1VCAA

Crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 angstroms resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
199
structure length
199
Chain Sequence
FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN VASCULAR CELL ADHESION MOLECULE-1
publication title Crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion protein
total genus 41
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05790 C2-set Immunoglobulin C2-set domain
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1vcaA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1vcaA01
2YUZA 2H1PH 1CYGA 4DZBA 2XRAL 3IDGA 4DKDC 3AM8A 2H9GB 1QRND 1L0YA 1J7VR 1OSPL 4KWUA 1FO0A 1U8QB 1JTPA 3QCUL 1SBSH 2E6JA 4Z7VF 1C12A 1D5MB 1QSZA 4HPYH 4NRXB 1BLNB 4MWFB 4RZCA 1EVTC 3GMRB 3OG6B 3VXSD 1KXVC 4FQQB 1U8OB 3IU4L 1CD1A 2PYFA 3T77A 1MWAA 3W11C 1A1NB 2QEJA 1ZHNB 3VWJC 4NQXB 2QSCL 4H88L 2NY1D 1QO3B 4CVZA 1OPGH 2CRYA 2APFA 3V5KA 5BW7A 1QSVA 1DLHB 2FLRT 2VDKL 3DETD 3TPUA 1T1WA 1JZ7A 1T22A 3OKDB 3QHZH 4V1DA 4YGAB 4C56B 4WHTB 5CKAA 4OZ4A 1IL1A 1Q9WA 3F12A 3WIIH 3QWOB 3VFVA 3VXOA 3S4SG 1F6AB 2QL1A 1F3DJ 3BP6B 5EOQL 5T1KD 1LEIA 5AZEH 1EAJA 5LWYH 3DXAB 5F97E 5GGRA 5IEHB 1RD6A 1FNEA 5CJXA 3EBAA 2FIKB 3OAUH 4B7LA 4IEFB 3TM6A 3HE6B 3HG1B 1JMXA 3UBXI 2ZUQC 2FHCA 3SKJH 3WLBB 1K5NB 1CGVA 4MD5B 2X42A 3B6SB 3QFDB 3QNYA 3MA7B 4HWUA 1XR9B 3AMLA 4O9HL 1RHFA 4HIEA 3DYOA 4JKPL 5SWSD 2AP2A 3UTQA 4M6OL 3OF6A 1HQ4A 5D7SL 4MJ6B 1ZV5A 1FSKB 2Z35B 1O7SA 1I7RA 4TN9A 1MJUH 5I73C 2JKXA 1FN4B 3TYFB 4Y5YA 3OKMA 1UWGH 3U0WH 1F11A 1HHKB 3BIKB 3GBNH 4HKJB 4ONGH 2WBJA 1YEDA 3DWTA 5CJQL 4UUJA 1DQDH 4HMEA 5D1QA 3S36L 5JW4N 1RIUL 1JWMB 3QHFL 1YEHL 3NCFB 2LABA 5HGAA 1QFUL 3O8XA 1OAZH 5F7DA 1JHTB 2OSLB 2N1KA 4P5TA 1MCWM 3LV3B 5E8PA 4GRMA 5A1AA 1JNNH 4NQED 