3LHPL

Crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
111
structure length
111
Chain Sequence
EIVLTQSPGTQSLSPGERATLSCRASQSVGNNKLAWYQQRPGQAPRLLIYGASSRPSGVADRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGQSLSTFGQGTKVEVKLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fv 4E10 heavy chain
publication title Computational Design of Epitope-Scaffolds Allows Induction of Antibodies Specific for a Poorly Immunogenic HIV Vaccine Epitope.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 111
sequence length 111
chains with identical sequence M
ec nomenclature
pdb deposition date 2010-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lhpL00
3IDXH 1EAJA 4UOJA 1JZ6A 5INCA 2D9QB 1I1FB 3S98A 3VFTB 1VACA 4AEIL 2XRAL 4CVUA 5AZEL 3ZTJH 3TN0D 2EDXA 4FXGB 2P5EB 2I07B 5A3IC 4OV5B 3FN9A 2X4SA 3MRBA 4JFXA 4U1NB 4QT5A 1TCRB 4LKXA 3HNVL 1RVFH 2CUHA 1UVQA 1T5WA 2PTVA 3FO1A 5CIPA 1HOCB 1QSVA 1IGFH 4Y4KC 1OAUH 2B4CC 2PYED 2DQUL 5C08A 5D6DC 3FN0H 1GHFL 1P7KB 2VKWA 3CXHJ 5HYJE 5DUBA 3QEQE 4XCFH 5DZLA 1I9IH 4YHIB 2F54B 1FL5B 1NDMB 5BS0B 4G8GD 3QXVA 2Q6WB 3LN5A 1CXLA 4XPHH 3LQZB 4F7PA 4L4JA 4YHLH 3ZYIA 1U42A 1EBPA 3O3AB 5CJQL 4HIHB 2V2TA 2H9GB 5BRZD 3ALXA 2Q86A 4PG9B 5DJCB 3RVVD 4BM7A 4KY1H 5HPMA 1AHWA 1YEKL 5DO2D 3BSZL 1AD9B 4IRJC 3X13B 1A9EA 4KMTL 3L5WB 1YEHH 4N90E 5ESAA 4TULL 3EO1B 4JQVC 4KVCL 4OCWL 4RFEB 3GMQB 5LWYL 5EIQA 2VQUA 4YQXL 2V9TA 3MYJB 4JZOB 1MVUA 3JUYA 4U2ZA 1JP5A 3HMXL 1HQ4A 1OGAB 1NCAL 5DMIH 1RUQL 4M00A 2WAHA 1MCPL 1SQ2N 2H3NA 2M8XA 3KJ6H 4WENB 4LCUA 2XA8H 4RGNB 3K3QA 1ND0B 1TENA 5IJVB 1DR9A 1GC1H 4WDIA 4RGMC 1MCJA 3O2DA 1FGVH 4JFEB 3IU4H 3TA3A 1FL3B 2IQ9H 5A2KH 5DHYA 5SWQB 4N8VA 5EBLA 5HHQA 3QUKA 2X4PA 5TE6H 4EN3A 2HFGH 4NKIH 1UXSB 2HTLC 2AJUL 1KB5H 4IHOA 5DD0L 2W9DH 4PRHB 4DCQA 12E8H 4J6RL 5GRVL 3HG1A 4JPWH 4U1JA 4WUUB 3ZKNC 1BD2A 3THML 3SDYL 3CFJB 1CLCA 3QR2A 1C5DA 2A9NH 3MLTB 4QHLB 4RDQG 2GK0B 1EJOL 1NCDL 1PJ9A 3TJEL 1BFSA 5D7KD 5DRWB 3EDFA 5IVXF 1U3ZA 4EIGB 4HLZH 1U8JA 1REIA 1IGIH 2AEPH 1KEML 1DEEA 1VKXB 3QUYB 1MWAL 3O6LH 3GSOB 3RWDA 5BV7C 4OAWB 1KCRH 3QDME 5ILTL 3DSFH 2ARWA 2FCBA 3BVNA 4U7MA 4KVNH 1HSAB 1OARL 2Z31A 3S96B 3PQYD 1DDHB 4ZAKC 5E6YA 1OL0A 4ZUSB 5IJKC 1XT5A 4H1LA 5DYOA 4U2YA 3SDAB 3LKOA 2BSRB 3CFBB 1NDGB 4CUCA 3CDFA 3QT2A 5F6HI 4MA3A 1GC1C 4GLRI 3RHWK 2BNQD 5F9WC 2FGWH 1S5HB 3EJZC 1B0WA 1LNUA 4XMKL 2ESVA 1G0DA 2CDFB 2VXQL 1A22B 3DVGB 2EEBA 2DLGA 2CIIA 5DD1H 2WW8A 4ALAH 4S0SD 3BGMB 3VFPB 1F3RB 5CP3H 1AQDA 4D3CL 4CMHB 5IW6B 2VB5A 3H7BB 2WBWB 1V05A 3BPOB 2V7HA 3GMRA 4M6NL 3IRPX 8FABA 5GHWL 3BESR 4LVNB 3MBEC 2D7PA 4YHNB 2VYRE 2AEQL 3OB0K 3LRHA 4IRSA 3FHAA 4HK0B 3RVTC 3REVB 3VXME 43C9B 3MOAL 1P4BL 5L0QC 4L4TB 4QRRB 4HUUA 5DWUL 3ARFB 4NQUA 1A47A 3T0ED 3C8KA 4Z9KB 1XR8A 1HCFX 1NCBL 4QRQB 5E2UL 4ZOEA 4YK4B 2O93L 5E8DL 2DF3A 4S1QL 2DWDB 4CVXB 1P6AB 1AGEA 2ZUQC 4E41E 1G7LA 1HNFA 2ID5A 4K7PH 5FGBA 4YHYC 1A7NH 3GGWB 1C16B 5CJXA 3TCLA 5HSFA 4Z8FH 1T1XB 3L3OB 2XWTB 3HE7D 3WNKA 1TETH 1MWAB 3MFFB 4AENA 2IAND 2XY2A 3SY0A 4PBXA 3O6KH 3CX5J 4NKMB 3S4SG 3ZTNH 4F57H 1KXQE 2GTWB 4L5FH 2EDYA 4PJ9A 3U82B 1Y18B 4GW1B 3KVQA 4ZYKB 4PJFA 3BPLC 32C2B 4KK9D 4XCEB 4HKJB 5TE7H 2CSPA 1FCCA 5FGRA 1T03H 1UZ8A 1FFOB 4EUPH 1YMHB 3NVQA 4K07A 4PJIA 5ADPL 1YY8A 1TJGL 2IBBA 4JQIH 2BSSB 4QTHA 4JFQA 7CGTA 4MAUL 1RPQA 3QDGB 1MFCL 5DEGA 1LO0L 3W11C 3T2NH 3JV6B 4XNXH 4WTWA 1QFWM 2Q8BH 4XH2A 5C09E 1II4E 3KWWB 4KQ4H 5E5MA 2YSSB 3TZVB 5IB2A 2XG4A 3QFJD 3HE6C 1WTGT 4YIQB 2HH0H 4JFDA 4DZBA 3RL2B 1DL7L 3U36B 2VDOH 3BW9B 5L6YH 4CW1A 2VE6B 4KGLA 2C7UB 3DX7A 1NANI 2ZJSL 4JAMB 2XZCH 4OB5L 1XCQA 3TBSB 4OCRL 2UVEA 1ZSDA 4YUEL 5F8QC 1GGIH 4P3CL 1T83C 3OAZH 4S1RL 5TQ2L 3RTQC 5HVHB 1TTFA 3RPIB 3L5HA 4DGYH 2NY4C 1H3UA 2F19L 4G8IB 3WXVL 3MRJA 3VMNA 3WJJA 3QFDA 4L4VB 3QEHB 4FNLL 5ANMB 3O2WL 3PWLB 4XBGB 4P9MH 2NY3B 4NKQB 5DUPL 3H9HA 3H42L 1R3HA 1HWHB 4KHXH 4P2QB 3RWHB 4WW2A 2R23A 1DFBH 1EO7A 5GGRA 3SQOH 1LK2A 2OP4H 4ONHB 4GG6A 4I0KA 5DI8A 3TM6A 2PXYB 5IM7B 3QNYA 4QEGA 5J8OA 5CCKH 5CHNB 4ODUA 4XC3H 1FAIH 2APWA 4N5ED 2H32B 3C5JB 1K8DB 3HI5H 3ZKMC 3FKUS 1T0MA 4XPFL 4AEEA 4C56E 4F7CB 5E2TH 2MPAH 4M6MH 3RY6C 2VIRB 2D7MA 5FECA 4OTXL 3L3JA 3DRTB 4PRAB 4PJ5A 3TGXA 2JCCA 5IB5A 5KG9A 3MLZL 4OKDA 4C83B 1M7IB 1C7SA 2FO4A 3LKNB 3RL1B 4F7EA 2DLFH 3DGGA 4P4KB 2W1NA 1NCCH 2OBGA 2QKIA 5M95B 2E7LC 1N59A 4LEXH 3C60B 1BBJB 3KYKH 1U8HB 4HFUL 2HYMA 3L95A 3B6SB 4NM8H 3VG0H 2KH2B 1RZJH 3B9KD 1ED3B 1HEZB 3LKRA 1XF3A 3QWQB 2FLBT 3WUZA 1P7QD 1J5OH 2A6DB 3C9NA 1E27A 4MNGE 1RMFL 2X6MA 3PDOB 2J4WH 1A5FH 1X5FA 1VFBB 5C0CA 1RK1B 4PJ7A 5E24E 3O9WA 3OKDB 3DUSB 4NBZB 1JE6A 3RKPA 2CQVA 1A7QL 3RIFF 1G6VK 2VUOA 4NNXB 5CJOH 1GAFL 4X4YB 4GOSA 1RIHL 1S78D 4I0PD 3WO4C 3FQRB 3RJDA 4FQXD 1M6OB 1YEFL 4PJDA 2EDQA 1N2RB 4GUPB 5B39G 3AREA 4XPGL 4FTVE 4E42A 5D2NE 1UJTA 2X1QA 2QL1A 3IRZA 4QRPD 3MLSH 3PWJB 3UTOA 3UAJD 3C5ZC 5IBLC 1WC7A 5F3BA 2A6KB 2VLKA 5A2IH 1DBAL 1P4LB 2NXZB 3MR9B 4FQIL 1MLBA 1U3HB 5SWSE 5EBWB 4L3EE 5CGYD 2H2SC 3RNQA 4R97C 1KJMB 1Z3GH 4KZEH 1INQA 4LLDB 5TDOA 2V9QA 4O4YL 2VDNL 4R4FH 3VFWA 4ELMB 4WTXA 4HX1B 