4NIYE

Crystal structure of trypsiligase (k60e/n143h/y151h/d189k trypsin) complexed to yrh-ecotin (m84y/m85r/a86h ecotin)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
137
structure length
137
Chain Sequence
PLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTYRHCPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title N-terminal protein modification by substrate-activated reverse proteolysis.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 22
structure length 137
sequence length 137
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4niyE00
1P0SE 1N8OE 1SLXA 4IW4C 1XXDC 1FI8C 1IFGA 1XX9C 1SLVA 2Y6TE 1ECZA 4NIYE 1ID5I 1SLUA 1SLWA 1EZSA 1XXFC 1ECYA 1EZUA 1AZZC
chains in the Genus database with same CATH superfamily
3X14B 3SJVB 1YN7A 5L4IA 4H40A 5I0WA 1U4EA 2H4EA 2NDGA 4XGZA 1XIWA 2DQTH 4KGLA 5I19H 4GRLC 1QNZH 1IQDB 3P3SA 1V7NH 3VA6A 1AJ7H 3QT2A 1ZT4A 4WU5A 3HZVA 3VXUB 1MN4A 4BZ2H 4PJ5D 1G6VK 1KXHA 1M9WA 4EIUA 1L9QA 3QS3A 3QG6A 2KMWA 5JIDA 1KGXA 2P5WB 2EEDA 4UNUA 3QRFM 2DS4A 2V2XB 3VM5A 3HE7D 4GSQA 5I6PA 2DQ6A 5MENB 4GI8A 4NWTL 1A0QH 4TPRH 4FJZA 3BAEH 2BWIA 2X40A 4KZ0A 4P2RD 4CJ1A 1AGFB 2JWYA 2BWDA 1U8OB 2N1TE 1LMIA 5A7EA 1D5XA 1WTLA 4JO3H 4N8CH 3EFDH 1CF1A 4GMTL 2O6CA 1XO8A 5EHFA 4A2GA 5I1JL 2VL5A 3SN6N 1M05A 2WQVA 3DPBA 3F05A 5HPMB 2ITDA 3MRRB 3DJ9A 3PHAA 4BUHA 4X6DA 4P2QB 5EIIA 2IAND 3WD5L 4NFBA 2C9PA 2DMCA 5INDB 4JKMA 2A6KB 3ZUNC 5ESQA 3L9YA 4QD2E 5IBUG 3V0VB 5D7KE 2D3LA 3NJMA 3MQIA 3N43B 1E9PB 5T3XH 1WBYB 3NA4A 3AB0B 4PJBA 4Z7VB 4NZRH 2NQCA 3N40F 1U95A 5ABAA 3CLEL 4WI2A 2NUPA 2ODHA 3L13A 3RB5A 4OLUL 1ZHBB 2AFNA 2W1NA 1JPFB 2VNCA 4HS3B 1DQTA 4RRPA 4MX7B 1MW2A 3NPSB 3U9PL 3RIKA 4MHHG 1B4LA 2FEJA 5AYUH 2YAFA 5DHVH 1A7QH 3DRQB 5HGAA 5D1XA 5E6IB 4JZOA 2SODB 4XOCA 2WWMC 5L2KD 5IV2B 4S1SL 5DUJA 4KFZC 1WGVA 1WC7A 1IAII 1XSOA 2BP0A 2PPEA 2IXQA 4FXTA 5E1IA 1T1WB 4HJJL 5AVQB 4PR5A 4H26A 1UHVA 4QXUH 4YFDB 1WISA 5DJCA 2O6FA 4S1QL 3WHXA 3V6OA 2CJTA 4B5EA 3DECA 4HJGB 3WJMA 4XWOC 1EAPA 1OANA 2OMTA 3DSFL 4HMEA 5JW3H 3EH3B 4JZJC 2AQQA 2AJSL 2K7QA 4NBYB 4X9IA 5DRXB 4NQDE 1Q1JL 5D7JB 2VMJA 4BZYA 1I1YB 3T0VA 2IDTA 2B15A 3W1ZA 2HPTA 3WY4A 4JQXC 1L9MA 3BHBB 3RA7H 3D05A 3AS2A 3MBXL 1BDYA 1MJJB 1SEBA 2J57A 1MCSA 5KYYB 4P2OA 1Z3GL 4M6NH 5KBPA 2L0DA 4HUNB 3HBZA 4HIEA 4LCIL 3IKKA 1A3RH 4XMLL 1OF0A 1OT1A 4ONFH 4XR8C 1E7VA 1IBDA 4XMKH 5D1QB 5IMOA 2ZJSL 2MCPL 1C5BL 1IBHA 5AW1B 1TVBA 3R0MA 4FYRA 3GMNA 3DI3B 1T5XA 4JG1L 2Y7OA 2NOYA 5DGRA 2CMRL 1KY6A 1NINA 1BECA 3JV0A 3SE4C 5TE4L 1OGAD 1QR1A 4G5ZH 3ARTA 4DP1X 3C8KB 1BXXA 3V2AR 4Y7OC 4GSRA 4IK7A 4X0NA 5C0AE 1Q0YL 4HH8A 3LPPA 2PWHA 4XN8A 1H8LA 1BIIB 1A4KB 1MVYA 3T3MF 4C56E 2GABA 1E8YA 2WKOF 3L5XL 2HG0A 4Q6IB 4U6VL 3FUEA 2HSIA 4F2MA 5L88H 3TWYA 2BRRL 4HKXB 4PW9A 2Z31D 3QHZL 2Y3NA 3VFNB 2B77A 1EVUA 4Y2DB 1HOCA 2NXZB 4O2EA 3E2HB 3UJIH 3FUKA 2QMKA 1MRDL 4PM1A 5K9KB 2OMVA 1V10A 1CVSC 4PJ5E 3S2CA 1RFDL 1NANH 2XTLA 5F9OL 5J3HC 5FO8B 5HGDB 5F9WB 1THAA 2CRIA 4KNTA 1R3KA 5A2BA 1RY7B 4YHLH 1J1XH 3E6HB 3KWWB 5I23A 3Q2WA 5A2IH 4X42A 3AMKA 1WWCA 3RE0A 4BZ1H 4NCC2 4NWTH 4N0CD 1JGDA 4P2RE 4BFIA 4Q9BA 2MTAA 2HX7A 1RUML 4HFWA 5DT1H 5J4MA 1I1AA 1NMCC 3DETD 4I3GA 2UYLB 4AEFA 4WW2B 3MJ9A 4WTWA 1PKQA 1ZOXA 1HXMB 3NRQA 4PWFA 1I9IH 5C2BL 5IHWA 5I1JH 5E4IA 4XP6L 5CO1A 5I8EA 5F71A 5HHOB 1U4FA 4XCEB 1DEEA 2Z7WA 2DKMA 1DVSA 1USZA 2H1XA 2PTTB 4IBQA 2EXSA 4HUWA 3DXAD 4OR1A 4KVPA 3X14A 1M71A 3SJVA 3CCHA 2IANE 3APMA 3LQZB 3BW9A 4UOW1 3VGHA 1TVHB 3FU5A 2YJQA 4A7QA 1T0MB 5A43C 3Q3GB 3GXPA 1BYPA 3L45A 1W80A 1GHFL 3C5ZB 4K71C 1W8NA 4OKVB 4MYPA 2P8LB 1I85C 4TTGA 4DKTA 4X8JB 3MBEB 1AD0A 3A6BH 4QY8B 1CGWA 2CRMA 1F2QA 4E9VA 2X70A 5ACMA 4ZXBC 3WKML 1NM9A 2V2XA 4LCVA 5GZOA 4TSCH 5KYXB 1BZ7B 4H20H 3QS2A 3SDCD 3K1KC 4QI3A 3VWJC 1BD2B 3CGTA 4X4KA 1Z66A 5CN1A 2G2RB 3QHFL 4BSWB 2IFGA 4PCTA 2B59A 5B38A 1E4WH 4BZ2A 4Y89A 4LLWB 2FB4H 3QDGA 2SEBB 1QPPA 3VMPA 1ZVHA 1MFAH 5JORB 5L2KE 5EC2A 4Q6YA 4WSGA 1JE6A 2Z4QA 3GSQB 4KJWD 3UH8A 1BLIA 4JRWA 3TF4A 5JHBA 3K71A 2XY1A 1T1ZB 4HJJH 3MRRA 1SVBA 3VDAA 4JPIA 2VLJD 4X2UA 2WKGA 1KCVL 4FTVB 4LOEA 4S1QH 1AKJD 3D48R 4KZEL 1KCRH 1JHTA 1FV1A 2BM3A 4LQ1A 2ORBL 3MGTA 3RGVD 1CN4A 5E9NA 4N5ED 3X17A 5CLXA 1Q1JH 1NGPL 3P69A 4UOJA 3BP5B 4H25A 1WBYA 2VXQL 2VR5A 5TE7H 1D5MA 4Z7VA 1ZV2A 2M26A 4LPUA 4L2YA 5CBEA 3DX7B 2EIJB 1PEWA 1U8IA 1RV6X 2DEYX 2WXMA 3Q7JA 5DS1A 5E51A 4PJHA 2EEAA 1T7XA 4NI6A 5EEUA 2YRPA 1OAUL 1JPFA 3LXCA 2JJUA 1I1FA 1NIEA 3ARED 3LS5L 3T08A 4MFHA 4QGTA 4IGBC 1FSKC 2A83A 4XMLH 4YDVA 3A5VA 2UXTA 2MCPH 1AO7B 1C5BH 5FKAB 3DRQA 4EMZA 1RUKH 3B9EA 4YAQA 4UB0L 4AC2A 5IJDC 2X6MA 3HI1B 2WXRA 2YD1A 5IV2A 1LEIA 3K2IA 3VE0B 5K1VA 3HC0B 1JZHA 4OCLC 1HINL 3FUJA 1NCGA 1OGAE 4ZG1A 2HCZX 1JUFB 1AZUA 4CSTA 1W6WA 3FCUB 3EIFA 3DDGA 1R19A 3FCSB 5DHVA 4GW4A 1U36A 1LE9B 2L7UA 4J8RB 3PXHA 5I17A 2H6UA 1B0IA 3CSBA 3Q1SL 1T7WA 4JFFB 3SGKC 5D7JA 3GB7A 2GUOB 3H3KA 5FYKH 3F6JA 2KDYA 2BRRH 3KW8A 1I1YA 1X5KA 2LABA 2WB7A 4P3CL 3VD0A 3RX9A 3QHZH 4I2XB 4U7KA 4GXUM 3IU3A 2X2JA 4KJYA 4LKCB 4RGNB 2QHRH 3TH2T 5MEQB 1B0WA 3ZMNA 5JHDE 2F08A 