4NIYE

Crystal structure of trypsiligase (k60e/n143h/y151h/d189k trypsin) complexed to yrh-ecotin (m84y/m85r/a86h ecotin)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
137
structure length
137
Chain Sequence
PLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTYRHCPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title N-terminal protein modification by substrate-activated reverse proteolysis.
pubmed doi rcsb
source organism Bos taurus
total genus 22
structure length 137
sequence length 137
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4niyE00
1SLWA 1FI8C 1IFGA 1AZZC 1ECZA 1ID5I 1EZUA 1SLVA 1P0SE 1SLUA 1EZSA 1XXFC 2Y6TE 4NIYE 1SLXA 1N8OE 1ECYA 1XX9C 1XXDC 4IW4C
chains in the Genus database with same CATH superfamily
4PJAB 1T2QL 5DLLA 3VD4A 3J27A 4Q7DA 1JXJA 4PJ5A 5H35B 5AW6B 2FZ3B 3LXBA 4TYUA 1F4HA 4ZOCA 3ZSTA 3X11B 5GJTH 4EF3A 1ZRUA 3QZLA 2Z34A 3FUIA 2DYPD 2XFXA 1G5AA 2XETA 3GIZL 3IFOB 1FN4A 4KJYB 4L1LA 4R7LA 2JCCB 3VGGA 1VKXB 4MA1C 5DHDA 3STBA 3OJVC 4GKZA 2V3FA 2NMSA 3E8UH 4NN5B 5DD0L 5FGBA 3T2PA 2HH0L 4I5BA 4PTUA 3FT2B 1U8OA 4WW1A 2XVLA 2B1AH 2BVPB 2IMNA 5FFLA 2VKXA 4WSJA 1BXVA 4Y9EA 1DLHA 1MCFA 3BGFB 3KYKH 4OM1H 5T1JA 1CDCA 1D2PA 4OD1H 4G70B 3S6CA 4EZKA 4X6CA 5L2JA 2IQAA 1HQRA 1MSPA 1G1CA 4JHZA 4UQEA 3RWCB 3VG9B 4FG0A 4JREC 1DANU 3QXUA 1DEEB 1PSKL 2XWXA 3A24A 3FT1A 2JJUA 4Q2ZA 2EDTA 2VUOA 1RZ7L 5E8EA 4ZMLA 4LU5L 3KL0A 2FH6A 3TJEH 2ZWKA 3PU7A 4FABH 4ENZA 3GRWA 2I5YH 3ZL1A 4NGHL 3P11L 5ESAB 5KSAD 3ZZLA 3NIDB 4Z5RA 4BWWA 1GSKA 3FFOA 5FB8B 3X3FH 1NFIB 1QAWA 2CLZB 3UMNA 3F7RA 4UIKH 1YMMA 1Z9SA 1IM9D 1AP2A 4P99A 5DWPA 4KX7A 2PXYD 3DX9A 4F92B 3D50A 4FHKA 5CWSA 2PYFB 5HYSA 5FOJA 1JWMB 5HHNA 4GQZA 4NQVB 3FT3B 2WQAA 2SODB 2NX5B 3BPOC 3GPEA 5I30H 5TK4A 3OKEB 1QR1A 1CDBA 4KK5D 3FQNB 1G9MH 4UILL 2A2QT 1NBYA 4JKMA 3EKCA 4PWEA 1AQ8A 5IMOB 4GJTB 4OJDH 2Q2EB 3PWVA 1XF4B 2R4RH 2BC4B 3QBTB 4WFFD 2WTRB 1QTYT 3H2WA 4U1JA 1I8UA 1SFHA 5ADOL 3WCYA 2YK1L 1G7MA 1O9ZA 5LLIC 4Y16A 3LRSB 1D9KA 5F9OL 3R4RA 3CFQA 4ABWA 4LSRH 5SWSE 4BHUA 9PCYA 2A9AA 4JY6A 3UC2A 2AXGA 3UG4A 1CXIA 4FTVA 3ZL4L 3NIFE 1I7ZB 2QQNH 5DD6B 1CL7H 3X2QB 5ID1A 4FNRA 4L3FA 3O2VH 3U36B 4C56D 2AQPA 5INCA 1LO3H 1IM3B 2EXYC 4GS7C 4I2XE 5FV2A 3NCXA 2ICWJ 4ES8A 4XOAA 5EBMB 2BNUB 3BUPA 4RETB 3VWJC 4UMSA 1OP9A 2Z64C 3CPLB 2ZG2A 5SWSB 3RWDA 5DHEA 1AQKL 2J1XA 5AKTA 2IALB 5F9AC 4GXUM 5DZPA 1XR8A 3NIFB 4UIMA 3SGJC 1VCBC 3NSFA 3BZ4B 2R0LL 1KIQA 2J25A 4HX1B 4U1KA 1WA0X 1C12A 1Q9KB 4PAZA 3CHOA 4CU7A 1RUMH 2VR8A 4JQVA 1MWAH 4NZRH 2O72A 4I2XB 4RGNC 4XVUD 3ZYOA 3FTUA 3N42B 1U6AH 1M71A 3FT9A 4QRSA 4R5VA 4PIBA 4L9LC 4A7SA 4NWUH 4BFBD 1YMMD 2HT4D 1PYWB 3W39B 1FIGH 3IJHA 4ZX3A 2DWTA 4MJ6B 5CP7A 5D7IF 4LIQH 3C6LA 2VDKB 4R9HA 3BN9C 3JBG7 3S96B 4AIZB 1FRGH 2R1XB 2WVUA 1MQKL 3QCTL 4FFTA 3FB5B 3D33A 2YEZB 3ZIMA 3IMVA 3QHFH 2ZXGA 2DI8A 2XKNB 2P24A 3LN4A 4FFVC 3QYNA 2IGLA 1V27A 2R29L 5BZWA 2Y5QA 2X7LA 1TVDA 3GDCA 4WV1C 1UFUA 3CVHL 3RIFK 3C5SA 4HG4K 5DD3L 4BFIA 3CLFL 3W9EB 1XAKA 4W9IC 5F3HB 1D6VL 2UUDH 3I9AA 1C5CL 2ZKYA 1OF0A 4IDLA 4QHMA 3ULAB 5JUEH 4Y16D 1OP4A 1NAKH 1S7SA 5LDSA 3NJMA 1U8PB 3D0LA 3ES6A 5I0YA 4FTVD 1OAZL 4L1SA 1BLNA 2B59B 5I8OH 5L4IA 1KJ3H 3O6FA 2FDBP 3W9DA 1OQXA 5CD5D 2AQ2A 1G6RL 5F7HA 5I71B 5DQJA 3ARFB 5CLZA 2E6QA 1A8JH 1Q1PA 2H2PC 4H25A 1MAKA 4LGRB 4R4NC 1TCRA 5D2NE 5E56A 1INQA 4ANKA 43CAB 2VDNB 4JBSA 3NK4A 2WINA 4ETQB 4OT1L 3T6QC 4E68A 4ZNEA 1M2VB 4OIAA 4NQCA 4M61A 3V2AR 5B3JE 1G7IB 3GHPA 3UROR 1U8MB 3O3UN 3U9PL 1E5AA 4XNZB 5JXAH 2DQCH 2DQJL 4ZAKC 3N9GH 2A38A 3O45B 1JERA 5FYKL 3EO0A 4ZO8A 3KDMA 5JQ6H 3FSAA 4M8VA 2VL5B 4HJ0C 4YBQD 5D2NB 4PCKA 2QLYA 1CPUA 5CJ5A 5E99L 1KG0B 2H3XC 3PWUA 2YZ8A 1BVNP 1E2WA 2IG2H 3F5WB 4OLYL 5HHVH 1DVZA 4KJQD 3GKWL 2HMIC 5HDQL 5CU9A 3LHPH 1PNDA 4KFZC 5AW1B 1BZQK 2YUVA 4LCIH 5DT1H 3UOAB 4DVRL 1UOWA 3NCJH 5EIIG 2PPFA 4UTAL 3FFCA 4LCWB 1QBML 3QR1A 2VQTA 2YKLH 1T03L 4APXA 3Q9PA 1SJVA 3HC0B 1XSIA 1KCBA 4GW1A 2E6JA 2X6VA 4ZO9A 1RHHA 4JFEE 4PJ7A 2D9QB 3BKCL 2YJQA 1TENA 1UZGA 4LQ1A 1ZCRA 3ZUNC 4MJ5B 3HHMA 4DPCX 3AY4A 1AOZA 2WQXA 2V2XA 1OPGL 1ESOA 5GS1C 2JJSC 3MR9B 4KDWA 3WUZA 3ECBA 3ORJA 4XH2B 2ICEB 4ZX5A 4D0BA 2QSVA 15C8L 3GMPB 1K8IA 3IKCA 2ZUQB 1WWWX 4HQQL 4JPWL 4LFHG 4AYEC 5IT2L 5IUCA 5KVMC 1N3NB 2VQ1A 3O6FD 2X5PA 1Q0XL 3C12A 2Z8SA 3L9EA 1EHKB 3VXTB 4XMTA 5BUAA 1UJ3C 5I26A 1I3GL 3KPRE 2CGYA 4JFEB 3OGCB 5FYLL 3BAJA 2O1AA 4AG4H 1IT9H 1BOGB 1B4JH 2IQ9L 2OMXB 5D2LF 4Z8FL 5IFJB 2X10A 5F96L 4HWNA 1A6WH 3V4PL 4Q9BA 4AVJA 5I9QC 4MJJA 2MHAA 4R4FH 4N8VG 4OI8A 3AS1A 1I53A 4QRPD 5LNGA 2XG4A 1MG2C 3DRTA 2P7TA 4IRSD 4NQCD 4S2SB 1ZHNB 2C3GA 4JO8A 3UBXI 1X5HA 3IMBA 4P59H 2YQBA 5KYNA 3IJ7A 1NCDL 3KPRB 5FKPA 2C4FU 3B7TA 4W4NA 3B37A 1DE4A 5DSCA 3RVWC 1Z9OA 5DHVB 1ZE3H 4PHZA 3VVVA 4PUBL 4WO4A 4F58L 1TQBB 2J5LC 1QBAA 3OKDB 2AW2A 5CD3B 4QCIB 3OB8A 1E9PA 3IGLA 4AYID 5E6IA 5AW5B 2M8XA 2E56A 3HUJF 4Z77A 4XC1H 2LABA 4RRPM 2DWSA 2X4SB 3GB7B 4PRBA 3VRLF 4XX5A 3VWJA 1QPPA 2VH5H 4IRZH 4JCLA 1D7BA 1A6UL 1QRNE 1X9LA 3FHQA 3QDJA 3N6YA 4AL8H 2IGFH 2ZOLA 2RAMA 3FFCD 2OYKA 1FORL 2V37A 3CZFB 