5IHUL 4JFYA 4G5ZH 4TVPH 4UOW0 1UACL 3NCJH 5L7XL 4HV8A 1C5BL 3D25A 2DQEH 5C0ND 4OZFB 1EIBA 3TBVB 2W59A 3MBXH 4KTYA 3FMGL 2R29H 4NPYB 3WV0A 1I3GH 5F7LB 4KKAC 3EJJX 3FJTA 3D2UB 3CFKB 3GHBH 3HZVA 3O3EA 3IVKA 1ZEAL 3EFFA 3V2AR 1FP5A 5I71B 3L5XL 4QY8A 2EYRA 1MREL 2IH3B 1N4XH 4Q74A 2P43B 2RGSA 5GGUB 2K9UA 3TYFB 3UEZA 4AJ0A 3LQMA 3U6RB 2QSTA 3RDTC 5FOBA 4N1HB 5C7XL 3IF1B 3QEQB 1ZHBA 4ZD3L 3S97C 3P4NB 1ONQB 3JWOL 3BDYH 2VL5A 4U1LA 4NJAH 4YHPA 4ZUWB 3VFOA 4WFGD 3QIWD 3STZB 2RBLA 3MMEA 4R3SB 4WI5A 2IQAB 4GAYB 4NQTA 5FYKE 3KPSA 3BRGC 2P5ED 3U4BL 5I8CA 5B8CC 1RJZB 4RBPH 1INDH 2ZKHH 1KSRA 3BH8A 1YYLH 4PG2C 4DZ8B 4BFBD 3KPLB 2R9HC 3CZJA 5GSVA 5I1KL 5DJ0B 2R15A 4UT7H 1YN7A 5BZDA 3RRQA 1ETZA 3BMVA 5D5MB 4Y19B 4KK5D 3RZCD 3VFRB 1R5WB 4AT6A 5F3HB 2FH6A 1A64A 4AIOA 1UJ3C 2F58H 3H9YA 4DEPB 2FZ3A 1AKJD 3KPOB 4QXTB 4DGIL 2AV1A 1JYNA 2XTJB 2PO6D 3G5YB 2BFVH 3WD5H 4X7CC 1KXTB 1BGXH 1G7PA 3MLYH 4XP6H 5GRVK 2ZG2A 3BJLA 1DCLA 4OI7A 1AE6H 1RU9H 4NWTH 4U1GC 1INEH 1YECH 4P2RD 5EU6A 1OAXH 1B4JL 4Z7OE 4I3SL 5HGGS 3GRWL 1AP2B 1F4AA 5GZOD 3CXHK 2ITDB 3VRJA 1IQDB 3T1FB 1ZLWH 1A6AA 4MQ7B 4NN6C 4ZUVB 5HVGB 3MRLA 4YFEA 1QPPA 4MLSA 1EDQA 4NYLA 4LHUB 1F3JA 5I30L 4RFNC 5HTSA 1QYGL 3GUTA 1JPGB 2JJVA 1J86A 2YKLL 3W39A 4P46A 2XPGA 4JRYB 1HIMH 3DRQA 4U4BA 1XZ0A 3ALPA 4HD9A 5TGBA 1IFHL 4GKZB 3VFVB 2HKFH 4OZGE 4HGMA 1JGLH 3FT4B 2OTWA 1FG2B 3QDMB 3VFGH 4EBQL 3FB7B 4TUKH 3ZT6A 1LO4H 5GXBB 1MFDL 1N7ML 1KCUL 1BREA 4N0UA 3BO8B 2XN9E 4P5TB 4WUUD 2GJ6A 4XXDA 4PP2B 5C9JA 1U8MB 3W5NA 3QJHB 3OKNA 3C5SB 1M71B 3BD5A 4JR9L 4OLZH 2ICWB 3IAPA 5CSGA 5FM8A 4N0YL 4K8RC 4KAQL 4R6UA 1MSPA 4U6XA 1EO8H 5E03A 3S37L 3UC0L 1I8LC 3VG9B 4GXUM 5LG1A 5GIRB 1RUMH 3OGOE 1ZVSB 4F2MA 1H9VA 3LZFL 4XI5C 1FGNH 5T1KB 4EJ1C 3R0NA 2A1WL 4HULB 1I9JL 3MRMB 1N8ZB 3HZYA 1HK6A 5BVPH 2BJML 2VSDA 3RA7L 5F9OH 4HIEB 2DM7A 2X4UA 4NDMB 1HWGB 5T3XE 2FWOA 4X99B 1HKFA 2GSIB 4WWKB 4OCYL 4NP4H 3SKNB 4YR6B 4QLRA 3S4SA 5IMOA 4NO2A 3VWKA 2VDQL 2HJLA 1AH1A 5J6HA 2VR4A 4MS8D 5EFIB 5EUOE 3TVMA 5H2BA 4JM4L 1EGJH 2IALA 5E9DE 1OW0C 2AGJH 3DGCR 5LGHH 1TXKA 2IAMD 4S10A 2NX5E 4OIBA 2AI0H 3VDAA 3RY4A 1OT2A 5IF0B 3S3JA 2XWBB 4GBXB 1JHKH 5I75B 4MD5B 1UGNA 5DMGC 1A9BB 1CL7H 4JPKL 1CG9B 3UPRA 4N9OB 1ZTXH 4CDGC 5JPMA 4WTZG 2B2XL 3W0WB 1BM3H 2ARJA 1LK3L 1IC7L 2FJGB 5GGSY 1N5AA 3NABH 3B5HA 1TIUA 3ILPA 4P2OD 4IIQC 1MAKA 4OZHB 3REWB 1NBQA 2Y72A 1YY9C 4KROC 3B3IB 1MPAH 3FTGB 3JUZA 3P2TA 4O2CA 5FYLH 1YMMD 2IBZY 3LEVL 3PL6C 2ENSA 3JV4A 5KS9E 5HDOA 2QSCL 5JOFA 2YPLD 1VEOA 3GI8H 2JIXA 3CVHL 4WEBH 4KDTC 1Y6NR 1EERB 2ERJC 3CJJA 4U6HB 2QADD 1OSZA 3S37X 2YRPA 4PRBB 5IFJB 1QSEE 4G6AD 3K81A 3OXSB 3QXWA 1IM9B 4X6CA 1S7UA 5C0RL 4KTEH 4Q2ZA 1SYVB 4QCIA 3G5XA 5C09B 5DQ9B 2ICWI 4Q7DA 4U0RB 2DQJH 3C6LD 5HD8C 1JGVL 4FXKB 5GS0D 1LMKA 1WFTA 5KVGL 4W6XB 4NQCA 3LRSA 1JWUB 4JFOB 3TN0A 5HYSB 5FA4A 3H8NA 1LO5B 1B0GB 5IB3B 1JPFA 3KPNB 4AG4L 4AIZA 4LLWA 1N6VA 1F4HA 1MJ7L 1NPUA 3T4AB 4DAGL 4M6OH 2L7UA 2MKLC 5CSZB 4HG4K 3DROB 4Z7OF 3C2AH 5MHSD 2OMNA 4Z7NE 5F44A 1C08B 4ZS7H 1IAOA 1YQVL 2PYEA 3P4OB 4BSVB 3F7QA 4L8BB 5E8OB 1UXWB 3JV5A 4NZUL 3ULVE 4M7LH 4P48A 2GJJA 1OD7A 2FX8L 1VHPA 4BQCA 4XMLH 5GPRA 1KJ3H 1RJCA 2BVYA 1GGYA 3OGCB 2J8UA 4G8GA 3DMMA 1NGWA 2DDQH 5EU7E 4EDWH 4GS7C 2GSGA 1QLFB 2Q1EA 4ZPVA 4MGXA 5BRZA 5EO0A 5T5NF 3BDBA 4CAGA 1N3NB 4OZGF 3BEVB 3EYUL 2O26U 4GH7B 1PLGH 3KNBB 3QI9B 3PHOB 2AV7A 1IAKA 5TF1L 3SJVD 1NCWL 2W38A 2VQ1A 2L0DA 4Q9BA 1JL8A 3ZKSD 2A83B 4X7DC 4OQTL 2Z8SA 4LARH 3RX7A 4U6VL 4RAHA 5MENE 4X8XA 3CVHB 4PREA 5J12B 5DJYB 1MHHA 1TQBB 1FRGL 5DD5H 3CLEH 2DKSA 2Z8RA 1G7IA 3MV9E 2DL2A 5JZ7C 4HUWB 2FECL 4O58L 4PUBL 5D2LA 5FDWA 2IG2L 2PXYD 4KK8C 5B39A 2C3VB 2JK5A 4U7SA 2VLJB 4I48A 4Y4KD 5D9SA 5IUSA 4PFEA 1QLEL 1J0JA 1FYTA 4HS6A 4X80L 3BKYH 3OBAA 2IPKA 2P8LA 4NOBA 1SJVA 1UWEL 2ED8A 1SM3L 1TJHL 5C0FA 5FO8A 4HCRA 4PJHE 3GO1L 3QUZB 4KKBC 2FIKA 4X6FB 3ARQA 3RWGB 1F58L 2PF6A 4ODBD 5FB8A 1OAZL 1CGTA 1D5IL 2NTSP 2VN4A 4ZDHA 2DQHL 1ZWIA 4PRDB 4LNVA 4XP9H 3VXSB 2DMKA 3CX2A 5EUOF 3CU7A 4K7FA 5F70A 2FL5B 4XRCA 5IFHL 4IRJD 4M6AA 1T22A 5FF6B 5GISL 1WUNT 3ZHLA 2CKBL 4HJ0C 2CGRH 2DI9A 5EN2A 2EYTB 2XOTA 4L3EB 3CCHA 3PQYA 4R7DB 3X3FL 3BAEH 2WWKO 4ZO9A 2UV3A 5DDHA 5BQ7B 4XGZA 3VD3A 4ZG1A 1MH5B 5ETUA 4MZ3A 5I8KH 2DIBA 1WK0A 3T0AA 1A3QA 2UYLB 1VGKA 3ROLA 4F80A 2BNQA 1MLCA 2B5IB 4EEEA 2BHZA 5CEZL 3QH3B 3T3PF 5T1DH 3V0AC 3NZ8B 5JIKA 4P9HC 4N0CC 1U8QB 3PWVB 5KS9F 5IB1A 3MNZA 4ODSL 1I8IB 3EOBA 1Y0LA 4TSCH 5EU7C 4DUXA 4ETYA 5EZOH 2HTLD 1R3LB 3BKML 2RAMA 2M2DA 4Y5YB 3V0VB 3G6DH 2CDGA 3QDJD 1SYSB 2WUCL 5EIIA 4PRIE 2QQQA 5E00B 4AIXA 4AYFA 2X5PA 1T7WA 3KYNB 1B88A 1DBBL 2F53B 4QXUL 2JB5L 4Z7UA 3O45B 5F9DC 2DOCA 2NTFA 3EGSB 1G7QA 1RULH 3B9EA 2H26A 1CE6A 5AUMB 2EKSA 1BZ7A 3HPLA 4UIMB 2OL3A 2R0LH 2WANA 4PJCE 5EG6C 3V52H 3T0EA 1QFUH 2AK4B 1WVZA 4NQDE 3NIGE 4B7LA 4Y16B 5IR1A 3L3DA 4Z7NF 4M8VA 5DJAA 3U9PH 3D2UD 2Z9TA 4F9LC 4Y7MA 2ADGA 4J3SA 1JN6A 4P4RB 5F9JB 4FABH 3SDDB 3AXLB 3ULVF 3E1F1 3BN9C 5HYJD 4LPWA 3QXTA 2IANA 3QEQD 4RMTA 4Y5VA 5GGTA 3PDDA 2IEPA 4P5KA 2EDEA 1IM3A 4MCYB 2ICCA 3HLAA 1HILA 1WFUA 2UZIH 5BVJA 2BSTA 4HJGB 