1AY1L

Anti taq fab tp7
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
210
structure length
210
Chain Sequence
DIQMTQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDSTNLASGVPVRFSGSGSGTSYSLTISRMEAEDAATYYCQQWSTYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on an inhibitory antibody against Thermus aquaticus DNA polymerase suggest mode of inhibition.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords TP7 FAB
total genus 51
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 1997-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ay1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ay1L01
3FAWA 2DQHL 1HCFX 1RZKH 2YUXA 5DJXB 4HDIA 3QEQE 2R0ZL 3FQXB 5E7FA 3ESVF 1TDQA 1R24B 5FF6B 4LSDA 5DEGB 1DQQB 2CRIA 2F58L 3BT2H 3UTSD 3WFBH 5IB4B 2XN9D 3RZCA 5K9QI 2C3VB 5I8KH 3EO0A 2AERT 1MLCB 4C55A 3AU1A 3P0YL 5HGAA 1T5XA 4MAYA 4Z7OF 2EIZB 4MQXC 1RMFL 1TJGL 4KQ4H 4F33A 4KJQD 1T1XA 3GSVA 2FD6H 4U0RC 1I1RA 1ODAA 2VXQH 1TITA 3CC5B 1BAFL 5IMOA 5F93C 1BMGA 1J0JA 4XP1H 5K9JL 4F9LA 3MCKB 1H3UA 4PR5A 3D5OF 4MWFA 2QQLL 1JHTA 3EDFA 3QXDA 1T4KA 3BWAB 2YPLD 2J88L 4HIHB 1FJ1A 4UBDD 1QLRB 3CNKA 4KRMB 1EJOH 3T3PE 4IJ3C 4U1IA 2EECA 5BW7C 4NQXB 3DRQA 4ONHB 3O3DA 1QZ1A 2FX8H 3RBGA 1P84J 1M05A 4LKCB 4LSRH 1KPRB 5DD0L 5BV7L 1RZJC 5H94A 3ULVF 3GJFA 3NPSC 4YQXH 1PYWA 2H45A 1ETZB 1T1WA 1GXEA 2WSKA 3VXNA 1H8OA 5KSUB 2ZCKH 4PRHA 4KC3B 4F7PA 4HS3B 4LBEA 3SHSA 1U3HD 3VXNB 4KZDH 2WWKT 5FYLD 1D6EA 3LPWA 2W38A 4GSDH 4ODVL 4MAUH 5BRZE 4MMXC 1RIVH 5IFAL 2V7NA 4XVTL 5GGVL 3FRPG 5E00A 4YDLC 2B4CC 1BWWA 3G6DH 4FXKB 3S6CA 5L2JB 3QWRA 5GZOC 3EOTH 4JJ5B 3TA3C 5EUOE 3JTTA 5DJZA 3VE0A 1JPTH 5I2IA 5JR1H 1GAFH 1AGEA 1KT2B 3MBEB 4P2RB 1FSKC 2VIRA 1OAUL 3KLDA 3HB3C 2GI7A 1RJYA 1QKZL 3MOBH 5I1EH 2P5WB 1SMAA 4JRWA 1WSST 3CDFA 4DK3A 3MX0A 4Q6IB 4UT9H 1G9MH 2WAHA 3M8OH 3P40A 3UTQB 3WUWG 1KEGH 4QGTA 4N0RA 2G5RA 3MV01 3BX7C 1C5CL 2Z31B 4OCSH 2EH8L 3U4EB 3OR6B 1BHGA 4HWUA 1ZTXL 1DN2A 1ZT1B 4H20L 4U31A 3K46A 4LGRB 4G6AD 1OAKL 2W60B 3OKMB 4WFGD 4XAWH 4JZJB 4QY8B 3FTGA 1FV1B 3AREA 4ONGH 3HFMH 2PW1A 4PY7A 3SGDH 3WYRA 5HHNB 1L7IH 8FABA 5CIPA 4Q97A 3LEXB 4HKBA 3DX6A 3ZE2F 2GUOB 3ILQD 3OF6A 3U1SH 1UA6H 2ZOKA 1RIVL 2HLAB 3CCHA 5IFAH 4P23C 1AE6H 3X3GH 1IGIH 1R3IL 3HI5H 4JFDB 4U6TA 1AHWB 5AZ2H 2IANE 4U1KB 2EXYD 32C2B 5HPMA 3ULSB 2KQMA 5HGAB 3SCMC 3EOTL 1LMKA 1CFNB 4KUCD 2XXCB 2VZ3A 3CLFL 1NFDB 1V3JA 1HHKA 2OL3H 5KS9A 2Y1VA 4V1DD 3ZO0A 4OZGE 4J1UA 1NGXB 1E4XH 1CS6A 5DWUH 3DSFL 2CUHA 5EORH 5I73C 4P23A 4PGZA 2VH5H 4U33A 3A67H 4DCQB 1OLLA 1N3NA 5A3ID 4OZIA 1DVFD 2CQVA 5FECB 3TT3L 4LIQH 3QG7L 3E6FB 3MREA 5A1AA 1FAIH 4DGIL 3QSKB 4ZPTA 4HUKB 5B8CB 1A6TA 3MJ9A 3E0GA 4P5TA 2O5YL 1ZT4A 1KFAH 4GAJH 1QD0A 2O5ZL 3O6LL 1XZ0B 2ICWI 4Z5RA 1JFQL 4X6CA 2BXYA 2ERJB 1EIBA 2VDKL 4K8RD 5LKNA 2DLHA 4G3YL 4MDJB 4PB0L 3TO4A 3GMRB 1T7XA 3ARWA 4XP6L 3I9GL 3SJVE 1UYWL 1F11A 1NBZB 3QDJA 5H8DA 1NAKL 1EZVY 2X4UB 3GRWA 4WFGE 5DJZB 3N06B 3GHEL 4AQOA 5DJ8B 1DBJL 5HXMA 4FG6D 1NLDL 4PJBB 2KH2B 3BSZH 1F4XL 1QO3B 4F7TA 4GAFB 1YEFL 5HYQA 3FZUC 5C09D 2DQTH 3IDXL 4O51B 2MOVA 3LKRA 2EDWA 3DI2B 4NRXB 1TLKA 1EVTC 5I1KL 1M6OB 1K8DA 1B90A 2CK0H 4GS7B 4JFFA 4GT7A 1S5IL 4YPGB 3THML 3KLHC 2D9CA 5GRXG 4J3TA 2Z93B 1DJSA 3OAZH 4KI5D 3S37X 5I71C 4OT1H 1BVKB 4CJ0A 1XGPA 1EO5A 5IVZA 5JXAH 4CGTA 1JPSL 4NNPH 4RMQA 1YYML 2QQNH 3WJLC 2HT3D 5GRJL 1T1YB 1NJ9A 3REVA 3D2UD 3D6GA 2AABL 2EZ0D 5TGBA 2ENYA 2VZUA 5F7NC 4M7LL 2QADD 1DLFL 4HGMA 2BSTB 2Z8WC 4XAKE 4JKMA 2DRUA 3D39A 1I1FA 4EQ3A 5IFHL 3NZ8B 3QQNA 3K2UL 2WZPD 1R3LA 1CDGA 3ROOB 5TF0A 4HG4K 1A9EA 2R9HC 3QDGE 2EDNA 5C7XL 4H8WC 4LRIA 5LGJB 5F6HI 3BWUC 2BX5A 4WHCA 1KCRH 2DL2A 1ZLSL 1X4YA 2IPUG 2BJMH 1A4JA 1DEEA 4UIKL 4GBXC 3UBXB 5L6YH 2X9XA 3VXUE 2NYYC 3E8UL 3HG1B 3GSXB 3QDJD 4UTBL 3I2CH 3S4SA 1BFOB 5T33H 4QXUH 1QSFD 2NLJB 4IRZH 2EDBA 5INDA 1JNNL 3H3PH 3QEQD 2JCCA 4MAYD 3S5LG 2CO7B 1YYLL 1JN6A 1NMAL 1P4IL 2VAAA 1NUNB 3AROA 3PP3H 5IT2L 3IFNH 4GG6A 1MCNA 1MJJB 1CG9B 3C5ZB 4QF1B 1CD0A 4YR6B 5KSUA 4OLEA 3F58L 1YDPB 2VDLL 4XH2B 3BE1H 5C0CA 2VABB 4XMKL 4CMMB 4YH6A 2FX8L 4FZ8H 4GKOA 3I6GB 2M26A 2XZQH 1A1MB 5C71A 1A5FL 1G9ML 3PIQA 4HJGB 5KSBA 3VWKB 5JIPA 4X7TA 5IW1B 3Q1SH 3Q3GB 4NN7B 1C5CH 1ZLWK 1BIIA 2FGWL 5DJ0B 4MDIB 3ZTJG 4E42A 2YD2A 4NPYA 3V7AG 4GLRI 3GMLB 4PJIE 1INQB 4GG8B 1Y18A 1BX2B 2ZNWA 3RZCB 4PJ7A 1IBGL 2W65A 3SDXA 2XFXA 1G7HB 1KXTB 3DRTB 3QIWC 2XG4A 2AP2A 1V7NL 4LCIH 2YOCA 2DS4A 3O4LE 1OSPH 1JHLL 2C1OB 2YUWA 3MA7A 5GGVH 3JSSA 1XF5B 4HWBA 1TVHB 4U6VH 2DLTA 4M61A 3Q48A 3OKLA 5CEXA 2P5ED 2NY0D 3IDJB 3S9DB 1JWMB 3VWJA 4L9DA 4NNXA 3T8XA 1HHIB 1S7QB 3TVMA 3V4PL 1QLEH 1OD9A 1AFVH 1P4IH 1WISA 3SDYL 5HYQB 1IVLA 2OJZH 2VXSH 2JJUA 4DAGL 2A6KB 1EGJL 1FPTL 5KSVB 2WIMA 4R2GC 3EYUH 3O2WL 5LCVH 4I0KA 1DUYB 3SE3A 4EXKA 4Y88A 5JOFB 2J8UE 5ETUB 1A6ZB 2NX5A 1KT2A 2DDQL 5E2JA 4JVPA 3RDTC 4IHOA 4I9WD 3SPVB 3FAXA 4PV9B 4N8CH 5D71L 3Q6FA 4LCWE 4YXLH 3O81A 5L8KB 3BP7B 5E9DA 2WLYA 3C5ZA 1P1ZA 5MERB 3TBVA 4NHUB 4LVNB 4XP4H 1LDPL 2VITB 3KG5A 3RUGB 3W11D 5JUEL 4LSPL 3C6LC 3OGOE 1HOCB 4WIQA 2FATH 4U1SB 5C0BB 3UAJD 5H35A 