4NIYE

Crystal structure of trypsiligase (k60e/n143h/y151h/d189k trypsin) complexed to yrh-ecotin (m84y/m85r/a86h ecotin)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
137
structure length
137
Chain Sequence
PLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTYRHCPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title N-terminal protein modification by substrate-activated reverse proteolysis.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 22
structure length 137
sequence length 137
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4niyE00
1ECZA 1IFGA 4IW4C 1SLUA 2Y6TE 1FI8C 1AZZC 1P0SE 1XX9C 1EZUA 1XXDC 1ECYA 1N8OE 4NIYE 1XXFC 1SLVA 1SLWA 1EZSA 1ID5I 1SLXA
chains in the Genus database with same CATH superfamily
1QHQA 2YUVA 1DQDH 4NKIL 2TRHA 3UGXA 2CRYA 3MMEB 4OSUL 3KZ8A 1NCTA 2E6QA 1D5IH 3O6FC 4I0PB 4QR7A 3CFEA 5EO9B 5IK3B 4XBMA 4ELMA 1MI5D 2WNXA 4D3CL 3F6LA 3DLQR 3IETA 4C56D 3L4XA 5I0YA 4M93B 5E2TH 1PVHA 3BHBA 3K5SA 2WKOA 3KMDA 4TNFA 4HT1L 1RJZA 2E47A 5CF3A 3BKMH 2CQVA 2ZWYA 2NLJA 4P2AA 4JFEE 3ZTNL 2FJFA 5IB3A 1JTPA 4PFEA 3UJIL 5A7BA 4JM0A 1ETA1 4P2QD 3LXUX 2PO6A 2BP0A 5FB8B 1WZMA 4FFYA 1MIMH 3R0NA 4G6JH 4NZUL 2QADD 4ZMVA 2YLHA 5EU6A 2GBUA 4HJJL 3U4AA 5JNYB 1AR1B 3O3UN 4YXHH 2UVFA 2VR8A 4K3EL 3NCJH 4DH2A 3ULVL 3IMTA 4KRLB 4F93B 4A6YB 3ZKND 1JYWA 4ZT1A 1X5JA 1R0AL 5F89B 4DK3A 4F7TB 2AMUA 2WXHA 1D7DA 2FATL 3BEVA 4NWTH 4PJXE 4MAZA 3BCDA 4EIBA 5IMLA 2GI0A 1RIHL 3KPPB 4LSQH 5M95B 4R4NC 3GM8A 1MHEA 1I1YA 3FQRA 3NTCL 1HSBA 3NESA 4NZFA 5HVGB 3H0TA 1SOXA 4DF9A 5E2VL 4CNIB 1D7FA 2Y7OA 1IC4H 2BWQA 4GW4B 4I0CC 5DT1H 3RG1C 1BZEA 1NOFA 3HNTL 1Y1UA 2VAJA 4XP5L 1AANA 2YPLE 1VFOA 3CPLB 3ARZA 3C8HA 1Z9OA 2GI7A 1LMKA 1EV2E 1IGIL 3NIGF 3O0LA 1JPST 2GKIA 4H88H 4IJ3C 5ISZE 4G1EA 2WLLB 3QEHA 4PWIA 4O2EA 1AOHA 1OHZA 4RBPH 4KZ0A 3VTAA 5HJGA 2W07A 5EIIB 4KTEH 2ESVE 4N24A 3BISA 3OWEA 3MRLB 4IIQA 1ZRUA 2N0KA 3BUTA 2B59A 1OP3H 1J7VR 2DQFB 2H5UA 2XFXB 3P0VL 5I0ZA 3DMMA 4F7PA 1AOZA 4GINA 4OLYL 1ZA3A 5F7EH 5DQJB 4W6XB 2D73A 3APDA 1A22B 3QFJD 3BGFB 3RWJA 3CVHH 3RL1B 3F7RA 5D7IE 1C16B 3PPEA 1XF2A 1GZPA 1I1AB 3C9NB 3HB3D 5BRPA 3QYNA 1L7TH 3FH5A 4PMFA 4BKLA 2EH7H 1JRHI 3TJEL 3VFVA 4NKIH 2WHVA 4OSUH 3VWKD 3O9WC 3TEUA 1EZUA 4J3UA 2GC4C 4TNWK 1KYOJ 1IM9A 2Q7YA 5DCCA 4D3CH 1KN4H 3NCFB 2IAMB 2ITDB 2N1TE 2B8OT 2W59A 4AKPA 2VR9A 4W4OC 1P4UA 1TJGH 4EIGB 5CD3B 1SBBA 4PVBA 4HT1H 3MPCA 3SDYH 3U30B 4HMDA 1QEWB 3ZTNH 3FB6A 3T6XA 2ZOKB 2EDNA 4PP2A 5GPRA 1VIWA 3UJIH 3BD5A 3VFUA 1SEBA 3MX0A 1A4AA 1E8ZA 1I7ZA 2WXNA 4NJ9L 1FJ1A 2Y7MA 5FUOL 3BJ91 1IBDA 4HJJH 3RGVC 5JUEL 1DQMH 4ZOBA 1CL7I 3EJJX 1F2XK 3TBYB 4AMXA 4LLMA 1IE4A 3ULVH 4YX2L 1XF4A 3VAEA 4A37A 5IFAL 3MRPB 1JPSL 2NW3B 5DK3A 2OAAA 1P84J 5E95B 3A6OA 3AUWB 3FFOA 5CINL 1R0AH 2KZKA 2Q8BH 3BPLB 1M1XB 2FATH 1TPXC 2X89D 4X5WB 1ID2A 1RIHH 4NZ8A 5F97E 3NTCH 4NQDD 2QT6A 2VL4A 1G6RB 1TTAA 2VLJA 4MZ3A 1INQB 4RLDA 5E2VH 3UDWA 3HAEH 5BMFH 4TLSA 5ICXA 3KCPB 3N91A 4NM4L 4GBXA 3HNTH 3PGDA 5INDA 4XP5H 2AJZB 1H3PL 2ZYHA 5BO1L 4A7UA 4R3SA 2AEPL 1U9KA 4RDQG 1FVDA 1IGIH 1QP1A 1XSOA 2RHEA 3B2MA 3Q5OA 3G5YB 4JHAH 4JO3L 4P5RA 4ZMWA 4R5VA 1CXLA 1EXUA 3FN9A 4JFPA 2ENQA 3ZIYA 1F56A 4KKNA 4W9HC 5J12C 2VLRD 4GQ9L 2E5EA 5KSVA 1BXXA 3NZHL 4PVNA 1IGYB 4ILDA 1ZT1B 4ZAKD 1I31A 4AIZB 3WOVA 4CMMA 3LTVA 4J8QA 5IVZA 3P0VH 5HHVH 2FJUB 4P46B 3WO4B 4PLOB 1COBA 4W81A 2VOTA 4WKZB 4OLYH 4UAOC 2H9GB 3CZGA 3TVMD 4C54A 4P5SA 2DWTA 4QHKJ 1B6UA 2UXGA 1R75A 3ARFA 3D85A 3Q5TA 3U36A 5FF6A 4XX5A 4K3DL 1BQ5A 2DY2A 3TJEH 4LBEB 5F93C 4B27A 1JGDB 2EO9A 1KCRL 3NJIA 4B5EA 5HYJD 2ZP0T 5K1JA 2XA3A 3B37A 3KDMB 4TKWA 4NNXA 1SXAA 3FFCB 3CFDA 5HI5D 4HXBL 1WFIA 4L9LB 2E6PA 1DYZA 3HR6A 3VXUB 1AQDB 3IDJA 2GBVA 5HJDA 1PFCA 4BFOA 4CU6A 3CZFB 2G3NA 1IBGL 1O9VA 2AEOA 4AE1A 1P6FA 3NCWA 4LKCA 4NJ9H 1NMCC 4ANKA 2WXMA 5GSVB 1JZEA 5FUOH 5FO8A 5T3XL 2PW2B 1UADC 2X6BA 3E38A 3WUWB 3S2CA 1FHGA 1R3KA 4XMZA 4MYWB 5JUEH 1TUPA 5E1QA 5ESVB 4FC3E 1G7IA 4OUUB 5KJ7E 2DMHA 1JPSH 1MOEA 2NXZD 3HC3L 3QGVA 1U8OB 3K2MC 1PZ5A 1D5BA 2F53D 3N5AA 4JFWA 4GUPA 5BOZG 1M71B 2FJHB 3RE0A 4J4PC 3I9AA 4XN2A 5KOMC 2FWOA 1XTLA 3U1QA 2M2DA 5KSAD 3IK2A 2A1WL 2DJUA 1OM9A 2QLVB 3FFDA 1LNUB 4MDJB 1MLBB 4XXDB 5I5JA 3T6VA 1LVEA 5DGRA 4XODA 2YD6A 4HPOL 1GZQB 5HDLA 1AP2A 3VO0A 2G9HA 1FIEA 1FZJB 4WV1B 5IESL 4Q6IB 4HKBB 4D0BA 4WHDA 2A77L 4M4PA 3TIEA 1KENH 3VRIB 2XUWA 4DP8X 1EAJA 2X0VA 4TM9A 4JO3H 1W15A 3IEAA 3O0RL 4HEPG 1YA5A 1F11B 4MB5A 1QBML 5BOPA 4KI1A 4I3SL 2X4UB 1U91A 4N2LA 2ZUSA 5L7XH 4GQ9H 1N0XL 4N6RA 3RIFF 3FSZA 3O41B 3NZHH 1IILE 3HZYA 4XT1C 4Y1SA 1RK1A 43C9B 3TFKD 5CNHA 4AEEA 5D71L 4JREB 1WD9A 5HI4C 1QBLL 3FUHA 1BZ9A 2B39A 2YGOA 3B2VL 3FH8A 3X2QB 2J1XA 4W6WB 4OKDA 4HFWB 2EDWA 4ELME 4B0MB 4PJCB 5HJ3A 2DBJA 2EKSA 2V5YA 3S3DB 3W9DB 3CUPA 3CSPA 3CU1A 4OLEA 4UBDC 3RFZC 1J0YA 1NEZG 2CR6A 2EUZA 2VM3A 1SRDA 1KCRH 3O3EA 2JKXA 4E9QA 3VX0A 1A7OH 1OSPL 2WW8A 2KQNA 5LBGA 3CVHB 4IRJC 4L4TB 4HXBH 3JWNC 5IQMA 4JFTA 4KUCD 1S7WB 1U8QB 2J7LA 4AIOA 4Z5RB 2WVTA 1IBFA 3QORC 4MNGA 1IBGH 4IBSA 4XC3L 2DLFH 1S5HA 4LEBA 3B9KD 1FN4A 2E4TA 