1HQ4B 5ID0B 2JI3A 1G1CA 4A04A 3TXAA 4EI5C 1RFDH 3Q13A 1AZVA 5MERA 5IB1A 1EIBA 1JGEB 2JI2A 4MA1C 3U83A 4DPBX 1R3IL 2QFRA 2IBGA 1MCNA 4Z7OF 4UILH 2R8SL 5GRZA 4E41E 3LTVA 3KLHD 5DJ8B 4AQEB 5DJZB 2VSCA 2J1WA 2XLLA 5CF3A 1BGXH 2ATKB 2BNUA 1B0GA 4WEBL 5ACLA 3TH4T 5A7BA 1B6DA 5ANME 2OJZL 2WV3A 4AUYA 1QHOA 2J8UB 3HMWL 5IVXB 4GP8B 4ILDA 2W0LA 5C2BH 3GSVB 4O2CB 1OP5H 4CU8A 2ZUXA 4GRMB 5GGQL 1O9ZA 3BN9D 4XNZC 1BIIA 1KELH 4BCZA 4BFRA 1NL0L 1DEDA 1VKXB 2MJWA 2ZX9A 4Q6IA 3BQUD 1W16A 1P4LB 2HFGL 4P46D 3TASA 3OQ3B 5I6LA 1J5HA 3ARRA 3D85D 2CKBL 2J1XA 1GL4B 1KZYA 2WNXA 1YEHH 5CU9A 3QUXB 2DYPD 2XKSA 1GVIA 5K9KA 5LG1A 2WZ6A 1HHKB 3CFQA 3QUML 4B41A 4ZUTA 5CU5A 5HGDA 4YUEL 2OYPA 3O2VL 1J1PL 4KK8C 3E6HA 3BSHA 3L3OA 4RFNB 3WTTA 4PBDA 5D2NE 4BCYA 3BIBX 2DMHA 3EYQC 4R0LB 1KDJA 4K9JA 2DLFH 3G6DH 5SWZB 2D3NA 3NCWA 3QHFH 4MDIB 4JM0A 1M57B 2PXYB 3TA3A 4DGWC 5EEYA 4O5LL 3ARSA 4Q0XL 2OTPA 2PETA 3GLAA 3VWKC 2X6BA 5K39B 1A7NL 4OZFH 3JUZA 4WHCA 1HXMA 3WIFA 1FFNB 5IMLB 1OAZH 3A6CH 2J2ZA 2XFXB 5HHOA 4NHCL 2BNRA 3P4OB 1UWEL 2VLJE 4ZO8A 2VDOL 4YSRA 4G9FD 3B3BA 1QZ1A 3ASWA 4KKAD 4ONGH 4LARL 4KZEH 5CILH 3QEQE 4M3JA 1UJ3C 2QKIC 4PJGE 1TVHA 4NEHB 4OIIL 1T0MA 2ORBH 2XOTA 3L4ZA 5DYFA 1PX4A 2EXWC 3QQ9D 5C2UB 3ZXAC 4C58B 2X1OA 3NFSH 3C5ZA 4LCWA 4WK2B 3LAFA 1KSRA 1QVOB 3WEBA 4AUJA 3SDDD 4QY8A 2G60H 1M2OA 5JW4M 1EJOL 3WY1A 1UKQA 1OHQA 1OLLA 1MKFA 1Q72H 2XT1B 4E36A 4BXVA 1U8QB 4MD0B 1F6AB 4Y1SA 4YNYB 1TTFA 4BSWA 5AG8A 4DN4L 2WXLA 1A7OH 2XTJB 2OCCB 4LLWA 5B39A 3VSUA 4UB0H 3HR5B 3FQXB 3GSQA 3EBHA 5ICZB 5EU4A 5CEYA 1FE8L 2UZXA 4M7ZC 5ISZA 2CCLA 3CZUB 2K9FB 3ARDA 2EH7H 4U49A 2Q6WB 5DSCB 3LZFL 1H6FA 3GS4A 3ZL4L 4Z9KB 2WNKA 2Y7MA 3HUJA 3Q6GL 1BG1A 3IBEA 5H35B 3ZPDA 9PCYA 5DMKB 1MEXL 4HJSA 1KENL 3Q1SH 1XX9C 3M1CA 4XPHL 3PV6A 4YHPB 4YBQC 3EXLA 3BP5A 4O51B 4GUPA 5DK0B 3ZIMA 4QGYA 4PCYA 4YXHL 3DX9A 2C3VA 5FKPB 2VSKB 1XB8A 3UZEA 5AOIA 5AEAA 3CVCA 2WD0A 1OCOB 3DI2B 5KAQG 1DCLA 2XN1A 4DEWA 4HUMB 4AMWA 1U9KA 2CHNA 4IDJH 3WNIA 1AQMA 4TQEL 1CDCA 4L1LA 1CLZL 3LZQA 3TCTA 1WO2A 3DIFB 4YFLI 1GJIA 2J73A 3B9KD 1AO7A 1R3IH 5EO9A 1JPGA 3HI5H 3PWLB 3RIFF 3T65A 1TQVA 3V6ZB 2CE6A 2HMID 4XBPB 5HHNB 2MRYA 4H44C 4KKCC 3P0YH 3RVWC 5EUOE 3BYYA 1CU4L 3RY6A 3O2DL 3MRFA 2ZSWA 3PHQB 3HMWH 2DM7A 4HHAB 1XIWD 2XWBB 3BJLA 1WH0A 1HL9A 1JUFA 2GCYA 5ECJE 5HI3C 1D6EA 5D2LF 4MMZC 3BKJH 2Z92A 4J8RA 4L5FE 5GGQH 2HT3C 2XRAH 4HUXB 4NN5B 1B3IA 2HTLC 3LIUA 3OKOA 4ZQKA 2N4IA 3ZHFA 4M02A 2ADYA 3BVNB 3MRNA 3O9WD 1KBVA 4ZFFA 3CVHL 1ZLVH 3VI4A 3CV5A 2CKBH 1QSEB 3D51A 2VLLA 2A9CA 3GMQA 4PVBA 3S8WA 1DYZA 4BH8B 4Z7NB 4FHBD 3LB6D 3ZKXC 3QK0A 2VMEA 1FQ9C 1J1PH 4HGWB 3NIGB 4D9QD 3RUGB 2ISDA 2F61A 5IQ9A 1M42A 3QJVB 2WINA 1VFUA 1QSVA 1QKZL 5DJZA 1IM3B 1FFQA 4A2DA 3L3HA 1KYOJ 2R69L 4GW1A 1DCEA 3VMOA 1YRKA 3ECUA 5I73C 2X2HA 2FZ3B 4FYSA 1FWXA 4Q56A 3MV7B 3BUIA 4O5LH 2BX5A 1BQRA 3QUMB 5E4OA 3VRIB 1UT2A 2BSBA 1S7WB 5BJTA 5E1QA 5D96C 4Z76A 4GLRI 4EI0A 4CC1A 5IQLA 4KTYA 1YNTB 1CFVH 1RZKC 3WJLA 2VXVH 2WWKT 2YA2A 3RKDD 1UWEH 3VI3B 1SRDA 1HDMA 3OAZK 2UZIL 3QR2A 2AEIT 2AJVL 4G9FE 4XXCC 4PB0H 5CFAA 2JKIS 4EEEA 5CSZA 5KSBF 1P4LA 1C16A 1G7LB 3SDAA 2DWDB 2QZQA 3WFDH 1P0SE 2OFQA 3BCFA 4OIIH 3GM8A 4M7LT 1W2KT 2WXKA 2EDQA 2APTA 3WS3B 4P06A 2Q76B 2Y25A 3AROA 2BY1A 2EABA 3WXWH 43CAA 5D1XD 5EZOH 5D72L 1A4JB 1U2CA 2VDOB 4MZRA 2HRPL 4J3TA 1JZ2A 4I1PA 4YJZL 1CK0L 1CFTA 1OOWA 3P3YA 4OCNC 4YSCA 5C8JA 5L0QB 4XN4A 3ZTJH 1ADQL 3F00A 4TRPL 4GYBA 2FQDA 4R0LA 4A6YB 1D3CA 2ZXBA 3LXAA 2AK1L 3AG3B 4KJPD 4DN4H 4Y4FC 1YJDL 3KAAA 2MH4A 3B43A 3OHMB 5CCKL 2WY3B 1R3LB 5LO7A 2GPZA 2X0VA 4ATWA 2Y7QA 2MIZA 5IMLA 3KH4A 4EQ2A 1ZHKB 1NGWB 2AQPA 1LMKA 2J8UF 2WLKA 3CQQA 4PGEB 4Y5XC 5IG7B 5D6CA 3ZL4H 4B95C 2ROYA 3NSJA 2A9NH 4WNJA 4F1ZA 4WEUD 1MCEA 2ZKHH 4HKJB 1BOGA 4YDLB 4OZFA 4XPHH 4IRSC 2VZVA 2EXYD 1PL3A 1HCYA 3LPWA 3UADA 3UBXI 3GBEA 2NY1B 3FB8A 3QIBA 3RDTA 3HB3B 3TN0A 1KIQA 3VG9B 4A55A 1QI5A 3U7WH 2YJLA 4TQEH 2K3HA 1CLZH 3L95B 4PI2A 1WD9A 3JUYA 4FEMA 4MD0A 4R83A 3D7PA 5DFVD 2L8AA 2VXQA 2XBDA 5AW9B 3WFCL 1MRCL 5FF6A 3QCUH 3I2CL 3C2AL 1OGSA 4XP1L 1CXEA 3MCYA 3DO4A 4OU3A 4Y19B 3FQXA 1CU4H 3STZB 5HGBB 2OCJA 5EDXA 5I1CL 3D39B 3KLAB 4C4KO 4Z3JA 4KMTL 2HG5A 2X4UB 1JWMB 1CR9L 4JO1L 1G6RH 3MUHL 4X8GA 2G4EA 5GGTL 3PWJB 1BFVL 2VUYA 1AIZA 4JFZL 2DJUA 1C9SA 1NCNA 4OD1L 3R7RA 5CIPB 4LHUD 2XWJA 3J27A 4LFHG 5CMAB 4GQZA 5D7SL 4YIQB 4N1EA 1L0XA 5FV2A 4F57H 2AAVA 4O51A 5DK0A 3UP6A 1WCBB 3PFUA 4Z7AA 3FF7A 2DQGL 1RLWA 3B2XA 2XY2A 2UWEA 2VUKA 4OAWB 5CHNA 3FHEA 1IL1B 3JVGA 1RI8A 7TAAA 1CE6A 3NCEB 4D9QE 2WYHA 3ZHKA 2X4RB 2XIBA 3CVHB 1MREL 3K6FA 5AL8A 2E4FA 3KBFA 3ZE2E 3BKCH 1QKZH 5FDWB 3VGAC 2D9CA 4FQLL 1WV7T 3ZKND 2FJGB 3SJVD 3KE0A 3QQXA 4Q9RH 4FFVD 1T4WA 3PNRB 5JHMA 3K80A 3N50A 1M7IA 4HHAA 2XWBA 3WFHB 3Q05A 3L8QA 4IHBA 3RTQB 1GKOA 2RHEA 4MB5A 1NC4B 3GMPA 1HZKA 4HJIA 1S9YA 3VXUD 1I7TB 3KJ4C 1AGDA 3UZQB 5KBDA 3MKGA 4UIKH 2G3ZA 1NCHA 4MA8L 3SKJL 2UZIH 4PJDB 2AJVH 2LV4A 4QOKA 2EVJA 2P5WD 3CN4A 2D0HA 3TBTB 5GZOD 3L4XA 2FLMA 5MEND 4DK5A 3EBIA 3GD1C 2FTAA 3BDYL 5EU6B 2DAVA 1U2YA 1YAIA 3QISA 4R26L 3T0EB 1NDMA 4NRYB 4BH8A 