1C8PA 2WM0A 5HD8D 1GZPA 4FQJH 5CEZD 3O3DB 2EE3A 1NSNH 1Y18A 4LPTA 5C6PB 5IMLB 1KLGB 4I8DA 4CMHC 3AFLA 2X4QA 3FOMA 3L3KA 3LKQB 4XPAH 4UBDC 3PUCA 1YZZA 4L3CA 4HKBB 1G6RA 1OAKL 4JN1H 4DW2L 1NDMB 3ROOB 2EYRA 1R6VA 4QLRA 1I4FB 5DS8A 2MNUA 1I1AA 5C0BD 3ZMRA 5IOPA 4EXPX 3NABL 4LLMB 3S5LA 5FAAA 3ZDZE 3VXMB 5L2KA 3MUZ1 3MNWB 4N1CA 1HHJA 1NC4D 1BVLA 5JQHC 4JO1L 3QUZB 4Q6IC 4NWTL 5E4EC 3UZQA 4UIMB 1UVQB 3O3AA 1SMAA 3BX7C 1R3HA 5B3NA 2P1YA 4UOW0 4P2RD 3QUMA 5DJAB 3BO8B 4JDVB 2EO9A 4Y2OA 5LAXB 4UZGA 2DQFA 4X6EB 3EYQC 1U8HB 4KGJA 4XMKH 2BNRE 1U9KA 2A9MH 1U95B 4JFYA 3TA3A 1CR9H 1KTLA 1HXMB 1U42A 1TJIL 5ICZB 1QSEE 3RVUD 4PP2B 1DVFC 5IHLB 5D70L 2VDQH 5ELIA 4C83A 2OXHA 4YHLH 4I13B 3UTTA 5IROC 3TIEB 3WMSA 1YY8A 1TJGL 1RV6X 1WCBA 4NQSA 1Z9MA 1CG9B 4BFBD 2EKSB 5KSVB 5E94A 2D7TH 3KXFA 1X5XA 4F7TB 2DI7A 2XOTA 4P4KB 5IB5A 5BVJA 4XC1H 3CC5B 4GSDH 3DI3B 4HS3A 4GG6A 4OB5H 1NC4B 5C0EB 1MFEH 4XBGA 4JFEE 3FN0L 5D2NB 2VXVL 2OL3H 3MV01 5GS0D 1I3UA 1UB6B 3WKML 3L9RB 1RZIB 3BP4B 2ERJB 5GS1A 3QQ4B 3V0VA 2DM2A 4PRBA 4MQXC 3TZVA 1EMTL 1TQBC 1BWWA 5GZND 2B8OT 1FYTE 2NTSP 2OR9H 1CICD 4XVTH 1IAII 2XWBB 4GMTL 2F54D 4Z77B 2DLFH 4CN6A 3I9GL 4YDLB 1WQVT 1G7HA 3HE7D 4X6BB 3VFWB 3MRIA 3WJLA 1QRKA 3DECA 2V5YA 3H9SA 4GOSA 3VG0L 3ARVA 3WCYA 3ETBF 1VKXA 2AJXH 4YAQA 1PYWB 1LDPL 5TDOB 1T89A 4OZIA 2ATPB 4NQDE 5DYOA 2RGSA 3BVNA 3IJYB 5K9QI 4FS0A 1NMAH 2XTJD 4C4KT 2DJ4A 4G8EB 1MHPH 2EDJA 1JHKH 1Z5LA 4IDLA 4J23A 1FNSH 2P8PB 3KYMB 3GMMB 3TYGH 3AREA 2PF6A 3QEUA 4I77H 1UH4A 3G5ZA 4QRRB 2FEDC 4UOJA 4PGCA 2WWKO 5DZOA 3MUGB 4P57A 3U0TB 3RL2A 4F9PA 2FZ3A 3WXWH 4P23A 3IJHB 3E2HC 2FECI 1QOKA 5FO7A 3DMMA 5HDOA 1R3IH 1S7QA 1IGTB 5JNYA 2FD6H 3FO0H 4K9EL 4XNMB 5JXEA 3SDAA 5HHXH 2G9HB 2PYEA 3TBWA 1JK8B 1KPUB 1GGTA 4JRYD 4XNXH 5I1DB 4HWZB 3MV7B 1YEIL 