3LPFA 3AQDA 3D25A 4GP8B 4YOKA 3V6OC 1AZBA 4ZTEA 5TK2A 1T83C 2VMDA 3WJLA 5ALBL 5T3XH 4YAQB 3DURB 4YBLB 1A2YB 4NNYA 4YHPB 2X70A 3MV7B 1JZ8A 4OM0L 2R29L 4F2EA 3TBBA 4P4KB 1NBZB 2QBWA 1R24A 4UDTA 3RUGB 2YZ1A 3RWEA 3SN6N 4A2LA 1QUNA 4DEPC 1KIPA 4WK4B 5HDQL 4H25A 4ZODA 4XPTH 1FNLA 3WTUA 1OW0A 3PP4L 3HC3H 3I9GL 1SN5A 3KH3A 3M7FB 3BP5A 1LK2A 2D3VA 4JRYB 4XNYL 1C5DB 2PCXA 1SJMA 3MR9A 1L9TA 1UH3A 2QVKA 3PJNA 1AKJA 3OKLA 4PBVC 1OP4A 1XD0A 4Z7WF 2A1WH 3EG9A 3IJYA 5FYKU 4GH7B 1EAPB 4EIUA 4LVNB 1MJ8L 5DS8A 3RWDB 2K78A 3T77A 1TQBB 3WJMB 3L9BA 1RZ8A 3AAZA 5D2NC 1QPKA 4HPOH 4J27A 2CLVA 2ZD0A 3EGXB 4HGMA 2I25N 1P5VA 2BIIA 1X5HA 4R6UA 2A77H 1H6EA 1WRFA 5B8CB 2XWXA 2CDEA 1BM7A 2GT9A 2K6YA 3O0RH 1FZMA 1HKLL 1F58L 1N59B 3IGAB 4HFUL 3VFPB 4HK0B 1K8IA 3UL4A 1U4FA 4YO0B 5E6ID 3EO0A 1PQZA 3HAEB 1OF2B 5IQ9A 3GEWB 1N0XH 4OFYD 4MBOA 2ICCA 1HESA 3RDTC 2CO6A 1SVBA 3EHBB 3IKCA 1XHHA 3N55A 1VAHA 1KCVL 2GAZB 3BVNA 1YEEL 3OHMB 1WICA 2P5EB 5D71H 5MERB 4LOUC 1YMMD 1KIUA 1QBLH 3DVGB 4UZGA 3RWCA 3SJVA 1MW0A 1A7NL 2YLKA 3WHXB 3FQYA 2LFEA 3B2VH 3QXUA 1YUHB 2G5UA 5F9AC 5FOJA 1QG3A 3BESR 5I6LA 4NPYB 2GEEA 1MN4A 12E8H 2E59A 1IAOB 5L4MA 1NC4A 2ZOLB 3H54A 5TE6L 1LEGB 2J57A 3M1BA 4ATWA 4B97A 1DDTA 4IOIA 4AQ1C 4PJFF 4QXGL 3LKQA 5I28A 3BQVA 3UAAA 5C2UB 1UM6H 1GPOH 1MUJA 5JQHC 1OSPH 1KGYE 1I7UA 3V7MA 3V6FA 3EF7A 1I9IL 1PY0A 3DO3A 3FTGA 1KF9B 1S8DA 1BGXH 1PLGL 2LE9A 1DVFD 3BPNB 5D96B 4AK2A 1SUHA 4RNRB 4RSYA 2YRZA 1LYQA 4C4KT 4OGXL 3GBML 1SUJA 1EGJA 4FDWA 3BZ4A 5DR5L 4O2CA 3VYOA 4CW1A 1B4TA 4RGMB 1RULH 1I3VA 3UAJC 1G7MA 1WFOA 1FO0B 3ARBB 5ALBH 3DDFA 5DXWA 5JHDA 3B3IB 4PI0A 4NN5C 3P4MB 1M6OA 1PF3A 3NIGE 4Z7WA 3OF6D 2OMVB 4WVRA 4XCYA 4L5FE 1H19A 4NRXA 2IANB 2Z7ZA 2YUXA 3BEWB 2N56A 2WTRB 3PP4H 1JWUA 1FNGB 5SWQB 4PY8I 2PUQT 3BX7C 4BWUA 4WUUB 1RPUA 2R59A 3BSHA 3IFOB 4TL4A 2A4EA 5AD0B 3SDCA 2KI6A 4XCNB 5CKGA 5E1IA 1UZ8B 3NCBB 5LNDA 1XXDC 3EFFB 3P9LA 3NFNB 4FNTA 1MJ8H 5AB1A 7FABH 2DV6A 5EBWA 1MCPL 1TVBB 3NP3A 1BVKB 3QNZB 4XPAL 3JZYA 4QRFA 3GGWB 5E1AB 3ZVVA 1KV3A 3MRDA 4HUXA 4R2GD 1BMWA 1EAOA 4LCUA 5FA4A 3QDGA 3KYKL 2WQWA 3JTSB 4QD2E 1ZKAA 3W82A 4X6DF 3ZIMA 4K7PY 1G6VK 3GS7A 3LRSB 3RB5A 4BFBD 1HKLH 5IREA 1LEIB 1F58H 3F04A 2NY6D 5DEFA 4HFUH 3DJRA 1W72B 3I85A 2L3BA 3QWRA 2IDFA 3VWJA 4EKJA 4NSKA 5FWRA 1SPDA 1A1OB 3RZCC 1ZT7A 2BWIA 3OKNB 1RZIB 1F8TL 2IALB 1KCVH 4N26A 4POZD 3OG4B 1YEEH 3ETBF 4BD4A 1CICC 2FH6A 2XV2A 1UFUA 3E3QE 4PJFA 1LEKA 4XNQB 5LGJA 4H0IA 4Y9CA 4CBPA 1A7NH 1DE4A 3LN4A 4N9GB 3S36L 3TJHD 2BFVL 1KPVB 1USZA 3A5VA 2NXZC 4IRZL 5F3HA 3LAFA 3FT2B 3L5WA 4LE8A 3GB7B 1SXBA 3MTRA 4FQXD 2DQDL 3L3OC 3UBXA 4F8QA 1EEZB 4UT9L 4JZJC 5E9DD 4NQCB 4X98B 5D72L 3S34H 2A6JA 5D7KE 4E41D 1SMDA 1Q1JH 4NKDB 3RRQA 4X5LA 1NIAA 1GYAA 2JCCB 4GSUA 3UP1A 4AQEB 4P2RA 4QXTB 3UMNA 5B38A 4OI9A 4YHZL 5ETUB 5AAWC 3UBHA 4U1JA 5C0IB 2EIJB 5I2IA 2JK5A 2CNYA 5EFIB 4KJYB 4BCZA 5FGBA 5HGBA 5DQDH 5JLZA 1DANU 4HKXB 4ZPVB 5B39B 1OSYA 1JZIA 1PLGH 4R7DB 3HJEA 1JCKA 5IB2A 3GXMA 5L88L 1E30A 4OD3L 2Z93B 4NRYB 3ZO0A 3GBMH 4JAMA 1P6WA 4YEEA 5IW3A 4LKXB 4NQUA 4ZQKB 4UNTA 3T65B 4AVJA 2NQCA 1JERA 1QI3A 4IJ3B 2O61A 4WGWB 4IHOA 2YRPA 2OTWB 1WC7B 3BKJH 3HZVB 3U4KA 2CLRB 4CJ1A 3UPRA 5I30H 3EOTL 5AW7B 3Q3GB 2X4OA 3DPBA 3F62A 3TPUA 1M7XA 4NHUB 1ET5A 1FVCA 35C8L 3F12B 4LIQL 4JM2D 1WD8A 2GJPA 3HE7C 4LQFL 3U1PA 1OZUA 1MSPA 4BK5C 4MA3B 5HGHA 2NX5D 4XMLL 4NI6A 1S7RB 1O9ZA 1N10A 4X6DA 5F1NA 2ENSA 1AC0A 5GGSA 4OLWL 3JWNH 4BSWA 1IL1A 2A74C 5CO1A 4DK5A 1MCPH 2Y72A 1N12A 3OV6A 1CI5A 2D31B 4KZCA 5LAXA 3U0TA 2Q2LA 3WE6A 2I5YL 3JVFC 3BIBX 3H3BC 3QO1A 1NGQH 1JOIA 3O9WB 4HIPA 5K59F 1HKFA 4B9FA 2YMOA 4XOAA 5CP7A 3WELA 1AC6A 2R23A 3QP3A 5D9SB 5E00B 4WI5A 1QRND 5BUPA 4JY5L 3KW8A 1ZVSA 1DJWA 3B9KC 4J8RA 4K73A 5G5DA 3S97C 1OSZA 1TJMA 1NSNL 3X12B 2F68X 3L48A 5BRQA 3IDIA 5BUGA 1N6QL 3WCYA 1RZ7L 4CDHA 3KLLA 5IOPA 1JZ5A 4WDIA 1E4JA 4PVMA 1F3JB 3S36H 4BEIA 1E8WA 2BFVH 3ZHKA 4MS8C 3SY6A 3V5HA 4X4YA 3FUDA 1IM3A 4YSOA 5E5MA 2I27N 3MZTA 3ROLB 4UT9H 4LFHD 4Z78A 2FR4A 4P2OA 2Z9TA 3GLEA 4ZZKA 3GZPA 2VITA 4MNGE 4DUXA 2WLZA 1XGRA 4TQPA 4BH7B 1OOWA 1XBRA 1TPXB 5EU5A 3S5LA 3F05A 1SDYA 4YHZH 4ONFL 1FFQA 3B2XA 3LRKA 5FO2A 5C0CB 3VNZA 1SJHA 4LB8A 3KGTA 3W5NA 4EIZC 3HNVL 5DWUH 2XLLA 2ZYIA 4OCLC 3WMPA 2YEVB 5IB5A 3TN0D 5D1ZC 4CN6A 3KPRE 1J18A 3TX4A 1UD6A 4QI3A 5EHFA 4NC0B 5C0ND 3HLAA 2XBDA 3B8YA 4JPQA 4OD3H 2IBZX 1IQWL 4LP8A 1K5NB 3ECBA 5C09D 1NLBL 1EO8L 4KO5A 2QSQA 4RA0C 4GW1A 1BEXA 4KTDL 4XPBH 1MJUL 5E9AA 5C07E 3LZLA 5JXED 2Q1EA 2YKLL 3EOTH 4LGSB 2NZIA 1KXTB 4I18C 2B1HH 1X9QA 2HFGL 3GIZL 3DJTA 3BKCL 3MLTB 5EU4A 5K39B 4AQAA 1N68A 4QRPB 3K8KA 1MNNA 4JVUA 3M88A 4LIQH 2IFGA 2AP2A 4UAOB 2QGEA 3DROA 5CEXA 5HGDB 1P6AB 2BLFA 4JFDA 4Z76B 4PS3A 3DI2B 5CP3A 2GJ6E 2H26B 4NCDA 4OLWH 4ORGB 5DC4B 4PLKC 4DOHE 4FFTA 5FLVA 2ALAA 3F84A 1RIVL 5TGBA 2B1OA 1T7WA 1KB5H 3FO2B 1FFNB 2I5YH 4AZ8B 5L2KA 3LYRA 1QSFA 3LKSA 4DSYA 3GMOA 1CBVL 1EDQA 3KM1A 2OCFD 4JLRA 5AAMC 4D94A 5DD6B 1GC1L 2QV2A 3QWNA 5HI3D 3SJVE 3KDPB 4EI5B 2ADFH 1P0SE 3VJ6A 2OXHB 2X4SB 1U8NB 2HKAA 1M4KA 2P5PA 4JY5H 4B9PA 5JO5A 2CJUH 2K6WA 1VA9A 