1AY1L

Anti taq fab tp7
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
210
structure length
210
Chain Sequence
DIQMTQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDSTNLASGVPVRFSGSGSGTSYSLTISRMEAEDAATYYCQQWSTYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords TP7 FAB
publication title Structural studies on an inhibitory antibody against Thermus aquaticus DNA polymerase suggest mode of inhibition.
pubmed doi rcsb
total genus 51
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 1997-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ay1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ay1L01
1O7VA 3AVEA 1FNGB 1FIGH 2VLKA 3ZDZE 3RWEB 5E4EB 3N1QC 3A0OA 5TGBB 3ZKQD 2AEQL 4NHUA 2Z92B 3WFCH 2AXJA 2YZ8A 4QTHA 4PJ9A 2NNAA 4JFPA 4EI5C 4M1CC 1QLEH 2N7BA 2F54D 2GHWB 3FTGA 3WLBB 4JHWH 4LLDB 3SE9H 3HRZA 4DK6A 1UA6L 1I85C 1N64L 2V5YA 2X1WL 3QZWG 2J8UA 1S7WA 4MYWB 4EI5D 4M1CD 3B6SB 2JCCE 2IALA 4G6MH 3VFRB 1IEBB 2XY2A 4HLZG 1S7UB 1CBVL 2HYMA 2FBJL 3QUYA 2B4CH 2CO6B 3FFCA 1P6AB 3MLRH 3U7WH 1ETZB 4YHLL 3L7EB 2OLDA 4G6FB 4AZ8A 3SY0B 1U58A 1A6ZA 2FX7L 4ZD3H 1MOEA 2UZYB 5IB5B 4E9LA 3PGCA 4F33A 3NCBB 4NKMB 3H3KA 2AXGA 3GSOA 2ARJB 1RZIA 3FCTB 1G84A 1NDGB 3OMZA 4X80H 5DJ8A 4F58L 4OF8A 3QIUC 4AL8H 4NKIL 4OLUH 4WO4A 3UROR 4LSQL 5IJKA 3MJ9L 5D6DA 4OZIA 4YR6B 1V3JA 5I2IA 2WM0A 1W0WB 1P4LA 1G7JA 3CU7A 3QIUD 2CR3A 4TPRH 1J18A 2XN9A 5D7JC 5L88H 3VW3H 2IFFL 3MZGB 1KCRL 4LRNH 2NXZB 3VRJA 4JM2A 4HSQA 1M7DB 2V2XB 3BJLA 3OJDA 4M4PA 1ONQB 1NFDE 4LCWB 4E0RA 3MO1A 5D7JD 1NLBL 1X6LA 3U0WL 1L7IL 2BNQA 3RQ3A 1U8KA 4JVWA 3AS1A 1ADQA 2EKSA 4XMLL 2GKIA 3R0NA 3C87A 3G6DH 3MLUL 3L3JB 2CDGB 2ED8A 2Y72A 2HFEA 5DLML 3U7AA 4OLVL 4XB7A 1CCZA 3CFKB 4HWZB 1OT1A 2LE9A 4PJ7E 4Y5XC 3VMPA 4X4XA 1MF2H 3LMJH 4ZXBC 5J8OA 1M6OA 4LVOB 1OVZA 1U41A 3O3EB 4XZUA 1K8DB 1O0VA 4LPVA 4J3TA 4CVXA 1SJHB 1DFBH 1RUML 4WHDA 3G6JF 4ZXBD 1J1OH 2CRZA 2AQ3A 3M1BA 4NZDA 2QL1A 4ZTPH 5K9QI 2BVPB 3IB4A 2IQ9L 1NCTA 4GKNB 4J3UA 1OF2B 4KJQC 4AIOA 5DEGB 1CL7L 3AY4A 2C4XA 3IDYC 1Y6KR 3MJGX 4WI9A 4KJQD 2OX5A 1AC0A 5KJRL 2RQ8A 3BP5B 2L4OA 2RGSA 3IU3A 3CFBB 5GIRA 2DQCH 5DR5L 3WS6C 5SWZA 4PJXB 5K9KA 1NCWH 1WCQA 5ICXB 1D9KA 4AM0A 4YQXH 1X5KA 4R4BB 1PLGH 4BSJA 5I1EH 4IRSB 5C86A 4Z7NE 1A1MA 4LSUH 1QKZH 1KCKA 1JF1B 3TT3L 2PCPA 4XHQA 5D7LA 5FK9A 5E6IA 4BA8A 1EEZB 4HS8H 2YRPA 4K2UH 3SDDA 3JV6A 5MEPA 4FP8H 2ID5A 1QP1A 3MUHL 3QQ3A 1IC7L 1NQBA 5LBSL 2WNGA 4C58B 5IFAL 1CK0H 3C2AH 3KR3H 2X89A 32C2A 2YEZB 1Q9WB 3SDYH 3QO1A 3T04D 1HYSC 3P73B 4XI5C 1OGAD 5GGTA 2VISB 3TCLB 5DURB 2R2HA 1BD2B 2X9YA 4ZXBA 2BNRB 2B7DT 2G75B 1CWVA 1JNLL 3DGCR 1HYSD 4X7SH 4QHKI 3B5GA 4XI5D 1T83C 2NY5L 2DQHL 3DARA 5FYKL 3SKJL 4PJDF 1Y18A 3DV6B 3ES6B 1A1NB 5DD0L 2P4AB 2P45B 3GSRB 4BZ1H 2YPLD 1KNOB 3UJJL 3T4YB 4E5XA 1JK8B 2GUOA 1FL5B 1RMFL 4HWEH 5CJXA 5HHQB 2X42A 2EDLA 4YHKL 5DJAA 4QF1A 1UACH 4XTRD 4KROC 2IF7A 2OJEB 4M93C 5L8LB 3ZZ1A 5T3XE 5ANME 1EZVX 5CSBA 3GJEB 5ISZB 1RJZB 3W39B 1JHTA 4KROD 4ZUTB 3QT2A 4HWNA 1IC1A 5E8OA 3DURB 5IGXL 4GW1A 1OGTA 1T7XA 3F5WB 4MJIB 3O2DH 5FEBA 1MAML 1RK0B 5TE7L 4NO0A 5JXEC 4L8BA 5CLTA 4F2MB 3PL6A 1WBZA 3Q6FA 4LP4A 2WP3O 4OZHF 1NEUA 3UBXB 5DRNA 1JFQH 1LNUB 4GT7A 5JXED 3QUXD 3MJ7A 4NM4L 4LNRA 1OTSC 3L3GA 1I3RA 4YDIH 3U2SB 1ND0B 1N26A 4R26L 1LP9E 4GBXB 3A67H 3QJHB 1MFBL 3ILQC 4RGOH 3ZT5A 1QSED 4HUNB 1TDQA 3IXAB 4X7DC 4FZ8H 1OTSD 3ELAT 5C0BA 1D7FA 1B3JA 1U2CA 1YQ2A 3MRBB 4ZFGL 1ZWIA 5CLWA 3WHXA 3GSQA 3ILQD 4Z7VB 5E2TH 2HN7B 4FQJH 5FHBH 4DUWA 1FAIH 3L5XL 4QRTA 5FUOH 5H35A 2QLVB 4E41D 1RJYB 5DVNA 4JRYA 3BDYH 2X4OA 3B9EA 4LHUG 1QFUL 5EH1A 3VXUE 4ZUUB 3SKMA 5ITFB 3H9HB 5HD8C 5J9PB 1RZKC 2LU4A 1JUFB 1JGLL 5EU4A 3MLZL 3NA9H 5ICYB 3EJYC 2APFA 3RZWA 2AQ1A 3NOIA 4KHXH 4OM1L 5C2UB 1UADC 3QEUB 2QSVA 4YUEL 2CDFB 5HD8D 4IJ3C 3JWNC 4KQ3H 1UYWL 3EJYD 2X6MA 4WEBH 5AWNH 2H9GB 2QQKL 4PFEA 4QTIL 5EIIB 1WZKA 4U6XB 4XWGL 5JW4M 3ARPA 1LEGA 3CDGB 5CEXB 1TZHA 1CR9H 5JHDD 1KCSL 1RUAH 4OV6F 4DAGL 3PXHA 1CD8A 3GO1H 5L2JB 3D2UB 4H8WH 1G9ML 3WFEL 3BD3A 5CEZE 2YSSA 3BZDA 3GSWB 5C8JB 2PR4L 2W65B 5C09A 1HIML 2ITDB 2GY5A 5GRYA 4Q97A 2VXSL 1YNKH 5C0CB 5TQ0L 5I73B 5EU6B 5IWLA 1NGQH 4PJFA 1RK1A 3TBWB 2Q3AA 3UZVB 1SM3H 2GCYB 4X5XB 2JTDA 1CGXA 3V79C 3ARDC 5F3BB 2AJUH 3D87B 3PDGA 4AH2B 2GI7A 3LY6A 5CAYB 5GRJH 3O41A 4GKZA 1BBDL 4V1DE 3V95A 3GGWB 5HSFA 4RX4D 3ARDD 1KJMA 3MQIA 2PTTB 3W0WB 4XNXH 5K9OA 4LCWE 1I7ZA 1SEQH 1IGML 4J6RH 4ODUB 4U31A 1IGCL 5DTFB 1X5AA 3KPPB 3WFDL 1ZT1A 2CRYA 1SMOA 4AEHH 2B5IC 4JFXB 2FSEB 1NKOA 2EE2A 1SJEB 1AIFA 4HKJA 3MRHA 4XAWL 2Q7NA 3QJFB 1YEKL 4MCYB 3WXWH 4QHNB 3PDOA 3RNKB 1QACA 1ZV5A 4JAMB 3PGFL 3QUZC 1JWUA 3O4LD 2ESVD 1LK2B 1T22A 1U8MB 3ZYZA 3QCVL 4NYLB 4HT1L 3KPSA 3IU4H 3ZL4L 1KLUA 3WN5C 3QUZD 1DQTA 1ORQA 3ARVA 2AABH 5F7DA 5EBMB 1CGYA 4I3GA 2C7UB 1U95B 4PREB 5CUSL 4UDUB 5I75C 4PG2C 5D1ZB 1FORH 3B9KC 4RAVA 1CGTA 2GTZB 4LMQE 4X6BB 4JKWA 5FM4A 3TF7C 3TO4C 4H1LA 3PF2A 3RBGA 2UUDK 1U9KA 5KSBF 1CGUA 4RAUB 3B9KD 1L9NA 4BSWA 1WEJL 3TO4D 3FQUA 3VXTA 2BFVL 4M48L 3FRPG 2BY1A 1X7QA 4PGCB 1WBYB 4WJ5B 2FH8A 4F8QA 2YA1A 2NY7L 4YHPB 3WLWC 