1VCAA

Crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 angstroms resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
199
structure length
199
Chain Sequence
b'FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN VASCULAR CELL ADHESION MOLECULE-1
publication title Crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion protein
total genus 41
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05790 C2-set Immunoglobulin C2-set domain
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1vcaA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1vcaA01
1EEUA 3BWAB 4EDXB 2VWEC 3ZT5A 2K7PA 3GJFK 4M7ZC 4UOW1 4ZUUA 1BGXL 1C5DA 3D18B 3LMJH 3RUGF 3CVIL 1T03L 1A4KA 2PTUA 2YN3A 2Q8AH 2P5EB 5ISZD 1ULVA 3ZE2E 5I1DB 1MCPL 1RFDL 2FRGP 5T5NF 5T3XL 3RGVA 1HHHA 2VUOA 2YZ8A 1VDGA 1P6AB 1SY6A 4G43B 4Z77B 1A7NL 5L88H 1NMAL 1FRGH 4ODSH 4W6WB 3HNVH 3DETD 1CFTA 3F7VB 3DV4A 3SY0A 4X5LA 1UWGL 3RVVD 1U3HB 2I26N 4JANA 1VESA 1F3JB 1G7JB 1NCAH 2ED9A 2DMKA 4XCCL 4F33A 1WZ1L 3SDDD 3QUXC 4WWKC 1ZLVK 1NC4A 2X4UB 2ARJB 2XWBB 3O6FD 4QY8A 4O51B 4X4ZA 1ZT1B 4BA8A 5JPMA 5C0GA 1I9IH 3H9SE 1E27A 4HT1L 4GRLC 5EU6B 3D1MC 5DD3H 3ORJA 5C08E 4CU8A 2IFFL 2EE3A 3I6LE 3E6FA 4JDVB 3T0WA 4NM8L 4XPBH 3CSPA 3QNZA 1T5WB 2NY3B 5DMKA 5GSRB 1JWUA 4LQFL 4OZHA 2HG5A 5MENE 4JM4L 3ZTNH 4D0BA 1U92B 1HINH 4ZQKB 1BM3L 4NZRL 4HX1B 5GRJH 4JN2A 4RWYH 4Z7UE 4G9FB 4LMQI 5L2KD 1DN0A 1V3JA 3ARVA 4J8RA 1BZ7A 5TDNA 4P4KA 3NCMA 3R1GL 3GGWB 4GKZB 5HGBA 1J0JA 1E0OB 3ZDYE 1Q9OA 4KGLA 1YNLL 1QSEA 1LMKA 4KJYB 5CEYA 1CQKA 3LEVH 4NO0B 2ZWLT 3CVHA 1NL0H 3G5ZB 4LLQB 5I1CL 5D2NA 4HWNA 1MFDL 4OI9A 4QLRA 3OGCA 2MTPA 5EBMB 2ZOKA 5ETUA 2WM0A 3T0EE 2NXZD 4P46D 2D0GA 4PP1D 5HHPA 4NQEB 1JPST 1ZHLB 2VLME 5B8CC 4GS7B 1S7QB 1MLBB 4N8CL 3FCTA 1NFDA 4UU9A 3TNMB 1F6AA 3DVFA 5GGVH 1QD0A 2CDGB 1TTFA 3MLRL 3K2UH 4U1SA 4JZOA 5I30L 4ZXBB 4PR5B 1KB5H 2X1QA 5D6DA 1FFOB 1VERA 2ITDB 4NRXA 3AMKA 3D69A 2BVEA 5F7EL 4NN7B 1ACYH 5E4IA 3EDKA 2K1MA 4Z7VF 1UQSB 1I1AC 1MNUL 1WT5A 3LKQA 4OCXH 4EDWH 4FHBD 3BDYH 1T1ZB 2DQJH 4YH6A 3T77A 2HWZH 4U31A 2MKWA 5EZLB 1ES0A 4HWEL 2XTJE 2AEPL 2V5YA 3AY4C 1IGCL 5JA8B 3U9UB 3LN9A 1DBBL 4PJAA 3I6KB 1SQ2N 1NFKA 3WJLC 1T66C 1Y6MR 3S34H 5D7IF 1EHNA 5TH2A 1ZGLA 4QWWC 5D7KD 3KPQA 4NKDA 3EYFA 4NPYA 3PWPE 4MXQD 1CTOA 1PKQB 4RZCB 1I4FA 3JZ7A 3SDXF 3MCLH 4JO2L 1RIHL 2HTKC 2VMFA 2VXQH 4IMKA 3L3JB 1Q72L 3MJ8B 3TCLA 4FZ8L 4Q58C 3ULSB 1I7UB 3SQOL 4Q9QH 5ITFB 4POYA 4Z7OF 1LEGB 2DQHL 4ELKA 3BRGC 5C9JA 3BIBX 3DVNA 3NPSC 1RIUH 1FNLA 5F3HB 1V7NL 3MV7E 4JQIH 2CMRL 5JR1L 3RBSA 4XCFL 5T3XD 2BZDA 5FGBA 1S7TA 1SEQH 4WHDA 1TVBB 5EZOL 5A16A 3AREA 4MQXC 1MRDH 3FMGL 3OKEA 4U0RC 4N0FA 2X89A 5KW9H 2PTTA 2A6KA 1QLRA 3ARDC 4LPYA 3RPIA 4PJDF 4XMKL 5J06A 3WFDL 1H5BC 1VCAA 5DMJB 3QIUB 5IIEB 4G8FA 1CU4H 5KVEL 1FGNH 2EIZA 5DJXB 2AQ2A 1TQBB 3QEQD 4J4PA 4EOWH 4R9HA 4Z7WB 2OK0H 3QJFA 1UB5A 5SV4A 4PJ9C 3VXSA 3TT1L 3R8BB 1MOEA 35C8L 3RL2B 4NHUB 5T1LB 5C8JB 2DIJA 1DQJA 3F7QA 4ODTL 1VGKB 4ZYKB 1BFVL 3GMMA 4BSJA 5C2UB 4P57B 2CLRB 4K7PX 3GRWA 4HUUB 1JPGA 1P7KB 2VLRB 3QWOB 1MF2H 1A6UL 2F5AH 2N56A 1UZ8A 3C2AL 4OGYH 1MFNA 3K46A 3RTQD 1FN4B 4OQTA 5FKAA 3KXFA 5B3JF 3C5JA 5DSCA 1FIGL 1G6RH 1U3JA 1A7PH 1IBGH 4Y4KB 4OUUB 3BGFC 1FYTA 3HZMA 3UJJL 3C87A 2A1WH 1V7MH 1HE7A 4HCRA 3SOBH 1JUFB 2BJMH 1WAAA 4RAUB 4U6TA 3RDTA 1G7QA 2IH1B 3DI3B 3LIZH 1OGAD 3VFMB 1KOAA 1WFUA 5A1AA 1E28A 3U0TB 4S0TD 4U3HA 4WNQA 5IHZB 4OCRH 3KYOB 1G9NH 2XA8L 3KYNB 4L8DB 5T1KB 5L9DH 3JWDH 5CGTA 4QRUA 3WNKA 3DRTA 2YS4A 4F7MB 2X4RA 1TTGA 4NJAH 4NCDA 4OFYA 4P23A 1RSFA 3CC5B 5JMRA 2V2WA 4KK6C 4JFDE 2NZ9C 3KPOB 3TJEH 4EI5B 1A6VL 4HC1L 2H8PB 2FIKA 1TFHA 1J1OH 4ORGA 5L2JB 5EN2B 5T3ZL 2JELH 3C60C 3DRQB 4JM2B 2V9RA 1CD1A 4GQ9H 3MGTA 1LVEA 2MOVA 3PL6A 2Y6SD 1XGPA 1QFUH 1FPTL 1RZIA 4UDTB 4YPJA 5IMLA 1T66D 1WBZA 2X4OB 3M17A 1JZ7A 3NACH 4P2RD 4PG9A 1VFBB 3BAEH 3GMRB 2XY1A 3MZGB 4MAYB 4ZS7L 4CW1B 5HVHB 3QFJB 1ZEAL 4GBXB 1OF2B 1S7VA 3RUGB 1PW3A 1LO4L 1XF1A 5C0CB 5CIPA 3V9FA 5IV2B 2YD8A 2D03L 4LCIL 2C1PA 2ENYA 5IUSA 4BZYA 3B5GA 2LAGB 2WUBL 4A2MA 1XFPA 5DZLA 2ZKHH 4PBXA 5F9JB 1I1FA 1R3HB 4LHQB 4WV1A 5ELIA 3WS3A 2DAVA 3UBXG 3LN5A 4PS4L 1PVHA 3A0OA 3BH9B 3GI8H 5CZXC 3NCJH 2NX5D 5IB1A 5C3LD 5I2IB 5DURB 1MFCL 3ARBD 2A73B 2QEJA 3PJSB 2BVTA 1IFHL 2MWCA 3RAJH 2F53E 3ZTJG 2ZUQC 4NJ9L 3REVA 1JGVL 3MV9E 4QHMB 4I5BB 3FB6B 3S7GA 2VZ3A 4CVWA 3VFVB 3ARDD 4RQQB 1P7QD 1FO0L 2XZAL 4L1HA 1C16B 4LGPB 1NUGA 4XP6H 4FA8A 3V6ZB 4Z8FH 3N1MC 1I7ZB 3BPOB 5HHNA 4L8CB 1E4XL 2NXYC 1TENA 2RFXB 3QCUH 2FX8H 1BX2B 4JY6A 4KMQA 1FNGB 3IAQA 1B2WH 4AT6A 3BUYA 4ONOA 2R0ZL 5D2LE 4YDLB 5IEHA 3BHBA 3N1GC 1HHGA 2WLYA 5TPWL 1RJLA 1DEEB 2WMPA 3CIQA 4X5XA 4PJ8A 4R3SA 3TBYB 3ECBA 4KMLB 1FORH 2FEDC 3PABB 1P2CB 3ES6A 2AV7B 1AGFA 4JPVH 3UCRA 3IFPA 4P5MB 5D7JD 1FFNB 4F9PC 3O81A 4YHKL 2I25N 3SPVA 5HBBA 3HNTH 1J05B 4U1NB 5IWLC 1ZHNA 5TE6L 4WEBL 3ULVL 1I7TB 3NGBC 2YR3A 4P2OC 1XF3B 1U8QA 4PGBB 2XQBL 3T65A 4Y5YA 1IAMA 1KCVH 3K2MC 2WQRA 3X3GL 2AK4A 5BV7L 1AGCA 4KTDH 5E8EB 1MCOH 5HHMB 1LEKB 4OZGA 2APVA 3HE7A 3PWUB 1U42A 3RWGA 2B5IB 4OCSL 