1TDQA 2AQSA 3D0VB 3F65A 3M8OL 1YMHB 1VZGA 3G08B 1B0RB 1IAIL 1BZ8A 1P7HL 3GSUA 1NMCB 1N6QH 1RZ7H 3EJSA 1CCZA 5CGTA 2BNQD 3SHSA 4XMUA 4LHQB 5FYLH 4NN6C 3VB9A 3TA3A 4HZLB 5IB4B 4IBUA 4EXPX 2MRYA 3SDXB 5SWZA 5E5RB 5FX3A 3QR2A 5DURD 4AYMC 3VFWA 4GQQA 5IGXH 2ZAHA 1E28A 4KUZL 2J4WL 1JXKA 2VN6A 4PJGB 2HRPL 4XGZA 3MNZB 4GRLC 3D0LA 4Q9CA 7TAAA 2IDTA 4ONFH 3O11A 3L3JB 4KRNA 1YQVH 2DF3A 1BIIB 5JIQA 4QRUB 2HT4D 5JHDE 3KH4A 1XF5B 3SZKC 4CKVX 2A3TA 4I77L 1GL4B 1LE5A 4Z7WE 5D1QA 5KSBF 2OJ1A 1KYFA 1CR9L 3MLXL 3FQTB 2FVNA 4S1QH 4QAMB 4L4TE 3WAKA 1EO8H 2V5TA 3FQUB 5DRXB 3QT2A 3WDIA 4FFVD 4UIKL 1K85A 2WTPA 1MJUH 1U8PA 3QIBD 4BWWA 1DQJB 2NNXA 2YKLH 2BC4B 3SPHA 2ZXCA 4P2QB 1BJ8A 4KOCA 4HVBA 3D9AL 1A6ZB 3GIZH 5JHMA 4JPWH 3O8XD 4FI7A 4MD4A 3T0WA 3LXCA 3QUZC 1XGQB 1FL6B 3GBDA 2OSLA 3MV7E 4N2HA 1UXLA 3NRFA 2ISDA 5F2FA 3EIFA 1UUNA 4F24A 4YDNA 3AY2A 2VLLB 1IB5A 4Q8BA 4YNYA 2R1WB 2C9PA 3LHPL 5DHXB 1HHJA 4PN6A 4ZX4A 3MUY1 1DBAL 2W0FB 5GIRB 3SGDH 3KWXA 4U1SA 4JRFA 1RIVH 2YXWA 5D93B 2GK0B 3BWUC 1JV2B 1B4JL 4RFOH 2EDYA 5KVEH 1OPOA 2VDOB 2H3NA 2GIYA 2V3EA 2A9MH 2BNRD 1WBXA 3KBFA 1WS8A 2Q8AL 3ULVE 1CBVH 3P77B 4H1LB 4H13C 4PJFE 4EXKA 1KPUB 4N4YB 5I16A 3EW3B 4IRJB 1NDGA 3VFOB 1KC5L 2BSCA 1DTUA 1F4XL 1Z32X 4U7MA 4HUWA 3QORB 1CLZL 1MAMH 2Z31A 2ZXEB 3MUGB 4HEPA 4UM8B 4X5RA 1WITA 2CKBL 3GM0A 2R29A 3C6EA 3UJJL 2JIXB 2GABA 3NGBC 4LLQA 1VSCA 1IAIH 2NXYC 1TQTA 1HAUA 2GQHA 3NJMA 5DQ9A 5C0FB 1EJ8A 4HIEB 2Q76A 2E76C 4G8IA 1L6PA 3N44B 1JVOA 4IMKA 4ZSOE 1XCXA 1HQ4B 8CGTA 3GSQB 1L3NA 3ZMEA 2BK8A 3V4PL 4DEPB 2LFGA 2P5EE 3OGOE 2VLKD 3O4OC 4P5TC 4JPVL 5ERWB 4KI5E 3VI3B 2VMJA 4MGXA 5EA0L 3QFJB 4KUZH 5KSBA 2C3XA 1J88A 2J4WH 2KZWA 1E40A 4FQ2H 2HRPH 4IOFC 5LWYH 2DQEH 3DSFL 4PMEA 3PHQA 5GRZA 2ZOTA 3ABLB 1DQQA 1NEZA 3MJ6A 4AW7A 1ZHBB 2IV9A 4JPIB 4MCZB 1ZGLM 2C26A 2IVFC 3BIKB 3N3EA 1YC7A 4QXWA 1WBYB 2P52A 1MWAA 2DLEA 2F9BT 2VSKB 2WQRA 4GAFB 2B3RA 4I77H 5D2NB 3VWKB 1L0PA 4Z7VB 3RX8A 1KMGA 4ZBJA 5JPNC 2YAQA 3ATFA 3F5WB 3MLRL 4QHMB 1CR9H 3MLXH 3CZEA 1FYTB 2FT7A 2L7QA 2PLTA 3OL2A 3PHOA 2D7TL 4F91B 3UGEA 1BVNP 1I3GL 1NCWL 4HULB 2HN7A 1Z3GH 1R3JB 4LSTL 1A3RH 1RCYA 4UIKH 1IKNC 2XN9B 1UZGA 1GGIL 3QZLA 4NUMA 1G1KA 1KTLB 3MJ8A 2CRIA 4X6DE 1OP9A 4ZUTA 3K72B 4EDXA 1S46A 5GRVL 2ZCHH 3PXHA 4HIXL 1BFSA 4L2YA 4V2CB 5IHBA 4ZMLA 5C0DB 4LSSH 4LXFA 3DXAA 4P57B 3L2NA 5E6UB 1OWRM 1MREH 4JO8A 1PAZA 4ZO7A 5DJAA 4M1CD 1IBHA 1XGPA 5T1KD 2F1AA 1F1AA 3LHPH 4AT6B 1CLVA 1DBAH 3GLDA 2XICA 1CZ8L 3BDYL 4AQ1B 2CA4A 3JQOB 1X6NA 4GXVL 1B4JH 2BSSB 4NQDB 5I0DA 3EDDA 2JFCA 4G9DB 3QJRB 4YN3A 1X5LA 2YEZB 1JHLL 1H0DA 1QD0A 5IT2L 1UB6A 1GSMA 4N2MA 2I9TB 5F9OL 1KC5H 4A1RA 4X7SL 1F4XH 1CL7L 4JFFD 5J6GB 1CLZH 3QWOA 4APQD 1TSHA 3WY4A 1KB5B 2CKBH 4GG8A 4V33A 3OKMB 2K3TA 4DHLA 3UJJH 2DS4A 2Z8WC 5MEQB 2BP3A 3R06A 4JQIL 1Z1WA 3RBGA 2VLRB 3SKUD 3SDDC 3TBVB 5DFVD 1P9MC 4AITA 4FF9A 4NN5B 4ZAKB 3AMLA 3NFSL 3PAUA 3QZOA 5DHEA 3SPCA 1CDBA 5F6HI 2EYTA 4ADIA 4YFLI 1I1FB 2ENYA 4OQTH 2J6EL 3V4PH 1CS6A 5C0EB 1K4CA 1IVLA 1SJEB 3PQYD 1MKFA 5G4OA 5EA0H 3ZQWA 5I74B 3UTSD 1NUDA 4WI8A 4YGVA 5EUOB 3D06A 3MRNA 1KWGA 2WJ7A 3DX0A 4XWOD 5GHWH 1NBYB 2WSDA 5F9DC 3KJ6L 1T1YB 4F1ZA 1BAFL 4MD0B 3T3MB 4FLSA 2CU9A 4MAYC 1O9WA 1T20A 2QPDB 3CGTA 5FDYA 4XMKH 4NDMA 1TEYA 4Q56A 4B9ZA 5ITFB 1ZTXL 3LH2L 3TO2B 3Q05A 2WWOA 3B9AA 1NCWH 5D7JD 1RK7A 2P5WA 5DK2A 5JIDA 1KULA 5D2LF 2R83A 4LSTH 4KXZI 3T71A 3CMOL 4YHOH 4JFDE 4Z3HA 1GGIH 3CSTA 4LLWA 1F6FB 3RZCB 2AEWA 2NCEA 2UV3A 4HX1B 4N90E 4YPGB 4MMYA 3VXRE 4P2YA 4RQQB 4IRZA 4AUUA 5IF0A 4HIXH 2O6PA 1OGAA 1CICB 2O6CA 3BP7B 3FO1B 5HDRA 4UT9A 4L0ZA 1Y6KR 1QSFE 2R9HC 1V7NL 3MRBA 4M4RB 4YLBA 5T8IA 4U3HA 3GWJA 4UU9A 3MBWA 1JL8A 5CM1A 2NXZB 3QUKA 1PZUB 5E2WH 2NR6C 4G7SB 1DBBH 2J55A 3ATDA 5K9OA 2XG4B 1N5AB 3L3OB 1WA0X 2WCPA 5BVPL 1MCSA 1XZWA 3PGFL 4MWFB 4JZJB 4OU3A 3RVVD 3PXJA 2A6DA 1CZ8H 4PRNA 4MFHA 3WIFA 1OTSD 3GRWA 5T3XE 3BDYH 2P3YA 2VDML 5HGAA 3UZEC 3FF7A 1KGCE 4JN2B 3MLYH 1FV1B 2HB0A 1SYSA 4U3SA 5BW7C 3BZDA 4H4NA 3AZUA 2IPUG 1JHLH 1S9XA 5E5UB 5CGBA 4L2LA 3ZDYF 4TQ8A 4G8FA 3VI4B 3KXFA 5AUMA 5FM5M 5FECA 2FO8A 1S7QB 1UA3A 1YEFL 2AQ3A 2APWA 3ZZLA 3NIFF 3DV4B 1V8HA 3LSOA 4GT0A 2C3VB 2VW7A 4I2XA 5SWZE 3PWVB 1OLZA 5B21A 5EZPA 4XVUD 3KCWA 1CE6B 3LIZL 1CFNA 1MG2C 1T04B 2HVJA 5E6ZA 3BZFB 2HT2D 1L9SA 3QARA 3B9DA 4QXVA 3AQZA 5HBBA 4QY8B 3EOAB 2GCYA 4CVZA 2E4FA 3ZE2F 1B0GA 4A7TA 3NFSH 2BRQA 1UWXK 2ZX7A 4OH2A 3DETC 3VH8G 4WHTB 3FCSA 3B43A 2J6EH 2Z7YA 1NFAA 2X4NA 3FT3B 4OM1L 3T04D 1KELL 3BP4A 2IWEA 4MD5B 1J1XL 3Q1SH 3BVWA 5LQBH 1CTOA 1NOAA 5DD0L 5D1QE 3HE7B 4DP5X 2FQDA 2C9AA 5JW3L 3DOSA 4YSPA 2PABA 3QC5X 2O5ZL 1KXVA 3ZTJH 1T21A 5DJYB 4YVNA 5D2LA 3KJ6H 2A74B 4IMLA 5JOEA 4GG6B 1BAFH 3QPQC 4M48L 4CC4C 2VZ1A 3B9VA 4DP1X 1MCBA 2DQ6A 4X5QA 1PZ2A 4AV0A 2JH2A 1YEHL 4EN3C 3MOBL 2FEDD 3AGVA 4P99A 2CCLA 1GAFL 3VGGA 3LH2H 4GY4A 1F18A 4OF3A 2EE0A 4EBQL 3D2UD 4NEHB 1CE1H 4L8BB 1BVNT 1RFDL 3B9KB 2XWRA 3O45B 1D5XB 5CJ8A 1LQBC 4AYEC 5D4HA 4DGVL 2Y07L 4AENA 2YD4A 3IJSA 4XMTA 2E8YA 3G04A 4A7QA 3DX7B 4GKSA 1KTDA 1W0VB 4B7IA 1YEJH 5IVXA 2UY6B 4NFCA 3T08A 4F8OA 4XHJD 1L0XA 1MRFH 