3GHEL 4BM7A 2R8SL 3GSNB 3SGJA 1F13A 5CEZH 4NS0A 4BJLA 1UWEH 3MU3A 2X70B 4NPKA 1LK3L 3IGAB 1VGEL 3QZBA 1UACH 4DTGL 2EP6A 1EDQA 1R75A 3FAWA 3HMWH 4U1SA 1BQRA 3WSQL 3ZE1E 1CDUA 3K3QA 4P2OB 3I6LD 4QXGH 5EZLB 2I60L 5GPRA 1A9BB 1M6OA 1TEGA 2A83A 4R6UA 3ZT7A 2C1PA 1SLXA 1QRNB 2PPDA 1FV1B 4YFEA 3I02A 2HJFB 1RUQL 5GQBA 5DEZA 1AHWA 2BDNL 3DA0A 4MXVF 4LBAA 3DK0A 5KVFE 5FO8A 4TSAL 5IQOA 2IPKB 3KPNA 3R4DA 1A14H 3A21A 2J8UE 5B39B 3SE9H 1LM8V 2W9EH 4B9IA 2Q20A 4PJHA 4KKZA 1KXVC 2XC8A 3APMA 3LRMA 3NCEB 4FERA 5LAXB 3ZE1B 1BOYA 3CSFA 1DDHB 5I73C 5IVOA 4ZUWB 5A6MA 4H26A 4YDJA 3QFDA 2EUWA 3K6SB 1B3IA 4WI0A 2DZEA 2O6DA 1EBAA 4OTXH 2PW2B 2JF1A 3IFPA 1N8ZA 1ZTXE 1A1OB 5LNEA 1A6ZA 1NIFA 2HAZA 4K8RL 3VU1A 4DP4X 4F24A 1DYZA 1TR7A 2NT1A 1S7XB 5BRZA 1BZ8A 4MA8H 1UWGL 4GFXA 2QFRA 3V55A 2CGRH 1RIHH 2J8UB 4LKCB 2BX5A 3HEIB 2HA1A 3K2MC 4FJYA 3SZ6A 2ARWA 4JMNA 1G6RA 2NY5H 1QSFA 1KIUB 4WO4D 5FC9A 1H3WM 5T33L 1T2JA 3T8VA 4UOW0 1ZA3A 5LWYH 4ZO7A 4NC2B 2EXYD 5KSBA 1CGVA 2A6DB 3GRWH 3BXNB 2NSMA 1BPLB 3IFLL 3SGEH 1LO0L 3WFEL 3IDJA 1UC6A 4G9DB 1MPAL 2NY2C 3VWJD 5CCGE 1DANT 5GSVB 2D31A 2V9TA 4HA1A 4XP5H 1A25A 1ZXKA 3MRBB 4CGUB 5C08A 3BQUA 3CHRA 4WHYH 5H37G 3G08A 1MCOL 3CSGA 4HYTB 4PU2A 5AOZA 4ZPVA 2JXMA 6CGTA 2L4OA 4KVNH 4ZX4A 1IFRA 2YQ3A 4RGND 3UIYA 1B2YA 4OD2B 4Y4HB 4WFHD 1JD7A 2YGQA 2VXTL 1OP5H 4AGPA 4CC1A 4R3SA 1UENA 4APQB 2ZCZA 1UD6A 2LVCA 4LHUD 1ZSDB 5DXWA 3FUHA 3MLWH 2E75C 1KULA 3ML8A 3QHZL 2R7EA 4JZOA 4K23H 2F2HA 3NRPA 4HHWA 5ECGA 3DBSA 3BN9D 4KXDA 3IN2A 4URTB 3VQMA 5IJBC 5AB0A 2GKIA 1T5WA 4KZ0A 4QXUL 3VI3E 1N4XL 1YY8B 3PNRB 5J6SA 3GXNA 5D7EA 1IGML 4FFVD 3G5VA 4JO5A 3ZRSA 4TKWA 1O6TA 5EO0B 3MRPB 3TBWA 3UEZA 3EFFA 3SKJL 4L2YA 4FYRA 5HDBF 4TL4A 1N6QL 2R59A 5E9NA 4HPYL 4JFSA 5DHYA 5BRZD 1B0RB 3QG6A 3WTVA 5EO9A 1ZPUA 3TNNB 3U4BH 3VCLB 4XNUL 4JFQB 5E2UH 5AYQA 3TBSB 1E5CA 4Q9QH 1GHFL 4WY7L 3OD3A 4FQJH 3VI3B 1EMTL 1QFWL 5FYKU 4KRLB 4H1LB 3VAEA 2DKSA 1M4KA 4EN3C 2DBLL 2J43A 4OUUA 5EPMA 1QSFD 2RFXA 1ORQB 2VABB 4OLZL 5KZCB 2A74B 2O26U 3QWRD 4N1HB 4P23B 2CPCA 4UB0H 3SPVB 3G5YA 5HGAB 1OCWL 1FAIH 2X4RA 2H2PD 4FQCL 1L0PA 2CDEA 2KQMA 1HIMH 3X3GL 2DI9A 4X80H 1HHIB 4K5MA 4ZUSB 4ZUVB 2MOGA 4EMZA 1OWRM 3REVA 1DJSA 1M1SA 3INOA 4QTHB 1CFQA 3TBVA 5C08D 3CIAA 4WJ5A 2V5TA 3ZKXB 3L5XL 1T7XA 5TF0A 2X4TA 1AIFA 5AL0A 1N9PA 4JB9H 2VZVA 8FABB 4MCZB 5FYKD 3VWKB 4ZAKD 4CVWA 3V0WH 2R4SH 3CFJA 2OMBA 3P4LA 4JPVL 1AJ7H 1ZLVK 4FA6A 4HJ0D 4DEPB 1CTMA 1HWGB 3D05A 3QDAA 5T5FL 2P8LA 1T5XB 4MNQA 1L9SA 4JE0A 5DD1H 1KELL 1AI1L 1WBYA 3DTXB 4XBEL 1HH9A 1ETZA 1Q9LB 3VMOA 2HMID 5GRVL 1INDL 2HYMA 3IAPA 5BVJA 1XCTB 4BQCA 3KNBB 1SVBA 1USQA 3ETBJ 2X1QA 4OIFA 3ZTCC 5AWNL 4NRZB 1I1YA 4BUHA 5DUBB 2EVHA 2Z91B 1JDDA 1F1GA 3O9WC 1OAJA 1R47A 3CFIC 3VG0L 4OF0A 1BZ9A 2FJFB 4RFOL 3S36L 4KKPA 3O6MH 1T1YB 5D72H 1E4KC 4RDQG 1A65A 1VADA 1MCLA 4M7LL 1QNIA 4KQ3H 1C1EH 5F9JA 3AWFA 1MJ8L 5T1LD 4GUCA 2B14A 4LLUA 3HVDA 3T2LA 4YSEA 1K3ZA 5A2JH 1CICB 3BCFA 4AQZA 2XBZA 4IHOA 3T6VA 4HUUA 3R1GL 4TQPA 4NNPH 4NO2A 4XN2A 1M7IB 4A2HA 1SOXA 3PV6A 1U91B 3V6BR 1J8HD 3BHBB 4F7PB 1LO5A 1UA3A 3BVXA 5TE7H 1QLFA 1R5WB 3T2QA 1X5AA 5BPPA 4ONGL 3IMUA 2GSMB 5FYLD 1AXIB 2XZCH 5AYTA 3L5WA 3I3BA 4MDRA 2FHFA 4Y4KC 3S5YA 4NP4L 3N91A 1KXVA 2LU5A 3IPFA 3TIEB 5K9QI 2OMTA 5A3IC 3CBKB 4F15C 2Y5TB 2J1ZA 3RUGA 1RJYB 4PBXA 3LNIA 5KOMC 3SBWA 2K1MA 3BAKA 4UOW1 2IXQB 4W9FC 1WV7T 1S9WA 2CJUL 2YXFA 4DCQB 4RAVB 3U2SA 2CO3A 3VFMA 1IAIL 4RBPH 2OSLA 5HDLA 4IU2B 1BJMA 5C0FB 3TN0A 4GG6A 1NEUA 2LR4A 4RAUB 1FZMA 3FU6A 5F7MC 5A2IH 1QA9A 2H3NA 2HVKB 5IJVB 4JK0D 3FRPA 4Q58C 4RGOH 4M8RA 3V52L 5JHDA 1JHKL 1G5GA 1NCCH 5FLUA 1LP9F 5D7SH 3SKNB 1K5NB 1AGEA 3RVWD 4YAQA 3R0NA 4WENB 1K3IA 4Y9FA 3QORC 1WLHA 4RESB 1JD9A 3HC2A 1NFAA 3K8KA 3UG5A 5BVPH 2YLKA 3ZDXE 1NDGA 3FSOA 5E8DH 1J9RA 3MKKA 5C07D 1U95A 3ABGA 3HS0C 4BFRA 1U8JA 2O5XH 4HJJH 3ECWA 2F68X 4NERA 1J5CA 1URZA 2EZ0C 5E2VH 1PG7W 5K9JH 3TNMB 1T20B 2V0AA 3TVMC 1BMZA 2LGNA 1U3HB 1CYXA 3AQXA 2WLZA 4JY4A 1FNFA 3BP4B 2WZAA 1NDMB 2NXYB 1E9OB 4GW4B 4FZ8L 1CB4A 3CZEA 4FQPA 2QMJA 2YS4A 1I8MB 4EI0A 1KYOK 1R5IB 1HN1A 3PABB 5F0PB 3ABMB 3STLB 1JWSB 4NBXB 1B9ZA 5HHMD 5F8RC 4X6DE 1UD2A 3E6HB 1BFTA 4GMSH 3ZDXB 4G42B 4LARH 3UO1L 5BZXA 3QO0A 3ELQA 4QRUB 4YHZL 4PCSA 2C9AA 2ODIA 2VZUA 3U48A 5BOPA 1DUZB 4Z7VF 4KOBA 4FLHA 4XHJC 2BP0A 2IFFL 1B0GA 2VXQA 2Z8WC 3WHXA 3CFCL 1TZHB 3HTLX 1VFOA 1MJUH 3DBXA 4IQHA 3AUVA 1HOCA 4OSUH 2VLRE 2WXNA 3DGDA 3KWUA 2WXPA 1CURA 4YDLB 2IC2A 5JIPA 1X5LA 1OL0A 5B39G 5KJRH 1WZ1L 2V2WB 3GK8H 5FEBA 4BFNA 3JWDC 1U4FA 3AMKA 2BVEA 1Y7VA 3QXAA 5C0JB 4NM4L 3JWDL 3QDHA 5IQ9B 1HNFA 3K91A 1ZVSB 5DJCA 1TJHL 5ICUA 3GTTA 3L45A 4W9DC 3QEQE 1S2EA 1KNOA 5E9DE 2C4FT 4HWEL 1Y6KR 4KGJA 3T4AB 4HZ1A 4UZGA 4BFGA 3BDBA 3K6DA 1I1FA 5LGHH 5JHDD 2CBTA 3B83A 4JRLA 1RFDH 1RV6X 3W2DH 5KYYA 3H9HA 1EAPB 2C9UA 4B9PA 4FJZA 3E1F1 1BSIA 2G4EA 4PVNA 1RZ8B 4GUPA 3S8FB 3HZVA 4KKLC 2WYHA 3QEQB 2VR3A 4AVHA 1EO7A 1OZTG 2VDPB 5E9DB 2NY2D 4AOFA 2JFCA 2DQIH 5KANG 3IDNB 3G6JE 3APNA 3EG9A 4M29A 4YHNA 4X42A 1LDPH 1UH3A 3U7AA 3MUGA 1PLAA 4HU8A 3H4FA 2Z31C 2WTPA 4PP1C 4GQ9H 1OANA 4CADA 