2FO4B 4KV5E 4XH2A 5FGCE 4J12A 1A4JB 2YWZA 1T6VN 1EAPB 4XP9H 5LXGH 4ODWA 3SGEH 1UJ3C 5TF1H 5JQ6H 4PLKC 4ONGH 1IM9A 3O6KL 4K3DL 5DFTA 1LE9B 3KYMA 3WHE1 1O7VA 2C1OB 3TF7C 5CBEA 3WN5A 3U2SA 2A77H 4Z7VB 4FQQB 2I60L 4GKSB 1RZKL 3T04D 4M48H 4JFFD 5CP7B 1BQHB 4MWFB 2GK2A 4I0CC 1EFXA 4JLRA 4KK8C 1F97A 5DHXB 5TJWK 2XPGB 4OLVL 5EZJB 1S8DA 4LLWA 2ICCA 4M93B 2DQEL 4N8PA 1GYAA 1ZSDB 3CCHA 5D1XC 1EBPA 2UUDH 4JFOB 1LO3L 2EO9A 3MRKA 1JWMB 4QRQB 3E8UH 1OAKH 5D7IB 1MCNA 1N8ZB 2DI7A 3MRPA 4G8IB 3WIFB 3BD3A 1WWCA 1BBDH 2CIIB 5CUSH 3CFJA 2ZZUT 4QRPB 3MRIA 3E6HB 5CZXD 3SDXB 1RZKC 2Q7NA 2VH5L 3RX7A 5SWSD 2VERN 2OLDA 4L29A 1A3LH 3FHQA 3O4LB 2HJKB 4KU1A 1KJ2A 3CSYB 2HRPL 1F4YH 2GEEA 4ZFOB 5JHDD 1NMBL 4IRJD 4Y4HC 4HFWB 3BP6B 1KXQE 1KCLA 1E4JA 1EDQA 4UV7H 3UTTB 4M7ZB 5FYJH 3DO7A 4PG2A 1BEYL 1JWSB 1RUPH 5IB3B 2F58L 1RAMA 1JV5B 3DIFA 3NFPA 4MJIE 3H7BB 2NXYD 4WFHE 1RZ8A 4QT5B 2Y23A 3MNZB 3I84A 1RZ7H 4CVUA 4NNPL 4V1DB 4DAGL 4PJDB 4JR9L 5IVXF 1XT5A 5T33H 1XF4A 4WO4C 1SY6H 4XGZB 5JOPE 1QSVA 4JO4L 4X6FB 2GTWA 1KBGH 1X5YA 2FJHB 5D9SA 4K23H 3HZKB 4HLJA 1WC7B 3ZDXE 4AMKL 2OM5A 3GIVB 3PDOA 1U3ZA 2PYED 1PZUB 4OCWH 4WFED 4JRXD 5F88B 2DM7A 2VL5A 3QUXB 4WWKB 5HHVL 3X12B 5HDLA 1X4XA 5JOFA 4O2FB 3W9DB 2JCCF 3OKMB 1NL0L 4N8VB 1S5HB 4L9LC 2KL6A 1SJVA 2I5YL 4JFZH 2WWKT 3D39B 3QHZH 1YEKH 4P2OD 5SWZB 4G6JL 4GRLB 5L0QC 3ZSSA 5F6IC 4YFLF 3KPLB 3DXAB 3ARGC 2HMID 4KJWD 4P0DA 5E2UH 5EOCJ 1RUAL 2RHEA 4XNZC 4WDIB 5FF6B 4AEHH 5JNYB 3OAYH 1YEDB 1RUKL 2KQNA 2Z8SA 4OD2A 4P59H 2YMXH 5F8RC 1J87A 3QDAA 2RQ8A 3AXLA 4K3EH 4XVSH 3AFLA 3U1SH 4PJBF 3BRFA 3VD5A 3PWLA 1I1YB 3NCFB 3DV6A 5AYQA 1BREA 3P9LB 3ULVD 4HWBL 4U6HA 2DQIL 1FC1A 1W8OA 4M7LT 3BDXA 1FVCA 4XPFL 1F90H 3C5SA 5EOTA 2MCPL 4OCXL 4GH7B 2HT3C 5MERA 3CVHH 4QCIA 4G8GD 3K1KC 1DQLL 2MPAH 5C0BB 3SE8L 4E41B 5F96L 1NAMH 1KUMA 3QDGE 4WFGE 1KCSL 4F15B 4X6DF 5A2LH 4ZTPH 5ILTL 2X09A 4N0CC 3BP5B 5HHXH 4X80L 1ZHKB 3INUH 4KZDH 1IVLA 2UVFA 5B8CB 3SKJH 3KPPA 4HIEA 2AJSH 4NIKB 1FGVL 1JMZA 2NNAB 1IAIH 2RCSH 4X6CE 5DJAA 2D4FA 4AIOA 3BGMA 3GJFA 4D9RD 3L9RB 1ZLSH 2ADGB 4OLZH 3WFCH 4W4OA 3F58H 3PGDB 2VXQL 3LKSA 3WHXA 1HYSD 4UIMB 3CX5J 5JPNB 5IW1A 4TN9A 3MQIA 4BSVB 1I1AB 1R5IB 3KJ4C 4X4MA 4JQIL 2FDBP 4HULB 4GKOA 3EJZD 3WXWH 4MCYA 2CRYA 2FH6A 4G8EB 2LAAA 3OSKA 3ARZA 3H3PH 4L8BB 1WICA 3IU3B 3LKRA 1DFBH 5TF0A 3HE6A 1VEMA 3NIGE 2P47B 4NGHL 3FHAA 2EEAA 3VFWB 3MLSH 3AS0A 1VGEH 1WTLA 4IIQA 4X4YA 3CH1A 3LD8C 4P5TA 1CDUA 3RWCA 1NDGA 1BQSA 3OHXA 4UINL 5D5MF 5CD3A 2ED8A 3QEHB 5D7LB 5FV1L 3RI5F 2QSTA 5BRZB 4QYOB 3O45A 1ZT7A 4H25A 4LDOB 4XI5D 4MA8H 3RHWF 4G7YH 3WIIL 2PUQT 1NGYA 2E7CA 5T5FL 2J7LA 3O4OC 1JNNH 2OX5A 3NPSB 3VDBA 4JJ5A 4LFHG 1I9EA 1CI5A 3U6RB 4X6BB 1BJ1J 4NKOB 3QEGL 3QUZC 1AXSB 1TXKA 4Y2DC 4KRNA 4JY5H 1ODAA 5FECA 3KYKL 4U0RB 4XBGB 4OLXH 4XCEB 1XGQA 3QZWG 5EBWA 1YJDH 2A1WL 4TULL 2Z31D 1PYWB 4HPYL 4MD4B 4NWTL 3L3OB 3KPRD 1H5BB 2QHLA 2XIDA 4KI5E 2Q8BL 5BXFA 3D87B 5E8NB 4JDTH 3SCMD 1G84A 2DBLH 4HV8B 1Q0XL 4YDKH 3NTCL 1CIDA 4HDIA 2WIIB 1G9NL 5EBGA 4ZPVA 4GG6A 4PJ9B 4OB5H 1JFQH 2BOBA 5JLZA 1A6WL 2YD9A 5L8LB 2UWEA 3FQUB 1ZS8A 2Q20A 1NGWB 4R96A 1MJUL 2FWOB 3GRWH 3GB7A 3V6OE 2QQLL 2DQUH 1D9KA 1DSFL 3PGCA 4PRNB 3P4MA 4TPRL 1H3PH 1ZK9A 3TJEL 4C56A 4D94A 2HT3D 3MRCA 5TDOA 3UTSD 4OQTH 3W39A 1IKFL 3MJ6A 3C9NB 4GUPB 4K7PL 4AZ8A 4D9LH 5TGBB 1NFIB 4KKAC 3BGFB 4GQ9L 3ZE1E 4EZMA 1MJ7L 3DX8B 4D0CB 2VISA 1ZA3A 1X5KA 3P73A 4MVBD 4HCRH 3MV11 3FONA 2FZ3B 4KQ4L 4LRIA 5DJYB 3RBGA 2HLFD 4I3RL 4NN5C 3V8OA 4ONHA 2DM2A 3ZL4L 4PRHA 4JAMB 4Y16C 3GUTB 4M6MH 1FFPB 2AJUH 5IMMA 3BQUB 5FHAH 3ABZA 5K9OA 4XVUD 1LK2B 1SYVA 4XP1L 3U30C 1UCBL 4F7PB 1U8PA 4PGZA 4L3CB 3NA4A 2R2HA 3G04B 3SN6N 4L8SA 5EUKB 1KJVB 1YQ2A 3OB0K 4NQCB 3VFNB 4TUKL 1UM5H 1MHPH 4ZD3H 4NZTL 3QA3B 4HMEA 3C60B 5H94B 3STZB 2P5WA 5CKGA 2FX9H 1A7QH 2EDNA 2XI9A 3IFOB 2G2RA 5DHYB 2WSKA 2ZNXA 1HILB 4G3YH 4Z78A 2V2TB 5C0AE 1DQQA 2J3SA 4UBDC 1JTTA 1YNKH 3M1BB 3RA7L 2P8LA 4A6YA 1K2DA 2B1HH 2NY2C 2P42B 3BKYH 3JWOH 4WW1B 2XN9E 3NAAH 5LCVH 3OG4B 3VWKC 2GJ6A 1CD8A 4XMPH 4Z8FL 3KG5A 1NAKH 1F4HA 3OKOB 5E2WH 3SE3C 2OTUA 2C3VB 5C07B 2ZOLB 1KN2H 3V6FA 3A67H 4GSDL 5CIPH 1Q0YL 2YD5A 3MRLA 5E95B 2BHUA 2J4WL 2R2BB 5ALBL 5DRNB 2WUCH 5A2IH 2CDEB 3LEYL 3BN3B 3BP7A 4OD1L 1KXTB 5LWYL 5FA3A 5IVXB 3WFEL 2R1WA 4HXBL 4LSDA 1YMME 3V7AG 2R4RL 2XKUA 3MYJB 4EUPB 3QUYA 3L5WB 2CKNA 3QUZD 1FORL 1CDBA 4HH9B 2VLJA 4MB4A 5F1NB 4WI3A 4CNIA 3K4AA 3PNWB 2J8UF 4L3ED 4PFEA 5KVGL 2ZUQB 1S9YA 1X6LA 3EOBB 2WBJA 5L7XH 3RU8L 1FLRL 4S11A 3FN0H 2JCCB 3VXUA 4WW2A 4PTUA 4ZSOE 1MEXH 5KSUA 3BT2L 1N6UA 1D5XA 1Z9SA 4PPTA 5CP3H 4OZFA 1EHXA 3IDXH 1EXUA 1U8IA 4JKWA 4PV8B 1YN7B 4IOIA 5F9OL 2XXMB 5I17B 4P49A 5IM7A 5BVJB 4RAHA 1RULL 3UMTA 3FZUD 1N0XH 1BOGB 1LDPH 1YEFL 4JFEE 5T5NG 1KV3A 3OXSB 3MOQA 1GGIL 1BD2D 4JHBA 3C08H 4OLYL 3FFCD 4PJBB 4ZUWA 1ZVYA 5DVLA 5SX5K 5HI3C 4XP9L 4BM7A 3UJIL 2NTFB 5CSZB 1FO0B 5JQ6L 4ONGL 1T0PB 5T1MB 4Z76A 4UQ2B 4OT1L 3LKNA 4PY7A 3DMMC 4JFHE 3T0EC 3QHTC 5D6CB 2YUZA 1DBML 2X4NB 1ADQA 1PLGH 3IJHA 2MKLC 5F9WC 1CFSA 1X5ZA 3VH8B 3NGBB 1CQYA 1CFQB 1H15A 2H32B 2VC2L 4P2OB 