1D9KA 4WFHE 1N7ML 2MNWA 4PUBL 1V7NH 2QVFB 3HZKB 2IBBA 3LHAA 2CHNA 4X4ME 5K9KB 4D9QD 2BXYA 3KYOA 3T2NL 5K5YA 2A9NL 1DQKA 3K2UL 5I19L 4ODSL 3UXFA 5BVPH 4JN1L 2IXQA 4HXAL 3KYAA 4XN1A 4HGWA 2FCBA 4S0TD 3LZPA 5KBNC 2XWJB 3F7VA 3O3DA 2VDMH 3PY9A 3IVKB 2DTMH 3T3PB 1HQRA 2V2WA 3WLBA 5F7HA 4X0NA 1M2OA 4XVJL 4F9LC 1U3NA 2WQVA 1BOGA 1TKWB 2CR3A 4IGBC 1F90L 4PREA 4DGIL 1HSAB 3NSXA 4HOMA 1JV5B 1QFPA 3BUQA 4IU3B 4PRIA 4QRBA 3K6SB 3OAZK 3T09A 2AV1B 4OD2B 1YEDA 1YEFH 5FK9A 4R5TA 4ZK8A 5I18L 2ZIDA 1LD9A 3KG5A 3CX5J 4MNQA 4K5NA 1BLNA 2R69L 4JFYA 5HGGS 4H8VA 3RL2A 1Q0YL 3NDYE 2HT3D 5IHZB 2F1BA 2BVPB 4E9RA 3IAQA 4KQ0A 1XTMA 5KSBE 4Q9BA 3VMNA 4MZRA 1W6WA 2EIKB 2BOLA 5I9QC 5DUBB 1U8IB 5J1AB 4LHJB 3SDAD 1A5FH 2E8ZA 4I18B 1YMMB 4OM1H 1A02N 2GFBB 4LZKA 2TAAA 1J1XH 4BINA 3MJGX 4FQIL 3S3CB 3AG1B 1F86A 2IPKB 3KVPA 4LCWB 1CFSB 1Y07A 5IIEA 1ZHKA 1G7PA 5DD0H 4BZYA 3CSYB 1J9CT 3KPNA 4TL5A 3MV9D 4I3GA 4AZUA 5JW3H 4H8UA 2UY7A 4X5XB 3CVIL 1FYHB 2AXJA 3V5KB 3PWPA 4AEFA 2FDBP 2O5ZH 2VXVL 4HK3J 1ZA6B 3KL5A 1FLRL 1YY8B 2VZ3A 2KH2B 2CE6A 2G0LA 5CJBA 4J12A 2ADGA 1VACA 4M48H 3ZPDA 2OQJA 5IWLC 3RPBA 1HOEA 2ZPKL 3NCMA 2WN3A 4AWJC 3N43F 5FFOA 1NKRA 1KBVA 3ZTCC 3MOBH 4NO2A 4Y4HC 1M2VB 2WINA 4QHNA 2IFFL 1GAFH 1MVFA 1BQLL 2WOYA 4PCKA 2FGWL 5K9QG 3RIFK 4OBRA 3QDJB 3DXAE 2SEBA 4APQC 4PGEA 4A2FA 1YRKA 1PX3A 3QO0A 1RFDH 4WK2B 5JORB 4OV5B 4DGVH 5CAYB 2Y07H 4FL4C 4FQQA 2R1XA 4PRPB 4ZFFB 4A7GF 2Q3AA 5G4NA 1FIGH 3EYOB 3EJZC 5E9NA 4S2SB 4WY7H 1S9YA 1XF3B 1N7MH 1HILA 3HS0A 4NN6B 4PUBH 4ACTA 5A6MA 2LW3A 5GZOA 1TJHL 3T2NH 4IBYA 2A9NH 2MNJB 3K2UH 5I19H 2CBMA 2RA1A 4JN1H 2OX5B 4FG6C 1SGKA 3WY3A 2ATKB 4MNHB 1G87A 4HXAH 2PXYD 4Y5VB 3WN5A 3PL6D 4BCXA 3OKKB 3MQIA 4G5AA 5L9DH 1MCNA 4GRLB 4XVJH 3VXTA 1BVZA 4HDIB 1ITCA 1FAKT 1WVZA 3HPJA 2JI2A 1N5YL 5ES4B 4JDTL 1RUQL 4B96A 1DFXA 1CQKA 1F90H 1NMAH 1AGFB 2AXFB 3G5XB 3MMEA 3OXRA 3C60D 3ZT5A 5E8OB 3BH8B 1IE5A 5EO9A 5IK3A 1WAPA 2PTVA 4YFDB 3RLSA 5GZNC 4WO0A 2WCGA 4XWGL 2HWZH 5J1SC 1HXMB 1LK3L 3C5SB 5GGVH 4QOKE 5LG1A 3VRJA 1CLYL 1ZPLA 4RCAA 3N0AA 2OV0A 1IC7H 1UD3A 2L7UA 3VFNB 1M57B 3MZGB 4Q4IA 2YPVL 3ZE1E 2ZF9A 2J5LC 3I9PA 4WTZG 3BVDB 1RZKC 3SY0B 3UAEA 1BFVL 5EZIH 3ZYOA 2ETWA 4XO3A 3X14B 3D69B 5JNYA 3V0HA 3TBWB 3CXDH 3SKNB 4WFFD 1SMAA 4OBSA 1NL0H 3LDBC 2AV7B 4FQIH 4K3HA 5KZCD 4CAGA 1A6VL 1N0LB 3CG8A 3QUZB 4G8GD 2QHLA 4J3OD 4A6YA 1DN0B 3I3DA 1DJSA 4UQIM 3DX3A 1W0YT 5CN1A 4BELD 3CVIH 4MYPA 2DYPD 3O4LA 1FLRH 4O2FB 1UKQA 1GYUA 4TNGA 3MCLL 5C3LD 5GS0D 3KPPA 3AM8A 2WBKA 4GRWB 4XMVA 1WT5A 4ZMXA 3ULUD 2F1EA 1XSJA 2ZPKH 3I50L 4ODHH 1OTTC 3SPIA 5L8KB 1HL8A 4DN4L 3HN8A 4L8CA 2MWCA 3DVNA 3QXDA 1RVFL 4AGLA 4A7GA 1A65A 4EOWL 5TDNB 2O5NA 1HYSD 4D2NA 2XPGB 2IFFH 4W9EC 4X7TA 5LBVA 1R5VB 1PZBA 1BQLH 1J05B 4HOZA 4YH6A 3LRLA 3SIKA 4HD5A 1E4KC 5C70A 4B9JA 1V3KA 3IJ8A 3DSNA 2VERN 3H42L 2YSSA 2WLLA 3V4UL 2I07A 4MJIB 2OR7A 2CIKA 3AT0A 1E9OB 1MQKL 2HCZX 2VN7A 3BLBA 3PJSA 1LE9A 3ASOB 5B3JF 4UCFA 4R5XA 1HEHC 1ZSDB 4NAQA 3SO3C 3I6KB 2EUWA 4MCYB 2XN9E 1NA8A 4FFZL 4FQPA 1OP5H 2DPKA 2RIKA 2V4LA 3D09A 4JFHE 2EVFA 2B4CC 2XPYA 1K3ZA 5HHPB 4XPFL 1HCVA 1TJHH 2EILB 4FTVD 4GKZB 3IGUA 1SHSA 5ECGA 1UWFA 1WZLA 3KLKA 5DQJA 3RWHB 4N0CC 1U2YA 3L81A 3WIHL 4RMRA 2X4TB 2NX5B 2CHDA 3RL1A 1SY6H 1URIA 2HZHA 4NWUL 1D6EB 3IJ7A 4UMSA 2F54D 1I1AA 4DPAX 1E67A 3B7YA 4V1DB 1OPGL 4RWYH 3T0ED 4PB9L 1N5YH 1WHPA 3EBIA 1RUQH 3MHZA 4H0LC 3QCVL 4PJHF 1P2CA 3GO1L 4KVCH 5IUSA 1E5AA 1UXWB 2MOQA 4LIQE 2FB4L 4NUGL 4OJYA 2QZQA 5E7FA 3GJFH 2VDMB 5JPNB 3EGDA 2A73B 5CD3A 3B7UX 2MQCA 2VXUL 1CLYH 1EZVY 3BWAB 3EGSA 5SV4A 5IBUB 1IU1A 5BVJA 3MO1B 3HI6H 2Q86A 1VF5C 2E9IA 2YPVH 3GK8L 4F7MB 2WOBA 4ZMZA 1BFVH 4LGRB 3UEZA 4FABL 3GIVB 3SBWA 3LEVL 4GMSH 4X42A 4G9FD 4TSBL 5KTEH 3T4YA 3TBYA 2YFNA 1A6VH 4LSUH 5H37A 2Z91A 4AEIL 1OTUC 3LVTA 1F5WA 4WJ5A 2CH8A 4WFGE 4AQ8A 4WWKD 3QIWA 4J7RA 1EQWA 5E4AA 1Q9WA 2UX7A 1FFOB 1MCWM 2Y25A 3H6JA 4G42A 1EVTC 1FNSL 4X5WA 3MCLH 3EH4B 4MMXA 1DUZA 3VA2C 4M43L 1U93A 4ODXA 1UCBL 3I50H 3II3A 4JFXB 1INQA 1TF4A 3MROA 2HFTA 4DN4H 4MZIA 2H3KA 1RVFH 3RWGA 4U1IB 3SKOB 1UOKA 4OF0A 3KCPA 5EZJA 3BO8A 2AJZA 2H6OA 5DJCB 1AIFB 4JQIA 4WSGA 1FZKA 2GG1A 2MQGA 4ZX5A 4FA7B 2X53A 2X4QB 1G5GA 3MGAA 3P9MB 1EHLL 3ZDYE 1FI8C 2NY0D 4WGKA 3DV6B 3U9UB 4CU7A 4ISVB 4LCVA 1FL3A 5GGVY 4EDWL 2ZUQC 3D39A 5KS9B 2H32H 4Q4EA 1M9SA 2H4EA 4X2UA 4FFZH 4NLHA 3SDDB 4AIZA 2DD8H 3MNWB 4PJ5D 6PCYA 1DVQA 4P46A 5IP4A 4ZX6A 4XPFH 4XNMA 2M26A 3GMQB 4R7VA 2HVKB 4PJHA 4PRIE 3VFMA 2H9GA 1NKOA 2IADA 3ZE2E 3WIHH 1VFBB 1YO4A 4GQPH 4KFMA 2V2TB 3HR5A 3HA0A 4GP5B 2N7BA 1NC2A 4IBTA 5ANMB 1G0YR 5TDOB 1EBPA 3TO4D 4OGAD 3GUTB 1OPGH 1E4HA 3FYEB 4PB9H 1KJ2H 3QQ9D 2EDTA 3JV0A 3QCVH 4NQSB 4S10A 4KKAD 3KDMA 2E46A 3BRFA 5CS7A 4MAYB 2PKDA 2FB4H 3KVDD 5J3HD 2R0KH 2I26N 4LGPB 3TNNB 4BSVA 2WLKA 1XGTB 4G6FB 4Y16D 3WE1A 2G5BA 2J2ZA 2VXUH 4EVNB 3CZFA 4LHUB 3BW9A 1XL6A 4IOSA 4M1DL 5BV7C 2XJKA 2V7HA 2R2HA 5DGQA 5FUZH 2EIEA 3KPSD 4YSUA 3G6AA 2BHZA 3GKWL 2B4CL 3GK8H 2XETA 2I7SA 3PWPE 4PJ9D 5GSVA 4K7PX 4WEMB 3UH8A 2PW2A 4GAGL 3LEVH 4HUKB 5A3ID 4TSBH 4PG9B 5MI0C 3EOYG 1T5WA 2E0PA 1I9RL 