3MOQA 4GAJL 4R8WH 5AKSA 4TMPA 3VE0B 4XT1C 4Y5VC 3VXQA 1FNSH 3TL5A 2VLLA 5TF1L 4HJGB 3HI5H 3BO8B 1CS6A 1ADQL 4GIPD 3MCKB 3WFDL 5I5IA 3D2UD 1Z5LA 1ZLSH 5FDYA 5T5FA 1TU2B 4YNYB 3MRFB 4MASA 2F61A 4RMUA 4NKIL 3SDXE 3V6OC 4F2EA 3G6JB 1FNAA 1FNEB 3IJSA 4ZRGA 4OR1A 5AEAA 2VMFA 4ADGA 1TZGL 3DJRA 4X4MA 4IW4C 1BD2D 2YPVL 5F7YC 1CE1H 1SJEA 4ALAC 3HS9A 3SQOH 3KXFD 3ILQC 4TPRL 2KMWA 4R0LA 1YEGL 4ALAL 1R17A 1SLVA 2DICA 2V7NB 2HFFB 1S46A 3CCHA 3MBEC 4LASL 2J73A 3O9WA 2CBOA 3Q13A 3QEGH 2X6UA 3WTSA 3WO4B 2QKIC 3HZ3A 1EPFA 1E2ZA 1E4KA 2Z1PA 3H54A 4PJEA 3SDXB 1FO0B 4N22A 5D8JL 4C58B 3DVNB 2FECI 2XV6B 3KJ4C 4YHKH 4Z6AT 2ZP8A 5IWLC 3B8SA 3OAUH 5G4OA 3WKMH 5DQ9A 1OAQL 1FVEA 1TQVA 4W9GC 3O2DA 3M7FB 3SOTA 3GD1C 5SX4I 4BDVA 2CAKA 3FB6A 1INEH 4EN3D 4JO3L 3WD5H 2Q0ZX 2IPUG 3QXTA 4EZMA 4H1LG 5IESL 1KGXA 2XPGB 4NT6A 5SWQA 5CR8A 1OM3L 1TUPA 5DRZA 5FECA 1J1PL 1UM5H 3SBRA 3BH4A 1HEZB 3HI1A 5EU5B 2F08A 1N0LB 2FSEB 2F7IA 5I1EL 3TWYA 4B5EA 1QFOA 4AENA 5JPMB 1M7DB 3RLSA 1MCKA 1IC4H 5F7EL 1SF5A 4S1RH 5T1KB 5KEZA 3DDGA 1THCA 3QP3A 4HALA 1I9IL 1N6UA 3EJTA 1A6AA 1SYVB 2I7SA 2DN7A 5FFOA 3RWIA 4PTTB 2GSIA 5I76B 3B9AA 1F02I 1EA9C 4I7ZC 3KYNA 2ED9A 4GKLA 5DUML 5LN4A 3BLBA 4M8QA 4U1HA 1KCVL 5AYUL 3W1ZA 3TPKA 1IAMA 5HD8C 2ZX6A 2BLFA 2JNZA 3QORA 2CDGA 1CD0A 4I9WD 3S7GA 3WXVL 1I75A 3O4LE 2VC2B 1H3PH 1XXDC 5JW4R 2RH0A 2P80D 1BG9A 5F6IC 3IPBA 5JA9A 3HS0A 2HKFH 4YHLL 5TQ2H 3L3OA 3HFML 3O3EB 1NSNL 3HKZA 3OWEA 4I77L 3SJVA 5BUGA 2JB6B 1UUNA 1DQMH 4N8CL 3DPDA 4IGBC 3O9WD 1XH3A 1HX0A 3EJCA 3NCMA 4PMFA 3VUAA 3BWZA 2WXOA 4J7RA 5LBGA 3H9SE 4G8EB 1UCBL 4XCEA 2MFNA 2ADJA 2BWQA 2OULB 1IUZA 1XF2B 2FGWH 4NSKA 4OZ4B 1CU4H 2EYSB 5TH2A 3CC5B 3A6OA 3AFLA 3RWHB 4NKQB 5LCVL 4KKRA 1PCSA 3B9KA 4NZUH 2VMEA 3PXHA 2CKBA 1G9EA 3DSNA 3J8F7 4XXDA 3UTSD 5LBVA 3TYGH 3VNYA 5KBLA 1KV3A 4R2GC 1KTLA 5ISZA 1AY1L 3ZE0F 3GMLB 2DTMH 4KY1H 5JIDA 3HAEB 2X6MA 4AGNA 4Y4KD 3H9SB 1R6VA 4KVCH 3PV7A 4PG2C 4R5TA 3WGUB 3CFBA 2N7AA 5A3ID 1NBVH 3MLSH 5H37H 2OSWA 3HZMA 1AG0A 3AT0A 3QC5X 3VXNA 1WP6A 3I50H 2JKJA 5JORA 1BIIB 1Z9PA 2WUCL 2YPLA 3F58H 3NZ8B 1K9TA 1IQDB 4MQTB 3PP3K 3ETTA 1D5ZB 1JF1A 5IBTH 3VMNA 1EGJH 3REWA 2IAMC 4MB5A 1KFGA 1Z5YD 4FQLL 3SGDI 1F45A 2VDRL 1J9SA 1HSAB 1XB6A 3DX6B 3NACH 4PJDE 1ET8A 3RZWA 3OXRA 2PCPA 3NN8A 4X8JA 4HOWA 3MUY1 4EE2A 1FFOA 1F56A 1P7QA 3QORD 4NKOA 1DBKL 4XI5C 3LD8B 3CZGA 5FM5M 4X5XA 1F6FB 2VDKH 1KWKA 3KWXA 2JQAA 5I19H 4MA7H 3W0WE 2FNBA 3WUWB 4FQHA 4NQEE 3OKNA 5IHWA 1CXEA 2GW5A 1UKTA 2L7UA 1LEKA 4YXLL 1YPZA 1T0NA 4XPHL 3LVTA 3SJVD 3GIVA 4P5MB 1W8OA 2EZ0D 2PLTA 2R2BB 5BS0A 3ARGB 5TE6L 5F9WB 3M07A 3ME0B 5GIRB 3TVMD 4LEOA 2OMVA 4PJDB 1S3KH 2XQYG 4U6XB 4JKWA 1EJOH 1RK0B 4N2AA 1GZHA 3UJJH 1HKLH 1MI5E 3W0WB 1MG3C 2N0KA 4X99A 2OTWA 4NQEB 1EERB 1DQIA 5AAWC 3WIAA 4P2CG 1A8ZA 3FDWA 4LVEA 2HRLA 5CCHE 2FAUA 2OTUA 5DRNA 2VDOH 2JB5H 4MMYA 1NGPH 4XHJD 1GGBL 5ISZD 4FHJA 4NI6A 3BPCA 5AOJA 4RAHA 4UM9D 4MMZA 3UZEC 1QKZL 1FIEA 1NMCC 3KS0H 2VDNH 1OGTA 4WFED 1MI5B 1FLRH 1QSVA 3KM1A 1JYXA 3A4AA 2WVVA 4X5LA 1PZ5A 1YAIA 2QKIA 4G6JH 1J9CT 5FF6B 2P46B 2YPLD 3D87B 4L3AA 4X5WB 4HHAA 4I3RH 2XQBL 3GTNA 3V9EA 5CZXC 5F7UA 1IZJA 1DN0A 2F74A 4M5ZL 3F12A 4D0CB 2NXZB 5JR1H 4FXGB 4PLNC 3TT1L 1UKSA 2NW2B 4R96B 5GGVH 1FZOB 4A38A 3QCVH 3RWFB 4W70A 2Y7SA 3RKDC 3QUYC 3LMJL 3DTDA 4XVJH 5EF0A 3N55A 4RX4A 2F1BA 4NRYB 1AQDB 2QHRL 1BZ7A 3LXAA 1MJJA 3HE6C 4OZIE 1P7QD 2YA0A 4KV5E 1OT4A 1ACCA 4NRXB 1MY5A 3EH2A 4DNLA 3CN2A 4KKLD 3MO1B 3NJKA 4JDVB 1JMXA 3RB5A 4UDTB 3OWRA 5MENE 2G60L 3R8QA 2AEWA 4AYFA 4B53A 3GS7A 1CLOL 5DVPA 5DFWH 2QTEA 5BS0D 1E9QB 5EZOL 4Z7OE 1JL8A 4R84A 3PP4L 4XB3A 4NYLB 5AALA 4LPXA 1IEBB 1OT1A 4D9RE 2VXQH 1JZFA 4PP1D 1SEBB 1KY7A 1UM4L 1V10A 1WVZA 5CJOL 4OZIB 4JFDA 5DMKA 3TCXA 4D0DA 4YPJA 5AVSB 4LP4A 2PR9A 4MRCA 25C8L 3HOGA 2OMWA 4FQIL 4R7DA 1QFWM 3R7QA 3K2UH 3MNVB 2A73A 4Z7OB 5EFIB 3BH9B 3S34L 5HY9A 1BV8A 3RFZB 3VD1A 4AQEA 3AUWB 3DVIA 1H15B 3DX0A 3KWWB 3PHSA 4I4WB 3IJEA 1UA6L 1ETJA 3GO1H 3ILQD 3Q2LA 5B22A 5JO5B 1FG2A 2H1PL 4ZFZB 2GY7B 3NBNA 1CGSL 2H41A 2WKOA 5LBSA 4A04A 4JO2L 2YAQA 3E80A 1JFQL 5CNHA 3MBED 4OBSA 4IGBA 3QA3B 4R7NB 1TTCA 4LOEA 2FR4A 5IGXL 1E6JL 1MFBH 3IXTA 5C9KA 3ALXA 5KSUA 4X7SH 1WFOA 1BFSA 3DXAE 3MODL 4LAJH 4HD5A 5CIPB 5EO1A 4BH7B 4DKFH 1AGFA 1IGIH 5CINL 3LX9A 3ARSA 5LCVA 3ULSB 3V0GA 4OCSL 4MD4B 1HYSC 1TJIH 3FT4A 1A22B 1Z3GH 3O41B 4RX4D 4JRFA 4QHKJ 2DQHH 5I1DA 3UJIH 5E08H 2GC7C 3P9LB 2ZXDA 4KZDL 2VXSL 2UYLA 4NQDA 2JJTA 2IDQA 2VLRA 5DVMA 4KAQH 2C7UA 3T4YA 3DXAB 3N44F 3WHE0 2ZIDA 3D0VB 1NBZA 4IBZA 1U2HA 3DPBA 5DMIL 1XB3A 2G75A 1IC0A 5IBUB 5L6YL 2CM6A 2KC0A 3EYSH 1Q9WA 3DIVA 1TZIB 3GBNL 3VXOB 4P3CL 2WYZA 3H8NA 2NTSP 5TK2A 3UGXA 2N56A 4JFDD 3B9DA 3P0GB 1FYTA 1A1MA 1AO7D 4ZMNA 1S7UA 4PBVC 3ZTNL 1FZJB 1NLBL 3G6AA 1D5RA 5HD8D 2MJWA 5FX3A 4CSPA 1IIKA 2W8CA 1XCXA 2ENQA 5EU6B 3T8XA 4WUKL 4RFNB 1ZGLA 1A3RL 4PY8I 2NYYC 2G9HA 3Q8FA 3VFOB 1BWMA 3TEUA 4JLRB 2CO7A 4KX8A 4L37A 1ZKAA 1BJ1H 3QYMA 3HCVA 1L9MA 1UGNA 3MVSA 4NJ9H 3SN6N 3G5WA 1DQJB 3O2DH 4NCDA 2E5EA 2V7HA 4A7GF 1YMHB 4IGBD 1WEJL 1E2VA 4ODBD 4BE5A 1F4WL 1IAIM 2Y0SA 3RIAF 