1VCAA

Crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 angstroms resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
199
structure length
199
Chain Sequence
FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion protein
molecule keywords HUMAN VASCULAR CELL ADHESION MOLECULE-1
publication title Crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 A resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05790 C2-set Immunoglobulin C2-set domain
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1vcaA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1vcaA01
4LCWB 2XZQL 1YC8A 4TOYL 1KIQB 3GK8L 2Y4SA 5IHLB 3N0PB 3GHBH 4U4BA 1MQ8A 3RPIA 4NQDA 2A6KA 3TYGL 3QHZL 2R0ZL 5I8OL 1KGCE 1MEXL 4M02A 2X4PB 2FH6A 3TBWA 4GAGH 5BVJB 1HQ4A 4XC3H 2YR3A 5HYQA 2Y23A 4DZ8B 1FNHA 1B0RA 4RNRB 3HNTL 4Q6IC 1WICA 1BREA 2C7UA 1A3QA 4JLRB 3ZTJH 2CRIA 3DETC 1T22A 2A83A 1P1ZB 1EPFA 4P4RB 2CJUL 3ZL4L 2R1YA 5EBMB 1NGQL 3BD5A 4KKBD 3MYJB 1U8NA 4YXKL 3T3PE 1K8IA 5GRJL 3H9HB 5F88B 4ZFOB 3O6FB 4ISVA 4OCXL 3RWGA 2ZUUA 5IFJA 3VG9B 4NUJA 4X7SL 5E56A 2OTUA 3D39A 1WWWX 4R0LC 1IAIM 4GKSA 2A2QT 5D7JA 1U8OA 1T6VN 3G6JF 4V2CB 3WEXB 4GRLB 3L5WB 4JY6B 4WI6A 1G9MC 3S34L 2CDEB 2GSGB 1AC0A 1NL0L 4XHJD 1N2RB 2OR9L 2LU7A 2DYPB 4LLUB 1ZWIB 3P2TA 4Q9QH 5DZLA 5HHPB 2JJTA 1Q0YH 3M1BA 3P3YA 4Z7UF 2FDBP 1V5JA 3BD3A 3VRIA 5JHDB 5F9OH 4FABH 1ZLSH 5D1ZD 5ID0A 2P5WE 5CBAA 4PRNB 5F9JB 4DAGL 3LSOA 1OSPH 5TH2A 4ZO7A 1J0JA 4HWZA 1S7VA 4PRPA 3VWKA 5E8PA 3OB8A 1U3HC 3PJSB 3RI5K 3VXOA 2BVQA 5D7IE 3ROLB 4OBSA 4NZUL 2VLKD 1A9BB 1MCRA 2VYRE 3GGWA 3JWOC 3EDFA 5EC2B 5IVZA 5FM5O 4JFZH 4PGZA 2IMNA 4PJ8B 1BEYH 4K7PH 4L5FH 1BD2B 5HHNB 1JF1B 5JXEA 2FO4A 4D8PA 5JXAH 4XNZC 1XF3B 4L8DB 4M8QA 1FNSH 3OAYK 4XGZA 3MV7B 3BO8A 2V7NA 3HKFA 4MXVF 4WWKA 4AMKH 5C6WH 1F4YL 3RGVA 5TJWK 3BH9A 2ZJSL 4OCLC 1EMTL 1A7BA 5D1QB 3DYMA 3OR6A 2KKQA 3QEUA 4NKDB 4LCWA 4XVUD 5EG6C 1KIQA 1MRCH 4E41B 2FHCA 1J5OH 2YBRA 4RA3A 1INEL 3HN3A 4DN3L 3WFCL 4Y16D 2ZNWA 4JFEE 1Q8MA 2X4PA 4ZOBA 3CZJA 1T0MB 3E1F1 2BXYA 4M93C 4PLKC 3SDDD 3ZLQC 2P7TB 5DT1H 2H32H 4P4KB 5E8OB 5EUOE 4O00A 4X9IA 3ZKSD 5KN5B 3FQWB 1JHTB 4DZ8A 4NM8L 4RNRA 1NPUA 4P2OD 4K9EC 3KNBB 4JLRA 4G6KH 5E2TH 2OS7A 5L0QB 1P1ZA 4P4RA 3T0EC 4X4XA 3VFGH 5EBMA 3MYJA 2BMKB 2Z92B 4LVOC 3F65A 3H9HA 5F88A 4IOFD 4ZFOA 5L2JB 2HRPL 1YJDL 3SDCD 1Q1JH 4O4YL 3FOLB 1BVKB 2ENSA 3MNZA 4U33A 4NSKB 1S9VB 2AJYL 4GMSL 3R1GH 3GRWH 1QA9B 4EDWL 2VNCA 2IPUK 1CDHA 2FL5B 4Q9BA 3JTSA 3WEXA 3L5WA 4JY6A 3NGBB 1BIIB 2CDEA 2GSGA 1OAZH 3LD8B 4KK8D 3CXDH 3FT4B 1N2RA 4U7MA 1LK2B 3OG4B 4QCIB 1ZWIA 1XFPA 3TYFA 4X8JA 5HHPA 4JREB 2PO6C 4YZFE 4YHPB 3V5KB 3GMNB 4S1QH 3VFVB 2YXFA 43C9B 1J18A 2YWYA 1W0YT 3GFUA 5I1KH 5JHDA 1RIVH 3SDYH 4LPXA 2E7HA 3QFJD 3WSQH 2GIYA 3K2MC 3VXUD 1KBGL 4PRNA 1D7FA 5F9JA 3ULVD 1MJ7H 3UAJC 2NY6C 5FYJU 1GGTA 3HG1E 2Y06L 3PJSA 3I02B 5FFLA 1BQLH 3ROLA 4POYA 1SMOA 2XFXA 5IVNA 1O5DT 1A9BA 3MYZA 1X5FA 2AJVL 5EC2A 3CK0H 2AJ3B 3N1PC 1T5WB 1PFCA 5C0BD 3V4PH 4PPTA 4PJ8A 1YQVL 1BJ1H 1BD2A 1REIA 5HHNA 2JJSC 5IIEA 1CFNB 3MV9E 1UVQA 1XF3A 4L8DA 4OB5H 1OW0A 5D70L 5IQ9B 3MV7A 3C60C 4UOW1 4ZOCA 3S8WA 4XPFL 5B4MC 2VXUL 4ZOAA 2CD0A 1TCMA 4CAGA 3QIBC 4TTGA 4JKMA 4HPYH 4TUJB 1PBYA 4LGRB 4IRJB 4NKDA 2HKHH 1IC7L 3BEVB 2NTSP 1CQYA 5GGTH 3TJEH 1CVSC 2X4RB 1LE9B 4S11A 1QBAA 1QFWI 1RZ7L 4M7LH 1SBBA 3IDYB 3SE3C 4NM4H 4M7LT 2Z9TA 2DIJA 3WXWH 5DRNA 2APBA 1T0MA 2F5BH 1RULL 3QO0B 2YPLA 1KN2L 2P7TA 4P4KA 5E8OA 4YGAB 3IFLL 4EIGB 5KN5A 1JHTA 2OL3H 4O58L 3MODH 1FRGH 2DBLH 3D9AL 4FQCH 4YNYB 3LQAH 3MJ8B 1YMMD 1GRWA 4Y19B 2H26B 3TWCL 1D5BB 4LAQL 4QTHB 2Z92A 5L2JA 1ZHLB 2CIKB 5DYOB 1MAML 3TNNB 1XGQB 1WTGT 3C8HA 3FOLA 1BVKA 2PYEB 3FQTB 2QADC 4JZJB 3SKJH 2VLJB 4R97B 4NSKA 2CRMA 1S9VA 2GY7B 3MRKB 2OTPA 2X4OB 1YEDB 2FL5A 2YD4A 3AUVA 1I85C 4W6XB 4TSCH 4YE4H 5L7XL 1ZTXH 5KW9H 1TITA 4FQPA 1BIIA 4FQJH 2HJLA 4KUCD 5JZ7D 5KS9E 3FT4A 3QCUH 4JM4L 1LK2A 4S10A 1OP5H 2V5RA 2VUOA 4QCIA 5DI8B 4O2FB 4R26L 2Q87A 2NXZC 1MQKH 1ZA6B 5ADOL 2IAMD 1WBYB 2IADB 5F3HB 2BHUA 3GMNA 3IAPA 1RZKC 3V5KA 3VFVA 3AB0B 4WEMB 43C9A 3GJFK 4NNPH 3HR6A 5IEHB 1RUKH 4Y1AB 4LSDA 1JHKL 2SEBB 1X5KA 4L3CB 3KPSB 3CDGA 3KR3H 2P8PB 2NNAB 1RV6X 3PWJB 1I8KB 2VQ1B 4X6BB 2BHYA 4MS8D 1LILA 4HPOL 3I02A 1U91B 4ZG1A 3KYNB 4BFEA 4RQQB 1PEWA 1AY1H 5SX4I 1YEJH 1G7LB 3BWAB 2AJ3A 1T5WA 3F58H 1TJHH 1TTUA 1F2XK 4ZYKB 1QP1A 2VXQH 3X3FH 1CFNA 2BVOB 2Q20A 1T7WA 1AO7D 3HE6A 4UT9L 1BGXL 2O61B 4N9GB 4GG6E 1OY3B 1A02N 5IQ9A 4UAOC 4K94H 1T1XB 2XTJC 3CIQA 1MFCH 3TO4B 5IQ7H 2IBGA 2JJWA 5T3XD 3QDHA 4ZTPL 2NY3B 1VKXB 1Q0XL 5T5FL 1NFDF 3WFZA 4TUJA 1QSED 3QJHB 1J88A 1UEYA 1ULVA 3EOTH 4LPWA 4XT1C 3O6LH 4IRJA 4LLVB 4RGNE 3BEVA 3EO0B 4HF5H 3IJHB 2N7AA 1HSBB 2UYLB 2X4RA 1LE9A 3VCLB 4TPRL 2CK0H 3MV01 1YYML 3UMTA 5DMGD 5CJXC 3QO0A 4ETYA 5CJQL 2OK0L 4D9QD 3MCLL 2FRGP 1J1XH 1RU9H 3BP6B 4IRSB 4B0MM 3HAEB 1CL7I 2IANB 4QXUL 1MJ8L 4PRAB 4XHQA 2VXVH 5E1HB 4MDJB 4YNYA 3RDTB 5KZCD 3MUGB 1G1CA 3U1SL 4QOKB 1Z2KA 1J87A 2OBGA 2V6HA 1TQCB 4Y19A 3LHPL 1MIEH 1OLZA 3NCJL 4GRMB 1JN6B 1D5BA 4G8GB 3VXMB 4QTHA 3VFSB 