3OKEB 2P43B 3BMWA 4TSBL 2X1QA 3IETA 5BXFB 3RL1A 3QDHA 1N5AA 3KLAB 5E2TL 2A77H 4R3SB 2G2RB 5IVXE 5JHLH 4ZFFB 3DVFA 5T5NG 1NC4A 3LN5B 2AXJA 5IWLA 3QP3A 1WGOA 4Z7VA 4NQCE 4MQXD 3WUWB 3HMXH 4EQ2A 1CT8B 4QRRB 4OSUH 4DJMA 2H41A 4IOFC 3MLPA 4NQTA 4MB4A 4JQVC 3DGCR 4QHNB 4MJIB 2HT4D 2QHLA 4X9FA 3RPIA 1IGTB 1UFUA 2E6JA 2RQ8A 5DVMA 4RMRA 2YZ8A 4BUGA 4I3SL 3FT2A 1N26A 4TUJA 3ARDC 5CEYB 1AO7D 3EYUL 4NZRH 3RNKA 5GGTA 4PRHE 4Q2ZA 3D3VD 4Y4KB 2WINA 1QSED 4JPIA 2GITB 3VXOA 1OTSC 3F8UB 4LKXB 1YN6B 1NMBH 5CJQL 4ZTPH 4Y1AE 2OQJA 4HIIB 4YHKH 5HI4D 4E5XB 1PGRB 3SY0A 4OUUA 5IROC 3VU2A 5E24E 4QF1A 5CP7B 1FL5B 3VFPB 4HXAH 2BNRA 5BOZG 1ZHNB 3IVKA 1GGCH 2R0KH 5CHNB 1K85A 3WFEL 3WXWH 4ZO8A 3WXVL 5LBSL 4LCWD 2CD0A 1FG2B 1GZPA 1CDJA 3R8BB 4PGEA 4F8TA 3HI6H 3UYRL 1A3LH 4UU9B 1AJ7L 1MCWM 2MMXA 4JO4H 3ES6A 2C1PA 2H3NA 1FL3B 1OAYH 4U6YA 5DZNA 4F2MB 3C8DA 4OCXL 5GJSL 5E6IB 1OGAE 4OF8A 2OL3A 1J0HA 2CDGB 4XTRC 1QBLH 5TQ2H 5LXGL 1I1AB 1G0XA 4JDVB 4WRLA 2J8OA 2LVCA 5LVEA 1Q9WA 4MQSB 4Z18A 3B2VL 3K81A 3VFGL 3BKML 5C0EB 2NXYB 1MRDH 3IJHB 2R23B 1XF2A 4QRQB 2HMIC 2DQJH 2A9NL 4JHAH 4QRPB 1ZHBB 4RFOH 5F9AC 1A9BB 3G9AB 3QUMB 5HGHA 2VZTA 3FN0H 4FQXC 2VDPH 3OJDB 3LKSA 1CXFA 2YMXH 2YD9A 1A7BA 1JHKL 3G6JB 2EE9A 1MF2H 1NBVL 4ZDHA 3OAUL 4RMVA 1KTKE 5FDYA 2B1HL 4F15C 1UADC 4KVCL 1RURH 4EI5C 5TE4L 3V0WH 2E7BA 2A83A 4ZFGH 4Z7WB 5CJ8A 3VFOB 2R0KL 4PRNB 1OAZL 4KUCF 5C07B 5GSVB 4PB9L 4NN6B 1J8HE 3MLUL 2YD4A 3GJFB 3IKKA 5C3LD 5C0FA 4U6HB 5KVMC 5KS9B 3NFSL 3WIHA 3HUJA 3R8QA 5I9QB 4GKZA 5TDPA 4RQQA 4Q9CA 1A6AB 4I2XE 5FYLE 5KTEL 4FQLH 1SEBA 1U2HA 1D5MA 4WJ5B 4NZUL 3W5MA 3G6JE 4ISVB 4MGXA 5D2LF 5FKAA 1ZOXA 3T65A 3BUYA 4FZEH 4UTAL 3B3IB 1KNOA 5CSZA 2GW5A 4HMCA 3K3QA 4AT6A 2YRLA 1JGEA 3D0LA 1KLUB 1S7UA 3W2DH 4C56E 5C9JA 4C4KT 1KCUH 2AW2A 4JEGB 5EA0H 5A2KH 1YJDL 4MXVF 4NZJA 1U58A 3DX8A 1ZLUH 4G8FA 3QDGD 4LPXA 4C83A 5D7IF 1J1PH 1IZJA 3U0TB 5ELIA 2OJEB 3G5ZB 1V7MH 5F9JA 1DBKH 4EEEA 3RVXC 3VXUD 5CWSB 2CRMA 5F9JB 5D1QB 3GIVB 4NQVB 4HKZB 4ONFH 3T4YB 3P0GB 4PJHB 4M93B 4OZHF 4JFPA 1OSZA 2EIDA 1U91B 3HZKA 1AGCA 4CUCA 4WU7B 3ECBB 3G6AA 3QDMB 4Z0XB 4NQDD 2I9LA 4GQ9L 4NO0A 3RVUC 3L5XH 1L9MA 5BMFL 3LEYL 3WNMA 2MQ3A 1YNLL 1MY5A 3VXMB 4WO4B 2A9MH 4YDJB 1T0MA 2CO6B 4WI9A 3IS0X 2R4RH 2WBJA 3ZL4L 4QHLA 2GK0A 4JRYB 4PRPD 5D7IA 2IQAA 2WUCL 1KIQA 3NIGE 2H3NB 1YY8B 3CCHB 4ZUSA 2E8YA 4P9HH 2GJZA 5F1NB 1OT1A 2EH8H 4LRNH 3QCVH 5BV7C 2NY1D 1UJ3C 3ZKMC 3L5HA 3WMSA 3KPLB 3OB0K 1M71B 4OZHA 2AXFB 4U1NA 1QBAA 3WDHA 2VL5B 2HLFC 4QXGH 2HT3C 5BO1H 2C3WA 3B9KA 3O8XA 1T66C 1KXQE 2BC4A 3BIAX 1PKOA 1LO2H 3MJGX 1CDHA 5DC9B 3PL6D 5EUOA 3UDWA 1XT5A 1CE6A 4XNUH 4R4BB 4N9OB 3IETB 5D2NC 3DURB 3MMEA 3QWOB 2HMID 4H1LA 4L29B 5ITBH 3KJ4B 4X6BA 4HIHA 3WIHH 3BQUB 1FLTX 4WI5A 1CQYA 3NFPB 3U30B 2OR7A 2F54D 2MKWA 4NQDE 2N7BA 3L3KA 1HXYA 3HN3A 2A0LD 1FG9C 3BE1L 3GUTA 1IAKB 3ZL4H 3G5XB 3A6OA 4D0BA 4EI5B 3SKNB 3CH8A 3AAZA 4ONGL 2IALA 3ULVL 4I0PB 4JQXC 5IV2A 1NEZB 1KB9J 4EN3B 5EH1A 4P5KA 4UV7L 2APXA 5BZWA 3P0VH 3NPSB 4TUJB 4N68A 4UOW0 4ZXBC 3RY6C 1NPUA 4M3JA 1L0QA 4PRID 3GKWL 3C9NA 2C4FU 1FNAA 5DJDB 4ODSL 2MQ0A 4DKFH 5KVDH 4WCYL 4MJIE 4GUPB 1KB5H 5I8CB 5FK9A 4WFFE 3GSUA 5EU5A 5IMKB 2GKIA 4XCCL 3FT4A 4LLYA 3L5JA 5EOTB 2V9RA 2O61A 2FD6L 4JQIL 3RGVD 1MFBH 4F7CA 4X6CE 4NO5A 4LHUB 1MCLA 3VW3H 1DUYA 4ZXBA 4EDWH 1UC6A 1XIWA 2XQYG 2XOTA 1BLNB 4IOIB 1PLGH 2B1AH 1NSNL 4F9LC 2GAZB 5DD3H 4FFWD 4P3CH 3B4NA 3QB7C 5EIIB 4LLMA 1IE5A 5M95B 4OKVB 5MERA 2HVJA 3VWJB 5IOPB 2Q87A 3QEHB 5MENA 4H0HB 1UZ6E 5EU6A 4BH7A 1MAMH 3RJQB 4FP8H 4J6RH 1GGIL 3RWFA 4NM4L 1WT5C 2D7OA 1VA9A 5AG9A 1JL8A 3CX5K 4S0TD 4EUPG 4XP5H 3U9PL 2YWYA 1YEJL 4WWKD 1FYTE 2QQNL 5HYSA 3GHBH 3CX5J 1T7WA 4FQLL 2ITCA 4ZODA 1CE1H 1GL4B 2YKLH 1B4JH 3WFDH 2CIIA 3U2SA 3SDCC 5JOPD 1DSFL 3TWCL 3MUHL 3EJYC 1GRWA 4OCNC 3PABA 2NCMA 1C1EL 1MAKA 3DO7A 1QSFE 4QTHA 5IEHB 4OGAC 5IGXH 1UM4H 1R0AH 1NCWL 5FYJD 1JNHB 4LSTH 3TJHC 3PP3K 1XIWD 1J8HD 2JK5A 4QT5B 2I27N 1PKQB 1NCUA 1QPPA 4K2UH 5I6XB 4ALAH 3OHXB 4X4ZA 1T3FB 1MCDA 5DJAB 5DT1L 5GGUB 4WTWA 4HFUH 5EU3B 1L0YA 1X5JA 5T1KD 3GZKA 1EAPB 1OP5H 3UX9B 1A1MA 3X14B 3FONB 2W9LA 4Z7UE 5IFHH 3C5JB 1YNKH 4LFHG 5C9KA 3L3IB 2NY7H 3H0TA 3WCYA 2HVKB 5CCKL 1R5WB 3FOMB 5KG9A 3TT3H 1TJHL 3CDGA 5D1QC 4L1DA 4V1DA 4F7EA 4PJ9D 1OTSD 4FFZL 4PP1D 3WFEH 5C08A 4OTXL 2YBRB 1YECH 4HULB 4M3KB 1FIGL 4WI4A 4M7KH 2DOCA 5DS8A 4QEGA 2IAMD 1HZHH 1TQBC 4APQB 2A1WL 4W6YB 4Q9QL 5JW4M 3IKCB 1CXHA 2DLFL 5L8LB 1JRHH 2O26U 2JE8A 4FFVD 4NN6C 1VADB 3N50A 3CFKA 4M6MH 1I8IB 2AJUL 2F5AH 1TENA 4XNXL 2P47B 1CDUA 3AMLA 5EU6B 3O3EA 5ILTL 4BH7B 2F19L 3FO1A 4P4KD 5CIPH 1F4XH 2XTLA 4NM8L 2NY4C 3RVTD 5HBBA 4ODHL 3IDMB 1A0QH 1KB9K 2AS5M 3C6LD 4XNQA 1WZ1L 4X7FC 5ACMA 3EKCA 4C56D 5JIIA 3AS1A 4ODBD 2YN5A 1DBML 1XGYH 3DUSB 1ACZA 2Q76A 3RVWD 1LD9A 1Y0LB 1AI1H 2L7JA 3RGHA 3KYKL 1Z9OA 1X5ZA 4AEIH 4ZUSB 2W59A 3GGWA 5GJTL 5L88H 1RURL 1GAFL 2H26B 3ARBA 4K3JL 5BW7A 3KPRB 4KJWC 2ED7A 3EYVA 3TPKA 2VLJA 4YJZL 1MCJA 2PO6B 4JPWH 1IILE 5KOVC 4K7FB 4DQOL 2AAVA 5SX4H 3CFIC 3OXSB 2FB4L 4BSWA 1OY3B 3FCTA 1S9YB 2QLVB 4K94H 1CI5A 3DARA 1Q0YL 3CJJA 5TDNA 5KAQG 