1AY1L

Anti taq fab tp7
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
210
structure length
210
Chain Sequence
b'DIQMTQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDSTNLASGVPVRFSGSGSGTSYSLTISRMEAEDAATYYCQQWSTYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TP7 FAB
publication title Structural studies on an inhibitory antibody against Thermus aquaticus DNA polymerase suggest mode of inhibition.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 51
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 1997-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ay1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ay1L01
4LHUA 4NCC2 4WU7B 2EH8H 3P4MA 2EYSA 1NMCC 3MJ9A 4JRYB 5IMLA 4AEHH 4LHUG 4TUJB 2YA1A 2Z93B 1CGTA 4GAGL 4M8VA 2P8LA 5JW4Q 1OB1B 1BOGB 3BAEH 3QDJB 5KBNC 1DDHB 2AEQL 1A4JA 5TDPB 3RVUD 1SMAA 4JM2C 4H0GA 2FB4L 2Y06L 2CDEA 3ALWA 3EKCA 3RGVD 1NDGA 4KMLB 5C9JB 3T3ME 4P4RB 3T3PF 2Q8BH 1CTOA 4M5YH 3HZMA 4BZ2H 4DCQA 3QXUA 1MSPA 3O4LE 3MMEB 4FQIH 4JN1L 2AJZB 3HFMH 2VDQH 4JG0L 4P5TB 4PB0H 3FQUB 4XVTL 3ILPA 1S7QA 1A22B 1FFOA 1KBGH 3MLZH 4JHZA 4CKVX 3C6LC 3LQAL 1NLBH 3OKNA 5T1LA 2FYYA 3Q5TA 3VFRA 4O4YL 3RVTD 2AJXL 4XCEA 1W72L 1U8QA 5D71H 4X7CC 1BBJA 1MHCB 2QADC 4U7KA 4JREB 4XPGL 4P2QA 5CGMA 1DVFA 5CMAA 3GSXA 1QRNE 4IMKC 5FYJH 4JB9H 5HHQB 1J8HB 3M8OH 4MDIA 1A3LL 2HFGH 1CU4L 4RGNC 1U93B 2DMKA 3GNML 3QUML 3ARDD 1XF2B 4M6NL 3M45A 2IFFH 4JG1H 1NGWA 4JKPH 3IDJB 4V1DB 1S7UB 3RWCA 5L2JB 3D39E 5E8OB 3RZWA 1SJVA 2R29H 4H25A 5D5ME 5CCKL 4YHYC 1V3JA 3TFKC 3PNWA 1TPXC 3AMLA 1WFTA 4UB0H 5D1QB 2DI9A 4UZGA 1JIBA 4R8WH 4YXKL 4U05A 3SJVD 1U8HB 3EYQD 1QA9B 2PYFB 3M07A 1X5HA 2XT1B 4NWTL 1F6AA 1OARL 2X4UB 5EU6D 3VXOA 1FFPA 5GZOD 1MCCA 3O3DB 1CLCA 1U92B 3WNOA 4FQJL 4HKBA 3GGWA 3RAJH 3HG1E 1T22A 2GI7A 3ZHDA 4JY4A 4WV1A 1OAKL 3VGBA 2YUXA 4LSRH 4FXGB 4R26H 1H0DB 5KN5A 3H0TA 4ALAH 1HYSD 3RUGB 1TLKA 1NMBH 4LGSB 3N1QC 4MA1C 1A7QL 1FFNA 3CK0H 2CPCA 4AIXA 1M4KA 3IS0X 3VDAA 2EXYD 3WKNA 1E6OH 1YN6A 3VA2C 4F15B 3VRJB 4D8PB 4PJ8B 3DJ9A 1U2HA 2AGJH 3RUGF 1EDQA 1RFDL 2B5IC 3FZUD 3LS5L 3VFUB 1PBYA 5KVGL 1CZ8L 3VXMA 1GZPB 3IDMB 3MRLA 4ZXBC 1OF2B 1OGAE 3KNBB 2R8SH 4JFFE 3G9VA 3BW9B 3MRPA 2K3TA 1L0YA 1QSFD 2DJSA 4U1IB 1YEKL 2AK4E 3BQUB 3MCG1 2IPTH 4Z7UB 5INDB 4GG6E 4OD3L 4HQQL 1N59A 2X89D 2GUOA 1T1YA 2ERJB 1N26A 3CIQA 4K94C 4LGPB 5ITBL 3SKMA 2HWZH 2V2WA 1F3DJ 2XQYK 4M3JA 5CINL 5F1SA 3WFZA 3U2SA 3TVMC 2VLMD 4J4PA 4RRPA 3B9KB 5L7XL 5IKCB 2V7NA 4Z7UF 4PGBB 5C6PB 1G9EA 2CDGB 4JDZA 4RRPG 5IROA 3WFBL 5DC0A 1FGVL 5J9PA 5JHLH 3IDXH 4RBPH 1C16B 3U46B 4Y4FD 2DKUA 2OM5A 3GMLA 5EFIA 1T66D 1J11A 4JZJC 3LPFA 2F58L 5HGDA 3CPLB 1CD9B 4JVPA 1KFAH 1RUML 1A6WH 4ZFOB 1FV1B 3V7AE 4F2MB 1CE6A 1JK8B 4R96A 2ICEB 2EYTA 5E56A 3ME0A 1LEKA 2ITDA 2DQEL 3SDAB 4LVHC 3E2HB 5JOPD 1UZ6F 3VFTB 4NRXA 5E2VH 5EA0L 4Y19B 3L3DA 4LARH 4LSUL 4QXWA 3IFPB 1EPFA 5L9DL 3TN0C 4YDKH 5IMKB 4GRMB 2A77H 1HILA 1P4LB 3EO1B 5GJTL 2PW2B 4JRYE 2V5MA 2GJZA 3ZT6A 3B5GA 1Z9SA 4PTUA 2C1OB 2CMRL 3CSBA 2BNUA 3QDJE 3T3PE 3KR3H 3P4OA 2EDLA 4BJLA 5AEAA 1U8IA 4I18A 3TGXA 4OM0H 3IFLH 3MODH 4IMLA 4RAHA 4XVJH 1VKXB 3DSFH 2JJTA 1SVCP 1AP2A 1NBZB 3C5ZB 4IDJH 3U0WH 4U6TA 4QYOB 4KUZH 3CFEA 2AERT 1M6OA 5FYLD 3AY4A 3BP7B 5DRXB 4UOW1 1AD0B 3LEYL 4XBPA 5JXAL 1CYGA 4NSKA 4IOIA 4P46D 5D72L 4FQLL 1U95A 3KJ6L 1C7SA 3QDMB 1OT2A 2VABA 2P42B 1HINH 3P4LA 1U6AH 1I1AD 3DBXA 1G6RB 2ZOKB 3BWAA 1N4XH 3L7FA 5E08H 5L88L 4PD4K 4DW2H 3MACH 3LD8C 1CGYA 2RR3A 5L0QB 3TJEH 3F58L 1U8NA 4YR6B 1FL3B 1TVHA 5C0AB 3ZSSA 4ELMA 3KLHC 4BK5A 3SDDC 1BZ9B 3W2DL 2VB5A 2C4XA 3WXVL 5GPRA 5K9KB 2Z91A 1WFOA 2CKBB 4FQXB 1NBVH 2W92A 4N90D 4BQBA 4ZNEA 3AU1B 4W6YB 1TCRA 3UYPA 1DLHA 1XGUA 2BSRB 4ODXB 5EU3B 4MJ4A 3PWLA 1LP9A 2O5YL 2NZIA 2N4IA 3QHTC 4NHCH 4UIKL 4HJJL 4JFEB 4XBEL 4G42A 4PD4J 2VXSL 1ZLWH 2G9HB 3A67H 4AEFA 2VLJB 3PJSA 4BSWB 1S9YA 4YFDB 2EC9T 2K7QA 5E6ZA 3D2UB 2A73B 4V1DE 4XNXH 1CLYH 3UBXI 4W6XB 3MUJA 1MFCH 1OGTB 4CDGC 3ZHLA 3KXFD 1J1PL 5D96B 3O2VH 3RVWD 4WRLA 3WS6C 5ANMB 4GRWF 3O4OB 4Q9BA 1IGYB 5H94A 5TQ0L 1VGEL 3IGAA 1MFBL 3UJJL 3VXRA 3QEQB 1WQVT 1ZGLB 4GG8B 1G0DA 2CIIB 5DFVD 3MRCB 5C7XH 2NY7H 5HVGB 3B5TA 2NY4D 4JY6A 2JK5B 4NC0B 5I8CB 4YO0A 4NQCB 4PRHA 3SCMA 2APVA 2VXTH 4X8JB 2UWEB 4ZUSA 4P5MB 1FP5A 3LB6D 1W0WB 2HH0L 3IETA 5T33H 4BSJA 4MXVF 4DTGL 2R1WA 4YFEA 3RUGE 1KLGB 2PO6C 2QSVA 4QRTA 4P57A 2X6MA 4MAYA 3TBSA 1HIML 3CH8A 4YGVA 1CICA 4JFDB 3OZ9H 4LSQH 2YD4A 2UWEF 4ZO6A 3W81A 4G6FD 1LWRA 2DQHH 4FN0A 5F7DB 3L3GA 1EGJH 3I75B 2IEPA 4OIIH 4QXGH 1BVLA 2APXA 3V0VB 5ELIA 2EIZA 5CBEB 3C5JB 3K74B 1OLZA 4TUOA 5LXGH 3SQBA 3W39A 1Y6MR 1J86A 3LY6A 1JHLL 1T5XA 4OGAC 4HMDA 1KEML 4JRWA 3KS0H 3MNZA 3T4AB 1OQOA 3O2DA 1F3JA 2VJXA 4ONGH 2CGRH 4F7TA 1WIUA 4Z7UE 1RHHB 2AJ3B 4XAWH 5F96L 5DR5H 5MEPA 2E6JA 2EIEA 3CJJA 3VH8A 4N9GA 3UX9B 2MHAB 3TNMB 3V4VH 3LN4B 2YRPA 3KPLB 2PXYC 3MGTA 2WWKO 1T2XA 3RL1B 5ADOL 1UWXH 5I30H 5E9DE 1FGNL 4AL8H 3NMEA 4Z18A 3AAZB 4XCFH 2X1OA 3T65A 1NGXB 3KPPB 3DECA 3GBNH 1JPTH 3ARGC 5C0EB 5DI8A 3NN8B 3P73A 3NABL 3MBED 4Q6IB 4WHYG 4G7YH 5FHBH 1FN4B 2KL6A 1UZ6E 5MEND 