1J10A 4OZFG 1RP8A 2AJVL 3X1FA 4RMTA 1T0MB 4AEIH 1XCQB 1X9RA 1U8OA 4YPJA 5T1LA 3RIAF 1P7QD 2OA9A 2PWHA 3ILEA 3BPOB 5ILTL 1ZK5A 8PAZA 3C5JB 1M71A 1UD5A 1VFUA 2ZOOA 1MVUB 2DIBA 1NGWA 1YSOA 1INEL 2BVOA 3PAVA 4H5SB 4MAUH 3N1QC 3ZYZA 3PYCA 1FNSH 3FYIB 3MRQB 2Z4TA 1YVLA 2OYMA 4JFOA 3MOQA 3RUGF 4AJWA 4Z3GA 1LNUA 2ITFA 4PJ7B 1MLBA 1PX4A 3CN3A 3NEEA 2DQCL 4XXDA 3U6RA 2IQAA 5FA3A 1MLCA 3FW6A 1LM8V 3C60C 2YQ2A 4B9GA 1L5GB 4URKA 2VISA 2J8UF 3RTQA 3TT3H 3ZRFC 4FLOA 4QT5B 1CT8A 2A5UA 1CWVA 2WWMD 3EF4A 3WYRA 5CBEB 3LIZA 5CWSB 2VDNL 5CHNB 1S2EA 1C7SA 1RHFA 3OSVA 2R0WL 1RZKH 3DNKA 3DIVA 4ETQB 2XQ0A 1E4XL 2H1PL 1EHLH 3VA6A 4TVPL 5D1XD 3K71B 1T1ZB 3REVB 3OD3A 3BXNA 4ZS7L 5GS2D 1BP3B 5IMOB 3OAUL 2DAVA 4KVNL 5C08A 3O41A 1WS7A 3QEQD 4ICXA 3U46B 4UDUA 3DUSA 1JNNL 2JB6A 3JV5A 2NY5C 3NT0A 4PJBB 3GMPB 2GTQA 1VGKB 3WGVB 3TS8A 2GJZA 3JV4B 2P8PA 2IH1A 2K7QA 2HLFD 4WO4D 3OZKA 2I32A 1XIWD 2Y22A 3H53A 2WXRA 3CNKA 1ML0A 4HFWA 1V3LA 5E0QA 1A7PL 4IEFB 2BZDA 5FCUH 2X7LB 2DTSA 5D7SL 3EYQC 3W9DA 1KGXA 2WGXA 1F13A 2UXTA 1YDPB 4L1TA 4HS3B 1KGUA 4H8PA 2E74C 1SNRA 5DVLA 4HSAC 5KYXA 2P9RA 3JWDL 4LL4A 1W2KT 5C0BD 1ZD6A 2F7OA 3IFLL 3N0PB 3NSFA 5D7LB 3KYMA 3QH3A 4PLJD 3LPOA 4C58B 4YZFE 5KBMA 4HWNA 1NJ9B 3CVCA 1YN7B 1FRGL 4EN3B 4LO9A 1LO0L 1J8HA 3FOMA 2X6UA 1EZLA 4XOBA 4A55A 1CD9B 1CQYA 1SDDA 4RZCA 3FT0A 2DI7A 3Q48A 5T1MB 4KJQC 4F58L 1A1MA 1LWHA 3GKWH 3GPSA 3MBXL 5HHMB 2B4CH 1USQA 4F1SA 3GSOB 3GJFB 1IT9L 4GAGH 2JKRM 3DURA 4YAQA 4WI6A 2ICEC 5FGRA 1GZHC 4G7RB 2D2CC 3GSWA 2NUTB 3GNML 4MXVF 3MCYA 2WLIB 1O7DC 1Q9OA 3RUGA 2AJVH 3VH8A 4YC2C 4HJIA 4P9ML 7PCYA 4HHGA 1Y1DA 3HMXH 3VXSD 5ILTH 2J8UA 1C5DA 2WY3B 3KPOA 4JY4A 3U6XS 4XPHL 2E7LA 1INEH 1JI2A 3HE6C 1XGUB 4LCCA 2WP3T 4KMLB 1J0JA 4K9JA 4XI5D 2JQZA 3EJYD 3DBSA 4N2DA 4WW1B 3DOHA 4NBZB 3W9EB 3WGUB 4YHNB 2X1PA 4UQ9A 1QOKA 2FYYB 3K4AA 4XNUH 5F7YC 2DYSB 1BBJB 2P8LB 3RB7A 2C1PA 4JHVA 1YEIH 1D3CA 1OE2A 4NQEB 5BV7L 3ARED 2R69A 1U92B 1HHIA 3DOIA 2H0JA 2Z65C 4Q89A 4DQAA 3BRGC 2VDNH 3GZOA 1DJZA 5HHNB 1MWOA 5B8CA 5AL8A 2R0WH 3RVXC 1W0WA 4M6OL 1E4XH 2DH2A 2H1PH 3AG2B 4RMQA 4U0QB 4ZUVB 4TVPH 5D4QA 4B9CA 4EZJA 4ZS7H 1HTYA 2E27L 2N01B 3VUAA 3QDJE 1OF2A 2GTWB 1UM5L 4KNQA 3OAUH 4KVNH 3LN9A 4NZDA 3US9A 3BQUC 2AJ3B 3NN8B 4U6XA 3BVUA 5AZ2H 5EOQH 5I76A 5I9QB 2JJSC 2ITCB 2MOGA 3FCBA 4S1RL 2ZNWA 3UADA 1CDYA 1B2WL 4FRWA 4HIHB 5CFAA 3HW7A 3D34A 2W5PA 4PGCB 4J3VA 4NPYA 5LG6A 5GGTA 2H32B 2BIMA 5HTSA 4PWKA 1LEGA 2ZXAA 2DJ4A 1QTSA 4FKEA 4RAHA 4P23C 5IJKC 1UACL 1S7SB 4N0UE 4H20H 5IW1B 3FHAA 2SODB 3PJLA 2F18A 3TYGH 3T1WA 4Z77B 1YQ2A 2YPLD 4U1LB 1IEAB 4L3EA 3JWDH 3ML8A 2VZTA 4PGDA 5E94A 1Q72L 4KPHH 4LPWA 3IFLH 3FC8A 3MJ7A 4NAMA 1PD1A 4NKQB 3IRPX 4B53A 3HG1E 3QDAA 1I8AA 4PSPA 1G7JA 1TYRA 1CBJA 3D5OF 3PFQA 2BW4A 4ZD3L 4Y4HB 4KQ4L 3GSXB 1SMOA 2XXGA 2VDKB 4HKJB 5BZXA 3APFA 1KJ2B 3NVQA 2BSEA 4F58H 2BS9A 3LOWA 2NY0C 4YIQA 4APQB 1G9EA 2O5YH 4AIEA 5KSUA 2V8MA 3TBCA 5C6PB 4KAQL 3VGDA 2OMBA 1FO0A 4FL4B 5J89A 1TTBA 1IT9H 4M6NL 4O4YH 4C59B 2XPZA 3GTTA 5JW5A 2H8PA 3GNMH 3ES6A 4JVWA 1QSZA 5KW9L 2IANA 1JGIA 1T7XA 2DWEB 1QHOA 3ARXA 3CH1B 1KJ3H 3Q8CA 4I9WE 1Y18B 4JMXA 5B3JE 4WU7B 2LTQB 3E6FB 3F64A 2IPTL 1AZNA 4KQ3L 1DEDA 2OR9L 4XPHH 3QI9D 5AYTA 2YAFA 5DD3L 2CKNA 2XZCL 3FMGL 3IFOA 1VADA 4XCNA 3UTSB 3S4SG 4OGAC 2WYZA 2P7TB 3ILPA 4K94C 1ED3A 2IOOA 3QA3B 4HLEA 5F7UA 3E9TA 4YQXL 1NBCA 3S7GA 3QNZA 2FJGA 1JMZA 1S78D 4KKAC 2BCKA 3GGWA 4ZXBD 3GSNA 3A6BL 1BD2A 3ARDC 4K5LA 4RMSA 1AS8A 1DLFL 1OCRB 3D39E 5BV7H 3D33A 3IDGB 2FQEA 5D4IA 1EFXA 5MENA 2XNAB 4LSPL 1WBZB 5T33L 4N2NA 4I9XA 4X6EA 4M6OH 1EJOL 3A4AA 2WBJC 3O6LL 3H9HA 1LEIA 4PJHE 2YPVA 3U79A 3BH9B 4N0FB 4F7KA 4GB9A 1PZDA 2BVTA 3ILQD 2ZCKL 5E1GA 2D3JA 2E27H 1NM9A 5LGKA 4PI2A 5EOTA 4KX8A 4AKOA 4NKMA 1DLHA 3S3PA 2R8SL 4HEME 2EO1A 5JZ7C 1U4EA 3MA7B 3KE0A 1G9MC 1AD0A 2IALA 5HPMA 1BVOA 1PBYA 3QULB 5C71A 4R26H 4WHCA 1T0NB 3G3LA 1HXYB 1A25A 3VE0B 4S1RH 1ZTXE 1B2WH 3UPAA 4MZ2A 3RI5F 5F6IC 2CUAA 2Y7QB 3GB7A 2AHIA 3TTYA 3I3EA 4IRSA 1E8XA 2GJRA 3CQPA 4X98A 3ULAB 2R1YA 2J1ZA 5DVOA 5F3BA 2Y5QA 4KJPC 2AK1L 2X0WA 5SWSA 3WTVA 4N2BA 1GW6A 5C0IA 2APFA 2ZE0A 2EVHA 4CSTA 4KJYA 4PJEF 4MJ5B 5BJTA 1JNJA 3WEAA 2AVFA 2V6HA 4HKXA 4ZD3H 1MCEA 4Z9KB 1GS6X 4GO6B 2VN3A 3ARGC 4X6FA 4M3HA 4KROD 3TIDB 2VKXA 2Z93A 4NRYA 5D1XC 1LJMA 1U3HD 2FX7H 4J6IA 4WU5A 2EDXA 4KAQH 1AO7D 4TPRL 4BIKA 3B5TA 2WKLA 1QI5A 2ODHA 4OZ4A 2OTWA 1WYJA 3HVDA 5GRJL 2WZPD 3C6SB 3FU3A 2RACA 1XEUA 2NZ9D 2AKRA 3SO3B 3Q3GA 4Z3FA 5KW9H 4FYQA 1GS8A 5L0QC 1A14L 1JGUL 2QKSA 2OW6A 2XIDA 4OCNC 3RKDD 2DL9A 1TZOA 3EBAA 1FL5B 5I0XA 3D6GA 1IRAY 1MF2L 2IPTH 3H7BB 4KQ3H 1OAQL 4LLVA 4NXSA 4I7ZC 1YEKL 2F5AL 2OR9H 5DA0B 5TTRA 3SCMC 3UBFA 1LDSA 3AXLA 2XZCH 3CBRA 3FMGH 2A0LD 4Y4FD 4ABUA 9CGTA 4TS6A 2MCPL 1AG6A 4PRHB 1DZ0A 3NCEB 5CZKA 2ZNXA 1HH9B 1ILUA 3TLRA 4C55A 4X6CF 4YQXH 4U05A 3QR1A 3PGCB 2VO8A 4BZ2H 1R4XA 4L37B 1DLFH 4M02A 3HUJB 2CO1A 5FC9A 3O9WA 3QUXD 4RDBA 4LDCA 3GDCA 4ADJA 1PTZA 1I3RA 2CXGA 3GFUA 4LSPH 5FOBA 1U36A 1PLAA 4K23L 1EA9C 1EJOH 4EO5A 5E00A 1BFTA 2ZCKH 1BXUA 1CLCA 1H3UA 3J2PA 2QJDA 4OF7A 5DRZB 4FADA 1GGYA 3QUMH 