1WAAA 4ONOA 2D7QA 3VMNA 2V9RA 4M1CC 2AV7A 4Y4KA 5E5MB 2YRPA 4HFWA 1GIGL 2Z8SA 1R5VA 4GUPB 3V4VH 3ULUD 5EIIA 1R24B 1FNFA 3HRPA 1JHLH 4RQQA 3WIHA 3VE0B 5IMOB 3UMTA 3O6ML 4HDIB 1N64H 2FB4H 3DTXB 3VI4E 1XFPA 4Y4FB 5CILL 4LLWA 1H8OA 3VWKB 2XQYG 4ZUUB 5FYKU 1DN2A 2E6QA 2B1HH 5HSFA 5F7MC 2ZCLL 4KV5E 1MOEA 1V7NH 3FB6A 5JIKA 1T0PB 1Q72L 5F6HI 4HJGB 3MOAH 4G7VH 4BKLA 1IAIH 1H0DB 3LKNB 4MQ7A 3S4SB 1EO7A 4LKXA 3QXTA 4YX2H 1ETZA 7FABH 1VEMA 3C6LA 1VADA 4HF5H 5FO8B 1INDL 3SKMB 4O4YL 4CVXA 4Y5XC 3LY6A 2VLKD 5HVHC 2N7BA 3L3GB 4OZFH 3BYTA 4WEBH 1B6UA 5D7LE 1MCRA 3MXWL 4XNQB 1S9YB 4DEPC 4LARL 1QG3A 5B4MD 3RI5F 4KH2A 4RFOH 3QDMB 3T3PF 4XXCC 2HJLA 4BZ2H 2YMXL 1D5ZB 1FO0L 3IXTA 3HNVH 1X7QA 1KCSL 3T0EA 4XNUL 2O5XH 1MCHA 5ETUB 1WBZA 1INEL 1P6FA 3ESUF 4HW6A 1JNHB 1A7NH 3WV0A 3OX8B 2GSIB 4R7NB 3BT2L 1K3IA 4LCWB 1FPTH 1QSFA 2BVUA 1MWAL 3Q0HA 3QNZA 5LCVL 1MVUA 2BVPB 3E8UH 2HTLC 4KKBC 1HCVA 5E8DH 1MIML 1HH6A 1TJHH 4GW5B 5D1XA 1A6ZA 1P4IL 2EDBA 4G8FA 1T83C 4OCYL 5C0AD 3CDYA 2DYPB 4PLOB 1Q9KA 1JWUB 5GGSA 3O6KL 2OP4L 5DRXA 2QADD 3L1OH 1MCPL 2QSVA 3TCLB 2DS4A 3OB0K 1N2RA 3OKLA 1D5BB 4U1JB 3B2UC 5GGVL 4MDJA 3W11D 2ZKHL 2APVA 1YYMH 1ONQA 3UTPD 3D85A 3C09B 5A2FA 1FFQA 5ICXB 5C3LD 2BNQD 4ISVB 3N1QC 4GO6B 3MNZB 4TQEL 5JXAL 4H5SB 1T03L 4HUXA 4RRPG 1PGRB 2Y72A 4F7EB 4G42A 4OGXH 1RZGB 3RX7A 5MHSD 1YNLH 3PDDA 5CBAA 1F97A 1KPVB 1Y0LB 2GHWB 2C3VB 3REWA 1VACB 5A2IH 1WVZA 5TQ0H 3TT3H 1UCBL 3ARZA 4GRWE 5DK2B 3DX6B 3WNPA 3EYVB 1MCJA 3D9AH 4OCWL 1A7RL 1KCVH 1ZHKB 3SQOL 4G6MH 3P4MA 3C2AL 1TDQA 3D25A 4FQXA 5C08B 2J1KA 1NJ9A 4OGYL 1MCLA 3AY4C 1ODAA 3MJ9A 3T04D 5HY9B 2ZCKH 4LPCA 3FAXA 5EO1B 3GMQA 5DZLA 1QLEL 4OLXL 5F7EH 1D7FA 3SKOB 1NCBL 3IDYB 1DSFL 2YD6A 2BNQB 4HZLB 1XCQB 2R4RH 2O5ZH 4L29B 5EC1A 3CH8A 5EN2B 5BJTA 3AB0B 3E1F1 1RZJL 4O2CA 