5EBLB 4PJXE 3HRPA 5CIPH 2GQHA 4NQEE 4OD1H 1BQUA 2VIRB 4R7DB 5DHVA 4RMQA 4NQDD 4N90D 3MLYH 2C1PB 3THMH 2VR4A 3WLWD 5I1IL 4KMQA 1A2YB 4LU5L 1MHEB 5FYLH 5JQHC 1X5JA 1KXTB 1PVHA 4ONHB 1DL7L 3C08H 4U1SA 4P0DA 4M1GH 4AIZA 1BVKB 2EDYA 5TE6H 2Q8AL 5HYEA 1DVFC 5EC2A 4HMEA 4ELMB 1F3DH 4X6CB 3MLSH 1HINH 1KTLA 4UUJA 4LSTH 2P46B 4L4VD 1FYHB 4CAGA 4NRXA 4MJ5A 1J8HD 5E1HB 2N7AA 5I19L 1EDQA 2FD6L 4PB0L 3MJ8B 4JG1L 1DVFD 2WWKT 4AEIH 4WUUB 3C5JA 1X5HA 1U36A 3GMQB 5IOPA 3Q1SL 4LASH 1EK3A 1NDMB 4GSDL 3LN9A 2FATH 4MD5B 4CJ0A 4DGVH 1BD2E 5E7FA 1X44A 3U79A 2BNRE 2XT1B 3EO0A 4YBHA 1BWMA 3EYVA 1AXSB 3BPLB 1H3GA 3W5MA 4I0KA 1YNLL 1Q9OA 5EG6C 4Y4KA 1ORSB 5J12B 3GSUA 4RMVA 2PXYA 4LIQE 4TOYL 5IHZA 5LGJA 3CU1A 1CQYA 4NOFA 3PIQB 3KYNA 4OKVB 3CFIC 3STLA 2DLIA 1AXTL 1BQLL 1OLZA 3CFCL 1EO8L 3SGKC 2X05A 5ITBL 3Q2CA 4UB0H 3SKOA 4KXZI 4RFNB 3QEGH 4JZOB 5TJWK 2CXKA 2D7OA 1B90A 3EYQC 3EYOA 4Y19B 4K3JL 1HSAB 4PJHA 2XQBL 3LH2L 4WNQA 4PRPB 5HPMB 4LRIA 4I4WB 4U1IB 4RMWA 4TSBH 3EYQD 4WWKC 4GG6F 4G8GA 1N5YH 5I15L 3BP4B 4DFHA 5IBUG 2ATPA 1EAPA 1PG7X 4MJIE 5I1HL 1R0AL 1NUFA 1EZVY 3PJSB 4WWKD 3TBSB 1QRKA 1OARH 2K7PA 3ESVF 3HMXH 1HHIA 3FB8A 4K7PX 4OGYL 5I8KL 4RDQG 1R5IB 4HC1H 1EFXB 1HHGA 4HC1A 1UZ8B 3OAUH 4Y2DB 1UCBL 2XZCL 3S3SA 4LK4A 4PD4J 4OIIH 1R5VA 1NC2D 3MRJB 3GJFB 1ZT7A 4JPIB 1FG2B 1GPOL 2H1PH 1G7IB 3QDGB 4ZUWB 1VFUA 5LQBL 1MFEL 4XC1L 4PP2B 2IFGA 3FB5A 4M6ML 1WFUA 4Z76A 2V7HA 4Z7VE 3M8OH 2VABB 3TIDA 1DBBL 3NZ8B 1EIBA 1YQVL 1IC4H 2VWEE 3S88H 1T04B 4F7MA 2JB6A 1S7TB 1I9JL 5CKAA 4Z7OF 1NEZB 3DX7B 4P2RB 5DGRA 4H26B 4S0TD 3JTSA 5E2VH 2FRGP 4JO3H 1IAOA 1U42A 4NRZB 1GGBL 4OGXL 4CDHA 1KN4L 4P5TA 3MBXH 4ZDHA 1EERB 5BVJA 4GW5B 3DV4B 3L1OL 4XP1H 2QQNH 1DLHA 1T1ZA 4HIEB 1XIWC 4XX1G 3MRRA 4QKXB 4WHTA 1JGUH 5HVWA 1WTLA 2Z8WC 3Q3GB 4L5FL 4X9FA 2IPTH 3QWRD 1IZJA 5D1XA 5GS2D 4I18A 4WHCA 3WD5H 1WJ3A 1XIWD 3JWDC 3S35X 4ISVA 5FOBA 4Z6AT 1EAJA 1KENL 4EN3A 4U1LA 4UT7H 3NFNA 4LLQA 3CD4A 2ZSVA 2DAVA 1I1AA 4PRHA 3ZDYF 1FJ1A 3B8SA 4F7CA 3MRKB 1AD9A 2ED7A 5I1LB 1FAKT 5EUKA 1B0GA 1J1XH 4OM0L 3TH2T 1FZKB 4D94A 4K23L 5DHYA 2K7QA 3MRMA 5KZCD 2H6PA 3TN0A 1AGEA 3F7RA 2XWTA 4IDJL 5L2KD 1DE4B 3LIZH 5JOPE 3SEPA 4ZS6C 1NAML 1MCOH 3BJ91 1OPGL 4RRPG 5CJQL 4ETQA 3SO3C 4TUOA 1FVCB 3QZWA 1QNZL 3M17B 1PG7H 4NWTL 4YDJB 5JO5B 3JTTB 5EU6E 4I1NB 4JFOB 4ZS6D 1ZT4A 1JMZA 4JDVA 1DUYB 5L6YL 4DCQA 3D39E 4TTGA 4QRSA 1BQHB 3NPSC 4P4RB 2G60L 2XI9A 1WGOA 3ULVL 2FECL 2Z8VC 5J11B 4O2EA 4ALAL 1RZ7L 3SCMA 4WW1B 1Q1JH 2BSRB 3QUML 2A9ML 4YHZL 5HYSB 3W0WE 2X7LB 5DRWB 1HOCA 1A47A 4YIQA 5DEFB 4M6NH 2WAHA 3OQ3B 4NCDA 5IEKB 3S5LA 5HYIA 4YBQC 2YKLL 1N5AA 3NMEA 1H0DB 3UDWC 1DSFL 2ZCLL 5AAWA 1C16A 4OCWH 1YEEH 3VXOB 4PPTA 3VXRE 3V6BR 3W9DB 3A6BH 3DYPA 1RJLB 3G04B 1J7VR 3EYUH 3KDMB 4HF5L 3UPAA 4D8PB 2VDRL 4K7FA 2VQ1B 1CLOL 3DRTA 3TM6A 1QFWH 3H0TB 1LD9A 2YK1H 3KWWA 3T0WA 2XA8L 3O6ML 3QDJA 5IP4A 1CXKA 3RY6C 5DJXA 5F70A 1TMCB 3EO1B 5ICZB 3HMWH 1A1OB 4KV5F 1WLHA 2WLZA 3U7YL 1PX4A 4ZOBA 3S35H 3MROA 2W60A 5DUBA 1W8NA 1FYTD 1B0WA 2NY1B 4RZCB 1QBMH 1JZ6A 1ZGLB 1UG9A 3MCLH 4R3SA 3LB6C 5C9JB 2AJ3A 3KYKH 2OTWA 1MJJB 5AZEL 1H3VA 5ESQA 2Y9RT 2FL5B 2P5ED 4YZFF 5F3HA 3WIHL 5MENE 3BAEH 2F5AH 4G9FB 4LLMA 5D70H 4EI6B 3I6KB 3QH3B 4WU5B 4XNQB 1CFQB 3CVIL 5FECB 3FRUA 3VXUD 2VZOA 2GAZB 3BD4A 5CBEB 5I18L 2NY4C 2UY6A 1LK3H 4XCNB 3VD5A 2VZ1A 4NN5C 3QSKB 2UVEA 3MLWH 2QSQA 3UO1L 4HXBH 1N7MH 2ATKB 4RMUA 1D6VH 4KTDH 1EMTL 4X6CE 1VEMA 2NY4D 3FQRA 2OP4H 1AKJB 2RCSH 2VC2L 1N4XL 1F3JA 3TNNA 1YDPB 3BMVA 3C5ZB 2Q76A 4UQ3B 2GTWB 4FQQB 3WSQH 1RUPH 1TCRB 2HKHH 2ZUSA 2O5XL 3D18B 2X4QB 2ARJQ 3GMLB 4L3AA 4WI8A 2E27H 3ARQA 4EEEA 2P8LB 1MH5A 5HVHC 1YMMA 3NCJH 2YWZA 3DSNA 2WQ8A 2BSTB 3QPQC 1XGTB 1S9WB 1CFSB 5CEZD 2DJSA 1XCQA 3KPMB 3RI5F 5GZNC 1VPOH 1KCUL 1AGBB 1FO0L 4F9PA 1CDGA 3QPQD 3SBWA 3VXNA 2VLRD 4K3HA 5GZND 1RIVH 3MACL 4H20L 4W81A 1TITA 4L8SA 5C71A 1IAIL 2DQIL 4NCC1 1IGFH 2O61B 5KVEL 1KXVC 3RTQA 1LQSR 5H94A 2VXUH 3PWUB 4V1DD 2BY0A 1Y0LB 3U46B 3OL2A 3D6GA 5IV2B 4PRPE 1ED3A 1AFVH 1P2CA 1YN6B 4ONGL 4N0CC 1FE8H 5B39A 4F7TA 1U8LA 2OL3H 4XPTL 1XGYL 3GBMH 5DFWH 8CGTA 3GMRA 3LHPL 1N64H 3VRIB 3HCVA 5J1SC 4L8DA 4CVWA 4PJCF 4N0CD 5DYOA 2VNCA 5MEOA 3VFPA 1EBAA 2NW3B 1J0JA 5KSAB 3HC4H 43CAA 5E8NB 4G9DA 4LHUD 5D1QC 4P23B 3HE7C 3T0BA 4APQA 1NGYA 3MNZB 1MAJA 3N0PB 4YHLH 2WUBL 3U0TA 3DSFL 2DQJH 2JJVA 3VE0B 2WBJB 4F57L 5D1QD 4I5BB 3HE7D 1QUNA 4KI5E 3JSSA 2FZ3A 4WFHE 4JZNB 1JNNH 3TZVC 3QDGE 1AO7E 4FTVD 1E6OH 2R2CA 1QSFA 2R1XA 3QWOB 4NKOB 2AXFA 4R0LA 3VFNB 4NNPH 4PRDA 1MQ8A 1WT5C 1CD9B 3QHZH 4LSQH 2NX5B 5FYJU 3NN8A 4KUCF 3MJ9A 1VFAA 4S0SD 3TZVD 4BJLA 2OSLB 3V52L 4JJ5A 3VXSB 2QJDA 1TLKA 2NY3C 1J11A 5F1NB 3D1MC 4HDIB 2KDGA 4P2RE 4C4KT 4NQSA 3UTZB 2IFFH 5BRZD 1KCRH 1LEKA 3QXUA 2NY3D 4ZO7A 3G6JB 1VB9A 2KKQA 5CCKH 1RZJH 1MI5B 4EQ3A 4HW6A 4WFFD 4NQED 4N68A 1RURH 3WNMA 1AJ7L 4YX2H 3CFEB 2M8XA 4XVSH 3V4PH 3LKSB 3QUKA 1PFCA 1L7IH 1DDHA 4NQCB 5IIEB 1TTUA 4XMLH 4EVNB 1N6UA 2YBRA 2D7TH 4M02A 1HYRC 5KG9A 2Z91A 4D0CB 4F7EB 5FV1L 3JXAA 5GSRA 3LQZA 1R6VA 1W0VA 5T3XL 1MRFL 4RSVA 3ALPA 4R7NA 3ARFB 5C92A 1KBGH 4J7RA 1CLCA 3JWOH 