3UZVB 4HBCH 4NUGL 1ZOXA 3WUWB 1TNNA 5KSBE 2XT1B 1CE1H 3EJJX 4QXGL 1MCWW 4Y16D 5C7XL 4NKMA 4X6DB 3R06B 3QI9C 1VACA 1QR1A 3H0TB 4GXUM 1UZ6E 3BKMH 1S5IH 3QFDA 1KJMB 1DUZB 3GNML 3I3EA 4I18C 3A6CH 3RVUD 1XH3B 4MJ2A 2I07B 1BQLH 1GOHA 4MB3A 5D1QD 2ADFL 1IL1B 1UJ3B 3KPMB 2XTJC 3Q3GA 3MV01 3P11L 1YY8B 1V8HA 1AR1C 4LLAA 5EO9A 3RIFF 4PJEE 2A6IA 3HI5L 3MRFB 4GAJH 2J8OA 3NA9L 4GW4B 3CXHK 3ROOB 1WFTA 2CD0A 2NY2D 4MJ4A 4CGTA 2PETA 2YC1A 3U7WH 3QPXH 4XXDA 5C0EB 3VWKD 5HGDA 3RWHA 4FXGA 3QDJE 3S35L 3SDAA 4IHOB 4R26L 4ZTOH 2X4TB 5FM8A 3RNQB 1MY5A 3B9KD 4M8QB 5D1XB 5DO2C 1GGYA 2DQCL 1LP9A 2BNQE 4YXKL 4D8PA 4FXLA 1EK3A 2BY3A 5H35A 3BZEB 3P30H 5I18H 3MYZA 4BZ1H 4Y7MA 3HC3H 3VGFA 5E6IC 4F37K 3O41A 2AJ3B 5D5MB 2OQJB 4NQSB 3N9GL 5CEXB 2VOTA 2DF3A 2Y07H 3H9SD 3WNOA 5DJZB 4R7NA 4NO5A 3IKKA 5ANMB 1OPGH 4HIHB 4WRLA 1M7DA 2E6QA 4UQ3A 3WLWC 5C08D 2BCKB 3I6LD 2R15A 4PRAB 4S1DD 5F97E 2AEWA 4X7FC 5C0FA 5IR1B 4Y4HB 2K3TA 4XTRC 4K94L 2V7HB 1IARB 1RY7B 2FATL 1KELH 4JHWL 5MEND 1BQHG 2BNUB 1YEKL 5A2JH 43CAB 1K3ZA 5IF0A 5E2UL 2X9XA 2E5EA 5BMFH 4ENEC 5DS8A 3KPNB 3UO1H 4YX2L 1UKTA 1MHEB 1V3LA 4P59L 5J0BA 3PQYA 4ZPTA 3OKLB 4MD5B 1MIEH 5JORA 4WO4B 3O8XC 3VXRA 4GG8A 4ZUVA 3CUPB 2IPKB 2VN7A 4K94C 5HI3D 4NWUL 2X42A 3PWNA 1NSNH 3I6GB 3ESUF 2IEPA 4MGXA 3DMMD 4AM0B 3T0ED 4MXVF 5HYJE 5BW7C 1NBZA 5DF0A 5BZDA 2J6EA 3CH8A 3KR3H 3NN8B 2VLMD 4F7CA 2R0WL 4QRTB 2BC4B 4UILL 2W91A 2W0LA 3MBED 1PQZB 5IFJA 5FM4A 1NAML 3CFCL 1DLFL 5KN5A 3V52L 2QADB 3BW9B 1M71A 5F6IB 3ARGB 3TPUB 2VDPL 2W9EL 1JRHH 4DQOL 4FTVE 4XNZB 5C0RH 3VFPB 1BFSA 3WEXA 5DR5L 3KPRB 2EDJA 1IAKB 3I75A 2H1PH 1IAIL 3TZVC 5EDXA 3RWDB 5GJSH 3IDJA 1ZLSL 3MRMA 5CJ8A 2GY5A 5BS0E 4TTDD 2FR4B 4HK3J 4NM4L 1FYHB 1IGYB 5ENWB 4HJGB 2GITA 2M2DA 3DVIA 1KPUB 3AMLA 4OKVA 4PUBL 5HVGB 1IC4L 4JEGB 3TH2T 3TO4A 4YBLC 2GTZB 4IRZL 5KANI 4QOKA 3HG1A 5GJTL 4AH2A 2B2XL 5CJXA 3MJ9L 2VXUH 1UWXK 1K8IB 2DBJA 4N8VG 3ME0A 2NY5H 5E1AA 4RGOH 3VFSA 1BQUA 1LO0L 1FDLH 4RAVA 1V5JA 3PWPD 3GSNB 4PTTA 5J3HC 1OQXA 5HGHA 1TVDA 1BWWA 3OKNB 1H8NA 4YIQA 4GKNA 2AV1A 5DO2D 4Y4FA 3G08B 1UT9A 1UM6L 1Q94A 4YGVA 5I1IH 4MD0A 1BVLB 2ICEB 2X1XR 5DD5L 4Z7QF 4KKLC 3NH7H 5JOEA 5ADOH 3Q5YA 4HIIB 4QRSB 1QYGH 3REWA 3MV7D 4JG1H 1Q9KA 4X5WA 1YPZF 4GW1A 4QNPE 1EGJL 4K3HA 1JNNL 2ZUVA 1KJ3L 3QZWA 3ZE0F 2R8SL 2GW5A 1FL6A 2FJFB 2DLGA 2A9MH 3QXAB 2CPCA 3KJ4B 4K3JL 2VDMH 1P1ZB 3H9ZA 1A2YB 5GGUB 2H3NA 1TJHL 2VDRH 3KDMB 1N5YL 1RJZA 2R9HC 1ACZA 1AO7B 1FZMB 1OAQL 2GI7A 4HQQH 3A6OA 1NGXB 1DANT 2BHYA 1AJ7H 2X4QB 3PGFH 3GSRB 2J8UB 2R2EA 2NCMA 4YWGL 1KLFA 3V5DA 3HRZB 4TNWK 1VENA 3AGVA 5HJ3B 1N64H 3LD8B 4RFEB 1IGTB 5GRUH 4QRRA 2G60L 3OJDA 2DBLL 3RJDA 4YDKL 3P0VH 3O8XD 5DMYA 4L4TA 4UT9L 3B6SA 4X98A 4XBEH 1A8JH 2IPTL 4B0MM 2UZIH 4MDIA 3TFKD 1KT2A 4KDTA 1UXSA 3DX6B 5IK3A 1GIGH 4X99B 4GW5B 2EH8H 4Y0GA 3PIQA 2Z93B 1TETL 5F7WC 2QQKL 3KWWA 4GFTB 3ULUE 3X3FL 1JL8A 3L7FB 5GGQH 2BVPB 1WSST 3BO8A 1K3IA 2OL3A 4D9LL 4XMLL 1HIML 4Y2DB 2YXMA 3UJTH 2VZSA 3PHQB 5I76A 2EXWD 4O02H 3B9EA 3KLAB 1FQ9C 3UC0L 3CZFB 3OPZL 3MRRA 3BYYA 2VQ1B 4QEGA 3X14A 2BRRL 3MNVB 1NCCH 1QTYT 2AW2A 3TT3L 4GAYA 4JFPA 3LS4H 1SVZA 4HFUL 3J8F7 3WKMH 3QDMA 1K4CB 3QXWA 3O2VH 3P0YL 4P5KA 4APQA 4Q2ZB 1CG9B 1CLOL 1XIWC 4JQXA 4JFDD 3MFFB 5AZ2L 4GRWH 4WVRA 4JO3L 3MX0A 4WHTB 4U2YA 2JB5L 1C5BL 1BVKA 3KPSB 2UVEA 5E5RB 4MNGB 3LEXA 4PB9L 3UTPE 5IB2A 2GSGA 1F5WA 4P3CL 2Y5TA 5EU6E 5M95B 1N3NB 3UTOA 2NY1C 2QSQA 2VZUA 3HI1A 2DKMA 1Z3GL 5F8QC 3VFMA 3QXDA 4YZFF 4KUCF 1ZANL 3PV6A 2VXTH 1KEMH 2RJMA 1S3KH 4HF5H 3TYFB 2CR6A 1JP5A 3TBSA 1S9XA 1QLFA 3IJYB 5GS2D 4C83B 4YHPB 5DD6A 4NN5B 4E5XB 4PRDB 5ID1B 3ARRA 2F54B 2AJVH 5DJCA 4Y16B 1R24A 1EIBA 1YYMH 3CFDA 3U82B 2BVQA 1T2XA 5IVZA 3ZKNC 1S7WA 1KN2L 1I8LA 5DUPH 4I48B 4Z95H 1MHCB 1MWAA 4OAWA 2BY1A 2OCFD 2VITB 3O6MH 2VLKA 3U30B 3BOVA 4BFBD 3D25A 2EDEA 1N59B 2PW2A 2QJDA 2EYRA 2BVYA 2F53D 1K6QL 2F74A 4RFOL 5GIRA 2NR6C 2YD6A 3FTGA 5IQ7L 3ZTJH 3OB8A 1A6TA 2NY4C 3MV9D 3FQRB 5ACLA 2IAMC 3D5OF 3T0VA 1Q9WA 1IM3A 2VDOH 2XTLA 3MLVH 5HHOB 4O2EB 3RY4A 2YPVL 3BSZH 3EFFB 5EU3A 1PSKH 5EB9A 4C4KO 4PRBB 2NY2B 2Y7QA 3BD5A 3HC0B 1MUJB 1RZFH 4M5YH 3P77A 5IBLC 4PIRF 1T83C 1QSFA 1QFWI 4F2MA 4U1JB 3GIZL 2DMBA 3QRFM 3K80A 5FCUH 1EEZB 1WF5A 1T0MA 4XCYB 1TQCC 2QHRH 1TITA 3O3AB 4H88L 1V05A 5FYKH 5EIVA 4M9OA 3TN0A 3WXVH 5C09B 1BVZA 2D7TH 2HH0L 4PRPA 1SJXA 5IW6A 5KSAC 4OFIA 4ETQA 1MRCH 5IEKA 5LGJB 3TESA 5DK0B 2B20A 4EI6A 2FB4H 5CZVL 2YRLA 5GS0H 4XAWH 1LEIA 1G1CA 1CL7H 1Q9LA 3V6ZA 1JYVA 1T22A 5IFAL 4HS6B 1MHHA 2C7UA 4NP4H 5ISZA 2G9HA 5JW4Q 1VPOL 5I1KH 1PKQE 4IRSB 4MYWB 3MRHB 2JB6B 3TIDA 1L7TL 4OGXH 1J12A 1RZGA 2CK0L 1S9VB 2AJXL 1OD9A 3TIEB 4HLZG 5K9JL 4JY4A 3RVTC 3QIBC 3C6LB 5EOQH 1IJ9A 1MAJA 1S5IL 3L5XL 1XZ0A 1E4KA 3SDDA 4U1LB 5LQBH 4JVUA 5MI0C 4LLUB 3O6FA 1I8KA 4KXZH 4ZAKD 4QHNA 5HI5C 1CLZL 1HHIB 4C58B 2ZCKH 4OTXL 4QXUL 3NFNB 1T0NB 2UY6A 1O0VA 2ATKB 3VXSE 1FSKC 5F21B 3EYOA 4HGWB 3MA7A 4TSBH 5D1ZC 4UI2A 1H3GA 3P9MB 2IGFL 1ADQH 5EBLB 5IESL 4M43H 4Z5RA 2ADIA 4Z7WE 3RWJB 1DQML 4QHKJ 1U2HA 4M00A 4BZ2H 4KV5F 4UNVA 5FA4B 3LRGA 4NT6A 5HVFB 3KXFE 3V2AR 1NC2B 