5TE6L 1G9MH 3MLYL 5IQ9A 3DGGA 5B21A 2GJ6D 4XPBH 4V1DE 2H6PB 1S7TB 3H9YA 3RIAF 1DUYA 4GAJH 4N1HB 5TF1H 4LCUB 1BZ9B 1FJ1A 4YHIA 3UXFA 4ESKA 4LVOC 1P1ZA 4WFFD 4JLRA 4F3FA 1JPST 5JO5A 4FFYH 1FG9C 4HV8A 2MQ0A 4UBDD 1CXIA 1OAUL 2A0LC 3ARDB 4QRSA 4TUOA 3PP3H 4G6JL 4UDUA 1Q38A 5INCB 2CLVB 1LDSA 4RAUB 3R1GH 2J6EA 3CFBB 3QUML 4JREC 3GIZL 4ALAH 1NCAH 5FECB 4HG4J 3QQNA 2YD2A 3CK0L 4L4TA 1MHCA 5JHLL 5DJ0B 3OL2A 4I3SH 2IFFL 3TBVA 3EO1A 3QWRD 2DM4A 2UY7A 4W4OC 1F4YH 4FRWA 3K2UH 1UM4H 4G9FA 3OMZA 3G9AB 4FN0A 1OARH 1J0HA 2AEIT 4X99A 4P3CH 5J13B 5F9DC 5B3JF 3CVHA 5EIQA 5EBWB 2NY0B 4PJ8D 3EYQD 2FO1A 5MERA 5DQDL 1HHGB 4D9RD 1OP3K 4I1NB 4OSUH 5KVGH 3IVKB 2BJMH 3SOBL 3MRQA 4R26L 1K9TA 2R1WB 3OSKA 1A6VL 1LP9B 3SDXA 4NJ9H 1JPTH 2VISA 2Y06H 5CGMA 1DVFD 3EDFA 1BAFL 3QI9C 1U8LA 5CUSL 2OZ4A 3GRWA 1SYSA 2EH7L 4AZ8A 1A3RL 1HH9B 3QFJA 3T2PA 5KVEH 1M1SA 1V7ML 4K7PH 1G7LB 3JTSA 3JTTA 4QYOB 3T3ME 3TH2T 2ESVD 5BRZA 1O7VA 2V2XB 5DR5L 3FL7A 2F74B 4Z7OF 5J12B 5KS9B 1CVSC 2HFEA 4XMLL 4PLNC 3S37X 3ISWA 1DE4A 3PJSB 3E6HA 3IDXL 1BFOA 3MJ7B 5T1MB 1N5AA 3RVXD 3AM8C 4PJGB 4YC2C 4WNQB 4S1QL 4Z7WB 4EIZC 1ZT1A 3O45A 5D5MB 4QEGA 1OCWL 4PJ8B 4MQXD 3NH7H 3RNQA 4Z6AT 3WS3A 4QHMA 4HBQA 1TCRA 1CBVL 4H8WH 1U8NA 2ADGB 4PJDB 5KSAA 1SY6A 3RU8L 1QR4A 1JRHI 3STZB 5C07A 4KRMB 2X4OA 4X7FC 2VIRB 5BW7C 1X5FA 2YPVL 3HN3A 4LOUC 4A2MA 5D7KE 2HLAA 4EDWL 3N1FC 3QUYB 1CZ8H 3KHOA 3P0YH 5FKPB 3UTTE 4JM2A 2ZUXA 4M6ML 1MELA 4PJ7A 5DJ2A 3KXFE 5DMGC 3KPLB 1HI6A 2G60L 1RMFH 4P49A 3C87A 3HAEA 4LFHG 1HWGB 1WBYB 5FO9A 1B4RA 2NPLX 2ZOLA 1ERNA 4GG6E 1M6OB 3RUGB 1IGIH 2FEDD 5HI5C 4LKCA 3CAFA 3LHPL 5FOJA 1QPXA 5K9OA 4JKWA 3WIHL 3F7VA 3IU3A 1ORQA 1KYOJ 4ZSOB 4PRHA 1I1YB 3CPLB 5JPMA 4FABH 2R2EB 3KPRA 3SE9L 3BPOB 4RRPA 2NY5L 3HLAA 4KQ3L 4K94L 1MF2H 3PGFH 2B0SH 4HX1B 