2AJYL 4JM2A 1OM3L 5KVEL 4AG4L 3O11A 3HI1A 2PW2A 1QBMH 2FYYA 2HKHL 3W0WD 4LARL 5ALBH 4L4JA 3LQAC 2A77L 1FPTH 4O02H 4NKMB 4RFEB 3MRJA 4YBQC 2AJVH 4NQEE 4HGWB 2AEQL 1D9KA 3RWHB 5KN5A 2PTTB 4NNYB 1HCVA 3TIDB 1KGCD 1N6QH 1JMZA 4EI5A 4JFPB 3T0WA 2GSGB 3FQUA 3RA7H 4NC2B 5IB2A 5CEZH 1JGUH 1JGEB 3D0LB 1LO3H 5I17A 4XXDB 5IESH 3ZHDA 1CXEA 3O8XD 3B9KD 2FJGA 4XVJH 3PGCB 4N0YH 3RPKA 5CSGA 2L0DA 5FCUL 3SKMA 1AQKL 1FZKB 3UTZB 1ERNA 3VXRD 2V5SA 1Y0LA 4FQ1H 1AIFB 5IQ7L 2MHAA 4NIKB 1MWAA 1KEGL 4OZFH 3KHOA 3MGAA 4U1MB 3MGOB 3WFHB 4L8SC 5HYIA 1H9VA 3PGFH 2J8UB 1SEQH 3TEUA 2FO4A 1EK3A 2W65B 3ULVE 5ID0A 2ZUYA 1E4KC 4MX7B 3GMRA 4PRDB 2J88H 4LEOB 2FEDD 3MXWL 3SDAC 4JM4L 3KWWB 3X13A 2PO6A 3H3KA 1CF8H 4G6JH 5F89B 4OSUL 1ZHNA 4P46C 1CBVL 2XQBH 1QBML 2HKHH 4U1NB 2DLEA 2ZSWA 1A7PH 2AK1L 4ESKA 2JELH 1HSAA 3QUYC 5HYJD 5ESQA 5IM7B 4OZHE 3OX8B 3U30C 1U92B 4PLOB 1NGQH 1G7QA 3PQYE 4HLZG 4JO1H 1S7XB 3OJDA 3EGSA 1KTRL 3HC3L 3GNML 2FNBA 3HC0A 1MJ7H 5DHVA 4JY6B 1RJCA 3HZMB 1VEPA 4GQPH 5DUML 2CSPA 3V4UH 1JGDA 1KCVH 3DMMB 4L5FL 3MV9B 1ORQA 4R2GB 5D7IE 5B39G 3IXAA 4HLJA 4PBVC 3Q5YA 3VFTB 1JRHI 4LHUA 4NDMA 4PJDB 3SDYH 1UACL 1EHLH 3Q6GL 4NUGH 4BFIA 2V2XB 2OR9L 2VDPL 4XMKH 3H9ZA 5ICZA 4I1NB 1KJ2A 2VLKA 4N0UB 5A2FA 4QTIL 1L6XA 5D2LE 1GHFL 4DEPC 5I1HL 4GRMB 3FFDB 3IAQA 1IAIM 1KG0A 5TE4H 2DL9A 4PJGF 5FYJE 2Q6WB 2QJDA 4MA3B 3BZFA 1HOCA 4ZFGL 3ZYIA 2B8OT 5TE6L 4WHTB 4EBQL 3CSPA 3KYNB 4TTDC 3VGHA 2YPKA 3CPLB 4K3EH 4ORZC 3BAEL 4G9DB 5SWSB 1YZZA 5HVHB 1Z9MA 1QOKA 4UT6L 5HHMB 5MENE 5EZLA 3HRPA 1KOAA 1U95A 3INUH 4OQ1A 4RMWA 4KDWA 2Y4SA 4G6ML 4YZFE 4RIRA 4D0CA 1AQDA 3FN0L 4MCYA 2AXGB 2V2WA 1EZVX 1TPXC 1FP5A 3MUGA 4HWEH 1U9KA 2UUDH 3PQYA 2DQCH 2AXGA 2V2WB 3NN8B 3TA3A 1I7UA 3SDAB 2HRLA 4OZGB 1N0LA 3VXSA 3ZDYF 3HB3D 4CKVX 1IAMA 1W0VB 4ZOAA 2A6IA 1BFVH 1OB1B 5H37H 3O3AB 5AD0B 3V0WL 5J1AA 3ESUF 2C3GA 4NC1C 4U05A 4NOBA 3S7GA 3IFOA 4LSUL 1S5IH 5L2KB 1ZGLP 3KS0H 5IHZB 4FTVB 4LVHC 3H3PL 5D7LB 3PWLB 3MRQB 2FRGP 1JGDB 2NY2C 5FK9B 2UY7A 4XI5D 4O51A 2OTUB 4Z78A 1UXWA 3JZ7A 2F53D 3BJLA 3D2UA 3FQNB 3AREC 4WW2C 1BD2B 2JB5L 3V5KB 4ODXA 1VFAA 2UWEF 2HFGL 4WV1B 1G9NL 4XMLH 5D1QA 4JFDE 4M7ZC 5DUBA 1GIGH 3DXAD 4UILH 2AXHA 4PG9A 4ZTOH 4K9EC 3K2UH 1MI5B 2OMBA 3ULVC 5K59F 2L7UA 2FO4B 4LIQL 3VXPA 1PG7H 2K9UA 1AJ7H 1D6VL 2AV7A 1ORQB 4JO4L 2EDKA 1U8KA 1RULH 3O6FA 4FXGA 3BZFB 3CXDL 4YDLB 1NMCB 4P46A 1CFSA 5I1DB 2DQFA 1QSFA 5IQ9A 3O6LH 2R2HA 3TBWB 3OJ2C 3RWJA 2I24N 4RSVA 2AJ3A 2AEIT 4MXQD 3U83A 3FQRB 1RZFL 5LXGH 2CXKA 5GZNC 1OAXH 2VLLA 2KQNA 4HC1A 3OX8A 1YMHA 4J3XA 1N64H 3DX7A 1HILA 2XKNA 4PJEE 4N8VA 4X4XA 5D7KD 5E8OA 4OLXH 1J10A 5GISL 1HYSC 2UVFA 4PGCB 2VQ1A 4NHCH 4TOYH 1FZOA 1RK0B 1ZS8A 4MAYC 2R0WH 1F00I 2YMXL 5JW3L 1D9KB 1JPFB 4LU5L 1OT2A 5EN2A 3U82B 4OCWH 4MHHG 5HHOE 4XXCA 3VFWB 3OKNA 4XGZA 4EXPX 3MNZA 1GC1H 5MEQB 3BFOA 2Y36H 3PWJA 4XNUL 1HKLL 2IPTL 5GRVL 4PJBE 4QCIA 3WEXA 3VG0L 1CXLA 4BZ2H 1JF1B 1AXSA 4KMLB 1FCGA 4D8PA 2FECI 2VXTH 4Y4HD 3MV7E 3MRCB 4KH2A 4NGHL 5AG8A 1S7WA 2ATPA 1FYHB 5MEOA 2BSRA 4P3DB 1PDKA 1A1OA 3DVGA 4QHKJ 1WVZA 2WQRA 3PWVB 1INQA 4PJCB 2Z8VC 4JPKL 1DBJH 4PJAE 5IMKA 1R5WA 1KJ2L 3UJJL 3BXNA 4HBQA 1E28A 1A1NA 3NIDF 1KLGA 1ZAGA 5C0JA 1JIBA 2X4PA 1R5VB 1FRGL 2OP4H 3ORJA 4NRYA 5T1LA 4ACPA 4L4TE 1LO3L 3SKJH 5JZ7C 2MHAB 4I3GA 4WCYH 5EBMB 3KLHD 2X4RA 4ZMAT 2VLLB 3N0PB 5HGBA 2J6EA 5IIEB 4OCYL 2DWEA 1MPAL 1QO3A 1WQVT 2NX5E 2ADFH 1QHPA 5KSVA 4HUXA 5L8JB 1ZVYA 3M07A 4RNRA 1IQWL 3SKOA 2VDNH 2BZDA 2R2BA 4FG6C 4OFKA 2CK2A 5JOFA 3AY4A 2YUZA 1K2DB 3O45B 1CVSC 5F6IB 5GJTH 1NANI 5L88L 4KGLA 4L3EE 4OUOA 2CIIB 3U2SB 1RVFH 5B21A 5CD3B 4JFXB 3F7RA 5JOEA 1QG3A 5DO2C 5I1IL 4KRPD 2D0FA 2AK1H 2XKNB 5D2NB 4PJDF 3ZKXC 1NCCL 1YQVL 3VWKC 4YHYB 4K9EH 1EFXB 1PW3A 5D1ZA 2DTMH 5D6DC 3EHBC 4YHPA 5DR5L 3RWFB 3VGAB 5CJXC 1MJ7L 2YPLE 4JRXA 3TBWA 4LL9A 3F12A 5KVEH 1BZQK 1ED3B 4MNQD 5KSAD 1JNNH 3NH7L 4X98B 2QQKH 4LAQL 1BM3H 2A6JB 4OAWA 4NJAH 5CP3H 2IH3A 4G8GA 5FYLH 1HHGA 1H0DB 1DBKL 3F7QA 3AVEA 4L1HA 3MBEC 4NWTH 5DJAA 5DF0A 4CW1B 4J8RA 1FIEA 3NN8A 1I9IH 2FJHA 3TA3B 1UKQA 4BSVB 3H9SB 3U0TA 1FZOB 1RK0A 2VNCA 1EA9C 3ULUE 2BXZA 2Z8RA 5MP6H 2DI7A 4OJFL 3STZB 3SCMA 4U7SA 4KKAC 5AYUH 4KMTH 4V1DB 3OJMB 3OKNB 4F9PC 3SCMB 3VFOA 2Z35B 4H5SB 3RKDC 1LK2A 3D25B 4NN7C 4PJXB 4E41D 1OPGH 2K7PA 1U8MA 5F1IB 2YPVL 4GMSH 1IQDA 2HFGH 1YPZF 2X89D 1PY4A 3BEVA 4FQQB 1EJ6A 1G84A 4AEHL 1DSFH 2HJFB 3N9GL 1T7ZA 2UZIH 4L4VD 4R4NC 4NBZB 2BOCB 4PLNC 1CLZH 4P5KB 3MV11 3MREB 1A6UH 2R0LL 2OXGA 3I9GH 2ZUQC 2DD8H 5MEOB 1HQRB 4AK1A 4JZJC 3UZQA 1KBGL 1WEJH 2VLKE 2FZ3B 4HJGA 4OLVL 1JTPA 3CXDH 3L7FB 1ULVA 2UZYB 1IEBA 2FGZA 4WWID 1MH5A 1NLDH 3KS0J 2Q3ZA 1DQML 4QO1A 1QEWA 4AIZA 3V7AE 4KKCD 3NPZB 2R15A 3VI4E 5C0GA 3SEPA 1TQCC 3IXAB 4RFNC 1BQHB 1GGTA 2VLRE 4LSUH 4MNQE 5IB5B 1BFTA 4WWKC 5JMOC 4QXTB 4ZO7A 5ESVA 2E6PA 4HQQL 4O2CA 4DTGL 2GY5A 3QHFL 4XMPH 5D7LE 5D9SA 3QI9D 1WZKA 1J05B 5CZKA 1OW0A 3VJ6B 1FO0L 2XTJD 5J6HB 1ITBB 3SQOL 5TGBB 1W72H 4UQ2A 1XF2B 4IJ3B 4PD4K 3CFCL 3SGEH 1A64A 3LKRB 2P24A 1G7IA 3VXRA 3CH1B 4LSVH 1X5XA 4RMTA 4IIQA 2GFBA 1ZXQA 3ARBD 3LD8C 1MCPL 1NUDA 4NN5B 5FA4A 4ZTOL 