4RFOH 4I5BB 1YUHB 5FO7B 4NT6B 1D5XA 3MNWA 4KI5E 2F5BL 5IQ7H 3D18B 4MDIA 1YDPB 1NKOA 3QIUB 4HPYL 5DHVA 4D0BB 1X5ZA 2NPLX 5E8NA 1F2QA 4LLYA 3IGAB 3MBED 4JG0H 5HPOA 5IGXL 1EHNA 3KPRB 3RVTD 5C3TA 4P57B 3L1OH 1BVZA 1W0VA 1A6WL 2UZYB 1G9NH 4LU5H 1EO5A 4ZQKA 5ESVB 2HJKB 4W70A 4D9QE 1I4FA 3V6ZB 5EU5B 5C0BE 4DGVH 4K9EC 2HFFA 5EU3B 5T1MA 5DD6A 3DOSA 4GQ9L 4NRZA 1D9KC 3TPUA 3QFJA 5L8JB 3MGOA 4QOKE 4PTTB 2KZWA 5E0QA 1IC5H 3FFCE 3TIEB 3OKYA 4O2FA 2AJVL 1NUGA 3WIIL 1IL1A 2VLRB 3OR7B 4WUKH 5DMYA 5I1JH 1WWCA 4ODHH 3UTSA 1N0XL 3HR5B 1LWRA 1MVFA 3IXTA 2OMBA 4ODTH 4DN4L 1YEEH 3BP4A 2X2YA 3WFBH 4PJHF 4FFYL 4B41A 4XMPL 4ZODA 4M5YL 4CJ1A 1WFNA 4LSUH 3WIFB 3FRUA 4FFWC 3U30B 1JK8B 5HHPA 2C3WA 1PY4A 3VD5A 5C07E 4K2UH 3MLRL 4Q0XH 5JHLH 2VZUA 4LHUD 5EULV 4K94H 3NFNB 3SDXF 1S9XB 4LNRB 2AABL 4XVUC 3WXWH 4JRYD 3KLSA 1NGPL 1K4DA 2LU3A 3MOBH 2BHYA 1MIMH 2P7TA 2DBLL 2APBA 1AGBA 1K5NA 4IMKA 3W11D 3QDMD 3MJ9L 2PW2B 4M8QA 1U3JA 1YEJH 1KPRB 4HIJA 4RMQA 1DZBA 3HE6D 4P5TD 1U93B 2ZCHL 5JLZA 4R4BB 2AQ1A 4QRUB 1XCTA 4ZFOL 5KSBE 3WKML 1S7VB 3RGVC 1JMZA 3B8YA 15C8L 1CFVL 1IGML 1CFTA 1YQ2A 3EW3B 4WTZA 4XP5H 1K3IA 2YWZA 4LSPL 3IJYA 2VH5H 3B9KA 4ZO7A 3RTQD 1P7QA 4WY7L 1KIQA 5C8JA 4JFZH 1N6UA 5EUOB 3UMTA 1ZT4A 4JGMA 1BJ8A 5GJSL 3DNKA 4UILH 3BP7B 1IGTA 1FSKC 5C3LD 1A4JB 4J1UA 4H25B 4ORGA 1V3KA 5MERA 2CMRH 1G9EA 1B6DA 4YBQC 3I9GH 1LVEA 5JXAH 1Q8MA 3DURB 1SY6L 3IFOA 4GRWE 4LKCB 4ODVL 4PJBA 4NGHL 2R2EA 4K94C 4OF7A 1L7TH 2FJFA 4Z78B 2OZ4A 4P23C 1ZLUH 1IC4L 3VXMD 2YK1L 5I19L 1NKRA 3D0VB 1KN2L 2YA1A 4I0PA 4LSRH 4FQXA 2X4NB 1EFXA 4HSQA 4WWKD 3MXVL 3CC5B 4OT1H 2XV6B 3OKKB 3NIGF 3WLBB 3U2SB 1MCIA 4JN2B 5D4QA 4POYA 4KDWA 5HY9B 1AR1D 1F6AB 1D6EA 1DVFB 3DV6B 1BJMA 4PGBA 4QRPA 1GPOH 2EO9A 3ZKMD 4WHDA 1NUDA 2A6JB 4FRWA 1OPGH 3QHFH 5KS9B 5EC2A 4XBEL 4Y4HB 3M17A 4R2GC 4E41D 4U6TA 4NNPH 3EYOB 1U95A 3AB0C 4LVOC 1J1XH 3PP4H 5GS1A 4GBXD 3VW3H 5D70L 5T3ZL 4MD0A 1JI1A 1MCRA 3GBNL 3ZHKA 1KJ2L 4PS4H 3RJQB 4KUZH 3H3PH 1MCSA 1ZS8A 3FOLA 2CJUL 4MXVE 4JKMA 4JANB 4PLJC 4YE4H 3NCMA 2VAAA 4KI5F 5CIPH 1LEIB 4Y1AB 3A67H 3K74B 4H88L 1ORQB 5MP6H 4WNQB 4ZFOB 3LMJL 4X5XA 2NY6C 4HKBA 4M1DL 1MCBA 2GJZB 4YHKH 2VDLH 2ATKA 1IT9H 5JMOC 3QA3B 4PRPE 1D5ZA 3SGDH 3BQUC 3V6FA 3OAYH 4NQXA 1HHKA 4JHZA 2OK0H 2BZDA 1VESA 4E9LA 1FLTX 3TCXA 2WBKA 5ISZB 4U05A 2W0FA 4P5MA 5C09D 2JB6A 2VC2L 3MXWH 3VFTA 3JTSA 1BWMA 1TZGH 2HVJB 2ZSVB 4NM4H 2B1AL 3QIWA 1CXHA 4LP4A 1LEGA 2X44D 5ENWA 5IVZA 3ULUL 3C5ZD 5IBLD 3QUXB 3I6KB 3PHQB 5E1HB 3OKEB 3L3GB 4OD2B 4OV5A 3DVFA 3TBTB 4M1CC 1VB9A 2H2SD 1TCRA 4JCLA 1M05A 1RZ8B 2CR6A 1HOCA 1UWXK 1BQHB 4JZNB 1QEWB 5JW4Q 4M7ZC 3QHZH 3A6CL 4F7MA 1UKTA 4Y2DB 1UM6H 4UT9L 2B1HL 1AGDA 3RZCA 5DJ6B 1EHLL 1HKLL 2CLZB 3WUWB 4LCYA 3O2DH 4Y8AA 4PD4K 5H35B 4YNYB 3OHXA 3IFNL 4YHIA 2VDKH 1AKJA 2JTDA 1FL5A 1NDMA 1F4YL 3T0WA 1A3LL 1KJ2B 3N06B 3NH7H 3NIDE 4OZFG 3B2VL 5DQDH 2PO6A 1KCSH 4PGEB 2X40A 4KKAD 1SEBA 4G6JL 4OF0A 5KOMC 3V7MA 4EOWL 5EORL 4PV9B 4KKNA 5J1TC 2VWEE 5IHZA 1T6VN 4F37F 4NO0D 1AD9A 1UYWH 5ADOL 1J05B 4P2RA 4YDVB 1MNUH 1PZ5A 1AHWC 1PDKA 3RDTD 1BIIA 5DZOA 4M5ZL 5I9QB 2L4OA 3O4OC 3MREA 3UJJL 1IQWH 5KN5A 4UV4H 5KSBF 1HHJA 1X5KA 4TNWK 1CXKA 4XVJH 4PJGA 5FA3B 2H8PA 3MA9L 5DR5H 1C5CL 1RZFH 3F58L 4LVHB 4LSDA 4MCZA 2FBOJ 1TTUA 1CE1H 4LLMB 1IGYB 3WJLA 1OCWL 4H1LH 1LO3H 2V5SA 3SDXB 2EC9U 1S8DB 2R9HD 3L3KB 3N85H 4Z76B 2DQDL 1FL3A 2HRLA 2MWCA 1LQSR 1U8IA 3NFSH 1WCQA 3WHXB 2ZUWA 1X5YA 3RWFA 4GRWF 2R69L 4MJ5A 1JFQH 4JQXA 5IBUB 1MQKL 2HRPH 1BJ1J 3HC0A 3LHPL 4NO3B 3VXQA 4QHUB 4EN3C 3RU8L 2B4CL 4XZUA 1I1CA 1XGYL 2EH8H 5DMJB 3TV3L 3O3DA 1DQDH 4AEHH 4ZUUA 2GK0A 2DLTA 2HKHH 5DRWA 4FTVD 2XKSA 3WS3B 3EYSL 1XF5B 3UO1L 4HIXL 2D9CA 3BP6A 3G5VA 1X7QB 5D72L 5GRZA 2DRUA 2EE9A 5ALCH 2ED9A 4UAOC 5SWSD 5FV2A 4KRPC 1WT5A 4L3ED 4XP4L 3IDXL 4K71C 1XIWC 1BFOA 2DLHA 4OBRA 2YUWA 2Z31C 4U1HB 3CFBA 1FIGH 1NDGA 3ARSA 4CNIB 2Y5TA 4LHUG 5JXEC 4P3DB 2EC9T 5DEZA 4HJJH 1YPZB 4JGJA 3C09B 3S88H 5HGHA 4B50A 1KTDB 5HDQH 5JNYA 5JHDE 2BNUB 3TFKC 1N6QH 4KFZC 1QSFE 2BXZA 3EUUA 3FQXA 3VFPA 1IGFL 1KIRA 1OAUL 3WSQH 5IW6A 2IAMA 3CMOH 3KXFE 3WE6B 2Y25A 4HBQA 2VWEC 3FN0L 3DXAE 1T7ZA 2F53D 3AAZB 1VADB 4HK0A 2G5BA 1EX0A 4XCFL 1CFQA 1I9IL 3GNMH 2XFXB 3O3UN 4K8RD 2CUIA 1Q0XH 3DX6A 1OAQL 4RIRA 1NSNH 4D8PB 3KLHC 3G6JF 5HHME 2QTEA 4XPHL 4YHLL 1KTKE 3AFLA 4P2OA 2BCKA 5EPMB 3V5KB 4ZFZA 3GSWA 4X7EC 3GM0A 5FYKD 4KY1L 2Q3ZA 2VDPH 1YMMA 3QEUA 2DWDA 5GRYA 4DFIA 3HZMB 5CSBA 3HI1A 2YPLA 2B39A 1YEHL 1NH6A 4WVRA 1U36A 2APTA 4PV8A 5I6XB 4QRSA 1TVDA 5I1CH 5CBAB 4PB0H 5FGBC 1T1XA 2SEBA 1UKSA 5ITFB 4JM2B 5MEOB 2DQFB 4PJXF 3R06B 5DMIL 5D93B 5J6GB 2MQ0A 3NIDF 4MQSB 5LGJA 1E28A 3PGCB 1DANU 3C6LA 3KJ6L 1M7DA 4JFFE 2XA8L 5IT2H 4QOKB 3VFUA 1J11A 1DLHA 1X5GA 3FFCB 1FGVL 3T4YB 2N7BA 3IU4L 4G9FE 2IQ9L 1HH9B 3QIUD 4L9LB 1YEIH 3FQUB 3BE1H 2WNGA 3V5DA 2K1MA 3E8UL 2RR3A 4LQFH 4LGSB 5TE6L 2YA2A 2HFGL 4NKIL 4OFIA 4RAVB 3GKZA 3NA9H 1KB5L 4MJ6B 2CXKA 2OXHA 2W9DL 3B2UD 5DMGD 2K7PA 1LD9B 12E8L 1Z5LB 3AMLA 4JPWL 1O7SA 5KW9H 2B20A 4HUMB 5F7EL 5CJBA 2R1XB 3O11A 4JRXB 1U8OA 1CU4H 2A9NL 4LCCB 4OSUH 5CS7A 2YBRB 4KROD 4BFIB 3H3KA 