3ET9F 4M1CD 3MRFB 3NTCH 3ZTJG 1MEXL 2FX8L 3VH8G 1UM6L 5D1QC 5C0CD 1AO7A 1WWCA 4ZUWA 3S88L 2I07A 4JN2B 4S10A 5JORB 4Z8FH 3X3GL 3H9SE 1U92B 2BFVL 1ZLUK 1NGWA 2B5IC 4RNRB 4P5TC 1ROWA 1T2JA 4OZIE 4P99A 1JV5A 3FCTA 35C8L 1S7UB 4PGEB 1A14L 5I19L 3SQBA 1I3GH 2GTWB 5BZDB 1QSED 1AE6L 3Q5TA 3Q3GA 4U7MA 3QXDA 3U30B 3RWGA 1RUAH 1MJ8H 3QUZC 1JRHH 1A2YA 4HCRL 5E70A 3NCBB 4X5LA 4DKFL 3QNXB 5EIVA 4M4PA 2PTUA 2DM3A 4L4VA 2NY2C 4HJJL 3GGWA 4NHUB 4XP1H 1JGUH 4XP9L 4PJBA 2SEBB 4ODUB 4ZUSB 1HILB 2ZUWA 1FFNB 4GBXA 2VDRH 4OCNC 2IEPA 2V5SA 1T5XA 1I1AC 1PEZA 1EIBA 1QFOA 5J6HB 2X4RA 3C2SA 4GRLD 3V5DB 4PGDA 2EDEA 3KLDA 3BXNA 4JFED 2A6JB 2MKWA 1A7QH 1NEZA 1WAAE 1CLZL 1IKFL 3P4NB 1UQSB 4M5YH 4URTB 5HGHB 1M7DB 2Q3ZA 5ESAA 1HYRC 1IGMH 1UM5L 1GGIL 1GGCL 1UGNA 2YKLH 2VDPL 1FYTD 2AJ3A 4UDTA 4LCYB 3QYCA 4TOYH 8FABA 2HTLD 4LLYB 4R2GB 1QQDA 1DQMH 4P4KC 3VRLE 1QHPA 2JIXA 3RY6A 2IANB 3OBAA 4OAWB 3UC0L 1KB9J 4YPGB 2X2YA 4EBQH 3QDJA 3IB4A 3ULSB 3PGDA 4OBRA 4MAYB 4XHQA 3TV3H 5DMIL 2HP4A 3J8F7 5AWNH 1OF2A 2K3TA 1JF1B 2WWKT 4APQB 4EN3A 1BFTA 4LCWE 4WIQA 2P47B 3DROA 4GRLB 2A77H 2YC1B 3DUSB 5F71A 3J7HA 1FNGA 1DL7H 3MLTA 4YDLC 4UT9L 4PJXA 3T4YB 3MRLB 1F58H 3BRFA 1A3LL 1YJDH 3OJVC 2P5WD 4MD0B 5I16A 2VE6B 3T0EE 3DRQA 4ZFZA 5C09A 4B41A 2EDRA 4LVNB 3MJ9L 2ARWA 2B7DT 1H5BB 3LH2H 5FA4A 5GS1C 4DTGH 1Q8MA 4PGZA 4TNVF 4H20H 1PAMA 1J5OL 4JZOA 3DPBA 3TZVC 5C0IB 1XCTA 5DEGB 1HYSC 1NBQA 4KK9C 3O9WA 1KT2B 2ZJSH 3ZKNC 4R4FH 1NCCH 3TWCL 5JDSA 4WI9A 2D31A 4Y5VA 5FA3A 2W9EL 2X4PA 4NSKB 4WCYH 5HDBE 4JO2L 3KNBB 5EO9A 3WJLC 4KTYA 4KKCD 4YZFF 2F5AH 2VLRB 2HRPH 4RFEA 5FV1L 4QRUB 4UT7H 4U6XA 1XF4A 3LZFH 1JGLH 4YPJA 3L5XL 1OB1A 1T89C 1N4XL 5FV2A 2A6DB 5LG1A 1ZK9A 2CDEA 2I25N 1NAMA 1KSRA 2XNAA 1NEUA 3GSRB 3ILPA 1CXFA 2FATL 4PRNB 5IR1A 4KKNA 3EYSL 4JAMB 1EJOL 