2HN7B 2XA8L 3LS4L 3IU3A 2JJSA 4BKLB 4YBQC 5E94A 5C1MB 5DD0H 1HHKB 4MJIB 1WAAA 4LKCB 4HIHB 4E0RA 3SJVA 3K7UA 3HB3C 4GS7C 4JM4H 5EOTA 4Y19E 2UZYB 1FIGH 1N3NA 4U3CA 5CZKA 5IFJA 3L3JA 2X4NA 3TIEB 1I9JH 4K7PY 1X6LA 3H9HB 5F21B 4ETQA 4R0LC 4U1LB 4IRSB 1W2KT 4DGYH 4OIBA 1TIUA 1RZ7L 1DFBL 1RK1B 1LO3H 3GHEH 3UJTL 3GIVA 1ZVHA 5BQ7A 4ODWA 1BQLL 4PYGA 5F1IA 3U0PB 1NUDA 5I76A 3DUHA 4UMGA 1XF5A 2BVPB 1AKJA 4R4BB 2EH8L 4PJIA 2C7UA 4AEHL 1NGQL 5D1XC 4MA3A 2KUTA 4X99B 2NX5B 2DQIH 4JQVC 2H26B 3HRZA 4OZHB 3BAEL 2X4QB 3GMRA 2XV6B 3RJQB 4KWUA 2WWKT 3JTSA 2FO4A 3WHXA 4GQPH 5GGRY 1WFUA 3QDME 4HMEA 1UWGH 3SGKC 1D5BB 4M6AA 5D7LB 3MRBB 1AR1C 1S7RB 3CZFB 5FB8B 3C09B 2ATKA 3EYFA 1CFSB 2PTTA 4Y8AA 5E2TH 4OZHF 4GSDH 3MUHL 1MJUH 1UJ3B 4EQ2A 2Q8BL 3MXWH 1D9KD 4M5YL 1QSZA 1MFDH 5C0AE 1EZVX 4M6MH 2X89A 4N0CD 1FCCA 1S7TB 3PABB 4K7PH 1TJGH 4BZ2L 5DJZA 3HFML 2VDQL 4PB0L 2IPKA 5E8EA 1AGBB 5JLZA 3TWCH 1JNHB 1FDLH 1KBGL 3MOBH 3MLZL 1T4KB 2EH7H 1VERA 4HKXA 3WBDA 2OMNA 4ELKB 2C3VA 1NLBL 2X10A 1OLLA 2X1QA 4JFEE 2YMXH 1EHNA 1RUAH 1QR4A 3QDGB 2XNAB 1FPTH 2VLJE 1H3GA 1WBZA 1AGDB 4UILH 1HXMA 2NXZC 5D71L 5DUBA 3IXAA 2GSIB 3FKUS 4LLMA 4WDIB 2A1WH 3H7BB 5FYJL 4JB9L 1EA9C 3M8OL 1A14H 3QXTA 3V6FA 1P5UA 2HFGL 2P8MB 5ANME 1NUFA 3JV4B 3PHSA 1AGFA 1PG7H 1U8PB 2IFFL 3QEQE 4JG1L 3KPOA 4Z95H 2BOBB 4JKPL 4MXVE 4RQQA 2ADIB 4LRIC 4TSCH 4NDMB 2VLRD 3GSNA 4HK0B 4EXPX 2R29L 5MI0C 1XGPB 3PWNA 2Y5TA 4Z9KB 2UWEE 2PCPA 2Z35B 5TGBA 4UB0L 3B2VH 5F7LB 1A1NB 4R8WL 2CXGA 4IJ3C 2Q76A 1ZGLP 3MV7D 4RAVA 2F53B 4EN3C 5C0CD 1JYXA 3EJZD 4H26A 4U6YB 1I1YA 4JFDE 1CQKA 4HXBH 5SV3A 3O45B 3RAJL 1UEYA 5ENWA 2ED7A 4GXUN 5ESVA 2D31B 1QO3B 2KZ1B 4OZIB 1JBJA 1YMMB 3ZKSD 3BZEA 3DPBA 4LSRL 5JORA 1IZKA 4R26L 3DXAA 2BP3A 4ALAL 1I9EA 8CGTA 4LASH 2B39A 1NMBL 5KSBA 5DWUH 4F9LA 3SE4C 1P4BH 3N06B 3HNTH 1FC2D 3BXNB 1ORSA 3CK0L 4UQ3A 4OGXH 4OZIF 2NY5H 5I1GH 4RGMB 1E6OL 1MRDH 1T0PB 3ARFB 4O2CB 4HZAA 1GRWA 3S8WA 3LN5B 4S1QH 1S9VB 3WFHB 1FAKT 4OCNC 5F6HI 1IM9B 1KLUB 1I1AA 2AGJL 3ULUF 4XRCB 3ULVF 4L3CB 2X4RB 2EXWC 3P9LB 1XCTA 1ZVSB 3RY6C 1IKFH 2R8SL 4WY7H 2WBJC 2JIXB 3T4YA 5GS1B 1P7QD 4CBPA 3GSRB 4WFFD 1CF8H 1AXTH 2DIJA 2IPTL 4B7IA 2VAAB 4FTVA 2JB5H 3UBXB 2CXKA 1I8LC 4XGZA 1KJVB 2HT3D 4GKNB 4YHKH 2P5WD 2HWZL 4HKJA 4OGYH 3VFOB 3OKLA 4YPGB 3U48A 2V2TB 4JRXB 1QZ1A 1EFXD 4HCRA 1XAUA 4QOKA 3QWOB 5CD5C 5JHLL 3EYSH 3TA3A 3IDXL 4MJIE 1QBAA 4LIQH 4MCYA 3VFMB 1W8OA 4P9HH 1B2WH 2QEJA 1J87A 1U3HB 3WCYA 3P30H 3BKYH 1QEWA 1KFAL 1AGCB 1DQMH 2ZUUA 5DEFB 1A6WL 3P4NA 2VR5A 5DVLA 4DWHA 4NN6B 4GRWH 2G60H 3N1PC 4J23A 3ZTJH 1CD1B 3SGEI 3MV9D 2EE3A 4X9IA 2ZCKH 4KZDH 4YAQB 2PTUA 5ISZB 5E2VL 3WV0A 4LARL 3AUVA 4KRPD 2E7CA 4YDKL 1Z2KA 3BDYH 2A77L 2GT9A 3Q5OA 1FNSH 3DHMA 1HHIA 5TDOA 4R4ND 4EQ3A 4NO3A 1M1SA 2X1XR 1LO0H 4L3ED 4KTDH 4OZHE 1BJMA 4N8VA 3KR3L 1T7WA 4J1UB 1WZMA 2VITA 3LDBB 3JWDC 4OM0L 4N8VG 3CFBA 3IFLL 3MODL 4P23B 4ZUUB 5IHBA 2DWEA 2HT4D 2R1XB 4XVJL 3DSFL 5D7LE 1OAUH 5B22A 4D9QD 1ZHLB 3RZCD 4IDJL 5D6DC 5AUMB 3U0WL 1KCLA 1FCGA 4KUZL 1CG9B 1NCUA 3WIFB 2XI9A 5EORH 5EN2B 3U30B 3U0TA 3GI9H 4DGVH 3RWJB 1TVBB 1CK0H 1DBKH 1M05A 4JM2A 3ZKXC 2OJEA 4G9FD 5HGHA 2BMKB 1HINL 1U6AL 5T3ZH 1UVQA 1N4XL 4HIXH 5E08L 4KKAC 4DW2L 3DX8A 3BIAX 3MACL 5HTSA 1NBQA 3TJEL 1R5VB 5C07D 3IDIA 1NDMB 3H7LA 5FUCE 5B8CB 5J56B 3CFJA 5J6GB 3MBEA 4PGDA 5ITFA 5DQJB 1KYOK 1U91B 2XZQH 5MENA 4UBDD 5TQ2H 3C6LA 5CEZD 2XWTA 3QG7H 5DJ2B 3QCVH 1NBVL 3MRKA 3HKFA 2OJZH 2ED9A 4AIZB 2X70B 1Q9KA 3HI6H 1QLFA 5DVNA 1SVZA 2GJ6A 1YPZB 4NHCL 4Z78B 3A67L 1FG9C 1K8IA 5GGTH 1AC6A 1G7PA 1J1XH 2CDFB 1ZXQA 2NY3B 4G8GB 4FABH 2EYRB 3MRMA 3OL2A 3GJEA 3LKSA 1CLYL 4R2GD 4XNXL 3LRSB 1MFCL 4M61A 3O2VL 3MRJA 3OXSB 4JVUA 4P5TC 2J1KA 3W9EA 5F3BA 5C2UB 2DYPA 2W0KA 2R15A 4XH2A 2F53E 1QR1A 2GCYA 5GQBA 4KKNA 1G1YA 3QSKB 5C7XL 2J12B 2A6DA 2NY7L 5EUKB 1IC4H 1DEDA 1A1OB 2VE6B 3L3KA 2BHUA 3L3OA 5DSCB 1UCTA 2E27H 2E6QA 1BD2D 2VXTL 4OZIE 1JPST 2AV7A 2EECA 1YMME 4NQVB 2M1KA 5HGAA 3SQOH 5T33L 4PJ7B 4KVCH 1MHPL 3ULUE 3S3JA 2ZUSA 1QRKA 1PSKH 4XNYH 2E9BA 3ULVE 4WTZG 1S7WA 5DURB 3QIWB 3P77A 2ZNWA 3OZ9L 4LSQL 1PKQE 3HAEH 1J18A 2DQHL 1FG2A 2QKIB 1EGJL 2YPLA 4NPYA 3FOLB 4OIIL 4QXGL 3HE7D 3R06A 3IS1X 4ZFZA 5CIPH 3MR9B 5FDWA 1DEEB 4TVPE 4XTRC 4GKZB 4PJFB 5LXGL 1TZHB 1NL0H 3BP4A 3AROA 4JJ5A 3EOTH 5D1QC 3VXSD 4L4TD 5EO9A 1D9KA 4MNQB 1T83C 2R23B 3WEXB 3QUKB 4JKMA 1T03H 4PRDA 4ONGL 2CGRL 4MXWH 3VFVB 1AD9A 1T1WA 3F7YB 4J8RA 4PGCA 4XAWL 1HHGB 5BVPH 4ZAKB 3SKNA 5JHDB 4MB3A 1NEZA 3OB0K 5DRNB 3C5SA 1A1MB 1UXWB 3JBG7 3HNSH 4DN3H 1NEZG 2R2EA 5GISH 5I30L 4LSPH 4AL8L 2Y5EA 4JRXE 4K8RC 4XCFL 1O7VA 4XNZB 3TYGH 2HVJB 1FZOB 4WFED 5FIEA 3GBNL 4I4WB 1JPTL 4F58H 2R9HD 5AWNH 1B90A 4X7TA 4NZJA 3ARBD 4PJ8C 4CW1B 4G7YL 5FHBL 2H32H 3TVMA 5I2IB 5I1LA 1YQ2A 5JOFB 2IANA 3RNQB 1X5LA 4M1CC 2ZSWA 4MHHG 3G5ZA 5KSVA 1G7MA 4YK4B 3CVHA 1L9NA 5DD0L 1MAMH 4UNTA 1DP0A 2DQFB 3OKDA 3SKUD 4RWYH 1V05A 3VXPB 3BI9X 4JM4L 3MV7A 4PLNC 1T0NB 1FIGL 5C0CA 4M7ZB 4NO2B 4JN2A 1I9JL 3VXUD 1NAKH 5C86A 2GITB 2BY0A 4HX1A 3MLXH 1KTKE 2OR8A 3MRGA 4DGYL 35C8H 3B9KC 5HHXH 2B4CC 3TBYA 4I5BA 5MERA 2D7NA 1NFDB 2OTWA 