1XV8A 2Y1AA 1ORSB 1XZ0A 1N19A 3IFPA 4FG4A 4Y8AA 2MCG1 4YL4A 5I0VA 3QDMD 5AKVA 4B60A 1TCMA 3HPLA 2KDGA 5DZLA 4LOFA 3H9SD 4UT6H 3VD9A 3C6LD 5E8PA 5DSCB 5EUKB 1K2DB 2IH3A 5A2JH 1F3JA 3P02A 3X1GA 3LEXA 5AVXB 3VYPA 2VR7A 5BQ7A 2EEAA 1WCBA 3CC5A 4PJEA 4WNQA 2Q0ZX 1T1XA 1J8HE 3WI9A 1J5CA 1KGIA 2BP5M 3RPIB 5GRYA 1JI1A 5FAAA 4BH7A 4X7DC 2AK1H 4FI8A 1TTFA 5CLZA 1KACB 1E5ZA 4FMVA 4JO4H 1M7IA 1T1WA 1QAWA 1R3HB 4GXUM 1WO2A 4JE0A 2WVUA 3KLDA 2WXJA 3ISYA 4KKRA 4A66A 3V9FA 2YAOA 1MHPL 3L3GB 1JNHA 3LCYA 1AGBB 1UGKA 2F7IA 5IV2B 2PW1B 1RLBA 4JRXA 5TH2A 3G7TA 1CFQB 5GGQL 5C0AB 3B5HA 2WAQA 4OJFL 1KWKA 1NCUA 4JJ5A 2QQNL 5LHDA 3KPQA 4TPRH 4Y5XA 5EEXA 2HPOA 1G7QB 4DZBB 2K45A 4XN4A 5GRJH 1BFOA 4D0DA 5I66A 4TQEH 3UJTL 1EANA 2I9LB 1UXMA 2EXWD 2ZUQB 3WJJA 1KDIA 1L9OA 1KXTA 5IR1B 2H3XC 5JPMA 2YA1A 1A14H 1JGUH 4X6CA 5EOCL 4OFPA 4QRPA 1MF2H 2JLLA 4W4NA 2W9LA 2F5AH 4P3DA 3AQXA 3UTTB 4MLSA 4WRLA 3MV9B 2MCPH 1JG9A 3K46A 5PCYA 1OV8A 3H1ZA 3QIUD 3ZMRA 5F7BA 3NZSA 3EUDA 1RP9A 1NCGA 1K8DA 3BN9D 4MX7B 5DJ6B 3HRPA 2XN1A 4G43A 5B1JC 2PYEB 3FO2A 2V37A 2ROYA 4RFNC 2QHRL 5KUKA 1ZJBA 2FLRT 1EWHA 1YJDL 3GMNA 4TULH 4K23H 3I2CL 1BXVA 2D7QA 4EI5A 2DMCA 4O51B 4Y1AB 3PHAA 2HFFB 4WF7A 1G4MA 2ADJB 4ZUWB 1JDCA 5HVFB 5BV7B 2CG9X 3D0VA 5IROA 1UZ6F 5LKNA 2K70A 5BS0D 4XOEA 5KVFL 2ATAA 2BSRB 4R4BB 2WJ5A 4FQLH 4HUVB 2QKIC 2W81C 3J07A 4ALAC 4HC1L 2VN4A 4L3EE 4A39A 2A9CA 1O6VA 1IEBB 2YK1L 4IKKA 5MI0B 1OY3B 5FKPA 4K94H 2NDGA 1JPFB 4JFUA 5EIVA 4Y19B 4AJ0A 1OHQA 4LAQH 2LU7A 1HIML 1SLWA 1YECH 3CDYA 3CMGA 1OAUH 4F2MA 4WI4A 3MNZA 4LRNL 1HS6A 1KB9K 5DJXA 1BJMA 2IAAC 3PL6B 1TOXA 2VL5B 2CXKA 1ZVNA 2PR4L 1HZLA 3DTXB 3EFOB 3MFFA 1HC1A 3RNKA 1HL4A 3VXMD 2PCFB 3DRTA 3C60B 4U1HB 5IQ7L 3SO5A 1BZOA 1FUNA 1MHPH 1A47A 1ACYH 2WLJA 3HBZA 4ZUUB 1MI5A 3LRMA 1XH2A 4NZTH 4G5ZL 1G9MH 1V55B 4C56A 4CRPA 4NHCL 5GGQH 4FI6A 5IW6A 3UG3A 2Y7NA 4OJFH 1TZ8A 3FQUA 1Z9SA 3SGEH 2QQNH 2YC1B 3DHJA 4L29B 4OCXL 3SE3C 1MDAA 4OUOA 3UO8B 3W2DL 2A9BA 2VR6A 2XKSA 1MJ7H 3FO9B 2BPBA 1A8JH 4FXKA 5DI8B 3VB8A 1CLOH 1PS3A 2VH5L 2FHCA 3UJTH 5I6XB 3OLEA 2BC4A 4P2QA 3Q9QA 4QRTB 3PRZA 2VDRB 4R8WL 2YD1A 1QPPA 1A6ZA 2AZUA 2NY4C 5EOCH 3MGTA 3DIFA 4QRRB 1BD2E 4OZFA 1XGQA 3MLZL 5DC9B 3TBTA 5BZDB 1FL6A 3QUYC 1ZS8B 1V7ML 4AH2B 3V0WL 5LXGL 5MENE 5AZEL 3FT4B 4R83A 1ULVA 1GY1A 3MLVL 1NAMH 4Z3JA 2C3HA 2VRAA 4ZFQA 3RJQB 5GIRA 4KXAA 1CURA 2ZUXA 1HCFX 2APXA 4MB3A 4PJ8C 3SZ6A 4I0PD 4KKCD 1A4CA 3AABA 2GK0A 2K9UA 1LXMA 2NYYD 4XH2B 2AQNA 2QHRH 5AVTB 3RVTD 4LVHC 5AB9A 4PP1D 1B6DA 1AXTL 4H1LA 4IDJH 1UFGA 4P3CL 1KPUA 2VKWA 3DK0A 5EOCJ 5AVRB 3JWOC 3TU6A 5JDJA 4KROC 1SJVA 3ROOA 4GLRI 3QG6A 5D6CB 2VN5A 4U33A 3W0WB 3I02A 2EC9T 2FBOJ 4FJYA 1K4DB 5SWSE 2B15A 1FNHA 3VVVA 3AU1B 2CK0H 4JGMA 1HQ4A 5J6SA 3UZQA 2EYSB 5I5RA 3QJSB 5EC2B 3QUMB 4YC2B 3BUYA 2OZ4L 4FTVB 1QBAA 1MZYA 4K5OA 4OLZL 5ERWA 1C9SA 1A1NB 4LFHG 4KK6D 1NFDB 3SQBA 2FL5B 3QFJA 2CIIA 1X9LA 3KR3L 4PRDA 1PSKL 4UIMB 4LRNH 3MUJA 2F54B 4RAUA 1AZZC 2PR4H 3POCA 2WZAA 2VR4A 2CPUA 3T5WA 4NCC1 5D6DC 4JGUA 1ODUA 5IQ7H 3VWKA 5C9JA 3MRRA 1IBYA 4I8DA 4ZMYA 1BG9A 3E6HB 4Y2DC 1IO4C 5I8EB 4G5ZH 1OANA 4NHCH 5T3ZH 3RILA 4PJIE 3U0PA 3T1FB 1ZWIA 4OCXH 3S4SB 3W2DH 5HSFA 1ETZB 5JOPE 1UQSA 2ERJC 3T3MF 2APSA 3HG0A 3TA4D 1P7KB 3K7UA 4FNSA 4KK9C 5EMYA 3WAJA 4TOYL 5F7WC 3BIAX 1JNLL 1R33A 4F7CB 5F7DB 2OMZA 3MLZH 4UTBH 1D5MA 4QYOA 5LXGH 3UYOD 5AZEH 3RQ3A 1UVQA 4ODWB 3RU8L 2UWEB 3ORJA 1EHXA 1OGTA 2RR3A 3F58L 3MLVH 3MV8B 4WWKB 1HINL 1AFVH 3WFHB 1I3UA 1KFAL 1QEXA 3F83A 1O7VA 3ATAA 2X89A 4C4BA 1N9PA 1GGCL 4A38A 1JK8A 4NFBA 4GKNA 1DSFL 2BSSA 4KK8D 4NQDA 3OMZA 4G9DA 3R7RA 3QQDB 1FNAA 2FBJL 3HVNA 2ZX5A 1AXTH 43CAB 2IAMD 4KKBC 1NCHA 1NDMA 4C47A 3EYUL 5I1JL 4YXKL 4MHHI 4N8VG 1O75A 3F8UB 5DO2D 4JS7A 2X4PB 3TBSB 2VXSL 5T1DL 1IKFL 4PJEE 4RX4D 4XCCL 2CJTA 2I24N 3ML9A 2NY0B 4Z7AA 3FUKA 3JBG7 3KPMB 4LLDB 5BZWA 1SOQA 4HCRH 4Y5YA 2VLRA 4OGQC 2AXWA 3TBVA 1I7RB 1PW3A 2EXWC 4RMWA 5GRVK 3FQ2A 3NQIA 4M6ML 4ZAKA 4BFFA 2UXVA 4EI6B 3U82B 4PJ5B 5C3IA 2YGPA 1N64L 4ONHB 2OZ4H 5C0EA 1NCJA 3DWTA 1GJUA 4NENB 2NUPB 2A9AA 5TF1L 1E3ZA 1NGZB 3CFKB 4L4VB 4OLZH 2OJZL 3TVMA 1KZQA 2PO6C 3W38A 2Y5TB 3KR3H 3R1GL 1SBSL 2ICWI 1VFMA 1CXHA 1T22B 5MHSD 5DEGA 3BN9C 5LJYH 1NBYA 2XWBA 5I1DA 2G2PA 4NKOB 3JWOL 1E6JL 4P5MB 3SPVB 1TFHA 5AG9A 4E2OA 2VQ1A 2NOYA 3L6FB 4MD0A 4S0SD 5GJTH 1DBML 3PWUB 5HYJA 1I8LA 1CB4A 3VD4A 3PWJB 2JJUA 2BVQB 4DUVA 3JVGA 1YPZB 4X6CE 4HF5L 2VMEA 4OLXL 2W95A 2EXYC 3C09C 1WWWX 3L1EA 1HYRC 3GHEL 2JVUA 4Y16B 4BK4A 2WV3A 3D18A 4GSDL 2V7NB 4MA1C 2WBJB 2YXMA 4ALAH 1TETL 2VC2B 4GG6F 4ZPTA 2GEQA 5GS1A 4L3FA 1E5UI 2ICWB 4IM8A 3KPSB 1W8NA 1MJJB 1G7LA 2GYSA 3CFJB 2X28A 3KBEA 4HX1A 1RAMA 5BXFA 4TOYH 3MBED 4FNQA 4JJOA 1TQSA 1TQCC 3GT6A 4RQQA 3ZE0F 1JNLH 2W0KA 2Y5EA 2XVBA 4XVTH 2ADIB 5IBLD 2VABA 3X1NA 2OMUA 3BP7A 3FO1A 5KYYB 3WNLA 1E9PB 4OTXL 2XXCB 1FWXA 3DJSA 2AQPA 4JQXA 3WY2A 1A9EA 3RU8H 4ETYA 3P73A 2F53A 4IIQC 1P7QB 5FDWB 1N5AA 2X1QA 3L3OA 4I89A 1MIEH 1HINH 2BOBB 2HFEA 1JZ6A 2PCPB 4JZJA 4JY6A 1J5HA 1IC5L 3K4DA 3KPRD 1GGCH 3MKKA 4XMPH 1PIGA 5KSAA 4MXQC 1DSFH 3DMMC 4JN2A 3G5ZB 4JPKL 4TUOA 