5GGVH 4JFYB 5E94B 3PNWA 3EOBA 2J8OA 5IEHA 3O4OC 5A3IC 4L4TB 1WIOA 1HI6A 2VDQH 2XICA 3DIFA 4CMHB 1TJGH 3BRGC 4HK0A 1RSFA 1V3MA 4ZO6A 1LEIB 1KCLA 1P4IH 3WL9A 3W9EB 3DO7A 5A3ID 3GKZA 5T3ZE 5E4IA 1ULVA 4JM2F 3S36L 4GRMB 2PYEA 5DJ0A 1MLCA 2BNRD 3UTSB 5FA3A 2I5YL 4Z7WA 4X4YB 1NBZA 4LFHG 4JQIH 3NBNA 4BUHA 1HH9B 4KKAD 3HR5B 1LO2L 5CJOL 4XWOC 5TDPB 3OZ9L 1NSNL 1J0KA 5JIHA 5LCVH 4Y16B 3LZFL 4NN6C 4E42A 1CDBA 3W2DH 5DJZB 4EUPA 4UV7L 4M5ZL 4XWOD 5C08B 1TQBC 4KDTC 2Y1VA 3MV7A 1Q9KB 1T2QH 3D3VE 4MCZA 1K85A 2A74B 2DM7A 2QSCL 4W4OC 4B41A 1BOGA 3SPVB 3MV8D 3TT3H 1ZLSH 4ZNCD 2XQYK 3DX8B 4WI2A 3N1PC 5DDHA 3CSGA 4HPOL 4WCYL 5KVFL 5IVOA 1JN6B 5HYJA 4PJDB 4P46C 4YDVB 5I8CA 2CUMA 1CDCA 1FZJA 4PR5B 2D03L 5CSZB 1FBIH 4RISL 1P53A 2P24B 5E6YA 5SV3A 3P11H 1EV2E 2ICWA 5I16A 2DQDL 1RUKL 2E3VA 4P46D 2HFGL 4MZ2A 1LO4H 1A4JA 1WC7A 4WUKH 3FAXA 3HNSH 2PTVA 3TBYA 3C5SB 4J3SA 3DMMA 3ULUL 4X5WB 4UI2A 3T77B 1CQKA 5C0IB 4QLRA 1AHWC 3KVQA 4BFIA 5FCUH 5DXWA 4ZAKB 5ACLA 1S7SA 3ZT7A 4OCRH 3QEQB 2AJSL 2VXTL 5CP3H 3O3BA 1DQQA 4FMFA 5D96C 4CVUA 3LEVH 1CDIA 2YUVA 4ZQKA 3LSOA 2EDBA 1B9ZA 5C0FA 2IG2L 4QRQA 1FNEA 1EEYB 3KJ4C 4MA7L 5A16A 4MA1B 6FABH 4OZHB 3CXDL 3RGHA 1NMAH 3RPIB 1BBJB 1RMFH 4PJ8B 1D5MA 4X6DE 4LF3B 4NO5A 3QNXA 4LLUA 4MSWA 4R4NC 2BOCA 1DQDL 5I1DA 1T1YA 4BQ8A 3KGRA 5F9OL 3S34L 4ZODA 1QO3A 1YPZE 4LMQI 2A6KB 3T3PF 4UNTA 4HXAL 2YC1A 4R4ND 3LN4A 5EORH 3EYSH 1GC1L 3I6LE 2AK4A 3T0XA 1K5NA 2AJYH 4ZFZB 3HZYB 2EKJA 2OZ4L 3BN3B 1M71B 3H9SA 1S9YA 1FFRA 2O5YH 1EBPA 2IWGA 3D25A 3E6HA 3OJVC 1UB5A 4PG9B 2G5BA 3RDTA 3O9WA 5CBAB 4H88L 4KC3B 2EYRA 3ARBC 3T1FB 1Q0YL 2OMBA 5JOFB 4EDWH 3HR6A 1CE6B 4L8CB 2D2OA 3VWJB 3QFJD 1CI5A 5TE4L 4RFOL 2BVQB 12E8H 4K3DL 2BCKB 1YEFL 3UPRA 4JR9L 3ARBD 2HRPL 4MNGB 1TVHA 3AU1A 5HGDA 1EFQA 1KFAL 4R26H 3GI8L 4G43A 4YHNB 4Y5VA 4DVRH 1RD6A 3ARGC 4OQTH 3MCG1 4HH8A 3GUTA 1DQJB 5JOPD 2H2SC 3GMPA 4ZFGH 3AAZB 4XVJL 5HDQH 1CIUA 3ARGD 3TNMA 4ELKA 2VMFA 3UTTA 1UH4A 2K1MA 4Q6YA 2H2SD 3VA2C 2BVOB 1F6AA 4JFEA 3W11C 4HUWA 5HGGS 3D39D 2RFXB 3AUVA 5J13C 4X9HA 1GGIL 1OAQH 3IDXL 5JHLL 2VDNL 4TVPE 4NKDB 5CIPB 1PW3A 4XNZB 3UYRL 2DQFA 3W11D 5KVGL 3VCLB 2UZIH 3R1GL 1V3LA 3DETC 3WNPA 3MLZH 1X3DA 4RMRA 5E8PB 1I9EA 1UB6B 5GGVY 3LV3B 3D69A 1T0NB 3HZKB 5J56B 2JJTA 1A9BB 1TJIH 4L9LB 1LILA 3DETD 5DJ6A 4UTBH 3VGGA 1UYWH 4NM8L 1SYVA 5BS0E 1P1ZA 5BMFH 3B2VH 4XWGH 5DUMH 4G80A 5D72L 2BDNL 1K4CB 3VXRD 4FQIH 1TZIB 3CMOL 5DK0A 5T1KD 1MRDL 3L3DB 1KCSH 1VHPA 4TNWF 3V6OA 4K9EC 4HD9A 4L3EA 2GY7B 3TYGL 3FQXA 4AG4H 5CD3B 2R4SH 4XB8A 5C6WH 2XPGA 4JFFA 3LRGA 4WI5A 3V9FA 2IGFH 4GMSL 3BDBA 4ZPTB 3WFEH 2MQ0A 4CBPA 3HPLB 3H3BC 4KVCH 1INDL 3VFOB 5ADOH 4XH2A 1HIMH 2A83B 5A2FA 2O93L 4UAOC 1B6UA 1QBBA 4YXKL 4HEPG 5DMIH 1R3KA 3WIIH 3V0VB 1ZVSA 4XCFL 1AE6H 1QSVA 4Y4FC 2JIXD 2IMMA 1MCBA 2MNUA 3PQYB 4YBLB 2NW2B 3LKQB 1J12A 4UZGA 3LQMA 3OXSA 3U9UB 4XBPA 1L7TL 5HI5C 2G9HA 3BE1L 2D3VA 3BGFC 4Y4FD 4FABH 1G6RB 3RIAF 1OLLA 1J1PL 3QXDA 4JO4H 1CICA 3G6JE 4P2QD 5I1KH 3TPUA 5T5FL 4N0FB 1ITBB 5MEND 1MJUL 5HI5D 5CMAB 2QKIA 5SX5H 4XP4L 1IGCH 1BZ7A 4QRPA 3P0VH 4R90L 2ZG2A 3RWDB 2AJZA 5IM7A 2IAMA 4X7EC 3FO9B 2WINA 3DI3B 2YD8A 3HAEA 1T21A 3UEZA 5KSBB 1MPAL 3BGMB 2ADIB 1G9EA 3D85A 3PGFH 2GFBB 1CD1A 2DOCA 5BVPL 5JMOC 2AJVL 4U6HA 3O6KL 4H25A 4FQ2L 1E6JL 2PO6C 5IJVA 3RVXC 4L4TE 5J89A 1XGQB 1CS6A 3UTQA 1I8MA 3OGCA 3BPCA 1I7TA 1FFNB 1KB9J 5FO8A 2PO6D 4MNQE 1WFTA 5KSVA 1QA9A 5F7HA 5J06A 2DMBA 1UWXK 1NGWB 1HILA 2N1KA 2MQ3A 5DI8B 3TA3C 1UVQB 1VKXA 4C56D 5GGRA 4HKBB 5KN5A 1GOHA 3FN0L 1I1FA 2HVKA 1KV3A 2ADJB 1OTUC 2MJWA 3NIFF 5JW3L 1ES0B 1YMHB 2E7MA 5IKCB 5KSUB 3TA3D 2NY2B 3IDIB 5D2NE 1S9KC 4HUUB 4M48H 4KI1A 3T4AB 1FFPB 1OTUD 4ZFFA 5IFJB 4HUXB 2NY7H 3V0AC 4ODVL 1SQ2N 1TVBA 1A22B 4P5MA 4IS6B 1F8TH 2A6IA 4OZFH 3UYOD 3G5XA 2CD0A 5F7LB 2AW2A 1T5XA 5BOZG 1YEDA 3FQWB 4U1JB 3EW3B 2CMRL 5I1IH 1LO3L 1RULL 3FFDB 4K8RC 2FHFA 4JQXA 4LU5H 3TVMC 4MJ2A 3UP1A 1HK6A 1JTPA 1FVEB 3GB7B 4BZYA 3DPBA 1CXHA 5ERWA 4MAUH 3VG9B 2Q8AH 1UM5L 4PJDE 1KCVH 1Z5LA 5E2UL 3L6FB 2N56A 2D0FA 3CSPA 2DM2A 4K8RD 3TVMD 3SN6N 2W38A 4RGNC 3TJEL 5HGBB 5IF0B 2CDEB 2WUCH 2EDJA 3QIBC 4PB0H 4XAKD 1AGFA 1RHHA 5C0NC 4BSVB 5I30H 1KJVA 4GAJH 4RGND 4HS6A 5HHMD 1VDGA 1QSZA 3QPXH 3BSZH 3HE6B 4KI5C 4CMMA 1KJ2B 4J3VA 5C0ND 4ZOCA 1EFXD 1MIEH 1NGZA 2MWCA 4PB9L 5E9DA 4BQ9A 4N9GB 3I9GL 4KI5D 3QRGL 1S7RB 4WFHD 1I9IL 2DJUA 4GG6B 4KTEL 3QDGD 3KPRA 1AO7D 1T7WA 2WV3A 1OP9A 4LCCB 4PV9B 1CE1H 3O3UN 1DUZA 4TOYH 2ADFL 4HPYL 2VRAA 4C55A 2R69H 5KS9F 2HWZL 4D0BA 1KLGA 3QULB 5HHNA 3HI1B 1BQLH 1EO8H 2CK2A 4OZHE 4PJGF 1V7NH 1UKSA 2X40A 3FOMB 4GG8A 4GRWF 5E03A 1HQ4A 1N3NB 5JDSA 2HJFB 1U3HA 3N85L 2EDOA 5JR1H 3QI9A 3I85A 3BEVA 3NCMA 4ONOA 1HHJA 3HG1B 4FOMA 4OCSH 1QRNA 1HHKB 2EE6A 2FEEL 4CW1B 3VXMD 3ZE2F 1IQDB 4EDXB 4BK5A 1GCFA 4YXHL 4JPVL 5FM5O 5CWSA 3DUUA 4X8JB 3HZMB 5I15H 1I7UB 5E5RB 4LKCB 5I1HH 4WV1C 3P4NA 4S2SA 1IKNA 3VJ6B 2ZOLA 35C8H 4ZPVB 5GS1B 2R0ZL 1IGJB 1RZKH 4OFYD 1OAUL 5DEZA 1ZLWH 4O51A 4O2CB 1HWGB 2NY6C 3K2UH 2I27N 3ZYIA 4DKFL 3MFGB 3PWPA 4WU7A 1BFVL 3BP6B 2GJ6A 1FDLH 4J1UA 3QIBA 3U1SL 2BSSB 4HIIA 5D71L 3KLDA 4MD0A 