1FN4A 3PXHA 4JREB 3RBSA 3I84A 2JKXA 5IMMB 1VGKB 1P9MA 3IGAA 1XGRA 1VKXB 1H3PL 1VEMA 1HH6B 4U3XA 4JR9H 2VWEC 3FN9A 2VMFA 2YEZA 4LLVB 1WEJL 4QOKE 1HDMB 1VHPA 5IB3A 4JZNB 2CKBB 4D0DB 2X9WA 2GTWB 4X5WB 4DFHA 5SWZB 1EO8L 5CZVH 4U6XB 5F7EL 2AJZB 1UH4A 4R96B 2RFXA 3BAEH 4A2MA 3NABL 1DQTA 4TNVK 3ZT5A 3VI3F 1ZHKB 4XCCH 1EXUA 3O9WB 3GB7B 1WWCA 1K6QH 3ZDZE 2H8PA 5CD5C 5IW6A 3VXSE 3OL2A 3I75B 3U7YL 3NACL 1YN6A 1H3VA 1IAOB 1JBJA 3X3GL 1KJVA 1QSEA 3O4OC 5CGTA 2BMKA 4YDVB 3JV0A 3QXUA 5CBEA 4P4KC 2APBA 1FVCA 2VWEE 2FWOB 5CBEB 4NRYB 1FNSL 2GCYA 5I2IB 1T0NB 4ZXBB 3QZWG 3SKMB 4PIRF 1QR1A 1F6FB 1Q9KA 5T3XD 3R06B 4LQFH 5CILL 4GW4B 5E56A 3MQIA 3QCUL 1Q9OB 1EMTH 2BNQB 3HNTH 3VFWA 1QTYT 5DRNB 5F70A 4C4KO 3ULVD 3UTPE 1VCAA 4NFBA 43C9B 4YDIH 3FO2A 1K9TA 5FUOH 4U2ZA 5EOCJ 4QRPE 3JV5A 4MDJA 1G6RL 3QIBB 4NKOA 5DLML 4F3FB 5HYEA 2ZUSA 5BZWB 4H88H 1H5BB 4LARH 4NBXB 5JDJA 5I19L 3GRWH 4K94C 5IMMA 4OLYH 5KANI 3QUXD 3BDYL 1U92A 5DJDA 1J5OH 4UOW1 3ARDB 3LEXA 4WW2F 1FH5H 2ZUUA 3MRNA 4PLKD 4LOUD 1MH5B 1A3QA 3OZ9H 4WI6A 2IGFH 3IS1X 4YHPB 2X05A 4PY8I 4U6XA 2AEWA 2D7NA 4LEOA 3C6LA 4I5BA 2NY3D 4JKPH 1XGQB 4ODVH 3QUZB 4MJ5A 3C2SA 4M8VA 2V2XA 2P5EB 3NTCL 2NY0B 3AU1B 2CGRH 2X40A 4LHQB 1Q1JH 3BEWA 3VRJA 4O58H 1Z9LA 1U93B 4RGNC 4LVHB 4D94A 3MV7B 2DM2A 4K71C 3VFVB 1A9BA 1JWMA 3SE8L 3MACH 3FKUS 3B9VA 5J3HD 4HUWA 3PGFL 4TVPE 2BY0A 5FECA 8CGTA 5T3XE 2LFGA 1DDHA 2LQRA 1OAUH 3GMOA 1D5IH 3STZA 4TTDD 3B9AA 4IM8A 4XX1G 3ARGC 4G9DA 3FB5A 3DUHA 3T65B 2KDGA 35C8L 4CRPA 4O2FB 3K74B 3H42H 2D31B 5I8EB 4NO2B 4DW2L 1K4CB 3U36A 4U6HA 1PEWA 5JQ6H 3L3HB 5ERWA 1NFDF 4ELMA 1TZIB 1NFIA 1X5FA 1OM3H 2XZCL 3P4NA 1BBJB 5EU6E 3S4SB 1D6EB 1MCHA 3IYLW 3ZE1F 4A6YA 2IGFL 2PXYA 1JF1A 3BD5A 2P5WE 1F6LL 2N4IA 4PFEA 2WWKO 3ISWA 3KYMB 5IFJB 3BZEA 2KZ1B 2WUCH 5T1DH 4PJIA 3LDBB 4KROB 4E41E 2EYTA 1AH1A 4NM8H 1U6AL 4PRIA 1M6OA 4G43A 4S1QL 4YC2C 3KJ6L 4LPWA 4WTXA 3PDOA 1RK1B 3VXTA 5C6WH 4P99A 5IBUB 3C60D 3KYKH 4KK9D 1W72L 2BSSA 3UTTA 3PQYB 3RPIB 3V52L 2J2ZA 1JGUL 4ZS6C 1VFAB 4JHZA 3TO4C 4KRNA 2ENSA 3WFHA 5CWSA 2DQEL 5EO1A 5F1OB 1IQWH 5IHLB 4PRPA 3B2UC 5A2LH 4WI8A 4DGVL 4Z0BL 1MFAH 5D7JB 4WUKL 4CNIB 1VPOH 1TNMA 1A3RH 1MLBB 1CLYL 3BYTA 4CDHA 4V2BA 1JV5A 2HRPL 1R3JB 5CCKH 1SJEA 4U1GB 2HT2C 4NKOB 4P46B 3WN5B 2EIZA 3VA6A 5KW9L 4YDKL 5JO5A 3CDCA 1MIML 1S9YA 1T0MB 1S8DB 2E27H 4PGEB 3QUMA 2GEEA 3FT3B 2FBJH 3BO8A 4U0RB 2H2SD 1T2QL 5DUBB 5I76B 3UBXA 1R24A 3CSYA 1OD7A 2EICA 3WD5L 5JA9A 3LPGA 5GGRB 3GIZL 1NFIB 4YFEA 5GRVK 3VFTA 4S1RL 2E6QA 4YPGA 4EDXB 3DMMA 1OARL 1XH3B 5IUSA 3AB0C 2VDML 3KLSA 4RCAA 1HWGB 1T04B 1YEIL 5FYKE 1FNSH 3WFCL 4HCRA 1F3DH 4XWOD 1RZIA 4OFIA 2D03H 2FL5A 5EU4A 4QT5A 1IC7H 3G5XA 4WHYH 3T2NL 3WIIL 5IB1B 1IT9L 3TYGL 4KXZH 3GSWA 1X3DA 3VRLF 1M7DA 1T6WA 4OLUL 2A0LC 2P24B 1QFPA 2NY7L 1JHTB 4E9LA 4UDTB 1QSVA 2NW2A 4G42B 5D72H 4HK3N 3MMEB 2IWGA 4LEXH 4NQSB 2WIIB 3QISA 1JCKA 5D96B 3BN3B 3LHPH 1N8ZB 3P4MA 3CVHA 5F7EH 1N5AB 1TVDA 4JFYB 3BW9B 2BCKA 3MGOA 5EZLB 1AGFB 1S9KC 5IP4A 4CMHC 2VE6B 3KXFD 5ICXB 5IWLC 2CLVB 2YD5A 1TTGA 5C08B 3QZWB 5KJRH 3BYYA 2WBJD 1FORL 2Y9RT 5GHWL 5JORB 1A6UL 5EZJB 4NKQB 2GTZA 4UBDC 4KJPD 4JO1L 4CVXB 5C7XH 1XF5A 3GO1L 3MO1A 3MA7B 2WP3T 3TNMA 4R0LC 1T66D 1BBJA 4G6MH 1OAYL 3MBEA 5D1XD 5B3JE 1S7SA 3ARDA 1D5ZA 1RI8A 3CFDA 5L2KA 3OKMA 3DVGB 4WW1A 2EYRB 4MYWB 3RIFF 4WU5A 2FDBP 4N0FB 4AZ8A 2XQYK 5GZND 2NZ9C 5SWQA 4Y4KA 3MC0A 4M48L 3GI8L 1PG7W 2AJVL 3BPLC 2A6KA 3NZHH 1NCWH 1T2XA 4Y19A 2LAGB 5ISZB 5FYKD 2HP4A 1WFTA 4FQPA 4M8QA 2I26N 4I0PC 4XAKD 1OGAD 4UNTA 4AMKL 2ERJC 3MA9L 1XF1A 3IJYA 3L1OH 5JIKA 1TVHA 3EYOA 2V7HB 3BDBA 3OKLB 2ICEB 5EIIA 5MHSD 2E9WA 3GBML 3JVGC 4MNGB 3BQUC 1QRKA 1AXTH 1NLBL 2BVQB 1M7DB 5GSRA 1FL3A 4KHXH 4Z6AT 3QUXA 1PFCA 2Q8AH 3KPOA 5DMIL 2BY1A 1CL7H 4U1KA 1FFNB 4PJFB 1YPZB 3WNKA 4OIIL 1A02N 2VTFA 1FBIH 5DD1H 1OTUC 5D1XC 2R8SH 3FFCD 4LF3A 2AK4A 2XZCH 3MRRA 1EO7A 4JDZB 4M1DH 1MCEA 2QQQA 3QULA 1QUNA 1T6VN 5C07A 1WTLA 3IF1B 3AREB 4ZUUA 2GJ6B 4OFDA 1NGZA 4HS3A 3ZE1E 4Z7NF 5A2IH 2IPKB 4LQ1A 3CIQA 3P11H 3W9EA 1PSKH 2GTWA 3ARYA 5F72S 2NTFB 3QJFB 2VDNL 1NFDE 1SHMA 4Y19D 3L9RB 1LK3H 3FB8A 1YEDB 5B4MC 3VXUA 4XPBH 3GNMH 3FT2B 3MJ6A 3EOBA 3O3AA 2QHRL 5AD0A 3VFMA 1QLEL 1NKRA 4DOHB 3LKNA 4WEBL 3STLB 4OV5A 4IHOB 5IB2B 2DIJA 3CZFA 1DBBH 3HE7B 1AD0B 4PYHA 1NGWB 3I75A 3SOBL 5LQBL 3ARGB 5F1KC 1YQ2A 4WU7A 4OZ4A 4QNPF 2JCCE 3RZWA 3BP5B 1E4JA 3O2WH 1JZ8A 3IVKB 3DGGA 2OTUA 4Z78B 2B2XL 4PD4J 4HH9A 2O5XH 4XXDA 1B2WL 1FNFA 2Y36L 4RAVA 2KPNA 2SEBA 1R3KB 2IG2L 3TNNA 4GS7C 5JLZB 1CLOL 3O6KL 4P3DA 1SEQL 4ZAKD 2DI8A 2HYMA 5T1MB 1I8LC 1A7RL 1XCQB 3UYOD 3MRCA 1MQKH 1TZHB 3HRZB 1BOYA 3MXWH 3BOVA 4OQTH 3MNVA 3HAEH 1M7XA 5EUKB 1JGVH 2IANB 2R8SL 2FJFB 4M6AA 1FZJA 1G7MA 2ZJSL 3F62A 5DYOA 5DSCA 3L3DA 2ARJA 4JN2B 4M1DL 2OYPA 4KKCC 4L3EB 3GMMB 4PJ7B 3ZHLA 4H8WH 3BKJL 3DXAE 1Q0XH 3R0NA 4Z7UB 5DQDL 4K94L 5J11B 3GBLA 2BVOA 5D6CB 4DEPB 3QCTL 1U3HA 1LO0L 2PXYD 4MVBD 2AEPH 3O2DL 3HPJA 3KYMA 1A0QL 5IFJA 4L4TB 1ZHBA 4MD5A 5ICYA 2NY6B 3EYQC 3U9UA 1YUHB 4FN0A 1CDBA 3GIVA 3UMTA 5D96C 4KI5F 3N1PC 4R4ND 5KSBF 3TVMB 1RFDL 1R3JA 1S3KL 2QSTA 2QL1A 