1X6LA 1KTKE 1R4XA 2VR6A 3VXRE 4CMHC 3PPSA 4DP7X 1ZY9A 4XVSL 1NANH 4BA8A 2PP7A 5EDXA 2QFPA 3LPOA 4FXTA 5BZDB 3NA9L 5EA0H 3SPJA 3SE8H 4YR6A 3BI9X 5HYQA 1ASQA 4LSTH 4O58L 4WI2A 1V5JA 4AUYA 2EICA 3UBGA 3PIQA 3RWEB 5J5EA 1NC4D 1BQHA 1HC1A 1XF5A 3SDDC 1OARH 4R2GD 4CAGA 1QASA 3DUUB 3GSUA 4JFOA 4JR9H 4BSVB 1CZ8L 1ZTXH 5K59E 5FLVA 1OE1A 3EFOB 1KLUB 1OVZA 4E36A 1P4LB 3VXRB 3G5XB 1S7WA 2AJZA 3MYZA 3UZEA 4TV3A 2AEPL 3IWVA 2WP3O 3HPJB 4EQ3A 1YEKL 3MREB 5A2KH 3H4HA 5I6OA 1IAKB 4NQQA 5B1KA 3F7YA 3IRZA 3HAEG 2D0GA 2EDMA 2C9VA 2J7LA 3ZGIA 2DKUA 1P6AB 5E8PA 1IKOP 2O6EA 4MNGA 2B1HL 3ABLB 3IS1X 1Q8MA 3QRGL 4UZSA 4M7LT 5F7FA 3QG7L 5JOPE 3JVFC 5DZLA 4NO0B 4UUJA 5ICXB 1AGBB 2GABA 4H8VA 1FYTD 4ANWA 4LCCC 5I15L 2ERJB 3LRLA 4WI9A 2R15A 4RMSA 1NPNA 3OJDA 5D71H 2XWBB 1PKQE 2ZP0T 1DCEA 4Y9BA 5F2FA 4G1EA 2ZCHH 4X4KA 4L4VE 2FWUA 4HWBL 3ZJAA 5TFSL 1JDAA 2ZUWA 3UBXA 1TO4A 3BCDA 3QQ4B 4OBRA 3L4CA 1H8LA 2MCAA 2WIIB 4GBXA 4PV9B 3PS6A 1WAAF 1WYJA 4N0RA 2ISDA 2CKBH 2DQ6A 1ZANL 2EEXA 3ZT6A 5HP5A 3HE7B 5DJDA 1PKQB 4LQFH 5D1XB 3DSFL 3NCCB 5HGHB 1OE2A 4L4VB 4PJBE 5DMGC 3BZEA 2C5DC 2GTZB 2EVJA 3FSVA 2EXSA 2E46A 2V5MA 3KPSD 4H1LH 3DUHA 4JM4H 2YMXL 3AWEA 3INUL 3MRQB 4HXAL 1SM3H 2FX9L 4FQ1L 5ETUB 3VRJB 1ACZA 4C59B 1CG9B 4G6ML 3Q3GA 3WTXA 2OPCA 1ACXA 2IV9A 3LEYH 3O4LA 2X41A 1KBVA 3K71A 1MCCA 3CSBA 4ZMVA 2HKHH 5IMKA 2CLVB 4QRFA 1ROCA 3L1GA 1V55B 4C57C 4CU8A 2Z4QB 3QUXC 5I0ZA 4P5TC 5GRVK 4A6YB 4IMLA 3P3YA 3LNHA 5AAMA 3P3SA 2WBJC 3ATBA 2DQDH 1KN2L 2HFGL 1JGLL 2PW1B 2IV8A 3H1ZA 1JXDA 4WRLA 5DDHB 3IWUA 4NPYA 4PJFA 4PFEA 3V4VL 3S8WA 4UQIM 5I8EA 1JF6A 1IEAB 1X7SA 1ML0A 3QNXB 3QO1A 3WHE1 1V8HA 3H2QA 1RIUL 1QNZL 1EFXA 1JZGA 1MH5B 3GXUB 4P3DA 3AS2A 3LAFA 4G8AC 3KWVA 3KYOA 4IS6A 2H6UA 1PZAA 1ZSHA 3LNDA 4UANA 2BHFA 3OMNB 4OUOA 5DVKA 4GNKB 4GMTL 4M1GH 1RZIB 5KVDL 2UZXB 4UCFA 3RKDD 3QUYD 5BO1H 5I8KH 2OAAA 3CXDH 2Z9TA 3BVNB 3QPQC 4YQXL 5I66B 1CF8H 3MROB 2AMUA 1M05A 3G6DL 4P2QB 2BCMA 3HE6D 3OHXB 4F7CA 1JZ3A 2DEXX 2YMTA 1CE6B 2Y06H 1OCCB 2EINB 4CSTA 3D51A 4J2QA 4KHXH 3CK0H 4RMRA 4MMXB 4O02B 4WO0A 3LZFL 3P9MB 4XHQA 1M3JA 4POUB 1A21A 4N86A 2KZ1B 4R4BB 5JOEA 3EIFA 1NOFA 1KCLA 3HZKB 5DRWB 2RIKA 2AJUL 3MRHB 4FFZA 1E6OH 5L8LB 2OXHA 2Q6WB 1JV5B 4MRBA 1S9VB 1WAAA 4X9YA 2D7TL 2Q7YA 2EAEA 1U8CB 3DX3A 5JYMA 1TTUA 1T3FB 2DV6A 1GYAA 4HIQA 2H32A 3KR3L 4HH8A 2JLLA 2QR0B 2VDLB 2PTVA 3GSQA 4HIXH 5C09B 3ZE2E 4E41E 4PV8A 1F4AA 4F2ME 1YN6B 4BWTA 3T5WA 5CP3A 4PJGA 4OGXL 1JZIA 5HXMA 5AOLA 1JPTH 1XGYL 2G5RA 3NFPB 4PVBA 1GKOA 1KXQE 3WEMA 5CGTA 5IVXA 4B3EA 2B1OA 3U25A 2P3YA 4TLKA 2L7EA 2NY4C 3P4MA 4M4PA 4WDIB 3WJMB 2IBZY 3ESNA 3TO2B 3L9RB 1ICTA 5E2WL 3PL6B 1D6EB 4E41B 1OK8A 2AK4E 5BV7B 3VFUA 4JG0H 4N1CA 2Y23A 5F7BA 1H3GA 1AC0A 2EIZB 2G0LA 2HFTA 4OZHE 4NHCL 3HMXA 3GBMH 4YVUA 4L1BA 4NN5C 2YA1A 3KLQA 1NMAH 3DV6B 4PRPA 1JZ7A 1X3DA 3C60A 1HYSD 2F58H 3UZQB 3JYCA 5SV3A 4L5FE 1XZ0B 1PX3A 4DH2A 4HBCH 5KVEL 4YIQA 4XPBL 2W1NA 2AK4B 5IW3A 3CN0A 3MA9H 4XNYL 3OXSA 4ERSL 1NJ9A 2HSIA 4HPOL 4OZHB 2ADFL 2VR7A 3C5XA 3NVQA 3VJ6B 2QADB 3LEXA 3MFGB 4H88L 4KH9A 3RILA 4XOCA 3ROLB 3VSTA 2W94A 4RISH 3SODB 4HU2A 2IJ0C 3I2CL 4D8PA 2BJMH 2A6KA 3VDCA 1ZVNA 1JN6A 3LQAC 1YN7A 3LEVL 5EB9A 1UH4A 2COQA 4OI9A 2VZSA 3LQAL 2WAHA 5CGMA 1HHGB 2CLRA 2IANE 4LVOC 3RZCB 3IJYA 4LCCA 1IC1A 1F4YL 2F53D 3DTUB 2RTTA 4Y19A 1O7SA 5LBSH 3H7LA 3GJFA 3S5LB 1H19A 4K9EC 4HWBA 5E00A 3MLZL 2R0ZH 3QI9B 1BBJA 3AGWA 5ILTH 4KZEL 3H3BC 4K9EL 2BRRL 4QY8B 5I75B 1JSYA 1PAZA 1GOFA 5BQ7B 5KS9F 2NYYD 4GO8A 4LT7A 5J4MA 4G9FA 4S1QL 4EUPA 1QFUH 3DX4A 5I0DA 1XGRA 2WXIA 2ZOOA 3NFNB 3S9DB 4F93B 3QDGE 1W0VA 4NQSA 2F7QA 2IIJA 1MCWM 5MENA 1IGJA 2EQDA 4A2MA 1WFUA 2P8PB 1M6UA 3QISA 4OH2A 2WO3B 4M5YL 3GMNA 4B0MB 4LVNB 2BSTB 1XGPA 2WXGA 4Y9CA 5GS3A 2C7FA 4YO0B 1G7QB 2ZCLL 4PCYA 4M4RB 2RMNA 3MCG1 1NCIA 5LXGH 4Q74A 3WE6A 4PRPD 1NCWH 5E94A 1MFCH 4JE4B 1ET5A 1UVQB 2HUHA 3QDGB 1DFXA 5H2BA 3V7MA 1KFAH 1P84J 2F5BL 1A0QL 4NB7A 3FO0L 3OKMA 4PJAF 1DBML 1XIWB 2X4NB 3N40P 1AFVH 2W65B 2OK0H 3GSWB 5IOPA 2V3DA 2VLKA 1S7TB 5HVHB 2FECL 3NQIA 5FA3B 1ZGLM 3TM6A 4PSPA 1XBRA 2WBJA 2GBUA 5AUMA 5C0CE 3V4VA 1AYRA 1NGYB 2JCCF 4F57L 1L3NA 1ZVYA 2KKQA 4JFFA 2F8IA 3MLRL 5DC0A 2ZXEB 1XBDA 4NAJA 1XF3B 5C2BL 3LS5H 3UGUA 2IBGA 1GZPB 3FQRB 2XZQH 1KJMA 3F3HA 1RZFH 1YYLL 3GMMB 1OP3K 2WN2A 3JTTB 4JKPL 3AGVA 1YEEH 2EH7L 3I75A 2RD0A 4DKDC 3PNWB 3MBWB 4JFVA 5HYJD 2QZQA 2A9ML 1DVFB 3GZOA 5DCCA 2UY7A 3NZUA 5C0CB 3BUBA 2HRGA 2FL5A 1JPFB 5EHFA 1FPTL 1M9WA 2X40A 5LB1A 4DQOL 5EG6C 4ZFOB 5HHOE 4U1NB 4GRMB 2FBJH 5EOCH 3DO3A 5EF2A 3NIDF 4G9FD 5EBWA 4ZW3A 5GGRA 3QQ9C 1KPVA 5E6RB 3EAKA 2CUIA 2AFNA 2OFQA 3ROOA 1KB5L 1MXGA 1VGKB 5E7BA 1YEJL 4OQTL 5GGTL 4ODUA 4HS3A 3A47A 5B8CB 4HIEB 2MNUA 1YAZA 1FO0H 2PYED 3IT8D 4MDIA 4AT6A 4W6YB 4D3CH 5DJ0B 1HH6A 4YDNA 2FHCA 3GSOB 5DEJA 4GH7B 1H9VA 1X7QB 1KZQA 4DZ8A 3MV7D 3NPZB 5DMGD 5HHOB 1OAUL 1R0AL 5I74B 2PTTA 3BD5A 2XV2A 1E8WA 1X4XA 1KLGB 2EDRA 1GCFA 5CBAA 1R46A 1C7SA 4JQIH 3FQ4A 4IEFA 1AAJA 5CUSH 4MJIB 4TL5A 3MCLH 5FWRA 1MCJA 5JLZA 5HTSA 3X1GA 4XB7A 3FUEA 5K9KB 4UTCA 3QUXD 2HVJA 2X38A 4P5TD 4PRHD 4RA0C 1FVDA 1HHKA 