4G6JL 3VXSE 5D7SL 4QRPB 1K9TA 5AG8A 5MI0C 2AQ3A 1ZHLA 2CIKA 5DYOA 2QLVB 3LEYL 1BAFH 3TNNA 3I6KB 1XGQA 2C3VA 1TZGL 4Z7OE 1NUFA 5SWSD 4FQLH 3V6OE 4MDIB 1JNNH 2VWEE 2PYEA 3FQTA 4JZJA 5DA4A 2VLJA 1VGEH 1FL3B 1L7IH 3MOAL 3NACH 4E42A 1ZSDB 2WMPA 1CL7H 4HH8A 4ZS7L 3MACH 2X4OA 1YEDA 1H3WM 4PGEB 2JIXD 5CKGA 2E9JA 1MHPL 3FO9B 4ACPA 3DX9B 1UM4L 3N06B 1A6WH 1HINH 4TYUA 4F80A 1T83A 1RZJH 4KK9D 4UDUB 5DI8A 4O2FA 1MFDL 1NLDH 2G5BB 3O2DH 5IROC 1ZA6A 1WBYA 3R8QA 2IADA 5FYLL 1NAKH 5F3HA 1MVFA 4MZ3A 3OXSB 3OJ2C 3CU7A 3QNXB 5DDHA 2SEBA 4GXUM 4YXHL 3KPSA 2P8PA 5T1DH 1VGKB 2KPNA 3AFLA 3S96B 3CSPA 1GPOH 1RJZA 1I8KA 2NR6D 2VQ1A 4YHNB 5IW6B 3QULB 3UJIL 4OD3H 2YN5A 1EK3A 3JWNC 4X6BA 5IFAH 1U91A 3KYNA 4RQQA 3BT2L 4V1DD 4LHUG 5F9WB 1AP2B 4XHJC 1G7LA 3EYSL 3MCG1 3BWAA 1MRDH 3VG0L 3KG5A 1FQ9C 4M5ZL 4ZYKA 4LSUL 4YUEH 2GK0A 3PNWB 3LVEA 2AXJA 2OMBA 2BVOA 5LQBL 2CO7B 2EIEA 2CDFA 5KOMC 1OAQL 3OHXB 4NFCA 5DLMH 1N59B 2O61A 1E6JL 4N9GA 4JRYD 4C4KT 1G7IB 5I71B 5DQJA 1T1XA 3TO4A 1X9QA 4M7JL 1VKXA 1MF2L 4MA8L 4I18C 1QHOA 3QJHA 1J0IA 4UBDD 1QPPA 1X5GA 1D5ZB 4LVHC 1FFRA 1E0OB 4LLVA 3NA4A 3TPKA 4XAKE 3WO4B 5HHOD 3IJHA 5I74C 3U4EB 1HSBA 1FGVL 5J1AB 2UYLA 4X9HA 1NANI 3VCLA 1YEGH 3MRJB 4HKJB 5JPMA 3CDFA 3TFKD 2ESVD 2AXGA 5BXFB 5F97E 1NMBL 5KVMC 3WFBL 3BP6A 3C5ZB 4IRSA 4X99B 3I85A 4RWYL 3HAEA 5EU4A 2IANA 1EO5A 3VWJB 4PJXF 1CWVA 4PRAA 4P23B 4MDJA 1HHKA 3RDTA 3MUGA 2HFGL 3MRNB 4QOKA 5JUEH 3F7YB 1JZ3A 4J3WA 4BUGA 1G9NC 4RFEB 3T0XA 3QHFL 2HAZA 3BOVA 1JWUB 4GRMA 1I7UB 1JN6A 1UA6L 4G8GA 3VXMA 4TNWK 3VFSA 3KYKL 4QRPA 4MVBD 5EU3B 4YGVB 1E4XI 1NKOA 4KHTL 4Y16C 1JFQH 2IPUG 4NKMB 4YHYC 4MDIA 1NMAL 5SWZB 3SDDC 3NCMA 1FL3A 2EDQA 5FB8B 4NFBA 1QBLL 3NIFF 3K4AA 1ZSDA 4S0SD 3QUML 4LHQB 4QGYA 4F58L 2GK2A 3RNQB 4PGEA 1S9WB 3ULVF 4P2OC 5AZ2H 3FO9A 1T5XB 1MCLA 3FB8B 3DX9A 1MHHB 3HCVB 2DQDL 4FN0A 4Z0BL 5CZVL 1EEQA 4UDUA 4X80L 1PKOA 2EIZB 2G5BA 3JVGC 2F5AL 5C0AD 5L8KB 4GH7B 1J10A 1DANU 4IOFC 1IMHC 4GJTB 4AT6B 5FHBH 3L3HB 3V79C 2Y07L 1LEGB 3OXSA 3QNXA 4UOJA 4Z0XB 4NQED 1VGKA 4JPKL 3S96A 4YHNA 2ZCKH 3QULA 4Y4KB 5IW6A 2F53E 4PJHB 3W39B 1C5BH 4GAFB 1GAFL 1AP2A 1IEBB 1H3PH 5IB4B 1CXFA 1LGVA 4XXCA 4I2XE 2Q86A 3PNWA 3DGCR 1F8TL 1CGUA 2Q8BL 3O9WD 1LP9B 1BF2A 1BX2B 2X7LB 2IPTL 3QXTA 3F5WA 3OHXA 3HE7B 1N59A 3VE0B 2R0LL 5TE4L 3BQUA 1DQMH 3HC3L 4NO0B 4WUUB 3T65A 3H2WA 4OLUL 2H2SD 4KI5E 1U8KB 2BJML 5B8CB 3LS4H 3GI9H 1RIHL 4Z7WE 5C08E 3MRGB 2J88L 4MHHG 4DVRH 4X7TB 1D5ZA 4QHMA 3CX5K 4PJIB 5T3ZH 5C0NC 4KC3B 3KLHD 5E94A 3U4EA 1JWSB 3RL1B 1C08A 4BK5A 4I3GA 5J1AA 4HMEA 2X4QB 3QXUA 3MRJA 4HKJA 3ABZA 3FRUA 4XB7A 3QISA 5ITBL 2Z91B 5IT2H 5C0CD 4D9LH 3ARFD 2E6JA 3S6CA 3BRFA 1UXSB 4JPVH 5BXFA 3C6SB 5GGSY 5C2BH 3IDJB 3C5ZA 4TTDC 4X99A 5F1KC 1P4BH 1ZVYA 5KVDH 1FZOB 3VWJA 2VMFA 5BO1L 4P23A 4P5MB 3NCFB 1OGAD 4UNTA 2EDFA 2DLTA 4HH9B 3MRNA 3F7YA 5HXMA 5GS1C 2DAVA 4RFEA 4P9HH 1JWUA 1AXSB 1I7UA 3SO3C 1G84A 4G9FE 1BBDL 3MGTB 4KUCF 1KIRB 2VQTA 2X5PA 3TN0C 2WQ8A 3BE1L 5GZND 4YGVA 1KTDB 2NY7L 4WFGE 5LGKA 1WGOA 1PW3A 3HRZB 1UB5B 3DUSA 4NKMA 4J12A 1DBBL 5HVHB 1BIHA 5I0ZA 3RWDB 4C55A 1UM6L 1KXQE 5SWZA 2F8XC 2DJSA 4OGYH 1PG7X 4ODHH 5CSZB 5FB8A 5GSRB 1N8ZB 4L4VE 5ACZB 1AD0B 1IL1B 3RNQA 5E4EB 1S9WA 3CFIC 2J3SA 4OZFG 1T5XA 1IBGL 4L4TB 3FB8A 5T3ZD 1MHHA 1NCCL 1NEZG 1SY6H 2D7TL 2ORBL 3HCVA 4NQXB 1W0WB 2AABH 2W07A 2DQIH 3NAAL 3L3OB 4AT6A 3QP3A 3L3HA 3FN0H 3NPSB 3PGCA 1UJ3C 1KGCD 4KJQD 1AE6H 4XNYH 4YDKL 4OFYA 3MNVB 3OPZH 4Z0XA 4K7PY 2OR7A 1SEQL 1YEIL 2YD1A 2YA2A 1NCBH 4Y4KA 2IGFH 4JPIA 1CVRA 5E08L 4PJHA 2N7BA 1UYWL 4Y5VC 3W39A 3MRQB 5JZ7C 1XGRB 1D9KD 1CF8H 4ELMB 4PJAF 1IEBA 1RQ5A 5IB4A 3U0TB 3N1MC 2IFFH 3GMRB 3H8NA 2HH0L 3UTTA 4N8CH 1EFQA 3EFFB 2X1XR 1TJIH 5DD1L 1BX2A 2X7LA 2EE9A 4P5KB 3RY5A 3VE0A 3UZEA 1DBKH 1WITA 4WUUA 3CU1A 3TO2B 4L9DA 3A6BH 1Y0LB 4KRNA 3LQAC 4H8WL 5B8CA 4PJCB 4M7KH 3MRGA 4MS8C 4X7TA 1E4WL 5B38G 2DB8A 4PJIA 4WI8A 3RPKA 1JWSA 2X4QA 5FYKU 2DLFH 2Z91A 3CFDB 4YHML 4MJIB 3QDMB 1T21B 4RCAA 4IDLA 2EE2A 1P84J 4P57B 1UXSA 4U31A 1WWAX 4LSPH 1I1YB 1HYRC 3IDJA 4K3EH 1PJ9A 3WKMH 1M4KA 2P5WD 4U6VL 1FZOA 4OCWH 4KQ3L 4P5MA 3ZTJG 5JLZB 2CLRB 4HH9A 4EBQH 3MRLB 1NAML 4NWTH 4FS0A 1A22B 1AXSA 1J1PH 4P46B 3MGTA 2AEPH 3GMQB 1KIRA 5I1HH 2O5ZL 3D3VB 4WFHE 1JZ7A 1KTDA 3VDCA 5C1MB 2NY2D 3HRZA 1UB5A 2X1OA 1DVFD 4N0UE 3RKPA 1C8PA 5C09E 3RWDA 3ROOB 4CKVX 5IR1B 3U2SB 4P59L 3QT2A 5DMGC 3NIGE 4OCMC 5J0BA 2ZUQB 3V0WH 4LLWB 2RAMA 5GSRA 1N8ZA 1KFAL 5GISL 4M1DH 5ACZA 1AD0A 2IFGA 4CMMB 4HWBA 2B0SL 4L4TA 3ZHDA 2ZZUT 5E9DB 4C56B 4OF8A 4ONFH 5DEFB 4ORGB 4NQXA 1ROWA 5C9JB 1HOCB 1T89C 5EWIH 1IAMA 4HS6B 3L3OA 2Q8AL 4NQUA 3OGOE 2VJXA 5HYSG 1JGDB 4OZ4B 3QCVH 1P53A 4PBXA 2HP4A 5LBSL 2ADFL 2XWTB 3BYYA 4K94C 4PD4K 5GGVH 2E7MA 3E2HB 4JFED 3MNVA 2F8VA 4JFDB 2FX8L 3P11H 4UV7H 3LN5B 4B7IA 4ZMAT 4G6MH 5DUMH 1HCVA 4OZGF 4XP5H 4YHZH 1I9IH 3EHBC 3MRQA 5MP6H 2XKNA 3K80A 3QUYB 4LVNC 2IG2H 3QDGB 4ELMA 4BK4A 3MGAA 5KJRL 1TJGH 5F9DC 3U0TA 4NQSB 1W8NA 5DHYB 4NWUH 2E9IA 3EFFA 4F7CA 3S88L 1GHFL 4P5KA 1S3KH 3P0VL 1JUFB 4CADB 2R1XB 3QJFB 3PWUB 3WYRA 3W9EB 2WV3A 4I77L 3VD4A 1U3JA 2DTMH 