3QJFA 2OTWA 3NAAH 3QIWA 4NO0B 5C3TA 2IBGA 1HH9B 3G5VA 4OLWL 5BRZD 4F58L 1U41A 3PHQA 3Q6FB 4FZ8L 3BGFB 4C54A 3DUSA 3L3KB 3BEWB 3CSBA 5HYFA 3WDJA 2CKBH 1MVFA 4GW5B 4JFEB 3H7BB 4HEPG 1P7QB 3NCBB 3D85A 5SWZA 2I5YL 1PVHA 1YY8A 3H7BA 3KAAA 2VAJA 3EYVB 1NGYA 4LCWA 1SEBB 3ZLQC 3ULSA 4HPOL 1I1FB 4NKMA 4RFEA 5J12B 4POUB 5BVJB 2B39A 5H35B 1ZT4B 5C0BA 2NXZC 3VXSD 4MLIA 4MQ7B 2W92A 1UVQB 3ELAT 4DVBB 4AT6B 2NY2B 3TN0A 4PRPE 2YN3A 1A9EB 3V0VB 2X6MA 5GSVA 2YA1A 1ZLWH 4U6VL 3ZDZF 5TDOA 4E41A 4PY7B 3A6CL 4R4FL 5DK3A 4Z7WF 4JM2B 3O11B 1Z2KA 3QUYD 5F9OH 1IAIH 2X4TB 1F4YL 4MD0B 5BJTB 4U1GC 3LKOB 4ELMB 4Q9RL 3S34H 2R69H 3C09C 5KS9F 3P9LB 1TJIH 1WCBA 2HN7B 4LGSB 3U79A 4M4PA 4ZO9A 4KV5F 3UP1A 1OP9A 2E7LC 5KG9B 2IADA 3HE7C 3SGJA 5INDB 1JPST 3MBXL 3KJ6H 4X6CB 5GS1C 2GYSA 3EDKA 3F7VB 2VLJE 4NWUL 1MF2L 1NBVH 1C12A 5TJWK 3OF6D 2EEAA 4OI9A 1NGPL 2F53A 4M1CD 1NSNH 3QA3B 4RWYH 4NNPL 5GGUA 3U0WL 2DQDL 2X4UA 2WWMD 3WLBA 2NX5D 5FB8B 3DETC 5C0RH 2I5YH 5FGCB 4P5TD 3LAFA 4JFQB 2F54E 1A7PL 1KIPA 4HPOH 5AUMA 3NBNA 1MCSA 5CD3A 5JMRA 1UM5L 3UO1L 5DJ0A 2NXZD 1H3WM 2DD8L 2IAMB 4IS6A 4Z7WE 5B39A 4Z0XA 3D9AH 4YDKH 4I13B 3HC3H 1I9EA 3T0EA 5C0JB 4Q6IA 1SYSB 4JY5H 3B8YA 3GHBL 2XKSA 4G8FB 4K3GA 3MRDA 5HSFA 1S7TA 1YMMD 1F4YH 3VGBA 2WBKA 3RL1B 2F8VA 2F74B 2VZSA 5HGDA 4ORGA 5EZOL 1W72A 1JNJA 1Q9LA 3OSKA 4Q9RH 4LRIC 1EVUA 1I8KB 3UC0H 1PKQA 5C86A 1RZIB 2W9EL 1MFBL 4OGZA 2BVQA 1AGBA 4P2OC 2XIDA 4U3CA 3DBXB 1VFBA 5L9DL 2NTSP 5HY9A 5TH2A 2EXWC 1Z0NA 4NOFA 3LS4L 1PLGL 2B1AL 4XC3L 4NQEB 3GBNL 4DCQA 4ZTPL 1E6OH 5A16A 1BVLB 5HHME 5MENB 4PRAB 1N4XH 1PD6A 4QTHB 3BQUA 4JAMA 4W81A 2VZ1A 3BZDA 1IC5H 4WNQB 5ACZA 2OL3L 4DZ8B 3MNZB 3DLQR 5CS7A 4Q2ZB 2D4DA 2XZAL 3N9GH 3KPSB 3MACL 3RAJL 5IVZB 1UXSA 5DQ9A 3ULUD 1C12B 4EI6B 5DK2B 3V6ZB 3RX8A 1NAMA 3AFLA 4KI5E 1CR9H 4ZFOA 1TQBB 1T1WB 1JE6A 5ADOL 3H2WA 2YD3A 3DROA 5KANG 5CJ5A 2O5YH 2Y25A 3HS0B 1KG0B 5MHSE 3DMMC 3FOLB 3TC9A 4ENED 1ZANL 2ZJSH 1CIDA 3D18A 2F8XC 4UT7L 1UCBH 2FZ3A 1NCAH 2DB8A 2ZP0T 4U1IB 4L4VE 5A43C 3NIFE 1MUJB 4R3SA 4ZS6D 4HPYL 5AZEH 5JQ6L 3WE6B 3QCVL 1RU9L 4M1GL 4Y2DB 4HX1A 2D31A 5I8EA 3V95A 2YK1L 4OUUB 3O41B 5BCAA 1LP9E 1BGXL 1KELL 2FO1A 4HUMB 5BZDA 4HZLB 1OWWA 4NO5B 3JTTB 4PJCF 3UTTB 3Q5OA 4OIBA 5KSBB 4MXWH 4Y16C 1VDGA 5FAAA 1A6VH 1YEKH 1DL7L 4MLSA 5DEFB 1Y6MR 4ZUTB 5F3BB 4FQJL 2A73A 35C8H 2I9LB 2QADC 5GISH 3FB7A 1BFSA 4Y4FD 3O9WC 1ND0A 1OSZB 4ZDHB 1U8JB 1KF9B 4XRCA 4N8CL 1K4DB 1RV6X 3MRQA 1I1AC 2Q7YA 1X5IA 3Q5TA 3BPNC 3TZVA 4BZ1L 5HYSB 4PJ7F 4P57A 1CF8L 4G6JL 3B5TA 2R23A 3LRGA 3RKDD 2DLIA 1RJZA 2YA0A 2XWTA 2ESVA 1IARB 3U7WH 4GRLB 3BP4B 3ULVH 1MWAB 4UT9L 4Z7NE 2MPAH 4M4RA 1S78C 4HWBL 1XIWC 2FB4H 2LAAA 1K6QL 1CL7L 2YSSB 3G04A 5SX5H 5EC1B 2VXTL 3FZUD 3WHXA 2Z0BA 4G9FB 3SDXB 5F1NA 2KZWA 3RU8L 3GSRA 4WUUB 5J0BA 1CFSB 4LHUG 3WN5A 3M17A 5KVFL 3O6FB 3OZ9L 1T04A 4D2NA 1NQBA 2VN7A 4ZUWB 5JW3H 2VJXA 1MREH 3TLRA 4U7MA 1T89A 2Z91B 3QBTB 1KPVB 3LPFA 4X5XB 3D85B 1LEKB 1RUMH 3QH3A 4JREC 3ARFB 4PTTA 1BJ1H 4XX1E 1SMOA 3PHOA 4XC1H 2CLRB 3ROLA 1YYLH 5B8CA 5EZIL 1MCBA 2HH0H 1Q9KB 2OZ4A 2XNAA 4C58B 2R2EA 3I6KB 2WINB 1LO4H 2AJSH 2ICWB 5DURB 4DN4H 4GOSA 3SPVA 5FYKL 1GSMA 5C1MB 1IAII 1PYWB 5I19H 1J18A 1UZ8A 1XF3B 3C8KB 4WY7H 4QHNA 1MFDL 1ZGLM 5CHNA 4UT6H 2I60H 2ITDB 2HWZH 4Y5XA 5EB9A 3TT1L 1GGBH 3AGVA 3MPCA 1JZ2A 3I50L 5BV7H 1A6AA 5IBUG 4YO0B 4HFWB 5ANME 1TVBA 2VDKH 3IDJA 3C9NB 3FHQA 4OI8A 3ALWA 4X8JA 1RIUL 2GSIA 5JZ7D 5HVHC 1NMCC 2LV4A 1BZ7A 2UWEA 1IC7L 3RY5A 4EVNA 3BXNB 3UEZA 2J4WH 5GS0H 2HG5B 1LO5B 5GGVY 3A67L 3NFNB 1C16A 4ALAL 5C6PB 2MCPH 5L2KD 1G1YA 5I75C 5F3HB 4M5ZL 4YHOH 2Z91A 5GS1A 2B1HH 3L3IA 2MWCA 4LCYA 4RGNB 2D0HA 4Y16A 2AJSL 4HKZA 3HZKB 3QHZL 5DJCB 5I9QC 2CKNA 2YXMA 4PG2A 5BV7B 1H5BC 4RNRB 1FFPB 1R6VA 3T3ME 2DTML 3IU4L 4RDQF 5J8OA 3JWOC 4QRQA 1YYMH 4MCZB 3MRBA 3NMEA 1C08B 1MI5D 3QFJD 1M05B 3LZFL 4UINH 4OQTA 1P2CB 1KULA 4YX2H 5TE7H 4GW5A 1HHHB 2PW1B 1UWXK 2NLJA 3EFFA 2Z92A 3OB0H 1SY6L 2XNAB 4TVPH 1JN6B 3U4AA 5D5MA 2E7CA 5C09B 3AM8A 5J57B 2GSGA 3FQUB 1QVOB 1IGIL 3UYPA 4AH2B 2MKLC 3LQZB 3VDCA 2NPLX 3W9DB 5H2BB 1LNUB 3K8KA 3UJTH 1Z5LA 4M6NL 5DD3L 1S5HB 2VLKB 3SDDC 5C2BL 1QNZH 4OZIB 4HXBL 1YDPA 3KPRA 2MQCA 5L2KE 4J7RA 3ULUL 4QGYA 4DN3H 1D7FA 1JWSA 3MLTB 4GBXA 5JHDE 5JW4Q 3S96B 1LILA 3MFFA 4WEBH 3BUTA 2P8PB 3OXRB 5ACZB 3SN6N 5DHYB 2PYEB 1CGTA 1EBAA 5LQBH 2HRPH 2R4SL 4IDJL 4MA1B 5M7QA 1BIIB 3MJ9H 3CFBA 4MNHA 4ODWB 4LEXL 4QYOB 4MD4A 1MIMH 3P73B 1ADQA 4X7DC 1IGJB 3P9MA 1CE1L 4C83B 4CADB 5D7SH 5BVPH 2O61B 3GK8L 3TO2B 1F02I 3DROB 3TGXA 1Q9WB 1MWAL 4KRLB 4RX4A 2ZSWB 1X44A 1XAUA 1P7HL 5DRWA 2F53E 1W72B 3JV6A 1VADA 2WBJC 2AVGA 1FZKA 5HHQA 4FNLH 3VDAA 3LKPA 4HJJL 3CMOH 4OCMC 1U8OA 1W0VA 1SVCP 2Y6SD 2XN9A 3RZCD 5GGTL 3OV6A 4CL7A 5HPOA 2ORBL 5KSAA 5DMGD 4CJ1A 3W0WA 1L6ZA 3BPNB 4JFFD 4Z7QE 3PABB 4BQ8A 1E0OB 1YEKL 4GG8A 1CDIA 3QEQB 4NJ9L 5D2LB 3E3QC 3VFUA 1GPOL 4PRAA 5D1ZC 4LCCB 2I9TA 4PJHE 4WW2B 1MCOL 1MNUH 2C3VA 4ZD3H 2AEPL 2VDLH 1VERA 3O0RH 4WTZA 3NFNA 4Y8DC 3GJFH 3VG9B 2GJJA 3TV3L 5K9JH 3RA7L 1I3GL 4Y5YA 3SKUD 2XYCA 3MYJA 3DUUA 4GXUN 4HMEA 2D2OA 4PBXA 1I8KA 3RFZC 3X12A 4W4OA 