2NUTA 2X2YA 4UI2A 1V54B 3QDGD 3QEHB 5AB0A 4LSRL 1GIGL 3UAAA 3VGDA 1JGVL 3RWEB 3NA9L 2NY5L 2CKBA 4FXGB 4FFZH 4PWGA 2JLPA 2V9TA 4P2QD 2MCMA 3UMNA 3BKMH 3T3ME 3ALXA 4R97B 4FYTA 4R4FL 1IEBA 2L4OA 3WBDA 2CGRL 3NIDF 3MV7A 4MCYA 5F9DC 3L5WB 3QUMA 1J1OH 5CCKH 3TU6A 2IOMA 2DLGA 3CQFA 3P40A 3OX8A 3P73A 4RWHA 2EACA 3V8CA 3S88L 3FQUA 2CLRB 4A7VA 4AENB 4IBSA 4TTDD 3CBKB 3FB5B 1LE5B 5F3HB 2ZF8A 3D50A 2C3HA 5IW1B 3P4NA 4B53A 3K1DA 4UZUA 3VGEA 2DWDA 1FVDB 1DBKL 3QEUA 3RVTC 4ZMVA 4Y9CA 2OL3L 5GJSL 4YXKH 1P2CB 4JJHA 1FGVH 5KN5B 1AS8A 1M7DA 2XQBH 4WY7L 1GAFL 5E6ID 5E6SB 4TNVK 3V9EA 1HXKA 3VFGL 5TH2A 3VVVA 5A3IC 4UV4H 2B39A 3HLAA 3IM1A 3H6JA 5C09B 3HG3A 4YL9A 1BX2A 1TDQA 3SSGA 2Z4TA 1JNJA 1U8MA 1MFNA 2ZXGA 3WFCH 2QLYA 3WTWA 4K3GA 4XP1H 3C2AH 3HZKA 2X4NA 3HN5A 5DLMH 1IILE 1N64L 4G8IB 2OI9B 4BQ9A 1N70A 1PDKA 4N8PA 3CQPA 5D7JD 4XCCH 3VTAA 1NFDF 5I1CH 1KT2A 2UXGA 4KMTH 1R0AL 5IG7A 1CR9H 2YUXA 4JO1H 1VACB 3ZKMD 4B9FA 4D8OA 5GGTH 3GXUB 1SUHA 3UPRA 1BFVH 3RIFK 1G9NC 4JFZH 3PGDB 2R4RL 1AFVL 3CE1A 1FG2B 4W68A 1LP9B 4J3OF 5GJTL 1LO2L 3F84A 3T09A 1OB1B 3VI3F 3O4OC 3WE1A 2FT6A 5D7SH 1YZZA 1X5HA 2OAAA 4NENB 3D2UB 3L1EA 1KUMA 5IR1A 4QT5A 3SQOL 2OJ1A 4PJCE 1IGYB 4BJLA 1AIFB 3UBFA 3SDAC 2B5IB 1VCAA 1CGSH 3ARBA 4FA7B 3UTSA 4F3FA 1H15B 1OCWL 5DHXB 1FDLH 1I1RA 4PJAB 5CZKA 4AT6A 4HC1L 1E28A 4X6BB 4LCYB 4UTCA 4X7EC 1KB5H 4G72B 3BSZL 4FQLH 2EKSB 2Z35A 4NQTA 4Y19A 5AD0B 5D6DA 5GSVB 2XWTB 3ECBB 3SJVE 4LF3A 2Q3ZA 3K81A 1Q4NX 2X4UA 4X4ZA 3VQLA 5I5RA 3PWJA 4Y2DD 2NXZD 3C9NB 1IFHL 1QFPA 2PR4H 4J2QA 1KGCD 5BO0D 3MNZB 4KRNA 1IIKA 4TLSA 5HYSG 3WY2A 3VXUE 3TGXA 4FQIL 3SKJH 4MA8H 1TU2A 3IDGA 1GC1L 2OM5A 5I15L 2QKSA 3ZDWA 3QPQC 4FABH 1PU0A 5FFOA 2P5WE 3O2DA 2LW3A 3DA0A 2VDLH 4Y5VA 4GUOA 5EEWA 4GBXB 4N2GA 4ACPA 1DE4B 5MENE 2NY6B 4ZODA 3TFKC 3ZQXA 1NPUA 1YA5A 1IL1A 2EYTA 3RVXC 5FA4B 2NNCA 5I24A 4JG5A 3HAEB 2D0GA 1J5OL 1IVLA 4QTIL 5DRZB 3MUGB 2Y6SC 1DVFA 1GS7A 2Q3AA 3OG6B 4HJUA 1IC4L 4G8GA 1GIGH 4DFHA 3S8GB 1AD9B 3CVHA 3K8LA 4OI9A 3HFML 3NA9H 4F93B 4YZFF 5HHOD 4AQZA 5FDWA 2BNRD 3A23A 3UTZB 4CW1A 4P2QE 2CWRA 1Z2KA 2X9XA 2ARJA 4R4FH 3FT4A 3E38A 2OJEB 4HALA 4QTHB 1KYDA 1N19A 2PCFA 3RGHA 1CYGA 5B1CA 1H0DA 3OJMB 3TJEH 3OKYA 4EZKA 1Z5LB 3UG3A 3MBWA 3AUWB 3C5ZD 5CINL 3NCYS 1FNFA 4HLZH 3VVWA 5BQ7B 5E8NB 2GHWB 3UBXG 5I71B 1R5VA 2R2CA 4XAKD 1TQWA 2R69A 1ULVA 3GI9L 4AX3A 3GEFA 2FDBP 5CCGE 3TBTA 2YOAA 2W81C 1BVZA 1G9ML 1E9OB 5I0VA 1BD2D 4Y7MA 1IGJB 5EU6A 3FN0L 4ODSH 4Y2NA 5GXBB 1NFIB 3TO4B 2OL3H 5EUKB 4WGWB 3QXWA 4EI6B 1SXNA 3ILEA 3ML9A 2FT8A 2PO6C 4YSSA 1JFHA 2ED8A 4MD4B 2DBJA 4KUCD 4AV4A 3QEHA 5E23A 3AXLB 3RNQA 5AYQA 5FOJA 4OZ4B 1J9TA 3CLFL 3P9LA 1GCFA 1XCQA 4C47A 1TZGH 3OGCA 1IC7L 2PW1A 4OGZA 1VSCA 4FTVD 1FYTB 2ZXDA 4ECNA 1N64H 1PZ3A 2GKIA 2VABB 1FRGL 1THCA 3P3UA 1KWKA 4XVSL 4LHJB 4S1DD 4I9WE 1Y6MR 1ADQA 1R0AH 4OF5A 1RIUH 1P5UA 3ZE0B 5HVHB 4AENA 5ES4B 4HWZB 3ULUL 1Y6NR 1PBYA 3FB5A 3NK4A 3OJDB 4L9DA 4A2LA 3MLPA 4QRFA 5T1LB 4FQCH 3TPKA 7FABL 1ET8A 1HH6B 2R4RH 3BGAA 1AFVH 4H2CA 4MDJB 1JNHA 1BVNP 1F8TL 1FVDA 1MVFA 1W72B 2EIMB 1U92B 2X89D 3BGFB 4M5YL 2D4FA 3AUVA 5GJTH 3UAJD 4F9LA 3IE9A 4ODVL 4RMTA 1CXFA 1CLYH 3DIDA 1HIMH 2LQRA 3NP3A 1IARB 5D1QE 5EPMB 1AO7D 5ITBL 5KN5A 1G7IB 4GQPH 3CVIL 3VXOB 3HE7C 1FNGA 4LRNL 1XGRB 2A1WL 3AWGA 2YRLA 3GJFK 4IKNA 3B7UX 3RWDB 4RAHA 1JK9A 1I8KB 1CO1A 3F7QA 1A4AA 2E9BA 2WHVA 1AOZA 1NANI 2E7HA 2NY2B 3W9DB 1S7TA 1BZQK 1OCWH 1V3LA 4YX2L 1B2WL 5JZ7C 4A68A 4UTAL 3K7UA 3MRLB 1AOHA 1NBQA 4G8IA 3BC9A 3RL2B 3BSZH 1KCBA 4HBCL 4OLYL 3TBBA 4ZW8A 2X6UA 4JFFD 4JKWA 3VXQA 2VITA 2WUBH 1ACCA 4OJFL 1MF2H 1UJTA 1BZ8A 2ENYA 1L9OA 4WIQA 1VACA 2CIIB 3NIFF 1EXUA 4RGND 3SOTA 1IFHH 5A2FA 3AVEA 1LLAA 3G5YB 3HHMA 1KGCE 2FQGA 4K9EC 3LMJL 1WAAF 3PDOB 4U1MB 2IH3B 1FG2A 2OX5A 3JWOH 1LP9A 4FQIH 4DK3A 1FZKA 1L3NA 4F24A 3UGEA 3RHWF 5IK3B 4UDUA 1FVCB 2O26U 5J6SA 5FR3A 4XMXA 5CUSH 3W2DH 5GGTA 5CSBA 4AVKA 5CJOH 2EADA 2VN7A 3DDFA 4WWKA 1LO0L 8PAZA 1M6OA 3GQFA 1IC4H 1SDDB 2CA4A 5GS2H 4H8VA 2B1AL 5B8CC 1AZBA 3HFMH 4PJAA 4Q2ZA 1J5IA 4XH2B 1CQKA 3KS0H 3BZEA 3ZL1A 4Z3FA 1E27B 2EKSA 4GMSL 5MEPB 1DL7L 1N2RB 1T3FB 2ZOKB 1OPGL 4BFFA 3GUTB 1T7YA 4CMMB 5KS9A 3QJXA 2DH3A 3GMOA 1JNLH 1IC5L 2NY3D 3BUPA 4K7FA 5IIEA 3MNVB 2ODIA 3C9NA 4P4KA 3IE4A 4ZFOL 3QUXD 5TJWK 5I2IB 4Y16B 1TJGL 3NP4A 2HA1A 3O41A 4MXWL 4MB3A 3LD8C 4GIOA 4CN1A 1KB5A 4RAVA 1QAWA 1ZLWH 4XAKE 3VXRA 2HX8A 1RURL 1JPSH 3CBRA 3CG8A 2GI0A 1WZLA 3G5ZB 2VAAA 1YN6A 3E6FB 4W9HC 1QSFB 4PREB 4XVJL 2VDML 2GC4C 1G9MH 5DEJA 3SKUD 4YHZL 4JHZA 2EIEA 1BD2E 4IMLB 2IDUA 3QDJA 5SWZD 4PRDB 2PXYD 1KGJA 1CFBA 4PRAB 4P8QA 5F1NA 1XF4A 3L1FA 1Q94A 2X0WA 3BH9B 4PGZA 7PCYA 5ELIA 1IBYA 1AD9A 3SPVA 4MNGB 1I4FA 3HHSB 3NSYA 3JV4B 3L4WA 4ZOAA 2ICEB 4KXAA 4XAWL 3WFEH 3OM3B 4FTVE 4PJ8B 2CBPA 4W1TA 3ZU8A 1AG6A 2G5BB 1HQRA 1P4IH 2APBA 4ATTA 4QTHA 1FNSL 3O3EB 3NZSA 3DO7B 2NNRA 3H9ZA 2VDPB 3D34A 8CGTA 1U3HB 4XVSH 4BCXA 2IH8A 3WG7B 1INDH 1JD9A 4M6OL 5LGYA 2FGZA 4AYBA 1RZJL 5E2TL 1TO4A 3IJ9A 3WFZA 1ETZB 3RVUD 4I0KA 3SQBA 4IOSA 2Y5TB 5D6DC 3RDTD 4U3SB 5DUBA 2OR7A 3BPCA 3O3DB 4N2CA 4WHTB 5C08B 4ETYA 3ABMB 