1M05B 2BY3A 2LV4A 5F6IC 3TO2A 3P77B 1Y0LA 5AG9A 2QKIB 2NR6C 5F6HI 4PJCA 4PJ5E 3KXFA 3EDEA 1GIGL 3VRLE 1H5BC 1FAIL 2P5EB 4W68A 2W9EH 4JR9H 2XIDA 4Y7MA 2NXYC 4APQB 5DK2B 2J6EL 4MCYB 1HHJB 3CFDA 3SGKA 4MJIA 3QDMA 2APWA 2A6IB 1T21A 1IGTA 4PRPE 1MY7A 1LK3L 3MV11 5J3HD 3GSUB 1AKJA 1NSNH 4P57A 3STLB 4AIZB 4EUPB 5ABDE 4MXWL 1I1YA 4OCSH 5FXCH 1BQUA 4NN7C 4O2CB 3UBXI 1ZGLM 4GRWB 2WZPD 1BFVH 2R2HB 2FATL 1MFBL 5JLZA 2OR8A 3HI5L 2Y36L 4DN4L 1A6AB 2WBKA 2WW8A 1KEGL 3IKCB 4UBDC 3FAWA 4U1GB 3STZB 3HG1D 4OZHA 5DJ0B 5GGRY 1ZK9A 4P46A 3BZ4B 3GMQA 1N4XH 5DS8B 2RBLA 3D3VA 5CUSL 4RMVA 1X5XA 3EYUL 2IJ0C 1FLRL 5BOZG 4PLOB 1A7NH 1XIWB 4FFWD 4H0IA 4LL9A 4BQBA 5BOPA 3ROOA 5IR1A 1JYVA 2OJEB 1S9KC 3TFKC 3QWRD 3MV9D 4LCWE 4LLWA 5J6HB 5I16B 4KJPD 1KCUH 4L8SB 3OB0H 3TC9A 5GJSH 3VFRB 3GBMH 3H0TB 4CMMA 1WEJH 4NCC2 3OXRB 3VI3E 3ZHKA 5E9DA 4M3KB 5TE7H 4C56A 4PRDB 5DEFA 4ORGA 1LE5B 5F7DB 5D7LB 2ZCHH 2BP3A 3RTQB 5C9JA 1HOCA 3TH3T 5C0GB 1R24B 5KBNC 3QO1B 4XPGH 4Y4HD 2F54B 4HS6A 1BJ1J 3TT1L 1PAMA 3QUXC 1A6VL 1A4KB 4Z7NE 1JGDA 3HC0B 2P24B 4GQ9H 1WLHA 4TSBL 2KQNA 2XWTA 4WO4C 2BDNH 3AY4A 1E4KA 3VH8A 1N5YH 4Z7VA 4JFDA 2AJSH 3LN5A 2ARJQ 4XAWH 2R39A 4WCYL 1L0XA 4LSTH 4JDVB 5F1IA 5EIVA 5CS7A 3GMMB 1BMGA 2VR4A 1RPQA 5L2KB 3VW3H 3QUYA 3UC0H 3TCXA 5IEKB 2OZ4H 1UT9A 3LKPB 4WV1B 4XB8A 1GZPB 3LKRB 1WAAE 3BPOB 4PREB 1ED3B 3OJVC 5IB3B 4NQSA 4C57C 5AYUH 1OB1B 5CIPB 5DHYA 2FX7L 5LGHH 5C07B 1EFXB 4XNQB 1X7QB 1JUFA 2C4FT 5IKCB 4CADA 2R1XA 4LSQH 3QJFA 3PWUA 4KFZC 3WFEL 3W9EA 4P3DB 3ECBA 4KY1L 3B43A 1M05A 3P77A 4F9LC 4DGIL 2QKIA 1HK6A 3MCKB 3TCLA 3DYOA 4OUUB 3SGDI 2VKWA 2D4DA 5JHDE 4WHTB 1BM3H 2P5EA 1VACB 3KLDA 4MYWB 4LP4A 5EZIL 5AAWA 4Z8FH 4APQA 5DK2A 3EJYD 1HHJA 2NY0C 2AI0L 4OLVH 2A6IA 1DN2A 1TZIB 3GSUA 4HT1H 5ILTL 3STLA 1MNUL 4I0CC 4AIZA 4EUPA 5D1XB 5BRZB 5E2WH 1JPTL 3DVGB 4O2CA 5JIIA 3MJGX 5LVEA 4YEFA 4HZLA 3VFMA 4LPCA 2A9ML 1MCOH 3H3PL 2H2SC 1BD2E 2ED7A 1A6AA 4NHCL 3RX5A 1JTPA 3IKCA 5HHQB 4TUOB 4OV6F 4IOIB 5DJ0A 4OZIE 3BZ4A 2APFA 1NCDL 5DS8A 1IGFH 3MV7E 4R3SB 3KLHC 1E6OL 2PTUA 1KJMB 3IF1B 5KSAD 5J7CC 4KHXH 1XIWA 2F74A 3IVKB 3VMOA 4NRYB 5L6YL 1AR1C 1FFNA 3RZCD 2OJEA 3V0VA 1H3VA 2Y5TB 4XP6L 2WBJB 4HFWB 4WJ5B 4XMKH 1ZS8B 5J6HA 5I16A 1TIUA 5HGGS 3UP1A 3VFRA 3QNYA 2EDYA 3H0TA 1NGYB 4OBRA 1EERB 3BKMH 3OXRA 5EORH 43CAB 1J1OH 3TZVD 4JQVA 3CH8A 4PRDA 4RGOL 2YPLE 1LE5A 3HNVH 1D3CA 5F7DA 4IDJL 3DSFL 3KJ4C 2VH5H 3KPMA 5A2LH 3RTQA 5T1KB 5C0GA 3FT2B 1R24A 4RGND 1M7XA 3QO1A 2F54A 5GZNC 2QQKH 4AG4H 1I3VA 1MJUH 2ITCA 1A4KA 1J8HA 4KTEH 3HC0A 2P24A 4Y4FB 1RJYB 1F58H 1VFBB 3T3PF 3CX2A 4XI5C 1CD8A 5FEBA 1DLHB 4ORZC 1H3UA 1M6OB 3LV3B 5JA8B 3UTPE 5EZLA 1EAJA 4JDVA 1FAKT 3GMMA 3QEHB 5JQHC 5HPOA 1Q38A 4N0YH 5L2KA 3C6LD 4NJAL 1JPST 5GS0L 2DM7A 1JMZA 3EAKA 4LFHG 4F3FB 4Z78B 4JHAH 5IEKA 1EDQA 4S1SH 3LKPA 4WV1A 1GZPA 3H42H 4YPJA 3LKRA 5T33H 4PREA 3L3KB 4YR6B 5IB3A 1C1EH 2B4CL 3I50H 4X4MA 1OB1A 5CIPA 5LCVH 5EU6E 3VXSD 2D4FA 5DTFB 2B5IB 5C07A 1EFXA 5L88L 5DMIH 2Z31B 4XNQA 1X7QA 2FBJL 4NN5C 2E7LC 3LB6C 4KJQC 1Y6MR 3F7VB 4LSRH 1EEZB 3QDJE 5IKCA 1V7ML 3SGJA 5TQ2L 3CNKA 4P3DA 5I1GL 2OI9B 1CG9B 1IM9D 4X4ZA 5JOFB 3MCKA 5HHXL 2CK2A 2FGZA 4OUUA 5IESL 5C3LD 2O5XH 4P9HC 3GDBA 2ZKHL 3S37H 4WHTA 5H2BB 2YN3A 1VACA 1LVEA 4MNQE 1FSKC 2NY1C 1M71B 5CCKH 2BC4B 5K59E 4X9BA 4NYLB 1R5IB 5D7IF 3V52L 4LRIA 4G7VH 3WD5L 2XRAH 3BX7C 4CMHC 2GT9A 1TZIA 5DRXB 3HNSH 4I0KA 2I60H 5BVPL 4XCFH 3SOBH 4X6CB 5D1XA 1S7WB 5BRZA 3DVGA 2VLME 2FBOJ 3S35H 3G9VA 3D18B 1PVHA 4WHDA 1TQBC 5IHUH 2VC2H 4LIQH 5FCUH 1K4CB 1X4XA 4FQ1H 4OJFL 4H0GA 1OHQA 4Q6IB 2QQLL 5HHQA 4TUOA 2J8UB 3MLRH 4IOIA 3RQ3A 1ADQL 4NZJA 1JWMB 4G42B 4KZDL 4R3SA 2MTPA 2JELL 1AXTH 1W8OA 1II4E 3IF1A 1FE8L 5DJDB 5IJKA 3GZKA 3RVTC 4EN3B 4NRYA 5I8KL 2W9DL 4KGLA 1DSFL 4W4OA 2Y5TA 5FUOH 4PJ9D 1FYTB 5C3TA 4WJ5A 3F62A 2DWDB 1U93B 3J8F7 4C83A 4MLIA 3AS3A 4TVSa 3WDHA 4N0CC 1HYSD 1JHLH 1NGYA 2XZZA 3UYOD 5DVMA 3Q0HA 43CAA 3MRMB 5EUOF 3T1WA 1KENL 3CMOL 5K9JH 4XMPL 5AWNH 3N9GL 2X4NB 4LQFL 3BKJL 4CNIB 1FYHB 5T1KA 2HFFB 3FT2A 4XAKD 3MV8B 4OCRH 2XY2A 2WUBL 3BGAA 1CXIA 4Y5XC 2BZDA 4Y4FA 4XTRD 1RJYA 2D03H 5A1AA 4AM0B 3Q48A 2A73B 1VFBA 4Y19E 3U79A 4K2UH 1DLHA 1M6OA 3LV3A 5CP3A 1UM5H 3G5VA 2X4TB 1XGYH 4NFDA 3QEHA 3X3GH 5DD6A 4PRBB 1U3HB 2PYEE 5F7FA 3T3ME 3SBWC 1I8MB 2VDPL 4F3FA 4TNVK 5CILH 4UT6L 3L3KA 1OTUC 1KN4L 1IAIL 1NEUA 1DUZA 1UWEL 3U7WH 1ES0B 1W72H 2BXZA 1XCQB 2Z31A 2PNDA 3D2UB 35C8H 3H9SE 4NQCB 4XNZB 4YZFF 1EHLL 3F7VA 1EEZA 3BEWB 3BMVA 3MLTA 1TXKA 1NKRA 4K7FB 3RAJH 1CG9A 1S5IL 5JOFA 3SCMC 1KB5L 1U58B 3TBVA 4FZ8H 4X7CC 1A6UL 1IFHL 1MCSA 3BHBB 1CDCA 4OKVB 5H2BA 3BSZH 1GGIL 3T1FB 4I3RH 4PG2C 1M71A 1TTGA 2BC4A 4PB9L 2G75A 2BOCB 4OFKA 4NYLA 5JOEA 1R5IA 4PUBH 2HVKB 4DJMA 4LPTA 3PQYA 4K9EL 4Z7UB 3CLEL 1GGCH 1PKQB 4HQQH 1A7RL 5DRXA 2OJZH 4QXWA 4ZD3L 5BV7L 4X6CA 4M93B 3WFDH 1IAKB 3ARBC 5F7NC 4AL8L 4ZSOE 1UH3A 4RMSA 3D18A 4K3DL 1XCTB 1IAOB 3GEWB 4LSSL 3S36X 5E5UB 1Z9SA 1K4CA 1E27B 1UWXK 1WISA 4FQHB 2F53D 2NY5L 2DQGL 1PZ5B 5AEAA 5J8OA 5MENB 1JWMA 4G42A 3T0EB 1B4JH 2EKSB 2MQ0A 1Y6KR 3DROB 3GKWH 5EOCH 3UTSB 1U6AH 