2MPAL 2DKUA 2YR3A 1GPOH 1PD6A 3G6AB 4KAQL 5IUSA 5T3ZD 5FKPA 5MHSE 3MRNA 1CGSL 3QQ4A 5DJCB 4X98B 4KXZH 4Y7MA 4Y4HB 3K1KC 1AGDB 3V2AR 4U6VL 4PGBB 3O3AB 5IQ9B 1GGUA 2DQGL 1LO5A 2XFXB 4I2XA 2C26A 3EKCA 2DI8A 3LOWA 2CLRB 3CX5K 4XCCH 4CDGC 1HZHL 3DXAD 1JWSA 1QQDB 1KN4H 4O9HL 4YPGB 3MRCA 3Q0HA 4JB9L 1FNSL 1HQRA 4MS8C 3H7BA 1JHLH 4IRJA 3D3VD 1U8NB 1P7QB 4PLOB 2GSGB 3I50H 4NQTA 2ENSA 1XF3A 4MS8D 5FYLE 3CFDA 2DWDB 1UM6H 2D7PA 1T1XA 4PJ5B 4WTZG 2MKLC 2V17H 5A40E 3MCKB 3EJJX 1B4RA 4NUGH 1NCNA 3D0VA 3RGVA 4KZEH 1OAYL 3SDCB 1KG0B 5IR1A 1U3JA 1AQDA 3DHMA 4GRWH 1CDYA 5TDOA 3O0RL 3IXTB 3E6FA 4PRNB 3UCRA 2APWA 4OSUL 1H8OA 1YYMH 5CS7A 4QXUL 5GGQH 3GIZH 4WI6A 3X11A 1IVLA 1P5UA 1G0YR 4PY8J 1J0IA 3MODH 2DTMH 3WJJC 2HAZA 3OAZK 1BZ9A 4K55A 2VERN 4TRPH 4LCIL 4WW2C 2HVJB 1NAMA 3MNWA 3VFTB 2AGJL 2P5WD 4U0RC 5CJQH 3HC0B 3QIWB 5I17A 1BLNA 2NTSP 2C3VA 4NWTH 2W9EL 1H5BC 2IQAB 3JV4B 5MEQB 4F15B 3PQYE 5ADPH 2DQTH 1HXYA 5ABDE 4HQQH 5I1GH 3RL2B 2A6DB 2VLJA 1AI1H 1U8IA 3P4OA 3FONA 5I1CL 4P4KB 1RZ7H 3AREA 5LJYH 2YZ1A 5C07A 2A9MH 4YHZH 4I0PC 3QUMA 1INQA 1CD0A 3ZTJH 1X5XA 2DLGA 5SWSD 4FS0A 1XGPB 4JFQB 5EIVA 1FG9C 1JGVL 5GSVA 1UEMA 2P8MA 2FIKB 4HX1B 2YKLH 5FXCH 3I6LD 2OL3B 5ID0A 4I0PD 3ZHKA 1UXSB 3SQOL 1DSFH 5CHNB 1ZA6A 5KSBE 2EIDA 4GKOA 1K2DA 5BZWB 2AERT 5DQJA 3GZKA 2VLME 1UXWA 2FHCA 5IBLC 5HDOA 1G6VK 3TJHC 3GKWL 3OV6A 3KLAB 3H3PH 1QYGL 2LTQB 5E1AB 2Q8BH 2ZWLT 4BKLA 4HJGB 1GHFL 4NZRH 5IBLD 3TJHD 3EYFA 4UQ2A 2AQ2A 2AEPL 2NY0C 4P9MH 2JCCA 1IGIL 1FH5H 1KYOK 2B8OT 2FDBP 5DRZA 4BZ2L 4F7PB 3OKKA 1NMBL 5C0AB 3T3MF 2X1OA 3BZFA 3BZ4A 1PX3A 3P0GB 1AGCB 5ACMA 4G6KL 2YMXH 3F12A 4O02H 5DSCA 3U7YH 2NY0D 2BRRL 4CADA 1MCRA 3OXRB 4HG4J 4KJYA 1DJSA 2JJSA 4LEXH 5ETUB 3IDMA 1D6EA 2VXVH 4P3WA 5KOMC 4HEME 5ESAA 1G7MA 3LKNA 2Z4QA 2J6EA 2X4NB 1JCKA 3GDBA 4U1GC 5EZOL 2R23A 4QOKA 4RIRB 2ZUQB 3WIHA 2BC4A 1A7BA 2FR4B 2D31A 2R8SH 4PTTB 3T0EE 4TVPD 1MFAL 1NBYA 4OD3L 3EOYG 1LDPH 43C9A 4U1KB 3RUGF 2CIKB 3E2HC 3MRLA 2VN4A 3MNVA 4JM4H 3LQAL 1FFQA 2X70B 4JFDB 4Y5YC 4OZGE 4QGTA 5DD3L 3UO1H 3C09B 1J05A 4GQ9L 4P2OC 4MWFA 2H3NA 2R1YA 5D8JH 5DJ2A 3IDJB 8FABB 1N4XH 4GRLA 5BS0D 5DMJB 2Y5TA 4FFYL 1CLZL 4TQEH 2GT9B 5IB1A 2O5XH 1D5BA 1JGEA 1XF5A 2CK0H 2DIJA 1QBLH 4R2GC 2JELL 1LE9A 1C5CL 4JKPL 4UMGA 1KIPA 3J8F7 3VH8G 4DVBB 3MJ6A 5DHXB 2LAAA 3HPJA 5A43C 2X4TB 4DUXA 1YJDL 4PJ7A 5F7UA 2ILLA 4X7TA 3VXPB 5IMKB 5FGBC 2V7NB 2R9HC 5FKAA 4NT6A 4R2GD 4UTAH 5M95B 3QDMA 5C2BH 3B5HA 4PTUA 1EEUA 1ZEAL 2APBA 5EFIB 1KPVA 4XRCA 5TDNB 1FO0H 3PV6B 4LKXB 3HLAA 1MCPH 1CT8A 1F4WH 3BWAB 4YFDB 1OAKH 3PXJA 4PJCB 3BXNA 5CZKA 1ZAGA 5EOQL 3V4VH 1RIHH 4HLZH 3L95B 4KMTH 4XMPL 3O6LH 4QRRD 5FYJL 5KVMC 2V5RA 4MXVF 3EDDA 3P40A 5EU5B 2H26B 1LVEA 5IESH 2P7TA 5D93B 4D9LL 5I76A 3SKUD 3BQUA 3HG1E 3RA7H 2FJHB 1MHHB 1I3GH 4Y1AA 4N1EA 3MRQB 5B4MC 5FM5M 4N8VG 4PRIE 1E27A 4XPTH 5F96H 1BPVA 5GJSH 1TTGA 2DYPA 5SWQB 2OXGA 1FIGL 2PUQT 2GK0A 5B4MD 1H15B 1P4BH 1PZ5B 2Z8RA 3AM8C 5DK3A 3KNBA 3K3QA 2XNAB 1JPGB 4YHML 5GS2H 3KLHC 1SVCP 2XY1A 5AG9A 3WFCL 3O8XB 1XAUA 3AXLA 2D0GA 2YD9A 4JHWL 4P2OA 1J86A 1V5JA 5D5MA 3G5ZA 4OIAA 3KLHD 3F7PC 4RA3A 2WUBH 1QEWB 3E3QC 3PP3H 4F57H 3C6LA 2DLHA 5BJTA 3IAGC 2XKNB 4FXKA 4G6ML 3VFUA 1IM9A 5EPMA 4MNQD 2HFFA 2XWJB 2YD5A 3NACH 2J3SA 2Q20A 1XCTB 2PW2B 1E4KC 4HWBH 5D2NC 3GSOB 3MLRL 3WO4C 3U7WL 3L3HB 3P0YH 5T33L 4PJEA 4ZD3L 5TH2A 1VFBA 1KIRB 3ZDYE 5M7QA 5B3JE 1FZMB 1R3IL 1KTRL 1JF6A 3HUJF 3QO0A 1GAFH 4OD2A 4X80L 1SBBA 4CNIA 5LAXB 4AL8L 2UVFA 1KLFA 4JDZB 3DVGB 4OLUL 5ILTH 2B1HH 5BV7C 4ZNEE 3OR6A 4NSKA 1X5IA 2BY3A 4JM2B 3BT2H 3K46A 4HAGA 3LS5L 4NNXA 3CC5A 5D9SA 4TPRL 1JGDA 1J0HA 5L88L 4U49A 5IFHH 3VW3L 1F11B 4LRNL 1MCLA 2BNQB 5AZ2H 4DGYH 2EKSB 5T3XH 1ACZA 3OB0H 1MRFH 4IHOA 2EH8H 3CSYB 4PS4H 5ANMA 2F53E 2ZOKA 3RKDC 1AQKL 1M05B 2IH1B 2F54B 4TSCH 5GRUL 4YHOH 3LKRA 4HK3N 3BH8A 3DGGA 2H32H 2H32A 3G6DL 1C08B 2Y4SA 4EI5B 4NPYB 4P57A 3RKDD 3B9VA 4MB4A 4D0DA 1MY7A 3JVGC 4D2NA 2R0WH 3N1MC 4CJ1A 3L5WB 4CVXB 1C1EL 2N4IA 2Q7YB 3RNQB 5HY9B 1P7KB 5IW1A 4HKXB 3R06A 1MF2L 3LMJL 1BFTA 4LLAA 3ILPA 2SEBB 3L9RB 2X5PA 3FZUC 2F8VA 3ZSSA 2ZUVA 1DFBL 2I5YH 4KU1A 3RJDA 2CUIA 1LP9A 4ZTPL 4DUVA 3FZUD 3MR9A 1WWBX 1U3ZA 1I7RA 4MA3B 2ZKHH 3K4AA 3LZFH 4UIMA 4UV7H 3RVWD 3BYTA 3DVFA 1E4KA 3I75A 4FFZH 5INCA 4AEEA 4QWWC 1TXKA 4AENB 1N0XH 4IOIB 1JV5A 3KYMA 7FABH 1LGVA 4LEOA 3QIUB 4HS3B 4AM0B 4RNRB 1MCDA 3MZTA 4KV5E 1BX2B 2V9RA 3UJIH 4QWWD 2DQCL 3VWKA 1E28A 4OKDA 4WCYH 5KVFH 3D0LB 1FNGA 5IVXF 3MRPA 4YQXL 5DWUH 4J3OC 1TPXC 3RWEA 5D7JB 1PLGL 3DI2B 5I1EL 5TGBA 1M7XA 1IGYB 2Z92A 3F7YA 3GM0A 4OBSA 4QY8B 3SO5A 2DQDH 4LDLB 3OPZH 2PYFB 4JRXE 1DBAH 3WLBA 1FZOA 4LLDA 4HS8L 4K2UL 1A14H 1EXUB 1CFNB 4G5ZH 4H0GA 3S4SB 3FN9A 3VFRA 1WZMA 1CK0L 1IEBA 4FA8A 1S7UA 1H3WM 3KR3L 2AJSH 1YEGL 3QCTL 4R8WH 4Y5XB 4ZXBB 1G7QB 3SDYL 1ETZA 3L7EA 4LCUB 3BUYB 3S98A 1MRCH 3IFOB 3SY0A 3HC3H 4MA7H 5L0QC 5CEZH 1SMAA 5D7KD 5IB5A 5HHVH 4J3XA 4NKMA 3CXDH 1RZGB 2ARJA 1JTOA 4XP5H 3FCTA 4X7SL 1NDGA 2R2EA 2V2TB 3CGTA 1JTTA 5BW7C 3TCXA 3O6FC 1FGVH 5TPWL 3IDYB 4XHJC 4YR6A 1FHGA 1W0WA 4XP9H 4BZ1L 3O6FD 4XHJD 5L9DH 2OZ4A 1UACL 