1F8TH 1KYOK 1F56A 2IG2L 2X41A 3D4YA 4CDHA 4HOWA 5IFHH 3PDGA 1GGTA 1IGJA 1R75A 1INQB 3C6EA 5B4MD 2F74A 5MI0B 4RGOL 1C1EH 3OAZH 2O61B 1AO7E 5EO1B 1CFQB 5ITBH 3DKHA 1HWHB 2XTJD 3CVIH 5LWYH 1NGXB 12E8L 3PPEA 1S7XB 3KGRA 4XNAA 4GSDL 2AGJH 3V4VB 3KLLA 4Y5VC 4LSUL 4F7KA 3PL6C 4A66A 2WZ5A 1BF8A 3APCA 5AYTA 2YPVH 1D9KB 2BOCA 2OL3A 5KSBE 2FH6A 3NABL 3ZYIA 4AIEA 4YX2H 1B2WH 4V1DA 4UTAH 1O0VA 3IJEA 4KY2A 2VR7A 5KANG 5H94B 4JFFE 4OJFH 2LU3A 2VERN 1MHHB 2W65B 4N2LA 1QRNB 2X1PA 1AC0A 1VZGA 1NSNH 4I2XE 3OXSA 3LXUX 1DUYA 3MV8E 1QLRB 1HH6A 3LMJH 3BZDA 4MDJA 5I5MA 2A5UA 4KPHL 2DQMA 3QJZA 4PYGA 3U4KA 2BSTB 3HRZB 3E8UL 3MRJA 4LBAA 4F15B 3BP6A 3KR3L 1CE1H 5F7MC 1L5GA 3CMGA 2YZ1A 3NJIA 1G7IA 2YGOA 1JI1A 2BVUA 1T20B 2DLIA 2Y06L 2VZOA 3IKCA 3NH7H 5D2NC 5EN2A 3S3SA 1XGRA 2B20A 3SCMB 4MD5B 2WLIA 1MCFA 1OAKL 3UP1A 1KPRB 5DZ9A 3RWDA 4AXWA 4KHTH 4ZMTA 3FFDA 3VO0A 2D8KA 4JM2B 3WMSA 1LO0H 2J8UE 3F3HA 2RB8A 4IMKA 5IVXE 4Y9FA 1QABA 2W94A 4I85A 5CZVL 1NOLA 2O72A 1IO4C 2LOEA 3L4VA 3W9DA 3WJJA 2GY7B 3QQNA 4F5CE 3QDMB 4WV1C 2WCGA 1FJ1B 4UOQA 5B1KA 2HKFH 3RL2A 4W9FC 4P48A 1DL7H 2WXIA 4QOKD 4YHKH 1COBA 4LSDA 1U8NB 1JZ7A 1DSYA 3GXFA 1K6QL 1VEOA 1VLXA 2FSEA 5HDBB 1IGMH 1J8HB 1QSED 1JXKA 2ENQA 1BVKA 3G5YA 3KYKH 4N5EC 1TJGH 3EFOB 3DX4A 1J8KA 1UQSA 1SLVA 4HC1A 4PG9A 5D5MF 2VUOA 1WGOA 1A65A 3BSZA 3LVEA 4GJTB 4U6YA 4BFKA 1AXSB 3JWNE 5DUPH 2PW2B 1E4JA 3LN4A 1ZT7A 4XE5B 1KJVB 3LN9A 4XVJH 2VDMH 5F88B 1VFAB 1YUHB 2J5LB 3OKKB 4YHZH 1IM3D 3AREC 2QQLH 3OLDA 5SWZE 2QADB 5CLYA 8FABB 1CGTA 3EGXA 3MV7D 3P2BA 4R2GC 3STBA 4EIBA 1HU8A 3F12B 4G6AD 3UO1H 2J5WA 3F7VA 4PIRF 5BW7A 1EBAA 4XH2A 1MOEA 2BS9A 4YSEA 3V0DA 2FR4B 3VGFA 2Z34A 2IGFL 1KOAA 4OGYL 4JCWA 4XN2A 4S0TD 1Y1UA 1CTOA 1FG9C 1X5FA 1U8HB 3DYOA 3FU6A 4O58L 2ZUQC 2J71A 5F9AC 4LSQL 1Z9SA 4NIKB 4OLZH 3KYOB 4M6OH 3DOSA 3NVQA 3VACA 3WNLA 3FS9A 1RZJH 1MWOA 3NTCH 4NSKA 3TBCA 2BNQB 5HYQB 2VL4A 3TZVC 4B3EA 5BV7L 4G7YL 4YSQA 2A9AA 3JQOB 5HJ3B 2WKOA 5KTEH 3E6FA 1F4WL 4UU9B 3MNDA 2OSLA 1I82A 3LKQB 4XP5L 3IMRA 3TVMB 3EJZD 1FNEB 2E74C 3QIUA 4KUZL 1O6VA 2FGWH 4YQXH 3GSNL 2QDWA 4RGOH 2V8MA 4WU7A 4GKZA 4XCNB 1AAJA 2XTJE 4FRWA 1OPOA 1O6SB 3CX2A 4HIQA 2FATH 4ELMF 1E4HA 1MY5A 4CSPA 2CH8A 3HHSA 3QO1B 2G9HB 4JO5A 4FERA 3GSRB 1U8JA 2HYMA 3NCJH 3QULB 3ZUCA 2OXHB 3RJDA 4GIAA 4JRFA 2R1XB 4OKDA 4Q7DA 3VSVA 2X42A 4ODBD 3NABH 2KLRA 4JANB 4QRPB 4WO4B 3QJFA 4MJ4A 4WWKC 3O3EA 1W0VB 3GNML 4PRHB 2MQGA 4JDZA 1U3HA 4PJFA 3IJ7A 1UZGA 2OULB 5GISL 4X80H 3BQUC 4P46C 2XWZA 3PAYA 1F4YL 4U2YA 2D4DA 4R7NB 2QR0B 2NY1D 1QSZA 4R3SB 5ABDE 1SJHA 4HMDA 1KYFA 4WFEE 5E2WH 3N6YA 5HHVL 4U3SA 4XOEA 4KPHH 4L29B 4LP4A 3WI9A 4NRXA 4DGYL 3ARBD 1OE3A 1BYNA 3E8UH 2W07B 4K3EL 2IADA 4H1LG 3KR3H 2A3TA 2RMNA 2V2WB 5EO1A 4LNRA 4KTEL 1ACYL 1J18A 2NSXA 4GG8A 1B9ZA 3U46B 4Y19D 1OAKH 4M8QA 1S9WA 1YYML 1YC7A 2ALWA 4OJEH 1J9QA 3D39D 5JIIA 4MCMA 2PPCA 4IBZA 4GRWB 3RHWK 3MLTB 5LGHH 4LHQB 2GJ6A 1WFNA 2LU7A 4D3CL 5I75C 2W0KA 4NKQB 3O6FA 2H26A 4X9HA 2PYEA 4NB7A 3FSOA 4KKAC 2W65A 1K6QH 3BUYB 4X98A 1ONQB 4ALAC 4CA4A 2BDNL 5LAXA 4GQRA 4L4JA 5B22A 1QSEE 4A67A 4HIIB 2YPVA 1WS7A 1EZVY 1Z5HA 1QLRA 3IGFA 3QQ9C 4Z7NE 4UTAA 1R3JB 1T0OA 2XN9A 3B83A 3V9FA 2AQRA 3NIGE 2VIRB 4WHDA 3RUGE 4MNHA 3RX5A 2V9RA 4DAGL 4RAUA 4KMLB 3QPKA 3SCMA 4LLUB 3X1EA 2X1WL 3DJZA 2OYLA 1KPRA 1J87A 1MLBB 3HTLX 1SOSA 2VDQL 3MV7E 4O02L 4UQ3B 2YAOA 1MFDL 3RTQD 3RWHB 1NC4D 1KIRB 4HP5A 5GS1C 1G7QB 1KTKE 3H4HA 3X13B 4KXZH 2ZCHL 3SY0A 3S9DB 4FXKC 4LCCB 3VI3E 2JCCB 3CFDA 3OGOE 4OGYH 4YHOH 5E9DA 4OF0A 3DYPA 2YQBA 3PF2A 5DS8A 2NY4B 3ULVF 4JKLA 1UH3A 2J3SA 3L9RB 5L4FA 2BVEA 1DSWA 2CGZA 5EU6D 5F3BA 5IB4B 1MDAA 1AYRA 3T0ED 2A38A 4P57A 3VB9A 3RBGA 1IE5A 4DEPC 2JKNA 4FFTA 1AHWB 2DPKA 1QFWL 2ESVA 4HD5A 4MWFA 4NZTH 5K93A 5K1NA 2EO9A 3TA4D 5BV7H 1XEUA 5T1MB 3B7SA 5JQ6L 5IGXH 2EZ0D 2W5PA 5F88A 3OKKA 5GRYA 5JR1H 3N1FC 1FLRL 3KHQA 4GH7B 1JZFA 2UY7A 4XP5H 3WUWG 1GZHC 1PZBA 4KUZH 3QUHA 4ZFOA 2Q8BL 3WKPA 4A7SA 4NO5A 3EO9L 3FQNA 4UAOB 1K4DB 2HMIC 2B9AA 1KGUA 1U33A 2DM2A 2F15A 5A2JH 1B0RB 1PGRB 3WOVA 3O6KL 1AHKA 3EO0B 4DCQA 1GSKA 4NRZB 2F7IA 5IWLC 1A3QA 1XXFC 2GBVA 1P5VA 3BT0A 4NBZB 5JPMB 1W0YT 4KAQH 2H32B 3LDBB 2YXVA 3EH1A 3ASOB 4Q52A 2WVVA 1MQKL 4FP8H 2F54B 2F53B 4H8WL 3GNMH 1U8HA 2ITCB 3SE3C 1UWXH 3VFWA 4XXWA 1CGXA 4HEMA 4A2EA 3KYOA 5GISH 3O9WC 4O9HL 3WJJC 2ZYIA 4PPTA 1LK3L 5FECA 3OLGA 4BELD 4JVPA 4G6KL 2FVNA 1JG9A 1NMAH 3RWIA 5HJ3A 2O6EA 4UU9A 1T21B 2VN3A 1MFCL 4L3EB 5C09D 3BPOB 1VA9A 3LB6C 2QELA 3L6FA 3VD5A 3U2IA 2NXYB 2I85A 1XGQB 1CICB 3Q6FA 4XCNA 3PREA 5DO2D 1G87A 4G9DA 4X6EB 4K8RH 3HC4H 4L9LB 2J1YA 1BPLB 3KNBB 4N8VB 3L08A 3O0RH 2Y9RT 1ZXQA 3FCTA 1YYMH 4ABUA 1NJ9B 3QZWB 3T04D 2WZPA 2G9HA 4ZMNA 3D39E 1WRFA 1NCWL 3DO3A 3EG9A 4HFUL 5KVFL 3QNYB 3DX1A 3QUYB 4KDTA 3FO2B 3KPTA 2DL2A 2VJ8A 3HS0B 1NBZB 1E6JH 4TF4A 4D3CH 2R1XA 4NHUB 3JWOC 3R7QA 2A4CA 5FGSA 4YHYB 2R1WA 4PY8I 1W0VA 4R5XA 3RKDC 4PRHA 2E76C 5D1ZB 2FEEI 4UQCA 2D3JA 2QL1A 1KB9J 4KO7A 3Q8CA 1DJWA 3EFFB 3D2UD 1C8QA 2EE6A 3FTZA 1EFQA 4L1DA 3VH8B 2FAUA 1R6VA 5LBSL 3S97C 2OTWA 4Z77B 4AYEC 5J12B 1L0YA 4ZPVB 1CIUA 1YLBB 