1LO3L 3ETBF 3PHQA 3VXNA 3DX9B 3GHEL 1EHLH 3MRDA 3VW3H 1A6ZB 1JGEA 5BJTA 5C0DB 5J1SC 5IBUG 4C83B 5GIRB 4OZFH 3UTTA 1TCMA 4WFGD 3FRUA 1NGZB 1CFQB 1ITBB 3MJ7A 4TNWF 1NFDF 4X7EC 2DQIL 4QO1A 2ADJA 2SEBA 3OR6A 2B8OT 2V5YA 4HGKC 5DEGA 3SDAC 3LKRB 1J0KA 3EHBD 4P4KB 3E2HC 1UWGL 5TPWH 3RNKA 1UQSB 2CLZA 1F4HA 5DD5H 5E2TL 4HJ0D 4GSDL 1MJUL 1ONQA 3MXWL 1MI5A 3OKMA 1E28B 1MFDL 1JTOA 4M6ML 3N9GH 2B2XH 4I3RH 2NY5C 2O61B 4K7PL 2K9UA 2X4SB 2P5WA 3IJHA 1Q9WA 4QTHA 3TWCL 4ZDHB 1FDLL 4PRID 3MOBL 1JZ3A 1IGJB 1KPVA 3K2UH 2EH7L 5SWSA 2DM4A 1EFXA 2VQUA 4YHMH 1YPZE 3C5ZC 2YMXL 3WFEH 4PJDB 1RUAL 5MEQA 1FPTL 2VDKH 4UILL 5C0JA 2OQJB 1G7JB 1P7KB 1EEZB 5JW4R 2A1WL 2ZUXA 1MVFA 1K8DB 3ILQC 1JZ7A 5F7YC 4QHNA 1EVUA 3VCLA 1PG7L 2EDJA 3OAUH 3KPSB 1AH1A 4Z95L 3RDTB 4MYWB 3O9WD 5L0QC 5ID0A 4TSCL 1I7TB 4A2MA 3G08A 1CGVA 3P2TA 1QTYT 4M9OA 2J5LB 1HXYA 3I6GB 1OP9A 2KKQA 1LQSR 4HV8A 5T5NG 3B2VL 3CX5J 4P2OB 4U2ZA 3BH8B 3AGVA 1MCLA 3QUXD 4FQXC 5MEOA 4L3EA 1HEZA 3QXAB 4I48A 3C8HA 3C60D 4UU9A 1EEYA 1SYVA 3OKEA 1DANT 3NVQA 3QEHA 4KK9D 5IVZB 4ZYKB 1F6FB 1WJ3A 4XPHH 1A47A 3TT1H 3RZCA 4X4MA 3LEXB 2C3XA 3EOAA 5D96C 4MSWB 4PJFE 4LASL 2IGFH 5DWUL 1JHKH 1P4BL 2DQDH 4YHOH 3O4OC 4MNQE 3HNTL 5K9OA 5GSRA 5D7IA 3CZJA 4ZPVB 1MCWW 3OG4B 3E6FB 3BJLA 4OGXL 3WE6A 2NY5L 5I1GL 1MRDL 4S2SA 4HS8H 4U1HB 5EC1A 1UXSB 3MFGB 4G9FA 4S1QL 5E4EB 2ZUVA 3V6BR 3BO8A 3B8SA 3CFDB 5JHDE 1CXHA 2HFFA 5ICZA 4NKDA 5IR1A 5C07A 1IM3B 4Z7WB 1IKFL 2G75A 2W1NA 4WY7L 5KAQF 3NFSH 1CF8L 1AXTL 3BP5B 4NM4H 5AYQA 4NKIH 5F9AC 4EUPA 2JB5L 2J88H 2I5YH 2UY6A 1I9IH 2E7BA 4EUPG 1WISA 4OZGB 3DX7A 4YHKL 5EZJA 3V52H 3QRFM 2A6KA 4OGYL 3WJLC 3P4MB 2EYSB 4DKAA 3QIBD 4IS6A 3K46A 4KROB 5CWSA 1B0RA 2M2DA 1U8OA 3EYSL 2LFGA 2P8LB 1G84A 1IC5H 5CBAA 4K3DH 4OZGF 1LE5A 4LIQL 4WJ5B 4P9HL 3RX8A 3QUZD 4KTEH 1B2WL 3P30L 3BKYL 3Q48A 3ZYOA 1DQML 4YZFF 3D85B 2D3VA 4U1GB 2FIRT 5DHVA 1K2DA 3FHAA 3HPLB 4L8SB 3MNVB 1T3FA 2G60L 4ZUVA 2ZG3A 2ZCKL 1FBIH 5I8EB 1JVKA 3HZMB 5HYSB 1NFDE 3SGDI 5A43C 4MD4A 4U0QB 4OBRA 2OL3H 1P1ZA 3BP6B 2VQ1A 1NCBH 3ILPB 3NPZB 2ZOLA 3BDYL 1FFOB 2XG5A 4Q6IC 5CP7A 2WSKA 1M7IB 1FNSL 4EI5D 3P0VH 3LKNA 1P69B 3BWUC 5E2WH 3VFRB 1LO0L 5E99H 4M6OH 4KTDL 3ULSB 4ZQKA 4XCEB 3TO2A 1LGVA 4F7MA 3QNZB 1JJUA 2H2PD 4ZO7A 3EOBA 4YPJA 4P2QB 2OSLA 2LU3A 3GSXB 1HH6A 3QA3A 4X6DA 1OAUL 4YNYA 1J8HD 1IT9H 5CLTA 2NPLX 2NY2D 5FGRA 3MUGA 3HS0A 2AQ3A 2FWOB 4NNXB 3X3FH 5ICXA 5EORL 5J0BA 4IRSC 3GI9L 1XIWB 4DGVL 1CK0L 1DBKL 4NJ9H 3SGKA 4H25B 4UI2A 4F33A 1T89C 1UFUA 3TJHC 2A38A 2HFEA 3WO4B 1SM3H 5E8PB 1CLZH 1EXUA 5T3ZL 3ZLQC 4HIXL 3UO1H 4X6CA 4ODSH 1FJ1B 1RURH 1OTSD 2FEEI 4LDLB 2NY1B 2QR0B 4HWBH 3QQ4B 3DO7B 5DO2C 3VXOB 3BEWB 4RFEB 3ARBA 2W91A 3GGWB 1E4KA 1T22B 2D0FA 4KUCD 2XZQL 2KBGA 4YHIA 5TQ2L 5I6XC 2H2SC 4JFHE 4DJMA 3QG7L 2OJZL 3F5WB 5SX4I 4ZFFB 1RIHH 3HI6L 4M7LH 5T3XE 1NEUA 3C09C 5HYFA 2IMNA 2IPUK 1XZ0A 3KPSE 1U2CA 2APTA 1ZT4A 4NIKB 5GGTL 1UJ3C 1J1XL 3BKMH 1SMOA 4FABL 4WEBH 1FE8H 3TO4B 4ZD3H 5HJ3B 4PRAB 4HUMB 3WUWG 1KPRB 4MD5A 5DK0B 4LGRB 3LSOA 5IEHA 4X0KB 4QTIH 4RA3A 3VXMB 3O8XD 1IC1A 3DMMB 2FHFA 1U8LB 4JFYA 4JZOB 5JW4N 4G8EA 1IGTB 5JZ7D 3MNWB 4XPBH 1IC4L 1KJ2H 1K5NB 3UTZA 5DMIH 5FUCC 2X4PA 4MVBD 2BCKA 2E27L 2AW2A 5ABDE 4OFPA 1VDGA 3GK8H 2JJUA 3BQUD 3TM6A 4FFWD 2GUOB 4IM8A 4OF0A 4ZSOA 1OP3H 3CXHK 1FL6A 3SQOL 5JQHC 4NKOA 3FO2A 4KVCL 3SKMB 4CNIB 4YWGH 1Q0YH 1Q8MA 4KXZH 2YXFA 4HJGA 4FFZH 1EERB 3L5WA 4EVNA 4XNYL 5ESAB 1SJXA 2K1MA 5H35A 1VFAA 3IKKA 5EPMA 5DJXA 5I16B 3PV6A 4JDZB 3VWKD 2AXGB 2D7QA 4OSUH 1QRNA 1IQWH 3V5HA 1D5ZA 1IEBA 3GMLB 2ARJA 1JF1A 3MROB 5DZNA 3X14A 1QFPA 3I84A 1I7ZA 5HGDB 1NL0L 4YIQB 2EDKA 3EOTL 2XKNA 3CC5A 3TBTA 4R96B 2GTZB 1IAIH 4UAOB 3TF7C 5I8OH 1T03L 2GTWA 4UV7H 4Y4HB 5KJRH 2P7TB 4MXWL 4TTDC 2PF6A 5BVPL 5JDJA 3MREA 2AQ1A 4NOBA 3REVA 4OZGE 3QJHA 5HPMB 3RY6A 3HNSL 4N0FA 1YNTA 3VI4F 2IC2A 2BZDA 4DN3L 5GISL 5JUEH 3OGCA 5FO9A 4NGHH 3ULUC 5F7EH 4LSPL 1I7UA 3KYOA 3G6AA 1MH5A 4YZFE 3HZVA 5CSZA 3ULVC 3TYGL 5BV7B 2IALB 3HG1A 4F58L 4RGMC 3ARFC 2FJHB 5AWNL 4WFHE 5GJSH 4DEPB 4QNPE 3CMOH 5IHLB 2XFXA 1S7XB 3JVGC 4NJAH 3I6LD 3WIHH 1YC7A 5CZXC 4IEFB 5A2FA 1FLRH 3OHXA 4NYLB 1KGCD 1MAML 4NSKB 1OTUD 4RWYL 1MFNA 3BUYB 3I3BA 3MLWH 3VI3F 3R8BB 1E0OB 1INDH 3GJFB 3ISWA 5LAXA 3BEVA 4N5UA 1A0QL 3DBXB 3EOYG 1OGAA 3C60A 3BWAB 5FV1L 3REWB 1F5WA 1NAKL 1VACB 3P3YA 4JFFA 4NP4H 1IILE 4XHJD 3MLXL 4UDUB 35C8L 5HHXL 5C3LD 3CUPA 3MRIA 2BVQA 2X44D 2AK4A 4GG6A 1EHLL 3U7AA 3VW3L 4P2QE 5A3IC 1IL1B 5FYKH 4GKSB 1HKLH 3PHOA 2WP3O 5A1AA 2P5EB 1KB5H 3STLA 3QH3A 1TCRB 4KK8D 5BZDA 5I75B 1NGPH 5K9QG 2NCMA 1SQ2N 1WWBX 4HC1A 4ELMF 3SPVA 4G42B 2ILLA 1HWGB 2E7LC 1S9YB 4NN6C 2NY0B 2FSEA 4PLKD 2COQA 2MKLC 2FO1A 1K4CA 2RIKA 5F72S 2R4SH 4O2FB 1IQDA 5D6DA 5AZEH 5TPWL 4OAWA 5L8KB 3V79C 1G9MC 2OTPA 5DD5L 4HUKB 5EU5B 5H94B 1YEGH 4L1DA 4JO1H 4EDXB 3IGAB 4JAMA 4QXUH 5SWZD 4OI8A 1FNEA 3SDCD 3RFZC 1Q1JH 1J9CT 4HZLA 3N9GL 1QQDA 2B2XL 4I3RL 1VB9A 5FKPB 4BM7A 1KC5H 1SHMA 4NQCD 3G5VA 1E27A 4LLDA 2DD8H 3QIBA 4OCRH 1FYTD 3K2UL 1ROWA 4U1JB 3UTPE 4JRYA 4YHML 4HGWB 3QQ9C 1W0VA 3KPTA 5D2NC 2Z93A 3WFEL 3TBSB 5LGJB 3BRDA 2VDKL 3BH9A 