2BNRB 4ZNEE 2VLRE 1EEQA 3EO9H 5L2KA 3QWQB 3P4OB 1A1NB 2W0FB 3R0MA 3QI9B 4K2UH 4XP5H 2VN4A 4LKCA 3ZKND 3UPRA 4MXWH 1EV2E 2H26B 3LKPB 4TQEH 1W72L 3GBNH 3P30L 4XWOD 5IP4A 3IDNA 4PB0L 3U0PA 8FABB 3QQ3A 5JW3H 5INDA 4RA0C 5DHVH 4FG6C 1XF5B 5IB5A 4DJMA 3U4AA 3IGAA 3FT4B 2E27H 4HUVB 1DR9A 4I13B 4PGDA 3RX5A 3OKKA 1LO2H 5I0DA 1HXMB 2MCG1 2XTJB 4R4ND 1F8TH 1YPZB 4PJCF 1ONQB 5HYEA 1TLKA 1OSPL 1JCKA 3O11A 4P46A 4MJID 5ADPH 4WFHD 5FIEA 4H1LA 1IEHA 3D85D 4HKZA 1B9ZA 5B39B 4G6FD 4LSTH 5J8OA 2F5BL 1E6OH 5IBLD 4Y8DC 4Q74A 3WUWG 1T2QL 2A38A 4NNYA 3VI4E 5JOPD 4Y5XC 3N0PB 1U8KA 1FAIH 2FD6H 3HZVA 1QFOA 2DOCA 3RKPA 3BKJH 5J1AB 5EO0B 1FP5A 3UYRH 4KDWA 3V7AE 4R0LC 1NBYB 1U58A 4YO0B 5DJDA 5D70L 5JXAL 1KIQA 2BMKA 1DCLA 1JK8A 3VXTA 2AABH 5DTFB 3VG9C 2HKHL 5E6IB 5FKPA 4XWGH 1MREH 3MV7B 1S7RB 4ELMF 3JV5A 2DM4A 4X4XA 5EC2A 3C8KB 4MAUH 1LILA 4UIKL 1LD9A 3KNBB 4UUJB 3HUJA 32C2A 5BZWB 3FQTB 1FV1B 4P2YA 1X3DA 5ICXB 5HDQL 5HYIA 4LRNH 4TOYH 4C54A 1N4XL 3AM8A 3QFJE 1IQWH 1YECH 3RUGE 4DKEL 1S9WA 4HK0A 5C0CE 4MZ2A 1HQ4A 3Q48A 2GCYB 1JGEB 4LSPH 4LF3B 3V4PH 4JPWL 3GMOA 1V3MA 3ZDXF 4QHLA 3VFGL 1KFAH 4JKPH 3VRIB 2H2SD 5F7LB 4WEUD 4AY0A 2XZCL 5IHUL 4X7SH 5ALCH 1U6AL 2H1PL 3MV8B 2P49B 2ZSWA 3V0AC 1SBSH 2UY7A 4R4BB 3JXAA 2R56L 1F42A 3VE0A 1I8IA 4LLYA 5HI5D 2HKFL 2Y25A 2FBJH 2PO6D 5E2JA 1QO3A 3CDFA 1JHTB 3DGGA 5MP6L 1FL3A 4Y19B 3QDGD 4WFGD 4CMHC 4F9LC 5ICYA 1D5BB 1I85C 1HSAA 4F7TA 5FK9B 1P9MC 2HFFA 1WVZA 3NIDF 1R0AL 2J6EH 2FL5A 3DVGB 3OAUH 1QRNB 2DB8A 3LV3A 4L4JA 1OWWA 5EIQA 4U1MB 2NY5L 3TNNA 1CD9B 2Q6WB 3ROLB 2AKRA 2NY0C 3MODL 3MUGA 5GZNC 3QEQA 4MSWB 1KIUA 4BKLB 1YEIH 5I0ZA 1OTSC 2AJYH 2WANA 3QG7H 1T7VA 2Z92A 2VJXA 1MPAH 1CE6A 4LCYB 3ILPA 4FRWA 4LLMB 4U1GC 3TZVB 2Q3ZA 3ZKMC 4KPHH 3QQ4B 1A3QA 1FCCA 3HR5A 5ID0B 1QYGL 3FJTA 3HS0B 2OMNA 3MRNA 3IETB 3RTQA 4O9HH 5EUOF 2DLTA 3TA3A 1OAZL 1GXEA 2ZCHL 4BELD 3F12A 4KRPC 1F3DJ 5DYOA 3UXFA 2KQMA 2Q76B 3NVQA 1J1XH 4OZGE 4RIRB 5GGRY 1GHFL 4OQ1A 1ORQB 1PG7X 2GK0A 3HTLX 3UPAA 4YBLB 1OLLA 1T20A 4F7EA 1GAFH 1OGAA 1NCBL 3QO0B 5C92A 1MIMH 3VCLA 2W60A 2VDRL 4FFYH 5HHME 1WQVT 2RIKA 3E3QE 5JUEH 4ZUSA 2E7LC 1UCTA 5H2BB 3O9WC 1ZTXH 5HD8C 2R4SL 1KG0B 2VAAA 5EC1B 4XX1G 5CLWA 1AJ7L 2HT4C 3D6GA 1BECA 1G9ML 4HEPG 5HDBF 4ZOBA 3WL9B 5F93C 3B5TA 3TVMA 5CBAB 4Y89A 2FHBA 5GGTH 2DQFB 2F8XC 3QUML 1A7OH 3RKDC 1MI5A 4PGCB 3FO1A 5F7UA 5GGRA 5DLML 2KBGA 1U95A 2YEZB 1KLUA 2FSEA 5IBUG 4DWHA 3QEUA 3VXMB 1LE5B 2AK1L 3QG6B 4Z7VE 3F7YA 4ALAH 3E2HC 1OGTA 4BQBA 2OSLA 2NW3A 2F53B 4JO1H 1MJ8L 2A74A 4WTZG 1ZWIB 1U8HA 2HT2C 1G9MC 3MV9B 3VFWA 5IJKC 4NQDB 1HCFX 3WJLA 2ZUYA 5AG8A 4X0KA 4EN3C 5F3BA 4E42B 5IG7A 1Z5LA 4KI5D 1U8LB 3V0WL 1G7IA 4ZUTB 4RGNE 1PG7H 3QQNA 4P2RA 3PP4H 2W9DL 3GEWB 5I8EA 4M8VA 3X13B 5D7IE 4UMGA 2O5ZH 4U7MA 4DGYH 4F8QA 1WEJL 2Z35B 4QRPE 2ED7A 1MJJA 4CADB 4XNQA 3SDXE 5SX4H 2Z4QA 5DA0B 2BVOA 25C8L 3BP4B 1AKJD 5MEOA 4MA7H 5CJBA 4MQTB 3RNKB 3MRGB 3O4LE 3GSWB 3ZYZA 3B83A 2WLZA 4NYLA 2NX5A 4EBQL 4XHQA 1CIUA 2EDXA 1QKZH 4XCNA 3UTTE 4CAGA 3ARBA 1KENH 3GMLA 2C9AA 2ICWA 3W5MA 2EXYD 1WBXA 1H3XA 3CXHJ 3ARDA 4RGMC 1HSBB 1P7QA 3AU1A 4DGVL 5ESVA 1T4KA 2OL3H 4PJDE 5J6GB 2ZG3A 4UV4H 3ZSTA 15C8H 4JRYD 5GZND 3VGHA 3D0VB 1E4WL 4MLSA 3W0WB 3MR9A 1ITBB 4DZBA 3O3DB 1SYSA 2DWDB 2ZP0T 4O5LL 5DJ0A 3BEWA 1W0WB 3BH8A 1WBYA 3SKNA 4UT7L 1XIWB 5IMOA 3OR6B 4WUKH 3DUUA 5E8OB 3GBML 3U46A 5AUMA 1JGDB 2FLRT 3JWDC 4S1RH 1WCBA 4Z95L 1A5FH 3JV4B 4KKCC 5DMIH 3V5HB 1AGEA 4ODXB 4KROC 3FO9A 5JHLL 1XR8B 3FQNB 3MNWA 4MHHG 4LSRH 4AENA 3SJVB 5SWZE 4IS6A 5MEPB 5B3JE 5D7JA 3D2UD 1H3TA 3QJHA 5C0AD 1I7RB 3DXAE 2NY1B 3IDIB 4E0RA 2XNAA 3K7UA 1KPVB 1AXIB 3STLB 3NCBB 5HD8D 3CNKA 1PG7W 3GJEA 4PJCB 2MMXA 4J1UB 5TE4H 3MGOB 4AYFA 3PP3H 4Q0XL 1G7MA 5DJ8B 3U4BH 4NO3A 5I1JH 2EYSB 1UXWB 4BUGA 1LO5A 5C3TA 4M1CC 3VG0L 4N0YH 5DDHA 2PKDA 4OLUH 4P4RA 3MROB 1SJHA 3MRBA 4M5ZH 1IAOB 2OJEB 4NC2B 1M1SA 1AXTL 1H0DA 4HHAA 2QHRL 3LDBC 5GHWL 3SKMA 4WFFE 1BZ9B 1CICC 5HYSG 4Q6YA 2EZ0C 4HS3A 5E8PB 4E41E 5IROA 4CVZA 3IB4A 1IKNC 5DMGC 3GMNB 2JE8A 3EJYC 4NQUA 1IEAB 4HUMB 2NY4B 1A1OB 1KC5L 4QXTB 4MA3B 4G42A 2IAMB 4H5SB 2XY2A 2FB4L 1U8JB 3FT3B 4JFFA 4ELMB 1ED3A 1N7ML 3C6SA 4XRCB 5KVFL 4LSQH 2DDQL 4HZLA 1G7LA 4BUHA 1G0XA 1AP2B 2ORBL 2ICWJ 3FOLB 3QAZC 1XGUA 4YEEA 5FO9B 3IT8D 1TVHB 4ZO7A 1K85A 4HKJB 2UUDK 3CPLA 4MLIA 5CILH 1KN4H 1KPRB 3ETBF 3UP1A 3IFNH 1CFNA 1TQCB 2BSTB 2YXFA 3G6JF 4LHUB 4P3DA 2HVJB 1J0KA 3D9AL 1IC7H 5SWSA 2BY2A 1IEBA 4NKIL 4YE4L 4JFHD 5EZIL 4ZFZB 1X5GA 4TUOB 3RWEA 2HYMA 5KSAB 5JHDA 2VDNL 4IRJA 1BFOA 1GC1H 3QRGH 2D7MA 1LNUB 2W65B 1D5MA 4L4VB 5I6XC 2H9GA 1BIHA 5TQ2H 3DYMA 5BJTB 5E00A 3HPLA 3VGEA 1DTUA 1URLA 4DZ8B 5D7LE 4RNRA 5BRZE 3CU1A 1QA9B 4LIQH 1MFEH 1YYLL 1H3WM 5D7SL 1D5IL 3OXSA 4ISVB 5IMKA 5ERWB 1CT8A 1DVFD 4XC1H 4YDVA 4PJ7A 5L8JB 4MNHB 1FNSL 4FQJL 2FIRT 5IB4A 3QIBB 2CKBL 4G6AD 4Y1AB 2PYEA 4KROD 1NLDH 4YBQC 5DQ9B 1UGNA 4JRXA 4N5EC 4JPIB 4YHZH 5MI0B 3B3IB 3ARFD 2GAZA 3MCKA 4TUJA 4NUJB 4MX7A 1WFOA 1H8SA 1ZXQA 4N68A 5EUOB 4WI9A 3HLAA 2DTML 5DQJB 3QSKB 1FSKB 1QEWA 3MLZH 4FQCH 3RZCD 2LFGA 3QDJD 1HDMB 5D1ZB 3PHSA 1PBYA 3QQ9D 