5C6TH 7PAZA 1X6NA 4XNZC 2WBJD 2IOMA 2HLAA 4G1MA 4OCYL 3FTVA 5IQ7L 4JFFD 5D1ZI 5E23A 5EC1A 3TZVB 4F33B 1IFHH 3PHQB 4MKMA 4FRWA 4DFHA 5MEOB 4LSQL 1Y6MR 4HZAA 1CLYL 1UG9A 2VRAA 3COOA 4P07A 2J57A 3WEXB 1A6TA 4LDEB 2BVPA 3OG4B 1FGVH 2X4QB 4FYSA 3N50A 3D3VE 3RTQB 4PGEA 1MREL 3NIFF 3PJLA 2YXWA 3QPQD 5EDSA 4FNPA 1QYGL 1SXBA 1AZBA 4LDOB 5ENWA 1K6QH 1AE6H 4R7XA 5KYWB 2HJKA 3GC3A 4U31A 4CILA 1FL6A 3N42F 3CLEL 3K0WA 4KMTH 5GZOA 3L2MA 3OZKA 2PPAA 1VEOA 3SBPA 3V6ZA 3E6FA 4W6WB 4IDJH 5GGUA 4QLWA 4V2BA 5KVGH 1OHQA 3D3VB 3RVXC 1Q72H 1F86A 4OB5H 1ZS8B 1D5IH 3ZKQD 1HZHH 1I3RB 3OZ9L 2DLEA 4KITB 1EXUA 1S5IH 2ZUQC 3HBQA 3KVPA 3U1SL 3DX8B 4QGTA 4DN3H 2UWEA 4LCYB 5E8OA 3PJSB 2J72A 3VD9A 5I17B 3KZ8A 2NUPA 1PCXA 3MRGA 2CR6A 2M26A 3NTCH 4WVRA 5IMOA 2Y3NA 2GJ6A 4ZFGL 4MQ7A 1DBAH 3ARZA 1T6BX 3HAEH 5GRJL 2PPEA 3LJ3A 1GJWA 3JV5A 4AEEA 1WK0A 2OR7A 5B1CA 1I1CA 2O93L 1BGXH 1C5DB 2VLME 4W9JC 2NY4D 4FP8H 2APVA 1HK6A 5IW6B 2EDBA 3MNDA 5I1JL 2UXTA 4WW2C 5BRQA 2ZKHL 3GLDA 1TEYA 4PJ8B 2WCPA 1ZLWH 4XMLH 1OE3A 1I7ZA 1ZS2A 1WAEA 1WUZA 4PP2A 4G80A 4HD9A 4D9QD 1EEZB 1TQBC 1AH1A 4P2RA 1A4JB 1ZA6A 2P5WE 2W9DL 3LH2H 5IEKB 1MFNA 2Z65C 4NWTL 1YNLL 4PJBA 2NQDA 1CLCA 3HPLB 2YRPA 4OF8A 4RSVA 4ZTEA 1L9PA 5ESVA 4WU7B 2WLLB 5EBMA 4FFZH 2I7OA 4PJCA 3LNFA 3ML9A 3N1GC 4TUJA 3V0VA 5KAQG 3T0EC 4PIRF 3M8OL 2HRPH 3UZVB 4GT7A 9CGTA 3BWSA 4KO9A 3FN9A 4TSCH 1UYWH 1FVCA 3QUKA 3PLYA 3GM0A 2CDFB 3MRCA 4TUOB 4DPBX 4K7FB 2IH9A 2WKGA 2ZQKA 2HB0A 3GSNL 4PD4J 3TEZA 2P5WB 2FJSA 2DIEA 5DJZA 4KDVA 1ZLEA 4WQOA 4MYWB 3RWGB 4Z7WE 2W0FB 2UVEA 3LHAA 4LSUH 1X4YA 1WC7B 2UUDK 2E86A 3MJ7A 4P2OC 4B96A 3VDBA 1U9KA 1MUJB 2DEYX 1WGVA 4P5KA 1XWVA 2XWDA 3GZPA 1Q94B 1IQWH 4W9HC 4G71B 5JZ7C 3NZHH 1F6AA 4IM8A 5B3JF 4XC3H 4O5LL 3BH8A 4FTDA 2BIPA 3ZYZA 4CJ0A 3M17B 2MWCA 2D3NA 4LF3B 4RDQF 4HSQA 2DM4A 2NX5D 2O6FA 3LS4H 4TLUA 4U1IB 1E27B 4ONFH 1RZKC 1HE8A 1I9JH 1HWHB 2QMKA 1OALA 3MBXL 3M88A 4Z7WB 1RZKL 2GJ6D 4OGZA 1XMEB 1YEFL 5AVYB 1EEQA 2X0UA 3S5LG 4BUGA 4OM0H 4U4IA 5LGKA 3HMXH 2WQUA 1KB5A 3C8KB 3N1FC 4I1RA 4NUPA 4FL4B 1J1XH 1UB6B 1U8LB 2AJXH 5GGTA 3U7WH 1AD9A 4JQXC 1A7BA 1OT2A 1T89C 2O5YH 3Q44A 4TULH 3VQ1C 3U0TB 2J6EL 2KDYA 3BX7C 2BIHA 5IMMB 2FNWA 5KVFL 1W91A 3MC0A 4YDZA 4UM8A 1JG9A 4HUWA 2QQKH 4W9ZA 2XZAH 3AM8C 1UUSA 3GGWB 4Z3JA 2OMUB 3US1A 3EOAA 3MRDA 3WL9A 4U6VL 2GK2A 4X6EA 6FABH 2N3JA 5I1LA 4G82A 4X7CC 1GKEA 1HT6A 4F2MA 5HVWA 2AQ1A 1CK0H 2ZE0A 2DLHA 3AXIA 1A7PH 3BSZA 4XN1A 3O0RL 1EEYA 5SWSD 4Z95H 3TEXA 4JPKL 1KXQA 5DJ8B 1HAWA 1TT6A 4LLWB 4AQAA 1TPXB 1M2VA 3P73A 4LEXL 4UU9B 2K3HA 4OCRL 4ODHH 5IBLC 4H20L 4TNVK 4IBYA 3WFHA 4LSVL 4OLEA 1H0DB 2GTWA 5IW1B 4HCRL 1KOAA 3RAJL 5I24A 3GJFH 2VCOA 5FUOL 1KJVA 4NO5B 5K69A 3EGSA 3MLUL 4Y4HC 3WFCL 1CQYA 1JNLH 4NZTL 2YD6A 2R69L 3EW3B 1NM9A 2X12A 2YARA 3MJ8A 5ITBH 1IGFH 1QG3A 2OZ4H 2XTJB 2J5WA 3JTBA 4LNRB 1KCUH 2YAFA 1O9WA 5CCJA 2MEJB 5I1AB 4IIQA 5HJ3A 3FQTA 1HCFX 2OJEB 3RX5A 4C54A 4F27A 2BZDA 4ZUUB 5JIKA 3O0LA 2EYTB 2P47B 3OBAA 3MNWA 4YWGH 4G6FB 2QPDB 2X1XR 4W93A 1KEGH 3EO1A 3AADB 4KQ4L 1YECL 1W72B 2ICWI 2K4WA 3LSOB 1OLLA 4AWJC 2M83A 3A5VA 4LCWA 2A77H 1BECA 2Y72A 3D69B 2WLIA 4X7TA 3OQRA 2EXWC 3FBKA 2LQRA 4F7TB 1FNHA 1PZ2A 4QAMB 4JMXA 4OFYA 3T71A 5J1AB 3QQ9D 4I3GA 1BAFH 1YEIL 4X7FC 3V6FA 4EEEA 1I1AB 3V7AE 4MJ5A 3ASOB 3L95B 3P2TA 4GW5A 1U3JA 4O2FA 2HX8A 2OR8A 1OOWA 3LPWA 3ILPB 3SYOA 1MNUL 3GKZA 5CIPH 3CDZB 3RDTB 1HILA 3C5ZC 4U33A 2VXVH 2EVIA 3O11B 4PGDA 5DJXA 4N9GB 3QRFM 1U2CA 2B5IB 2YGPA 4QNPE 3ZE1F 3FUFA 2A74C 4P23C 2IANA 4GEIA 4ODSH 1ZT1B 4Y4FB 2W0KA 5D4JA 1GMIA 5C0GA 2WSDA 3ZHDA 3MRKB 5FHAL 1O6SA 2FX7L 4IRJB 1GJUA 2FWOB 4N3UA 4I0PB 3WELA 1D2OA 2MPAH 3MRJA 2D4FA 4BZ2L 1EWHA 2VSDA 4JG1H 1EHAA 2J8UF 1N5YL 1G7PA 3ZKXC 3BD3A 5FGRA 1P2CA 2VAJA 2XPYA 4WW2A 3VWKC 1QLRB 1JDCA 5IMLB 4YC2B 5K9OB 1WTLA 2KL6A 2CIKB 1JPSH 2GJZB 3GMQA 3K8MA 5DK0B 4LDLB 1QLEL 4JHBA 2BP8A 4DEPC 5DHVA 3K7UA 4PJIE 1A5FL 3QR0A 4XWGL 2WIMA 2PWEA 4PRAB 4PW4A 3DDFA 1BYPA 3QNZB 5K1VA 3ZZSA 1JYVA 4J3VA 1S5HA 1ZEAH 2X9WA 3P4NA 5F6HJ 4FMFA 3TLRA 5T3ZE 5I1GH 2EIKB 4YFLF 1I8LC 3GEWB 4YHOH 4CBPA 1ORSA 3FQXA 4M1DL 2MQCA 1XL6A 4DEWA 1ZHKA 2L0DA 3SPIA 2HVBA 1P6WA 1AHMA 3T0EA 2AF2A 1XCWA 2YD7A 4LCWD 4KTEL 5D5MA 4YXHH 1Z7JA 2HN7A 3PG2A 5CGYC 5AVVB 3MZGB 4AW7A 5FDWA 2XDHA 2APTA 2ENSA 3QIWB 1F11B 4OFYD 4PJIB 5LVEA 3ULVE 4G8GA 4PRIA 1HI6A 4XO8A 1MWOA 4XPAL 3TCLB 4YDIH 2NQ3A 2W9LA 1BQUA 4FQQA 1I9RH 4ZYKB 1KCSL 3RVXD 4PJXE 5H94B 2Z4TA 5IKCA 3SEPA 3SDYH 3ZO9A 1FHNA 3A67H 3E9TA 3QULB 3RBSA 5J9PA 4UOJA 1E3FA 3QPXH 5E4EC 4PGCB 5DQDL 1RIVL 4N24A 2XTLA 2CRYA 1RK1B 3BDYH 4R83A 4X6BB 4KQ0A 4JN1H 3GTVA 3GBDA 1F1AA 2IBZX 4YHMH 3GSXA 2IADA 1GYWA 4JFZL 5D70H 3K6SA 2EECA 3QQNA 5CLWA 3G3LA 4V1DE 3B2VL 5L88L 4OJFH 4QYOA 3HG1E 4WK4B 2X4PB 4WHDA 4JQXA 3V5HA 3MXVH 2XX0A 1ZHLA 3VI3F 1F8TH 1RK7A 4U1MB 4PR5B 1AS7A 2IAAC 5C0DB 5I18H 4MAYB 4X0NA 1ET7A 4HIHB 4S0TD 3BRFA 3NAAL 1QBLL 1U0QA 2F54A 1JWUB 1AACA 3GBEA 5D4HA 5AW3B 4I1NB 1EHLH 4Q8BA 4XMVA 2C1OB 2H4EA 4PB9H 4PYGA 1W80A 1YNTB 2W60B 4TS6A 1OP5K 3KPPA 1NPUA 3JUYA 4MZIA 3KLSA 4PWGA 1KBKA 2K8MA 2DI7A 2M2DA 1NZRA 