1RIUH 4NO3A 1M7DA 2V2XA 5BQ7B 3S3JA 3SDAC 1ONQA 3D5OF 4LCWA 3LEYH 1F4XH 1T5WB 4Y8DC 2WIIB 3SDAD 4RMSA 2WBWB 3L3JA 1V7ML 1JYWA 1PG7W 4CN6A 2CDGA 1T2XA 4XPAH 4ZYKB 3ZE1F 4PY7B 3PE9A 3CFKA 3O2DL 4HWZA 4LSRH 4PJBE 1S78C 4NRYA 3V5KA 3ALWA 5FUCE 1X5GA 1MJ8L 3L3GB 2A73B 3O3EA 1JFQL 1K8DA 3CH8A 5T1LD 1SJHA 1OGAB 4NZTH 1S78D 5DVOA 3MUGB 3WUWB 4XVJH 1T1WB 2EO9A 1IFHH 4PJCE 5C0RH 1ZE3C 5EUOB 2HH0H 5C0BB 5ESVB 4YDIL 2BVPA 1KTDB 1VGEH 4OCMC 4GKNA 1JZ8A 1OF2A 3A67L 1ZXQA 5GS0D 3NAAH 4FZ8L 1XFPA 2AJXH 2VDNH 4P9HC 2CLVB 3DROA 4W6YB 4OZFB 4FQJL 5KVGH 3BP5A 2YPLB 2X4OB 5J0BA 3CFBA 4RFEA 5FA4B 3PWLA 5T1DH 4PJXA 4JO2L 3BDYL 5ICXA 4MAYC 4R4BA 3U82B 1Q8MA 1X4YA 4IRSA 4Z78B 1FVDB 5JZ7C 2FGWH 1PKQA 4KROB 3KXFD 1D5XB 1JF1A 4M93B 1MFDH 4MAYD 1PKOA 1EEZA 4W4NA 1Z9MA 2DTSA 3KPQB 4KHXL 1I8LA 5JZ7D 3BRDA 3K74B 4FNLH 3TC9A 3G5VB 3IYLW 4GMSH 4WEBL 5AWNL 4Q6IC 2VUOA 2C9AA 1IKFL 4Z5RB 4MDIB 2YEZA 5DS8B 1Q9WA 3MRIB 2Y07L 4JEGB 1CR9L 1FC2D 3P73A 2VISA 3TCLA 5HPOA 3IKCB 1BD2A 4H8WL 3KYAA 4QRUB 1QSEB 2G75A 3RWCA 4DZBA 4ZFOB 1L7TH 3SQBA 1P5VA 2LU7A 4OZIE 4PGDB 3T0EC 1YNKL 5D7IF 3TT1H 1NGXB 4LIQH 2E8ZA 2W0KA 4LQ1A 3DV6A 5EWIH 3ES6A 1A1NA 4OF7A 5T5FH 1NGQL 4ZG1A 1MJUH 3P77B 2XN9E 3GSRA 4E41B 1SM3L 3T0ED 1H3PH 1KNOA 3BYYA 4X5LA 1JK8A 1OSZB 1FL5A 2AJUL 5HHQA 3G08B 3MTRA 5I74C 2UWEF 2OJEA 1MPAH 2BNQE 3GJEA 5ISZA 1RJZA 4TNVF 4XNXL 1U93B 3W39A 4O4YH 1WFOA 1DCLA 4J6RL 3LKPB 4LCYB 4NOBA 4AEHL 3DURA 4OCNC 1I8KB 1PAMA 2X1PA 1OSPH 1T22B 3F5WA 1BFOB 4MJIA 3WXWL 5GRZA 1RK0A 1JZ4A 4N5UA 5F88B 1CVRA 3KS0J 2CPCA 4JHAH 4RDQF 4F2MA 2YPKB 4W6XB 4JZJC 5JHDB 3J7HA 1BWWA 3UBXA 3NZHH 1I1CA 1LNUA 3P4LA 4WI4A 2UYLB 4MJ6B 2YA0A 2AABL 1JNHB 1IJ9A 3HTLX 5HVGB 3U2SA 1NUNB 5C0EB 1ND0A 3DYOA 4NKQB 4GBXA 3QJHA 5FGSA 3GRWH 3QG7H 7CGTA 1FORL 3IXAA 3X17A 2LFGA 5T5NG 2C1OB 3IDNB 3MRBA 3WYRA 3FQUB 4U1MB 5F7YC 2HN7A 1PSKH 5DT1H 1KACB 2DLFH 1MFNA 5DHVB 2DIAA 1BF2A 2NZ9C 2YPVH 4Q7DA 1Z3GH 3ARDB 3KPOB 5FGCE 4PRID 2X4UB 3T8XB 5E2UH 4OD1L 4S10A 4U1SB 2NZ9D 5D7LE 3MLYL 4ZUUA 5KS9B 5ITFA 1EUTA 3H9HA 5J9PA 1IEHA 3THML 4M8QB 4PJAF 1CGWA 2VSCA 3PP3K 1CXIA 1JUFA 4PJGB 2WK2A 4GRWB 5FYLL 3RZCC 1D3CA 4OZ4B 5ICYA 3C08L 4GXVH 4NRXB 4I48B 4M1GL 4DGIH 1B2WL 1HN1A 3MLSL 1HINL 2B5IB 3RZCD 3O4LB 2ESVB 4LSTL 5J4MA 3TIEB 1Z0NA 5EIIA 1RY7B 4U6XA 4IOFC 3MYZA 1AR2A 4AEIL 3CDGA 3I2CH 3U0PB 3QUZB 5CEXA 4NBYB 4KTEH 3WO3B 4LASL 4IOFD 5L2JA 3D2UA 3WXVH 2YD4A 5EO0A 3WN5B 2HWZH 4DGVL 2FLBT 2W65A 4DN4H 3PGDB 5LGJB 2ITDA 3BP7B 4LVNC 1CFTA 3BHBB 4XPGH 3GI9H 2IPKB 4P3DB 1G7HA 5C0CA 5C6TH 5I75B 2IANA 3DVNB 3B9KB 1L0XA 5EU6A 1HWHB 3TO4B 5GGUB 3TBWA 2AV1B 2GCYA 5GS0L 4X5XA 3FQNA 4P99A 1ZHBB 2Z31C 5F3BA 3PWNB 3CVHH 1G6RL 4UB0L 1RHFA 4WNQB 4NQDB 3GGWA 1VESA 3QEGL 4A2LA 5I8OH 2Z31D 5HYQB 4N1CA 1CDJA 5IVZB 2PTTA 3W0WA 2QQLH 4ODUA 2F53D 5DTFA 4FQCH 3KPPA 1X5FA 4OCLC 3WFBH 4JFXA 2FSEA 1JZ7A 4TSBL 5LXGH 1SJEA 4HGWA 4L4VB 3QJFA 4MCYA 3QAZC 4QHNA 1INEH 1J8HB 1N5YL 3RNKA 3GNMH 4U4BA 4JAMA 5JNYB 1DVFB 2AK1H 1J0ZA 3P2TA 1LK2A 3MBEC 3IFNH 2Y5EA 1OARL 5ID1B 2DRUA 4KAQH 1U8MA 4NN7B 3H8NA 3HMXL 1KGCE 1K4DB 4OFDA 1EHNA 3ARRA 1MUJB 2BXZA 4KHTL 1A7PH 1JVKA 1UJTA 1L6ZA 4U2ZA 3MBED 5EBMA 4ERSH 3OAUL 3BMWA 3WFHB 4K9EH 2C7UA 1U95A 3JBG7 5C0BE 4PREA 1DN2A 4UDUA 3FB5B 1CIDA 4OFPA 5D1ZA 4X6BA 1FNAA 2GTZA 2FHBA 2V7HB 4XBGB 4XCEB 4O9HH 1FNSH 5ENWB 4RAUA 4YE4L 3M8OL 3WKNA 4OUUB 3QXAB 3S88L 4PGCA 1WBYA 4U7MA 4WJ5A 3WV0A 5E2VL 5EBLA 4JO3L 5CGTA 4OLXH 3MBXL 2A9NH 2NPLX 2VIRA 1VADB 4R7DA 3ARZA 3LRHA 4OTXH 2OTPA 1C5BH 2C1PA 1JF5A 4XP1L 2QQNL 5FFLA 1A2YA 3VFGH 1MHEA 3HFML 4KI5F 4ONHA 1JGUL 4AMKH 5IW6B 2VDLH 2IPTL 4LLQB 1BVKA 1W0YT 4JRXD 2FCBA 4OSUH 1I1AB 4MXWL 3WD5L 4ELMA 4X6CA 1C12B 4R97C 2Y6SC 4X83A 4UT7L 2H2PC 4WWKB 1QLFB 3WNKA 5ACZB 1FNFA 1KIQA 3L3OB 1HXMB 2D7NA 3MJ8A 3NCYP 4WUUA 1HH6A 2Y6SD 2AGJH 2H2PD 1AGEB 2APTA 4ZS7H 2XWTB 1Q0XH 3GMQA 1IQWH 1NDMA 1KJ2L 4MD5A 4NCC2 3TYFB 2F58H 5C09E 4DQOL 1NC2B 4YGVB 1X5YA 2R0LH 1N59B 3PG2A 1QSEE 5MI0C 2R2BB 1AXSA 3LIZL 4PJFE 1BP3B 1MCOL 4LGRB 4HHAB 2PETA 1ORSA 3TBTB 3WBDA 3BPNC 2HLAB 1ZS8B 1JWMA 4Z18A 1PG7L 3GHBH 3MSPA 5I8EB 2HJKB 3PIQA 4OKVA 2JK5B 2P8PA 2BHZA 4O2EB 4NQXB 4MHHG 1JGVH 2BERA 4U1HB 4NUJB 2EO1A 2EXYC 5EC1A 2KUTA 1KEMH 2X09A 2Z35B 2Q86B 4Y19A 1HSAA 1HCFX 3GMMB 4XVTL 1F2XK 1B88A 4PRPA 5HPMA 4I4WA 4OI8A 2A0LC 2XZQH 4U1IA 3NGBC 3L3KB 2EXYD 3DVIA 4M6NL 4X6EB 2AEWA 1XIWB 4K8RH 4AIXA 3K8LA 3OF6A 5B38G 3BO8B 4DN3H 3LPFA 1ZMYA 2A0LD 1P84J 5EO9B 3KPTA 3A6CH 4OCWL 4FQXA 2V5MA 1OWRM 5C0DB 3PJSA 3RUGB 4TTDC 5B8CC 1U8HB 5JLZB 1Z9OA 1NMBH 4JGMA 3EYUL 4GAFB 3ZMRA 1IT9L 3HI6L 1EHLL 1R5IA 1QFWL 4TTDD 1UZ8A 2OM5A 3D9AH 5F7MC 5KZCB 4Y2DA 1KPUB 3ROLB 3O11B 1EGJL 3LD8C 2X4RB 5L2KB 3MRJA 3GJFA 4MQ7B 4PBWD 4JPIA 1FG2A 2HFTA 1G7IA 4P59L 3L3IB 3VA6A 4ZUWA 3WJLA 1FCGA 1N2RB 4CN1A 1CGVA 3S35L 5D93C 2QADC 2HG5B 2AJ3B 2VABA 3SO3B 4JPKH 2AEIT 4Q9RH 1IAKB 1T04A 2DIBA 4U7SA 1S7TA 1KT2A 5FIEA 4LPXA 3QDHA 3EFFB 5IQ7H 1NEZA 3DX7A 3MCLL 4P2RA 4H26A 4IEFB 2XQYG 4GXUN 1FNHA 2QADD 3KYKL 4PJ9C 4NRZA 2Y25A 5IMLA 2VLKD 3CPLB 4YO0B 3SOBH 3NPSB 2ZG3A 5IHUH 2F5AL 4GW5A 3IRZA 3DV4A 