3VRJA 1GZQB 3HAEG 2IG2H 3CSBA 5AD0B 3FN9A 2BNQD 5DT1H 2XACC 5DRXA 1KCUL 1MFBH 3Q2CA 3CFBB 4C56E 3MRQB 1AH1A 2YHGA 2VIRB 1YEJH 4YXLH 3LKOB 4OV5A 1SEBA 3OAYK 1TZIA 1QBLL 4KJPD 3BKJL 4KZEH 5DEFA 4W81A 2YPKB 4OD3H 2VDKH 1NH6A 4JN1L 3RWIB 1U91B 5DD0H 4M3KB 1GPOH 4KXZI 3QIWB 2HFGL 1JF1B 1EEYA 5C0JB 5FDWA 5DMGD 4M62H 1F13A 1JYXA 4PJFA 1OT1A 4OIAA 1JPTH 5KVDL 3C5ZC 4G8GA 5J9PB 1T3FA 2DYPB 1IQDB 3DECA 3DSFH 4H20L 4KTEH 4PRIB 3CFIC 1IGJB 2FLBT 3ULUL 1HQRA 1KCRH 1M6OB 1ZV5A 5SWQB 1YEEL 2FECI 4KMTH 2VLLA 4WCYH 3H9HA 4LKXB 1AFVH 4OM1L 5FB8B 5FYKD 3QNYB 1P4IH 3V4PL 4NOBA 2HVKB 2FYYA 4I0PC 4R6UA 1JZ2A 3DTXB 1NGZB 4N9GA 2J88L 2OZ4L 1F3DH 1X7QB 1GVIA 1UJTA 2MHAA 1KEGH 4PJ5B 4R0LB 5BQ7A 5GS0D 2J8HA 3MA9L 1LK3L 2IPUG 2YKLL 1OSZA 3UAJC 3RGVC 3IKCA 1I3RB 3ULUC 4HUWB 5ESQB 3T8XA 3VG9B 5CMAA 4DN3H 5HYJD 5I19H 3D48R 2Y36H 3QHFH 5EU4B 2JJTA 4M61B 4YDJA 1UG9A 4M1GH 2FBJL 4OFKA 1RJYA 4PGEB 4NSKB 3VMPA 4NCC1 2CLZA 1Q1JH 3FKUS 1DQDL 3CLFH 3UTZB 2NY6C 3WJJC 2L4OA 5LG1A 3SGJA 5DI8A 4FTVD 5DZOA 1B0GA 3RP1A 4J23A 1B4JH 3TJHC 5C07E 1PAMA 1WIPA 4NZDA 4UDUB 1UB6B 1U3HC 4DTGH 2D7NA 5SX5H 4LOUC 1WLHA 5BS0D 2X2YA 1SM3L 5IVXE 4XZUB 3BEVB 3RPKA 1ETZA 4IEFB 2AJYL 2PR4L 1F3RB 4YBQD 1JMXA 3IF1A 1AKJB 1BGXH 4CVXA 3CVIH 4QTHB 1T03H 2WQ8A 5JDSA 1GGUA 2P7TB 2SEBB 1HZHL 3L3GA 4H0GA 2HFEA 1U93B 1MCPH 1RFDH 3TBTA 1ORSA 3S3PA 4MDJA 4L9LA 2JCCE 4P4KC 3B9AA 2YD2A 5BO1L 4CMHB 1M05B 4UT6L 1EFQA 1NCDL 5ACZB 1A7NH 4YHOL 5C0DA 2MQ0A 2Z31A 3JWNC 5AWNL 1JN6A 2ZG1A 4U6XA 1UWGH 2VXVL 1OAUL 1YQVL 1SHMA 3SCMA 4ZFGL 4XCCH 5D2NC 1WZ1H 4LCWB 4LQ1A 2NY0B 5HPMA 2DN7A 4UTAL 1U0QA 1R3KA 5EIIB 2XWJA 4HJ0D 3B2VL 4RISL 4NDMB 4PJBE 4N90E 1FIEA 4JHAL 1AQDA 1CXEA 1CWVA 4EIGB 5CEZE 2UYLA 2AI0L 4HT1H 1G7PB 1SJEB 2IQ9L 4HPOL 4U1GB 4WTZA 4OGAD 2XZQL 2IFFH 1U8OB 5INCA 4NM8H 3UTSA 4HG4K 3C5ZD 4KRPB 4LQFH 2VZ1A 3WFZA 4FQXB 2OYPA 1T5XB 4HIJA 1KB5B 2EYTA 4JM4H 5EU5B 2P43B 3MLXL 1BM3H 4NZRH 4R2GD 4BSWA 3O3BB 4NBYB 1N5AB 4FABL 3IFLL 2YA0A 1FJ1A 3RGHA 1WT5C 4HWBA 2XN9B 3JTTB 3R1GH 1VFMA 3EYVA 1DBKL 2XWTA 4N0UA 3O9WB 3WD5L 4BQCA 3FQWB 1ZVHA 1MCIA 1YNLH 4HKXA 2EEBA 1T21A 4HSQA 4I0PD 3FT2B 3BIKA 5EPMB 4NN7C 3G5XB 3UTQB 4KK5C 3U7YL 2V17H 3EFDL 4GLRI 1ZVSB 1AD0A 5DRWA 5I1CH 3MRDA 4FQHA 43C9B 3GSUB 1R5VA 5ICZA 3UAJD 3ULUD 1XF2A 4F3FA 4NRZB 3VWJB 5B38G 1YMMB 2P5ED 5E9DB 2ADJA 2NLJA 3MLUH 3L3HB 3GHEL 3NZ8A 4IMKC 3E2HB 2D9CA 1LP9E 3G6JB 1WGOA 1F00I 5LBSL 3DI2B 4EXKA 5FO8A 4I2XB 4N8CH 4NQXA 2BOCB 1OAYL 4BQ6A 3RRQA 5DXWA 4JKKA 3TJHD 3I3BA 2WK2A 3MLRH 4EN3B 3DLQR 3EZ8A 4ZSOB 5I30H 1X5IA 3RWFA 1S7XA 1U3HD 4BK5A 4M7JL 1MCBA 1MFAL 5H8DA 5FGBC 3UZEA 4QF1B 4UV4L 5F7EH 1DZBA 1K5NA 1MNUH 3ZKXB 5F1SA 1I3GL 2NW2B 5D5ME 4JFEB 4YNYA 3KS0J 4HWEH 1Z9OA 3BXNA 3UTPD 4XNUL 2AEPH 1IRAY 3JTSB 1IGCH 4DCQB 1VADA 3WDHA 5EU6D 1CZ8L 2GJZB 3OF6D 3OL2A 1DBBH 3QXTA 4S1RL 5F7FA 2R1XB 4F80A 3WE6A 4J4PC 4NRYB 1JHKL 5IKCA 1CBVL 2NY3D 3QUZA 1JVKA 3RL1A 2BY0A 3IDMB 1HH9B 2X05A 4L3EA 3S96B 3PQYE 4PJIA 4X7TB 4G9FD 3PWVA 4JO2H 1RIHH 4RGMB 1Q72H 2HJFB 4GOSA 1QFWL 1MCKA 4FZ8H 3NABL 3SQOH 1AGDB 1G6RB 2DI8A 5E24E 3LRHA 4YAQB 1V7NH 5SX4I 3VJ6B 3U4BL 2CMRH 5JR1H 4NO0D 4KKNA 5HYSA 5DFWH 4X8JB 3RDTC 4OZHF 2XRAL 4JFYB 3B43A 3LH2L 1UWXH 5EZOH 5I9QB 3WLBA 3FMGH 1BD2A 3OQ3B 3G9AB 3FFCA 4G9DB 3F5WB 2DWEB 1VKXA 4K7PY 3EDDA 3RZWA 4NQED 3DO3A 2OBGA 1N6VA 3FB5A 4XMKH 1YDPB 4KROB 3WFDH 1FE8L 1KLGA 3MJ7B 3P4NA 1TCRB 1G7HB 2P24A 1I8MA 3L3IA 5KVEH 4J3XA 4P23C 3R4DA 2R0KL 2DJUA 3WFBH 1YN6B 3ALXA 2X4PB 2IF7A 2VNCA 5F89A 3TT1H 3ZYIA 1DUYB 35C8H 3S36X 4OZIA 4ZXBD 3EO0A 4ODTH 1BFVH 4RBPH 4HWZA 5GRVL 4X9BA 1ZLUK 4BQ9A 4LNRA 1TZHB 5F7YC 4LFHD 1OP5K 1A6UH 4U1IA 3C2AH 2GUOB 4G6ML 2D7OA 1GZPB 1N2RA 1U9KA 2A83A 4J3UA 3SDCA 1FIGH 4BH8A 3JWOC 4JM2C 3EO1B 2YUWA 2Q7YB 1KTDA 1OWRM 3IXAA 3MUHL 3JV6B 3V0VA 3UJJH 1TIUA 1XR9B 1NFDF 1RUML 5LJYH 5FYLE 4J3WA 4DK6A 3GSXB 1GL4B 2Z91B 5D1QA 2AGJL 3LDBB 2IBZX 1CICB 4Q7DA 3UZQA 1B0WA 1G0YR 1QR4A 4MAYC 2B1AH 2XA8H 4KRLB 4P2QA 4F57L 4WV1C 5FGSA 5H37G 2CIKB 1GC1L 4KDVA 2Z8VC 1A6AB 1G9EA 4JZNB 2R23A 3S5LG 4W6YB 1A1MB 2PYFB 1U3YA 3VWKA 5E5MB 3X11A 3S4SB 2F19L 1U8MA 4HLZH 4PJAF 3B9KA 5LAXA 3BGAA 3DJ9A 2WWMC 1ZA6A 1Z9LA 1A6VH 4NNXB 4HC1H 4FZEL 4MJ5B 3RVXD 3QAZB 5T3ZH 3BN9C 3L6FA 5JW5A 1C12B 3DURB 3SE9L 3V79C 5CGYC 4JZJA 4XPHL 5EH1A 4BH7B 4K07A 1PEZA 1WCQA 3TCXA 4GO6B 1FPTH 2FBOJ 1OM3L 1MCFA 3LZFL 3H9SA 4QHKI 3VXQA 5C0IA 1SMOA 3LN4B 5I8CA 5KG9B 3VXSD 1AO7E 4ZS7H 5C08A 4PBVC 1ZEAH 3QISA 2ATPB 4ODUA 1K8DA 3HAEA 1LO4H 4IM8A 4U7SA 1MQ8A 2D03H 2J8UE 4LCIH 1B0RB 4O2CA 4CBPA 1T04B 1RHHA 5MENA 1D5ZB 4PJ8C 2CO6B 5I6XB 5ESAB 4LCUB 1A64A 4Z7UA 2O61B 1BBJB 2VLRD 3V7MA 5DQDL 4PS4H 1HEZA 4CMMB 2YA2A 1RK0B 2WINB 1RK1A 2DJ4A 5FUOL 4ZDHA 5F7NC 3S8WA 1T1YB 1MFCH 2YBRA 3EOAA 4Y4KD 3DX9B 3BE1L 4JG0H 3TO2A 1TJGL 4GT7A 1MRFL 3IDGA 3MACL 5EOCL 4NJ9H 4J3TA 1XMWA 1JGVH 4KZEL 4YPGA 2XFXA 1BLNA 4M6OL 4R97B 1B6DA 4LHUG 1D6VL 1FFQA 1FO0H 2XZAH 4PV9A 3KAAA 1YMHA 3HE7C 3DMMA 2AQ3A 1MVUA 3T0EA 3BDBA 1QVOB 2O93L 1E4XH 5HGGS 2IH3B 5T1KD 3GFUA 3TBVB 2LV4A 5E08H 3MBEA 3E3QC 3WNMA 4XVJL 1WUNT 2AVGA 