3OR6B 1FO0A 3ZDZE 2X4OA 2ICWJ 5FUCE 3PL6D 1FVDB 1I1AB 4HC1A 4U1IA 2VE6A 1IGIL 2AEPL 1QRNB 3O6LL 5C6TH 1U0QA 4PY7B 2BVPA 5D1ZC 3TH2T 2RIKA 1KCRL 4BELD 3DSFL 4O2EB 4KVNL 3RPIA 5HDBE 1KXVC 3DBXB 2ZG1A 1WSST 2PUQT 5IK3B 3SJVA 4ETQA 5D7JC 1JRHH 2VSCA 3QG7H 1J88A 4KKCC 2DWEB 1DANT 4D9LH 3LN4B 2XN9D 5CMAB 3WJJC 3WDHA 1H3VA 4KZDH 2FGWL 1XFPA 1KIPA 4X6BB 2IF7A 4OD3H 5HYSG 5CD3B 3A6BH 3RWHA 4OLWH 1AFVH 2AEIT 2QSQA 4TVSa 3I75B 4NBXB 5IIEB 1FIEA 5DD1L 2PXYA 4ALAL 3T8XA 3AS3A 3SDCB 4X98A 4FP8H 4Y4KA 2H32A 2OCFD 5EO9A 3QO0B 1LE9B 4S2SA 2WP3O 5D6DA 3O2VH 3MV7E 4CU7A 4Y5XB 3MTRA 1M7IA 2LVEA 4IDJH 4GRWB 1F2XK 2DLEA 4IMLB 4WJ5A 2Y9RT 3O6FB 1KBGL 2FX7H 5D1XB 5T3XD 1NC2A 5C92A 4NCDA 3RY5A 4G43A 3FAXA 1A4KA 3PIQB 2AKRA 2QQLH 1CDYA 4ZUTB 1ED3A 1BZ9A 1NEZG 2J1KA 4MWFB 2NYYC 1PKOA 5DS8A 3IDNA 2QHRH 4IRJA 1F11A 4K7PL 5IVXA 5E9DD 1A7NL 1A02N 1H15A 3F62A 2WQ8A 3UBXB 2NX5D 4Z8FL 2FX9H 3DUSA 3SCMC 1N64H 4XTRD 5JOEA 5B22A 2IMMA 4YDIH 1TETL 3UXFA 4OLEA 4NNXA 3O6KL 4YBLC 4ZFFA 5DA0B 3ZTNL 1EAPB 4F57L 2A0LC 1NC4B 5IV2B 2J8HA 1GZPB 4L5FL 5JZ7D 1ZHLB 1NMBH 4XNUH 3EZJB 1NQBA 3KDMA 3STLB 2VR5A 3K2UH 3D85B 3FB6B 3F7YB 3QQNA 5TE7L 1DVFD 2BDNH 2D4DA 3Q6GH 1T03L 5FUCC 4YPGA 3AS0A 5J3HC 1I75A 4GW4B 4Y4HD 5ID1B 2ICEB 4JQIL 4V1DE 2A6KA 2CK2A 1P4LA 4UDTB 4PRPB 4GO6B 5D7LB 5EBWA 4S11A 3QDJA 4Z6AT 2EDTA 3T2NL 2X42A 4XNXL 1QSED 1KJMA 2Q8BL 4QHNA 4KQ4L 5J0BA 1BAFH 1TNNA 1AXIB 4LLDA 1CICB 3ZYJA 3BPLB 2HH0L 1UEYA 2VN7A 3SGKC 5CGMA 5MI0C 2PTTB 2X4TB 2DQTH 3VCLB 2VDOL 4DQOH 5L6YL 2ADJB 4HX1A 2XZCL 4FFVC 4UTBH 1AR2A 1CT8A 1U9KA 2R1WB 3G6JB 1GGTA 2AXFB 2WLZA 3O3BB 4Y1AD 5F1IA 5JORA 1ITCA 1WBXA 1GGIL 3QNXA 4FXLA 4MNHB 3VFSB 1JTOA 3I6GA 4DGYL 4NZTL 2R4RH 3QQ4B 1QLRB 4ZOAA 1CLYH 1EV2E 2FHBA 5IJKA 2FD6L 2PR4H 1JPTH 3UZVB 4P9ML 5GGUA 4FA8A 3DO3A 1N0LA 3LDBC 2APVA 3D39B 5DK2A 4K7PX 1S7TB 2V2XB 3ULVD 5HYJA 4KHXL 4XNYH 5E6ZA 1R5IA 3QEQA 1S7SA 2R2CA 4I4WB 1DFBL 4AH2A 4N0CD 4PJXB 1MFAH 3SQOL 3STZA 5LGKA 2OP4L 3BX7C 1OGTA 5IW1A 4M3JA 4WFFE 1EEYA 5EU4B 1DP0A 1FN4B 5CCKL 4XC3L 3BZEB 1FAIL 2OTUB 1A7OH 2VISA 3SKMA 3QP3A 3HI5L 5HDBF 3UBXI 5C86A 2Q7NA 2DTMH 3BZFB 2MPAL 4M6ML 5E2TL 4IOIB 4TTDC 3MBEA 3KPLA 1WIUA 1A1MB 1T5XB 3VGAB 5DJ0A 1MHCB 1HI6B 1I9RH 4ZS6D 4Q9RH 2DLFL 3FT3A 3SPVB 2E6JA 1WBZB 2O5XH 3OF6D 4OD1L 1NCCL 3TIDA 4EUPB 4LGRB 2V5TA 4ISVB 4G8EA 3NACH 3AS1A 2Z8VC 4LEXL 5MEND 3KYKL 1H3TA 2A38A 5JPNA 3VG0L 1RZJL 4OUOA 5K9KA 3NCCB 1J5OL 1BFVH 3MV9D 1T0PB 1A5FL 5I1EH 5CD5C 4NQEB 1A8JH 1ZGLB 3NCYP 1XGTA 1KNOB 3BN9D 4NQSB 2BVQA 4RZCB 1OP5H 4N9GB 5CJOL 2C5DC 1KELH 2OTPA 4M62H 3PJSA 4XB8A 2ITDA 3ZZ1A 3VWJB 4AL8H 5F7DB 1JV5B 5JR1H 1S7RB 1RSFA 4MQ7A 4YXKH 5L88H 3BDXA 1AGFB 1IC1A 5E8PB 3FONB 4JJ5B 4EI6A 4P2YA 3FB5B 3HMWH 4HFWB 4LHUA 5EOTA 4L8CA 4O5LH 3MLSL 4MDJB 5FCSH 1JPGA 5J13B 5L8KB 1BEYH 1Q9WB 1G7HA 3H9SE 2V5RA 3ARBB 5I1LA 4GMSH 3M45A 2FBJH 3RVWD 1T1ZB 2ZNWA 4ZO6A 1ZVHA 4LSSH 5KSAC 3L7FB 3WO4B 3RFZC 3U0WH 5C0AB 3QDMA 4OGYH 1FZJB 1S7QA 5F6IC 1Z3GL 3BEWA 4KZEL 1NL0H 3TT1H 1KT2B 3HS0B 1D9KD 1TPXC 3V4UH 3HE6A 4IJ3C 4R4FL 3BPCA 5MEPA 1MHPH 5KSVB 3PV6B 3D87B 1ITBB 4N8CH 3DYMA 3LN9A 3QJHA 4BH7A 4G5ZL 4TVPL 1B0RA 1RUPH 4PJAB 1OTUC 3EYQC 3NCJL 4YHZH 2ICWA 1Q72H 3QIBB 2DQEL 3NN8B 4MAYB 1Q38A 3MBXL 5IQ9A 4KGJA 1FZKA 2R29L 3RTQA 1I3GL 1UQSA 5B38A 5T5NG 3S5LG 3GHBL 4WI9A 5JHDB 1K8IA 4QTIH 5D1QC 2QQNH 3EBAA 3DX9B 2YXFA 3H2WA 1N4XL 1F97A 1QHPA 3KS0J 4LLQB 4JLRB 3FN3A 5DQJA 1MY5A 4PRID 4HH8A 3DXAB 4YDKH 2IPTH 4Z7VF 4Q97A 3QZWB 5ALBH 1ZVYA 2E6QA 1UB5A 4HIEA 4NDMA 3VXMA 4NJAL 3PGDB 2ZUSA 1DEDA 2EDHA 4OLVH 4X99A 2GSIA 2QQKH 2AERT 4WO4B 4WWKA 5E2VH 1K4CA 3SE9H 3SKNA 5HYIA 2VR9A 3OJ2C 4ZXBC 3GHEH 1INDL 2GI7A 2ZKHL 4NQDD 1YEGH 2EE6A 2EXWC 2AXHA 1YYLL 4BA8A 4HUXB 2C26A 5TDNA 2ZNXA 5EA0H 1TQCB 3TO2A 3RY6A 2YUZA 3D69A 2D03H 4PJ8B 3TVMC 1XGPB 4UT7L 4E41A 2HWZH 4H0IA 1VFAA 3FFDB 2Z35B 4ELKB 4IM8A 3UROR 4U1MB 1MI5B 1X9QA 3VXUE 1CTOA 4OZIE 4O9HH 3X11B 3RGVD 5HGDB 2E7LA 2F58L 3DIFB 5DJ8B 5KZCB 2W60A 5E8EB 5GGVY 1GCFA 2LTQC 1FNAA 2FO1A 2BFVL 3WD5L 4TUOB 1WCBB 3Q5TA 3MLYL 4XP6L 4I3GA 4KI5D 5IHLB 2E8ZA 1FNGA 4M93C 4G9FB 1AE6L 1RU9L 1QQDB 4NWTL 1INEL 1U8KA 1YECL 2YEZB 3ESVF 1OAXL 4MJ2A 3V8OA 3NGBC 2FSEA 3B5TA 4W6WB 3B9VA 3UTTB 4I2XB 1CD8A 2MHAA 4YWGH 2KDGA 3ES6A 1NBYB 4NRXA 2I5YH 5EWIH 5C0BD 5C09A 1NGZB 3QXUA 9CGTA 3HA0A 1QRKA 3VGFA 4FXKA 4QOKD 2V17L 1F42A 2P4AB 2IMNA 2DQIH 3FFCD 1FC1A 1UH4A 2F74B 1HIML 3C5ZA 1V3LA 4I18B 3T4AA 4G42B 2HKFL 4YFLI 1JGLL 1A6UH 3VFGL 5K59E 4L3AA 4TUKL 1LO4L 5LKNA 5AG8A 2GITA 4PGCB 1C08A 3OJDA 5AG9A 5DMKB 1QBLH 3IDUA 4DFHA 3GKWH 4PLJD 2AW2A 1MCFA 3QXAB 1T0NA 2A6IB 2P47B 2D3VA 4K3DH 4OLZL 5C07D 1UEMA 1MEXH 5FOJA 5FYJE 1JHTB 2VITA 4C55A 1EO8L 2VRAA 4QYOA 1S9YA 2NY6D 2CLVA 1FORH 4G9DA 3V4PH 3U0TA 4X5WB 4TSBH 1U91A 1FGNL 3BQUD 1NEZA 2BRRH 3BEVA 1T2QL 3O8XC 4NO0A 5DD3H 3MV8E 2EYSB 4RWYH 2RHEA 5DO2C 3RDTA 5C2BH 5I73B 4EDXA 5I1AA 5BVPL 3P9MB 4YLQT 1XGRA 5F9OL 1IVLA 1W0YT 4DVBB 2KKQA 2YS4A 1EVUA 2X05A 5DVOA 2YUVA 4XWOD 4NP4L 1FNEA 2FHFA 3CPLA 5HHNB 1JJUA 2VNCA 3HC4H 4IS6A 1S9WB 5B8CA 2NMSA 5E94B 1PG7H 4M1CD 3QDAA 4WHCA 1EGJL 