5D70L 5KS9E 4HIEA 4PJ9D 4N0RA 2BOBB 3Q3GA 4LDEB 4JGUA 4PJGE 4GRWE 3DUSB 1EVTC 5F8RC 3S37X 1NH6A 4G7YL 1B6DA 3MLWL 3QUYC 2YD3A 1XGRB 2Q76B 4JKPH 2B4CC 4WW2F 4YAQB 1D6VL 4KTDL 2XIDA 5F71A 2OP4L 3O4LE 3O2VL 4N0YH 2ESVE 4OT1H 2RCSL 5DC0A 5K93A 3X13B 2Y7QB 3QUYD 3ZE2E 1BECA 2Y06H 5FCSH 3FFCD 3WSQL 5I1LA 4PLJC 1RUPL 1S7XB 4X6DF 3IGAB 1FZKA 3OKOB 4KFZC 1G9NL 2KQNA 3V0WH 2E27L 5J6GB 1OTTC 1NKRA 3ME0A 5IJKC 4WO4C 1JRHI 5T3ZH 4PLJD 5D6DC 1YPZF 1IGTB 1FL6B 1DE4A 4HMCA 3CUPB 2R4RH 4PJIA 1D5IH 1OTTD 4XMPH 1FVCA 4WO4D 1XR8B 2W0FB 1FYTB 4YDJA 3M17A 5JO5A 3JTTA 4BH8B 4JFOA 1T66C 4F9LA 3R8BB 5J7CC 3CFJB 2D7QA 4D9LH 1DUYA 4M1DH 1BQHA 5DMGC 1RIVL 2XN9D 2P5EB 2FX8H 4P4RA 3FN3A 4JM2D 4PJHE 1T66D 1IGFL 4LARH 1U8QB 4NQDE 4N90E 3VD7A 1UJ3C 2VXUL 1MCKA 1GOFA 4S1DC 5DMGD 4WW1A 2BSRA 3VXUB 1HKFA 5HYSA 2BNQD 3VFWB 1XT5A 2X7LA 5DRWA 3RIFK 4YHMH 5DEFA 1AFVL 2VR9A 3HUJB 4L8DB 1FE8L 2IBBA 3OWEA 4S1DD 4CVZB 1UGNA 2OL3L 2FIRT 1H0DA 2NY4B 1K3IA 3GBML 3X12B 4L4VE 4G9DB 5FO9B 3OR7B 3VD9A 5FDWB 3MA7B 4NN5B 1J8HE 1XF1A 5TF1H 3SHSA 3S6CA 1RJLA 3G04A 1JRHL 3IJYB 1A7OH 3EOTH 3HC4L 3KDMA 9CGTA 3BEWB 1JL8A 4FQLH 4JHZA 3H0TA 3E0GA 1P84K 4YWGH 3AY4C 4S1SH 4YFEA 3TH4T 1EO5A 1U92B 5AYUH 2LU3A 2DQJL 5T33H 1S7VB 3EO1A 5ICZA 1RU9L 1A1OA 4JREC 1R3IH 1KN2H 4Z95L 1JNNL 3NN8B 4D3CH 5HVHB 3S37H 3WIFB 5JW5B 3T09A 1E6OL 5EU7C 3WFZA 3S5LG 3NFSL 4KGJA 4NNPL 3BKMH 1SVZA 4LBEB 3CCHB 3QYCA 2VLRB 1FV1B 3QHZL 1D9KC 2QBWA 2YD7A 4QHUB 4O2FB 3MRFB 3QHFH 1OP3H 4F37K 4RZCA 1ZGLA 4BQCA 5SWZD 5C9JA 2I60L 1MJJA 3LS5H 1A6UH 4PRAB 2OR8A 2KZ1B 1ZLUK 2PN5A 1D9KD 2FL5A 4L29B 2AI0H 2MFNA 4V1DB 5E6IC 2Q6WA 5J6HB 4G9FA 1OHQA 3IJSB 3SDDC 1TQCC 5CCKL 1C5DB 1RZJL 4EI6A 3IDGB 2BJMH 3I6KA 4WU5A 4XNQA 1RURL 1CFQA 4YX2L 2R1WB 5FECA 4XVSL 5D7LD 4N9OB 3V4PL 1AQKH 2GAZA 5CBEA 2CKBH 4NWUH 5E6ID 4YXLL 3WS3B 5MERB 4XCNA 5GRUH 3SDDD 3V5DB 4B50A 3I6GA 3TBVB 2D7TL 1UJ3A 4MQTB 1HNGA 2ATKA 3NIDE 4PRHE 1BHGA 3EOBB 1AKJA 2X89D 1C1EH 1UFUA 4LHUB 2B39A 1YDPA 3C5ZA 4URTB 3U36B 1KBGL 4FXLA 2GTWA 2V2WB 4FQQA 1TCRA 3JWOL 5GGVL 3D18A 2X4QA 1OAXH 4KJPC 4HBQA 4N8CH 5IVXB 3GMLA 4HLJA 4I77H 5GGSA 2DBJA 4D9QE 2VDQL 1U8JB 3BKCL 2P8LA 4X4MA 5D1QB 1TJGL 3HE7B 5DK2B 4UT9H 4FXGB 1P4IL 2IC2A 4KJPD 4FTVB 2BSTA 2XZZA 1XGTA 1S9WA 4BH7B 1CFSA 3KPMA 4M7LL 1UQSB 1AGBA 5CJXC 5EULV 5EN2B 3TZVB 2CJUH 5GQBA 2FYYB 4JQIL 1JP5A 2GJJA 3GIVB 3BN9C 4LHJB 3T3ME 2WQRA 1VGKB 5LCVL 5BRZB 2O61A 1T03H 2NY3B 3O3DB 3G9VA 3W2DL 3WKMH 4TVPH 4JN1H 4NQEB 2E7CA 3PWUA 3OKDB 5FV2A 1DEDA 3BN9D 3S36X 1T2QL 1Y0LA 1MLBB 3U46A 1A6WH 4XP6H 5IV2A 5EZJA 3VI4F 3F65A 4YC2B 3MREB 5I8CB 5DVMA 1YN6A 3PL6C 5C3TA 1ZLSL 1BVLA 5DUPH 3AFLA 2Q87A 2AP2A 4XVUC 3SKNB 1JE6A 2ED9A 4NO0D 3VRIA 1BM3H 1UM4H 3TFKC 3DTXB 2VO5A 3PL6D 1FBIL 4A2MA 4MDJB 4POZC 5E08H 3RUGE 3P11L 4OUOA 2NW3A 5KSAA 1MHCB 4XVUD 5E8NA 1AH1A 1Z2KA 1YEGH 3QCTH 1LO4L 4P23A 2HKFL 3HNSL 4WUKL 3TFKD 4PRBB 3DECA 3MNZA 1KGCD 1S7SB 4POZD 4KPHL 2P49B 3BRFA 4K3GA 4K07A 4OB5H 3O4OB 2WBJA 4CU8A 4X4ZA 1U8OB 4I5BA 5L2KE 4H5SB 5FCUL 4TSAL 5CEYB 1I9RH 5C0BD 4JZNA 5IMOB 4JVUA 4OCRL 2ITCB 5B39G 3QWOA 2EDHA 3H7LA 3LEVL 1AP2B 2LQRA 4NKOA 4PGEB 3VFNA 3AMKA 3CH1B 1ZSDB 2NX5A 3NABH 4DTGH 1D5MB 5TPWH 2OSLA 3VXSA 4Q74A 4EOWH 2EIZB 4HDIA 4OLWL 4JG0H 4JRYD 6FABL 3CLFH 1NMAL 3UTZA 2M2DA 3QP3A 3ZYOA 3G6JA 2H8PB 2FJFA 1MI5A 1CG9B 4NN6B 5E70A 4HFWB 1AD0B 1QR4A 1NJ9B 3CFEA 3MV8B 3IKKA 4NNYB 1TQBB 3LKSA 3H9SB 3ROOA 2FB4H 4NQCA 5EORL 5IIEA 3EYSL 4EVNA 1M1SA 2AJYL 4WFGE 4GAGH 1V7MH 4J12A 4QO1A 4OFIA 1WFNA 4D0CA 4MXVE 2O5YL 1H9VA 1UWEH 1WICA 1BAFL 3O2DA 3ARFA 4P46B 2VXQL 4DW2H 1OD7A 1MJ8H 4JFYA 3FO0H 3IRPX 5E94A 4EDWL 4EXKA 1YMME 4L4TA 12E8L 2E8YA 3IAQA 5LGHH 3O81A 4M61B 1QLRB 5IWLC 3W9EA 3HI5H 5C09D 4OAWB 2IH3B 3NIGE 4DVRL 1AHWB 4GRMA 1MEXH 5CILH 4ZUVB 4OQTL 3UTSA 3DRQB 2V5SA 5EBGA 2XXCB 4M9OA 5SX4I 1NLDH 2EYTB 4X4YA 4GOSA 4A6YH 1FYTE 4XPBH 5D96B 3V5HB 5HI3C 5HDQL 3KPNB 3HR5A 3S7GA 2J1KA 5TDPA 5I66B 4C54A 1F4YH 3GSNH 1C8PA 4GW4B 1FSKC 4ZUSB 5F9JB 3CZFB 3KJ4B 1CXEA 4Y16A 2FO4B 1UKTA 2P5EE 5HI3D 5DJZA 2ZP0T 1OAQL 4JO2H 3RL1B 5C08A 3IT8D 1JHKH 2JB5L 1Q9KA 1F02I 2A74A 5HDBF 4JPWH 4RCAA 4OCXH 5BV7H 1R3HB 2UZIL 4MNHB 3SPVA 3DX8A 3HUJE 5D7IB 1N6QH 1JN6A 4PJDA 4KY1H 4YDVA 1TJIL 1A6TB 2IPUK 4TUJB 4UTBL 2P24A 3ABZA 1UZ6F 3UAJC 3QFJB 5BMFL 3B2VL 1IKFH 4NHCH 1H8SA 1IEAB 3KPSD 3GJFK 5DUML 3TGXA 4FQIL 1NCDH 2YUXA 1MCNA 2Y07H 1CFVH 1Q9LB 3C5SA 3EBAA 2UWEB 4GLRI 3ARBB 2B2XH 4D9RE 4EUPG 4BYHA 4X5WA 3AROA 3UAJD 3T77A 1MCEA 5CSGA 4AG4L 5C0IA 5F7FA 2R4SL 3REWB 2X4SB 1GL4B 5HI4C 1QSFE 2IGFL 4ZAKA 3QEQA 5IBUB 3PV7A 4KVCL 3B8YA 1G7PB 5ADOL 5BO1H 4OGZA 5IB2B 2RIKA 5HI4D 3ARGB 3OXSB 1UWGH 5DMIL 5I6XC 2A38A 3WIIL 1EEYA 3ZKSD 4GKSB 2VLRE 1AE6L 3MXWL 2DI9A 3T2QA 3IDUA 3D39B 3SDXA 4OZHA 5K59F 3RPIA 1BBJA 4PJ8A 5CJBA 4LF3A 2X4PA 3ZLQC 3TWCH 3U83A 3CVHB 4OF3A 3PHQB 3SGDI 4FABL 4JO4L 1NBQA 1BZ7B 2F19H 5J13B 4M7LT 1A0QH 5I1KL 5E5UB 2O5ZH 3DUHA 2A6KA 4OJFH 5CKGA 5C70A 3CZJA 4M43H 4MD4B 2IADB 4MQSB 4NIKB 3P0VL 3OB8A 3HZYA 4ZFZA 2EH7H 4XPFL 4NBXB 1IM3A 3OJ2C 4FFWC 4H25B 4QHLB 4WGVB 2ZCHH 4PG9A 3VXRB 5CBAA 3I3EA 