4ZPTB 1C5BL 3RIAK 3F04A 1OTTC 4PN6A 1F97A 4ELME 5HPMB 4GG8B 3ZDZE 5IB1A 5EIVA 1P5UB 3T0ED 3FYEB 4XMXA 3HNTL 4XO4A 1OB1A 1U3HC 4ZOBA 3FJTA 3RYMA 4Y89A 2CMRL 3CFMA 5C0AE 1FL3A 3G9AB 3BEWA 5A2CA 4HCRA 4K3DH 3L1EA 3UTTA 5F89B 3U46B 2XNAA 2UZIH 5D7JB 3VXUE 4EZJA 5HHQB 5IB4B 3MNZA 7FABL 3NDZE 3QUZB 1SLUA 4NZFA 1GL4B 2H2SD 4P2OD 2FYYA 4N6RB 1NCGA 3QYCA 1U3YA 2JI2A 3MKGA 2VE6B 4WWID 3BRGC 1NUNB 2CK2A 2QSTA 3QIUA 4S0HA 5JZ7D 5J13C 5HJBA 4CN1A 3UAAA 2NSQA 3GSRA 2BH0A 3CPUA 3UYRH 2H0PA 3IDXH 2WMPB 3AB0B 4QHNB 3RVVC 2XJLA 2AV1B 4ATTA 4KUCF 4YDLC 5AOKA 5L7XL 2OX5A 4CW1B 2LU4A 3D34A 3GXPA 4EI5B 3PDOA 3SQBB 4Y1AE 1L7TL 2VIRB 3HG2A 1T0MB 1JHLH 2DQFB 2WLYA 5GGSA 3X14B 2BNQA 1L5GA 2ATAA 2FEEI 4PWKA 5D4QA 4A6YH 4L8DB 4I18B 1MFEH 2VQUA 4ZW7A 2X0VA 3O3AB 4NN6B 5DJYB 1MEXH 1MELA 4JDEA 1OTUC 3T4AC 1N8OE 1Z5HA 4NUJA 3NABL 4QTIL 1NGXA 2DMHA 2HJLB 3H53A 4TUKL 1QVOA 2VSMB 3PFQA 4UNVA 3BP7A 2F54D 2CSPA 1D5XB 2FJHB 1WCBB 2OMYA 3C5ZA 2FJGA 3Q0HA 4Y1AB 1B88A 3LKRA 3RG1C 1RZJH 3LQZB 2BOBA 4G6KL 3DECA 3SGKA 4N2BA 3CQQA 2AJ3A 1J1OH 3N0AA 4JVPA 5DFVD 5BW7C 4Z23A 5CFHA 4O51B 2EH8L 1JK9A 3K80A 2VDPL 1YLBB 4GQPH 2XOTA 4UNUA 5IB3A 2EDNA 1QOKA 3L13A 4O02H 2YSSA 5EUOA 3X12A 1DQDH 3FN0L 3OAYH 1KN4H 5B1BB 5IBLD 3UTTD 2J8HA 3P0VH 1URLA 1SF3A 2AJSH 5I1CH 4J6RL 2AJYL 2WB1A 4IMKC 5EEYA 2V5RA 2AQ3A 5D1QE 1KDJA 1NFDE 4Y4HD 4HJUA 3FXIC 4M62L 2CO2A 2QVKA 4OCXH 4RIRA 1OSYA 5CJXC 3EYVA 2Q2LA 3KEHA 4Z7UE 3T1FA 2FIKA 1S9XB 4NO3A 5BJTB 1ND0A 2VDLH 4MB1A 3BGMA 4UTBL 2VDMH 4RZCA 5J56B 3FCSA 1TQTA 3QXVA 1JMZA 1BFVL 4U0RB 4YOKA 4ANXA 3AS3A 4JDTL 1RKRA 4MAUH 3F84A 4HS6A 2CU9A 2KS0A 5FAAA 2YOAA 1CGYA 2J8OA 4OD3L 4P4KA 1R3LB 3MV8B 3KYAA 2J1WA 5CGBA 2EXWD 1NFDB 1U93B 2CR0A 2VWEE 3FN3A 3WO4C 3ZDXF 3WENA 1JZ2A 4W6XB 5BOZG 1KY6A 4CVXA 4TOYL 2VW4A 4RBPK 4JJ5A 4D94A 2AK1L 4WU5B 4RWHA 1SMOA 1WFMA 3CDGA 1X5JA 2DMGA 5BV7H 5KG9B 4D9LH 4DESA 1FSKB 2GK0B 1GCYA 1W16A 3B2UC 3BSZH 5JHLL 3C5JB 1U91A 3OX8B 3UX9B 4Y2LA 1XF1A 5AD0A 4HEME 4XN8A 3TJHC 3T09A 2EEDA 2N7SA 3BZ5A 3KPLA 2ITCB 4HGMA 4HUVA 1AZRA 2ZOUA 4FLRA 4I0KA 3C5ZD 3VFWA 4FQ2L 1A7RH 1PPIA 4ZBJA 4JVUA 4ODXB 4KBPA 5KZCD 1L9QA 4MCYA 4P23D 2E0PA 3CAFA 1XSOA 4BFOA 1U58A 4HISA 4LKXB 4PBWD 1V7NL 2ZUUA 4NUGH 3RNKA 4WEMB 5E1GA 5I16B 1I4FB 3DWTA 3NSYA 2Y7QA 5DK2A 4KKNA 5H4YA 3Q1SH 4ZTPH 1D3CA 2GITB 5CFAA 4XRCB 5D7LB 2KPWA 2VERN 1DSFL 5CM1A 3R18A 3US9A 4KK6C 1TYEB 2DWEA 4HOZA 3DV4B 4PQXA 3VWKD 5LN8A 1R3IH 1FNGB 2R23A 4JRXE 3KPOA 1I7UB 4NP9A 4L5FH 4DO4A 5ACZB 3LNGA 6TAAA 3OKLA 1LQBC 4MJ2A 2ADIA 5FM8A 4XP4H 3RBGA 1AGCB 3NG5A 4WGVB 2B39A 2PF6A 4BSWB 3CFKB 5IK3A 4Q97A 2XSKA 4AQ8C 3HZYA 3AJ7A 3BT2L 3C09B 3SGDH 5IB2A 4XPFL 4OLVL 2VC2L 2BVUA 1KPRB 1UWYA 3VDAA 2ATKA 1SMAA 2W07B 4LSSL 2WSPA 5JXEA 2ZPKL 1P0SE 1H8SA 3RJOA 4F1ZA 5CEXB 1QI3A 3S37H 4JEGB 5IZ7A 1HQ4A 1ZLDA 4D7PA 5IJDC 2FYVA 2VN5A 5IM7A 5MEQB 4JRXB 5J11C 5CGYD 4M7KL 5HI3C 4A63A 4FQXB 1TQCB 4Y8AA 5DUPL 4AX3A 4UQ2B 5MP6L 4KUCD 3OSVA 3JVGC 4XVTL 4ZTOH 1K4CB 1ZT7B 4PG9A 4OJEH 4YLCA 1KSRA 5EUKB 32C2B 4K94H 3CDYA 3M7OA 1USZA 2WYIA 4HH9A 2IGTA 4AZ8A 3G6JF 3B1TA 3EJJX 4PEEA 4TSBL 5JPNB 1RJZB 4TLSA 3ESUF 4TLTA 2GCYB 1DFBH 1YYML 1NWOA 1UZ6E 3KJ6H 1N5AA 4OFQA 4JNXA 4EXPX 2IEPA 5EZJB 5GGVY 3MJWA 3KAAA 4L8CA 2NY7L 2OCCB 3KLDA 2R2HA 1P7KB 3ESMA 4KTDH 5DO2C 1MRCL 3RU8H 3KPMB 2ZOWA 1QO3B 2BINA 3FFDA 4IJTA 5ICYA 2ZXAA 5FA4B 3I6KA 3MV9E 1RMFH 1VESA 5FYJL 4QF1A 2GUYA 3C08L 2YD0A 5LGJB 5IV2A 3ARRA 3SDXF 8CGTA 1G7HB 4LBEB 3SPCA 5AL8A 3FK3A 4Q0XH 4N5UA 2GHZA 4G11A 3QIBC 2NYKA 4GXVH 4U3SA 4QRRE 3SDCB 4ZD3L 3CSYA 2I9TA 1TNNA 3WIFA 1RQ5A 1HOEA 4BK5C 2H1XA 2EUXA 3T4AA 4GQQA 4LP5A 2LLGA 4HKZA 1M1XA 1CDGA 3OAWA 4V33A 3HC4L 3MV9B 4QAWA 1E5YA 2CRZA 4ODWB 1HCYA 3UACA 1X5IA 3BUYA 3P0YH 5FO7A 1QHPA 5CXPA 3VACA 5GRUL 4OIIH 4EDXB 1WWBX 3GSVB 4P9ML 2DQEH 2NTFA 2A6JB 1IKFH 4JRWA 5EBLB 1XR9B 4QRRB 2I69A 1J11A 3NP4A 2ZX7A 3LDBC 1OTTD 3FU9A 3LKQA 1O5DT 5BW7A 1OSZB 3LNEA 3VXSA 3II3A 1KBWA 1T21A 3MYJA 3ARGC 5F9WC 1RH8A 1JZHA 4K2UH 4N2OA 1Z2KA 1U3HD 4B7IA 4KXZH 4J5VA 2RBLA 3LQMA 2R1YB 3FU5A 1SXCA 1T7VA 1Q38A 4MSWA 3VGDA 2E4FA 4DW2L 2WZ5A 2B0SH 1I3UA 1FDLH 3BD4A 3RIFF 4XOBA 3NP3A 4IMKA 1QI5A 2NY6B 5DI8B 5EV7A 4LPTA 3N5AA 2VMCA 1KIPB 2AHIA 1JZ8A 3WBDA 4JHAH 3ZSSA 1R5VB 2ARJA 3WNJA 1HXYA 4EKXA 3SDAB 4LIQE 4OLWH 3C2AH 1SY6H 5D96C 2AAAA 3K72A 3PGDB 3QJZA 5LQBH 4XNMA 2VAAA 5C0BE 2GAZA 1RZPA 1LILA 4HEPA 1PS3A 2EYRB 3EJYC 1OSPL 3H3PL 4Z0BH 5CLXA 3RVVD 2NY3B 3VRIA 2GUOB 4ODTL 3RWJA 4UQ3A 4GAGL 2XKUA 1GIGH 2MNJB 2NR6A 4HF5L 4N0FA 3H42L 4OW6A 4P0DA 3RPIB 4X9IA 3T77B 3MOAL 1U3ZA 5K39B 4DKEL 1LEGB 1CLZL 1P1ZB 2CHDA 4HWZA 4X7DC 5F7NC 5FKAB 4BCYA 5C0BB 3DROB 2KZKA 1BEXA 2YO3A 3KBHE 3MLYL 3DYMA 4TNWK 1OTUD 2NXZC 5I8CA 1BF8A 1MCSA 1Q1JL 2F5AH 3V10A 3WDJA 1YQVL 2CGZA 4NOFA 1QEWB 1QPKA 4PJXA 2VLJE 1RURH 4YBHA 2AXHA 5B21A 4B6ZA 3PWPA 5C1MB 1DSYA 1SEQL 1UD5A 1PEWA 5IF0B 4H8WC 1U41A 3UDWC 3O3BB 1AXSB 1FZKB 5ERWA 4ZUTA 3GNML 3O6LL 3CNKA 4H8WL 5DGRA 4RGMC 3QEUB 1DJGA 1PIFA 4OZGE 1OGAA 5HPOA 2CCLA 5IFHH 4NJAL 1JP5A 4H0LC 2AQNA 5ACMA 1THAA 3VFSB 5I1KL 3PGFH 3BE1H 3HRZA 1IBFA 1CFSB 