4K94L 4JY5H 4CU7A 4XHJD 5I1GL 1QWNA 4P5RA 25C8H 5D7HA 4BSVB 1URIA 3RI5F 4F8PA 2NR6A 3N42B 3JWNH 3D3VA 2ZOLB 5FFLA 5TDPB 1IE4A 3T77B 3L2MA 3DIVA 1PD1A 1OTUC 5EN3A 2EIZA 3VFUB 1A02N 1AE6L 3HE6B 3WNJA 3FRPB 4KJPC 4DTGL 1MVUA 1OP4A 4O02H 5HDOA 2OV0A 3F8UB 4HIPA 1MFDH 5A16B 4QXGL 1MUJB 3LEXB 1K4CB 3EJQA 1ZS8A 2ZCHH 3GJFH 4P9MH 4IIQB 2V5MA 4KQ4L 4PJDE 3VXRD 4NP9A 3HMXH 2W80C 4L18A 3BUYA 2VDQB 3HN3A 5EOQL 32C2A 3QWQB 4XZ4A 1MI5A 2J1ZA 4YGVA 5DZJA 4ZUSB 3W11D 2PYFB 4HIIA 4J1UB 4KRPC 5GZNA 3VFPB 2NY6D 2BVQA 4QJ5B 3QDJD 5EU6E 1HHIB 3T0EE 2EXYC 4NO2B 3S5LA 1ZGLP 1PLCA 2G5UA 3TYGL 5I1HL 3CH8A 3M7OA 3MCKB 2C7UA 1JHLL 3QC5X 3IDYC 1BJ1H 4UT7L 5DDHB 3JT0A 4Z7UB 5KVEH 5HHMB 1FLRH 5H2BA 3X12A 5DU7A 4CMHB 1EZSA 3GEWB 2EJ1A 2QGBA 4XC1L 2V5RA 3EO9H 5BS0B 1ZLSL 5I0YA 1TTRA 1UOKA 1TT6A 3NIFE 3WMQA 2LLNA 3FFCB 4TVUA 3UC2A 3O6KH 3PP4H 2I9LB 1NUDA 4KK5D 3ECWA 1HZHL 3X13A 4LCCA 2GFBA 4LPXA 3C60A 5DFWH 4KRMB 2JCCA 3KBHE 2VM9A 1DJXA 1KJMB 2HT2D 3ARUA 4H8WH 2X87A 2ZXAA 1Z32X 3EJJX 3EOAB 3O6LL 3CPLB 5K9OA 4PWKA 4L3AA 3MLSH 4ZYKB 4O9HH 3TO4D 4W9CC 1IEAB 1YPZF 3P02A 5D2LA 2X09A 5KYUB 1D7DA 4HSQA 3QORB 2K3TA 3V0WL 2NW3B 5CSGA 3TNNA 2COQA 3V0HA 4M1CD 4B3VA 3QUGA 1YEDA 5C09E 1XF5A 3H2WA 3M7FB 3P0VH 4POZD 3OPZL 3QZPA 1FYTD 4BK5C 3D2TA 2BJMH 5IMMA 5K33A 3TO2B 1K4DA 4QMEA 2FX8L 3MLWL 4YPGA 4HT1L 5DRNB 4ZSOB 4FAAB 3ZKNC 2BH0A 4ELKB 4FFVC 1NCWH 5DJYA 3EDEA 1FYHB 4M7JL 3BP4B 2YBRB 2ZG1A 3GSNA 3WLBB 2NX5A 3FUNA 3DVNA 2J7LA 3DX8A 4WEEA 3BVVA 2I25N 2X3AA 4MQ7B 1GZQB 1LP9E 1OV8A 3GHEH 2ITCA 5BRZA 1A8ZA 1A6PA 2AK4B 4JKNA 4XMZA 1PCSA 5GIRB 1HSBA 2K78A 3IDXL 2WCPA 4NO3A 1QI3A 4F7MA 3IJ8A 2VISA 3WEMA 5I0ZA 2RH0A 2A2QT 4G7VL 1DBBH 1NGQL 4PJIA 5DD1L 4ADIA 2FUQA 4DH2A 3IDMB 5CR1A 2JJSA 5LBSH 4ZUUB 5CJQL 4K4KA 4U1IA 3M07A 5IEKB 4Z78A 4K94H 4RSVA 1IGTB 3RNKB 3ESUF 4NKIH 4HG4K 3EDJA 2WBKA 1T21A 1DUZA 3UCQA 5E2VL 3HHRB 3HPJB 1XT5A 1CICA 2NY2D 3NJKA 3A47A 5EFIA 4M1DH 1JPTL 1A6AB 4N9GB 3ZTJG 5F7NC 1PZ5A 1NJ9A 2ZT9C 3WCYA 1ZLUK 4LLMB 3QAZB 4DTGH 3OJVC 4XPAL 3ZYZA 2YKKA 3RY5A 2CBQA 2HB0A 4QXGH 5FLUA 4OV5B 3O4LA 2QPDB 1CD9B 2ZUVA 3KYMB 4YSTA 3AB0C 4GG6B 1OTSD 1R5IB 1BQHA 3N1PC 4J3OH 5D1ZA 4TTDC 1PS3A 4OZGB 2DN7A 4XP9H 3EFFA 5EOQH 3RGBA 3ETBF 3AS1A 1RU9H 3S34L 1Q9WB 1DJGA 2J55A 5AOJA 5HVFB 4HS6A 1XGTA 2EH8L 2Y3AA 2ZUSA 2BK8A 3NPSC 1Y7VA 3P2DA 4Y5YC 4ZPVA 4ZUVA 3LKSA 1L9RA 4H8PA 3SE9H 4AVHA 1RZPA 2CNYA 3BUQA 1ECYA 5E6IC 5EB9A 1QFWM 1HNFA 2H3NB 1JHLH 3S2AA 2QGDA 2Y4SA 4MZ2A 1H3PH 2VDRL 5ESAA 2ICWA 1ZA6A 3NJJA 5CJXC 2ZOLA 3SKNA 1TLKA 5TDPA 2L7JA 1F3DH 1A9BA 5FK9A 1TZOA 1BQLL 4NC1E 3HE6A 2VTFA 3MLVL 4JREC 1GKEA 4XNXL 2GITB 5D4JA 5C0DA 4N90E 3P30L 4H13C 4OT1L 5A16A 4JG0L 4Y16D 2C1PB 3VFTA 1HZHH 3IETB 5ALBH 1YEJL 2A7BA 4UMGA 3MA7B 4DERA 1JL8A 4G7QB 5F21B 5IT2H 4IIQA 2EP6A 3T4YB 3L3GB 5EZLB 3TJHD 3V0EA 3QJSB 5T33L 5BUGA 3MNMA 3HNSL 1WFIA 3TNMA 3DVFA 1QSFD 4O02A 3ESNA 3S36L 4ZUSA 4BE6A 3NMEA 4AQAB 1ZTMA 5I1IL 4JHWL 3VFPA 3QFDA 3TIDB 3QFGA 3QIUD 4WCYL 1MNUH 1NMBL 2XIIA 2Z93A 5D1QC 3GJFA 2AQTA 1N18A 4ZUWA 1I7RA 1N4XL 1RZQA 3SPIA 3OZ9L 4WKZA 3T4AA 3V0WH 1M1XB 4ERSL 4IJ3B 4MTMA 4P5MB 1TJXA 2KPNA 1UC6A 5DDHA 4EIGB 3GO1H 3IMSA 4Z7UA 3NJNA 4ZI8A 2OS7A 1E9QB 4LNVA 4DO5A 4JFWA 1M3JA 1EZVX 3L3IB 3OPZH 3MLXH 1FYTE 3CD4A 3QC6X 5LNDA 5BMFL 2Z3FA 2K45A 4X7CC 1E3ZA 4OM1L 3DK2A 3T71A 5CEZD 1X7QA 4X6CB 3L81A 2E6PA 3UTQA 1U3HD 2I9LA 1B6UA 4KKNA 1H6UA 2YC1B 5C70A 3N5AA 3GZQA 1YEGL 1NUFA 2XZQH 4R7DB 1RPUA 1PFCA 3ZE0E 1DQQA 2WP3T 4Y2DC 2ZCLL 4PRPB 1ID5I 2V37A 3E2HC 3IPEA 3WUZA 3CFCH 2VMFA 4RMUA 4U6TA 5JPNA 2GTQA 3ROOB 3NQIA 5CLZA 3UX9B 5DC9B 3OJ2C 2PWEA 5F9WC 5AG9A 2UZPA 3CIQA 1T5KA 2FK9A 4ZYKA 2FYYB 2IBZY 2AJYL 2XJLA 3KYNB 1N5YL 4HJTA 1NGQH 3M8OH 5DD1H 4DPCX 5DD3H 3ULUD 1GW0A 1NWPA 4G1EB 2WYTA 1PIFA 4L2LA 1JHKL 4MJHA 2Y23A 4F1SA 5BOPA 3PWVA 4L1HA 4ACTA 4WW2C 1ML0A 4OZIB 3CFJB 1SJMA 1B4JL 3W0WB 4Y1AB 3MOAH 3QXVA 4LSTL 1D9KD 2FO4A 3QUZC 5KBMA 4EN3A 2CUHA 4PB9H 2PYED 4HUUB 2ZCKL 3JTSA 5DRNA 3EW3B 3L9EA 1NCAL 4QKTA 3FONB 3EYSL 4Z7WB 5TFSL 4OVUA 1U41A 5C0BB 1PG7L 4AVIA 1Z9OA 1QRND 2WXFA 3UG5A 4MXVF 2AQ2A 2LHAA 1ZA3B 2YBRA 4JPWL 2EICA 4FLHA 3B2MA 4MQ7A 4JY6B 1GZQA 4TOYL 3ES6A 4M4RA 1JGIA 3MBEC 1A9VA 3JV6B 2XN9D 2DI7A 5H37H 4BKTC 2HLAB 2WSPA 2E27H 1KN4L 4XPBL 5AVYB 4F37K 2EDTA 1NBYA 5DJXB 2Y1VA 3FU3A 2EH8H 3SCMD 2IF7A 4YC2B 1U91A 2ERJB 1DBML 3ISYA 4MNQB 2VB5A 4JM2D 1E2ZA 5E5MA 1NAMH 5HVWA 2YPKB 5CLWA 1E6OL 2H0JA 2VDRH 3U9WA 5DD6A 3TWCL 3QDMD 3FQWA 5LBSA 4IBVA 2WQ8A 3EDFA 5ESVB 1A6AA 4QYAA 5DQJA 1BQLH 5CR8A 1K5WA 4K2UL 1E65A 1UURA 2D2CC 1K8DA 5HD8C 5GSRB 1X6LA 2WK2A 1OAJA 3D69A 3MJ8B 1J8HD 3P30H 1MLCB 4OT1H 4ZT1A 4ETQB 4BK4A 4JG0H 4DKDC 3KYMA 4W9ZA 2BOBA 4JQVC 1YEJH 1Z1WA 2XPZA 4KMQA 1R5IA 2C9RA 1J8RA 2EDKA 2H2SD 2XWCA 4NLAA 5DLLA 5T33H 4PY7A 3N41F 5DZNA 1LK2A 3HNSH 4LLVA 1NKOA 5EA0H 1NFDA 1QSFE 3T0XA 1C12B 1S9VA 3UAJC 1Q9WA 1Q38A 3BQVA 5I1IH 4JHWH 3RAJH 3T9WA 4F2FA 1T1XA 2NRDA 4WCYH 3ROLA 1ILSA 1NBCA 3X3FH 2ADFH 4AKOA 2QADD 3HC2A 3C5XA 1XH3B 1SN2A 3K2KA 1N4XH 1YMMA 4NNYB 2BVPB 3N40P 4H0IA 5J1AB 1Q9LB 5E2UL 3KWXA 1FZJB 2BMKB 4MNGE 