4LVOB 3TGXA 5IBUB 3QUKA 4I9WE 3RWHB 4P3CH 4EN3A 3FB5B 4ZOEA 5FGRA 5J3HC 4EJ1C 5HGAB 4J3SA 3SJVE 3HLAB 2GITB 3SE9L 4BSVB 1FYTA 3BPCA 1U93A 3EO9L 5FM5M 1VFOA 4JG1H 2VXTH 4XP9H 4NOBA 5GJTH 3MRMA 3GSNL 4KI5D 2FZ3B 1A3LH 5I0DA 2X4NA 3K8KA 5C08D 3K7UA 4H1LH 1MWAB 4RAHA 4CN4A 2HKFL 2FWOB 2IANE 2HFFA 3MV8A 1G0DA 4L4JA 1YY9D 4LU5L 1PD6A 2PO6B 5BJTB 3U82B 4FFWC 4MQTB 1AQKL 1SVZA 5EBLB 4QOKE 2BSED 4JFYB 3C5JB 4WEBH 2UUDH 1HHHB 2RCSH 4G8GE 3VXME 3IRPX 4KJPC 2R0KH 1SM3L 4OM0L 5JW4N 2ID5A 4QRPE 3P0YL 4OLZL 3G9AB 4GAJH 2X4TA 1FP5A 3MBXL 5CBEB 5FO7B 4HUWB 4RZCB 5HYIA 2NY6B 4OD1H 4PRBA 4ZUVB 1LO5B 1U3HA 1DDHB 4D0CB 1I8MA 4HWNA 1IC5H 3QCTL 3RGHA 2IQAB 4G9FD 4KZEL 3OL2A 1CGSH 4Y4HC 1MRFH 5KS9F 2V2WB 1ES0A 2IF7A 2DRUA 4WFGD 1XCQA 3LIZH 5JDJA 3D2UA 3T2NH 4AENB 3JBG7 4NQCA 2VZVA 3WIIH 3BEWA 4Z7QE 1HQRB 1KC5L 3C60B 5CEXB 4K7FA 1EBPA 1JNLL 4BSJA 4U3HA 3VXQB 2EKJA 5C9KA 1U58A 2B1AH 3QIBB 4L4VD 3NH7L 3BHBA 4OKVA 2DJ4A 3T1FA 4FXGB 4UT7H 1KJVB 3PWPB 4HWEH 2BOCA 5KSBE 4LLQB 1RZFL 2CKBH 1OSZB 4MQ7B 4LEOB 5FYLE 1PKQA 5DC0A 1KB5A 3RWIA 2HFEB 1QBML 4L8CB 4RAVB 1IAKA 3S35X 1WSST 2E8YA 3F7QA 5HDQH 1XCTA 1IAOA 4JQXC 4BH8B 5F7UA 4YDVB 5ALCL 5JQ6L 1E27A 1T03H 3BI9X 5CGYD 4FQHA 1VEMA 2D9QB 4DCQB 4J2XA 2FX9L 5MENA 1PZ5A 3FZUC 2CLVA 2HLAB 1QR1B 1ZOXA 4FQIL 3T0EA 5IBLC 1R6VA 3DROA 2FYYA 3EJYC 3UTSA 1AD9B 4I5BB 4K71C 4P5TD 4XX1E 3RWHA 5BMFH 3QEQE 2LVCA 3WN5C 1N7MH 3T04D 1EJOL 2GITA 3CFJB 3HLAA 5DF0A 4BSVA 2QADB 2AK1H 4TN9A 3RRQA 1NDGB 3PP4H 1AGCB 4OCYL 1P6AB 3BKCL 2FZ3A 1FNEB 3TVMD 1BQSA 4XCCL 2RR3A 4J6RL 1MWAA 1N64H 5ICYB 1DZBA 3H6JA 2FWOA 3FO0L 3I3BA 2FD6L 5HDOA 2NXZB 2ADJB 2PO6A 5BJTA 1YEKL 4KAQH 2EDJA 5E8EB 1CE1L 4XNXL 3BZDA 5HI3D 3IFPB 4IRZH 2DQCL 3C5JA 2X4UB 1OGTB 1HHHA 4AEIH 2KUTA 3FFCB 3UJJL 3DUUA 4KI1A 2Y25A 5JIHA 1SYVB 2P43B 3QNZB 1UACH 1CFVL 5CBEA 3ARWA 5FO7A 4HUWA 3SE8H 2D0FA 1B9ZA 1VDGA 1LO5A 5SWZE 1DDHA 4D0CA 4MA1C 5M7QA 2OM5A 1G7JB 1S5HB 4FFYH 3RVVD 3EZ8A 1K6QH 5EBWB 5T1LD 2IQAA 4NBYB 2VDLL 2YC1A 4WFHD 4ERSH 3DUHA 2LVEA 1NCUA 2JJSA 3E8UL 3LZFH 4G6AD 3I75A 4O51B 1A7QL 4AENA 4X8XA 3D85D 3D87B 1HH6B 4WENB 3UJTH 1A64A 1HQRA 3IJSB 4DKFH 1FH5L 4UAOB 3C60A 1K4DB 4I1NB 1F6FB 2Q3ZA 4HC1L 2XTJB 1T7XA 4KUZH 4HBCL 3T2PA 1MI5A 2AJZB 4RMRA 3VXQA 3QIBA 3FO2B 1OM3L 4YXLH 4BJLA 4G6FD 1CLOH 4IIQC 3C6LC 4FXGA 2GTWB 4DKEH 1L0QA 1KJVA 3PWPA 4N68A 1CGTA 2LE9A 4NUGL 2ZUXA 4LLQA 4HUUB 4WHYH 4CJ1A 1OSZA 3WE6B 3UYPA 1DQTA 2XN9B 3UZVB 2HFEA 4JO3H 3Q6FA 4L8CA 1LO2H 3KWWB 2R29L 5GRZA 3ZHLA 4I0PD 1DFBL 3V6OC 3ALPA 3JV6B 4GKNB 4I13B 1U8JB 1T0NA 1WBXB 4YDVA 4OIIL 1BZ7B 1MCEA 3KGRA 3UTTE 1NGPH 4OZFB 1F3DH 3QIUC 4NCDA 4XWGL 4DCQA 3VJ6A 3F6IA 2Z35B 2HLAA 3V4VL 1QR1A 4A6YL 4KRLB 2EDEA 3ESUF 2XZCH 2QL1A 1MCCA 5F7LB 2BOBB 4XVSL 1FVDB 1AD9A 4I5BA 5MI0B 3D6GA 1L0YA 2GI7A 4DQOH 1S7TB 5D7JD 2BRRL 4WTZA 4AK1A 2VDMH 1L7TL 5FYJL 1OP3H 1PEZA 4PJEB 5GRVK 2AJXL 4PV9B 5E2JA 4GLRI 3SKUD 5L9DH 1JGVL 3CJJA 1NDGA 1FBIH 1A7PH 1AGCA 4NZRL 1NFDB 1UWGH 1B90A 4KDWA 1I85A 5EUKB 2AK4E 1FNEA 3EGSB 2IBZX 3BZFB 3KYAA 5ICYA 4HGKC 1KXVC 3R0NA 4YFDB 1EVTC 5BCAA 1CBVL 2ADJA 1I1AC 3EUUA 2XZQH 3LEVH 5CINL 3IFPA 3GK8H 5HGDB 4PRPD 5FM8A 3VWKD 3I9GH 1T7YA 4PJ9C 3GHBL 3FFCA 5EIQA 5JW5B 3L3JB 4DW2L 5I8OH 3WNLA 1MEXH 1SYVA 3QNZA 3HMWL 4P9MH 3WUWB 4UILH 1OP5K 5DJ8B 1NFIB 3HI1B 4GAGL 1EZVY 2I26N 3V6FA 4XC3L 3N1GC 5JXED 2PW2B 1I7TB 5D96C 5F3BB 3HNTH 4K3JL 1G7JA 1S5HA 5EBWA 3AM8C 4LLDB 3CFEB 5D93C 5DWUL 1JE6A 4O51A 3CFKA 4XTRC 3RGVD 1TZHB 1NGQH 4PGBB 3PL6C 1HH6A 1ERNA 1VHPA 1GSMA 5GRJH 2CUMA 1ONQA 1K4DA 4LCWD 5EH1A 4OCXH 3A6OA 1MLBB 4JFPA 3O4OC 2AJZA 5F6HJ 2GJZB 4X7SH 2P8LB 3DO3A 4I18B 4N9OB 3ILPB 1FN4B 3TBYB 3CVHL 2QQQA 3PDDA 5LXGL 2ED9A 4LVHB 2GTWA 2YD8A 5DVKA 1TETL 5F7MC 3BPLC 2PETA 5GGSB 4ODTH 5I74B 5I73C 4HUUA 4G43B 3HS0B 3ZE0E 2LU4A 3V6ZB 1MCHA 3WE6A 2XN9A 4OV5B 1NL0H 5FO8B 3HB3D 1UB6B 1AHWC 2F8OA 1ORQA 3Q5TA 5CJXA 4EI5D 3KWWA 4Q9QL 5K9OB 3P4OB 3JV6A 4GKNA 3ZDZE 1U8JA 4HIXH 1WBXA 1QBBA 3LKOB 5SV4A 3P4NB 1JCKA 5I76B 5HD8D 2AS5M 4FABL 3U0WH 1ZLSL 4MD4B 3SE4C 4KI5F 4Y88A 4IS6B 2E6QA 4MAYD 1OSPL 5DR5L 2BOBA 4HCRL 1FVDA 4OF6A 1S7TA 5IF0B 4NZUH 4Y16B 2X2YA 2Z8SA 3KXFE 5HYSB 4YHYB 4PJEA 3UBXG 4K3GA 3V4UL 1F4WH 1CDYA 3IXAB 4ZS6D 4HJ0D 2V5YA 1NCNA 1NFDA 5JXAL 2X10A 4P2OB 5EUKA 1FNSL 4D0DB 4HXAL 4X6EB 1KJ2B 2HTKD 2QJDA 3MXVL 4R2GD 5JHDD 1KT2B 3CXHK 1EEYB 1AGFB 5IROA 4NO2B 4RX4A 5A2FA 4FQXA 1H3GA 1X5ZA 4RFNC 3K4ZA 3NFNB 5HGDA 1MRCL 2EDNA 1INEH 4OZHE 5ICZB 3WFCH 1I9RH 2EZ0D 1IQDB 2VZ1A 3S36L 5LG1A 3WUWA 4PJXB 1KB9K 1T0PB 3AS0A 1YDPA 5DJ8A 1GC1H 1NFIA 2X9YA 3HI1A 3U0PB 1BD2D 1N6UA 1G6VK 2WLZA 4E9LA 3N1QC 2B1HH 3RVXD 1I7TA 2HFTA 3PWLB 4X9FA 5F3BA 4ZUUB 1DUYB 3CH1B 3MV7D 3CFEA 5E2TL 1ZLVH 3H3KA 3NN8B 5IHBA 1FV1B 1IGJB 2MCPH 5E9DE 5B39G 1EJ6A 1TZHA 4KTYA 4C56E 3VFGL 2H32B 3BFOA 5JHLH 4MXQD 2MQCA 4DEPC 2DQJL 4OFDA 4MB4A 2NY4D 1MLBA 1G0YR 2EYSB 1Q1JL 4O4YH 1R3JB 3DTXA 2GJZA 5IMOB 2P8LA 5JR1L 5ISZE 4I18A 3ILPA 1G7HB 2YXMA 2HT3D 3NVQA 1FN4A 1MCKA 2AJYH 3R1GL 4Z7VE 4TULH 2YPLD 5GGSA 4D0BB 5LAXB 4WU5B 3PXJA 1T66C 4KKCD 4MD5B 4G43A 4NC2B 2X1PA 