3OGOE 4JLRB 3T1FA 3ECBA 2BMKB 5T1KB 4UOW1 5JOFA 1CE6A 1AY1H 3W5NA 3VWJA 4L8CA 4FFWD 2BVQA 4M3JA 5FO8B 2BCKA 2ZPKL 4LDOB 2BY2A 1S7QB 5IVXE 4Y4KC 4MNGA 3QNZA 2PYEE 4JKMA 2PXYC 4N0UA 4PJAB 3V7MA 1WIUA 5TF0A 2QHLA 2ZUWA 4YHNA 1R24B 3RVUC 5CINH 4Z7WE 4FTVE 4Q2ZB 3QFDA 4LLWB 4Y4KD 5EOCH 1F6LL 3STZB 2PXYD 4ENEC 3AAZA 1WZ1H 2JIXB 3MLPA 3RVUD 1RVFL 4LPUA 4UAOB 4PGZA 3TH3T 4XNMB 3IF1B 4JY5H 1E0OB 2BVOA 1A3RH 3G5XB 4LRIC 4KKCC 2HLFC 4Y4FB 2UV3A 1FL3B 2RFXA 4GH7B 2XTJE 5D2LF 5BRZE 1OW0C 2CUHA 4P2QB 5DMYA 5MENB 4WFFE 4DZ8B 1F8TL 2I9TB 2VOTA 4NKDA 4TUKH 5CIPA 4WWID 3BGFB 3DLQR 3L7FB 4KKCD 2HLFD 4UDTB 5I1AB 3VCLA 5ERWB 3LRSB 1E4XI 1KB5H 3BW9B 1A7QH 1T3FB 5E8PA 1EUUA 1UB6A 4G8GD 3LV3A 1T0NA 3HZKA 4G42B 3ZTNH 5DD1L 4L9LA 4MAUL 1KCVL 2BZDA 4KQ4H 1B2WH 3GSXB 4HZAA 1OP5H 2YXMA 4NN7C 4EBQH 4XPHH 4V2CB 3LS4L 1NC4A 2WUCL 4PBVC 4FQPA 1K4CA 1TZIA 4OLZH 3LN5B 3H42H 5I30L 5E24E 4GAJL 3FAWA 3FMGL 5CD3A 3QPXL 3BSZL 5F9WC 2D4DA 2PO6B 4ZPTA 3MA9H 1MIEL 2F74A 2Q3ZA 4EZMA 5FYKE 2J5LC 3HPLA 3VFOA 4LPCA 2A83A 3EDEA 4C56B 1CXFA 1FLRH 4KVNH 1MCCA 5B38A 3SE3A 4RA0C 3X14B 4OZGF 5HHNB 2WLYA 5D6CA 4P5TC 3ZE1E 3V0VA 3TA3B 1CE1L 1T2JA 3EZ8A 3BZEB 3PQYA 5GS0H 2R69L 3LKQA 2WSKA 3C9NB 3U9UA 1DN0B 4ZFOL 3ARWA 2MQCA 3T08A 4P5TD 1V7NL 1OY3B 1G6RH 5J1TC 4EJ1C 5D1XC 4YDLC 4I18C 1S5HA 3BPOC 4N0FA 5JR1L 5JORA 4P9HH 2GSIB 5CMAA 4EN3C 3MV8E 2F15A 1ZHKB 3O45B 4OCSL 3H9SE 5D1XD 3EIFA 1XZ0B 1I1AC 1OW0A 2PF6A 2VYRE 3RWDA 3RKPA 3FO9A 4EN3D 5I0DA 3TVMB 3BGAA 4G8EB 4XMKH 5KSBA 3BGMA 1MREH 2ADIA 1I1AD 1RZ8A 2GFBA 4PRHD 4O51B 1G7LB 3TN0C 4XNUH 35C8L 4AQ1B 2E7LA 4RGNB 5HHMB 1U91B 4YNYB 3CXHK 4ODXB 3HMXA 1MCWM 3Q5OA 1RZKL 3QIBB 4KHTH 3S96B 5IVNA 5IHBA 3C8HA 2PTUA 1W72B 3K2UL 1XGQA 2VN7A 4Z7UF 3TN0D 1AR1C 1XF2B 1T89A 4D9QD 1FFNA 3QQ9C 4L3CB 1MWAH 4WI7A 5TFSH 1FDLL 1I75A 1NGWA 4MHHI 3QRFM 1AO7B 4J4PA 1AR1D 5DI8A 1A4KB 1UVQA 1BJ8A 1XGUB 2FEDC 3UTTE 1UT9A 3QQ9D 3NFPB 4HKBA 2EC8A 4EXPX 2ADJA 3HAEG 4UU9B 3SGJC 4YE4H 1YY8B 1ES0A 2ZUUA 5IKCA 3SCMC 5KSUA 2FEDD 3IDIA 4K94C 3MRCB 4HUUA 2A6JB 1B4JH 1FFPA 1T20B 3RWGB 3MOBL 1X9QA 4XCCL 1BJMA 5IFJA 4HUXA 2Z8SA 1J5OH 1ACYL 4GO6B 4IS6A 4XT1C 3SCMD 1ZHLB 4JY6B 4L1DA 3QCUH 3S8WA 4KMLB 3EO9H 3FQWA 4U1JA 3CFDB 4CRPA 1JHLL 2OR9H 3DOSA 5HJ3B 3VXMB 4FFVC 3GBLA 3FFDA 3I50L 3HFMH 2J4WH 1YECH 4BFGA 3X3GH 1FVEA 2I9LB 1KPRB 1NMCC 2KZWA 4P2YA 1T7ZA 1NCUA 5D7IE 1UM6L 2L7JA 4MXWH 3L6FA 4FFVD 2V17L 1MQKL 2V9QA 4NUGL 4NC2B 5HGBA 4NFBA 1ZTXH 3KJ6H 3MPCA 4Q9QH 2CDEA 3DX6B 5EO1B 4KZEL 4QNPF 3V6OE 3QFJE 3SGEI 2OCFD 4BSVA 5B3JF 4WV1B 4JFFE 4X0KB 2QR0B 3QDJD 2UWEE 2JJWA 1YYML 3HE6A 1KJ2H 4UILH 2DJ4A 5GGQL 4DQOH 1VEPA 3GIZL 2NY6B 2IBZX 3MODL 2DTML 5I17B 2VAAB 4N9GA 2LVCA 4QT5B 4TRPL 4OQ1A 5JPNB 4GG6A 2EDXA 1BREA 4LCCA 4PV9A 3U4BL 3QULA 3HI1A 5ADPL 3DXAB 2DQTL 3HHRB 3QA3B 4K7PH 4P5KA 3FOMA 4CU7A 4HQQL 5I1GL 5DF0A 1N3NA 2HJFA 3BKJL 2DL9A 1AI1L 4Z77B 2A1WL 3SGJA 3D3VB 4XVTH 3RY4A 4M3KB 3ETBF 4U3XA 5E99L 1HHKA 1A7RH 2EYSB 4CW1A 3N06B 2RR3A 1KXQE 3VI3E 4KRMB 5GRVL 4HH9B 4EDXA 2FX9H 3MXVL 5DQJB 4Q9CA 5T1MB 4IMKA 4X8JA 4XXCA 1I7UA 4WFGD 5DRXB 3MRGB 4LKCA 4Z0BL 2MSPA 4XXDB 2CXGA 3VJ6A 4YBQD 3EYFB 4LGPB 4ZPVA 5GS1A 1IGJA 1WBXB 1IT9H 4KZDH 4MGXA 3H3PL 4XX1E 2Q8BL 3HI6H 4O2CA 1EHLH 5CP7B 4NZRL 1XH3B 1YMMD 5F6HI 4F9PC 3BP6A 1EGJH 4ZO8A 2W9DH 1JZ2A 1EGJA 3SBWC 4P9ML 1FH5L 3CAFA 4PJAE 2BSSA 4CGTA 2P5WB 3G6AA 3RWJB 4P59H 1R5WB 3IETB 4FQHA 4L8SC 2YMXL 5DJCA 4O02L 4X98A 4Z0XB 4WW2B 4Y4HA 1AGDA 1K3ZA 2AV7B 3RTQC 4LEXL 4U0RB 5IQ9A 3QEHB 2XFXA 3PWJB 2VXVL 3OHXB 1S8DB 1H5BB 3H2WA 1K6QH 4X6DB 3RTQD 1V8HA 1T0PB 4P2QE 2VDKH 1WAAF 3PHOB 5TQ2L 5JW4Q 5SWSB 2R8SL 3LB6D 5DMKB 3O2WH 1U8NA 1P7QA 1YPZB 1LDPL 2GSGA 4UT6H 1J05B 1HDMB 2R29H 4MWFB 2CKBB 4JM4L 4X6FB 4WFEE 4I0PB 1WF5A 2DWDA 4G7YH 4PJ5A 5AUMB 4M7JH 3MCKA 3UTPE 4APQC 1CN4A 5I0ZA 3SDCA 1KG0A 3O2VH 5D8JL 2E5EA 4MB3A 3V7AG 3JUZA 3WNOA 2I24N 4U1NB 4APQD 4LLYB 4MA8H 3IXTA 3BFOA 4TQEL 5HHOA 1N8ZB 4PRNA 2CK0L 1G9NH 1QBLL 4R0LC 3N1GC 5INDB 3S3PA 4D9RD 3MGTB 1RZFH 5AG8A 1QSFD 1DEEB 5MP6H 4UTAL 2NY0B 2HVJA 1TJHH 1LMKA 4C56E 5E56A 3VFTA 5C2BL 1R3LB 3QIWA 3R0MA 1KULA 1ODAA 4TULH 4UOJA 1MCPL 1F4WL 2IQAA 1OAKL 3JV4A 4JQVC 2R56L 1SBSH 3T2OA 2KL6A 3U48A 3P9LB 3RL2A 3QISA 3V4VL 2P7TB 1RIHL 2A6DA 4KMTL 3VG0H 4HUKB 1FQ9C 3O6LL 4P4KA 1H3TA 1XF4B 1QRNE 2EDFA 2XWBB 4U1GB 3MC0A 5I1JH 5IESL 5IT2H 1XGPA 4JFQA 4PJBF 1IZKA 3RA7L 1I3GL 2FIKA 4U6YB 2AAVA 5E8EA 1EEQA 4M6AA 2OL3A 1FN4A 5F96L 3E2HB 3VFSB 4NQVB 5GJSL 1UXSA 4U2YA 4OLYH 5FUZH 3SJVA 5CHNA 4Y5YB 2EDEA 5BZWA 4PJIF 4RWYL 5BS0B 1P4BL 4XAKE 4U6TA 4P2OB 1JRHH 4HZLB 2OI9C 5F1IB 2BNUB 2XG5A 3KLAA 4RGNE 5HHME 5E1AA 25C8H 2GJ6E 4HJGA 4HFUH 5DQ9B 2XOTA 2QHRH 2HFFB 3JWDL 2VL4A 4R2GB 1HKLH 4X8XA 2VZUA 4F7PA 2PYED 2PW1B 1WCBB 1RU9H 5C0AA 4HJ0C 5D7SH 4Z95H 1AGCA 3SE8L 3ZHLA 4K7PY 1ZVHA 3QR2A 2ADGB 3NACL 4ZSOB 4ODSH 1DQLH 1VFBB 3VFVB 3NFSH 3OXRA 4I13B 5DFVC 3FQTB 4HWBL 5GS3A 5ETUA 1BGXH 4LHQB 1KF9B 5F6HJ 4HJ0D 4G8IB 4XBEH 2VDPH 3P0YL 4OD2B 2XTJC 2HMIC 4GJTB 5DC4B 3F6LA 2I60H 5DFVD 2X4NA 1SY6H 4QRRB 2J8UF 5JA9A 3MV7D 1GAFL 4RIRA 4MB5A 2XTJD 2APVA 