5BQ7B 3AS3A 5IOPA 3KPPA 2IMMA 1RJLA 3QWQB 4YBLB 2DKSA 2GK2A 5C70A 3U7WL 4EI5D 5IHUH 2H6PA 3CDYA 4HT1H 4XCNB 1BVLA 3D18B 4WUKH 1EMTL 1P4LB 3SQBA 5FDWB 15C8H 4EZMA 1OSPL 1SBSL 5ESQB 5A3IC 4PS4L 5IM7A 2CDEB 5EOQL 4GKNA 3FB6A 1XF3A 3C8KA 4FQXA 3O3DB 2N7AA 5GS2H 2OZ4H 1U8HB 1ZTXH 4QXGL 5BO1L 3K7UA 1CBVH 2AQ3A 5JHDA 4JFHE 3B8SA 4H88L 3MUGB 5T3ZD 1LO2L 1U42A 3BDXA 5FFLA 1NCAL 3MODH 5EIVA 2VXSL 5I1AB 5CJXA 3VMNA 1HXMB 4U1JA 4GH7B 2BHUA 1TFHA 5I1KH 4PRHD 1XR8B 4M1GH 1DANT 3VXRE 1KELH 1IQDB 3TV3H 4HS6B 4K23L 1FLRH 1IKNA 3DNKA 4PLKC 4AEIL 4CU7A 1UB6A 5AEAA 4YR6A 1K3IA 1SJXA 1Q1JL 1AO7B 1OCWH 1F4HA 2FIRT 2V17H 3PWPD 3GM8A 5J9PB 3D3VB 1AC6A 4DGYL 5GS3A 3TYGH 1F8TL 2R2EB 4UI2A 5FUZH 1EEZB 2ZG1A 4MDIA 3S5LB 3LN9A 4OZIF 2J1KA 5CGYC 3JTSB 3A6BL 1NDGB 3VH8B 1DBAL 5D1ZD 5GSRB 4PP2A 4HHAB 4K7PH 1J87A 1FAKT 3QEGH 4JFOB 3EO0B 3IAGC 4FFYH 1MCIA 1ZLSH 2ZOLB 4N0UE 3ZKNC 1JF5A 1O0VA 2AJ3B 5DA0B 4PTUA 5GGQL 5TE7L 2OI9B 3UYRH 3E8UH 1ZEAH 1N7MH 5HHVH 2G5BA 4Y1AD 3NVQA 4BKLA 2W60A 4YHLH 4N90E 4LCYB 1TJIL 1KV3A 4DKAA 4OM0L 3FB6B 3UTSA 1NANH 5F6IC 3G5YA 1NAKH 4KQ4L 4JDTL 4LLWB 3T2OA 3UTSB 2XN9B 4U49A 4ODUA 4RBPH 3SGKA 4ENEC 3G6JA 1GC1C 3NA4A 3BN9C 4LLQA 5DUPH 2Q86B 2NNAA 4K2UL 5IEKB 4Y7MA 5F8QC 1NCBL 1JNLH 4GG6F 1ZGLB 4YK4B 1FFOA 3QHZH 4X7SL 1E4XL 4JRXB 1MI5E 3WXWL 3WXVH 3RUGF 3ULUC 1HNGA 1OCWL 4PRNA 4UNUA 4G6FD 2N1KA 4XNQB 5FHAH 1UQSB 5F9WB 3L3JB 4Z7UF 1A3LL 2AGJH 3BVNB 5FUZL 5FO7A 3ZDXE 1XCTA 3ARBB 3ZKND 4KVCH 3RDTA 2Z92B 2CRZA 4WJ5A 4CW1A 4N5UA 5DTFA 1KCKA 1T4KB 3MFFB 6FABL 3D9AL 3BPOB 3DV6B 4MQ7A 25C8H 4P2OA 3VGFA 3K4DA 2FR4A 4JG1H 5E9DE 2VXUL 1GIGL 2M1KA 3QDME 3VWKA 3EAKA 1WBZA 5IGXL 1DLFH 4TSBH 1T89C 2UZIL 4QRRE 5KOMC 4CN6A 5LJYH 5I8CA 3AB0B 4HBCH 1AD9B 1CLYH 5EO0A 4Z5RB 3H3BC 4Y4KC 1BZ7B 3I50H 3IF1A 1DUZB 3ZKMD 2IBBA 4P2QE 4HUUB 4KK8C 3KPNB 1UB6B 4M9OA 3QNXB 1RUKL 1FYTD 2NW3A 5ID1B 3S35H 4P4KB 2P8PA 5EBMA 3RNKB 1L4IA 5HDQH 1H15A 4JHWH 4RMSA 5EBLB 2JCCB 4Z9KB 2J7LA 2V6HA 2VYRE 3U46B 5E8NA 4J3OC 3MRHA 2HVJB 1NL0L 1HHJA 2N56A 3WHE1 1YPZE 2DKMA 1W0YT 4YHNB 1Q94B 5MP6L 1E28B 4DGVH 3GSUB 4UIMA 1FL5A 1G9NC 2IFGA 5HD8D 1GGUA 3GM0A 2SEBB 5D5ME 3KPRD 4UIMB 2XPGB 5C08E 3JV6B 1ORSA 2V7HA 3MCG1 3SDCA 4ETYA 1YMMA 1S7WB 1XFPA 2ATPB 4GRLA 4XVSL 3FONA 1JI2A 1I4FA 3KPMB 3U0WH 3D3VA 5F97E 4TUOA 4YGVB 1HNFA 4S2SB 1KACB 1NUFA 2Y5TA 3QEUA 3HC0B 1H8NA 2FJFA 2VITA 3ZTNH 3OTTA 4O2EA 4WO4D 3LRHA 4LSSL 3WNNA 3MSPA 1FH5L 7CGTA 2IH1B 5GGTH 3VGEA 1TCRA 4HJ0D 3RWJB 2Z31A 2UY6A 2ATKB 3MROA 3VFSA 5C0EA 1QRNB 5CUSH 1B4JL 4LDOB 3WFDL 1UB5B 1J86A 1IM9A 4MXWL 4XP9L 1ONQB 2G5BB 3GJFK 1KJ2B 1PX3A 1U8LB 1V7NH 3HE6A 4HUWB 3MRBB 1AHWC 2FSEA 4UAOB 1KIQB 4L8CA 5E6ZA 4XBGA 1U8LA 5FEBA 4PJDE 2Q7NA 3QCTH 3V8CA 2B20A 2BNUA 3RU8H 4AENA 1A4KB 2XI9A 1CXKA 1NL0H 4G6KL 4AENB 5D1QD 5IT2H 3MJ7B 4NCC1 3QWOA 1YY9C 4ZNEA 4LASL 3LIZH 4P4RA 3GBNH 3L9RA 3B9KB 3O8XB 3DIFB 1BOGA 4HIJA 4XWGH 4QOKB 4ZSOB 2EDOA 2P8MB 1U8HA 3CFBB 1MHHB 4XPFL 4FTVA 1BPVA 1JYVA 3FQTB 4XVSH 2X5PA 2F9BT 5FCUH 4J1UB 5DC4B 1CLOH 3O6KH 1A5FH 1QQDA 4MHHI 3TO4D 4AMKH 3RNQA 3TO2A 1TPXB 4KMQA 1D5MB 1C5BH 5D6DA 4DUVA 5J12C 4NZTH 2VC2L 5IKCA 4U1SA 2XPGA 5C09E 3WIHL 4GKZB 1V3KA 5KBNC 4FQXD 4FS0A 4GRWF 5BVJA 4X7TB 3M1BA 3WLWD 1J11A 5HHPB 3RX7A 3BP6B 3BKCH 4YNYA 4LSPH 43CAA 4JFYA 1LQSR 3O4OB 4N0FA 5HYJB 3CVHB 4H0GA 4OGYH 3MRHB 4WDIA 1UM6H 2NQCA 3QNYB 4H1LH 3GRWL 1TMCB 2ILLA 3VXPB 5B4MD 3EDDA 4HX1B 2IALB 4JJ5A 1HKFA 4Q0XL 5EBGA 1J5OL 1GZQA 2DF3A 4FNLL 4G5ZH 2IEPA 4B5EA 3GSNL 5ID1A 1KIRB 2YK1H 2FCBA 1OF2A 3LS4H 3QXAA 4R2GD 4A6YH 1JZ3A 2A6IB 4NT6B 3DV4A 4G9FE 5DRWB 3G5ZA 4XNYH 3KNBA 4HKXA 4LOUC 5CINH 4XBGB 4OCWL 3GMQB 4R8WH 1A6VL 2C4XA 2X1WL 1BJ1J 1YUHA 3QXDB 2GT9A 5CFHA 1CXIA 3VFPA 3MXVH 3HNTL 4S1DC 2NY1C 1FFPA 3ARZA 4MZ3A 1F58H 1JGLH 1WAAF 2BVUA 2P7TA 2QSCH 1KJMA 1KXVC 4DZ8A 4HS8H 3HAEA 5DMIH 3TYFA 1KIPB 5FO7B 2DQDH 3IRZA 4XNMB 2Y5TB 4OKDA 1FVDB 3HUJB 3RTQD 1Z3GL 3RWCB 4KV5E 1D9KC 2X2YA 4XZUB 4PLJD 1XH3A 3KPPB 3ZE0E 2DQHH 3I2CL 4S1SL 1J7VR 4WWKB 5I74C 4X6FB 5J7CC 3NGBB 4OLVH 1VACB 3GIZH 1II4E 5FA4B 3TVMC 3CU1A 3QUMH 3W81A 4WHDA 1VACA 2VLRD 3UPRA 2R56H 3SDAD 5EULV 1RUKH 2AKRA 2VL5A 5CJOH 3BKYL 2DQCL 4P2QB 2B0SH 5JQHC 1I7RA 3SKJL 2IJ0C 4U4BA 1Z5LB 5K59E 4M02A 2R29L 2FWOA 4LHUD 4MJ6A 1YN7B 5JPNB 1H3TA 4NYLB 4D9RD 3BGMA 3WDIA 5DHVB 1HHHA 4LCIL 2AI0L 3QUXC 1F3JB 1S7RA 2X4NA 4HK0B 3RWGA 4C56A 5HGGS 5C0ND 4DZBA 4WFED 3S3JA 2A9NH 3IT8D 3S36H 2H9GB 1KIRA 5C0DB 4FRWA 1I7TB 1N6UA 5L9DH 4JJHA 4K23H 1VESA 4BFIB 1F58L 1H3GA 1U3JA 4JGMA 2AJXH 4KROC 4KZEH 3RHWK 1DUZA 4P0DA 4GAGL 1EUUA 2I07B 1WIOA 3T08A 4LPYA 1QFWM 3BP5A 4JZNA 4WVRA 4NKIL 4GRMA 2Z4QA 3PG2A 5TPWL 5FYKH 5I71B 2CLZB 1KB5A 5F44A 2PO6C 2OSLB 4K3DL 4XP6H 2C3HA 2VSCA 3DV6A 4WY7L 3FOLA 4ODTL 4WUUE 3DV4B 5C0NC 3PDDA 1CU4L 1FNEA 5GJSH 4MA8L 2NXYC 4KTEH 1DQQA 3CDGB 1MUJA 3O6ML 4X83A 2P4AB 4JM4H 2CIKB 4NUJA 5E2VH 3GSOA 3N1QC 1INEH 3MROB 1E27B 1YA5A 2ARWA 2FBJL 2F74A 4XHQA 2XA8L 5HGDB 1C16B 3MV8D 3JWOH 4NZDA 1MRFH 2HG5A 4M5YH 4LNRA 5BS0A 1F4WL 4F33B 2AKRB 4OLWH 4F58H 4KQ3H 2J4WL 2H2SC 3BIKA 4PJ5A 4OLZH 2P45B 1I3VA 3MRMA 4F7TB 