4P4KD 3HS0A 5JDSB 3V6ZA 3FFDB 4HEPG 5DQDL 4OV5A 1OAZL 4W6YB 5C0DB 5FO8A 3W5NA 1WZ1H 1UB6A 4XPBL 2APVA 4XH2B 5K9OA 3P4OA 4WRLA 4HUVB 3LKOA 4M03A 4S1QL 4JCMA 3L6FB 3P4NA 1XGTB 3UTPD 1AH1A 5I76A 3CVIL 1RIVL 1QLRA 4GW1B 4LGSB 3U9UA 4GT7A 4J23A 3FOMB 2OMNA 4JB9H 5GS1B 5FDYA 4IS6A 4RSVA 4PP2B 3SO3B 1MJ7L 2VR9A 3KLSA 4H20L 5HI5D 5C8JB 1YUHA 3TN0B 1T1WB 4S2SB 5EU6D 5HYSA 4K8RH 4KRMB 3CK0L 3G5YB 1EHXA 1HKLH 3QDJD 1F13A 3IXAA 1U3YA 2DJUA 3DIFB 3HZMB 4OB5L 5D70H 1FC1A 4D0DA 4X6EA 4XPFH 4N5ED 1YMMB 3WS6A 2IQ9H 4U2ZA 2NX5B 4MNQD 1CU4H 1EEYA 4GRWE 3LKNB 4HPYL 1AGFA 3JVGA 4NO2A 2EIDA 4P48A 4P5TC 2HKHL 3NFNA 2IMMA 3UTZB 4KKNA 5GGTL 3BWUC 3TJEL 4K55A 1UJ3B 2X4SB 5EB9A 3WLWD 3ES6B 1MCJA 1SEBB 4LDOB 1IQDA 4U1NB 1E28B 1A14L 4PJXA 3WXWL 2VLMD 1FVEB 3OWEA 2F5BL 1QTYT 4NRXB 3EYQD 1WFNA 1D5IH 3HI6L 3S7GA 5GGUB 3TVMC 4Y5VB 2AEWA 2DL9A 3WL9A 2HN7B 1NGWB 2OL3L 3HE6D 2N1KA 3PWLA 4XPAL 1CR9H 4UB0H 3D9AH 5GRVL 2DBLL 1A5FL 1DUYA 3CH1A 4FQCL 3RX8A 3LQAL 15C8L 4OI8A 1G9MH 4DUVA 3NN8A 1FV1A 1IGJA 3TWCH 5EU5B 4P99A 1U8IB 4P2RB 5HI3C 3D25B 2H32A 5I1AB 5J12C 1OAYL 3EW3B 5E5RB 1RK0B 4WI5A 3PWVB 3OAZH 5DURD 2EYSA 1R3JA 1B6DA 2F54E 2EEDA 1LNUB 5IMOA 2V5MA 1J8HE 4MA7L 1G7HA 1TPXB 5TF0A 4LCUB 1I1RA 1QRNB 1U8PA 4M6NH 4YIQB 5ADPL 1NGXB 3MJ7B 3TT3H 4D0BA 3ARVA 5LAXA 5L7XH 4WU5A 3RVVC 4TSCL 5DJ2B 4MD5A 3D5OF 1JRHI 2EXYC 5KW9L 5JDSA 2HYMA 2ILLA 3FFDA 4YK4B 3MGOB 1CQKA 5C0DA 4JM4H 4G6AC 4U2YA 5L2KE 4JANB 4R26H 4S1RL 1AO7B 2VR5A 5ADOH 4Y19D 1J86A 1Q72H 3GRWA 1EUTA 4HUVA 3RA7L 5GGRB 3TH4T 1FIGH 3L6FA 4NNPL 4ZPTB 4X4ME 3G5ZB 3V8OA 4GW1A 1GGYA 5C07E 1A7OH 5DUPL 3FOMA 4YX2H 1IZKA 5GS1A 4RMQA 5I75C 1CFSB 2PYED 4OQ1A 4PJAB 4PP2A 2VLJD 3ZE2E 3VRLF 5C8JA 1JRHH 3TN0A 1LEKA 1T1WA 2VDKL 3GI8L 5E2UH 1CT8B 1S9YB 3OJMB 4WEUD 5DJZB 2R9HD 3MLWL 1T1YB 3S9DB 5GHWL 1IGIL 1JPFA 5GIRB 3G5YA 3H9SD 3F58L 1TJHL 1ITBB 4I0PC 1YY8B 3UPAA 3TEUA 2APXA 2AQ2A 2VXQL 3X3FL 4PTTB 4NBXB 3VFWB 3AS2A 3HTLX 3PDGA 3DIFA 4PJGB 1U8HA 4YHLH 3QZWG 3DRQB 4HD9A 3GSOB 1I8LA 2XQBH 1B0GB 1MFCL 5IQ7L 1BLNB 3ZTNH 2NX5A 1GGBL 5T5FH 2X09A 1AJ7L 5MEQB 3BN9D 3LKNA 3MLSH 5FUZH 1QYGL 3B6SB 1U36A 3O6LL 2CXKA 3UTZA 4H0HB 4HF5L 2VZ3A 1UJ3A 2X4SA 3REWB 1GH7A 3KPQB 2PR4H 2VISA 4D9QE 1ZLWK 4Q2ZB 2CK0L 4U1NA 1E28A 3B5TA 2VDNH 1FVEA 1M7DB 1SJXA 2OK0H 5CJQH 4KMTH 2FB4L 3MOBL 4JZOB 2JIXB 4I4WA 4LOUC 3R4DA 4NT6B 3SEPA 1BQHB 1J1XL 1IEAB 3DJ9A 1RU9L 3HMXH 3LH2L 4OF7A 4Y5VA 4QXUH 1U92B 2HN7A 5GGTA 1NGWA 3CAFA 4LVNB 1MJ8H 2YRLA 2FIKB 1UXWB 3K81A 2VXVL 5AYQA 1M7IB 3N1FC 3U1SH 4YBQD 2EDBA 3TO4D 1MIEL 3QAZC 25C8L 2CIIB 2NY3D 1MWAH 5EU5A 2BHZA 1U8IA 4P2RA 4ENED 1ZHBB 4I9WD 2VLLA 2NZIA 3D25A 1ZLUH 4G6JH 4NZTL 5I1AA 3OAYH 1J8KA 3VWKC 4Z7NF 2EO9A 3SJVD 1OCWL 2XWBB 2CUHA 1RK0A 1QSFB 5KVEL 3LEYH 1IGCH 1FORH 3PWVA 1VA9A 1ZHNB 5F6IB 2R0WH 1LNUA 1CK0L 2MWCA 1DP0A 1EA9C 3MOAH 4LCUA 1QRNA 4XNMB 3NACL 1H5BB 3VGAC 2AV1B 3RWCA 3FQNB 1YPZB 3D0VB 3ZT6A 7FABL 1NGXA 3B2VH 5ICXB 3L9RB 4V1DB 3MJ7A 3S3JA 1MHPH 5EOCJ 5ESQB 5DJ2A 4IRSD 2NXYB 4CN1A 2IAND 1UM4H 3MGOA 4XCEB 1C7TA 5T1MB 1DN0B 1OQOA 1A6WL 1HINL 1WVZA 1WAAF 1V3JA 5HYJE 1RZJL 3K8MA 2AJUH 3RDTD 1MFDH 4QOKD 1NLDL 2YZ1A 3T2QA 2I24N 3LKSB 1F4HA 3PP3K 5GGRA 4ONHA 1BBJB 4NN7B 4G8GD 3VXMD 4ZPTA 3G5ZA 4QRPD 5M95B 2YEZB 4OZGB 4YXHH 5T1DL 3L95B 1T20B 1CFSA 4PGCB 1UZ6E 4Q9CA 4PJAA 1LO3L 3BKYH 3UJIH 3S4SG 3VFPA 5HHOB 1DBJH 5IFAL 3BT2H 1DBML 5H8DA 1S9YA 5DVNA 1XF4B 1KB9J 1T1YA 6FABH 3HB3C 1MRDL 1YYLH 5GIRA 2OX5A 3ILQD 4EI5C 4M5ZH 1YY8A 2IC2A 1UG9A 3TP4A 5LQBH 1Z9OA 4MB3A 1N0LA 3PQYE 4PTTA 3VFWA 1OAQH 3LRGA 3MLYL 3O2WL 4GO6B 5HD8C 5DLML 4PJGA 1UKQA 3LEXB 5IBTH 4H1LG 4UU9B 3DRQA 4X6CE 1JGUH 1B0GA 4M7JH 5BZWB 4N0RA 4J3OC 4MAYC 3VG9C 1HIML 4X5WB 4WY7H 3V5DB 3P73B 1KG0B 1T89A 4OZIF 3KPTA 5IVXA 1TTFA 1KJ3L 3IETB 3QUXB 4QRSB 5FYLD 1QR4A 3REWA 4WO4B 4GOSA 4ZO9A 2I07B 3KPQA 4X98B 1YEGL 4Q2ZA 2XQYK 1ZT1B 2W65B 3FN3A 4ZS6C 2Q7NA 1M7DA 5CJ8A 2YHGA 1LWRA 5E1AB 5FYKL 4JZOA 1ZGLB 2JIXA 2R2BB 4N5UA 1BQHA 1IEAA 4QHNB 1D6VH 1OT2A 2GTZB 1G6RH 2HTKC 2YZ8A 3CSBA 2VABB 4OM1L 4R2GC 2FIKA 1UXWA 1ZEAH 4JO2L 4QEGA 3H7LA 3L1OH 1M7IA 3BQUD 3DHMA 3QRGH 1D5XB 2HA1A 3T09A 2CIIA 3DVIA 1HKFA 3RKDD 1J0HA 1P4LB 1ZHBA 3QEQD 4HS3B 5JPNA 2E6PA 2XWBA 5JIKA 1CFQB 4KHTH 1QSFA 4ONOA 4XBGB 3I2CL 3MV8E 1JFQL 1ZHNA 4MCZB 4Q7DA 2FEDC 4FNLL 2HT2D 2YD3A 4LCIL 1F2QA 2WWMC 4XNMA 1H5BA 4XWOC 2AV1A 2BY0A 5BS0B 3FQNA 1YPZA 3D0VA 4LNVA 4F58H 3RVXC 5ICXA 1V7NH 1OW0C 3NCBB 5ESQA 1QEWB 3RUGE 3TA3C 3HRPA 5EA0H 4N0FB 4XCEA 2NY0B 5T1MA 1DN0A 2P47B 2DQDH 5CZVH 5E2VL 4PB0H 2RGSA 4P23D 3KPNB 4JO1L 4X80H 4YQXL 2IALB 4LGPB 4YEEA 4QF1A 4X5LA 4MXQC 4XBPB 3O6MH 3LKSA 1XR8B 5KANI 1BBJA 2K7PA 1HI6B 2KBGA 5JMRA 2NY4C 5FHBL 1UKTA 1ND0B 1KPUB 2YEZA 3WHXB 4U3CA 4OZGA 1J7VR 4B7LA 4EVNB 2HT3C 2EC9T 5DJXB 1DQDH 3MNWB 3L95A 1T20A 4PGCA 2W9LA 1K2DB 1H8NA 3O2DA 5SWZD 1DL7L 4H5SB 3KPOB 2MHAB 4GAYB 2ZCKL 1WJ3A 4KROC 5C2UB 3QQ4B 1HH9A 2ZNXA 2VUYA 5HHOA 4DFIA 4KXZI 3T0VA 5K59F 1C5BL 3B83A 4ESKA 4TUKH 5C0CB 4U05A 2AERT 4OIAA 1XF4A 1F90H 3N50A 1H3PL 4EOWH 4HFUL 5CJBA 1T3FB 1QPXA 1RK1B 2GW5A 1GC1C 5TF1H 2YKLL 