4F2EA 4MMXB 1L0QA 5HI4C 4U4IA 2JJSC 2WLHA 1MIML 4AK2A 4CC4A 1WFOA 2HJLB 3TBVB 2K1MA 5BMFH 2Z7YA 5GGSA 5C86A 4OM1H 2AABH 1LO4H 5CEZE 3NCCB 4XNYL 4E5XB 3D18B 4JHUA 3CDFA 5DWUL 4HETA 2JKWA 3WNKA 2GSMB 3HJEA 4XOAA 1A9EA 3WEAA 2C1PA 3C8DA 1YEGH 3BKYL 3EJYC 2DWEA 3IETA 5I1KL 2B4CL 2CK2A 2YD9A 3MRIA 2BNQD 3L3GA 1KCSL 2ZCLH 4HK3J 3NESA 5I30H 1KLFA 5F0JB 4AEEA 3L7FA 5TGBA 5C0GB 5C08E 4MAZA 3DGCR 1JZ4A 1TZHB 2AJZB 1U42A 3NFPA 4QPEA 5F7UA 1EHLL 3TIDA 3TVMD 5DD0H 1LHZA 4YVNA 4FQXC 4EAEA 2X2UA 1RJYB 5J6HA 1HYSD 4K8RC 3ILPA 1N5YH 1HILB 5AZEH 3VD3A 1NCJA 4NN7B 1HHHB 2GTZA 3QAQA 3ZYOA 1KG0B 1U6AL 2JIXB 4WI8A 1QA9B 2UZYA 5INCB 1WF5A 2GEEA 3KPNB 4X9FA 3PHOA 3L3IA 4GOSA 5IKCA 1VF5C 4MAYA 1T1YA 5FGBC 2F8VA 3KXFA 4QRPD 4WO4D 2R29H 3RU8H 2GSIA 2ZCKH 5HY9B 4IRJB 4PRHD 4ZMPA 3FU0A 1CUOA 3QWRA 1RVFH 3SZKC 1XZ0B 5TFSH 5FDYA 3BDBA 1PG7H 5E08H 1DQIA 4XCYA 3MJ6A 1QRNE 4GT0A 1LEGA 5HHPB 1RLBA 4F8OA 3N0PB 3QUKA 1LTXA 1P7BA 2EDYA 3CFTA 3DMMC 3JXAA 3QUXC 4M03A 2Q7YB 4RNRA 4AYDC 2WPGA 4I89A 2OMUB 2WXNA 3CFEA 4HV8B 4TOYH 2IDSA 5LGKA 1G1OA 4KI5D 4HLZG 3JWNC 2NR6D 1JWSA 3OLIA 1BAFH 1UENA 5I6XB 1AANA 3TURA 4Z8FL 2L7QA 3FBKA 5FEBA 3U9UB 5MP6L 4MLSA 2C4FT 2XG5B 5F7BA 4UIMB 3PGCB 2PXYC 4K73A 2E8ZA 2IWGA 3SBRA 4LL9A 5KSUB 3O3AB 3CHQA 2HJFA 2R0KL 3BRFA 4IJTA 2VR8A 1CDYA 2VQTA 2ZQKA 4FMVA 5EOCL 3TONA 1E6OH 5IHZA 4KZDL 5DTFA 1M2VB 3EUUA 4KOCA 3QDME 3TIEB 1IKOP 3FRUB 2XXFA 1KDIA 4OZHB 4LSPL 3CDGA 3N85H 2YFNA 5FOBB 3TCLA 4Q9CA 5CGYD 3OHXB 5ADPH 3FU8A 4K2UH 1HKFA 2BS71 2EUVA 3Q8AA 4Y9EA 4A39A 3LQAL 3VXMB 4WDIB 5HDBE 3MACL 1J8HE 4V11A 5AAMA 3ZJAA 4DN3H 3OKNB 4B9IA 3G7TA 4I87A 4Q58C 4XN1A 1JFQL 3RVUC 1ND0B 1NCOA 2H2PC 4JDEB 3FH5A 3QIWA 2WLJA 1RUAL 4AQ1B 4Z3GA 4XPGH 1QBLL 2HLAA 4EIZC 4NNPH 1S5IL 2HWZL 3CWGA 5IB5B 5LCVL 3RWGB 1YEEH 4JLRB 4FNQA 4AIZA 2FQFA 5JNYA 3DX2A 4G2AA 3FW6A 4RX4D 4FHKA 5B4MC 5E7BA 2JXMA 1A5FL 2XTJC 3AQXA 2ALAA 1H3WM 3GWJA 5E2UH 1N7ML 3NSDA 3BZFB 5KJ4A 1SQ2N 4B9ZA 2AJUH 4F7PB 3VFMB 1LEKB 4IQHA 2CBOA 4OZIF 1KB9K 2DWXA 2YUWA 1EHKB 4PG2C 4IBYA 1YEKL 1BLNB 4PD4J 2NNFA 1QLFA 2Y5QA 5AAWA 1Q9KB 3F6LA 2F5AL 2NY4D 1LNUB 4F7CB 1VZIA 5EZJA 4JN1L 4AQ8C 1KCWA 2HFTA 1N0LB 3RFRA 2F7RA 2X6VA 2JFCA 1RP8A 1VFBB 4U3CA 2B4CH 2A9MH 1KJ2L 3ZRCC 3LKNB 2BNQE 2XPYA 2IALA 4FNLH 3US1A 2BFVL 5IZ7A 3BZ4A 2MPAL 2WLMA 2ZWYA 1EHLH 2WXOA 2JQMA 5IM7B 2WLLA 2MNUA 4DETA 3EXJA 4MJJA 4ABQA 4FC3E 3LEVL 1JF1B 4IYKA 2Y22A 3HI6H 1HT6A 2GC7C 3ZE1F 4XP4L 1C5CL 1NEZG 1BBJB 1OT4A 2CJ3A 4EDXA 1F11A 4Y1TA 3GSWB 2MCAA 5F8RC 1WBXB 1WIUA 5TPWL 1II4E 1PQZB 4Q14A 1OW0A 2ZCZA 3T6QC 4APQC 2F54D 1F13A 2F53D 3H9SB 4QRPE 5FUZL 1DQJB 4OCRL 4NN5C 3ULVL 2DF3A 2ZWNA 1LDSA 1UH4A 3AT0A 5IB3B 4NQEB 4TUJB 1SDAB 3OMNB 4KHXH 4MVBD 3H3PL 1KEML 3LSOB 4LP8A 3CFIC 3CTTA 3MODH 4OTXL 1N59A 4RBPK 3RFZA 1R24B 2FJFA 3ZTNL 3RWCB 2VRKA 1L9NA 3F5WB 2AJZA 3JYBA 4L3ED 3EJSA 1GSMA 1Q0XH 4KI5E 2NXYD 1CICD 1H6EA 4RGMB 4H8UA 2O5ZH 1RJYA 4R7XA 1OVZA 3S5YA 1HILA 3ARFB 4BUQA 4F33B 4Z8FH 1OHZA 2ADIB 2EC9U 1HHHA 5MP6H 1S7QB 3UBGA 3FO0H 4ZX6A 2AP2A 1RZ8A 1MHCB 5C7XL 4NPYB 5FAAA 1DBAL 2VH5L 3OMIB 4E9LA 2CQVA 5INCA 1WYJA 2JELL 3I6KB 1P7KA 3QCVL 1IAKA 4KRLB 5EOCH 5AW0B 1RZ7L 1NDTA 5C07B 5IJCC 4KK6C 4PWHA 3U25A 3AU1B 3BOVA 2CDGA 2HVKA 5D1ZD 2P3YA 3OMAB 1A6WL 3EH4B 1E5CA 4D94A 2HFEB 3UTTA 5DK2B 5TQ2H 3LQAH 4NC0B 3BYTA 3MACH 2XU9A 1EPFA 1KTDA 3A4DA 5CD5D 1XMWA 1WHOA 3MGAA 1X9RA 4LEXL 2D9QB 2Q7YA 15C8L 1JFQH 5IESL 3QJQB 3FNKA 4FDWA 4K07A 3FTXA 1GGIL 4KXZI 4TNGA 5ICXB 2RBLA 1RUAH 5L0QC 2NT1A 3D87B 3JWDC 1QBLH 5I1EL 3QNZB 4N22A 2YD0A 3WTUA 5CEXB 3U9UA 5I82A 4WW1A 4AJ0A 3HE6D 4UQ2A 1UD2A 4BWTA 4LHUG 2ZXCA 2X9ZA 2K9UA 5HHXL 3LNFA 3O3AA 4GQ9L 1W8EA 4WWNA 3G3LA 2IBZX 2OPCA 3BWUF 4Y9GA 1M2VA 3TIEA 2MPVA 3IGUA 4G3YH 3FRUA 3KPPB 3NRPA 4G42A 4UANA 3QXAA 3CN1A 3L9BA 1AKPA 5HYJB 3VA2C 3L4YA 3Q2VA 4FHJA 3L3JA 4HPOL 1MAJA 43C9A 2F5AH 3ZKSD 3K6SB 4N6RB 2R83A 4WDIA 4N9OB 1KTLB 1QYGL 4JN1H 3S3JA 5B1JC 2CK0L 3VFOB 4TQ8A 4H7VA 4U1KB 2R23B 5C0JB 4OGXL 1UB6A 1IV8A 4J6RL 4NUQA 1ZLUH 2Z1KA 4BXSV 1FN4A 3FTYA 3U0PB 2CD0A 3HB3C 3I50H 2BFVH 3QZLA 4AQ1A 2MPAH 4UQAA 4OFPA 3FU9A 3VG9C 3CN2A 4FG6D 1MCIA 3B7TA 4MBOA 3WMPA 4QWWC 2ROXA 3K91A 3N44B 4FNRA 5D7LB 4HXAH 1YG9A 3TV3L 1KJ2B 4J3VA 3GBNL 2WMPB 4M1GL 1WVZA 5IBTL 3VAEA 4N0YL 3REVA 1UXMA 1A6ZA 4JPVL 4XP4H 3II3A 5H8DA 3V4UH 1S8DB 4KX9A 4UQ9A 4D0DA 4J7RA 1EFXB 4F9PC 1BXVA 3CSYB 4PW4A 1ROCA 1T89A 2IPKA 2YQ2A 4W9EC 5TPWH 1JZEA 5GS0L 2E7DA 1YC8A 1IQWL 1TITA 4JGUA 1RMFL 2F54E 3X3GL 2F53E 4Y8DC 3FYEB 1CFSB 4XBEL 2C26A 3AXIA 3INUL 3GK8L 5ETUA 4OCRH 4ZS7L 4HS8L 3ULVH 2B1HL 3MV11 5JMOC 2E59A 4W4OC 1N0LA 2O4EA 4RDQF 3GTTA 5AZ2L 5JDSB 1EAQA 1KEMH 1VEMA 4FNSA 1NGYA 4G43B 4Y4KC 2CHXA 1VDGA 3LKNA 4N24A 4P9HC 4HDIB 3QORD 3LRSB 4AOFA 3QFJA 4F58L 4POUB 4NWUL 4EBQL 4L3EE 4JEGB 2E4TA 3OAUH 4DKFL 5T5NG 1N10A 4PJ7A 4UDTB 5A2CA 2B9BA 4LCUB 4EN3D 4QAWA 1JF1A 5E6YA 1IX2A 5KW9L 1Q9OB 1OQXA 3DK0A 2ICWI 1CFMA 4UUJB 5C0IB 1BBJA 4XB8A 2OP4L 4ZO7A 2OMZB 1DBAH 2R27A 1KJ3L 2VH5H 4CVXA 5L6YL 5E8EB 1I7ZB 1WTGT 1A3ZA 1J9CT 4TUKH 3RTQC 3MFFA 1NCCH 1RZ7H 4RMWA 5D7IF 1RXLA 2NLJA 