2DMBA 3BP7A 5E9DB 2CR3A 4L3AA 4R7DA 2DBLH 5C0IA 3RDTB 3ZHKA 5IB4A 3S34L 5IJKC 3RVWC 2BHZA 5DJ2A 4I5BB 3C6LB 3EO1B 5CGYD 4CN1A 2NW2B 4G42A 4APQC 5EN2B 1T03L 3CXHJ 5JUEH 3HZYA 1PZ5B 2BY3A 4KWUA 4QOKA 5HJ3A 4FABH 2WUBH 3FCTB 4MA7L 2G2RA 3VD3A 4Y4HB 5HHXL 2JIXD 4XBPB 4OLUH 4Q74A 1H3XA 3DXAA 5E2UH 1IGFH 3DI3B 4PJFE 4AY0A 2BNUB 1OTTD 3BEVB 1CGXA 4YEFA 2J12B 4TTGA 4PV8B 3TBVB 4ODSH 1YNTA 4JFZL 1FQ9C 1OAKH 4GAYB 3P9LA 5EO9A 4HUVA 4J4PC 1GPOH 2Y06L 1QSFB 3ALXA 3P2TA 5IQ9B 2HTKD 1IM9D 5D1XA 4LAJH 3MR9B 5CSZB 4CBPA 2P8MA 1LK3L 3OKKB 5FKAB 2BNRE 1G7PB 3EYSL 5I6XC 4AM0A 4X5XA 4A6YL 3VFNB 4KQ3L 1KN4H 3B9KC 3O8XC 3U7AA 2PW2B 1HHGB 3F65A 2WV3A 2X4NB 1MREL 4C56B 3UJTL 1F4AA 1ZV5A 4WFFD 3V5KA 2Y6SC 4KAQH 5T1MA 3F58H 5DC0A 1DFBL 4YNYB 1RJYB 3QPQD 1EEZA 3MRGA 3MXVL 4NQSA 4FP8L 4X99A 2IBZY 1T03H 1FL6A 1OGAA 1YNLH 3QQ4A 2FEDC 1Q0YH 1JZ6A 2YPLB 2HH0L 2P1YA 4PBWD 1G7HA 2CDFB 5ITBL 1W0WA 1D5IL 1KN2L 1HHJB 1NUGA 1Q94A 3OKYA 4ZAKB 4JPKH 3P9MB 4KI1A 1AQKH 5EU7C 5ANMA 2PYFA 1PZ5A 1IBGH 4N90D 3V6OE 4JN1L 1YC7A 3MUY1 4RWHA 4FTVE 1HH6A 4LRNL 2X1PA 3G5YB 4N1EA 1DEEB 2DJUA 1FYTA 1MIEL 5C0AD 1MFCL 2WK2A 3SKOB 4HKBB 3K8LA 3TPUA 3WHXB 4WI2A 2PCPB 5L0QB 5CJBA 3QIBC 3EYSH 1ZVSA 4TSAH 4M6ML 4JB9H 4KJWD 3GEWB 2W07A 4XP9H 3MRDB 1ZGLA 2IH1A 2F15A 4Z7UA 5IBTH 2JJSA 3D39B 4IOSD 5C2BH 2C7UB 1QNZL 1G6RA 1D5XA 5GZOD 3K8MA 4BQ9A 4ERSH 4PJFA 4HPYH 2XWBA 1CZ8H 1UB5A 3RVVC 3F6IA 4TRPH 2DTSA 2ARJQ 3NGBC 2LTQB 3X3FH 5IF0B 1WZ1H 4NFCA 3MV9D 4XPBL 3MA9H 1KTLA 1UWGH 2YRPA 5E1AB 1XCTB 1L9NA 3BWAA 1OVZA 2YUVA 5BRZB 4NRZA 1J1XL 3HKFA 1B4RA 3EO1A 2OTWB 3V9FA 5ADOH 1WFNA 3FHAA 2CLRA 3ROLB 4FQ2H 4YE4H 1DDHB 3CH1A 1ZHKA 4NDMB 4PJDA 5E2WL 5C0AA 1AXTL 5HD8C 3O4LA 3SGKC 4D3CL 2HAZA 1E6JH 4LKCA 3O4LB 3IDGA 3PWNB 3T1FB 1CFTA 3DVNB 4EIZC 5DK2A 3V6ZA 1B0RB 1DQJA 1FZMB 2DLFH 3DETD 2RJMA 1X6NA 2XFXB 3W2DL 3LQAH 2B5IC 2AJYH 3DO7B 4ZAKA 2ZOKB 4P5MA 1TQCB 4RFNB 4X6DF 5FHBH 1WCBB 1QQDB 1C5DB 3BPCB 3PV7A 5HHOB 4I4WA 3PUCA 5DDHA 1IC1A 2F5AL 2NTFA 2DYPB 5MI0B 4EJ1C 3TNNB 2DQIL 4KK8D 4PJXA 5HYSG 2YD7A 3WO4B 2PF6A 3MRNB 4I8DA 4P9HL 1UM4L 4QRTB 1R0AL 3FQWA 3TCXA 4S1RH 1XGTB 3P4OA 4NZRL 4TVPL 2VR4A 3QQ9C 1ROWA 1NGWA 4J3UA 1BX2A 1OQXA 4MXQC 2H32A 2E3VA 1BVZA 1QLFA 4OD3L 4BSVA 4M6OH 1XGPB 3VXQA 5I1LB 4IMKA 2P5EA 4RWYL 3SE3C 3SJVA 2BVEA 4OZGA 4HXAL 2NYYD 4PJAB 4ZO6A 5E70A 2BVOB 5D6CA 3T2NH 3MGTB 4ZFZA 3HA0A 3NCCB 4PV9A 3P77B 4LSVL 3ILPA 3L95A 2VIRB 4HDIB 3NAAL 4JLRA 5IVXA 3I02A 5GS1B 4WFEE 5T3XH 4ODTH 3CGTA 3MCKA 3OBAA 1JZ5A 2F53B 1FAIL 4DGIH 2V2TA 7FABH 1P9MC 1CU4H 3DECA 3QEHA 3U4EA 4XPAL 5E8DL 4I48B 2I25N 3MLYH 2O5ZH 5HI5D 2AXFA 12E8L 3QIWB 3LQAL 3QJHB 5E8PA 1KENL 3D1MC 2E8ZA 3DXAB 1QBLL 3IDIA 1Y6NR 2A74A 3MODL 2LE9A 5CIPB 4RAHA 3S36X 3BKJH 3MOAH 2APVA 3MNWB 1MFDH 4GO6B 4WU5B 1MRDL 3QI9C 3ZDXF 4PV8A 4QY8A 4DTGH 1U3HC 4K7PY 5DEGA 5EUOB 2FECL 2Q86A 1PBYA 1URLA 1A7QH 3U7YH 3C8HA 2VR9A 3S4SG 3T0EC 1ZHLB 3FO9A 4OZFA 1JHKH 4WUUA 1MFNA 2EDHA 4AIOA 5C92A 4R90H 1YEFH 1T80A 3EUUA 4YUEH 5FYLL 1RD6A 4M6OL 2EYTB 3V52H 2IAMC 4MSWA 4EUPA 2YEZB 4LLVA 4OGAD 1CFTB 4NO3B 1UZ6F 3MBED 2FSEB 4KY1H 4L8CB 4NUGL 1HHKB 4WGWB 5DFTA 3QFDA 3VW3L 2X4QA 5C0CB 5I73B 3SJVD 5CKAA 3I6LE 4K8RH 4CAGA 3K4AA 4DVRL 3QI9A 5GRZA 1DBAH 4XWGL 2XWJA 5F7YC 1IGTA 1YPZA 1BEYL 4X0KB 4CU8A 2CRYA 2UV3A 1WTGT 1HK6A 4OCSL 3NCJH 2VAAB 4P49A 2ICCA 3IRPX 1EHXA 2FATL 2W0KA 2XZZA 4JG0L 4FFVC 4GFTB 2KL6A 1A22B 1LP9F 4EVNB 5IMLB 3UPCA 5IVNA 2XN9E 5TFSH 1SJEB 4GXVL 5JHLL 5EOQH 2BNRB 5HHQB 2WM0A 1A47A 1CGVA 5CMAB 3WKMH 4GMTL 4OGYL 4TSAL 2YZ1A 4L5FH 4WENB 4Y5VB 1GH7A 2X7LA 3MZGB 4HFWA 4OCXH 5EOCH 2IADB 5I76A 2A2QT 4HIEB 4KKBC 5FUCC 1XGTA 3P4OB 1DFBH 3MV7D 1G0YR 1OLZA 4XHJC 2HT4C 4G8EB 5SWQB 2IC2A 2OP4L 2NNAB 4TRPL 1F42A 4MAYB 3NA9H 2Q7YB 3O2DA 5BZDB 3PL6B 2YWZA 4DKEL 5T1LD 5JOPE 5DWUL 5I30L 3CMGA 3C5ZC 3HAEB 4QHLB 5DVKA 4NQCB 4TUOB 4KRPC 3T09A 4YHIA 1CICB 3JV4B 3QNZA 5EIQA 4FHBD 2VLJD 4M6NH 4PJGA 1GVIA 2A9ML 4D9QD 4WGVB 4PYGA 1IC5L 2R1YA 3KPOB 4B53A 3RI5F 4KPHL 1ZSDA 2R1YB 5IQ7H 1UM5H 3Q1SL 4OM1L 1V8HA 3ZTNL 2C1OA 5JO5B 1FRGH 4X6DB 1EGJA 3BUYB 3H9HA 4LSQH 1JUFA 2ZCKL 3MJ8B 5ALBL 5H94B 3E6HA 2A6JA 4WI7A 1KTLB 1WICA 5E1AA 1FO0A 3FQXA 4OTXH 2BOBB 3NTCH 5CUSL 3GDBA 2CGRL 2EXYC 3ZZ1A 5K9KB 2CXGA 5K9QG 5GRYA 1NBZA 2X70A 2A1WH 3JXAA 2WP3O 3W39B 5DI8B 2HFFB 2OBGA 3RVUD 2D3VA 1JF6A 2FX7L 4PRBB 1ZE3C 5HI3D 4X0KA 2KBGA 3LCYA 2J5LC 4LPCA 3CZJA 3UPRB 1XZ0A 1VFMA 3OGCA 4G6KH 3ZKQD 1QVOA 2H8PB 4I0CC 5IW6B 1DVFC 4Y5VC 2V5TA 4Z7QF 5HVFB 4FQQA 1KC5L 1ZLUK 4XRCB 3FQTA 4M7LT 4URTB 4CADA 4JKWA 2ADJB 5C0FB 1OP5K 4IRJB 5C6TL 4Y16D 1OAZH 3D2UB 4R4BA 1ZK9A 3MLVH 4HWNA 4J4PA 2BY2A 4P2OB 3SCMD 5DMKB 3MFGB 3O2VL 2DICA 4P5TC 2ESVB 5CZXD 4KTYA 4NPYB 4PRIB 3OXRA 4XT1C 1RULL 3EOYG 1ZA6A 1B3JA 3KPRE 1N8ZA 1JZ4A 5EU5B 3QO0B 4JE4B 5CJOL 2NY3C 1MLBA 4ETQB 1MHCA 3L3GA 4JG1L 2ORBH 4CU6A 4CVWA 1JWUB 4Y1AA 3O41A 1OAXL 4H26B 4JO3L 4MJ5B 4BFGA 2AK4D 3ARFC 3DJ9A 1W8OA 1S7SB 4JZJA 4Y5YC 5D93B 1X5AA 4OF0A 3VJ6A 1MHPH 1ZWIA 3DTXB 1WC7B 1XGUB 2FEEI 4BQCA 1T1ZB 5J13B 5E2VL 4F57H 4NQEA 4O00A 4PJ8B 2OS7A 3CVIL 4X7SH 1QBBA 4JO2H 