5A43C 1CFNB 5B1JC 2W92A 5LGYA 3VXSD 4Y5YB 1A4KB 1CXLA 1KGIA 1PJWA 3F83A 4MZRA 3T0DA 1ETA1 4M48L 4WUUE 4WJKB 4MJHA 4V1DA 1EJ8A 4OLXL 3MRLB 4HC1L 2NY0B 2IDCA 3EGXA 2BVTA 5IEHB 4X98B 4DSYA 2WLHA 4F8OA 1GC1C 2CHWA 2H0EA 1G7JA 4IBQA 1E42A 5F70A 1KGWA 3WFZA 1CT8B 5K5YA 1GC1L 1LE5B 3JWOH 2APWA 4X5RA 2XWJA 3FO9B 2X9XA 3K46A 4QHUB 1N7ML 3TO4A 4N8UA 4GI9A 4AQ8A 1B2WL 1AZNA 3Q6GL 3VI4E 5AZEL 1JGDB 3VH8A 3RFZC 1EVTC 3LYRA 1VB9A 3W57A 4WUUB 4AKOA 1V3JA 1MLBB 1A3LL 2FT6A 4JM2B 2XXCB 1QABA 4FG2A 4PJDF 4Z7QE 4LPUA 5HGBB 2RR3A 3EYOA 2XRAH 3R06B 5DFTA 2RACA 4HLZG 1RZGB 3L81A 4XR8C 4DPRA 1JYWA 2DLIA 1N64H 1FFNB 4OF7A 3RL2A 1LHZA 2NR6D 4ZDHB 3QJHB 2QQLL 4Z7NE 3JVGA 5C0AA 4DP1X 1UQSA 1K8DB 2XY2A 1JVLA 3BIKB 3T65A 3AU1B 3BUIA 3LKSB 2DQUH 4PGBB 3DOSA 2YXMA 3VI4B 1MRDH 4JO4H 3OKOB 1TVHB 3KHOA 5FM4A 2X89A 2FSDA 3RRQA 5GJSL 3B2UD 5PCYA 3BVWA 4Z7QB 1T4KA 2PO6A 3B7YA 1KT2B 4XPGL 3LRHA 3TV8A 43C9A 5E95B 3TJHD 2RQEA 3QFJE 3PWPD 5AVTB 3HG5A 3A6CL 3T3ME 1OF2B 5HHXH 2OL3B 2ZX5A 1KJ2B 1EANA 2HT3C 3WIIH 2BSSA 1OGAD 1I8IB 1MIML 4XMPL 1GAFH 1L9NA 4A2EA 4ZT1A 1XCQB 1SRDA 4GKNA 1BVLB 4XCYB 5CEYA 2NUTA 1OW0C 3KGRA 4E9YA 4YHIA 1G4MA 3MRIB 5T1KD 3U2JA 4I1PA 3QIBA 4XXCC 5E1IA 1PGRB 2FATL 3F7VB 3WNKA 3UADA 3LB6C 3V4UH 1F42A 1KLFB 4LVHB 4XCCL 3QFJB 3VM5A 2VDQH 3KL3A 4M93B 3SD5A 3THML 4AUJA 2HKAA 1AXTH 2EE2A 1JUFA 4KK6D 3IM1A 1Q0YL 3T3MB 4AZUA 2E74C 2XN9A 3KYMB 4XWOC 1D7FA 2Y2TA 3B6SB 4XP1H 1VFBB 3L1OL 4DT2A 1L9OA 4M6MH 2LFGA 3OF6A 2DYPB 5TDOA 1E8ZA 4JAMB 3UTQA 3D0AA 1GGIH 3PE9A 5T3XL 4N0YL 1A7NL 4RFNC 1UZ8A 2GIXA 5JOFB 4EVNA 1F90H 1OAXL 1ONQB 1JRHH 1R3HA 1MZYA 1A1NA 3M1BB 5D1ZA 1NC2A 4HV8A 2HG0A 5FYJU 4AH2A 5CILH 4OZIF 4KV5F 2HX9A 5CEZE 3HLAA 3LZNA 4J3OG 4ZXBC 5HI3D 1FP5A 4UWQB 4HXBH 2LFEA 3GMRB 3MV11 2D7QA 2QVMA 2DWYA 2MCPH 1JGEB 3IDIB 3GXFA 3C9NB 3DMMC 4ETYA 3WEOA 1Q90A 1OAYH 4WEEA 1AMYA 5KSAB 4HK0A 2FX8L 3CX5J 2NW3B 1IO4C 5E51A 4Z7OF 2AKRB 3IE4A 1T1WB 1TJGL 4R90H 4LCUA 2Z8RA 2Y36H 3RL1A 2PWGA 4F3FB 4HPHA 1IM9B 1YRKA 4GYBA 4I13B 2PXYB 5DO2D 4HKBB 1K4DB 1PG7H 2BIIA 4XBGA 2Z0UA 3K8LA 4Z7UA 4DGIH 2JKTM 2Y22A 2PTUA 3DI2B 5FYJD 1DJHA 1MCNA 3FB7A 3QNYA 4PJ5E 3M1OA 4G3YL 1UJTA 3H9SD 2R2EA 4LAQH 3H7BB 1WE5A 1GY2A 2ZOKB 2QJDA 1RU9L 4UT7H 3VX1A 3CZNA 3G04B 1SYSA 3ZZ1A 4YZFE 4ABVA 4HFUH 4ZS6C 4J3UA 2FD6L 1NCBL 3CBRA 3L16A 5J6HA 5C7ZA 3E3QE 5JYLA 3QIBD 4J1UA 4YBLC 3DVGA 2CO4A 1UT2A 2V2TB 3E8VA 4NKDA 5AW4B 2YN5A 3QHTC 1U2YA 4WFGD 1JPGB 2DM3A 2EIBA 3DRQA 3AXHA 1L4IA 4E5XG 1F4XH 3ILDA 1CD8A 4PJ5B 2JELL 2DPKA 3IU3A 3LCYA 5KYUA 2VITA 3OF6D 4PJ9A 4WNQA 1S7VA 2XFXB 3UDWA 1FN4B 3N85L 1KGUA 3VW3L 3SCMC 2AGJH 3HNVL 4YHYB 4GKZB 4HW6A 2VSKB 4OCWL 4I5BB 4PTUB 3MA7A 1LWRA 1U8OB 3QZWA 4WW1B 5F0LB 5FO9A 1BVOA 4LB8A 3MJ9A 5EN3A 4MWFA 3SQRA 1MCPL 2Y2YA 4WTZG 1NC2D 1KYAA 1YMME 3FRUA 4IBVA 1IBBA 3ARGD 3QRLA 4X6CB 5L2JB 1HQRB 2P5EA 3FQ2A 4HC1A 4RZKA 3HE7C 1TNMA 4ZNCD 4Q2ZB 1N2RA 5JW5A 4H8UA 5CHNA 5E8EB 2X4OA 5D1XC 4NQXA 3W56A 4TNEA 5AVUB 1JZ5A 4TVSa 4WIQA 1DBJL 3ESVF 2C4XA 4CDGC 3VA2C 3W0WD 1HXMA 1SDAB 3B7RL 1KEMH 4Z5RB 3FW6A 5AVXB 4RFEA 4AMKL 4K71B 1YMMB 1Z9SB 1AP2B 3UG3A 1Y18A 1OPOA 4Z3HA 3DX9B 4N87A 3P30L 4CVZB 5CWSB 2QSCL 2QPEB 2ZNXA 4EIBA 5HYSB 1GPOH 5HHNB 3EJYD 2Y5EA 1NINA 1QHOA 3KWWA 2AXFA 5BRPA 1QR1B 2WJ7A 2X6CA 2QBWA 4PS4H 5SWZA 3GI8L 3VYOA 3QUML 4FTVE 4H0HB 4YFDB 2QV4A 1NBYB 4GO6B 2FGZA 4UQCA 3B2MA 1WRFA 3TA4D 1WZKA 3PWVB 3Q05A 4F9LA 2KZBA 1NMBH 4MDJA 1EXGA 4LESA 2DQTL 4DGYH 2J3SA 5IB5A 1OWWA 3FONA 1F3JA 4U1JB 1PZBA 4MKTA 3LKPA 4UDUA 1G7MB 4PBDA 4Y16B 3FQUA 1D9KB 2NXZD 4H4NA 2C26A 2YAEA 1H8NA 2E9IA 3MXWL 4PWIA 2CRIA 4UQBA 4JY6B 2ROXA 2AXGB 4FTVB 5CLTA 5IP4A 3KLHD 3FCTA 2F7RA 5ID1B 5E6SB 3TA3A 1RVFH 2EIEA 3WLWC 4BZ1L 1S7QA 4YDVA 2FUQA 5IJKC 4E5XA 4HAKA 4IK6A 5INCB 3IDGB 4X0KB 1BQ5A 3ZN6A 2J4WH 2P42B 4MBRA 4HT1L 2XKSA 4Q89A 2JI3A 3N1PC 2Y1ZA 3TBTA 3D25A 3FQ1A 3IJ9A 1EFQA 4WWKA 3Q5YA 3QWNA 4HUKB 4KRMB 3IDMA 2BNRA 2XTSA 3RWDB 5K59F 5GS0C 1LO4H 2YSTA 4XXCA 2R9HC 4YX2L 4PYHA 2BVOA 4H40A 1XR8B 1W0YT 3NRFA 4L4TA 2QT6A 4M7ZC 1CIDA 4UIMB 1OB0A 3ZMEA 1TZIA 5GS0L 4WKZA 4WTZA 1KIQB 1OD9A 4U1KB 3M1CA 2VZTA 1C12B 2AANA 5T3ZH 2NNXA 1UB5A 4BCXA 2WP3T 2GSGA 4F9PC 1BFOA 1G9NC 4G7YH 2UZYA 2E47A 3UJTL 2EO9A 2BVQA 2ZUSA 1G9NL 4JN2A 4LXFA 1M71B 4QRSB 2XWRA 3IEAA 3D06A 1PX8A 5DGQA 1S4IA 3S35H 5DZ9A 2WLKA 4N90E 3IJHB 5IROA 4DK5A 4XCNA 3HR5B 3WNIA 5CP7B 4WI6A 3ULVH 2N0MA 4QHPA 2XXGA 1P4IL 3F6IA 4MCNA 1MIEL 3C6LB 4ZI8A 2FH8A 3J7HA 4A66A 1FYHB 1RUKL 1ZDSA 1A66A 5I1HL 2VISA 4DP0X 3SOBL 4I88A 1XDTT 4LRNH 4NZ8A 3TONA 4AITA 4DUXA 3FF7A 3U1PA 1HKFA 2X28A 4MD5A 5CO1A 2P24B 2LAAA 2QGBA 1UD4A 3I6GA 3LN4B 2IH1A 3PL6C 4ZXBA 3FTZA 5BZWB 1EHNA 1RPUA 2BXZA 1CFVL 2X7LB 3VB8A 5AB2A 1NCOA 5GGQH 1FFPA 5FOBA 1ITCA 3C5SB 4LP8A 2LHAA 1PZDA 3DMMA 4BFIB 1JZ4A 4FNLH 4HKXA 3BUDA 2Q8AL 4QHMB 2D7MA 4O00A 2ICWA 1F6LL 4OKVA 5E0FA 3VFGH 1QFWI 2XVKA 4YSQA 4Q52A 1S7SB 4HS8L 4HG4J 1R19A 3ATEA 2V5YA 3D0LB 5T1DH 3ES6B 1BLNB 1VFUA 2HPOA 3I6SA 4YE4H 3EUUA 4ZNEE 5FHBH 4NQCE 3GXIA 3O6FB 4EOWL 1MHHA 3W9DB 1SOKA 5EEVA 1WA1X 4RNRB 5F1SA 5DQJB 4H25B 2SEBA 3W5NA 4D2NA 