3S88L 2H32H 3IYLW 3I50L 4KY1L 4ZFFA 2GT9B 1KCRL 4WUUB 3WDIA 5I16A 4WJ5A 1WAAF 5TPWH 3B2UC 4KMTL 2B4CL 1DE4B 1QQDA 2ESVB 3OKDA 3K8KA 1HN1A 3HN3A 3MRJA 3WN5C 3KPSE 4JM2D 4I18A 4MNGE 2YZ1A 3GHBL 3MREA 1FZOA 3CFEA 5FO7B 4YHKH 5E7FA 2BSSB 3FT4A 4G6KL 1FVDA 4WGWB 5TE6H 4WEBH 3ULVH 2X4SB 3U0WH 3EGSB 1UM4H 2YPLB 1OB1A 2P8MA 2FEEI 4PP2A 3OTTA 4KQ3L 4MAYD 3CSGA 1AIFB 3QFJD 3QHFL 4GBXD 4M93C 3QO1B 3X3GH 5BV7H 3H2WA 4D2NA 5C0CD 4ZFOL 4AEIL 4LCCA 5I1AB 3VI4F 4RGNC 1A6PA 5EWIL 3LQZA 4IJ3C 3VFTB 4O58L 3EHBD 3GSQA 3PWPA 4OCSH 1AGBB 3DBXA 5E2TH 2F54E 2VLKE 3W82A 4YHIA 3U36A 2YSSA 3FRUB 1T7WA 4DVBB 4DUWA 4H26B 4NC1C 4PD4J 3BN9D 5DURD 4R7DA 3O3EA 3O6KH 4K3DH 1F58L 4C4KT 1RD6A 4ZUUB 5IJVA 1C5DB 1EH9A 4TVSa 4ZOAA 5DEZA 3QCVL 4DN4L 1A4KB 5J1TC 3CFKA 1WIUA 2EDYA 3U4EA 5HSFA 1NQBA 2I60H 2HLAA 1RZKH 5J13C 3HZYA 5TQ0L 3THML 3SGDH 3RGVB 1HHHB 2FJGA 5HHOE 4OLVH 5HI4D 3VDCA 3HKFA 4ONFL 5J89A 2DQEH 1YNTA 1LO3H 5K59F 1CFTB 3DV4B 3SY0B 4ODVL 4BK4A 4LEXL 4JANB 4FQ1L 2NY6B 1EHLL 2E9IA 1VEPA 3BFOA 1IC5L 4F33B 2LQRA 1MCRA 4K7FA 1NC4B 2D9QB 3LB6C 1RZJL 5JW4M 4NZJA 4QY8B 2VH5H 1OTTC 5JPMB 5C0GB 2EC9U 3O8XA 5C09E 2X44D 1E27B 2HRPH 2GQHA 4AEEA 2JJWA 1NMBH 3E6FB 1OD7A 3QNZB 2APFA 3GSOA 1QBBA 2AP2A 3T4AA 4ZMAT 5DMKB 4KTYA 1JWUB 4OZHB 1KIPA 1BEYH 1BPVA 1Y6KR 2HG5B 2F58H 4D0BB 3BZFA 1NGQL 4JN2B 4WU5A 1RZJC 1HH6A 4MXVE 1DN0B 2OR8A 4J8RB 5HHMD 1BZ7B 4NNPH 5TDNB 4PJGA 1FBIL 4JGJA 2QKIA 4P4KB 4RRPG 4OSUL 4DAGH 5JO5A 5B21A 4JR9H 1A9BA 4RFNC 4OF8A 1INDL 5HGBB 1KULA 4M7KH 4JO4H 1Q9OB 1QSEB 3KS0H 5CEYB 3D0LA 2GSIA 3B2UD 4AMKH 3CVHB 1CTNA 3PDDA 3Q6FA 5F1KC 1QG3A 4LASL 2LABA 5D2NB 3OBAA 3PV7A 3OZ9L 5HHVH 1JZ8A 4LU5L 3AVEA 3OGCB 4JFDA 5B38A 2ZOKB 1RPQA 5MHSE 5ETUB 4LL9A 5HHPB 1OP9A 2V17L 2X7LA 3HC4H 4OZGF 3MLTA 4CN6A 4J6RH 1NAMA 2I5YH 4G6JH 2HFTA 5B4MC 4F15C 3SDYL 4R8WL 1RIVL 3HNSH 1W0YT 1RUAH 3FCTB 1NFDB 3MLUL 4FFZL 4UU9B 5KSVA 1F6AB 1RUKH 1FZJA 4W4OC 3S6CA 1F11A 5HYFA 4U1SB 3MPCA 4JZOB 3GO1L 2BNRE 3GSNH 4NRXB 3D69B 1M4KA 5CJOL 3MLYL 3QR2A 5DRZA 3LKQB 4MNQA 4QRPD 4MQ7A 1AI1L 4HWBH 3T77B 2DQIH 2CR3A 1W2KT 1ES0B 5K9KA 4XPFH 3WIHH 2QR0A 1CFVL 3O4LD 2YD7A 1YC7A 4HWUA 2MCPH 4Z7QE 4OV6F 4W68A 2VABA 3FQXA 3HE6C 4RA3A 4PJAB 3CXDL 1DQLH 2CSPA 3BIAX 3SE8H 4P2CG 5F96H 2WNGA 3UTTD 4IIQC 4EVNA 4XPGL 2VR5A 1YPZE 1KCSH 4NBZB 1ZGLB 4P5TC 1F2QA 4NFCA 1A6ZA 3KPQB 4MS8C 4NKDB 3EOTL 5ILTH 3EYFB 2X1PA 4NPYB 4X80H 5EO1A 3ZE0E 1I4FB 1NDMA 4QGYA 2FX7L 5CJ5A 2E9WA 1FGVH 2N7BA 3TCLB 3U83A 2N4IA 4V1DD 3DROA 4X6EA 4ELKB 5L6YL 5C9JB 4XPTL 3DVNB 1IE5A 2HTLC 4U1KA 3M45A 4I8DA 4CL7A 1EGJA 4OIIL 1S7TB 5D2LA 5I8KL 3BX7C 1HWGB 3GMPA 3QUXD 4FNLL 4WWKD 5A16B 3AREB 3OKEB 4N0FB 4O4YL 4L1DA 3L3KA 4LARH 2I9TA 1ZHBA 2VQTA 2PTTB 2A6KB 2M26A 3G5VA 1QLRB 2CRMA 4JDZA 3RPIB 5HDOA 2R69L 1WWWX 3QXVA 1C08A 5SWZD 3D39D 4GRLD 5E4EC 4LMQE 1X5XA 2AXFA 4NGHH 3DXAD 4G8FB 1CF8L 1Y18A 2EIZB 5DVKA 5D71L 5E6YA 5DEGA 1ND0A 3QJFB 1UB5B 3VXSB 3HPJA 2VAJA 3GM0A 1DQJB 2JK5A 4J7RA 4UINH 3GMMB 5KZCB 5F71A 3WFBL 1JPGB 1D9KC 1UZ8B 1D3CA 2IBGA 4QO1A 12E8L 5FKAB 3WIIH 3KXFB 7FABL 4WHYG 4N1CA 3C5JB 5T5FH 5DSCB 1QBAA 2VZVA 3MV8E 4POUB 3IXTA 1XCQA 1FYTB 3HZMB 3HB3C 4H0IA 4WFFD 3IVKA 1VFOA 3RDTB 1G7QB 3RIAF 1HHJA 1NEUA 3QEGH 4LRIC 5C0BD 4E41D 4KRMB 3ZT7A 4FFWC 5IT2L 1E28B 2OXHA 4Y19E 1EMTL 3KYKH 1NUNB 2BDNL 5DZNA 4WNQB 5I1EH 4ZAKA 4TULH 1QRNE 4HPYH 4NWTH 4DGIL 3VXNA 2DQGL 3S5LA 2ICWI 4QRUB 2Q8BH 1UA6L 4A6YL 3DRTB 2X4RB 4OLWL 4YZFE 1Q0XH 2B1AL 3NTCH 4P23B 2VZTA 1LDSA 5DJ2A 4DUVA 2V2WB 1CXIA 5ITBL 4X9GA 4L8SC 5JMOC 3BQUC 4BFIA 1A6WH 2WP3T 2FIKB 4ORGB 1MJUH 3I85A 1CD1B 5HGAA 3KLHC 2QQLH 1DL7L 4LSUL 3MGTB 2P4AB 1DSFH 4TPRH 1I1AD 3S36L 3PL6B 4DKAA 1XGPB 3FB7A 5FV2A 5A40E 1IKFH 4NO2A 4K7PH 2I9LA 1RZIB 5IMLB 3M17B 1WBZB 2V7NA 1T2JA 2KPNA 1L7IL 1MJ7H 1RJCA 4PG9B 2J5LC 1ZMYA 2HA1A 1YC8A 3KJ6L 3KHQA 1SVCP 2BX5A 4KQ4H 1S7VB 5CIPB 4IDJH 4I3RH 4X7EC 3L5JA 2C1PB 3FRPG 4QWWD 3ZL4H 4MJIA 3J7HA 4L5FL 5D7LD 1MI5E 1I9RL 1I1FB 8CGTA 4WV1B 5BRZD 3WS3B 3D85A 3W11C 2HTKD 3LN5B 1A7BA 1QP1A 4POZC 1JPSL 4XP1H 4NOFA 1UCBH 2XG5A 3ARWA 3ZYOA 5IB1B 3H7LA 5D72L 3QUYC 2AJZA 1X5FA 4LBEA 5FCSH 5I1LA 4TUKH 2MFNA 5J57B 5ECJE 4NZTH 3M8OL 3REVB 3OAZH 5EU7E 3VXME 3G5YA 4LSSL 4WW2C 4JG0L 1AQKL 1XGRA 4MQXD 4P2RE 1FZKA 4NFBA 4HG4J 5HHNB 2IADA 3RA7H 2UZXB 4NQDE 2B0SL 4JY6B 1JE6A 5CEZL 5CP3A 1P5VA 4AT6B 3Q6GL 3U48A 3BUYB 1JPFA 3HAEH 3MO1A 4E9LA 5IEHB 3BHBB 5D8JL 5D93C 1HHGB 4GSDH 1Q0YH 5E08L 4PJ9D 1RJLB 4ZS6C 4C56D 3C8HA 4X5XB 4PJ8B 2J4WH 5ALBH 4R3SB 3LEYH 4WIQA 3ECBB 4OD1H 3S4SG 5LWYH 1NEZG 3P4LA 1C7SA 5DUMH 3ES6B 1AGFB 3IFPB 3WFEH 4HXBH 4J3OC 1MCLA 1P4LA 2R4RH 4BFGA 3SPVB 4FXKA 1ZHNB 1R3JA 1I75A 1JF6A 4FFWD 4S1QL 1RUQL 1U8QB 4I3SL 5KVGH 3OX8A 3T65B 4GG6F 4FFVC 4Y5YB 3RU8H 2PO6A 5EORL 2AK4B 1FLRH 1AGCB 2FCBA 3L7EA 2UWEF 4HUNB 3U0WL 1UM4L 4MJ6A 3BT2H 3QDGA 4OZGB 3HE7B 3LVEA 3RWGB 2CDFA 5IFHL 4JQVA 5F9OH 5T1DL 5AG9A 2VQUA 4XH2B 3F7PC 1RULH 1HOCA 3W0WE 3BQUD 1YEFH 3AROA 4EJ1C 2X9YA 1A21A 3ILQC 1JNLL 4ODWB 4X6CA 4MCZA 4YHNA 5E2TL 1GGIH 1IM9B 4HXAH 4LLDA 4KK6D 4OLYH 2VE6A 5C1MB 2NZ9D 3KYMB 4NQCD 