5A16B 1MUJB 2LABA 4PG2A 4Q6IB 3WHE1 3KLDA 3MA7B 2C3VA 2AGJL 5LGHL 1IMHC 4MNGA 3DUUA 3HRZB 1HHGB 1BQHG 2PCPA 4KXZH 2AI0L 1IGCH 1A6TB 3ETBF 1JHKL 4QF1B 1RIUH 5IMMA 1VA9A 2D31A 3WUWG 2YN3A 2XKNA 5FK9B 5C0GB 1CL7L 3LKQB 1WBYB 1E4KA 1UJ3A 3MACH 4HT1H 3E6FA 1BM3L 5JW5B 1I8KA 1Y6MR 5ID0B 2XYCA 3NABL 4DVRH 5D1XD 4BK4A 1EPFA 1HDMB 1ZK9A 3F8UB 4HXBH 1NFDB 1W8OA 3QG6B 4U1KB 2OI9C 4F7TB 1T3FB 1MPAL 2DL9A 2C3XA 4HLJA 5FYLL 1URLA 1FV1B 4FTVA 5D2NA 2AJZB 1CXEA 3GI8L 2ZUTA 5FXCH 4WEBL 5CBEB 4AZ8A 4J3OC 5HHOB 1TVHB 5EH1A 4BFGA 3QXDA 1RZ7H 4V1DB 3MRRA 4OZIF 3K7UA 5SWSA 5IMLB 2OL3H 2EYTA 2R0ZH 4JFPB 4L3EA 1MJJB 4KTEL 3LEXA 5DRXB 1HZHH 4MA8H 4X4XB 2EC8A 2PETA 5F7UA 3U7AA 3OAZK 1NC4D 2DQJL 4APQC 4Z7VB 3J8F7 2AAVA 5IROA 1F90H 2ITCA 3ET9F 2ZOLA 3ULSA 1B3JA 3O4LE 4GRMB 1P53A 3F6LA 4M6OL 3CSYB 1QPXA 4UUJB 3C2AL 4WGWB 4UNTA 5GGTH 1Z0NA 5IBUG 4PRPD 5E1AB 4CMMB 4ZS7L 4Y5YA 5D7LD 1CIUA 3RX5A 4ERSH 3I02A 3ZL4H 3VRIB 3WFEH 3GMNA 4M7LL 4XMLL 4ZOBA 1CICD 3R1GH 1KJ3L 1YNLH 2HFEA 5DHVH 4AM0A 3EGSA 2XI9A 3LPWA 4CKVX 5L2KE 1CLOH 2VLLB 2DDQL 1J8HE 4EDWL 1I8LA 3PXJA 4PPTA 5F89A 1EBAA 1XH3B 3BZDA 3FCTA 4XXCC 4MD4A 1PLGL 1KOAA 4BH8B 5K59F 1W72A 4Z7WB 1XIWD 1Y6KR 3VRLE 4OF6A 3MJ7B 5DFWH 2D7QA 1PQZB 5F9JA 4LARL 2FRGP 1NBVH 5JXED 2X9YA 1HSBB 3AC0A 1G7JA 3NAAH 4I13B 2JJUA 3G08A 5DD5L 3HE7C 3CLEL 1CDGA 4MCYA 3U0PB 5DJ2A 3S34H 2AXGA 2W9EH 4TPRH 1YUHA 1C12A 3I3BA 4NT6A 3BIKB 2DMBA 1I9EA 3TFKD 1IAMA 1Q9LB 5ELIA 1Z0MA 1ES0A 1OW0A 5GQBA 4OV6F 3UYOD 2VDMH 3FT2B 3Q3GA 2HN7B 4L8SB 3ARGB 3BKYL 3GMPA 5DRZA 4QKXB 5IB4B 5CJ8A 4KK9C 5D7IB 4MJIE 1BIHA 3HZKB 2BNRE 1ZLSH 3D3VE 1CYGA 5KVFH 3C2SA 3AS2A 3QPQD 4WU7B 3RBGA 4F58H 1L9MA 3IDIA 4NKDA 5C0DB 4HBCH 4F3FB 3GSUB 4X6DB 3O41B 3SE4C 3KJ4B 3QHTC 4XP9L 5JQ6H 5J06A 4PTTA 3OKMB 1I7ZB 5F97E 3PL6A 4R0LC 3AMKA 4NZRH 4RMVA 1J1PH 3P73A 4LCWE 4J4PD 3H9SB 5DJDB 2VJXA 4TRPH 2CGRL 3S5LA 3L7EB 4OZGA 3BAEL 3GMMA 3IB4A 3D0LB 4PJEF 1HXMA 3RI5K 3F7VB 4PB9L 5I8KL 3EOAB 4DOHB 1DBKH 5I1DB 1ZGLM 2XN9A 1ZHKA 4Y89A 1CL7I 5L2JB 2DM2A 5T1DL 4L1HA 4LNRA 2K3TA 3IFPB 3MUGA 2HLAA 1QFHA 3SO3B 2QHLA 5SX5H 3QO1B 4TSCL 3GZKA 1E6JH 1RZIA 3LKSB 3ARBD 5EZOL 3MRCB 2OZ4H 3W9DB 3IJHB 3G6DL 3QNZB 2NW3B 4HKXA 4HDIB 3I85A 2MKWA 1R3KB 2DBJA 1U58B 4NSKB 1RIVH 4TUJB 1A14L 4RBPK 5C0JB 4MNQB 3T77B 3MUHL 4OIIH 1RULL 1EXUB 1R24A 4QRUA 2R2HA 5AWNH 3L6FB 1Q94B 1SJEA 1MCQA 2R0LL 3V52L 2HT2C 1L4IA 1QFUL 4NHCH 3R4DA 4Z5RB 4KMQA 2G5RA 4OF3A 4LIQE 5DSCB 2Y23A 5I76B 2P5EE 1I85C 5KJRH 3U9PL 5EUOA 4EI5B 3B9KC 5JHDD 1WWWX 5IOPB 2OM5A 5DJXB 1DUYB 5E9DA 3W82A 1QSFD 5I0ZA 2X70B 5D7JD 4FABL 1WTLA 3EDDA 3FOMA 2NX5A 4KKCD 3RHWF 4NC1E 3DXAD 4HK3J 4X0KA 3OG6B 1TZHB 2ATPA 2F54E 2UZIL 4D0CB 2WZPD 5BS0E 5HHMD 4RFOL 1TVBA 2R0KH 2Z4QB 3CC5A 2DIAA 1HHIA 1S78C 3SQBA 3OKKA 3U2SA 5IQ7L 4JN2A 3Q1SH 1NUFA 2WLYA 3TYGH 4IOFD 1ZLWK 1DVFA 4KH2A 3WLWC 4JG0L 2A6JA 4UBDC 5DFTA 3VRLF 5E5UB 3P40A 5KS9A 2EE2A 5T1LD 4LQ1A 2CUMA 1JYWA 3L1OL 1YEDB 1G9NL 2CH8A 4LU5L 2WSKA 35C8H 3VDCA 1MI5D 2VKXA 4QNPF 1QSEA 2M1KA 5EB9A 2OS7A 1FNSH 5BXFB 5CGYC 3TO4B 1R3JA 4HGKC 4LDOB 5I8EB 1MRFH 1OGAE 3LEYH 3I84A 1D5MB 1IC5L 5ECJE 4JFFD 4RMUA 5I1HH 1QBBA 2YC1B 4LRNH 4RGNE 4HEPG 4PTUB 4WUKL 3LY6A 1FFQA 3VXOA 4R4NC 5I1JL 4MSWA 4ODHL 1JNHA 4WNQA 4G9FD 3UBXG 4HLZG 3LSOA 3Q5OA 4JFEE 2GJZA 3PABA 1Q9KA 4X7FC 2HT3C 3FQNB 2XWJB 3SCMD 5GJTH 5I66B 1D5BA 4NNYA 5ITBH 4JKKA 1P84J 3CNKA 1YYMH 1MF2H 3E2HC 3F12B 4LSUL 4PRHE 2GCYB 3HUJB 4UQ2A 5F88B 3LOWA 4WUUE 3VGBA 4K2UL 4Q0XL 4NCC1 5JHLL 1K2DB 5K9OB 1F02I 1XF1A 4W68A 4K94L 1NFIB 4OI8A 2M26A 1GVIA 1HNGA 4WGVB 1T20A 1T04A 3WXWL 5J3HD 1XR9B 1JWMB 2ADIA 3X3GH 1YN6A 3MOBL 1VFOA 3QULB 1MIML 3L3GA 5DT1H 2BY1A 4XB7A 3U46B 1YEJL 2BHUA 5BW7C 3IKKA 1AO7B 4F8QA 4JZNA 1QEWA 3GSNB 3OKOA 3VXPA 4HMCA 2NXYB 1Z6JT 1AD0B 3OF6A 4YDJA 2BERA 3QDHA 3N9GH 4ZTPH 5MENA 4UQ3B 2P8PB 4XP5L 2WIIA 1CFNB 2VH5L 1SMAA 4DWHA 1J0ZA 2YN5A 4E5XA 2MNUA 3MRIA 4ZMAT 4JFZL 3NFPA 2PN5A 3LS5H 3MV9A 3BRFA 1U8LB 1HQRB 4F9LA 4XT1C 3WIHA 2V7NB 1JGUH 4UILL 5KSUA 1E6OH 4FZ8H 2WINA 4BKLA 2CMRL 3ZDXF 4HAFA 1IJ9A 5EZJB 3I9GL 3S3SA 5JXAL 1FVEB 1NBZB 3GBMH 4MX7A 5TH2A 1L7TL 5SV4A 3U9UA 3WFCH 4DKEH 1PGRB 1VEPA 3MODH 1PVHA 4WCYH 4PJHA 3MNVB 1KLGB 3MGTB 4LSRL 4YHMH 4PJEB 3P9LB 4L4TE 5M94B 4QRRE 4JPVH 1AQKH 3IJSA 4CADA 4OT1L 5J1AB 5CP7B 3AUVA 3TBWA 3MJ8B 4R96B 3G5ZB 1KTRL 4HGWA 4HZAA 4GG8A 3MC0A 1GPOL 1IGYA 2C1PB 4N1CA 1OPGL 3QHFL 3RUGB 4RGNC 1T1YB 2X1OA 4NNPL 4P23B 1WLHA 1EJ6A 2F15A 2DJUA 1J1XL 3VW3L 1EMTH 4YDLB 3O6MH 1HYSD 2YD7A 4LAQH 4KUZL 3H3PL 3UTQB 1RJYB 1KFAH 4KJYA 3MLPA 1D9KA 2A74A 1BX2B 4YE4L 4URTB 1FL6B 3PGFH 5JDSA 5HYQB 3LD8B 4ONFH 4R2GB 3A67L 4PBWD 2P24B 5F7HA 5MP6L 5CD5D 1KB9K 3QQ3B 4FOMA 4YHKL 2VDLL 3P4MA 1IT9L 1CCZA 4KUCF 3BH9A 1S9VB 1X7QA 43CAB 3GMOB 1OB1A 3EYFA 1FJ1B 4V1DD 2GFBA 3LQAH 3TNMA 4DKFL 5J11B 2OK0L 2OJEA 1OVZA 2AJ3B 1Q9OA 2G2RB 3QDGE 4PRIA 3MXWL 3SKJH 3THMH 4B53A 2VABA 3SDYH 3GMLA 5INDB 1TZGL 1PZUB 3SDAC 4OUUA 4NM4L 1WITA 3OXRB 1TCMA 2OQJB 4FQ1H 2NY2B 4J3VA 1HXYA 1J8HB 2HG5B 3TWCH 4X7TA 1RJLA 2YOCA 4PJCA 1H8SA 3CH8A 3VXRE 5C0EA 2RFXA 4QXGH 4NQDA 3FQTA 1IGJA 