5JQ6H 3WFDH 1HXYA 5AYUL 1HH6A 5CJBA 3QEQD 1MAJA 2CR3A 2HAZA 5IEKB 4ONGL 2Q3AA 1E6OH 2R9HD 3B9KC 3VFUB 2EYRB 3NAAL 3N9GL 5LGHL 3RTQA 4ODSH 4LSSL 3IKCA 4MNGA 5E5MB 4L4VB 5L8JB 5DJ2A 4OKVA 3UTTA 6FABL 3DRTA 2QQQA 1I7RB 3RX5A 1KCLA 3RX7A 1SYVA 4TUOA 1T0NB 3FFCE 4TVPL 1D3CA 2A6KA 2JJWA 1FVEB 2QV2A 3QB7C 4Y2OA 3H9SE 4MD5A 4K23L 3UTSA 3OG6B 3LD8C 3NCBB 1A0QH 1AGCB 1EMTL 5T5FH 2LU7A 2GK0B 2BVOA 4MJ6A 3ZLQC 3DO7A 4BZ1L 4EXPX 4DVRH 4GS7B 4I9WE 4DOHB 2BHYA 5C86A 5EC1B 3CZFB 1JPSH 4CBPA 1UH4A 4LCYA 2D7TL 2ICWJ 2E7MA 3SQOH 5DVKA 2ZOLA 4Q9QL 3QEQA 4NJAH 1C8PA 3CD4A 4BSWB 4WTXA 1DQLL 4P2CG 4Q0XH 1NBYA 3BKJL 1VFAB 3PP3K 3UJJL 5T1LD 4F9LA 2VUOA 4QTHA 4ZUSA 5DUPL 2AJVL 2XA8L 4JGJA 5IEHB