5L8KB 4HIXH 2HMID 2FR4A 1VENA 4JQVA 4PTTA 4YC2C 5ILTL 2B1HL 2C3HA 3F58H 5FF6B 4U1KA 1NFKA 3ARXA 4YXLH 3H9YA 3VXME 4L4JA 4AT6B 3BT2L 2X70A 3LPWA 5HYJD 3E8UL 4JFDA 1D5ZB 2FGZA 3P9MA 1CLYL 4HCRL 2VSDA 1UENA 3DX9A 5IFHL 1BMGA 3DMMC 3LEXB 4OV5B 5AZ2L 4DGYL 2CGRL 1WWCA 3IDJA 2EH8L 3BH8B 4PS4L 8FABA 4ODHH 5KAQG 4D0DB 4JY4B 2GT9A 3DMMD 4JGJA 4TSCL 4GAYB 4YHOL 4PYGA 3MV9A 4OZIF 3EDJA 3U4AA 2NY5C 4G6JH 5SV4A 3BKCH 4DVBA 1TVDA 2R0WL 2X4TA 3ZYJA 5JDJA 2E9JA 4MNQB 3VXPA 5IMKA 2V7NA 1JYVA 2O26U 2EXWC 2KBGA 4I3RH 5LVEA 2D9CA 4HGKC 5FYKD 3FT4B 5EFIA 4M7LH 1I7RB 3PV6A 4LKXA 3BWAA 4PJCA 2YRLA 3VRLF 5IK3B 5DZOA 4A6YB 3I02A 2EXWD 4S1RH 1J88A 3SE4A 4EIGB 2C3GA 5GHWL 2IBZY 3ULVE 2CKNA 5D2NB 3WO4B 4MXQC 3RJQB 3NH7H 4P48A 3DXAE 3GSNB 1QFOA 2ZKHL 3LDBC 5BZDB 3L95A 1SEBB 4LSPL 4FFZL 5EU5A 4MXQD 2H26A 2VQTA 1BQSA 1N0XL 3T65B 7FABL 3MYJB 2NLJB 3VFMB 2AK4D 2FJHA 3OG4B 3MRPB 1MHHA 3RDTC 3O9WC 3MRQA 3KLSA 4QHMB 1M4KA 5BV7B 3UJIL 1QBAA 3H9SD 5C0JB 4JKLA 1IC5H 1DBMH 2J88L 5HHPB 5KTEL 4TVSa 3FO2B 3F7YB 5SWQA 4WIQA 3RDTD 5F93C 3O9WD 1MY5A 5DWUL 1PGRB 3VGDA 3WCYA 4BK4A 1H15A 1EH9A 1PZ5A 1FZOB 4O58H 2XNAA 1JPGA 4YEEA 3O8XA 4Y5VC 3OPZL 2I07A 4WGWB 5A2JH 2HKFH 1DBAL 3EGSB 2XKUA 1T7VA 4P3CH 1PEWA 4KPHH 1A14L 1QEWA 1LE5A 3Q5YA 1FFOB 2DMKA 4IRZH 4G5ZL 5EOTA 4NDMB 2XKNA 3DBXB 2OJZL 4H0IA 4TSAH 3TLRA 3ISWA 2P5WE 5C3LD 2XWJA 5CP3A 1XCTA 4R8WL 1PY9A 3MFFB 4XC3H 2PW2A 3UTTD 3GBNH 3P4MB 3EZJB 3L3HA 1S9VB 4YHYC 4JFED 3GMOA 2R2EB 1MRCL 3HC3L 5CEZL 4QOKE 1KIRA 5HHVL 4OLWH 1FZMA 4NZUL 4XP5L 4V2BA 3AC0A 3VGAC 5LAXA 1CL7I 1FGVL 2JJTC 4MX7A 4JDZA 3DVGA 2DBLH 1YYLH 5SWSE 2V6HA 4XP9L 4NO3B 1FNLA 2W92A 1OCWH 3RWFB 5JPMB 1BJ1J 1UEYA 5L9DL 2DKMA 1F11A 1ADQH 1RIUL 1MFCL 4M7KL 3V6OC 2XKSA 4S1QL 3CSYA 1BAFH 4LLVB 5E8DH 2VXQH 3LEYL 1M05A 2IH1A 2F54A 1TPXB 1G9MC 3BVNB 1T4KB 2LVEA 1G1CA 2EDRA 1F4XL 1KUMA 4L3ED 1IILE 4M9PA 2NYYC 4NRYB 3VGBA 1C08A 4JFFD 3V5KB 4EI5A 4NPYA 4RAHA 3QXWA 3VXQB 4XPAL 1QG3A 3DYMA 3QDME 3L5WA 2Z0BA 3U9PH 2QQQA 2ICEB 4LSRL 1I85A 2Q7YA 2IMNA 3RNQA 5HY9A 1P7KA 5LWYL 4HKXA 2G2RB 2NYYD 5EBWB 4NC1C 3TPKA 5GRWA 2SEBA 2ICWI 3L9RA 4M62H 4OQTA 3REVB 3OG6B 1IBGL 3HNTH 4JN2B 3MLVH 1CTNA 3FB7B 1G0XA 4NZTL 1CICC 3RHWF 1IFHL 2DWEB 5C0RL 2HH0L 1YEJH 5T5NF 3HNVL 1VGEL 4MA3A 5F89B 5K9JH 3B3IB 3DROB 5HTSA 1YEIH 1T6WA 5L0QB 1CICD 1F4AA 4I3SH 1L0QA 3NAAL 2AJXL 5EA0H 1IAIM 2IAMC 2JB5H 1JPST 4RFEB 4Y1AE 4AENA 4IOIA 3PWLB 3GSVB 2DS4A 3O6FB 5KW9H 4QRPD 3QIUA 4UOW0 1F5WA 4HS3A 4Z8FH 2Z93B 3IJHB 4RNRA 1KB5B 1BX2A 2IAMD 1A3LH 4HIHB 1GGYA 5T1DL 1PYWB 5JXAL 1PKQB 3D0LA 3GMNA 1DP0A 3D85D 4J8RB 5D7JA 5DJYB 4KRPC 3GHEH 1IGYA 2FGWL 2ZNWA 4NGHH 4QY8A 2EC9T 1SYSB 5D5ME 3RWHB 1F00I 2PYFA 1MFDL 3SDAB 1ZANH 1GRWA 4HKZB 4KRPD 3U30C 4FNLL 4LSSH 1EXUA 5SX4H 1CFNA 5FO7A 3OKMB 3S4SA 4KDVA 3QXVA 4G7VH 3PWVB 2OXHA 2CLZB 5GGTH 5T1LB 1X5ZA 4K71B 4Y5XA 2VE6B 4PJEE 1G7QA 4ZSOE 3X3FH 3RWCB 2NTFB 4DZBB 5E2JA 1I1YB 1A5FH 3WEXB 3MRDB 3NCYS 4LCUA 4PYHA 3BUYA 2EIBA 4M5YL 3MXWH 4AY0A 1ZOXA 3IFOA 3FL7A 2ZCKL 4I9WE 1S5IL 3NTCH 4RGMC 3CDCA 1RZGA 5JW4R 5F6IC 2EECA 1TFHA 4GS7C 3GK8H 4JQXC 5EZIL 4QRRE 4XTRC 1BF8A 3EHBC 2V2TA 2K3TA 4M7ZC 3RAJH 3TT1L 4LIQL 5EWIL 1QTYT 4LNVA 4PV8A 5L8JB 1K8IB 4B5EA 1ZK9A 3EHBD 2XYCA 1H3PL 4GMTH 2D4FA 4ONFL 4WDIB 2VH5L 2HP4A 4XPFH 4DOHE 3C60C 4WFED 4G8FB 4GLRH 2DQEL 5BQ7A 3WS6A 4XGZB 1DQMH 2EDNA 3G5YB 3KXFB 3UTPD 2PKDA 4MAYB 1F90L 3C60D 4O4YL 4KDWA 3B43A 1ZHNB 1U8PB 5D2LB 4DEPC 1T5WA 3QUXC 2WIIA 1MVUA 2OS7A 4PJFF 3VGHA 2ZPKH 2ZUXA 3CDFA 4ZYKA 3VGEA 3N9GH 3KPLA 3SDXF 4C83B 1OSPL 4PY7A 2XTLA 1NCBH 5E9DD 1A3QA 3QQNA 1KJ3H 3VI4E 1FGNL 3C8KB 2VZSA 3L5IA 4JHAL 1MWAB 1KIUA 3BH9B 1J9CT 3RVXD 4PBXA 5H2BB 3A6OA 3CLEH 3E3QE 3KPRD 2A73A 5KANG 3NZHL 3CX5J 3KHOA 4Q6IB 1OGAA 4WVRA 1WISA 2J8HA 3MUGA 3SGDH 3WUWA 1T1WA 1U3HC 1RVFH 2ZUTA 5EUOA 5ESVA 1KTDA 3PHSA 3QI9C 4XCYB 2EIEA 5FM8A 2D7MA 3S9DB 3GRWL 3QG7L 5LGKA 1U3HD 4L9DA 2ICWJ 5I9QC 4QXWA 4WRLA 3QI9D 2CLVA 4BM7A 1T83A 4OZFA 1YEHL 1PSKL 3T0EB 5DT1L 2YPLA 1QRND 1GGCH 2GITB 3IFLH 2VJXA 2DLFL 2ORBH 5IB4B 1IKNC 5FA4A 4HIJB 5JIPA 2YPVL 1DBJL 2OQJA 3VD3A 3TESA 4OZGB 1Q94B 1Z3GL 3VD4A 4JANB 5DD1H 1MNUH 2HRLA 4OI7A 1J10A 4PY8I 3WE6B 4Z78A 5I74B 5DD5H 1FVDA 3VU2A 5GGSY 4ODTL 3LS4H 1D5XA 4X9IA 4NJAL 4R96A 3ULUE 3LCYA 1HEZA 4WHYH 3MOAH 1I3UA 1Q38A 4U05A 3C60A 4GXVL 3KPQA 2VITB 3PWPD 3FMGH 2W59A 4DGIL 1HSBB 2MCPH 1NCAH 2GJ6D 4S11A 3G5VA 3QIBD 1PBYA 1YUHB 4Z5RA 4MDIA 5JXEA 3QUXA 5DS8A 3MRIA 4PP1C 3I2CL 5EO0B 3HS0B 4JZJB 5L7XL 4JFZH 5C7XL 3IKCA 1CFTB 1YN7B 2ZSWB 1G7HB 4PP1D 3WXVL 4QRUA 1QSEA 1EVUA 4R4FH 2IANB 2HJLB 1MAKA 4IRJC 1U3YA 1E4XH 4ZFOA 4DN4L 1BIIB 4PGDA 4XPGL 3GI9L 4Q58C 3RI5K 3FQNB 1QZ1A 1IL1B 4NBZB 4NP4H 5C6TL 1NGXA 4Z7UB 4IRJD 1ZA3B 3U6RB 1GH7A 4KJWC 4QHKJ 1JYXA 3P77A 4KRLB 4E41A 2QV2A 3RGVC 1V3KA 1OSZA 3L5HA 3CVHL 3G08A 4PRIB 2YHGA 4IMLB 4KJWD 2X10A 2ZUYA 3FO1A 1KELH 1S9XB 3IVKB 5KVDH 3RGVD 2R0KH 2DM3A 3BISA 3QNYB 4UINH 2Z9TA 4GUPB 5I8OL 3LKOB 2DD8L 5JW4N 1U93A 4HGWB 2QQLL 4X99B 1KYOJ 4FQCL 3LKPA 1OOAA 4LCYA 4BFBD 3WFBL 3U4EB 4QCIA 4HUVB 5LXGL 1VEOA 1I8KA 3RZCB 3T2NH 3PP4H 2QEJA