3THML 4F7PB 3B9KC 5J13C 5J1TC 1YZZA 1NBZB 1PKQE 3WNKA 2R0LH 3LEXA 1OTSD 2VDQL 3VGDA 1MAKA 4UU9A 3HC3H 1DQML 4IMKC 4XPTL 4GBXC 5DD5L 3SKOB 5BZWA 4PTUB 3VA6A 4OLUH 4L1DA 4Z9KB 4G80B 4X5WA 3KJ4B 3VRJB 4OZFH 1RIHH 1VFUA 3P73A 5HI5C 1KG0A 3EOAB 3LS4L 3MUJA 4DVRL 4KXZH 3GJFH 3IETA 3QUXA 4QRSA 5E8NB 5TPWH 4HS8L 4Z76B 4WO4A 5D5ME 3CFCH 5HPMB 5MENE 2I07A 2W0FA 1YJDC 4X98A 5ITBH 3J7HA 4JHWH 5IT2L 3LAFA 4LPUA 1ZT1A 2W65A 4D9LL 5BZDB 2V9QA 2CQVA 3UTSE 5EULV 5E1AA 1ZGLA 2EH7L 2MCG1 4U0RC 3ZDYE 3UTTD 5C2BL 4QHNA 1A1NB 2GTZA 1P4BL 1T2XA 2DBJA 2VABA 4MQSB 3VFTB 4Y0GA 5KVDL 1VENA 4MXVE 3TLRA 5JW3L 3CLFL 1D5XA 3B5GA 2FSEB 1UQSB 1P4LA 1KIPB 4HS3A 5JTWA 1IT9L 4NN5B 3B9VA 1CFQA 5MHSE 4CN6A 2BNUA 4F9LA 4LCCA 4MCZA 1ACYH 1F3DJ 3EYQC 3RVWD 4OGYL 1NBYB 4ODHL 5CJ5A 2AK4D 3EFDH 5BS0A 3QQ9D 1Z5LA 1FSKB 2NY1B 3HE6C 3Q6GL 2R4RH 2H6PA 1LDPH 1QEWA 3OKDB 3T3MF 4JG0H 3QYCA 4ZFFB 2ORBH 4N0FA 1F3JB 1G9EA 4K8RC 4CMHB 4KJWD 4U1JB 3L7EA 3KPNA 1XH3B 2IALA 5KSVB 1P9MC 2XWJB 4XBPA 2AABL 1XR8A 3NAAH 1YN7B 1JZ5A 3BIAX 2PYFA 2V7HA 1JL8A 4Y5YC 1ZAGA 4PJ7F 1QFUL 4JKKA 1HI6A 1TQBB 3FN0L 1ND0A 1KPUA 4ZQKB 3BP7B 3WHXA 1AE6L 4LASL 4YDKH 4XNYL 4EVNA 5IM7B 5DJXA 3OPZL 4ZFOL 5IV2B 3MNWA 1S7RA 1SEQH 1YEIH 1UH2A 2XT1B 4Y2OA 1K2DA 3UO1H 4J1UB 4H5SA 3KPOA 2MHAA 4GAYA 1NCBL 3QQ4A 4HW6A 5HHVH 3L7FB 2XG4A 3MZTA 5GRUL 2E9BA 4R4BB 1MI5E 2A0LC 1T4KB 2MKLC 5DC9B 1F6AB 2CPCA 5C0CA 3IFNL 1RZIB 4G8IB 3KDMB 5HHMB 1BVZA 3TPUA 4WTWA 3PWPE 4JN1L 1T3FA 1RK1A 1MVUB 4XZUB 4N8CL 5DD1H 4P2CG 1TJIL 1CGWA 3ZT7A 1NBZA 3RWEB 3NABH 4HLJA 1P4IH 5GPRA 1G0XA 3SKOA 4PTUA 4H8WH 5HI4D 2BNQE 4G80A 1YMHB 3VRJA 3EOAA 5CFHA 4M7KL 1NGZB 4Y5XB 5E8NA 3MMEA 1KCRH 1G9NH 3UCRA 7CGTA 4Z76A 4OT1H 2FH8A 2R9HC 4JFOA 1IC4H 1INDL 3IXTB 5HPMA 3JUYA 5D2NE 4UINH 4GMTH 1GXEA 5D71H 3ZE1E 4LEXH 5BZDA 1T83C 3GJEB 2P42B 3O8XD 3SQOL 3OF6D 4PS4L 1AGBB 1CD0A 2DL2A 2VL5B 4YFEA 4LSPL 3SDXE 4U6HB 4HGMA 1A1NA 2PXYA 4ZNEA 1LHZA 3WKML 2HRLA 4U6VH 3VFTA 1EGJA 4KQ3H 1MH5A 1FNLA 3BN9C 3JZ7A 1KJ2H 3KHOA 3ARTA 1NAMH 2FSEA 4BQ8A 5I15H 5EU7E 3TBTB 5C71A 1KIPA 1XAUA 4AYFA 2BVUA 4C59B 3KXFD 2E7LA 5H35B 1K3ZA 4RGMC 4JFEB 3LS5L 1MUJB 2E27H 3AMKA 3WUZA 4P59H 5DFVD 5EUOB 1A0QH 3SCMB 3RI5F 1I9JL 1NBYA 3P4LA 3V6BR 1KFAH 1AKJD 2X1QA 2AEQL 4YFLI 3FFCE 4OFVA 3BJLA 2B0SH 3OKDA 3DBXB 1B0WA 4ZFFA 2VN7A 4YBQC 1F3JA 1XZ0B 3DHJA 4U1JA 5F72S 5KSVA 2EDWA 4RAUB 4AQ1B 2XWJA 5EWIL 1IZJA 3ARBB 1YN7A 5C0FB 2CRYA 4P46D 2RFXB 1QLEL 1WCQA 3LRSB 3GSRB 4Z7QF 4ZQKA 5BVJA 3BP7A 3BGFC 1FNFA 1SY6A 5F89B 3MPCA 5IM7A 5IV2A 3MRFB 3ULVH 4J1UA 4IJ3C 2HVJB 5I1IL 4HK0B 4JKPL 3L7FA 1ZT7B 4OTXL 2XTJE 4G6ML 4R4BA 3F7RA 1T4KA 1I9IL 1F6AA 5MP6L 3KPRB 5KSBF 4G8IA 5I8CB 2P8MB 3KDMA 3VD7A 1TJGL 5E9DD 4PYHA 2G2RB 4C56D 3O6FA 4U1HB 4N1CA 1MVUA 1FHGA 4NWUL 4XZUA 2V9RA 4DUXA 3S88H 2EXWD 2XN9E 4PP1D 3RWEA 3GMLB 4FMFA 4CVZB 5ISZD 4I77H 4X7DC 3GO1H 5FGCB 3HG1B 1YMHA 4GRLA 4WI9A 5IW3A 1AFVH 1HWHB 3IS0X 1SYSB 1PGRB 2IH1B 3A67L 1NGZA 3RP1A 4Q9RH 2UY6A 2DYPA 4LLUA 2QSTA 2GJJA 5GSVB 1R3IH 4PGDB 4R7DB 1PYWB 2W9EL 3IXTA 2J6EH 3S5LG 3GJEA 3Q2CA 3ZT5A 4AH2B 4CU8A 2VL5A 3DMMD 3L3GB 4MXWH 4BSWB 4U6HA 3VMNA 4PJEE 1EIBA 1VSCA 3SBWA 5F1OB 1BFVL 4BZ2H 1KCVL 4N1HB 2Y36H 1NJ9B 4OLYL 1FL5B 4QO1A 1KEGH 1EO7A 1N4XL 5FYJE 3EYUH 1F4XL 5H35A 1Q9OB 4JFEA 1JF1A 1JTTA 1MUJA 4OGAC 3EJZC 2ZPKL 4ODVH 5EUOA 3SCMA 3SKMB 3H9ZA 1A9EB 4XXCC 2PW1B 5B3NA 1BECA 1JGEB 5GJSL 4AJ0A 5D1QA 3Q5OA 2C3HA 2E7CA 1WEJL 3DBXA 3BQUC 4WI4A 4ODWB 1XZ0A 4TRPH 3K8LA 4WHCA 4E41A 1WT5C 1L6ZA 3RKDC 2YK1H 1DTUA 5C0RL 2ZCHL 4JRXB 4RAUA 4ZAKD 3UBXB 3TT1H 4JJ5B 3ARBA 2ZWLT 3PG2A 5C0FA 2FHFA 2RFXA 4GQ9L 3LRSA 3GSRA 3A6CH 2BDNL 3ZZ1A 1QSZA 1SBSH 4EZMA 5F89A 3FQWA 1XIWD 2HT2C 2AJSL 2UZYB 32C2B 4PRHE 4DZBB 3FMGH 3W0WE 5A43C 3KNBA 1FCCA 4XAWL 4FTVE 2HVJA 2WSKA 3CSYB 4HK0A 1F42A 4M6AA 2JKXA 1ZT7A 2NZ9C 1IGMH 2WIMA 4OGXH 5DD0H 2EH8H 5D7KE 3IDGB 4K71B 3VW3L 3KPRA 3KYMB 5CSBA 3UC0L 4QRUB 2BMKA 4G3YH 2VAAB 3WN5B 1QFWH 2P8MA 2X44D 2X40A 2G2RA 3FRPG 4U1HA 1KF9B 5IHZB 5EZJB 1IJ9A 5DRWB 5AYUL 5LGHL 3AU1B 2FLBT 2EDRA 3RTQD 3BRDA 4MJ2A 2H2PC 3RFZC 4YBLC 4NKIH 3GMLA 2F54D 4CVZA 4XVJH 4ZFZB 3GSQB 1QA9A 2I27N 1J8HD 2A77L 5IGXH 4DGIH 1RUPH 4YDJB 2HT4D 1R3LB 3HG1A 4LLMB 5T3XH 3QI9C 2UZXB 1SYSA 3PABB 3R0MA 2JJVA 2R4SL 5GSVA 3MQIA 4PGDA 4R7DA 1PYWA 4Z8FL 5B39B 4AIXA 4YHPA 3NTCL 2VN4A 5E6ZA 5J11C 3QWRA 1WZKA 5L2KD 1T1ZB 2F58H 4JQIH 2ERJC 4OLVL 4KKLD 4HT1L 5IMLB 4AH2A 3HHRB 3ULUL 3VXRB 1XGUB 2AV7B 4BSWA 3NOIA 1JPTH 5EPMB 1TDQA 3ARDC 4ONGH 1U8LB 5C07D 1UFUA 3PGFH 1EFXD 2OSLB 4MA1B 3MRDB 4M62H 5F1NB 4Q58C 4Z18A 4JO4H 4NHCH 1NJ9A 4ETQB 3ARZA 3DI2B 1FL5A 3OZ9H 5E8DL 3UXFA 4U1MB 4OLEA 4W81A 1Q9OA 3DV6B 3S3PA 4BFBD 1F11B 2A38A 1R5VB 4GSDL 4BA8A 4X0KB 5L6YH 4ZUSB 3WNNA 4XP6H 3SKMA 2HJFB 1BVLB 2WP3T 3IB4A 4XMKL 2PW1A 1JGEA 4OQTH 4OLWH 4IIQB 3C6LB 1AI1H 1J1OL 3HPLB 2DM2A 4ODWA 5SX4H 1CDIA 3ARGD 3VXSB 4IDJH 3DSFH 4JRXA 4Z6AT 3UBXA 4JJ5A 4HJGB 1NMCC 2QQKL 1R5WB 5AD0B 2EEBA 5CHNB 4BZ1H 4JQXA 3MRCB 1C16B 1IM9B 3VXTB 1F58L 3QG6B 3NCEB 1BHGA 2IBBA 3RVWC 32C2A 3O11B 3KPPB 3QIUB 3G6DL 5E4IA 1KSRA 3QQ9C 