2OMWA 2IDQA 3ZX1A 3L3KA 2LE9A 2ZKXA 5J1TC 4O2FA 4NKMA 4P23B 4P5TA 3U2SA 3DHMA 2D7QA 5F1IB 2R9HD 1VADA 3U36B 1ET7A 2AK4D 2YN5A 4MA7L 3CXDL 2DRUA 3AGVA 3KLSA 2P8PB 3AG4B 1XEDA 3SYCA 3B9VA 4XT1C 5DUMH 4B97A 4EUPB 4YGAB 1OO2A 3ZIYA 5J13B 4LEXH 1UZ8A 1PF3A 1YECH 3A24A 15C8H 3RWCA 3T0EC 4ENED 2VAJA 1H5BC 1AZCA 5IESH 4QF1B 2BVOA 1JGUH 5I1EH 4KJQD 1PW3A 3ELQA 2VT0A 2H6PB 2EZ0C 1UKTA 1P9MC 4FXGC 1REIA 1S7QA 1ZANH 1AH1A 4KX7A 4R97C 2OQJB 4IU3B 3H85A 3HEIB 4NPYA 5CLTA 5SWQA 3VTTA 4HISA 4KTDL 3ML8A 1H8SA 3P54A 5EDSA 5J56B 1M1SA 4GQ9H 5G4OA 3FQTA 4ZPTA 5BXFB 3FTGB 2WBJA 2X3BA 2AQ3A 3TF7C 1MCWM 2UX6A 5A6IA 3O8XA 5D93B 3QI9B 1QG3A 4YDIL 1J12A 2JB5L 3CIAA 3LQMA 1SJVA 4RZCB 1XR9B 3UJTL 2GJZB 5A2LH 2VC2L 3FN9A 1YQVL 3NDZE 2HFEA 2FJSA 2P44B 4DT2A 3S48A 1ZJBA 4R4ND 1TLMA 1QYGH 1UWGH 5AAPA 1IKFL 2CK0H 1EMTL 1L7TH 4HKBA 4JK0D 3ELAT 3GXIA 4OGXH 2DTSA 4OCYH 2CHDA 4DW2L 2A77H 3P4MA 2LLLA 4J6RH 5G5DA 1HL5A 3IJHB 3SKOB 2N0KA 4JW3A 1LXMA 4HKZA 1LD9B 5CKGA 4JB9H 1TNMA 3FYIB 5I76A 3QNZA 4HOMA 4ADJA 4Z7UE 1MFEL 5HHME 5I8KL 4B7LA 5KSAA 3US0A 5ADOL 2XKNA 3GC3A 2C9UA 5HDLA 1PKOA 3G08B 4X8XA 1AS6A 4X5WA 1EZLA 2Z0UA 5BS0E 4KO6A 4XB7A 3RL1B 3TV3H 4I13B 5IBTH 4M1GH 4DIXA 4MXVE 1FFRA 3BIKB 4N0YH 3OLEA 4X4XA 2EVHA 2QSQA 3OSVA 3FFCE 3ZMEA 2CIKB 5LCVA 3FUIA 3T2NL 4UOW0 4U0RB 4PTTB 4Z7QB 4JFQA 1J88A 3RZCA 1ES0A 2IDCA 2YLHA 1LWRA 1WHPA 3ARGB 3QQDA 3X3GH 5FGRA 1U8CA 1F1GA 2YMXL 3GK8H 1NIDA 2XYBA 3NFNB 4HS8H 4JZNB 2B1HH 4WK0B 3OR7A 4ZS7H 3X1FA 4ZW3A 2G0KA 1E67A 5DR5H 2I7OA 2XV2A 1ACXA 4HU8A 3BAXA 3D0LB 4TMPA 3OKDB 5TDOB 4I0PA 4G8FB 3LKPB 4XHJC 1N8ZB 4NWUH 1E8WA 3BMWA 4EBQH 1A1OA 1AR1B 4AE1A 3UYRH 5KVGE 3MN8A 4DKFH 1YY8A 3ET9F 4GIPD 4MB4A 2YIHA 3FQ4A 3NGBC 3T2OA 2I07B 1WWBX 2J12B 2RFXB 3E8VA 3APNA 1KJ2A 4MMYA 1TENA 3EJTA 5GRVK 4EQ3A 4W81A 3V5DB 1UT9A 4L8BB 5BZDB 4ZSOE 3DVGB 3QWRD 1EEUA 4LDLB 4IS6B 4F8QA 2CM5A 2CO6B 4Z18A 3MOBH 2PCPA 1VEPA 3FQRB 4AMKH 3GLZA 3WN5B 4J5VA 2VLKB 2YQGA 2X7LA 4W6YB 1T0NA 3WNPA 1P7QB 2D03H 4BWUA 2FJHA 2AK4E 4MA7H 4BQ8A 3CXDH 1SF3A 2QT6A 5CZXD 5E6UB 4PY8J 5KVFE 3WTXA 4GBXC 1HWGB 1N6QH 1KXQE 1I8LC 4HDIA 3S7GA 3VXSB 2EDFA 1RZGA 2OK0L 4DESA 2NY6C 4UT9L 2M8XA 2WTRB 1IKNC 4CADB 2AV7A 2VXUL 4KKLD 5DMJB 1IIIA 2A6IB 4JPSA 3SGEH 3VSQA 1RJLA 2NNAB 3HG1B 4Y1AD 5AOKA 4RETB 2A74A 3ZY7A 4LCUA 3IFOB 1Q9OA 2EYRB 3LH8A 3G5XB 3WGUB 4UUJA 4JFVA 5C0IA 4NC1C 3MRQB 3H54A 3HC3H 2D31A 4S1RH 5C0BD 5I8CB 3EJRA 2V0AA 2B3IA 4KTDH 2BP8A 3IDNB 5D4IA 5E8EA 2YXWA 2X4OA 4L4VA 3GKWL 3UL4A 2ADGB 4M3KB 1L6ZA 5EOTA 4LASL 3GFUA 3IXTB 4KK5C 4YDIH 4P23A 2JB5H 1XSKA 4YHNA 5I71C 4GG6E 1QFHA 1WPCA 4U6XA 4JRYB 5F1IA 2FWOB 4OZGE 2CR6A 3UJTH 2HT2C 5CP7B 4PHZA 1PZUB 1AQKL 2H9GA 4KX8A 2WLNA 4WUUB 2GAZB 4WNQB 4Y4HB 4WHYG 4URTB 2Y2YA 3QEGL 4BEIA 3S37L 4JGMA 2GJPA 2QJDA 1IKFH 3KW7A 4KNUA 3TO4C 4PV8A 1A64A 3CFKB 3MRHB 3MR9A 3TM6A 5F7HA 2HUEA 2EDXA 4QF1A 1L9PA 3HG4A 4JFOB 3P77B 2GT9A 4XTRC 2DEXX 1MDTA 2VC2B 1VJSA 1XB6A 5GGUB 4DOHB 5HDQL 4JJ5A 1MFEH 4M7KL 1JDAA 2BHZA 3OMZA 5ADOH 2DY2A 5BVJB 1GGBL 3U0WH 4U3XA 2BC4B 1FL3A 2QPEB 4IU3A 5FGCE 3GPSA 2OMYA 1RZFL 2F6AA 3QQ4A 5AW3B 3W9EB 3PFQA 4EDWL 1ZK5A 3U6RA 4NOFA 3DSNA 2R0LL 3EOBA 3D0AA 1VRSA 3HBPA 3TYFA 2XWDA 5CBAB 4PJXA 1DDHB 3T2NH 2OXGB 3FSAA 2X4PB 3ILQD 3QR0A 4HK0B 5KOVC 4QHMB 1XR9A 4H88H 2GJZA 1CFNB 1ZSDA 4ODXB 3OB0H 1OGTB 3LPGA 2YMXH 1TYRA 3BESR 3BGFC 3R0NA 2H5UA 5IW6B 5FUCE 4BFBD 4KKQA 4LAJH 4PJEB 4NAQA 1ASPA 1ZSHA 4JO4H 5FYLD 2FX7H 4P5TC 3CHOA 3CVBA 4AJYV 2WWKO 1QUPA 1UYWH 3D0VB 5IVZA 3HR6A 3V4PL 2ZXQA 5DRWA 1BZEA 2A9BA 4QRAA 3C08L 4YR6B 4F7EB 4BFOA 4OM0L 2YPLA 2FL5A 3OKEB 3TS8A 4MJIB 1ZVSB 3RURA 1S7VA 1CF8L 2UXVA 3IU4L 4Z95H 5DO8A 4LQFL 1Y18B 3MROA 3OZKA 3JWNG 3WXVL 3NPZB 1TFPA 3IXAB 4PGDB 1HCVA 4X6CE 4ZTOH 5TE6H 5SWSA 1UA7A 2X4QB 2VDNL 1TOXA 4JY4B 4D0CA 4M43H 2XXGA 3PJSA 4J4PC 4L4TB 2BO0A 4NZFA 3HNVL 2AXGA 4PTTA 3CFNA 4TSAH 2AEPL 4HYTB 1ZT1B 2GK2A 4PRPE 1CXLA 1TCRB 4JCLA 4K5LA 3QYNA 1XSJA 1F4HA 3EYVA 1AQ8A 1MJ7L 1M6UA 4ORGA 2V5TA 2DJMA 1RK0A 3NFNA 3ZZLA 4DP4X 1OTSC 3MRGA 1UVQB 4NPKA 1EEYA 2WIIA 4H0LC 4M56A 4D8PB 1JK8A 4MRCA 2XFGB 3AAZB 5F3FA 5B21A 4YDNA 2HT4D 4GKNA 3W56A 5I18L 2OK0H 1F58H 2VERA 3GDCA 1SVCP 4QJ4B 4Z5RB 4UT9H 2AANA 4G8FA 3UEQA 2JIXD 1MCPL 3WAJA 1N8ZA 3PQYA 4AI7A 1PNCA 4HGKC 1HH9A 3QG7L 4N2EA 4PD4K 2EDOA 3W0WE 2HLEB 3DJRA 1RCYA 4OZIE 3IVKB 1KXVA 2WLYA 4Y1AE 1PEZA 2J43A 1EV2E 3I85A 1AS7A 1UD3A 2I07A 2RFXA 1RQ5A 1V3JA 5CM1A 4IRJD 2F8IA 3DVGA 1CURA 5I1LA 5JXEA 4Z7WE 3S36X 1IGIL 5C0BE 3WE6B 3U1SL 1RHHB 3K6OA 3K5RA 1N26A 1NMCB 3GKWH 2VKWA 1ANUA 2W8CA 2QGEA 3GSOA 4LASH 3IF1A 4Y16C 2PR9A 1UEYA 1A6VL 3IDJB 1ZHLA 2AI0H 5DHEA 1KMGA 1MH5B 2GBTA 2W0FB 4GQQA 1U93B 4PHXA 2M2DA 3TJHC 4V2CB 3V5HA 5DEZA 4KROB 5BZWA 4LDCA 1QI4A 4L48A 1R9FA 3KL0A 3MXWL 2EE9A 2XQYG 3QEGH 3IGKA 3VXSA 1A4CA 4GRLA 2XNAB 2PCXA 1BZ9B 3KPOB 4ABWA 2IEPA 2AMUA 4MNQE 5FC9A 4K71B 1Z9MA 5I5IA 3GMRB 1NCDL 5EBLA 1ACZA 5BZXA 1MXDA 2IWFA 2NNAA 2OTUA 3KD4A 1SHSA 2QVFB 4I1NB 4JO8A 3US9A 2ATPB 4RBPH 4KVNL 4MRBA 3STLA 2F8XC 2EYRA 1BXAA 4M7KH 2ICEC 1YPZA 3NACL 4AVJA 3VXPA 2XC8A 1GGBH 3LKOA 