1T04B 3JXAA 4MCZB 4MA7H 1CGWA 4YH6A 1DL7H 2CUIA 3RGVB 1OHQA 5TDPA 3D18B 4CDHA 1LDPH 1AQKH 1FO0H 1BQSA 3VXME 5C9JA 2Z8WC 3MYJB 4K23H 4P4RA 3OAUL 1H5BB 1T5XB 2RB8A 1EBPA 2WP3T 3MNZB 2L7UA 1LK3H 1F3JB 1CFNB 2DQGH 5IB1A 4F7TB 1GPOH 4Z8FH 1MIEH 3X11A 3FQUA 3DRQB 5MEPB 2CRZA 1LNUB 5INCA 4EI5A 1AE6H 3CU7A 2CH8A 1BBDH 2DLEA 1GOGA 3ZT5A 4QRUB 1N2RB 1LE9A 1OAYH 4X98B 2BVEA 4KKLD 2CD0A 5EOCH 4C57C 4CVZA 4HWZB 4GH7B 4Y5YA 4ISVA 3T65B 1MHCA 2VDNH 4OI9A 2NY3C 4XPHL 3TT1L 1WBYA 1J8HA 1L0QA 3P73B 3FB6B 4WI2A 4CVXB 3ARDB 1U93A 4FZEH 2IGFL 3MLUH 4Z0XA 5I9QC 1JHKL 2DQDL 4YHOL 4PJ9D 2P1YA 3IU3B 3IDJA 2BY1A 3VI4E 2CK2A 4HS8L 3F7QA 3X17A 5JW5A 3VRIB 5EIIA 3SJVB 5EOTB 1CDBA 3L5HA 2Y72A 2NTFB 5IFJB 1N3NB 2XA3A 2X4NB 1U8HA 2PYFA 4MNGB 5EU6B 5IQ9B 2HTKD 1FNLA 3RWEB 4XWOD 2DL9A 4XHQA 2IPUG 2X4UA 4R7NB 1WAAF 3NFSL 3O3DA 4MJ6B 1U92A 1NAMH 3IDNA 3PQYD 4NM4L 2CUHA 4NKIL 1QSED 3MGOB 2J88L 2I5YL 4QWWD 3GIVB 5BQ7B 1I9IL 3G6JA 4AJ0A 4FXGA 1MFEH 4FG6D 4KKBD 3QNYB 5I76B 4OLUH 3K81A 2BNQD 5EULV 1N6VA 3VI3E 3C87A 5HVWA 4PJIB 5H37G 2C7UB 2DJUA 4P49A 1U9KA 1YEEH 5I1JH 1R24B 3WDHA 1EUUA 3VRJA 1IC5L 4PJ8A 2NX5D 4K3DL 5LKNA 4F8QA 5MHSD 2A0LC 4AM0A 4OJFH 3O8XA 4KTEL 3VFUA 1PFCA 2N7AA 4PJIF 1ZLUK 2YR3A 3UTSB 3EYFB 4ZAKC 3OX8B 4RMWA 5FEBA 3IDMA 4D94A 1OF2A 2P44B 2P49B 4JE4B 4XAKD 5LGHH 5A16A 3TP4A 1QSFB 1KEGH 2HTLD 4LAJH 2AABH 4F7EB 3T77B 3ARED 1KACB 4TSBH 4R97B 2DLTA 4U1IA 1FBIL 3BQUA 5E03A 4Z7UA 4RMTA 2GFBB 4MLSA 1EZVY 5INDA 5DJZB 1G1CA 1TQBC 2OL3L 2IPKB 1NCBL 4NC2B 4ZNEE 2P5EE 3OR7B 4NBZB 4KH2A 3P0VL 3B9KA 4X5LA 5F6IB 5IKCA 3MLPA 2BHZA 1BX2A 1CD0A 3VWKA 4PGBA 1DE4B 2EC8A 2PR4H 3HCVA 5E2WL 5E99L 4M6OL 3QI9D 2ICES 4E42B 4O2EB 4Y4FB 3ESUF 1HXMB 2EC9U 3QDGD 3IXAB 3KVQA 4EXKA 4YK4C 1C16A 1S9KC 3RY5A 4DZ8B 3MV8B 4V2CB 2APFA 5DLMH 2HT2C 4L3AA 3CPLA 1RUQH 1IT9L 4ZFOA 1FV1A 4F2MA 4M7ZC 5KZCD 1JK8A 3STZA 1F97A 3KPOB 2HMID 3VFNB 3X3FL 2D4DA 2WWMC 3UTOA 3SDAA 3IU4H 4PJGA 1ND0B 5FECA 1Z5LB 3EO0A 4PJCB 4NJ9L 5SX5K 3E0GA 2X9WA 3PWNB 5E6IB 3VFTA 5GZND 4Y19A 1MJJB 3SOBH 1SM3L 1FORL 4MHHI 5F1NB 1CLZL 2IQ9H 2OYPA 1P4LA 4F37K 3ZKNC 2GYSA 3UO1L 3C9NA 4ODSL 4YBHA 1RURL 1S78C 5CJ8A 4HWBL 1X5ZA 4H26B 2YK1H 1W72A 5FK9B 3V0AC 4C56D 1GCFA 3CU1A 2DDQH 3GMNA 4PBWD 2FLRT 5ESVB 1JMZA 2G2RB 4NFBA 4JO3H 4JDTH 4NQDD 5LQBH 1VKXA 1RK0B 5IBLC 3DROB 5JORB 4P4KC 4OCLC 3P0YH 1NBZA 2A6JB 2O5XL 1RIHL 4I3GA 4M7LL 3QUMA 4QYOA 4TULH 3DRTB 4OF6A 1ZS8B 5GS3A 5IB2A 3BIBX 1B4RA 3BP7A 1Q72H 4WWID 3GSQB 3BKML 4P46B 1AD0A 4WEBL 1FE8L 1JHTB 2Y4SA 4ZD3L 4N1EA 3WFCH 5F9DC 5TE6H 1I1AB 5ADPH 3MLYH 5KSBF 2EE6A 4QTIL 4WI4A 1G6RA 2BERA 2YD8A 3UAJD 5B38A 4GBXB 2OZ4A 5C6TH 3QISA 3VDCA 3ZMRA 4YR6A 5B38G 4XPBL 3T4YB 2OXHA 5C0AA 1KJ2L 2CO7B 5TF1H 1UM6H 4Y5VB 5DMIL 1H8SA 4H1LH 5CUSH 1V3KA 3GK8L 2YPKB 5K9KA 3OAYH 4L8BA 2ZG1A 4S1RH 1TFHA 3FHQA 4FQXA 5KVDH 3AU1A 1NC2D 4ODXA 5EU3A 4HKJB 1YN7A 2IADB 4YWGL 1Q0YL 1B88A 2LV4A 3OKLB 4FFZL 5EC2B 3HR5A 3HUJB 4ZOEA 2VLJA 4BSWA 4LCIH 3QUYD 2VERN 5IWLA 2A73A 2BRRH 3KXFB 3RDTC 4GLRH 1OGTA 1Q94B 1WAAE 2YHGA 4OSUL 3ZL4H 1IQWL 2P24B 4LKXB 1KT2A 3SJVE 2J5LC 1EHAA 1QEWB 2AJSH 5SWZA 1IGYA 3BHBB 1SYSA 3P4NB 1XF1A 4MNGE 1U3HD 4M43H 5EU6E 1GC1H 4PG2A 5DEZA 3QEQA 2NY4B 1ZGLA 4X7SH 2CIIA 4ZOBA 1IAIL 1XF3B 1YMHA 3MRCA 4XPTH 5I8OL 5I8CA 2JK5A 4UV7L 4NQCA 5KJRL 4HULB 3T1FB 2EKSB 4WGVB 2AS5M 2Y6SC 3ARGD 3QXDA 2UWEA 4P5MA 3O6MH 3BYYA 1FYTA 3BGMB 1W0WA 2J6EA 5ISZD 2VDRH 3DV4A 5DDHB 1MQKH 2MSPA 5JUEL 4D9LH 1NQBA 4NGHL 4G6FB 4PJIE 5F7EL 2DIBA 3MCKB 4JFDA 3NACH 5J12B 4DFIA 1WIOA 1NLDH 2MNUA 3I75A 5DD3H 3U1SH 2VITB 3V0VA 1WCBB 1U3ZA 5D1ZD 5E4EC 5GJSL 3CMOL 5CBEA 3C5JA 1CDGA 4RMUA 1P9MA 3K8MA 4P23D 4G6AC 4Y88A 1WTLA 4L9DA 4NJAL 3WIHL 4QRPD 2WBKA 2I24N 3D3VD 3KYAA 4AIOA 1QSFE 4FP8H 1FLRL 3VFWB 1K4DB 3LOWA 3U0TB 1RHHA 2AJ3A 3W5MA 3MLWL 5HI3D 4W4NA 1INDL 3D1MC 5GS0D 3TNMA 3LN4A 3TH4T 2VLME 3KPLA 4X83A 1UVQB 3RY4A 3RL1A 4NP4L 3T1WA 1A6TB 3AAZA 1KB9K 2BNRD 4JM2F 5JR1H 4BFIB 1H3XA 3QNXA 3O2DH 2LAAA 1NGXA 3KPPA 1O0VA 3CFJB 3HC0B 4PGDB 5I19H 4J3OC 3NN8A 4CN1A 5MENB 5D9SB 5FYKL 5TE7H 3QP3A 4WHCA 1HKLL 4PJ9A 1FN4A 1G0XA 1KB5L 2HN7A 1DCLA 4QXTA 1NGPL 1QLFB 2E8ZA 4BSVB 3CFKA 3OJVC 4BKLA 3LPGA 3ZYZA 1GJIA 4U1GC 3OKYA 1C8PA 1G7PB 4LLUB 4U2YA 2H3NA 5JOPE 1HHKA 3CH1B 4MJIA 3D0VB 3OQ3B 4LKCA 1J12A 4PJCE 1A6AB 4HIHA 4G8GD 1CN4A 2R4SL 1FYHB 1JYWA 1PLGH 3EJYC 2BC4B 4XP5H 5AZEL 3G5XB 4B50A 2Q87A 2X05A 1QLRB 3TIEA 3FB8B 1WEJH 5F3BB 1OY3B 1YEGL 1DQJB 4XH2B 4JO1L 2VL5B 4V2BA 3BD4A 1G7HA 2AJYH 2GCYB 4U1LA 4QXUL 1Q1JL 3FB5B 1T89A 1RK1A 4KK5C 5CJBA 1KC5L 1KCUH 2VKWA 2BNQA 2CIKA 5DC9B 1TZGH 5HI5D 1G7QB 1DVFC 2DD8L 4OCRL 1YYMH 2BVPA 5FYLE 4R4BA 1ED3A 1UA6H 4JCLA 3WHE0 2ITCB 2DQUH 4QLRA 1S7WB 1A9EA 2NX5A 3RKDD 1P7HL 3P77B 2X4QA 1KCRH 4MA7L 4FS0A 4R90L 5EU4A 3QIWD 4NPYB 4CL7A 2VH5H 1DL7L 1F3DH 5M95B 3NCCB 4ZFZB 2P43B 5D7LA 3MRBA 1LDPL 1AQKL 1S7RA 3CZFA 3QHFH 5J11B 1FO0L 4L29B 3DO3A 1CFSA 4JJ5B 5ACMA 1D9KB 4K23L 1UKSA 2MJWA 3QAZB 3VRLF 3B9EA 2NY1C 1LK3L 4U6HA 2DQGL 3PABA 1GPOL 4Z8FL 4M1DH 1AD9B 1MIEL 4RBPK 5EOQH 3CDYA 4PGCB 4R9HA 4N90E 2PKDA 1AGBA 1JNHA 3SKNB 4I0PB 