4CBPA 3C08L 2V17L 3CSYA 3U6RB 5CP7B 3MJ8A 2XNAB 3AGVA 2FEEL 2H26A 1OAUL 2ZP0T 4NJAH 3IDGA 2Z8VC 5I1JH 3KYMA 2A9NH 4QRUA 2VAAA 4JHAL 4S1SL 3H42L 4QT5B 3ZE0F 5T33L 5IHZA 5EZJA 1C1EL 5DRWA 5LCVL 3AU1A 2R8SH 1FPTL 1G7MB 1QKZL 5DMIL 5DHVB 1G1YA 1RZ8B 4L1HA 3ZDZF 1OD7A 1PG7H 3E6FB 3MRKA 1V7MH 4ZFZA 3GSQA 4BQ6A 5I1GH 3ARPA 3B3IB 3U4AA 5J6GB 4NPYB 2OZ4A 5IG7B 4YDJA 3PGDB 3V9FA 1R3LA 4LLMA 3EDJA 5GS3A 2BFVL 3BVNB 2O5XL 5KAQF 3IDXL 3S37L 1I1AB 2ICWI 2OQJB 2GJ6E 4KKBC 4LCYB 5CCKL 4IM8A 5B39A 3GSVB 5HYJD 2DWEB 5F9AC 4GKZB 1RZGB 4PJ9B 1T1ZA 3WD5H 5IEHA 2XRAL 1I1CA 1QD0A 4Y1AA 5IMLA 3IU3B 4L3CA 3VXRA 1XGUA 2AV7A 2F19H 3HZVB 3SOBL 2NNAA 2P46B 5EPMA 1MFEL 4MAUH 3PWJA 1U8LA 5IWLA 1WZLA 3O6KH 3MRDA 1P5VA 1FCGA 5F1NA 5D96B 5HI4C 4D9RE 4L29B 4LIQL 5FCUL 1IQWH 2HTLD 5GS0D 2XKUA 4ETQA 2QQLH 4OI9A 4JDTH 5D93B 1ADQH 3MLRL 1MFNA 4U1MA 3BESR 4KZDH 1A8JH 2JELH 5M94B 5CEZL 1WIPA 3DV6A 3PL6B 2WM0A 1F11A 2NX5E 1R5VA 4X4YB 1MLCB 1T7VA 3ULSB 4I48B 1LO0H 1QO3B 4ZUSA 3O8XC 4N8VG 4OZHF 2W9DH 3O4OB 4PJBE 2A6DB 1DSFH 5D1ZC 4YDIL 2HJFA 3DXAB 4NJ9L 1IE5A 4HIJB 1BVLA 3PQYD 2DQUH 3LPFA 4LLYB 3T4AB 3U9PH 2KZWA 4QRQB 5HJ3B 4N8PA 5DO2D 3U30C 3EIFA 4DGYL 2PF6A 5ENWB 3M8OL 4CVXB 2VXSL 5LGJB 3RY6C 1KV3A 1PG7W 3BPLB 4PJFB 1XF2B 1K5NB 4CDGC 5I73B 3HPLA 5K9JL 4HG4K 4ODXB 4XMPH 1JMXA 2A1WL 3EO0A 3LKQB 2BY2A 3VXSA 3BKJH 5L8JB 4YWGH 4M61B 1AHWB 1IAII 4HJGA 3DETD 1R5WA 3OSKA 5AD0A 5CHNA 1QZ1A 2BNRB 4JFXB 3MRCA 4YHOL 1C16A 1IM9A 2D03L 3VXTA 3QG6A 5DFVC 3ZSSA 1RFDL 4BUHA 3KAAA 4K2UL 1NC2B 3O11A 4P2RE 4H8WC 4EN3D 5TDNB 3QIUA 3QZWB 3VGEA 1UM5L 3U6RA 5CP7A 1XGYL 1HSAB 2XNAA 1KELH 2VLRE 1T04B 2YPVH 1I1FB 3X3GL 4Z7VF 2ICES 4XVUC 4JGMA 2VDPH 1RVFL 2X6MA 1NANH 1QRNE 2XXMB 4XX1G 1JI1A 5JNYB 5D2LB 4QT5A 5CILL 1QVOB 2ATPB 3I6KA 3F8UB 1UWEH 1MY5A 1W72L 3VFUB 4GXVL 2DD8H 5HGBB 1G7MA 1MPAL 5LKNA 3MV8D 1EHLH 1RZ8A 3SN6N 35C8L 3SPVB 3E6FA 5ACLA 2WANA 3QXDB 3B3IA 5J6GA 4IBLT 1WUNT 4YFLF 3RHWK 5IG7A 1NCAL 1S5IH 3PGDA 4TNWF 4NC1E 4FG6D 3ARYA 3FO1B 1DQJB 1OP3K 1ZANH 4FZ8L 5AZEH 3BVNA 1IFHH 5C0JB 1W72B 4LARH 1GGIH 1I1AA 4OF5A 4D3CH 4LCYA 4RFNB 5A2JH 4C4KO 3GSVA 4I2XB 3MJ6A 1E4XH 2DWEA 1UENA 3BDYH 3MLXH 1U3HD 1TMCB 1RZGA 4K07A 3CLEH 1YNLH 3SDCC 1A7RH 1IARB 1GGCL 4ZD3H 2OJZL 1A1OB 3IU3A 5HY9B 3HZVA 4M43L 2EXWC 3QEGL 4PP1C 3U7YL 2EDTA 2O5YL 4OAWB 4JKWA 2C1OB 2D3VA 4M1CD 5LWYL 1H3TA 3D2UD 3MRPB 5C08B 4AQOA 3O4LB 3WJJA 4L29A 1VEPA 4JY4B 3O3AB 4M00A 3AM8A 6CGTA 4KK8C 2NY5H 2L4OA 2XYCA 4PJGE 2PCPB 2Y9RT 1QFOA 1TENA 3UEZA 3PL6A 3GKWL 4DEPB 1R0AH 1FC2D 3L3DB 3MRRB 3M45A 1U6AL 4X4YA 4RISH 4KGJA 3ULSA 4BFIB 5DZOA 4NNYB 4I48A 4P3CL 1QO3A 3ORJA 1RHHB 2A6DA 1RIUL 5IVXE 4XMLH 1G7IA 3DXAA 1AC6A 4HIJA 3OX8B 3DMMC 3T4AA 3CC5B 3ULVC 3EO9H 4MLSA 4QRQA 5HJ3A 2IPKB 2BSTB 3RVUD 4OKDA 4Y2DD 5ENWA 3QQNA 4CVXA 1CICD 5LGJA 4PLKD 4UDTB 2H8PB 4PJFA 2VXTL 3NZ8B 4TVPL 1K5NA 1XF2A 3GSNH 5KVGL 5GZOD 5GJTL 3S4SB 2AGJL 4ODXA 1A3LL 2K7QA 2Z8WC 4PY8I 4R8WH 4HUXB 3BIKB 1EGJH 1CXEA 2HKFH 1AXIB 4M61A 1WWBX 1LMKA 1CGYA 1UZ8B 4LU5H 3ARUA 5MEND 2BNRA 1AQKH 5INDB 2G60H 4JFXA 2DMKA 2NTFB 1CDJA 3UTSD 4WEBL 1GOHA 1NC2A 1QLFB 1N6QH 5TDNA 4H1LB 1SM3H 3QZWA 3SE4A 1H8SA 3OKEB 5EO1B 1OAXH 3MBXH 1V3KA 1QSFE 4KTDH 1CI5A 5F1SA 1T04A 1I1FA 3C8KB 5SWQB 1UH4A 4XRCB 3QG7H 4EXKA 1I7RB 5EU3A 5D2LA 4HWBL 5JNYA 5KANG 1YPZE 4W4NA 4ZAKC 5F96L 5J89A 1QVOA 4KZEH 2ATPA 1FJ1B 1MRFL 1U9KA 3VFUA 5MHSD 5HGBA 3LIZL 4YC2C 3T2NL 4YLQT 5C7XH 3SPVA 3MSPA 1OQXA 3WIIL 4PRIE 3QXDA 3FTGB 4U1KB 3WXVH 1KC5H 1JNLH 2C5DC 2D0GA 3AS1A 3NH7H 1DQJA 2B1AL 3JTTB 4F7TB 1QFWM 5C0JA 1W72A 1QNZH 1IKNC 1EO8H 4P5TB 3ZE2F 2J4WH 2EIZA 3PXHA 4HDIB 3FL7A 4I2XA 2FLRT 2UV3A 4X5XB 1RZFH 3U7AA 4D94A 4KDTC 2CKBL 1BZ9B 1OL0A 4F8TA 1LEGA 3MTRA 3P30H 1BWWA 2I5YH 1A1OA 5EOQH 1OAKL 1MHCB 5HY9A 2MSPA 4M9PA 1HZHL 4OAWA 4PY7B 2DKUA 2C1OA 3TVMB 2FHBA 4I3SL 5C08A 5JQ6H 3O4LA 4JY4A 3O3AA 2BRQA 4B5EA 2CKBB 4M6ML 4FFZL 3C60D 5D72L 1MI5D 5HTSA 3QIBD 2IEPA 2PCPA 1FG2B 2IAMC 3RBSA 1H3XA 1LP9A 3L3DA 5J12B 3H7BB 3QUZD 5FOBB 1RUQH 3WDJA 4BFIA 5A40E 1OPGH 2BCKB 3PWPD 4KKLC 1P2CB 3HE7A 1RHHA 3K1DA 1MIML 2JJUA 1N7ML 3OX8A 4NO0A 4P49A 3CC5A 3RU8H 4G7YL 1EBAA 4O5LH 2KZ1B 3FQRB 4ALAL 2IPKA 1ZLVK 1U8KA 4NGHL 4FHBD 3PP4L 1DQQB 3NZ8A 1WIUA 3WHE0 3TBSB 3BKCH 5GXBB 3S4SA 4JE4B 1ODAA 2BNQD 5T1LB 3RX7A 5D8JH 2WINB 2GUOB 5ID1B 1FVCB 4HUXA 3RL1A 3BIKA 4TSAH 1N64L 5I19H 1JK8B 3C2AH 3FO0H 4WI7A 3U83A 2FO1A 3VA2C 2R2CA 5DHXB 5C09B 2R23B 3D85B 1UZ8A 2VL4A 4KAQL 2VB5A 3IDNB 5INDA 3L5XH 2Z93B 3C6SA 3GNML 2DQCH 4OLXL 4IRZL 2NTFA 5FYKE 4O02H 1RMFL 1QLFA 3W11D 4WGWB 3MLVH 4H1LA 4F15C 5I75B 4XBEH 1AGDB 3OKEA 5EO1A 2QADD 1CGXA 3ARED 4PG9B 5KAQG 4OI7A 5GS2D 2GY5A 3SE8L 1WQVT 3C8KA 5SWQA 3WIHH 4U0QB 5F44A 4XRCA 2DN7A 2XA8L 3ARGC 3HZKB 3LY6A 2N56A 1VPOH 1ITCA 2ICEB 5BS0E 1D5MB 5I2IB 1K6QL 2VDLH 2UWEF 1FJ1A 4I0PB 1U41A 1P7HL 1AQDB 3IDUA 4ERSL 1T22B 3E8UH 5HSFA 1JP5A 5I18H 1A7QH 3LZFL 5B21A 5CSZA 1PX4A 3GIVB 2FJFB 3FB6B 5F7EL 1NBVL 3FTGA 4U1KA 1FH5H 4WI2A 1K8IB 1IL1A 4DKFL 2H1PL 4NQDE 1GOFA 4HC1H 4HBCH 4KUZL 4YAQB 2OXHA 1OM3H 4F7TA 3FFCD 4YXLL 4ODSL 