2HT3D 2L3BA 1KMGA 1JGUL 1PNCA 4AQ1A 3DXAD 4JZJC 5EOTA 1TLMA 3EXLA 1TCRB 4JFYA 1INQB 2QADC 3DIFA 1MCBA 2ITDA 4MVBC 1ETB1 2BNRD 3BAEH 2H6PA 2WANA 4FA8A 2WINB 1REIA 4CN4A 2H26A 1A7QL 3LB6D 5GS2D 4L4TD 2MTPA 4NQCB 4M61B 2F7PA 2R0WL 1LYQA 5IUSA 3L7FA 4K3JL 5ICXA 1G7LA 4KK8C 3FFCE 35C8L 4RCAA 4XWOD 3RZCC 4G7VH 3EO0B 2QQQA 2V33A 3WN6A 4GRWE 3MPCA 1PZ3A 5G4MA 5T3XD 3UEQA 3HHSA 4G5AA 2IPUK 4YPGA 3CZSA 4JGJA 4KFMA 2VLJA 3KPTA 4PJ7E 4MA1B 4XMUA 5EU6D 2Q1EA 1E4WL 3PWUB 3SCMA 2HTLC 2JMRA 4QHKI 4ZZFA 4E9RA 3P2BA 4Z0XA 3U7YL 2B4CC 4OZGA 4P05A 3L4TA 5ESQA 1DLFL 3VSVA 2B4CL 1WICA 4NENA 3FFCB 1J0JA 2BZ7A 5C70A 4K94C 4APXB 2XVBA 3VFRA 3K6IA 1URIA 4ZXBD 1G9HA 3U0WH 3I9GH 2DLFL 3PUCA 4GRWB 4GW1B 4AV0A 5DC4B 3N43B 1RHHB 4LVNC 3O4OC 4PJ7B 3CN3A 4TQ8A 1Q9OA 1GGCH 3DMMD 2VM9A 4YS4A 2DWDA 5FW8A 3HNSH 2V2XB 4YDKL 2R1WA 1ID2A 5FPIA 2Y07H 1BVKA 5HYEA 3ECBB 4LCVA 1MHEA 1NIDA 4U7KA 1K8IB 2QVIA 3IKCB 3JV4A 4XMZA 4LOFA 3IETA 4M6OH 1KCKA 2VQ1B 4GXFA 5FK9A 2W88A 1XIWC 3QUMA 4M9OA 5EORH 1MJ7L 1S8DA 1OY3B 1OO2A 1CFMA 4BKLA 4RRPG 3L5HA 2ZXBA 5MERA 5HVHC 3LV3A 2XA3A 5HDOA 3B7SA 3LH9A 3P02A 1CTOA 2G5UA 1IAII 2VXUH 2LVEA 1DVUA 4JL1A 4ZS6D 2CWRA 2OCJA 1X9UA 2MHAB 3V0AC 4EI6B 3K2IA 3EYUH 5JIHA 5DF0A 2XG4B 3E0GA 2ZSVA 3KD4A 3DRTB 2P7TB 3NFSH 3QJFA 4Z3EA 3OV6A 4JHWH 3FHEA 3MX0A 2JQZA 2W0PA 3QDJE 4I3SL 5FKPB 2I26N 3OC8A 1CFBA 1DE4B 4N2FA 1EIBA 5CJQH 3V9CA 3TP4A 1MZZA 5DSCB 3QZOA 1DVFC 3WJLC 4P2QA 5DTFA 4GFTB 4WO4B 2Y7OA 4OZHF 3SCMD 1CD1A 3NGBC 4X5QA 1E9PB 4NDMA 2PP9A 4HLZH 4FYTA 1PLGL 1CR9L 2A9NH 4RGNE 5E6IB 1ASOA 3BVUA 2B2XH 4WFHE 1P1VA 5GHWL 4Z77B 4ZFOL 3NH7H 3CX2A 3PDGA 4PRBB 3VWJB 4BZYA 3PHOA 3QDJB 3HZKA 1ZDQA 2ZOLB 3VFNA 1R3JA 2EC9T 2ZXQA 1IILE 2C3HA 4M6NL 5EWIL 2RCSL 5C3IA 3HE7D 4UV7H 4WWOA 1J48A 3GI9H 4ICWA 2AZAA 2HWZH 3DHPA 4WEBH 5D1XD 4F9PA 1VHPA 4GSQA 4PJHE 4W1TA 4TVPL 5DD5L 1T3FA 2Q7NA 4XE5B 4RGNB 4U1SB 5I74C 2ZKXA 4Q6YA 2BY0A 3QWQB 5J6GA 4HIIA 2A83B 2C1PB 3IMTA 4FNQA 3CX5K 4ZODA 2V9QA 3I02B 4WAFA 4F7KA 1AHWB 5C92A 1CXKA 5BRZE 2GEQA 4XPTH 3KPNB 3QQ3A 2AV7A 4UT9L 5HYSG 3HC3L 4PJHB 3RFRA 1DL7L 5C0RH 4DVBA 5FCUL 4NX0A 2QEJA 3TV3H 3NOIA 1QSFE 3ARPA 2XQYK 4GRLC 4H26B 3E9UA 3QFDB 4YDJB 3TWCH 4Q9RH 3TZVC 3ARBC 4WI0B 5KSBE 3WN5C 4S1SH 1CLVA 2VUKA 4KUZL 3U2IA 3LIUA 3IFPB 1GTNA 1N8ZB 2APFA 4XO3A 4KVPA 1A6ZB 2FB4L 2IO5A 4MXWL 1CL7I 3MJ9H 5A6LA 5BRZB 3FF8A 4KJWC 4HZLA 4JUTA 3SY0A 4DFIA 3LY6A 1NICA 5C08E 3OR6A 1E4XL 1HJBC 3WS6A 1XAUA 2Q8BH 3IVKA 4P2QD 1G6RB 1KB9K 2R56H 1FC2D 1QSFB 2N01B 3RY6C 1B4TA 4AEHH 4TF4A 2OR9H 5FYKE 4G8IA 1ZA3B 4JO1H 5KSBB 3CMOL 2FO4A 4TVUA 1KTBA 2J71A 3E1ZA 4OLUH 4KNSA 1IJ9A 4K07A 2X87A 4J3OH 4JZJA 5ITFA 3IDJB 3CBJB 4NN7C 5DZOA 5F44A 5I5RA 4LOUC 1XTLA 2D31B 2WQVA 4FFYH 4C56A 4K3HA 4LEBA 4JJHA 5GS0D 1PF3A 2E9GA 2Y6SC 1J86A 3SE4A 2R9HD 4B5ZA 1BCIA 5C08B 4JKNA 1EH9A 3RGBA 3SYQA 3BQUB 2PWDA 1VPOL 2EACA 4UNIA 5L2KA 3QJQB 3G08B 1VA9A 2CO6A 3NJXA 1LWJA 5BZZA 4ZPVB 4MXVE 3BEVA 2BSRA 2JXMB 3JUZA 4Z3GA 2OCFD 1CGWA 1MAMH 1ZV2A 5KYXB 2BY3A 1J5OH 5CN1A 5C7XL 5C09D 1NEZA 5EEWA 1ZWIA 4KK9C 4PRNA 4WCYH 4R3SB 5IFAL 1WJ3A 3FO2A 3QCUH 4CNIA 4HCIA 4YHPA 2X09A 3U6RA 2R7EB 3O81A 4JZOB 4G59C 3L3HA 5CCKH 3LZQA 5FUZL 1E28A 1SNRA 4Y7MA 1T5WB 3H0TA 1CBVL 1P5VA 3JSSA 2CK0L 4FZEH 3WXWH 2WNWA 4U7MA 3PL6D 2XA8H 1NH6A 4J28A 4TRPH 2AI0L 5H8DA 5FYLE 1B0IA 4UQ9A 3TBWB 3EFFB 2FE0A 3MLVH 4YO0A 1RLWA 3NESA 2DDQL 3FQWA 3BPLB 5DHYB 1EVUA 3QG6B 5EO9B 3GLAA 4P2YA 2H0FA 1T1XA 2C3VA 2Z7YA 3IDYB 3GHBL 2D03L 1JCKA 1G0YR 3BFOA 4NKMA 1AGDA 1GYCA 1WH0A 5EPMB 2RFXB 4IJ3B 1TETH 4YN3A 3BP5A 2KT6A 1MRFH 3G5YB 1L7IL 2X4RB 3WDIA 3Q01A 4MB3A 4Y2DB 4QXVA 3O6KH 5JIQA 2CDEB 1H6UA 1I7RA 1C7TA 3FOMA 1S7RA 2QADD 4MNQE 3DLQR 2E27H 3NCYS 3PAYA 2A0LC 2J55A 1OXYA 3B3BA 4MVBD 5IQMA 3REVB 5DWUH 7TAAA 4LGPB 1CFQB 1Z32X 3TBVB 1GZPA 3O3DA 3EGDA 4KDTC 3WKQA 4WJ5B 5JTWA 5JNYA 5L2KD 1JJUA 2X4TB 2F8XC 3JTTA 5ADPH 1QUNA 3RZCD 3CFJB 4N2DA 3KPQA 4IOIA 4QOKA 4FADA 1F2QA 2ZKWA 2F9BT 1QATA 2P8LB 3LRKA 1G6VK 4M7JL 4J4PC 2XFGB 1A7OH 1YEDA 3ELAT 1V3KA 4MNQB 5HHME 1WBYB 2HTLD 4ZMYA 3BKMH 3CXFA 2EKJA 3TOPA 1HH9B 4OZFA 1ETZB 5IVNA 4WI4A 3C6SA 2WUBH 5HDBE 5BVJB 1GTFA 1BM3H 2WWKT 3MRNA 2JJVA 1I1YB 1YEHL 1R3KA 5I1IH 1W15A 3P40A 3U4AA 1BZ9B 2APSA 5AOIA 1MFDL 1VADB 1H6FA 5HHMB 3VGAB 3EDKA 4HETA 5F9JB 3K81A 3BAWA 4K7PH 1W8EA 3EJUA 3RUGE 4LLUB 1JGVH 2DQGL 1AD0A 3ZT5A 5AZ2L 3VO0A 4IHOB 2Y2WA 3IU4L 5GGRY 4NAQA 5CBEA 5C0EA 4HUUB 4WNSA 4NO2B 2GFBA 3PF2A 3PV6B 4GSDH 4XP6H 1MN4A 3VX0A 4MS6A 4P46C 2ZOTA 1JBJA 1LO5B 4Q4IA 1G0DA 1HHJA 4GG6E 4I85A 1QLFB 1AR2A 3A6BL 4UT9A 3L6FA 1XIWD 1UXWA 4PB0H 2N59A 2YQ2A 3L5WB 2HTKC 1M42A 4HFWA 1TPXC 4ODVH 1YY9C 4NLAA 5GXBB 1PEZA 5JHDE 3AVEA 3ZYJA 5BXFA 4HJEA 2OMTB 4O4YL 3CIQA 3RUGB 4MGXA 2YFOA 3U6XS 1IC5L 1MF2H 4RQQA 2PETA 4GRLA 1S9WB 1JNHA 2R0KH 5AOMA 3U2SB 3R0MA 3VFMB 3ARBA 3FTYA 3WN5A 3QXDA 2VDOB 5CZVL 2OSLB 4OGAC 3B5GA 4IOFC 5A16A 4DETA 2E7LC 3MACH 1QP1A 3MGTA 3TN0B 3LIZL 4GG6B 1FZMB 2XTJC 2COVD 1CI5A 1QA9B 5DR5H 2H3NB 2B15A 2O6PA 3FRPB 1H5BC 4EBQH 2X4QA 4G8FA 4XP9H 3FU7A 3TF4A 3VGEA 3ULUH 2WPGA 4QOKD 5JHDB 2OP4H <