3IDUA 4PRHE 5EO1A 1LO3L 3ARSA 3FFCD 3FOLA 5H94B 2FBJH 2MMXA 4N1EA 4NOBA 4QJ5B 3ZDWA 5A2CA 4FLRA 3VXUD 2VM9A 1DJIA 1NAMB 3RDJA 2G60L 3EYUH 5DK0B 2WANA 4F33B 4YXKH 1JPTH 1EMTL 1PG7W 3HUJE 5C07D 1AH1A 2VDQB 5F0MB 5CFHA 2VXSH 5D7HA 1IKFH 2VTFA 2IDQA 2HJFB 1GKOA 3GXIA 3QZWB 4IKJA 1U8CB 4Z7OF 2CRZA 3GS4A 4UZSA 5D1XB 4AJVA 3ZK0A 4KZDL 2G3XA 4F2ME 5F21B 5F1IB 1UH2A 1WZAA 1J5DA 1F0LA 1JN6A 3NMEA 4TF4A 4XOCA 3BH4A 4M6MH 1H3TA 1CDIA 1Q8MA 2X40A 4QTIL 4WHTA 2GJ6D 3CDCA 4RFEB 5L0QB 4WO4B 4ONGL 5TF1H 9PCYA 2WMPB 4TVPE 4ZFZA 1MI5E 5DJ2B 4YHML 4WFGD 3SCMB 2Y6TE 4C56E 2XWEA 1HE8A 1OGSA 3IJ9A 2J25A 1SBSH 4PY7A 2VJ0A 1P5UA 3TZVD 3LKOB 4AXWB 5C0JA 4KKCC 1P69B 1FF5A 1E6JH 3JWOH 1Q9LB 4GG6A 4UYQA 2I7OA 5H2BB 2A6IB 1U8MB 3STZA 4S0HA 1DBMH 3A4EA 2UX6A 2WXLA 1A4BA 3N9GL 5CCKL 2PETA 1HZKA 4KK5D 1GS7A 1MFEL 3D08A 4HF5H 4TNVK 1ET8A 1EO7A 1A7BA 1ZHLB 2BRRL 4L1HA 4PS8A 3LQZA 5AVWB 4NYLA 5DJ0B 5FYKD 3IS0X 4M1GH 25C8L 4ONOA 1SXNA 5HY9A 2EEFA 1OQXA 2GSGA 3B9KA 3DARA 4U4IA 3UDWC 3WS6A 4R0LA 3ZKQD 4MMZC 2DMGA 2MQ3A 1NMBL 5PAZA 3VXNB 1X5ZA 4NT6B 4GBXC 2NRDA 1FE8L 1G7HB 5ESQB 3SE4A 1W0VA 2FIKA 3L08A 2XYBA 3S88H 3L17A 4TUKL 4FQHB 3FH7A 1EZVX 3D4YA 1JDDA 4G8AC 5JHAA 2N59A 3CLWA 5CCJA 2HTLD 4UOJA 4PD4K 3V4VH 2E9JA 1HOCB 2DICA 2E9BA 3A23A 5LAPA 2EDMA 5JW4Q 4OZIF 1R3IL 5CIPH 4GSQA 3VG0L 3VXSB 2OMXB 3GMRA 2RJMA 3U4BH 1UM4L 4E5XG 4KRPC 1WFNA 1WTGT 1LILA 4CILA 3P54A 3LN5B 5DZAA 15C8L 2FUQA 1RJYB 1B90A 2NY2C 3AS1A 2EEXA 3IDNA 4G1MB 4JPKH 2PP9A 2AAVA 4DFIA 3MYJB 2UUDK 4JFQB 4L4TD 3HG4A 4XE5B 3MREA 1BV8A 3VFSB 3FCUB 4DIXA 2G60H 1ZT4A 3ARFC 1VERA 1WAAF 4JFEB 4J3TA 3CFCL 3K6SA 4I13B 1W91A 4YJZL 4JZNB 5SX4H 4HJ0D 4E9LA 1HHGA 2VDLL 1Q9KB 2VXQA 2FO4B 3E3QC 3GXTA 3KWTA 3FDWA 2WLNA 2PWFA 2OXGA 3MRIB 3O2VH 4M8RA 4DVBB 5E6IA 3MV7D 4XNDA 2HP4A 4DO4A 4OFYA 2NDFA 4P4KD 2J8OA 5IMMB 1ASPA 2QVIA 3EJQA 5B4MD 3RIAK 4HMCA 3H4FA 1ASQA 3HG2A 1ZGLB 4HOXA 4QTIH 2OYLA 3OKDB 5CD5D 2WVSA 4JRYD 1R34A 1Q0XL 1YMMA 4I18A 3K3QA 4YHLH 5LGHH 5TPWL 3PIQB 3THMH 1YCSA 5DMGD 1TTRA 3GMLA 5AW5B 2IPKA 2C34A 4MVBD 4PJXB 1WZ1L 2H2SD 5AVQB 3PNWB 1SJXA 3QVAA 3L7EB 1OIOA 1PKQE 2WKGA 4UANA 3VD1A 3ULVD 1OT1A 4Z7NF 2WXIA 1L7IL 3EBHA 5J9PB 2R27A 2JWYA 4OJCA 1ZA6A 2CO7B 2ZOUA 2AGJL 2FD6L 4F3FB 4F8PA 3TYFA 2EVGA 4KK8C 5F7NC 3ZHNA 4HAFA 2X44D 1RERA 3UCRA 2YPLB 2ZSWB 4PWGA 1BQHA 1P4LA 2GB2A 2F7RA 3N9GH 5ISZB 4DW2L 2QR0B 3JZ7A 2YQGA 1ZVYA 3O3BB 4RFNB 4QUOA 4YDVA 2LGNA 1KLGA 1MFEH 3UIYA 2BRRH 4I48B 3J27A 2ESVB 3ZRSA 1I8KA 3MRHB 2R2BA 1HWHB 1DVFA 3VFRB 2QDVA 3NIDF 2Z35A 2FLBT 25C8H 2O26U 1AKPA 4GRWF 4OV5A 4OZIA 1TZIB 4EUPB 1LTXA 3B56A 4HC1A 2FEJA 5LO7A 4Q9RL 2P5ED 4ZFFA 1S3RA 1FE8H 2R2EB 5JW4N 3ARVA 1B0IA 1SYVB 4KI5D 3CIQA 4D8PB 1NM4A 4TUKH 1T6BX 2UZXB 3ME0B 1JFHA 4FFYH 4YSSA 1DBKH 5DJZA 3OF6A 2QKIB 1AGEB 5D7IB 4AL8L 3JV6B 1U58A 1NQBA 4BZ1L 1R3IH 3VG0H 3GSVB 1JZGA 1UM4H 5DHYA 1WAAA 5FUCE 4IS6A 3WY1A 1YYCA 1EEYA 3QI9B 2H2PC 3OQ3B 4Y5VA 3BRDA 3WHE1 4HCGA 4N85A 3WFBL 2A6KA 1WIUA 1ZVHA 4X9HA 5DZJA 4YSEA 1RK0B 3L3DB 3PG2A 2AABH 1FORL 1FH5L 1IBBA 3ALXA 1J5IA 4JDEB 2H0EA 2HMID 2ZG3A 2XN2A 5E8OA 3BH8A 4JM2F 4GW5B 1AQHA 3CFCH 5AKTA 3OGCA 1BOYA 3T6ZA 2C8NA 2F8OA 2DI9A 4FFWD 1EVUA 2VDLH 2VIRB 4I3RL 2DDQH 3VDBA 1YY9C 1HXMA 1F3RB 1R47A 3C5SA 4PLNC 3D4ZA 3ARBD 1S7VA 5EBLA 5JQ6H 4Z7QF 4MQXC 3UTQB 2IG2L 4E68A 1CFMA 2XWTB 1B4RA 4S1DC 1QWHA 1ONQB 3C5XA 3N40P 1ZSHA 2YA2A 1U3YA 3SY0A 1KT2B 2ZTBA 4FZ8L 3L45A 3J7HA 4HUUB 1KBKA 5F0LB 1HWGB 3D69A 3WKYA 1NCNA 1OT2A 3FONA 4NBXB 1Z7JA 5F1KC 2EECA 4WJKB 1FGNL 3TXAA 2OTPA 2NY4B 4RWHA 5HYJE 2KZBA 4WUUD 5F7MC 1N0LA 4KBPA 3UOAB 2ZWKA 4HCFA 1JF6A 3QUYB 3RWIB 4GQRA 3WKPA 4FQXA 4QJ3B 3OPZL 3WJLC 3VXPA 1O7DE 3KL0A 2WQAA 4HLZH 5DJDA 1RZGB 1L7IH 2BM3A 5E9DA 4BFKA 1UCTA 2AGJH 2FD6H 1WZKA 4E41A 1ITBB 2X41A 4YXLL 2ALWA 3QFDA 5DDHB 2YN3A 5ENWA 1V5JA 4PJ8B 1GA2A 5BRZE 4FHBD 1NUNB 3O6FD 2IGLA 4MJJA 1M05A 2MSPA 4DW2H 3D1MC 3L4VA 1ZHNA 5TDNA 2RQ8A 2O6FA 1J9QA 1R5VA 2O5XL 1ZLWK 3NSDA 4UM9B 3SYAA 5J6HA 2J1YA 5DYOB 2FSEB 3IRZA 1WFTA 4KROB 1V10A 1WAEA 2A38A 3LV3B 1QSEE 2C5DC 2F53E 3AS2A 1K5WA 1ICTA 5C7XH 5ID1A 3K91A 1VCAA 1KTKE 4ERSH 1E9OA 3GTVA 4XTRC 4P4RB 4W9JC 4HIJA 1ZDSA 4U1MA 1ZSDA 1BF5A 4ANWA 3MI6A 1LO5B 1DVZA 3BSGA 3FUNA 4AL8H 1WGVA 3REWB 5HHPA 1QNIA 1E27A 3FUMA 2GHWB 4NQCD 3RYMA 3WKNA 4AOFA 3RWHA 4JM2A 2CRMA 3QWQB 2X4TA 5HYIA 2ZUWA 3CBKB 4Y4FB 4OD1L 4H8WC 1GGBL 5C0GA 3WFBH 1ZANL 1T2QL 4RMBA 3TZVC 4R4ND 4A68A 1TVHA 5B1KA 4LVOC 4YDIH 1U8KB 4Y9BA 5AVZB 3V4VB 2NY3C 1EHNA 1X5KA 1FH5H 1RD6A 5F72S 5CIPB 5CEYB 1R5WA 3IE4A 1YUKB 4P9HC 4Z95L 1IZJA 4QCIB 4X9IA 4OCRL 3B1TA 3HC0B 2EDKA 1J9TA 1T5KA 4I3RH 2J43A 4N90D 4Y2DB 5JPNA 1FNEA 1AZRA 2YD7A 4NQVB 1AXSB 5HYFA 3VFTB 2A73A 3VXRD 1NBVH 2YEQA 3H2PA 4M62H 1QRNA 3WSQL 2OM5A 3OB8A 4G6AD 1QFHA 4ZFOB 1CVSC 3BWAA 1JF1B 5JMRA 2DZEA 3NYKA 2Q6WB 2BP8B 2QSVA 2IJ0C 2ERJB 1JZ2A 3BGAA 2IDUA 4F7MA 4F8NA 4HPHA 3CDGB 5MEOB 1DO6A 1JP5A 2ATPA 4M7JL 4ES9A 1FGNH 1ACZA 5EF2A 4XP9L 4X99A 1J0IA 1NDTA 2UYLA 5T3XD 4LPXA 2V17L 1MDTA 4MDIA 1MEXH 2X2HA 3SPJA 1KGCD 3OPZH 1XL4A 3ZE0E 3TV8A 1KNOA 2W60B 3GINA 5A1AA 