3C6SB 5J3HC 4WV1C 1AE6L 1T4KA 5CD3B 1BBDL 3L5JA 2H1PH 2YD6A 4FFVC 3C5SB 3MLTA 1MAJA 3WYRA 1OAYL 3IXTB 2CR3A 5DC4B 4Q9RH 2R2EB 3LVEA 2X5PA 5EOCL 3QDGA 2XNAA 1AGDA 3NTCH 3ROLB 1X44A 3KXFE 5KANI 2VDNL 1WCQA 2GIYA 4WDIA 4LLYB 3RHWK 3PV7A 3TO4C 4PP1D 3H7BA 3RVVD 2E5EA 4MQXC 3B9AA 2P8MA 5IB5A 3JV4A 4FZEL 3MLUL 1EBAA 5I1LB 1U8PA 2VZSA 4XI5D 2V5TA 2FEDC 5D6CA 2VLRB 2BOBA 3DMMC 1G7MB 3B43A 3CVHB 2J7LA 5GGVY 2WIMA 1MCOH 1XGPA 3OKDB 1F90H 3P0GB 1A1NA 4DK6A 1BGXH 5C0CB 4AH2A 4U7SA 3VGGA 2VXUL 3U4AA 4XC3H 3QWQB 4J4PC 2NNAB 1F42A 5C0NC 3MJ6A 4I5BB 3O45A 1NAML 5MERB 3R1GH 4NZUH 3GSNH 2W9EH 5IBUB 2XN9D 1YMMA 2O93L 2ZPKH 1MFEL 4QF1A 2IQAA 5I1CH 1UH3A 4OLUL 2Q6WB 4UV4H 2GK0B 2NMSA 1BWWA 3BXNA 2VLKD 3ARXA 1YEEL 4TTGA 4TPRH 5I1JL 4UAOC 3LN5A 1QFUH 3WFHA 1IM9A 4Y4HC 5JO5B 3M17A 4OJFL 3JVGA 3S7GA 4OCWH 2BVYA 4L3CA 1EV2E 2X4RA 4X4ZA 1XGTA 5GGVH 2CLZB 5LGHL 1PEZA 1P7QB 1KEGL 1DBJH 1R3JB 1ZLWK 2VZOA 5GS1A 5LVEA 4NHUB 4TSBL 4B53A 3GSRA 1S5HB 1MWAB 1C1EH 2VAAA 5BV7C 3UBXA 2P5WB 1YNLH 3IJHB 5MENE 1KJVA 1REIA 3BKJH 1KPVB 3VFOA 4DEPC 4YPGA 2X2YA 3QUYA 5F6HJ 2V2TA 1JRHH 3RPIB 2BVTA 1A6PA 2C4FT 4RX4A 2PR4L 3DARA 3QWOA 1XF4B 3AY4C 1QUNA 1PKOA 3VMPA 4PRNB 1BREA 3RWGB 3VFMA 1CDHA 5DLML 1U3HA 1EO5A 1AGCA 1RUQL 2UV3A 4U1NA 2AI0H 2EEDA 4LVNB 4QHNB 2H8PA 1JL8A 5JA9A 3ARRA 2WQRA 2E7LA 1VCAA 3MV9B 4P2RD 4OFKA 4OLZH 2YN5A 4O51A 1ZEAH 3IU4L 5ID0B 2NYYC 4NUJA 3G08B 1D6VH 1CIDA 4KRPB 4YAQA 4MJ5A 4PGZA 5ISZA 1HXYB 5C3TA 4LCYB 3IKCB 3SOBL 3DVGA 1VFBB 3DVFA 4KI1A 4Z7VB 4L8DA 4B5EA 4P2OD 2VZVA 4L3EB 4JPIA 5I75C 4I48B 5T5NF 4XXCA 5IUSA 2YK1L 2VLLB 1EEYB 1SYVB 3FO0H 4PJ5D 3QZWA 4R6UA 4NO0D 5DJ0B 2DDQL 3VRLE 2NY0C 3QZWG 3JTTB 3ZSTA 2UY7A 4Z7VF 3RZCB 4P23A 4JDTL 4ZUUA 2R1XA 5LQBL 4QRPA 3QFDB 3P0YL 1ZHLA 2R2BB 3D3VA 4IOFD 5AUMA 1S9WA 3PWPD 2PTVA 4TULL 1EAPB 32C2A 3ARQA 5K9OB 3WIFA 5GSRB 1UWXK 1Q72L 4O58H 5EN2A 3BSZH 5HD8C 5EC1B 5HHVH 3RWJA 5I71B 1TVBA 4G9FB 1F4WH 3WFCL 1DUZA 5TE6L 4QGTA 1CTNA 5ADPL 3MLYL 4URTB 3MA7A 5F9OH 5D7IF 1HOCB 1J8KA 5C07B 1X4ZA 5TDNB 3WNMA 1J0JA 5C6TL 5HGBB 4N5ED 1KXTB 1R5VA 5B8CA 5TF1L 1UM6L 5J6GA 1RJCA 3UYRH 5DQJA 1U91A 2A6IA 4UUJA 4EUPB 5CUSL 4JY5H 3RVUC 5A40E 4RZCB 4S1RL 5DJ2A 5KVDL 4R4FH 4AIZA 3RGVC 3OJDA 1HK6A 4TUKH 2X70A 4LCUB 1KIQA 2JCCB 1U8MB 1YPZA 4Z78A 2X42A 3RJDA 4OFYD 3V4PH 3N85H 1TNNA 4R2GB 2VLRE 5CWSB 1UCBH 2CDFA 4LCIL 1CQYA 2ZJSH 4G8GA 2BRRL 1QPPA 4KROD 2HG5A 2XPGB 5CBAB 3ZL4L 1GXEA 2JCCF 4CMHB 3MV7E 1HHHB 1EEUA 4WFHD 5C0CE 1BQHG 2AJSL 4KHXH 4M43L 4RIRB 1GC1L 5IF0A 3NH7L 2FH8A 4I1NB 4GMTH 5DHVB 4X7SL 1JGVH 3WJJC 4XPTL 3D85D 1T3FB 5EUKA 4ZUVB 3NCYP 3RVTC 4ZS6D 1BD2B 4NFCA 5DSCA 3BYTA 5D7JD 1UJTA 1L7IH 2D03H 1FVDA 1T21A 3O6ML 1YJDH 1Y18A 4W81A 4HF5H 4PJ7A 2VDRL 3T8XB 1MQKL 3ARDC 4L1HA 1VSCA 4D9LL 1DBBL 3JV5A 3LKNB 3QIWA 4P0DA 2BXYA 2JJSC 2QKIA 3HE7B 1NLDL 4XWGH 3D48R 3FOLA 3KLSA 3H9YA 3EOBB 4LPYA 5DD3L 3U1SL 4ERSH 2OSLB 1DEEA 3VXSB 4L4TB 3H2WA 1HH6B 4GKZA 4PJFA 3VG9B 1Z9LA 3SE3C 4NCDA 3EYQC 1Y6KR 4KRLB 2R23A 4RA0C 3EO9H 4JR9H 3ALPA 2VC2H 4H20H 4FP8L 4WFFE 5B4MD 3J7HA 5GZOC 4XP1H 2YXMA 4OLVH 5FF6B 5IM7A 3VFVA 5GS2D 3F7YA 1N7MH 3WN5B 1HHGA 4F33B 2F8XC 2P5WE 1XIWD 1JPSH 2B1HH 1UM5H 5DRNA 3VU2A 1HYSC 4OF8A 2FDBP 2NXYB 4ESKA 3HZYA 4LPCA 2Z31D 2IAMD 3CFCH 1QACA 3FONB 1D5XA 4H0HB 5C0IB 2EXYC 5GRZA 4WW1B 5JR1L 2HVJA 3FQTB 1FZOA 3O2DL 3QEUA 2DWDB 4RSVA 5I19L 3FFCD 1MLCB 2CRMA 3FZUC 4QRRB 4YHIB 1B0WA 4CW1A 4G3YH 4X6CF 2N1KA 5TE7L 5CILH 5DD1H 1ETZA 5CEYA 5I2IA 4LCCB 5JOFA 4Y2DD 3NGBB 3MV9E 3FO9A 3GB7B 3BPLC 1N8ZA 3WUWB 4R7DB 3ESVF 4OD1H 4R97C 4K94H 5DJYA 1P53A 3VXPA 1PLGL 4L8CB 1Q9LB 3C08H 4GMSH 1T0NA 4H5SA 2WQ8A 4XP5L 3VXUB 4PS4H 5IEHB 3X3GH 4NO2A 2D4FA 3F65A 1WEJL 25C8H 4Z7VE 2A9MH 3QPQD 2AJYL 4L3EE 4JFYB 2FD6H 2DTMH 2RAMA 2W0LA 1NFDA 3DX9A 2BCKB 4Y4FC 1A6ZA 2UZIH 1KCUL 1PQZB 5IHUL 5C0DA 5KSAD 1T66C 4D9QE 1MCPH 4X4ME 1TZGL 5GIRA 4WO4B 4XPAH 4ZSOB 5J13B 1YYML 1FL6B 4NKOB 1NGZA 4YE4H 6CGTA 1UA6L 2VLKA 5C8JB 1I1FB 1JGLH 3L5WB 1F8TH 5DJXB 1A2YA 3UZQA 3U6RA 1KCRL 1J5OH 4BZYA 3IJYB 1HSBB 2Q86B 2J3SA 1BWMA 4G9FE 4ENED 2VH5L 3DGGA 4P4KA 3DETD 1URLA 1JF1B 3QHFL 3PDOA 3EBAA 3B83A 1CGSH 4S0SD 1AFVH 1VEPA 2XKNB 4HLZG 5C07E 3CC5B 3TBTB 3DX6B 4EIZC 4NRYA 1A7BA 3S98A 1E28A 3DIFB 2GTWB 5A2KH 1M71B 3IAPA 2O61A 5ACZA 2X4OB 5CEZE 4M1DL 1K6QH 4PRIB 5EOQL 2X4SA 2DIAA 3U83A 2XTJD 2QSQA 4ZDHA 3R8QA 3MREB 1JZ2A 2C1PA 4PLJD 3NCBB 2H1PL 3H9SD 3QJHB 4Q58C 2JCCE 2MOVA 2D9QB 4Q9RL 1OOAA 5FO9B 1ZHKB 5DYOA 4PJDA 1I7UB 4F9LC 1DTUA 3HZVB 1G7JA 3NTCL 1MY7A 1P7KA 3GRWH 3PGFH 5SX5H 1EEZA 4P46C 4AT6B 4KJPD 3STBA 2I60H 1K8DA 1HNFA 4GXVH 1BP3B 1I1AC 2XFXB 2W0FB 4JEGB 1V3LA 3O9WB 2OTUB 3KPSA 3FQWB 1I7TA 1BD2E 2HKFH 1MCOL 3I6GA 4Y5VC 1F90L 3QUXB 4HLJA 3NOIA 4P2OA 5GGUB 3BH8A 5F1KC 3GO1H 1BGXL 5L8JB 2D7OA 4U6XA 4OM1H 1T5WB 1Q38A 2GAZB 5IMOA 3HC3H 4PJ5A 5T3ZD 1CXKA 5EUOB 5E1AB 5BXFB 4XC3L 1GGUA 2CRYA 3RIAK 4C55A 3CUPB 1JI1A 3MRIB 4ZYKA 3MO1A 3HI5H 3R1GL 4NZUL 3GSNL 1A9BA 5DZOA 1QFHA 2W9EL 2VDMH 2IFGA 1WIPA 3RVWC 3LEXA 3PWPA 2ZPKL 4PV8B 3VXSE 4L4TE 3L9RB 4MSWA 4PRPD 5I1CL 3STLB 4UV4L 3PDGA 1NFKA 2XWJA 1IAKA 5IGXH 