5KSAD 4GRLD 1IARB 1MHEB 3FB8B 1E4XH 3KLAA 3TP4A 3QHZL 1UM6L 4CJ0A 1UADC 5GS0H 4DW2H 1SBBA 5INCB 4CMHC 4L4VE 5ANME 1CWVA 1VACB 2COQA 2OR9H 3BPOC 3O2DL 4RQQA 2N4IA 3RGVA 3N1GC 4LVNC 1OTUD 2VDKL 4AMKH 2XQBH 2UVFA 4P2QE 3NH7L 5I2IA 5DQDL 1IEBA 1KCSL 2VXUH 5H94A 3HHRB 1V3JA 4IOSD 3MRBB 2X4SB 1CGXA 4QT5B 3ARFC 5D1QD 1C8PA 4LKXB 4NZDA 4WFFD 2AK1H 3E6HA 1UVQB 5D71H 3FO1B 1F4WH 4J3TA 5CIPB 1UYWL 3HZMA 4YK4C 1MNUL 5C08B 1A21A 4PGDA 2WIMA 2E6PA 3ZKXB 1FO0H 5IBTH 5DUBB 1IQWL 3QZWG 3K8MA 4UV4L 4HC1H 2FEDD 1FHGA 1IAIH 4MA1B 3VXNA 5GRUH 3JVGC 4XVJL 3FO9B 4H26A 1L9NA 4F7PB 3R06A 5C0BA 2KZ1B 4ZXBD 5DR5L 3GSXA 1RZFL 2V2TB 4H5SA 5F1NA 2I25N 3X17A 3HC3H 1CE1L 4QOKA 2EXWD 5IEHA 5HPMB 1LO3L 1WGOA 1ROWA 1BQUA 5A2FA 3FFCA 4LF3A 3N85L 4DJMA 4F33B 4OM1L 1DQJB 1EZVX 4GJTB 1JNNH 1A9EB 2W0KA 4NQVA 3NFSL 4NO5A 4L9LA 5IWLC 3LIZH 1JZ4A 4WIQA 3BMWA 2VXTH 3TNNA 1JFQL 2HRPL 1PY9A 4GKNB 1IBGH 4F8TA 5LAXA 1MVUB 1ACYH 1HQ4B 3CXDH 4JG1H 2EH8L 5I17A 2R4SH 1VDGA 2H3NB 2O5YH 2LAGB 1DQDL 4LCUB 4AEHL 2H32H 3QCVH 4C54A 1KYOJ 5C07A 2HKHL 4WDIB 3MCLH 2ADFL 2NLJA 3TZVC 1DN0B 4R26H 1D6VH 3TA3B 1ZLVH 5DVKA 1RZGB 5DHYB 1DQMH 5EBLB 3KYMA 3H9SD 1A1OA 5HHQB 3QUKB 2X4PB 4PY7A 5ALCL 3BQUA 4IHOB 1H3XA 3V9FA 2H6PA 4RNRA 1L0QA 5IK3A 3HG1B 2D0GA 5HVHC 2EICA 1MAMH 1BD2B 4U49A 5E99H 5E95B 3OWEA 5DTFA 1C5DB 1FIGL 5FM5M 4PR5A 1YNKH 3ZMRA 1IKNA 3LN4A 5CMAA 1NAKH 1KJVB 4R7NA 4Y88A 4ELME 5TDPA 1OM3H 3DJ9A 4HJJL 2NY3C 5KSBA 4YJZL 4X8JA 3LB6C 1DEEB 4KRPB 3RWDB 3I75A 3VXTA 3CSGA 4P3CH 5FEBA 1N6QL 3BVNB 4ONOA 5DXWA 3CU1A 3WSQL 2Z31B 2BVOA 1FZMA 2PXYC 4GFTB 4H1LB 2IFGA 5DYOB 1LE9A 3WXVH 3LKOB 5GGSA 4Y5XA 3GNML 1L6ZA 4X4ZA 3WNMA 2UY6A 1NSNL 1LNUB 3EOTH 1CK0H 5FGCB 3HB3D 1NAMA 1G1YA 3ARDB 5D1XA 3SKOA 2XKUA 2Y1VA 4P4KC 5CLTA 3EHBD 1X6NA 3EO0A 2VDPL 2XZAH 3OJVC 3C60C 4HWBH 1EEZB 4JEGB 1HN1A 4NFBA 4MWFA 1AQDB 3O8XD 5GRWA 3EKCA 2V7HB 5BJTA 8FABB 2BY2A 4HAGA 5FO9A 5H37G 4IRSB 1AXSA 5I1CL 3UBXA 1NLDH 4PB0L 4HK3N 2LE9A 1MCKA 5CKGA 2ZG3A 5D5ME 1CN4A 4Y19E 3VXUD 4BSJA 3GJEA 5BV7H 1VGEH 3C8KB 5E6ID 3ECBB 2R2BA 5IT2L 1XR8B 4HFUH 1I3RA 4I3RH 2AEWA 3DARA 2XTJE 3CK0H 3ROOA 3MRQA 1ODAA 2ZOKA 5FUOH 3P3YA 4LPCA 1G7LB 2QV2A 1A1NA 1YEIL 3BE1L 1I1YA 4JY6A 3WNOA 4D9RE 4LQFL 3TCLB 2F8XC 4WI8A 3NA9L 5FKAA 5JO5A 2Y07H 4L1DA 1JF1A 4UDTA 3K8LA 4PRPA 3UZEA 1IKFH 5D7LA 4AENB 5KW9L 1RV6X 2NXZC 1K6QH 1U3HC 1CU4L 4OSUL 1CICA 4QHMB 3FL7A 4O02L 4X5LA 4PJ9B 2MSPA 5DC9B 2Z92A 4PJFB 2ZP0T 1FAKT 2R1WA 4JB9H 2IH1A 4RA0C 5AYUH 1UZ8B 5C6TL 5F72S 1Q1JH 3N1FC 4PJIB 4JRYE 4AEFA 1YY8B 4QTHB 5HI5D 3Q6FA 3GI9H 3IU3A 5DEGB 1XIWA 5I74B 1JRHL 3QG7L 4XH2B 5E5MB 1IZKA 3KAAA 4M61A 4XCYA 4D9LL 4APQD 5IB2B 3T2PA 5I71C 4KZDL 1S7TA 5JXEA 5C1MB 4DZBB 4OD3L 4XC1H 3A6BL 4CW1B 4OLWL 1AFVL 1XCQB 4PJXA 5FYJD 1KLFA 1ZSDB 1KPUA 2PYFB 5DK3A 1KEGH 4S0TD 1FNHA 4NN7B 5ICZA 5EU4A 3GJFA 1ZLUK 2E9BA 4FP8L 3P30H 2OTUA 1S5IH 1J0KA 4X7SH 4WFHE 2JKXA 1ZT7A 3B8SA 4OKVA 3O2VL 2DICA 1ORSA 5IVNA 1U8NA 3BHBB 3MV8D 1A1MA 4HHAA 1MHCA 4IDJL 4LASH 3H9HB 3SPVA 2Y7QA 1R3HB 5CWSA 5FFLA 1QFOA 1ERNA 4ELMF 4WW2B 2R23B 2Q76A 5GGRB 4XX1E 1LK2B 2QQLL 3N50A 4GG6B 5D6CA 5DI8B 4I77H 2ZWLT 3QNYB 5LJYH 5SX4I 5T33H 1J9CT 4DEPC 5K9QI 3U4BH 2G75A 4ODUB 2QHRL 4ESKA 1PW3A 4M9PA 2YD5A 4CN1A 2XTJC 1T0MB 5KVDH 4Y0GA 4N8PA 4J4PA 2FLRT 5FECB 3BUYA 1W2KT 2FX9L 1DUZB 3KG5A 4PJ5B 2JCCB 5KG9B 5FGSA 2FO4B 1N64L 4F7EB 4YDIL 4MYWB 3DGGB 1OTSC 5ICYA 4LL9A 3PV7A 2QKIB 1N59B 1OF2A 5E08H 4N0FB 1U92B 1JV5A 2WBJD 2B7DT 3L95B 3W0WE 1TTGA 1QKZL 4WV1B 3LKRB 1XF3B 1AGFA 3KR3H 4XNUL 3FONA 4XCNB 3QRFM 1E27B 3I3EA 3K2UL 3OAYK 4OZHE 4HFWA 5JMRA 2LAAA 2BDNL 3Q6GL 4XP1H 5C0CB 4PJ7B 3ISWA 3O9WB 1CDUA 3BZ4B 3CLFH 3GIVB 4L8DA 3RWIA 3PWNA 4WU5A 2P1YA 3L7FA 4X9IA 5D5MF 2FB4H 1SJXA 1BAFL 3FHQA 1KT2A 2NNAB 2WV3A 4KPHH 4PJDB 2IFFH 3WN5A 2DQTL 3AREB 4DQOL 3L9RA 1CI5A 1ZA6A 4P5TC 4UTBL 1BVKA 1BOGA 1U8PA 5F1KC 3FQWA 3O4LD 3CUPA 2ZUVA 3NN8A 2PKDA 5D1ZA 1WC7B 5F3BB 1LO2H 2VLKB 3VXRB 4KK6D 5F7MC 2R4RL 2X7LA 1CLYL 5JHDA 1MOEA 3VG9C 3RNQB 2YPKA 1QSFA 2PR4L 1JPTL 5D7JA 2J12B 4Z0XA 1INQB 3KXFA 3GSQA 4DK6A 1R0AH 5TDOB 1KG0A 2VQTA 3DXAA 5CILH 5ICXA 4XNYL 3W9EA 4BZ2H 1MFAL 4HV8B 3D25B 5L2KD 1GSMA 4FFZH 4Y4FB 5I18H 1KUMA 4BSWA 1J8HD 1JF6A 2HLFC 5HI3C 3S37H 1MCCA 3TPKA 4GW5A 1A7OL 2XQYK 4WWKC 3HZVB 3T0VA 3O3EB 3IVKB 4JPIA 4FQQA 3EFFB 2DTML 4QY8B 2EYRB 4DTGH 1AR1C 5T1LA 2BOCA 1FFNA 4U6YA 4XAWH 2PTUA 1I9RL 3BD4A 4Q9RL 1EK3A 3DI3B 1VCAA 2O5XL 3NTCH 1ZHBB 1TMCB 1QACA 4HKZB 3NACL 4JY5H 1VFMA 2VL5B 4YHPB 3VFOB 4GBXC 2HT2D 5I75C 3MMEB 4UU9A 2NY1B 2P42B 4HUKB 3KPSB 3LVEA 4LDLB 1KCVH 1BQSA 1BFVL 4JFFA 1Z9LA 4XBPA 2BVUA 5TE4H 5I1EL 5T5FH 1KPVB 4GAGH 2VLJE 5GSVB 5F7FA 4U1SA 5GS3A 4G9FA 3QAZB 2EDWA 1SVCP 1YN7B 3SCMA 1JUFA 2HT4C 3MQIA 4RRPG 1KELL 5HHVH 2X4RA 4MJID 4GXVH 2BNRD 4M62L 3BGFB 3D3VD 4LEOA 4JCMA 4AL8L 4HUVA 5JR1L 1XAUA 4L29A 2FZ3B 2HJFA 4G7YH 1G7MA 4YXKL 5L88L 3HAEB 4XNMA 2B8OT 1QR4A 5A40E 3HMWL 3VXSE 4XPBH 2GTZA 1G7PB 5EUKA 4U0RC 3WLWD 1XGUA 2WQRA 4KTDH 1A7PH 1BEYL 4OCXH 4UBDD 4UDUA 3MRKB 3LEVH 4GMSL 2FBJL 5EU6B 4LCWD 3CH1B 4LSSL 1QZ1A 1CVSC 3K4AA 3U0WL 2Q3AA 4OGYL 