2CJUL 1ZT4A 3UJIH 3CMOL 2DJSA 5CBEB 3TH4T 3WN5B 3U2SB 5KS9A 3P3YA 3C60D 2FHFA 2HN7A 4OT1H 5EG6C 1J5OL 5JA9A 3SJVE 1EFXB 3O6LL 4JLRB 1DBMH 1R3LA 3S35X 3SDAC 1S8DB 4LLWB 3QNXA 5I1GL 3CCHB 4XBPA 5TFSL 5E56A 5DUBA 2VC2H 1I1CA 4ACPA 1FL5A 4NUGH 3MRKB 3WBDA 4JFQA 2FGWL 4QXGH 5C7XH 4PJCE 2YD4A 3MRPB 5C07D 2JLLA 1W72A 3LQAL 1X6NA 3N1FC 3MMEA 3LPGA 3QPQC 3CFJB 4CRPA 4RGNB 5T3ZD 4IJ3B 1RU9L 3MRIB 3C8DA 3GNMH 3IDYC 1D7FA 2X70A 4Y5XA 2K7QA 3PWJA 2OJZL 4L29B 4OM0L 4M9PA 4GMSL 1KJ2B 3CLEL 4AK1A 1DLHA 2ADFH 5I1HL 1IILE 4U6VL 3P11H 4UZGA 1IT9L 2W9LA 1JI2A 3DO7B 4PJHA 3RY6A 2FH8A 1S7UA 3HI5H 5FYKU 2QSCL 1CDIA 2DQDH 3NA9H 3DIFB 3NFPB 1TPXC 3LQAC 2E6PA 4PJXF 3FFDA 3FO2A 1RZ8B 1EX0A 1W0VA 5J13B 4RRPA 4ELME 5CINL 1CK0L 3LOWA 5DJ6A 2VDQL 3ZKSD 3S35H 4XNMA 5CCKL 4R26H 1XF4B 3ZHLA 3VFOA 3QULA 2GTWB 2DQCH 2PCPA 5D9SB 4YXKH 4K55A 2ZUTA 1PY9A 4M02A 3PDOB 5HY9A 2NYYC 4M7KL 3QH3A 2VL5B 4UAOC 3N06B 5IVNA 2X1OA 3VXPA 1HWHB 4NCC2 5JOFB 4N90D 5HHQA 3N9GH 2H6PA 4V2CB 4WW2F 4XB7A 3G6AA 5CEZD 2FEDD 2AEQL 4WY7L 4OZ4A 3V6OA 4GAGL 4WU7A 1HI6A 1FAKT 3EYSL 3SGDI 1A02N 1QUNA 3HC4L 1YUHA 4K94H 4U0QB 2FATH 3NZHL 4QHUA 4JHWH 2UZYB 3QYCA 1M7IA 4G80A 4J6RL 4OD2B 4L4VE 2QADC 1OY3B 3AXLB 5FYLL 3HNSL 3PWLB 3PF2A 1MCCA 1UWEL 1Y0LA 3NIDE 4YX2H 3DV6B 1B6UA 5IBTL 1AHWA 4RFNB 4U6HB 1BWMA 1UC6A 2EH7H 2Y72A 4OCYL 5FOBA 4JRYA 4P99A 5CLTA 3X17A 1FVCB 3GSNL 3GMQA 5IOPA 3ARUA 2EKSB 1LQSR 3TO4C 3C5SB 4PYGA 5EOTB 2P8PA 2IQAA 3BWUC 5CWSA 4NWUH 4JREC 5CJXC 5MERB 4Y1AE 4QCIB 2VL4A 4CU7A 4PLKD 3HMXH 1PJ9A 2Y9RT 1BOYA 3WIHL 4B41A 3NCEB 2R1YA 4PREA 3SDAD 2V2XA 2R0WH 4UILH 5E03A 4YUEL 5EUOE 3O2WL 4Y4FC 4K8RC 3CFCH 3LRSA 1DLFH 4P9HL 4OF6A 3KPPB 4HIEB 3TBWA 3V52H 2NY7L 3D2UA 5F1OB 4KK8D 3IJSA 4G7VL 5C0AA 2I27N 4PLNC 2VDPH 2W9EH 5DJAB 4LPUA 3HCVA 3AS1A 3BGMB 3GJFB 1KACB 4DQOH 3GSVA 3L95A 1D6EA 3OG6B 2ITCA 3BVNA 4KVCL 5D1XD 5DR5H 4YFEA 2YK1L 4YR6A 3LKSB 5KJRL 2A6DA 3WHXB 1JTPA 1U8NA 3I2CL 1NCUA 3T3PF 5J11C 4LLVA 5IW1B 2QQNL 1KNOA 4NM4H 5EFIA 4NKQB 5F1IA 5GS2H 4PJFE 5E8DL 4S2SA 5HDBE 4P9HC 4G8GE 3PP3K 4PUBH 4MCYB 5DFVC 1IC4H 4IRZH 3LKRB 5GJTH 4X7DC 2B2XH 3HE6B 2APTA 5E0QA 1LP9F 3D3VE 3MJ9H 4LARL 3DX7B 5BVPL 3KVQA 4HUKB 4Y4HD 4U6YA 4PLOB 1J8HA 3N85L 3VD7A 4IIQB 1LO0H 2V9TA 3K3QA 4X4YB 3CH1B 3AAZA 4PRIE 4P5TB 3RWCB 1NDGB 3OHXB 4IMLA 1WJ3A 5CD3B 5IJKA 1A14L 6FABH 3EBAA 3O45B 1ZT7B 4H25B 2OTWA 1Q8MA 1UM6H 3IAPA 4HS8L 2DL9A 3GZKA 1J0ZA 1OQOA 2WW8A 3DUSA 3QUMA 5DK2A 5DD5H 2JIXD 1NGYB 4WO4D 3T4YA 3B8YA 4JJ5B 1NPUA 1KIRA 1S78C 4PJ5E 1EGJH 3IS1X 2XKNA 3TV3L 1KJ3H 5GGSY 3HMWL 2R8SH 1CLYL 3NOIA 5F70A 4U05A 5FECB 4XNYL 4K3JH 2Z8RA 1XGQB 5EBWB 2D31A 3H42L 1TJHH 1GGCL 4ERSL 3B9DA 1N5YH 4TVPL 1OAQH 1CCZA 2G5BA 3OWEA 4NQVA 4XVTL 1AD9A 2QADD 5E4EB 1OP3H 5BXFB 1IGIH 3ARGD 4HKBA 4APQC 5I1EL 4HDIB 1FNEA 1QSZA 2ZPKL 4YWGH 1MQKH 4ZPVB 4GG6B 4HAFA 1UACL 5FUZL 5BCAA 5JW4R 4JKLA 5JLZB 2BOBB 1CGSL 5KSBA 2G60H 1JNHA 2Q86A 2R29L 2UWEB 1ZS8B 3WMSA 4G5ZL 1JI1A 4R96B 4UT9H 1M7XA 3CDGA 3GB7B 2IPTH 5GGSA 1INQA 1D9KB 3PGCB 3P4MB 4C56B 4HUXA 3MRCB 5JW4N 3P9WB 5TDOB 5J12C 1MWAL 3W39B 4Z0XA 3V5KA 1TETH 4N9OB 4WI2A 3WKNA 1T1WA 2QQKH 1DVFA 3X3FH 5FYLD 2ZCLL 3VMOA 5F7DA 3K4DA 4K3GA 2VISB 1ZGLM 1ZA3B 3P73B 4TTGA 3FONB 4CDHA 2JF1A 5KAQF 1BIIA 3FOMA 3FRPA 4XMLH 1HIMH 2CLVA 3NCYS 3ARFA 1WWAX 5CZKA 4PJEA 3UC0H 1EUTA 4ONHB 1L0QA 5E70A 3OPZH 5GSVA 4PRHB 3E1F1 4LSVL 2BRRH 4N0CD 5H37H 4J3SA 3U9PL 1EO8H 3OR7A 3TT3H 1I8LC 1XGTB 1KTLA 4IDJL 4HFUH 5IMMB 2G75A 3P0YH 1HXYA 5K9OB 4KVNL 1SYVB 1WTGT 2DLIA 3QDJA 3RZCA 1CLOH 1U8PB 4K9EL 4LCWE 3UBXA 2R2HB 5AZ2H 5C71A 3I02A 2BNQA 4L8SB 4JB9L 2OR9L 4JO3H 2JB5H 1C5BH 5M94B 3MXWH 4PB9H 4LEOA 2P5WB 2OP4L 4P3CH 4DFHA 2G2RB 3EYQC 1BZQK 4Z78B 2ZSVA 5TDPA 1MAML 5I66A 1DQQB 1Z3GH 4C55A 2O5YH 2IANA 3FAWA 2P8LB 4A6YB 1MH5A 1K2DB 1MVFA 1ZANH 3AB0C 3ARSA 2VKWA 1AO7D 4K9EC 4M7LL 5K9QG 2J5LB 1UVQA 2GJ6B 5F44A 4K71B 2OTUB 4KHTL 4BFEA 1DDHA 1EZVX 3V6FB 1WISA 2XQYG 1WK0A 4UTBL 2ERJC 4TSAL 1AE6L 2BVUA 3MRLB 2YRPA 5IQ9A 1GGBL 3TN0C 1NEZA 3Q5TA 4XHJC 3L5HA 3BP7B 4AIXA 1XCTA 5FA3B 4PJXA 5CSGA 2R1WB 4YC2B 3QUKA 3L5IA 2O5XL 1S78D 4JFXA 1KCKA 4M4RA 3QUYB 3VFUA 1K6QH 4RFOH 1HHKA 5DUML 4DKFL 2PXYA 2VLJB 5IQ7H 1TZGL 4CNIB 3SE4A 5E9DE 1S9YB 4WI6A 2AXGA 2WBJB 4Y5VA 1CVSC 4FP8L 3BZ4A 1QFWM 4Y2DD 3VGGA 1NJ9A 3VXUB 4WW2B 3G6JE 3CDYA 4PTUB 2FGZA 5HYJA 5KSUB 1D5XB 2YPVH 3PHOA 5EA0L 4OZFB 4I2XE 1PZ5A 4IRSC 1EXUB 1U8IB 3Q0HA 4IOIB 3DETC 4LDLB 4RMUA 5IM7B 4Z0BL 1A22B 3RVVC 2ZJSL 1CDCA 3NFSH 4D0DA 3GIZH 1E4KC 3MLWL 3WCYA 4FTVA 3SDDC 5DD1L 5D93B 4DUXA 3O6FC 1RQ5A 5C6PB 3C6LC 2J2ZA 4ZUWB 4H88H 5DWUL 3MUZ1 3KPSD 3HI6L 5IVOA 3MZTA 3DX9A 4Z76B 2HH0H 4HXAL 5BS0A 4PY7B 3LKNB 1A9EA 3WFHA 1F4XL 5GS1A 1PEWA 4JRWA 1QFHA 3T1FA 5C0NC 4L3EE 4KUZL 3UX9B 3IJHB 1X4YA 5CZVH 1EO7A 4QTIL 5J6HA 1JYWA 1CFSB 2V9QA 1FVEA 4KKAD 1H15B 1P4BH 5IFAH 3L3DA 1VPOH 2APWA 4AIZA 1ZLUH 3EKCA 4DEPC 4NKMB 1L7TH 1OP5H 1JIBA 3CX2A 1VACB 1QR1B 4EQ2A 4YHLH 2CK0H 1RURL 2F54D 2VLKD 2AJXH 3QFDB 5LVEA 5E2VL 3LSOA 5HYQA 5K9JH 1QHOA 2CKBA 1CGWA 1FG9C 3BJLA 3L5XH 5AAMA 2EDRA 3Q3GB 5FDYA 4M03A 