5DFVC 3EDJA 5FM5O 4KAQH 3E6FA 3BIKB 2NY4C 3ES6B 4TPRL 3ALXA 4U1HA 5BVJA 1UXSA 5J89A 1QFUL 2FSEB 1K4CB 3TLRA 3LB6C 4P5KB 4LPTA 1T7VA 3VGHA 2HFTA 5JA8B 1E4XH 4CVWA 2VR9A 1IQDB 4OCWL 5IFAH 5GGVL 3MSPA 4Z7WA 1MELA 1TTUA 5HI4D 2VZUA 1DBJL 1YEHH 4WFEE 4CAGA 2ZUQB 4DKDC 3BP5A 3BGFB 4O5LH 1C1EL 5J12C 1IZJA 2HJFB 1G9NH 3VD9A 1JGUH 1YNLL 1ORQB 4QRRE 1YZZA 4XVSH 1E27B 1Q0XH 2DB8A 1NUNB 4G8IB 5EZOH 3BKJL 4POZD 1CDYA 3EJJX 1JRHL 1RUPH 3BDBA 3K8KA 5GRVL 1W0VB 2V9QA 4MB4A 1FRGH 3BH9B 1ZHBA 2LVEA 3QUZB 5CEZH 4WJ5A 1MQ8A 2YRZA 2V17H 4GW4B 1OQXA 1LO2H 5FA3A 1A64A 4TRPH 3VXUE 4WHTB 4WWKD 1MRCH 2BY2A 4XPFH 3D85A 2AI0L 5DJDB 1I85C 3AXLA 3HPLA 4GW5B 3MNVA 4KDWA 4L8SA 2EZ0D 5D7JA 4G9DA 3MRNB 3BE1H 4OLZL 1JYNA 1ZEAL 1NJ9A 2YZ8A 5T1MA 5I8EA 5HYSA 5IB1B 1D6VL 3L1OH 5I66B 3X11B 1HWHB 1VGKB 2PYED 5DVOA 5BRZD 3MBEC 1VADB 3BP6A 5HYSG 4WFGE 3X13B 1WK0A 2LU4A 5INCB 4ZSOE 4EI5B 4AG4H 1M7IA 1LE9B 1BMGA 4H88H 3ZTNH 5DGQA 3FO0L 4CVZB 1HQRB 3ULSA 4Y5YB 4ISVB 3RQ3A 3QNZA 5CEXB 3ZO0A 5DHYB 1WBYB 1YDPA 1AI1H 2W60B 3V6OE 3L3HA 4C54A 4RMSA 3S4SG 2NY2B 1H9VA 1YJDC 4Z0XB 1LK2B 4F3FA 5I1DB 3O6FD 3L3IB 3PL6D 3NFNB 4Y5XB 5GRXG 2XOTA 2FWOA 4NNXA 5BO1H 4O58L 3BSZL 3T2QA 1R6VA 2GY5A 5HHVL 1XIWA 1V7MH 5JDSA 1F4WL 2V7HB 3U79A 5JW5B 4PRIE 4PBVC 1WITA 5EIIB 2I07A 2VSDA 2HLAA 4WTXA 1KOAA 5E8PA 1SBSH 2FECL 5FDYA 1FJ1A 2I9TB 3O3BA 4F7CB 2QR0A 1AO7D 3QQ4A 1FNHA 3DVNB 3DO7A 3BKCH 1DR9A 3FFCA 3BEWA 4RFEA 4IRJD 3C2AH 3IDNB 3UYRL 3FQNA 3I02A 2Q20A 4JY5L 1RULH 3G6JB 4Y2DA 4R4FL 5F7FA 1OAQH 4NFDA 3LZFH 4TUKL 3F5WA 4ZFFA 4JHWH 4LFHD 1O5DT 1KJMA 4KUCF 4FQ2H 4OT1H 2W9DH 5CHNB 1JFQH 3V4PL 2EDYA 1FH5H 5HHMB 1C08B 1D9KC 3FOMB 1UCBL 4HFUH 1MCNA 2ZJSL 2G5BB 5DA0B 4N0CC 3TO4A 3WLWD 5L6YH 4A6YH 2K7PA 3G6JF 5HJ3A 3T0ED 4PRAA 1KPRA 3NA4A 1WBXB 5DK0A 3JV6A 4AM0B 3O8XB 4U31A 4X0KA 1BLNA 5KG9B 3DMMA 4KHXL 1U8LA 2DBLH 4GMTL 4JZOA 5A16B 3UTSD 1JGVL 1L9MA 1IGTA 1ERNA 3SE8H 3MNWA 2V5SA 5CSBA 1K5NA 3JSSA 1Z3GH 1YUHB 4Q9CA 3TPKA 3MLSH 1L7IL 4HXAH 2D03L 1A8JH 3CCHA 5GRYA 2JJVA 1L4IA 1BJ8A 1RIVH 4RAUB 1YJDL 3ECBB 4HF5L 4XCNA 4CNIA 4JPWH 2YD7A 4JGUA 2M26A 3IF1B 5ESAA 1G6VK 1BX2B 1RVFH 3VWKB 1YEDB 3HCVB 5I16A 1INQB 2ARWA 2ED8A 5CKGA 2AXGA 4XWGL 4ERSL 4JFPB 3OKKA 4EOWH 4LP4A 4JGJA 1RZIB 3MROA 1GGIH 4P9MH 1MHHA 3FQXA 4YIQA 3MV8D 1WC7B 5IVXA 5D70H 4LCWB 3EJZC 3EO9L 4JR9L 2GTZA 2VC2L 1MVUA 2YUWA 4H20L 3STZB 5HYQB 1D6EB 4XP1L 3QBTB 1TQCB 4Y4HA 2P7TA 4OLVL 4PJGB 4PJEA 3ZTJG 5FECB 3EO0B 1CS6A 3MRHB 1N7ML 2XXMB 3MRFB 5LCVH 3H9SA 1JPSL 2B1HL 5FM5M 1F13A 1EFQA 1UM5L 5E6ID 2EICA 3RL2A 3IT8D 5HPMA 1OVZA 4XC1L 5J6HB 3O3UN 1OW0A 3C9NB 3NIGF 4PJGF 3CFCL 3GMQB 1UACH 3CDFA 4WEUD 2BRQA 1W72B 4GW1A 3DI3B 2IALA 3FO1A 3NFPB 3GMNB 2EEBA 1B9ZA 1UM4H 2FJHA 3OF6D 4CU7A 3GDBA 2ZZUT 4G3YL 3F12B 5CILL 5DD1L 3S88H 1S7XA 3ORJA 1MCWM 3CFIC 3QUMB 4Z7QF 5IB2B 5HYJD 4YBLB 2KDGA 4HAFA 5DJCB 3RTQB 1C12B 4NYLA 5L8LB 1ZK9A 2AAVA 3S5LA 1KF9B 4OD1L 4K94L 3BUYA 3BUTA 3N1GC 2V9RA 3GJFA 5CGYD 3C08L 4MZ2A 4GMSL 3QT2A 5FO7B 3S5LG 2HT3C 3ZKMD 1NUGA 4PS4L 3X3GL 2AVGA 25C8L 4JPKH 3H42H 1YECH 2VR4A 3REWA 5D2LB 2A9ML 4EZMA 1VACA 1PGRB 5B38B 4M5ZH 3SDXB 2FD6L 4J7RA 4LP5A 1ULVA 4UDUA 4DKFH 2DTML 4GBXD 4OCSH 1A7PH 1M7DB 5DMKB 4PRPA 2UZIL 5F7NC 5DRZB 1IL1A 3OKOB 1MCPL 1J8HE 4L8BB 4GKSA 1T7YA 4XPAL 3SDXF 2P5EA 3PXHA 1YN7B 4YE4L 1CXIA 3WO3B 3HR5B 1JGLL 4XP9H 5C08B 4QRSA 4LVNC 4D0BB 1F8TL 4AENB 1J5OL 2W38A 3FL7A 1ZA3B 5GGSB 5AAWA 5F44A 4MQTB 3HMXH 1GL4B 4O2FA 1KT2B 4WTWA 4KRPC 3SGJA 2HRLA 3P40A 4UTAH 3P11H 1S7VB 5EU5A 3LKQB 5SWZB 1CGSL 1SYSB 1AFVL 3CNKA 4HIJB 4LMQI 4YC2C 3SDCB 4EDXA 4R4NC 1BF8A 4HC1H 3FJTA 5CGTA 3ET9F 4KDTA 1YMHB 2DI8A 2PW1B 4ODBD 3WSQH 4MXQD 3KPQA 4QRQB 2E9WA 3JWDH 2B20A 5FKPA 1K6QL 3QXDB 4PJBB 3UDWC 3LPWA 2X40A 5DVKA 3N50A 3TCXA 1FYTB 3L5IA 2HT4C 1HQ4B 3G6JE 5EBLB 3KPRD 3RZCC 3DV4B 4U1JA 4PIRF 4Y16D 1HHJB 5EBMB 4HGWA 3TC9A 2XZZA 1RAMA 1S8DB 1PYWB 2ID5A 1L6XA 4DGIH 3HAEA 3RVXD 5LGJA 5E8DH 4PJBF 1T04A 3KG5A 5DJAA 2PUQT 3PGFL 3GRWL 4MCZA 4YHYB 1YY9D 3HAEG 1RUKH 4WWKA 2F15A 5CIPA 3RGVA 2I60L 3D18A 1I7RB 4GXVL 1G9NC 4UDTB 1ZOXA 1JCKA 3T0DA 3MYJA 4X6BA 1H5BA 3AB0B 4OUUB 4KRNA 4ZPTB 4RFOH 4S1DD 5JXED 4J3WA 1CFNA 2VQTA 3V2AR 2HKFL 4TYUA 3CSYB 3EUUA 4RDQG 2BVUA 2X09A 3DRQA 4UBDC 4NUGL 1SJHA 1LNUA 1ZMYA 3GO1L 5I1EH 4QRUA 1N2RA 4OM1L 3KPNB 3U4EA 3WJJA 3HC3L 4EEEA 4ODTH 4X98A 2DL2A 5DZLA 4XVUD 4HWZA 1U42A 4OZ4B 4PY8J 3HE6D 4R2GC 4TSAL 5KW9H 4O02H 3QNXB 3HI5L 3TT3H 2VDML 4M03A 3EZJB 3S96B 1ES0A 2IF7A 3FB6A 4CVXA 4HWEH 3PL6A 3ARDA 1TMCB 4PJ9B 1H3VA 4CMHC 4QXTB 4LCWE 3VWJD 5AD0B 2F5AH 3CFKB 5IGXL 5IMMB 3HC4H 4KAQL 5IHZA 3IRZA 4WEMB 2H3NB 3NIGE 4PJGE 5E7BA 3L7EB 3VRIA 3EFDH 4WI6A 3SE3A 3ARSA 4G6KH 1E4XL 2NTFA 3PG2A 3MUZ1 4YQXH 3LEVH 4M3KB 5IFAL 4MNGA 5EU6A 5IQ9A 1HN1A 2EDTA 3RWEA 1G7HB 4R7NA 4OF7A 4W68A 1YEHL 3PQYB 4MJ6A 1X5FA 5IJKA 3QO0B 4Z7QE 1QSEB 3MBXH 4KC3B 5CP3A 3MXVH 4O5LL 1DQQB 3MLRH 4L4VD 1G9NL 3MGOA 3HE7C 3QB7C 3CAFA 1JGUL 4W4OA 1FL5A 3GSVB 4MMXC 2BNQB 2CIKB 4UT9H 4XVSL 5E4IA 2LABA 1Q0XL 3QNYA 3A0OA 2HJLB 3I6LE 5EZOL 3U36B 2E8YA 4U0RB 1ED3B 2QTEA 3VG9C 3F7RA 5DS8B 1RUPL 