4KZEL 4KUZH 1J12A 3W9EB 5CP7A 4AQ1B 2PCPA 3FN3A 3QEQA 4K3JH 4XCNA 2M8XA 1K5NB 2F8OA 5I1HH 3PP4L 3OB8A 3QO1B 1PG7X 4NO3A 4XPAH 5E8DH 5T1KA 3IFPA 3PNWB 4DWHA 4NP4L 1T22A 4KKLC 3NCMA 1NFKA 1NDMA 3NCYS 1FVDA 4L4VB 5ICZB 2JB5H 4QRSA 5KSBE 1KPUB 3F5WB 1M7IB 1LEKA 2WLZA 1NGYB 3HS0A 4LCWB 5DGQA 5E2WH 2MCG1 4DUWA 1KGCE 1CTOA 2BNQE 3PHSA 2V2TB 4YPJA 5JW5B 1JGVL 1JFQH 1JV5B 3OPZL 4BFEA 2WIIA 2EZ0C 5I0ZA 1KSRA 1IRAY 4LLUB 4B7LA 3WD5H 5SWZE 2EE2A 3R1GH 1QRNA 4OB5H 1LGVA 1Q9LB 2IQ9L 5EDXA 4RGMB 3VG9C 2I60L 3IGAB 1VKXA 2PR4L 3O2DH 3QPQC 2VDMH 1OQOA 3GHEH 4R0LA 3V4VL 5E94B 1X6LA 1K8IB 1FVEA 2H32B 3BKYH 1QFOA 2XQBL 4HMDA 2HFEB 4DOHE 2QQKL 5A16B 1BM3L 3SBWC 2D7TH 4IOIA 1X5YA 3RGVA 4L4TA 3WV0A 5LCVL 1G7LB 3TIDA 3SDXE 4H25B 4OF5A 4DUXA 1V3LA 1HQ4B 4OJFH 1EEUA 3D0VB 1I1YA 3RVXD 2HT2D 2JCCF 3CVHL 4XXCC 1DQLH 1RHFA 2UYLA 3DHJA 1E4WL 3QXWA 5JXED 3KYOB 1JPSH 3AC0A 1N5YH 2VLMD 3MRLA 4M5ZH 3S3SA 4IRSD 1BZ9A 2UUDK 1R3KA 2PYED 2C4FT 1WV7T 1WUNT 5D7SL 3KR3H 5BVPL 1RPQA 3RQ3A 2ZCLH 4Z0BH 5TF1H 5BS0D 2XWTB 3P4MB 3RWIB 4J6RL 2EC9T 4G7VL 2JF1A 1F6AB 5EG6C 5E2TH 3HE6D 2YRZA 4MNHB 4ODWA 1RAMA 2P49B 3QIBD 4AEFA 1FBIL 2IFFL 2VDOL 1RIHL 5DD1L 4N8PA 4H20H 5FXCH 2LABA 4XNZB 1U3ZA 4TUKL 1S7TB 1K4DA 2H2PC 2ZNXA 5GPRA 2ADGB 5IVXF 3ROOA 1KJ3H 5F1SA 1GZQB 3CUPA 1SYSA 1UENA 4IDLA 4ZPVA 3NIDE 1QFWL 1A6PA 1L7IL 1NC4D 3VFVA 4KAQL 4I18C 4YHZH 2EIBA 4ZUTA 5FGBC 5TH2B 3C60A 1G7JA 4AEEA 3BP4A 5HY9B 1F90L 3AS0A 1C08A 1YN7A 1Z6JT 5JPNA 3QFJE 1BFOA 4TVPD 3TZVC 4YAQA 4XCEB 2QHRH 4UQ2B 4LASH 3KJ4C 3G04B 3BH8A 1MRCL 3H9SA 4PJ5D 1FFNA 4MA3A 4YHMH 3T0DA 3WJLA 3SE4A 1N5YL 2OX5A 3HTLX 3KPSA 3O45A 4OF6A 4TQEH 5D8JL 4NQCA 4JDZA 5ADPL 1FFOB 4HT1L 1N59B 2O5XL 4P57B 2VXQL 4FQHB 4WNQA 1B2WH 1RZ8B 1AP2B 3C60C 2VISA 1P5VA 1FC1A 1MJUH 4WFHE 1I3RB 3PGDB 4DN3L 5F1IA 3BDYH 3OWEA 2COQA 4ZSOA 1U95B 4X5WA 5TF1L 3EYFA 4MA7H 1DQDL 4XH2A 1U36A 3AAZB 1HE7A 4NGHH 4HUNB 4W68A 1AXSB 1UKTA 4F80A 1IEHA 2W0LA 3QUXB 4LFHD 5CKGA 5F96H 3EFDH 4U1LA 4G80A 5FB8A 1X5KA 2H2PD 1AGDA 3TBSA 1XR8A 3B9DA 3L6FB 1JWSB 5KZCB 3TCLA 5CMAA 1KJ2H 3UJJH 5E6ID 5ENWB 1X7QA 3SDDD 1CICC 5D70H 4ZS7L 2ICWA 5IJVB 2IBZX 2RAMA 5F7DB 2XA8H 4YDVA 4X8JB 3U4BL 4OZ4B 1WBZB 1V3MA 5B8CC 3SO5A 5EFIA 4YHNA 5DFWH 4Z76A 3T0ED 5FOBA 4X9BA 3QIUA 3SE8H 4YBQD 3L3HA 3GSXA 1BAFH 1FGVH 2P8LA 3PHOB 1I9JL 4Q7DA 2NZ9D 3RHWF 5DJ6A 3X11B 1AKJA 4CVXA 4J23A 1ZA3A 2ADFL 3REWA 4XNXH 4P4KA 4JFQA 1JYNA 4PUBL 1OHQA 5IIEA 4X80L 4KGJA 5LAXA 4UNVA 3UAJC 5D7JA 2KKQA 2RHEA 1PQZA 4H5SA 5I16B 3U0PA 4X99B 4G7YH 4OIAA 4L3CB 4OLXL 1I7ZB 3FOMA 4LQFL 3VRLE 5E08H 1I8IA 2P5WD 4H26A 3UXFA 4UILL 2R0WL 3FO2B 2AV7B 1HH9A 3BQUD 5SX4I 5DQJB 3CFJB 3OAZK 4IDJH 4FA8A 1BD2D 5JHDD 2BSSB 4U7KA 1PG7L 4GJTB 1HYRC 2Z31D 5D7KE 4F3FA 1U2CA 5J06A 4TSCL 1EUTA 4P59L 1LE5A 4M43L 4B50A 3IU3A 4WV1A 4JO3H 4KHXL 3QDGA 1WK0A 2X42A 4YAQB 4N8VB 4X4XB 5D5MF 3P4LA 2IPKA 3NACH 2FIKA 4JM2D 4R9HA 5CSBA 1RJLB 1ADQH 2CMRH 4PJXE 4X9HA 3RP1A 1AFVL 1HINL 5E5MB 3SDDA 1IAIL 3W11C 3LSOA 2AJUH 1PX4A 5DVLA 2R2HB 1N0XL 3OGCB 1JMXA 2R69L 4Y5YB 4KJPC 1T1XB 1IL1A 2DQEH 3HG1D 3U9UB 4J2XA 4YIQA 1SY6A 3TBTB 4HQQH 1N3NB 5HGHB 4G8GB 4Z95L 1NEZG 4ZOBA 3GSQA 4P23B 5MI0C 1OARH 4XCEA 5F6HJ 4F37K 2A6DA 4JFHD 3TP4A 5DJ2B 2DLGA 1T0PB 4R90L 4WI3A 4JRXD 1HEZB 1NGPH 1JNHA 2DBLL 1FNHA 3CFCH 5E5UB 4GAGH 5D7JD 1X4XA 1Q38A 4H1LB 4L29A 5KW9H 1L7TL 4MCZA 1CGYA 3I6KA 4U1HA 2FX9L 4M1CC 4UV4H 3NCFB 5EUKA 4TSCH 5EORL 1NDMB 2VH5L 1BD2E 1S5HA 1MFEL 2CLZA 2BDNH 1S9XB 3C5SA 5I17B 3B6SA 1LVEA 4RAUA 4ZFOB 2FBOJ 3TH2T 3TZVB 4TNWF 4Q0XH 4PGBA 1FCCA 5DMYA 4LBEB 1LE5B 3QRFM 3HPJB 1U0QA 3QUYA 1RUQH 2D0GA 1ADQL 2CMRL 4JY5L 1ACYH 4LIQE 3RUGE 2OR8A 3O3UN 4LLWA 3DPBA 1X7QB 2EEBA 3V0VA 4PJ8A 5CAYB 1BFVL 4K9EL 3TPUB 4RGMC 2FHBA 1ZEAL 2ZUWA 2YA2A 2IANA 4JZOA 5D2LA 4S1SH 4X8XA 4MD0A 3S88L 5ISZA 1WITA 1U6AH 1F90H 1J8HB 3N1GC 3MLWH 2KUTA 4APQA 2J6EL 3IJHA 3BHBB 3KXFE 5IB5A 1UWGL 5A2JH 5KS9E 1JGLL 3ARBC 3MLXL 3HPLB 5FYJL 4QHMA 5JXEA 4PG9B 1JPGB 4JY4B 4IRSA 1KFAL 4GAJL 5AAWA 5IMOB 1HSBA 2QR0A 1CIUA 1MCPH 5D8JH 3Q6GH 4JRXE 5CGMA 2XA3A 4JAMB 4N0CC 4LCCA 3MOBL 2I9TB 1WIPA 2QSVA 3VWKD 1UKSA 2HJKB 1HI6B 4NCC2 5DRZA 3QJHA 1I4FB 3KPMA 1OW0C 3EFDL 4OGXL 5C8JA 4KRPB 3WBDA 1WCQA 3WFZA 5B38A 4XVUC 5FF6A 5C8JB 5TE6H 1EFXD 5GS0C 3EYQD 2GJ6A 3JWDH 4DK6A 3BI9X 4EN3C 4OM1H 3SE9H 5F7UA 2AJZA 1XGQA 4XPHH 1IKNC 3FO0H 4F7MB 5J4MA 4HUVB 4AH2A 1IFHH 3F12B 4ZUVB 3KVQA 1QYGH 3HE7A 5FV1L 5D5MB 3TFKC 3D69A 1NH6A 4G43B 1SYVB 2APFA 3GSNB 3OKDA 4QRRD 4WHYG 5D7LA 4YXKH 5JR1L 1RK1A 1DL7H 1FC2D 2NY4B 4X98A 1DLHA 1UACH 5FYJH 5IBTL 1HILB 1X5HA 4UOJA 3TA3D 3QT2A 3O0RL 2VXVH 4XCYA 5FKPA 3WUWA 4XPFH 3CLEL 4XB7A 2O93L 4Y4FB 1OTTC 5FO9B 1RZGA 3QUKA 3VG0H 5DMKA 2C26A 4Y2DC 4ZFOL 1CD8A 1HN1A 1I7UB 1XR9A 5CJQH 5EUOF 2VZVA 1FGNH 5IHBA 4K7PX 1BF2A 1U91A 3VRIB 5FV2A 43C9A 1INDH 1G6RH 1CGSH 3G08B 3CZFB 6FABH 5MEQA 1IGJA 5IR1A 1MCRA 1AGFA 1RUPH 4Y4HC 2APWA 4UIKH 3KXFA 4NSKB 2HJFA 2RB8A 3X13B 4MNGE 3LS5L 1SBSH 1IGYB 4PJEB 2BHYA 3QIUD 3CD4A 5HTSA 2OMNA 1YJDH 3CFDB 4KDVA 3RZCC 5F3BA 3TNMB 4AG4H 3VI3E 1IGFL 3F6LA 5F7LB 1ZLVK 3O6FD 3W0WB 4L3CA