1MLCA 3BPCA 5DHVA 5IGXL 3W9EA 2A6JA 2NXZC 4P46C 4YDIL 4PP1C 5EO9B 1CLZH 1I1RA 2A6IB 5MEQA 5FUCE 4OTXH 4QXUH 3SKOA 4MQSB 3U7AA 4U1HA 4RDQF 5HHOD 4XXDB 2W07A 5HGDB 3RWHB 4FXGB 4YHYC 2IGFH 4UBDD 2GFBA 3SDAB 5IESH 2DQDL 4NHCL 3TGXA 3C5ZA 3LS5L 4XB8A 1DQMH 3VD9A 2HJLA 1WZMA 4GRMA 1HKFA 1LP9B 2IALA 5FAAA 3TH3T 4D8PB 1K4DA 1A0QL 1SMAA 5H35B 1FG2A 3WO3B 3FB8A 4LPWA 3O41B 1W72H 3MUY1 4OBRA 3VFRA 2HAZA 2BSRA 2PW1A 4PB0H 3IDYB 5CHNA 5C09D 4R7NB 1N6QL 4I0PA 4NO5B 1S7SA 3SGEI 3VXOA 4I4WA 3OXRA 1M7DB 1VFAB 4UQ3B 2P45B 4FOMA 3GK8L 1CS6A 3AM8C 3BWAA 4EDXA 4N5UA 5C0FB 4P2QE 5FOJA 5FHBL 3CK0L 2E8YA 3D18A 3MBXL 1OSPH 2P5EA 4MXQC 1TPXB 5IF0B 4IRSD 5I1DA 2F5BH 5DS8B 1T2QH 4G43A 1UFUA 3PQYB 4Z77A 2FNBA 4ZPTB 3WJJA 5JORB 1RHFA 2OZ4A 3VXRB 4GG8B 3F7VA 4ZUVB 3C6LD 1U3HA 2XV6B 4Y88A 1F3JA 1G7JA 2JIXB 5D70H 5JXAH 3PWNB 3AS2A 5IHLB 3FAXA 2EH7L 2HKHH 4UNTA 3TP4A 2X4UA 4FMKA 5MHSD 4UAOB 2ARJA 2LTQC 2XWBA 1KF9B 4RMWA 1NBZB 4O51A 5C0ND 5BZDB 5E99L 1ZT1A 1QNZL 2W0PA 3CAFA 4UIKH 2JKXA 4F7CB 1XGYL 3HMXL 4XPAL 5HDQH 5EU6A 3F8UB 5IFJB 5KN5B 3OF6A 1N4XH 3SBWA 1PDKA 1M71B 4JPKL 4JDVA 5DC4B 4DKEH 5F9AC 1T5WA 3B9VA 4WI5A 4WI8A 5GSRA 4DFIA 3WEXB 4U33A 4HJJL 1U92A 4JPWH 2JJUA 3I75B 4ZQKA 2MSPA 1NC2D 2BNRD 4HX1A 3VFGH 4G9FA 3MOBL 3IDJB 3QI9D 3MRMB 2XICA 2XZCH 4M6NL 5IHUH 3SGKC 3RTQC 3BKCL 1U6AH 3TA3C 1OW0A 3GGWA 4GKZA 1PD6A 2GITB 1MCDA 1Z6JT 4CU6A 2GHWB 4KJYA 4OKVB 2R56H 3T2NL 3VI3E 3TO4B 4NO0A 2HKFH 3NIFF 4QOKB 3HG1B 3G5ZA 4JREB 4LLQA 4AH2B 5GS3A 5MP6H 5KTEL 2XTJD 4HBQA 5EBMA 5E1AB 3VFSB 1AR1D 2YD3A 4NN6B 2NPLX 4RAVB 3O2DL 4YBHA 1R0AH 4NQEA 4LAQL 1ERNA 3V4UL 4PTTB 1OCWL 5HGHB 3O0RH 1ZHLA 1JTOA 4YIQB 4GKNB 2AV1B 5GISL 2B8OT 4Y4FB 3LCYA 4DW2L 3TVMC 1Q94B 4YGVB 4MD0B 3H3BC 4U4BA 1L6XA 5B22A 1S7QA 1EJOL 1MLBA 3MODH 1DBAL 3TNMA 4WUUE 2G5RA 2PNDA 3REWB 6FABL 1CGYA 2CDGA 5GGTA 4ZXBA 4OBSA 1Q9KB 4PR5A 4HH8A 4X5WB 1NLBL 2ESVE 2M8XA 1FFOA 2ITDA 4GW1B 4R90L 3ARTA 5E6ID 5J11B 1JZ3A 1UQSA 3QZWB 1OARL 4ESKA 1FL6B 1OAZH 1T1ZA 2Y6SC 4RBPK 3WSQL 2ZCHH 5EU7C 5EZLA 2H3NB 2EDLA 3R8QA 1RJZB 1GHFH 2YPLE 2ARWA 4XXCA 1TJIL 3WLWD 1YEHL 3U9UA 3I6KA 1AY1L 5F6HJ 2GYSA 1NCBH 4BYHA 3CMGA 4XTRD 2FHCA 4WHCA 2R2EB 3V5DB 2EDQA 3EIFA 2R4SH 1PX3A 4MMXC 4QRRB 3OJDB 1KB9K 1IGIL 4LVOC 1PKQA 1PY4A 1FH5L 1G9MH 4RZCA 4L4TB 1IAII 3B6SB 4X98B 4ENED 3L3JA 3MJ8A 1MQKL 1C5CL 3HUJF 4MDIB 3ULSA 1KT2B 1UH2A 1I7UA 1UXSB 3H8NA 1QBML 2E9BA 5IK3B 3QUMH 4WHYH 5ITFA 3MV8D 5FYJE 5LGHL 1LEGA 3ARBC 3PIQB 5F3HA 4H8WL 2IMMA 3KWWB 2V5RA 5DLMH 1JGLL 5HTSA 3P40A 4KI1A 2AK1H 1JZ6A 4KKBC 3BO8B 3MOAL 4Y19D 1TVBA 2OL3B 1MJ8H 5I76B 1P69B 4RMQA 3GDBA 2AS5M 3AS3A 1U36A 2KH2B 2A9NL 1QRND 3MRRB 3BRDA 4ZNCD 3X14B 2X1WL 3V0WH 4GAYB 4JFPB 2CQVA 4OF5A 3QIUA 2W9DH 5IIEA 3QDMB 1FHGA 4KUCD 4P5KB 4APQB 4H8WC 4OIBA 5DJXA 4Z7WA 1WEJH 3DOSA 1EO8L 4AG4L 3RL2A 4NHUA 5T1LA 3TA3D 5C8JA 1VGKA 4ZYKA 1BVKB 4ZNEA 25C8H 2CLRA 4I9WE 4P57A 4HUUA 3TC9A 1P7KA 2VLRA 3MTRA 3QWOA 3TZVD 3LEXB 5IB2B 2GSGB 2Y5TB 5D7JC 1YEGL 4Z18A 1EVUA 1C1EH 1FN4A 1X44A 3TWCL 4LVEA 3VW3L 4EBQH 3HI1B 3BJ91 5J12B 4Y4KA 2OR7A 1A7RH 3QXDB 4OUUA 5J7CC 1NKRA 3MXWL 1UH4A 4OZHE 4PJGE 1J18A 1MCJA 3PV6B 3ET9F 2NQCA 3C09C 4NC0B 1JUFA 1NANH 4YHML 4RAUA 2IH1A 2ICES 2ZNWA 1T89A 2O5YL 3TBSB 4DGVH 1S9XB 1QLFB 3U0TA 4NZUL 1OHQA 2RAMA 3CGTA 3TVMD 5DD6B 5IHZA 3KHOA 3KYOA 5DJCB 2CGRL 3KYNA 4L8DA 1MI5D 5T1KA 1BMGA 5J3HD 1R24B 4P9ML 1E4WH 3CFDB 5C6TL 1QSEE 2BVQB 4P48A 5I15L 5IVZB 4YEFA 1S7WB 4LVHC 3JUYA 4F7MA 4O5LH 2W0KA 1MWAB 4OAWB 3B5HA 2VLKB 3CC5A 3D25B 4UT7H 5D2NE 4KKLD 2PW2B 5IROC 2EYRB 4F58L 3GBMH 2F74B 3KPOA 5GIRB 4EI5A 2JJSA 3FTGB 5CJQL 4Q9RL 4F37F 5LGKA 2C3HA 2H8PA 1A6TB 5L2JA 1L4IA 1UYWL 4GXVL 3VXMD 5EN2A 5JHLH 3DRQA 4FS0A 4JM2A 3K74B 1Q9WB 1L6ZA 1IM3B 3T2PA 2QSVA 2EDOA 2YOCA 1X4ZA 5EU3B 1NFDE 4NQDD 4UDTA 1QRKA 2X4OA 3AB0B 4N1EA 2Y7QB 2R9HD 4MNQE 3JSSA 1VFBA 3B8SA 3GMRA 3P77B 4MAYA 4CW1A 1QSFB 3QFJA 4F2MB 1J1PL 4GBXA 1BP3B 1OF2A 3RUGA 4Q0XH 5C0CA 5IV2A 1T0MB 3GI9L 2ERJB 2LU3A 2DLHA 3VG0H 3NFSL 3TN0B 5F9JA 4ODHL 1R3HA 1U2CA 3BMVA 3BPLC 4PRPB 1AXTH 5IW6B 3BH9A 1RVFL 5GHWH 1QPXA 4ETQB 4IRJC 5IEKB 4PJAE 5I2IA 4LPVA 4EI6B 5F72S 4KKBD 2F9BT 2A73A 3PJSA 4I77L 2H2PC 1LEIB 2EICA 2V5SA 1Q9LB 1T22B 3CJJA 1MHHB 1E6JL 1KC5H 2C7UB 2VUYA 4QHMA 2G9HB 4URTB 5ISZB 4I5BA 3FB6A 3VFVA 4RQQA 1N7MH 2DL2A 1C16A 3TIDB 1RMFL 5ACMA 4HIXL 3UYOD 1R3IL 5KVFH 1P4BL 2ZUUA 2D0HA 2DLFL 1RZGB 1I7ZA 4YXHL 3RI5K 2DDQH 4I1NB 4L8CA 1OTUC 3H3KA 2RFXA 3RHWK 2ORBH 3W0WD 1BX2A 4JY4B 4CJ0A 1FNGA 1CXKA 3OJ2C 4YHLL 3FO0L 4YQXL 1GOFA 1XZ0B 1XIWD 3SDDB 2DD8H 3NPZB 2Y06L 4D9QE 5BOPA 3O6FB 1I8KB 1DEEA 3HFML 4QHNB 3KGRA 1BAFL 4X8XA 3TBYA 3GKWL 3D9AH 3PABA 4FQIH 4NKIH 1IGFL 1P2CA 4YE4H 5EZIH 2AV7A 3SJVD 4P5MA 1EPFA 1FFNA 4OF3A 3EYOB 2MQCA 2NY1D 2VDNH 3MA7B 4KJWC 2HMIC 1T80A 1J05A 4JGUA 4U1NA 2E8ZA 5SV3A 3MXVL 4Z5RB 2ADIB 4D3CH 1I7TA 4EUPG 2YRZA 1XF3A 4PGBA 4NT6B 2VYRE 3FN3A 4X7CC 1NGPL 4OZFG 1TCMA 3TEUA 3KLDA 3QP3A 4LGSB 5L2KB 5E8EA 4DEPB 3UPRB 1LEKA 1IGML 1YYLH 4LKCB 3PWUA 5GQBA 2Z9TA 2VXSL 3DARA 3ULVC 5D7SH 3G6DL 1D5IH 2WIMA 3V4VL 2FO4A 3IDN