3VRJB 1B90A 1NL0L 1PYWA 1F45A 4NOFA 5JW4N 1A6AB 3V4UL 3MRLB 3HNTH 3VD9A 1MHPL 4UZGA 4RCAA 3SGKA 4J8RA 4N8CL 4O00A 2HVKA 4NYLB 4H20H 3IXAA 3WCYA 1PG7W 5JUEH 1L0XA 1RUPL 4OZHF 4U33A 4YHZL 1Q72L 4G80A 4R4ND 3W39B 4P46B 2XPGB 3KPPB 4ZPTA 2X4QA 1XZ0B 5SWZE 2HT3D 5TGBB 3ZHDA 4QTIL 2QQNL 3TT3H 1NLBH 4OLUH 1N5YH 2OTWB 2ZUUA 4F9PC 4OZ4A 5J1SC 4N0UB 4YH6A 1HHHA 3PWUA 3HKFA 4HW6A 4YDKL 2ED7A 2IPTL 3QI9C 2GJ6B 4XXDB 1GOHA 4LPTA 3LKPA 5C9JB 5IFAH 3MV7A 3F65A 5ALBL 2F53E 3OKNB 1DQLH 5FAAA 2Q7YA 4FN0A 3IFLH 3VGHA 4OLVL 2E9WA 2QQKL 4EZMA 4U6XB 1UB6B 3IDGA 3SE9L 4ENEC 3OX8B 3GHEL 1YEGL 5E94A 2AK4E 4F2MB 1TQBC 5EA0L 3EO9H 1MFBH 1T1WA 3BIAX 3MA7A 3SE3C 5I1GL 2HWZL 1PD6A 3VD4A 3IDYB 4BZ1H 4YGAB 3HZYB 4TSAH 3QWOB 1P5UA 4O9HL 4HS8H 3BT2H 5AZ2H 3VJ6B 2X4UB 3BPNB 1WBYA 2FWOB 2VDRH 3AU1A 3DHJA 3V4VL 2VZ3A 4GMTL 1GIGH 3S4SB 1E4KC 5IMOB 3ARDD 1LDSA 3MJGX 2F54D 4NO2B 4MA7H 3QUZC 3VWKB 2HJLB 2VMFA 5BS0D 5J6HB 4OLYL 2IALB 1T3FA 3LV3A 4JO1H 1BF2A 1J12A 1V8HA 2CRIA 3RAJH 5CEZE 5D2NC 5FKPA 4K8RH 4KUCD 3KPRE 3MRGA 5E2JA 4V1DA 1CBVH 4YWGL 3UPRB 1X5HA 5IMLA 5JPMB 4PBVC 1QA9A 3DLQR 2I5YL 1N5AB 5EWIL 5FYKH 3SE8H 1ZOXA 3U4AA 2I60H 3ILPB 1JWSA 1OGAD 1W72H 3KS0H 3GSRB 5JW4R 2ZSWA 2DQIL 1Z9OA 5IROC 4RGND 3GB7A 5JOFB 2B5IC 4W81A 2VLRE 4LMQI 2DAVA 2DYPB 5KSAA 4GRLA 5DUMH 2X1XR 5EBMA 3F5WB 4JFED 3WEXA 1A6UL 5F96H 2DQCH 2MFNA 3L3IA 3C08H 1AGCA 5IMKA 4CMMA 1HE7A 4X6CB 1S7UB 3MUY1 4Q2ZB 5IKCA 1VERA 1QBLL 2VO5A 4YO0A 1KACB 3G5XB 3GKWL 3VRIA 2BOBA 4Y5YC 4PRHD 1JZ2A 3GSVB 3DTXB 3U1SL 4K3DL 5A43C 3UYRH 4NQCB 2P5WE 1MEXL 1DBJH 2BXYA 3CFDA 1RQ5A 4G6KH 3TN0B 5CEZH 3CZFB 5FA4B 2VLLA 1JPFB 4LP5A 4AIZB 4LLWB 1EFQA 3RWEB 1FORL 3V4PL 4HCRL 4U3XA 4ODSH 1JGDA 4TSBL 2NR6C 5D1QA 3WKNA 2BRRL 1YNTA 3DV4A 2L7JA 4A6YA 1GGBH 2MQCA 3QUYD 5DD3L 1IAOB 1UM5H 4RWYL 1H5BA 2ORBH 4Y16C 5C2BL 5C6PB 3NIFE 1DBBH 2X41A 2C4FU 3QSKB 3WDJA 3SDAD 2YHGA 1HH6A 3SDDC 3UJTH 4G8GB 3DMMB 2G60H 1NGWB 5A1AA 1VPOH 4JY4A 2GSGB 3HC4L 4ZXBA 1NGXA 3R8QA 4ZPVB 1A7BA 1PG7L 3NPZB 5J9PA 3KYOA 3BIBX 4YEFA 5ERWA 5EO0B 4HWUA 3DWTA 4XVTH 1MFEH 4JDTH 3O0RH 1LE5A 2AV7B 3RNKB 1IAKB 3FT2A 1IGCL 1AIFA 1BZQK 2VQ1B 3BGAA 1OD9A 3CD4A 4WW1A 5GGQH 5IB4A 3W81A 1RIUL 4XPTH 3QIUC 1BVLB 3PP3H 2EIDA 3MRDA 4HT1L 3MACL 1NMCC 1T2XA 4WU7A 4PREB 5CEYA 4MMXC 4DVRL 5IEKA 1NUNB 3MRPA 5C0DA 1MHHB 2E7CA 3B2UC 4OCNC 4HXBL 3B4NA 1G7IB 4L4TD 4QRRD 3ARFD 4RAUA 2Y36H 2J6EA 3FO2A 1V3MA 5D2LB 1BLNB 5DC0A 5FDWB 4HWZA 3S36H 5B39B 3OKMA 2JK5B 2YZ8A 4I48B 3RVUD 2YXMA 2IADA 5D9SB 4HS3A 1IEAA 1FYTB 3T3PE 4HS6B 1NMAH 2IPKB 2P8LB 3H9SA 2FJHA 1RZ7L 3CDYA 1EVTC 2C4FT 5C0FB 5T3XH 1T89C 1NCTA 4TNWF 5FO8B 2OL3L 2R0ZL 1KIUA 4PRNA 2FIKB 3RX8A 1J1OH 5E4EC 1HZHL 3VD7A 4MA8L 3DYPA 5FB8B 3IYLW 2J5LB 4ZDHB 3BP5A 3F7VA 4OQ1A 1F90L 5TQ0H 4UTAL 4K7FB 4WHTA 4EKXA 1CFBA 4UT6H 4XRCB 3U30C 3QUMA 1LDPH 1T22B 4Y1AE 3UDWC 3T0BA 4CGTA 1L6XA 1OOAA 1ZT1A 1JNJA 1CXIA 3V95A 3S9DB 5GGTL 1N0XH 5D7SH 2R39A 5EN2B 3IJHA 5F7KC 1PG7X 3CCHB 3PQYB 3QNZA 5JA8B 5TFSH 4ERSL 5DDHB 3H7LA 2NY0B 4FFYH 4XGZB 3ZL4L 3WFEL 1TZIA 3T3ME 4JZJB 3QDGD 1FFPA 4TUJA 1VGKB 3R1GL 3ROLB 1YNLL 2BNQB 4AK1A 5ISZE 3CX5K 3ZYOA 1RI8A 1BP3B 1CLOL 4NRYA 4RMWA 1NCUA 3TZVD 2DJSA 3DPBA 3K1KC 5IB1B 2XTLA 1QNZH 3MNZB 1XGQB 1Y0LB 5I16B 4WRLA 4XNZB 2GK2A 2VLKD 3VXRD 5ACZA 4JDVA 1RUKH 3DO7A 3O8XA 2LV4A 2CDGB 1SBSH 6FABH 1PSKH 1DLFH 5DJXA 4L9DA 5F9AC 2BVTA 4Z7UB 1UH3A 1NBVL 2NTFB 3KHOA 1Q0YH 1G7QB 2MQ3A 4L4VD 4K3EH 4RRPA 5BZWB 1I7RA 1CE6B 3IETA 5HJ3B 3VXUA 4OZIA 2NY3D 2EKSB 1BZ7B 3HPLB 4GAJH 1RHHA 3LS4H 4XTRC 2XQYG 3C6SA 1NJ9A 3MV11 1FZOA 2OL3B 3LB6D 3T0EB 5E6IA 1OP5K 3S34L 4P2QD 1WIOA 5T3ZE 1EUTA 2R1YA 2W9EL 2CDEB 4Y4FD 4TPRL 3MRHB 1OSPH 3V6OE 4K7PY 3S7GA 5IR1B 3L3DB 4CVZA 1CF8H 2VDML 5DJAB 2Y06H 3P77A 2ADGB 5AAWA 1JN6B 5IVOA 3QEGH 3VGDA 3D6GA 3ULVH 3MLWH 3QJFA 1TITA 1DVFC 2XA3A 2E8YA 1ZLSL 4JREB 3NIFF 3TBYA 5KVFL 4NHUA 4P99A 1LEKA 4P9HH 4F58L 1SVZA 4Y4HC 1IILE 4Y5VB 4U31A 4HBCL 1I8MB 4P5KB 1IM3B 4P4KD 3U48A 3HLAB 1HILB 4XNQA 5BVJB 1CGUA 2BSTB 5JQ6L 5I8EA 1D5XB 3C60D 3MNWB 5FIEA 2MJWA 4MDIB 1MRDH 4NZRL 5E8NB 1J1PL 1AI1H 1GGCH 3SDXE 1A2YA 4TRPL 4LSTH 2IGFH 1GZQA 5EOCJ 1KC5H 4ZQKB 2VZVA 4KXZI 3ULUE 4HZLA 4JO4H 4MVBC 2AP2A 1SJHA 5CGTA 2HFFB 3HFMH 5T1MB 3F12A 3MCKA 4O51A 5DD6B 4NRZB 2KQMA 1DBKL 4APQA 1AC0A 2C1OB 3QFJB 4LBEA 4RX4D 3MGOB 3WIHH 1QVOA 5MEQA 1QO3A 4WI2A 1S7WA 3MROA 4O2FB 1FNLA 1I1RA 2BSED 3ULVC 3I6LE 3SBWC 5HGAA 3HNSH 3VFMA 5K9QG 3ARZA 4Z0BH 1E6JL 4JKPH 3UTSB 1XR9A 5FM4A 2OZ4L 5SWZB 3IXTB 1B4RA 4AY0A 1UM4H 4KKLD 3JTTA 3QULA 3BP4B 3QUXC 4ACPA 2NXZD 4ODWA 4A2MA 1XEDA 2XNAA 1U3HD 1P4IH 4QHKI 1RIVL 3FRUB 3MV8A 1WIPA 1I3UA 5HHPB 4LPVA 4OIIL 3GSNA 5LCVH 4D0DA 5AWNL 4ZS6C 4Y2DC 3EDJA 3VH8B 4NHCL 4LFHG 1H0DA 2F5AH 2NW2B 5AD0A 1YPZE 2UWEE 2FR4A 4LSQH 5C70A 5F6HJ 4XXCA 1WZLA 1K4DB 5KJRL 4ORZC 4K9EH 2P7TB 3JWDH 3I50H 3V6OC 1AGBB 1K5NB 4M8QB 4ZSOB 1L7IH 4FMFA 4HIJB 3T3MF 1VFUA 3QQ9D 5JLZB 3T0XA 5E2WL 5HHXH 1OAKL 3NOIA 1XCTB 1G6RA 2J88H 3V5HA 3MO1A 3HE7A 5I9QC 2WBJA 2CKBB 1M1SA 3MGTA 1A6VH 1J87A 2A9MH 3P9LA 3UTZA 2R0KL 3B9KB 1OQXA 3BYYA 1P7QB 1UCBH 5C8JB 1G9ML 3Q1SL 