1KLFA 3WNPA 1UZ6F 1JZ2A 1CLOL 1W0WA 2FJHB 4P5TA 4DKEL 4R6UA 3MJ9A 3P9WB 4ZUTB 3EDKA 4X5XA 2M2DA 1BZ9A 1KPVB 2P1YA 4RFOL 3G04B 2D7QA 2R29H 1LO2L 1DFBH 2QSCL 3ETBF 3MLUH 4HG4J 4PY7A 2R2EB 3TVMA 5K93A 4KV5F 4PJ5B 4OIIH 3GMPB 5B3JE 4YHIB 5KOVC 4CVUA 5I6XC 3BAEL 2XA3A 2CKBA 3U46B 5ID0B 1Z9LA 1XGRA 4XWGH 2XTJD 4KK9C 3D39E 3QAZB 3V4VH 4A6YH 4S0TD 3GMRA 1DQLH 3MBED 1V8HA 2XZCL 1JVKA 3VWKB 5E8PB 5FOBA 4DQOL 3VXOB 3QXAB 1ZV5A 3W5MA 3CCHB 1P2CA 1L7TH 2VDML 1WFUA 5FYJH 2AJXH 1NFKA 2JCCF 1S7QB 2XN9D 3FQRA 3PV7A 4G5ZH 3VGAB 2CR6A 3MFFB 4NZRH 2FO4B 4J3VA 1DQQA 3VH8G 3TBSA 5CLTA 2HTLC 2QHRL 4XGZB 5T1LA 1A6PA 2WINA 3QFDB 2GUOA 1PSKL 1FVCA 1FGNH 1BOGB 2ZSVB 1ZXQA 2B4CC 3ZYJA 5C09A 2R23A 3D85A 1B2WH 3OR6B 1CBVH 4LBEB 1CZ8L 2BVYA 2VDRH 3IDNA 5CINH 3Q5YA 5D4QA 1MCDA 4NKQB 3LEVL 4E5XB 1WFOA 2Z93A 5TFSL 1F4AA 1UWXH 4HHAB 5KVFH 3I9GL 2YBRB 3BMWA 4NNXB 4KWUA 4RRPG 3WS3B 3TH2T 4DW2H 5CMAB 1F6LL 4XNUL 1AGDA 3HMWH 5DO2C 4EQ2A 2CLRA 4P9ML 4UILL 2PUQT 3INUL 1G7PB 4KMQA 1NUDA 2J5LC 4PG9A 3MRLA 1FIEA 1P7QB 1ZA3B 4UTBH 5TQ0H 3HZKA 1CXLA 4NKOB 4K3JH 2ZUVA 3RUGF 2ICEA 5D6DC 1D5MA 2J12B 3LQMA 5I2IA 4J7RA 2VITB 5FYJD 4EI5B 5DWUH 4I0PA 3EBAA 2DQHH 1AQDA 5E5MB 3U2SA 2BK8A 4U3XA 4JFHE 4FP8L 4X4XB 5E7BA 3BDBA 3GIVA 2FJFA 3FB6A 4POZD 4PJDF 4RX4D 3JUZA 4M4PA 1A1MB 4FQXD 4HJJH 4YHKH 1KPRB 2DQTH 4EN3C 4JKLA 2VZSA 1NC4B 4MAYB 4EUPG 4YAQA 4LMQE 4OD2B 3MNZB 3CVHH 2VSDA 5LXGH 4HAGA 2FJHA 4Y89A 1RUML 1TETH 4NOFA 2DKMA 3BUYB 3EOBB 3MRBB 4ZUTA 4MVBC 4ODTL 3JTSB 2V2XB 2XI9A 4OZ4A 1KPVA 1FDLL 4FZEL 2EIBA 4U6YB 3FKUS 4KVNH 5BW7A 4XC1H 4X6DB 2VE6B 3G04A 3TYFB 4X8JB 1MREL 2R2EA 3CX5J 4HIXL 5HHME 1YNKH 4PJ5A 1W2KT 4PRHD 3GMPA 3DV4B 4YHIA 4K3HA 4R2GB 3W0WD 4R4FL 4RDQF 2J7LA 4FG6C 3U46A 4FTVD 3ZMRA 3U0WL 2K1MA 2EECA 4F7EB 3DSNA 4KK6D 3QDGA 2QTEA 1F02I 3QRFM 3FCTB 5D7KD 3O3BB 5DR5H 5EDXA 3HUJB 2D7OA 4HCRH 2G5RA 2P48B 3QXAA 2XFXB 2ZCLH 3CCHA 5D5MF 4QXGH 3GKZA 4QRRB 1CLZL 3UPCA 5F7YC 1OWWA 3TV3H 5J9PB 4JRWA 1S7QA 3V4UH 1X5IA 4PIRF 3AXLB 3K4DA 1F4WL 3VD5A 2ADIB 5I1CL 4ODUB 3MFFA 4M1CC 5IIEB 1MFAL 2DDQH 3ZDYF 1UVQB 5SX5K 1ZLUK 5JW4R 3IGAB 4OZIB 1ZGLP 2UZIH 3OV6A 4HXAH 3QFDA 3TA3B 3MXVH 1BOGA 2ZSVA 1QHPA 3WLBB 4MCYA 3UPRB 2QEJA 4JFFB 3O9WC 3QR2A 4LBEA 1FO0H 4MGXA 3U4BL 4E5XA 2NY4B 4LF3B 1KIUA 4HHAA 1FLTX 1DEEB 1X44A 2DMBA 2LAAA 4NNXA 4DTGH 2DS4A 3WS3A 1I9RL 5KTEL 2ED8A 5CMAA 2R2HA 3S36H 3EZJB 2M8XA 4DKDC 3RVUC 1K8DB 4Y2DC 5DRNB 3SGDH 1CICC 1CLYH 1G7PA 2YPLB 1GC1L 1FNAA 4KROB 5GZOC 1P7QA 3STZA 1ZA3A 3NFSH 4TQEL 3WV0A 2B1HL 3ALXA 4NKOA 1CN4A 2R69H 3DURB 2VITA 4EI5A 2YD5A 5BV7C 3ARFC 3Q1SH 1NLBL 2QHLA 5E5MA 3S5LB 2MCPL 3KYOB 3B9KB 5CSGA 5J13B 5I1EL 4L8SA 4E41E 5JHLL 3SKNB 2DQJH 1A1MA 3ME0A 4WW2F 1KPRA 5FUCE 3C87A 4GBXB 4W70A 1TLKA 1NC4A 4MAYA 5JR1H 4IMLB 1N6VA 4OD2A 4MJ6B 2NY5C 5D7LA 1WAAA 4CJ0A 3BUYA 4TULL 3EOBA 3MRBA 5EU6B 5C0EB 2EDDA 2V2XA 1KCKA 5JO5B 2Q3AA 2KL6A 2HJLB 4FFVD 5DQDH 1EUUA 3QDJB 4U6YA 2BY1A 1N0XH 4X6DA 4XPBH 1WZ1L 2VE6A 1J05B 2MPAH 3KPRE 3UZQA 4U0RB 3JWDH 1FNGB 5HDBE 3DV4A 3WJLC 5DHVH 1JPSH 1RHFA 3CVIH 1BWMA 4MNQB 5IB2B 5HVGB 4F7EA 2VDOH 3K2UL 1EXUB 3CDGB 4OF3A 4JB9L 3HFML 3FCTA 1ED3A 3O3BA 2ZSWB 5J06A 3HUJA 4H20H 2EE3A 5FGCE 1UKSA 5C0ND 1X5YA 4QRRA 4L3EB 4WFFD 1YEEH 1CFTB 4K8RL 3ZE1F 2IH3B 5J9PA 1N5AB 4WW2C 3AXLA 4XP4L 1HN1A 2ADIA 1HKLL 3QXWA 4ODUA 1S78D 3MUHL 3WDIA 3SDXF 3HE6B 3QIWD 3IGAA 4OZIA 4S1DD 4TTDD 2YD6A 3MLZL 4K23L 3TA3A 1D9KC 4CDHA 4ELKB 2IQ9L 3ESVF 3WLBA 2DKSA 3MROB 2GJ6D 3UPRA 1CU4L 1I4FB 3KHQA 4V2BA 4NP4H 5EZOL 4JFFA 5DFWH 3QUZC 2H41A 1DBAL 4JPWH 4Y5YB 4LF3A 5DURB 4DGVL 5E24E 1DEEA 3TN0D 4CW1B 1U95B 1X4ZA 2F9BT 1G7QB 1A14H 4RBPH 2NPLX 2YSSB 1K8DA 3T4YB 4JM2D 4KRPD 4CVWA 3HI6H 1D5IL 4KPHH 2YPKB 4D9RD 4XPAH 4PD4J 1KJMA 1CR9L 4UB0L 1A5FH 4M5YH 3DURA 2KDGA 4LSVL 4ZXBD 15C8H 3IVKA 1R3HB 1G9ML 5D2NC 2NX5D 3LMJL 3S5LA 2WBJA 4HFWA 1ZS8A 3LRHA 3V7MA 3T0AA 3KYOA 1YECH 3B9KA 3FONB 4KVCL 3SKNA 1OAYH 4R0LB 5E99H 4KKAD 5DEGB 3W11C 4JRXE 1B4RA 4IMKA 3EJJX 3W2DL 4GBXA 4XVTL 2C3VB 4O9HH 3HPJB 4M1GL 5CZKA 4D2NA 1NDMB 4IMLA 4MA7H 3O0RL 4MJ6A 1F5WA 3AREC 2EDOA 4E42B 2ICWJ 3EYOB 2F15A 5GGQH 4M6NL 5ADPH 2RB8A 4L9LC 4KDVA 2X89A 4NO5B 3I3EA 5EU6A 5C0EA 4FQ2L 3TT3L 2R56L 1XR9B 4UTAL 5EU7C 2NY2C 5JO5A 1DVFC 4NQTA 4PJ7B 3H9SB 3QDJA 1X5JA 3JWOL 4S1RH 1J05A 1T2QH 4OSUL 4X7EC 1Q72L 1FNGA 3RA7H 1FIGL 5CJOL 3QPXH 4P2RD 4NC0B 1IC1A 3RY4A 3O3EB 1JGLH 2D7NA 4MNQA 5IB2A 5DDHB 5DUPH 2DQEL 2FR4B 3S97C 1A7OL 2VLJE 4GFTB 1EXUA 1DANT 1CCZA 1H0DB 1T80A 2VLRD 4Z78A 4YX2L 4NN6C 5IFHH 1RJZB 1Y18B 1N3NB 2FECL 2C4FU 3EO1B 4YR6A 2ZSWA 8CGTA 3I3DA 1QRND 2ARJB 3QA3B 5DTFA 3K74B 2DF3A 1JRHL 1TCRB 3MUZ1 4RGMB 2VDKH 3GI8H 1QACA 5E2UL 4L3EA 3MLWH 1CFTA 4ZSOB 5GHWH 1IGIH 2IH3A 3V5HB 3FN9A 1N5AA 1RSFA 3KS0J 4K7PX 3W9DB 2GK0B 5DK3A 1KXTB 3IU4L 3G6JB 1MCPH 3M07A 4TNVF 4M6OH 3GBNH 3QWQB 3GBLA 5E70A 2CDFB 4PJEF 4LRNH 4Y1AE 3T0WA 4YHLL 2D7MA 5DQJB 2HJKB 1Q9KB 3KPSE 3VXRE 4YBHA 4ELKA 2XQBL 3VD3A 3ZTNL 1GGBH 1AJ7H 3MROA 5F71A 3MBEC 1I4FA 4XCNB 1B88A 1P9MA 3MLSL 5FUZL 3FRPA 1QYGH 2YRZA 3SJVB 2WWKO 4Y5YA 4P2QB 1NBQA 1WV7T