3FN3A 5IESH 1KGCE 4LVHB 3T0EA 1FRGL 1A9EB 5CJQH 5HHOB 1R24A 2MKWA 1PJ9A 2QQLH 5EU4B 1AQDB 4MJ2A 1EUTA 2DQTH 2MPAH 2V17L 1R3IH 1LO2L 4AYFA 3WN5C 1LEGB 4TRPL 2R0LH 2FJFB 1OP3K 3UTSA 1MRCL 3OX8A 4XPFL 4APQD 2XQYG 3O81A 4XBGB 5BCAA 3AREB 5FFLA 2EDEA 4K8RH 1QSFA 1IJ9A 1BFSA 3SDXE 2GSGA 3BE1L 4F7EA 3T77A 3CGTA 2F54D 1RZGB 2YSSB 2IH3A 4U6HB 1YNKH 2GFBA 3L1OL 4BH8A 2R9HC 4FQIL 1HNGA 3GFUA 4FXKA 3ARBC 1E4KC 2VZ3A 4OLXH 4AG4L 3OR7A 4LEOB 4I0PD 3MLTB 3QI9B 4H88L 2W59A 3ZTNL 2YPVH 5C08E 1AIFB 1UENA 1DE4A 3NGBC 4E42A 4O2EA 4Y4FA 5DMJB 5C2BH 4TOYH 4DZ8A 5F71A 3MV8A 3H3PH 1AI1L 2FL5B 5F1OB 1R3LB 3PXJA 4F57H 5KZCB 3DSNA 5IB5B 3SY0A 3TCLB 5SWZE 4OCXH 2B4CH 3VFNA 4UT7H 5D6CB 5BO1L 1PY9A 3JWOC 1ND0A 1Z5LA 4NQCE 4CU6A 4F37F 1V7ML 4PJCA 4HDIB 5E6IA 1ZLVH 4Q7DA 2DQCH 4PJBE 4Y2OA 1S5IH 1FYTE 1MJJA 5MP6H 2YBRB 5F1NA 2FB4H 1SBSL 1QVOB 2AKRB 4HAGA 3IJSB 4TNVK 3LRHA 3FAXA 1A02N 3GMOB 1DQLH 4QT5B 4AH2B 5J7CC 3U4BH 1KXQE 1LEIB 5J13C 4C56B 4AMKH 1T1ZB 1XMWA 3BKCL 3TH3T 2IG2H 7CGTA 2NQCA 2PNDA 3PF2A 3OF6A 5FK9A 5T1KB 1BM3H 3E8UH 3ZT7A 1MPAH 3MOQA 3C2AL 1IGCH 3NIFF 4NQDB 1TJIH 4HG4K 1RU9H 5FV2A 3FN9A 2CR6A 2G2RA 3K4ZA 1X9QA 3EHBC 8FABB 1RULL 1OP5H 3BRFA 4KFZC 1RK0A 3DROA 4QF1B 1OAQL 2IQAB 3LZFL 2A6JA 4HH9B 4JHWL 5FYKD 4HJ0C 3DRTA 3MOAH 1ZS8A 3B6SB 4FQ2L 4OT1L 2W9DL 1MUJA 3W0WB 1JFQL 4LVOB 5C0BD 4ZFGH 3S35X 1FH5L 3GSQA 4P46A 2WM0A 4HFUL 4QHUB 2R0ZH 1JHTA 2BOCB 5L6YL 2V5RA 4K2UH 4A6YL 1Z9OA 1JMXA 1GHFH 4UIMB 3ARWA 2GQHA 4BUHA 4HEME 4BQ9A 2V9TA 3M17B 5I0ZA 3RPKA 1CU4H 3GKWH 1XGTB 4GBXA 2DBLL 1RZJC 2A9NH 1R5IB 1L0XA 3SE8L 5DRWB 1Z3GL 4Y5VA 3MLSL 3PIQA 3BD3A 1PVHA 4HXAL 3VJ6A 5F9WB 1FAIH 1NC2B 2YPKA 1BFOB 4HD9A 1RIVL 4HUXA 1KTLB 1GOHA 2X9YA 4CU8A 1MJ8H 4JPWL 1G6RH 2IADA 3Q6GH 4KMTH 4WIQA 1IBGH 5EC2A 1MCQA 4YDVB 3QUYB 4NM8H 2OZ4H 4ZTOH 3HUJA 1CD8A 1RVFL 3GUTB 3O9WC 4WW2B 4RFNC 5ILTH 3TZVD 3KXFA 2NZ9D 1Q94A 3RU8H 4JJHA 5FM8A 4EOWL 1DQDH 2P24A 4LKXA 2FBJH 4K3GA 3CDGB 1GGIL 4OTXH 4P9ML 2CKBH 3QUXC 4Y1AD 3BHBA 4U1NB 5D70L 2H8PB 1CL7H 4LHUD 5T1DH 1XF3A 4LEXH 4OKVB 3C60C 2EDNA 3PQYE 1L7TH 3ARGB 4KK9C 4NQTA 4O51B 2XZCH 2P46B 1QSEE 3T1FA 2EKSA 4NUJB 3ZDZF 5LCVL 3BVNB 4MJ5B 3KPRA 1NBYB 2Z9TA 1NANH 5CZVH 3BGMA 1WWAX 3LS5H 4OQTA 4MD0A 5I1HH 2BNQE 3DVGB 4I0CC 5DDHA 3AVEA 1I3UA 4U7MA 1KCSH 4L8DB 4K3EH 5EBWB 4JFZH 1XEDA 3MFFA 2P4AB 4JPIB 1GGTA 2XWBB 1UACL 3MCKA 5IIEA 3QZWB 2NX5E 1ODAA 4R3SB 1RZ8B 4M7JH 5MHSE 1UM4L 5D1ZB 1ZANH 5E95B 1MOEA 1WCBA 3THMH 4IHOB 5GHWH 3S88L 4WENB 4XAKE 2J6EH 1X7QB 4QRPB 3D3VB 5CINH 1S9WB 3I6KB 3OSKA 3PWJB 1FZKA 1LO5B 32C2B 1OSZB 2DMBA 5DK3A 2QL1A 4NOFA 4POUB 4HUWA 3VFWA 1K4DA 1QOKA 5KTEH 2ICWJ 4OGZA 2NY6D 1G7LA 5IVNA 1IMHC 1U3YA 3CLFH 2ZUQC 1DUZB 3BGFC 4OF5A 3MA7B 3OV6A 1I85A 1V8HA 1A3RH 3H42L 4JPKL 1YECL 2ZNXA 2BNRB 4HWBA 4M5ZL 3QIBC 3HE6A 3QFJB 5ACLA 4XP6H 4DKFL 1A6TA 4LOUD 3QDGE 4BFIA 4BFGA 4OCSL 4BELD 3BDXA 4PPTA 1A7PL 1CFTB 4MQ7B 3HC0A 4MDJB 1QFWI 3LKOB 4UUJB 2A6IB 1N64H 5D9SA 3QUZC 3HLAA 5M7QA 5E70A 2ATPB 4AZ8A 4PBXA 1T20B 3VWJA 1WF5A 3OJDB 4QKXB 3ZE2E 1S7SB 3EDFA 1KIQB 4LLWB 4BSVA 3ARUA 4XP9L 1K9TA 2EEAA 1ZTXH 4LLUA 3O2WH 3CH1A 3D0VA 2HG5B 2JLLA 3F7VB 3HNVH 5IK3A 1A6AA 1HDMA 3TYFB 3HMXL 1KNOB 1W0YT 1BQHB 1KYOJ 2BC4A 3C2SA 3G5XA 1YPZF 3A6CH 4PRBB 3P11L 2ZKHH 5D7KD 3NIFE 4UTAL 1QLRA 3FB8A 5I8KH 5CKAA 3N1MC 1C5DB 1DQJA 2VL5A 3AS3A 4EI5C 4LLQA 4HT1H 4HC1L 5IF0B 4C56E 3Q3GB 1KJ2A 3FCTB 4L4VA 2VDLH 3WSQL 4F9PA 1NGYB 3FT3B 3FB5A 1R3KA 1NC4B 2Y7QB 4MS8D 2H2PC 4YDJB 3GEWB 5J1AA 3JWDL 1Z6JT 3O6LH 4JGMA 4NQDE 1IC7H 1MAKA 1AY1H 4Y5YC 2R39A 1FVDB 1T21B 4JREC 1G7QA 1Y18B 4QY8A 4NO5B 1INEH 4WTZA 3F6IA 2IBGA 2DLIA 2ITCA 2NY2C 3W0WE 4DKEH 3MRRA 4NKMA 4M93B 4DGIL 4Y5XC 5E8DL 2DS4A 5IB4B 1FVEB 1ACZA 3EFFB 4I2XB 4BQ8A 3OXRA 1ZV5A 2G5RA 4U3HA 1I1CA 2AV1B 1RUKL 3KPMA 4PJ7F 1VFUA 4APQA 4L29A 3H9ZA 1F45A 2J8HA 1OTSC 1IEAA 3BFOA 3NIDE 4P2CG 3WFDH 2IMMA 3QRGH 4RFOL 5FOBB 5GXBB 5E5MB 4DVRH 5GRJH 5IM7B 3VE0A 4PJFF 4NQED 5F3HB 3F8UB 5DR5L 4UOW0 3JV0A 4I0PA 3C6SA 4XMLH 3T2PA 5CD3A 3V4VL 5I1EL 5M94B 1TDQA 3IXTA 4ODTL 2Q1EA 3HZYB 3RHWF 1F4AA 4G80B 2W0PA 5F9JB 2KZWA 1D5XB 2NXYD 4LMQE 1AXSB 2C4FU 3ROLA 5KW9L 4O02L 3UPRB 1TXKA 2GJJA 3TT3L 5B39B 3QEUB 2VXQH 4H8WC 4HFWA 4LLYA 4K3JH 4F15C 5ICYB 4HWEL 4KKCD 1ETZB 3ZDZE 5CEYB 4QRRD 3O8XC 4GRLD 2C3WA 1DBMH 3UEZA 3S37X 5DMGD 2F5AL 2W9LA 2VLRA 3HC4L 4DOHB 5JZ7C 3DV6B 3PP4H 1CIUA 1KELH 4OLEA 3FO9B 5IV2A 3ELAT 5C0GB 1N8ZB 5E24E 4MVBC 4N0UA 3EFDL 2YEZB 5DJYB 2LAGB 5ISZE 3BQUC 4FFWC 4G6KL 5JPNB 4H5SB 3IDGB 4YQXL 3VFPA 4Y8DC 5JQ6H 1J7VR 2ERJC 3LEVL 3MGAA 4AEIH 5IEKA 4RGOH 4DK3A 1DUYA 4J2XA 2DLHA 1UKQA 5FGCB 3KYMB 4X9GA 2NNAA 2XN9B 3MBXL 4F80A 4F7PA 3VWKC 3TIDA 3MXVL 3MLRL 3QWRD 4N0RA 1WLHA 5FYJE 3BPOB 4CJ1A 4KJQD 1JPFA 3KAAA 4UT9L 3W11D 2Q6WA 4JANB 4QRPE 4EBQH 1D5MA 3D3VE 3ROOB 2V2XB 4WO4D 2GK0A 2VLKB 3MQIA 3CDCA 3EDDA 3TNNB 3GIZH 5IESL 3QYCA 5CJQL 5DUPH 3ARZA 1MNUH 1A2YB 3U6RB 2QQLL 1KIRB 4KRMB 5JO5A 3OBAA 2DQTL 2ADGB 2MPAL 3DGGB 3MPCA 3T0AA 5IVOA 1R3IL 4PREB 2R0LL 3BZFA 3OAYK 3VFGH 3HI1A 1TJHH 3PDOB 3FT2B 1SJEA 3ULUH 1V5JA 2BNRE 3D5OF 1P7QA 3LQAC 3QFJE 