3ARTA 3IXAB 4MXWL 2DI8A 4M03A 1WFMA 3SOTA 1BYOA 4YXLH 5FXCH 3M1OA 5HDOA 1WF5A 1T5XB 3BWSA 2HJKB 4V2BA 2WUCL 3PU7A 1CGYA 4BDVA 4PRBB 3TONA 2FGZA 2XZZA 3B6SB 4DGWC 5EH1A 1S9WB 5JYLA 2O5XH 1XBDA 2B1AH 3SDCC 1FFPB 3TN0A 3WL9A 3CZLA 3Q8BA 3IJHB 1NH6A 4PH8A 3MRMB 4Z23A 1S7XB 1JHTB 1R1CA 1AS7A 3BT2H 4WIQA 4JCMA 4BH8B 3P9MA 4NRZB 2L0DA 4ACPA 2Q9OA 5C09A 4PQXA 3U9UA 5KUMA 2ADYA 1J5OH 1RJCA 1UWXH 3CFEB 2YFOA 2HH0L 5DUPL 3QNXA 4X9GA 3RGVD 3RI5K 4ELMB 4F20A 5JXEA 5BUAA 4UZUA 1U33A 3LPPA 3IETB 4Z7OE 3HIZA 3DTDA 5DMIL 1I8MA 2IBGA 4Z7UF 3L7FA 3SODB 1JZDC 1IQDA 1OAZH 3BHBB 3VWJC 2VAAA 4MVBC 2QL1A 2HVKA 3S3SA 1CTNA 4JBSA 4XXWA 3ZHFA 5IJVB 2FJFB 5IB3B 1LO4L 3I6GA 4CGUB 4K71B 5DZPA 1JXGA 1NFKA 4E9WA 2JI1A 4BE6A 3HI1A 5CJXA 4KVPA 4IBZA 3U0WL 1ZANH 1T2QH 2O93L 5C0CD 4PRAA 4PJBF 3GUTA 3OJVC 3K2KA 4BWTA 2EXTA 1BWWA 2B08A 5I75C 3FHEA 3BAEL 4OCRH 1IMHC 2AJYH 4Q7DA 4OLUL 5DMKA 4WK0B 3TNNA 2ODIA 3UGUA 3ZZQA 4FTDA 3UABA 5E8EB 1SM3L 3BEVB 2ORBH 3NEOA 2R4SL 5F1OB 1HH6A 3WSQH 2AJXH 3COOA 3UTOA 4WFHD 1EJFA 1Z5LA 2CHWA 5FGBC 4TVUA 4ZNCD 4QXUH 2F5BL 4K3GA 4AUYA 4FAAB 2BNQA 4M7JH 4ODUB 1TQCB 4O02L 4NFDA 4XP9H 5LBSL 2PP7A 4H8WL 2DWSA 2I60H 3AC0A 2V17H 3QUHA 1XCQA 4G1EB 4ZDHA 4O2EB 5AOLA 2W07B 4J3BA 3AB0C 1TSRA 3X11B 5IEHA 1MVUA 4FJ6A 4IIQB 1HK6A 4P9HL 2HLAA 4AMWA 4UTAL 1FC1A 2B59B 2AANA 1PG7X 3MRQA 5KVFE 3FRPB 1UENA 4OZIE 1KIQA 1Z0NA 2AMGA 3UZEA 3BP6B 1EEUA 2BXZA 3DMMB 4CU8A 4F7PB 5HJBA 1CD1A 2WUCH 3OAZH 1L5GA 4PTUB 1ZA3B 4GOSA 1QZ1A 3MNVA 3T4AB 5CBEA 4F5CA 4OY9A 3U2IA 4NNPL 1GZPB 5C2BL 4Z7UA 5I82A 1CYGA 2AK4E 3L95B 4L3AA 5FHBL 4BKLB 1A3LL 1S3KL 3D3VE 4OGYH 1E9QA 1NINA 2RCSH 2Z7UA 3L4YA 1MRDL 3OXSA 3X1EA 1EGJL 4PBDA 2JKSA 3QIBA 1CDCA 2HH0H 3L4WA 4Z18A 3WKML 1CK0L 2Q7YB 1A9BA 3EAKA 4LEXL 4M8QA 3U46A 5DMIH 3L9EA 4PJBA 4Y2OA 2XBTA 3GMPA 1OK0A 1VGKA 1MHCA 3JV4A 3RWFA 4IHBA 2VUOA 3O8XA 3ZL4H 3UBXG 2CBTA 4TYUA 2WSPA 3FB6B 3MRKA 4JDVA 4PP2B 4J4PD 3EOBA 4IEFA 2GSMB 2X7LA 3VFUB 4GEJA 4X0KA 3MX0B 2BMKA 4KDWA 5AW8B 4WZ9A 3HMWL 1FJ1B 4R9HA 5B38G 2BSTB 1YDPA 2OULB 4LASH 5CUSH 1QYGH 3X3FL 2QPEB 3QXTA 5CZVH 1NLDL 2X9XA 3RIKA 4Z7NE 2BNRA 3U2SA 4UINL 3NUKA 1TT6A 4P2OC 2V5MA 3WFDL 2BO0A 2FX9L 5GS0L 4R97B 4U6YA 1YN7A 3ULUL 3K81A 2JQMA 1SM3H 3X17A 1BHGA 2R4SH 4C4UA 1PNCA 2KDYA 1MRCH 3NIGB 3TWCL 2HJLA 5E0FA 2F8VA 3VVWA 2WB1A 3WD5H 2RBLA 4NIKB 5HDWA 3LKPA 5I17A 1RXLA 2Y2YA 4MMZB 3RVUC 1QFWI 4OCSL 2E6JA 4KMTL 1BF8A 1V3JA 3NIDE 3QC6X 4GBXB 4E41E 4CVWA 1ZV9A 4PW9A 3PGDB 3TOPA 1QQDB 2LOEA 2MEJB 3G6JF 4O02H 5F7AA 5HI4D 5INDB 3W37A 2WLIA 3PV7A 4R3SB 5F88A 5LBSH 3IMUA 4H8WH 1TMCB 4PV9A 4OZGF 4MBRA 1FVDB 2V9UA 4HPYL 2X1OA 4OFDA 1FG2B 5KJRH 2PWEA 2YUZA 3PDGA 2VLKA 2ZCZA 5HXMA 5KSVB 1IJNA 3PP3K 4P9HH 4UBDD 2P46B 3AG3B 4KRPB 1I8UA 4XNBA 4CMMB 5IVZB 4YHNA 2FYYA 3VSQA 4W9GC 2OK0L 3DGGA 3SQOH 1BBJA 4Y4KD 4QOKD 2P8LA 1TEFA 2V5SA 1QO3A 4L9DA 3MLWH 2G2RB 4IRJD 2F74A 2XN0A 3G5VA 4XN5A 4U6VH 1JPEA 3ALPA 5ALCL 4ZW3A 3ARFB 3QORD 5HHNA 4NNPH 3D85B 3FO0L 4K9EC 5C2BH 3U36B 1U8LA 3MUHL 1LL1A 5A16B 2JIXD 5HHOE 1A3LH 2K8MA 4G6AC 4XPGH 2K0RA 2C4FU 4P06A 2AW2A 1EGJH 1UOWA 4NNXB 2ZWZA 1CK0H 2QGBA 3NN8A 1IGMH 4XBPA 3WKMH 3CFDB 3L3KA 3UP6A 4LEXH 3ZT7A 1UA7A 2KZ1B 3I3BA 3HZMB 3LNFA 3FSOA 1GMEA 1O0VA 5AOJA 4M5ZL 3LB6C 2ITCA 1A66A 1SVCP 5DRNA 1P1VA 5E6RB 4GI6A 3ESVF 4M3KB 3PDDA 4Q9QL 1AIZA 1GIGL 3IWUA 4LKCB 1D6VH 4U1KA 2PPEA 4TQHA 3BE1L 4E5XA 3P30H 2AEQH 4C8XA 5T1KA 5DC0A 5FO8B 3NPSC 3S5LG 4IDLA 1JTOA 4BUHA 4NB7A 1QRNE 2AQ1A 3BZEA 3TA3C 5IW1A 5L4JA 4ZZFA 1G7IB 4XCFL 3FZUC 3V6BR 1IEAA 2BIQA 1NLDH 4YBHA 1TZHA 1SXSA 5AOZA 4WW2F 3OSKA 4UINH 5B1BB 2FX9H 5EDXA 1FYTD 2R15A 4GUPB 4N0YL 1JK9A 3G6JA 2FWOB 5GRXG 4GUCA 4XBGA 5J7CC 4HALA 5FEBA 4OZGA 3UYPB 2XN9D 4JFFA 4JKLA 4C83A 1XB6A 2KMWA 3NSCA 3FFDB 5EN3A 3V0AC 4APQA 4JFHD 1GJIA 1PNDA 1YYML 4ZO6A 2BX5A 3RDTD 3CHRA 1CGSL 4NZUH 1ETB1 3CBJB 3GKZA 3KYNA 1OT4A 5KANI 1AP2B 4OCSH 3IGLA 3QS2A 3NFPA 3JSSA 2XBZA 2G9HB 5D1QC 2XQBL 4HG4K 1VGEL 2CZNA 4LOUD 4BZ1A 1TQUA 2E9WA 4BRJA 4D0BB 4K3EH 1PL3A 3MRGB 3CFNA 3A24A 3TIEB 1YC8A 1RUAL 2Z1PA 1ZXKA 2YBRA 2QSCL 4WU7A 3E6FA 4KJWC 1U91B 2CUMA 3NSYA 3PQYA 3IU3B 1QA9A 4N6RB 1T2JA 2A83A 2EDEA 4RIRA 3KHQA 3HZYB 3QR0A 3ZKMC 2IV8A 1ZLDA 3MDJA 2XV6B 3UTSA 2YWZA 3L5IA 4DTGL 5E4IA 1R9FA 2L04A 2X4RA 1BZ9B 4PGBA 4EAEA 3L16A 1Z9MA 4PAZA 5HJ3B 3OWRA 4HK3N 1A21A 4KKLC 5ALCH 2EKSB 1N2RA 1H15A 1IC0A 2H0FA 3FO0H 4Q2ZA 2O30A 4JG9A 4XZUA 4IQHA 4X7FC 2Q7AA 3UZVA 1Q94B 5I1LA 1B9ZA 1NANH 4N0FA 5D7JA 2A2QT 3QXAA 2JXMA 3UAJD 3VFGL 4G70B 3C08L 4DGUA 2Q7NA 5E5LA 3FU7A 5CZXC 3MBEB 1BQKA 2ZUUA 2OYKA 1QFOA 1KFGA 4M5ZH 2VZOA 1EUTA 3BVVA 2Z31C 4MNGB 4AJYV 2YAMA 1PX8A 1W8OA 1S5HB 2X2JA 1HHKA 4WW2A 5DD1L 3BC9A 3RP1A 1GIGH 3GLZA 5FYLD 4XC1L 5I1IL 1MG3C 3ZKSD 3DX9B 1OO2A 4NNYB 1AI1L 4LQ1A 4IMKC 5EN2A 2Y9RT 1AXIB 3KPRB 3IDYC 3P3UA 4UDTB 3N41B 1R24B 4MSWA 2WTOA 3RWEB 4U2YA 4K9EL 1KIPB 4L8DB 3WTSA 3TCTA 6CGTA 4PJDF 3BP5B 1LK2B 3MR9B 4BM7A 1ZAGA 5GGUA 2F6AA 2BNQE 5E2JA 5DFTA 4HV8A 1TXKA 1AKJB 2AS5M 3VRLE 3OKLB 4DPBX 4Y7OC 1EFQA 1M3JA 3OHXB 5C97A 5C07B 4E9SA 4J3WA 2C7UA 4K4KA 5F96L 1MY5A 3G9AB<