3ATFA 4PJ8C 3FULA 3K72B 4N0UB 4X4YB 4CU6A 2YAQA 1K2DB 3IDNA 2RAMA 1TJIL 3VXMD 4NUJB 3CDZB 3TBYA 4Z3EA 5FYKU 2ADGA 3WN6A 1KFAL 1ZE3H 3DBXB 1CBVL 1KGYE 1KIUA 1UXWA 1FFPB 4E0RB 3OV6A 3B8SA 3MRPB 1I3RB 2M83A 3BWSA 1A1NB 1TZIB 3Q48A 3PJLA 4I48A 2RQEA 1O7VA 5TK4A 1FZOB 3F7YB 4LPYA 2GAZA 4DZBA 3B1UA 4RWYH 5TDNA 5J8OA 3VRJB 2N7BA 2R0WH 1F90H 1T5WA 4ZMQA 3FT3A 3DWTA 4ZTPH 3QCTH 4DPRA 5MI0C 3EH5B 4G5AA 3B9KB 2ZYHA 5FYLE 2R1YA 5ACZB 1GTNA 5BVPL 1QBML 4AYGA 1AP2A 2PWDA 5DMGD 1SQMA 3OB8A 4FQJL 4JFOA 1PG7X 1QLEL 3P77A 3O45B 5F7AA 4CKQA 1OF2A 3CZFA 3C08H 2J6EH 4OM0H 3VNYA 4JGNA 1ED3A 1P84K 2BIMA 2FBJL 2RIKA 3AJ7A 4XGZB 1XIWB 4XI5C 2KKQA 1CF8H 1MFUA 4KC3B 4LQFH 2LU5A 2NTFA 1FSKB 1D9KC 3KPSE 1GJWA 2O5XL 1NFAA 4N3UA 4ODUA 1ZT4B 1DHKA 3LCYA 4WFFD 4WU5B 4KDVA 3WXVH 2K8QA 1MWAL 4JCMA 4Y2LA 3W9EA 4BHUI 2ZOTA 4EVNA 5GGVH 3QXUA 2EE3A 3QG6B 3BP7A 3JBG7 1JXGA 4HF5L 1SMDA 1DDHA 3RWJA 3AY2A 1YNKL 3LZNA 4YE4L 2W91A 4PJGF 4NO0A 4TULH 5C0RL 3UTPE 3HCVA 1K5NA 1IGCL 1R47A 3HJ0A 3KLKA 3AZUA 4WTQA 1OGTA 1MJ7H 1PY9A 5JDJA 4ZS6C 2EECA 2BSDA 3HRZC 2KBGA 3E7JA 4JZJA 3FMGL 3FSWA 4GKSB 2VDNB 4F15C 2FD6H 2F58L 2VL5B 1M05B 3DPBB 1GH7A 5I18H 1JIBA 3PXLA 3D0VA 5JIMA 4X6DB 4JQXA 4ZOCA 1MCPH 1X9LA 1CD0A 3OKEA 4JM2C 4LVHB 4KVCH 1BMZA 4Y9BA 2LTQB 5C6WH 3QO0A 1QNZL 4WGKA 2CBTA 4KQ3L 1MSPA 1V7NL 4XXDA 3UYPA 2H0PA 3H9SD 4IBTA 4PJBB 4PGDA 1U95B 2VXTL 4HEPG 2NUPB 5CP3H 2X4QA 4FJ6A 2XI9A 4ZDHA 3SE4A 1UA6H 5A2KH 1ZT1A 3SBWC 3EZ8A 3VXTA 3MRBA 3BAEL 4J27A 1ODUA 1FA4A 2P48B 1AI1H 4U1LA 2NZIA 3OQRA 5HGAB 1UVQA 1ZHNA 3NZHL 3D12B 4JZOB 4JO3L 4D8PA 3PLYA 4N8CL 3UAEA 3BUDA 3H7LA 3SKMA 5DMYA 2ZPKL 2HLFD 4MCNA 1WC7B 2IXQB 3U4EA 3SGDI 4ZZKA 2FIKB 3ARFD 3KS0J 4PR5B 4DQOL 5DJCB 3G04A 2QADC 2W9EL 3L2NA 4ZNEA 2KZBA 3WJMB 1EAPB 2OMTB 5J9PA 2YWYA 1NCDH 3AS3A 3DHUA 3FUHA 3M17B 1EJ6A 2P24A 1M7XA 1T03L 5C07D 3UC0L 4WGVB 1DVTA 4G80B 5T3XL 3I84A 3NACH 4OZHE 1RZKL 5I6NA 3EGDA 2CDFA 3ZGHA 4N87A 4UT9A 4KZCA 3SZ6A 5L8JB 4MJ2A 3WE6A 1RHHA 1PTZA 2MMXA 2CO7A 3MRCB 1WICA 1TJIH 4P2OB 2O5YL 3VXME 4YHML 4HIEB 5DJ2A 1KFAH 1UCTA 4KFMA 3VWKB 3UCRA 4XNMA 3N06B 5AYUL 5IMOB 1OM9A 3EH2A 3E1F1 1MH5A 3KEDA 1MFBL 3GMNB 1T5XB 1QUNA 5DURB 1EEQA 4QRSA 2YMTA 2P8MA 4FQ1H 3VGBA 1UM4H 5KG9A 2QKIB 4PP2B 4QXUL 2P42B 1BF2A 2DQEH 1HXYA 4I3SH 3TVMC 1QR1B 5JQHC 1FZMA 1XHHA 2VDKH 5F2FA 1HYSC 5LGJA 1KLUB 1OSEA 5JIHA 1QBMH 3KBPA 3V0GA 1I85A 1E43A 5BVPH 5FYJD 3PV7A 3COOA 5TQ0H 4NT6A 5EEXA 4ZXBA 4FMKA 1IBFA 3KYAA 4I3RH 3WLWC 4JUTA 4ZAKC 5A1AA 2Y24A 3F58H 3RZCD 5HYJD 3VWJA 1AXTH 3AQDA 2O5XH 4IEFB 5J0BA 4CSZA 4X9YA 4WO4C 3M1BA 5KBNC 1BEYH 3CDZA 4GINA 7CGTA 4P3DB 2XJKA 4DJMA 3H1ZA 3B2PA 4QJ3B 1QLEB 2CKNA 1A3RL 3WDIA 1R3KB 4E0RA 4HF5H 4OY9A 2YD5A 1I3RA 3OKMA 2QTVA 4XMKL 1C7TA 4L8SA 4ODTH 4Z7IA 3OTTA 5C0RH 1N67A 1TZIA 1XCTA 4I8DA 1JGDB 4BFIB 3DV6B 3QNXA 4Y88A 5LXGH 1A2YA 4LSSL 1MWAB 3F7YA 3GXDA 2EDEA 1I1AB 3QJHA 2MOQA 4AIXA 2DQCL 3QR1A 4KI5C 2WOBA 3I6GA 4H4NA 5EU3A 4AZUA 5D7LD 1E4KC 1PKQB 1AMXA 4LT7A 5AKVA 2F58H 5H37G 2C3XA 5ACZA 3LN5A 2YA1A 5AOMA 1DEEB 3POCA 4HUWB 4B5ZA 2UUDH 5L88L 1EFXD 1M71B 3NK3A 2X9YA 3CCHB 4M62H 1I9JH 1LQBC 2Y7LA 3BW9B 3CUPA 1JBJA 3EJPA 4U1HB 3D9AH 4APXA 4RRPM 4IGBA 4KQ3H 3UJIL 3U1PA 3H9SE 2EIBA 1Q1PA 1D5IL 3V4PA 2VXTH 1AD0B 2KERA 4NQEE 1K3ZA 2CR0A 5CGYC 3J07A 4YHLL 1J1XL 3UBXA 2X70B 3KPRA 3PWPE 3B1TA 1U58B 5LB1A 4BZ1L 1T83C 3Q43A 1WBZA 4DP5X 2XZAL 5L2JB 1PJWA 4TVSa 5BCAA 1HZLA 2N7SA 3N0AA 3BT2L 4BDVA 4A7GF 5F7LB 4LPWA 4TXVB 5DT1L 3PPSA 2B59B 3T0DA 5B38B 4P04A 1AGCA 3QDGB 3NZHH 2DJSA 4GKSA 3W57A 5EC2B 2ZPKH 2Z4QB 3Q5OA 3SGKA 1CVRA 6TAAA 1I9IL 3UXFA 3K71B 3MLZL 4UWQB 4DQOH 3E9UA 4JPIB 4TVPH 2BY0A 2W9EH 1VGKA 4NQXA 4UAHA 4F8TA 4JJOA 2XA8H 3HBGA 4Q4EA 3BXNA 1JHTB 2BSEA 1OIOA 1FV1B 4L4VD 4EI5A 2C3WA 2P45B 4LLDA 3MGTB 3ZTEA 1T03H 5C07E 3UC0H 4H25B 4JFUA 5SX5K 3VQMA 1D5MB 1RZKH 4P23D 4NXKA 5CBEB 1AGBA 4K3JL 1U8IB 3A6BL 1MPAH 4PJHB 5I73B 2NY4C 1GA2A 2O5YH 1JZ3A 3OC5A 4TSCL 4YHMH 4H20L 4ZD3H 1I1FB 4A1RA 1GJUA 1UGNA 4JFHD 1ZTXE 5D96B 2A83B 2V3DA 2K7PA 2L04A 4YDVB 3ZMRA 4KU1A 1E4WL 1CQYA 1GYCA 1AHWC 4QRUA 4G8EB 1JXFA 2FB4L 1QWHA 4YAQB 1VB9A 1MFBH 1MFAL 5CP3A 3ZDZB 2R56L 3SO3C 1LEIB 2FIKA 3NCMA 1K9TA 1EO8H 2MSPA 3QA3A 3VD4A 1KCRL 5DHVB 4UAOC 2I5YH 4YO0A 2CHZA 4GW4B 3ZE2F 4D9RD 3M17A 4DGUA 4ZMLA 5FYJE 1HEZB 1NIAA 2RGSA 1U8KA 1BP3B 3FAWA 3DGGA 5I17B 2K6WA 1SY6H 2NZ1A 3BVUA 3GB7B 5F89A 3QI9D 4G80A 3W3BA 1HEJC 5TE7L 1S78C 4DHLA 5E6RB 4ZMAT 5JPMC 4RFEA 2X12A 2MTPA 5HYJE 3LDBC 3INOA 3IU3B 4KJYB 2JTYA 1F5WA 1CDUA 4K5OA 1WP6A 3MRCA 3MTRA 3O81A 2EE2A 1OQOA 3VWKA 5MERB 3LH9A 5IB1B 3EYUH 4YEFA 4CN4A 4UMSA 2QQKH 4YLQT 5I1AA 3CXHK 1RUKL 1KXTA 4HCGA 5BO1L 3DUHA 3SDXB 2PP8A 2ZKWA 5IHHA 1PY0A 1WZ1L 2BNUB 2F68X 1B0GB 1D5BB 1WA2X 4LGSB 5AQ0A 3BZ5A 4LSSH 3MA9L 1CTMA 2QKIA 1UJ3A 2DQCH 2ZP8A 3BPOC 4FQ2L 4PP2A 4JL2A 4UV7L 1RIVH 5D7LE 1F4AA 1G43A 1WT5C 1TO5A 1KLUA 4G6FB 4L9LC 5C7ZA 1QO3A 4QXVA 5HHQA 2DQDL 1LGVA 5FYKL 4PVNA 3FF8A 4DO4A 3QUYC 2QFPA 3HS0C 2QPUA 1GTFA 2P80A 5EH1A 5I0XA 3HAEG 4JFEA 4DUWA 4ZMOA 2XHNA 2QHRL 2OSXA 3ARGD 4IEFA 4NQSA 1G9NL 2YKLL 1XAUA 1D5IH<