4K8RL 4KY1H 4CMMB 3ULVH 1XT5A 1R3JA 4NRYB 3RWIA 4PJXB 1OAXH 3OG6B 4NHUA 3HR6A 1S5HA 1MWAA 3I50H 1YNKL 4YHLH 5ACZB 1TJGL 4ODUB 4OLXL 4TVPH 2C1PB 4PJXF 4K07A 2VISB 3MYZA 3TZVA 1X4YA 3RPIA 2YPVL 3P9WB 4G8FB 1WV7T 5DYOB 1JNJA 1UZ8B 1XF4A 4YBLC 1RJZA 3B9DA 4G8GE 5J4MA 2R69H 1J0IA 5C2BL 4TOYL 4PRNA 1OTUC 5FM4A 1IAMA 4DQOH 1MCEA 1N5AA 5DUMH 3RWGA 4PRHD 4GXUM 4Y1AA 3SCMD 3X12B 2Y9RT 3H3PL 1ITCA 1A14L 4NNYB 4F57L 1II4E 2H45A 3D0LB 1XH3A 4LRNH 4PJDF 4OFDA 4HUUA 4P2RB 4OCXL 3RWHB 1NGQH 2ICWA 3MV9A 4X5XB 4XHJC 2B4CL 4UT7L 1UGNA 2ZG2A 4MAYD 5F7UA 1CICD 4M1GH 3D69B 5GSVA 4G7VH 2DQCL 1WZKA 3GM8A 4LCYA 1S5IL 3IKCA 3KDMB 3PP3H 1CCZA 5MP6L 1VFBA 2O26U 3ZZ1A 4UNUA 1FZMA 4Z7VA 1YEJH 4KK8C 1DQLL 4PJ7E 1RZFH 4U6XB 3U4BL 4BFEA 4ZFOL 1J1OH 4BA8A 5IMOB 4PJ5B 3WXWH 2EDXA 4AMKL 4NO0B 1MIMH 43CAB 1I3VA 2IG2L 2VLLA 1PG7W 1X5YA 3MRQB 1BM3L 3E8UL 5DJ0A 1YC8A 3JWNC 3DURB 1MPAL 4I2XE 3UDWA 3LN9A 2ZP0T 1ADQA 4HXBL 4ONOA 4PLKC 1IGCL 3MO1B 2WINB 1TJIL 2DKMA 1A9BB 1RU9L 3JTTA 3BJ91 5IWLC 3BN9D 2ORBH 2R0KH 2OK0H 2VZ1A 3PWPB 1G9MH 2QQQA 3QFDA 2XACC 2R2BA 2NR6D 5L2KD 4WI9A 1EAJA 3MOAL 1EAPA 5HDQH 5BZWA 3RA7H 1B6UA 1KTDB 2XWJB 1IAKB 4ZFGL 3SDCC 4PG2C 2R0ZL 4K2UL 5BVJB 1GHFL 3V95A 4JFQB 4TN9A 1P2CB 4OLWH 3NZ8A 3B3IA 5IFHH 3NBNA 4KK6D 1HOCA 1T6WA 3GKWL 2B0SH 5TDNA 1NCNA 1B3JA 5HGBA 5I17B 1J88A 2A9NL 3H8NA 2N7BA 1Y6NR 1NAMA 1KV3A 5DF0A 4YXLH 3D25B 1OTTD 1FAIL 5GS0H 3MJGX 4RZCA 1HCVA 4RISH 4Z7WF 3L6FA 1IEHA 3UP1A 4LCUA 1MJ8L 1G6RL 2JCCA 3Q6GL 1U8MA 4KMTL 5A2JH 1IBGL 3SO3B 4NM8L 4ZTOL 2OZ4L 1P9MC 1DZBA 4EJ1C 1S3KH 4DOHE 1PDKA 5ILTL 3AB0C 3DVIA 4M9PA 4NT6A 2XPGA 2HYMA 1ZHBB 3RU8L 4FQHB 1FQ9C 1DQDL 3GSUA 1Q9OB 2FBJL 4OTXL 1HHHA 2CKBL 4FZ8H 5FA3B 1I8IB 2WLZA 3BMWA 4QHLB 3P9MB 3T08A 4HUVB 3WDJA 3QO1A 4RIRA 3EYOB 4KKLC 1CL7L 3AXLB 5T1DL 4LEXL 4XMPH 1AKJD 5D7JB 4G9DB 4OIAA 5FGCE 2L7JA 1L7TL 1BD2A 1NJ9B 2XZCL 2XN9E 4JCMA 5EO1A 5T1MB 1DSFH 4QNPF 3RWFA 3WMSA 1BFVH 4KZDL 5CZVL 2ZSVB 5I1HL 1MREH 4CADB 2YA0A 3T8XA 5BOZG 1KCSL 4PJ9C 1KIUA 3B2UD 4HKZA 2VLKE 4K3EL 4JFZL 3HHRB 4PJHB 4MWFA 3UZEA 2X1WL 4OCMC 3HE7A 4KI5D 4YXHH 5E5UB 4HMCA 2EO1A 4LF3A 4M7JL 5I1IH 1B0GB 2J2ZA 1ZANL 2Z92B 4QHKJ 3PGCA 1P84K 1BAFH 3S4SB 5DTFA 3VXSA 4L4TA 1YDPB 4WU5A 3THML 5GHWL 3L3HB 1XR9B 2J6EL 3VGFA 4PJHF 3IAGC 1UADC 2HTKC 5E9DB 5GGRB 4F3FB 4XWOC 1AHWB 5F88A 1WGOA 2Z4QA 2NLJB 4PJXE 2FR4A 4NQEA 1G7IB 4LLAA 5KTEL 5FF6A 5IW1B 3VDBA 2CKNA 1UYWH 4YDIH 5JDSB 3CLFL 3WN5A 4QWWC 3WDIA 2E6PA 5BW7A 1P84J 2CLRB 2I07B 4FG6C 2HLAB 3QJFA 4KKBC 3FN0H 2Z31B 4K71B 5KANG 2IAMB 2VTFA 1A3RL 1CFVH 3NZHH 1BJ1J 3KJ4B 3RRQA 3O3BB 3FONA 5KS9B 4XP6L 4U0RC 4OFIA 3LH2H 2YWYA 4HS3A 5C0IA 4PJDE 4HPYH 1NCDH 3FFCB 4WW1A 3FQTA 3RIFF 1DN2A 1CDCA 2DWDA 1N0XH 1MLCA 1AJ7H 1LD9B 1JYVA 3FQNB 4LLVB 3I02B 1N64L 4QRRA 4GRLA 2XRAH 2FBOJ 1WICA 3V9FA 4Z0BH 1N6UA 4LSDA 3QCVL 4Y2DB 5KS9F 5EBGA 4LDEB 3OJ2C 4LCCA 1KJMB 4P2RE 4HS6B 2VN4A 1GOFA 2HTLC 3DTXB 3AS2A 1ZTXL 3GB7A 3AREC 3LQZB 3WUWA 3DHJA 3O2WL 4R7DA 1QHOA 2EDRA 5HHMD 5KSUB 3HNVL 3VXTB 2WBWB 3ARVA 3GSWB 4L8CA 1Q9LA 1RJLB 3JV6B 1FVCB 4KV5F 3VXUA 3A6CL 1EH9A 2ZKHL 4NZTH 4X6EA 5JOEA 5B21A 4EDWH 1BLNB 5I8KL 2Z8RA 1XGQB 3DXAD 4ZS7H 2FH6A 4HT1L 4PJ5E 1XR8A 3DUUA 1YA5A 2VDLL 3QWRA 3QI9C 4Q9QH 3O6LL 5KSAB 4H1LA 1IC7L 1AY1L 2GHWB 3CCHB 1PQZA 1GIGH 4H1LG 4WO4A 3PWPE 4D0CA 2JJWA 2H41A 1INEL 4XCNB 1JZ4A 4Z7NF 5C8JA 3VD5A 2VDOH 1I1FA 1CT8B 1PSKL 1QG3A 3VD7A 4DKEL 2HMIC 4XMKH 2ZUTA 1AC0A 4Z6AT 3TH2T 3DWTA 3RI5K 3IJYA 1I1RA 1HSBA 2Q86A 5BS0D 2MTPA 3OKKB 5GZNC 2V6HA 4DZBB 2IBZX 4DN4H 3V6OA 2Q7YA 4J3TA 1C5BH 2D2OA 3BZ4A 4FTVD 4M7KH 1MHHB 3QIUD 3FQXB 3I3EA 1GH7A 3CXHJ 5TJWK 1H3WM 4WUKH 5IVXB 2XZAH 2DQJH 3FFDA 4GRWB 3WFDL 3DX6A 2VWEE 4Z7WE 5DFWH 1MVUB 1CDIA 1T1XB 1HSAA 3QRGL 4LCWD 5EZLB 3DIFA 5GRVK 3RX7A 4Y4KD 2IWGA 1M71A 4DVRL 4PTTB 4PJEB 5FA4A 1WT5C 5GRJL 2X4OA 2XTJB 3DYPA 4QOKD 4PRIA 1IAOB 1I8MA 3OPZH 3TA3D 3H9SB 3T0VA 3NCMA 5IVXF 4QHMB 4XMLL 2ENYA 4HLZH 5F89A 2FIKB 3RL2B 3E6HB 15C8H 3V5KA 1MCHA 3CXDH 6FABH 4PJEF 1ZHKA 3WNLA 4ACPA 2RQ8A 4LVOC 4GW1B 4HUNB 3FO1B 4KPHH 4AT6A 2KH2B 4KJWD 2VXQL 2X41A 3CSGA 4K3JL 4N0YH 4FMFA 2OCFD 2GEEA 1A6VH 1TZIA 2VUYA 2CSPA 4M00A 4FXLA 2RBLA 3SKJH 4XZUB 2W0FA 1MHPH 3UAJC 3O9WA 1DBML 2OTUA 2HLFD 1FHGA 2EIDA 3PP4L 1PAMA 1KJ3H 1KELL 3FQWA 3MJ8A 1KXVC 3V8CA 3RTQD 1KCKA 5GS1C 4PYHA 4AK1A 3SGEH 3S5LB 4UT6H 1JV5B 2DF3A 4P3DA 3WD5H 3QUXA 3L95B 5F9WC 2MWCA 5GGUA 5C70A 4D0DB 3RIAF 2HJKB 5JQ6L 1T5WA 3S36X 3O3AB 2GAZA 5T3XH 4AEIL 1FSKB 4RGOL 1LDSA 3V7MA 3QPXH 5EUOA 5E1AA 4JKKA 1X5KA 4PJHE 5SWQB 5BXFA 3QUYC 4OF3A 3V4UH 1AR2A 4WW2C 4P48A 2O5ZH 4PRPB 5L2KA 4PV8A 4ETYA 1ZT7B 4XNMB 3L9RA 1OPGH 4JM2D 3QXVA 4U1KB 5I1AB 3D9AH 2QQKH 1DJSA 4EBQL 1FNGB 2FHBA 3VH8G 1U3HC 5IOPB 1P4IH 3AM8A 3GIZL 1XFPA 4QRSB 3VXQA 3BIKA 2VL4A 3ES6A 4IDLA 1KSRA 1IGFH 5DUPL 5C08D 1MNUL 1MHEA 3IRPX 1NKOA 1QBLH 3S6CA 4X80H 4XCYA 4P5KA 2VXVH 3KLAB 2KQMA 5FCSH 2XKUA 3VFGL 1TJHL 1U8JB 3KYKH 1EEQA 2DICA 3C6LD 3V5DB 3ULUL 4UQ2B 2MCPH 4KY1L 5KS9E 2XY2A 3ULVL 2GJ6D 1OAXL 4LBEB 3FFCE 3KPQB 3IDYB 5FGBC 4XXCC 3I50L 4YHPB 4YHLL 2HJFA 2QADD 1FFRA 2RHEA 1F3RB