3TYGL 1ZT4B 3MLXH 1IGTB 4TOYH 5GSRB 4LVHC 4J1UB 4ORGB 1N26A 3SEPA 5HI4D 3PNWA 35C8L 3IFOB 3PXHA 4PJBB 4M7JH 2R2EB 2MCPH 4EVNA 3DX8A 2FJFB 1OTTD 3RVWC 3UJJH 4PP1C 1FNSL 4Y19D 3BWUC 4I0PB 4DUWA 3SE4A 4FQXB 1EFXB 1MRFL 4NUJA 3LEYL 3JWDC 3RBSA 2CLRA 1FL6A 3VWKD 5I1HL 4LRNL 4R0LA 1D6EB 4QRPB 2XTJD 2KQNA 3O4LA 1OY3B 5EC2B 3S6CA 3IDMA 3M17B 4D9RD 1CDCA 1U95B 1OTSD 5GJTL 5GS1B 43CAA 4MD0B 2FECI 5ITBL 1FJ1A 4FS0A 1RZKH 1YYML 1MF2L 1ZS8B 3FOLB 3JBG7 2DKUA 1P2CA 3RU8H 3DVIA 3T0DA 3K46A 4TNVK 2BK8A 4JRXE 2VAAB 3T04D 3NCBB 1FLRH 5E56A 1JGEA 2P5WB 4QRTB 5L2KA 2Z91B 3KPQB 4HKBB 1J8HA 3X3GL 4LPYA 2HG5A 4B0MM 2DI8A 1XF4A 1W0WA 2ATKB 1QRNE 2GT9A 2DYPD 1R5VA 2YD8A 5DT1L 5J57B 1G84A 3C09C 3D9AH 3V6FB 5C0IA 2Q8AL 3ULUF 4NQXB 2LU4A 3MLUH 1I7UA 2Z93B 1UWGH 5DFVD 1NGYB 2EDNA 3Q48A 3JZ7A 4IBLT 1GOGA 2W0FB 4P5MB 4OGXH 2JB6B 3N9GL 3QRGH 3JTSB 4ZTPL 2MMXA 3NA4A 1D7FA 1GJIA 3QIWB 4NQCD 2ZPKH 1LEGB 2VLME 5ENWB 5IVZB 1GL4B 3G04A 2CIKA 5KBNC 2OJZH 1I85A 5LBSH 3LS5L 4K3GA 1F3DH 1RZKC 1JGUL 1M05B 1E6OL 5SV3A 4FZ8L 3U7WH 4F7MB 4KI5C 4WFHD 5T1KD 4HH9A 5CKAA 1VENA 3GBML 4XWGH 1AGDB 3RZCB 3ZT7A 3MRNA 3WFCL 4MJIA 4DKEL 4YAQA 4X4ME 2BNRA 4LCYB 3D3VA 3MODL 3U4EA 4WCYL 3OHXB 4YHML 5I6XC 1AKJB 4G3YH 3FO9A 1OAQH 1AQKL 4HF5L 3CDGA 3DMMD 4JPVL 2BY0A 2HLFD 2V9RA 2PO6B 5HI3D 1YPZF 1Z2KA 3KGRA 2UWEF 1KLUA 4JM2C 3WMSA 1SEBB 4G6MH 4WHYG 1WJ3A 2JF1A 5D93C 4YC2B 1T4KA 5DURB 4P0DA 5IHZB 4F33A 2CO7B 4GKSA 2OLDA 1DQJA 1A0QH 4P2RB 4I0CC 3RZWA 3CIQA 1PZ5B 4WI7A 4LCWA 1BIIB 1EMTL 3T1WA 3O6ML 3MREB 4L9LC 4LAQL 5KN5B 3BWAA 4GKNA 1HHJB 4MB3A 4HIIA 1KFAL 2R56H 5IG7A 5F21B 3IKCA 4PJGB 2H8PB 3PGFL 3W0WD 4JVPA 4MCZB 1T2JA 4ONFL 2J7LA 4W6YB 2FYYA 4YXHH 3QISA 1R3IH 4YFDB 4LCCC 2AJSH 1WZKA 1T7YA 1DN0A 2V6HA 4Q9QL 1U8IB 2HFTA 1FYTD 5FDYA 1RZGA 1E4WH 2RB8A 2N7AA 4GRWH 2HT4D 3RWFB 3S35L 1I1AC 3E8UH 1UENA 3LQAL 4MJ5B 5F8RC 1NAMH 3HC0B 5CZXC 3VXQB 5D7LE 5LVEA 4JM2F 2W0PA 4XZUB 5F7EH 4FG6C 3SKJL 3HAEG 2HMIC 1IM9D 3P4LA 3O3DB 4F15B 4UINH 4ZUUB 3R0MA 2HA1A 1NGQH 1KJVA 4FQ1L 1I1FA 5L9DL 1IKNC 4KRNA 3TWCL 2RQ8A 3BP6B 3G5VB 3G6JE 4XWOC 4QXGL 4Z77B 4QO1A 4FXGA 4NC0B 2P5EA 2I07A 3E0GA 3LAFA 1E4XL 4U1NA 5BW7A 4FQJH 5ACLA 1BFOB 5GS0L 4DW2L 5FUZH 2NY0D 1DQTA 3SDCC 2OR9L 4JRWA 2Y5TB 5F7WC 3D39E 4JN1H 4AMKL 1P7KA 4LLAA 5C71A 2XQBL 5DZNA 3U79A 2YUXA 4Y5XC 5KTEH 1F8TH 4FQCH 5TPWH 2VXUL 3ARDA 5HGHB 1JHLH 2F54A 3O6FC 4PJXE 1FE8H 5BS0A 2Q6WA 5JNYB 4JJHA 5D1XC 3LQZA 2JJWA 5BMFH 2AK1L 5D71L 1EEZA 1F4WL 2C3GA 3O3AA 3FQXB 4HIHA 1KIRB 2H9GA 2IAMB 4PG9A 5DJCA 4K55A 5F7NC 3BUTA 1OWWA 3IAGC 3QI9D 1FVCB 1CR9H 1FO0L 5IBTL 3WNLA 4P59H 3T08A 3X13A 2G5BB 1CFQB 4HC1L 4ZO8A 1IAIL 1V7MH 3O81A 1FFRA 3L5WA 4HUNB 1KGCE 5GRUL 2CKNA 3DX6B 4RIRB 3EO1A 4UV7H 4S1SH 1KBGH 3S35X 4PY8I 4RFEA 1HINH 3GMQA 4ENED 1T66D 4P2OB 2BCKB 3TJHC 3MYJA 3ECBA 4JZOA 4ZFZB 3GSWB 3HC3L 5E5RB 3SN6N 5F93C 2A73B 1OGAA 3SGEH 1WICA 3QCTH 4C59B 1YMMB 3QEUB 4ZNEE 3WYRA 2ILLA 4M48H 3WFDH 1JNNL 3HI1B 1ND0A 2YPLB 5IJVA 4NN5B 1P69B 3LIZL 4HG4J 2VLJD 4NQEE 4PV8B 4QRSB 2VXTL 3RWCB 2BC4B 3LRGA 2QADB 4JFEA 3GM8A 3CAFA 3RPKA 2SEBB 4POUB 1IBGL 5SWQA 2YPVH 5JIIA 2ICES 4M1GH 2HP4A 1ACYL 3ZKQD 3CXDL 4JG1L 5SX5K 1CZ8H 1P1ZB 1UXSA 2OYPA 3BKCH 2R4SL 5LGJB 4PRHA 1E28B 3QUZD 2O5YL 3GJFH 3C6LB 1M7DB 3VFUB 3QCVL 4WUUA 4QHMA 1DLHB 5D96B 4JHAH 3EAKA 3UYPA 3CFJA 3JXAA 3MCLL 4CL7A 4R26L 3MLTA 1CICC 3ARVA 1D6VL 2JJTC 3VXSD 3PG2A 4QHLA 1DQML 3VI4E 3V5DB 4I8DA 4TTGA 5IHBA 1WISA 1JZ7A 1VKXA 3QUYA 3GSOA 5CAYB 3TLRA 4OAWA 1MAML 5C0AE 3O11B 5E99L 4IRZH 2WMPA 1U8OB 1HSAA 3S96A 1DDHA 1YNKL 4ZUSA 1NAKL 3SDAA 2BSRA 3B5GA 2VUYA 1OM3L 1FO0B 3ZDYE 2X4OB 4U1IB 4PJAE 2VERN 1S5HA 4OBSA 2UWEB 2PYFA 3DHMA 2BVPB 3UTSD 1OQOA 2CDFA 5SWZD 5CUSH 5K9JH 3DVGA 4NZTH 3HMXA 3SJVB 1RVFL 4ETQB 3GIZH 1X44A 3V7AE 2FD6H 3BGMA 3S3PA 3H7BA 3BHBA 5CFHA 3MYZA 3V0WH 4UNVA 4OGAC 3QBTB 1TFHA 4E0RB 4YHNA 1KIPB 2VZOA 3VGGA 3EOTL 1CK0L 2WUBH 3VGAC 2YMXH 3REVA 2DMCA 2W9LA 3RQ3A 3QPQC 2R8SH 43C9A 4I9WE 5CEXB 4HQQH 4L4TA 4QRRA 3ARFA 1TJIH 2NR6D 2LVCA 2XZAL 4HWBL 1CGSH 2AJXH 2NY5H 4A2LA 3T8XB 4FQHB 4X98B 2AK4D 4Y4KB 4QRQA 3C8HA 5EO9B 2X9WA 4S2SB 4Y16D 2D7OA 4CVXA 1KENH 2KBGA 3WFHB 1KN4H 1NLDL 1DUZA 1ZA3B 2N1KA 1AY1H 4J4PC 1CDBA 1XF2B 4WJ5B 1E4XI 2UUDH 3GGWA 3P11H 1C16A 3JVGA 3SDDD 1MI5E 4OD1H 3UJIH 5BV7L 1RUAH 1NC2B 1P5VA 3L3OA 1VGEL 4G43B 2XWTA 1U92A 4N0FA 1A4KB 4XX1G 1MWAA 2AKRB 3MFFA 4WWID 3G6AB 4I3RL 4WV1A 4NKMA 3VWJC 1BZ9B 3CK0L 1ZV5A 3F6IA 4XCNA 5DS8B 5FUOL 3IDNB 1RFDH 4IRJB 5D8JH 4RMSA 1F11B 2GTWA 5IVXB 1GC1L 4S1DC 5IWLA 1H15B 1Y18A 4GW1A 4ZYKA 1M4KA 32C2A 3BZ4A 1MELA 4TVPE 4XCEA 1JZ5A 3GIVA 4HKJA 2Y07L 4POZC 3DVNB 5CEZD 5J13C 1FFOA 1IKFL 1P9MC 3ARBC 1YMHA 3KPRD 2E9IA 4ZFFB 3UTTE 2BSSA 1K6QL 4I2XE 1CLZH 1JVKA 2NY5C 3QDGA 1PFCA 3L5JA 2NNAA 1EFXD 4GXUN 3ARXA 3JV6A 1IAII 3JV0A 4WEMB 3KWWA 4P2CG 3KDMB 4RGMB 2YSSA 3TZVA 4YIQA 3WN5C 3NZHH 4JB9L 3T65B 5AYUL 2H2PC 3RL2A 5FYKU 3U36A 3INUH 1Q1JL 4YPGB 3BW9A 2X1WL 2C7UA 4JAMA 1KV3A 2VLRD 3TBSA 1CQYA 3VXRA 3QIBC 4U7KA 3U83A 2BMKB 3WNNA 3GI9L 4MAYC 3QDJB 2QR0B 1ZHNB 4QHNB 1RZJC 5DHXB 4G8IA 2JE8A 1MIEH 2DI7A