1YNTB 3HI5L 3IXAA 4KJYB 4O58H 5IHZB 5L7XH 2J88H 5MEPB 1Y6NR 3NCYP 1MHHB 4AYFA 3GSXB 2WLZA 3DYPA 1UYWL 3VXQB 5IT2H 1XF2B 5CZXC 3RDTB 4F9PC 4IOIB 4P23C 2FR4B 2GITB 2IFGA 1F4XL 1LP9F 5D7LD 1DN0B 5C0GB 5DO2C 2CKBL 3A6OA 1J9CT 1R3LA 2P5EA 1OGTB 3VWKC 3DMMC 2F8OA 3FB8B 4AEHL 2A0LD 5JXEC 3SDAC 3WFHA 1EUUA 5GIRA 2FHBA 4JPWL 4OCXL 4UNTA 4IMKA 3CVHL 4UAOC 5CS7A 4Y4KC 5KS9F 5HGBA 4PLKC 5JOPE 2UUDH 1TTFA 3O3EB 5HHQA 1U58B 1JMZA 2EEDA 3EYUH 4FXKB 1HHHA 1U3HD 1JZ5A 2Q8AH 1EGJH 2DOCA 1DANT 2GAZA 3AS3A 3QEQD 2FO4A 4KHTL 3MXVL 1DBMH 1OP5H 1RU9L 4PJGF 5FKAA 4GH7B 2VO5A 3SDYL 4Z7WF 2DQTL 1XGRB 5D5MF 3GRWL 2PW1A 3MRBB 4WV1B 3V7AG 4GW4B 4Y8DC 1FGVH 2H41A 3WFBH 3L6FA 3C6LC 2H8PA 4PJCA 2A1WH 5I18H 4QHUB 2WWMC 3RVTC 5JUEH 1NL0H 5EOCL 2Z31A 4PJDF 1QP1A 2ZCHL 3S35H 4HIHB 3HNSH 5MEOA 1T1YA 2HG5B 5HHPB 3BP7B 2K7PA 2Q87A 5BV7B 4JHWH 4MJIB 1CD9B 4I0CC 2EEBA 3QI9D 2Q86B 3W2DL 2ZPKH 3MLUH 2Y7QA 3B2VH 1A6TB 2ZG3A 5T1DL 4Z0XA 4MS8D 3RGVA 3DVNA 4L1HA 3AGVA 1MAMH 2DMKA 2YD7A 3T0EC 2WW8A 1QFWH 4BSJA 1TZIB 1S7RB 5F96H 4M3KB 4L4TE 4JO4H 3VFOA 12E8L 3RUGF 4LMQI 3VH8B 1AJ7H 2ICWI 1C08B 1XT5A 1MRFL 1SY6L 4X80L 3FMGH 5HHOA 1IEAB 5I8CB 1QYGL 4G9FE 1I7ZB 4LNRB 4LPWA 4OFIA 1FORL 1NBVL 5HYJB 1B4JH 3QEHB 1RZ7H 1CL7I 4LP4A 1CDBA 1HN1A 5FFLA 1J12A 3VDCA 5EZJA 1F3JB 1X9QA 4WW1A 3MNVA 2XACC 1KBGH 2HKHL 4I3RL 3V6FB 5CEZH 5T3ZH 4JY5L 3SDXE 1OQXA 4N0CC 1MFCL 4TPRH 5DD3L 1NBZB 3IDMB 1MJ7H 3B3IA 3NAAH 2JELH 4V1DD 1JWSA 1AC0A 3QFJE 1XIWA 1UZ6E 3QULB 4J3OC 2DBLH 4PRIA 4HKZB 4QCIA 5T1LB 2E7LC 1LMKA 2W65A 1J10A 3RX8A 4GAGH 4CU7A 1LQSR 5DMGD 2Z93B 4ZPTB 1JN6A 3B4NA 3VD3A 1KPRA 3KPSB 5HI5D 3IDYC 3VXRA 1FFOB 1MJJA 4QOKA 2N7AA 3BSZH 2VZ3A 5DTFB 3I85A 4P9MH 3UAJC 1XGUB 3DVGA 4HPYL 2BDNH 5KVDL 5DFTA 3MYZA 3OF6D 3I84A 4HUMB 4FQXC 4EDXB 2BSSB 1QLRA 4Z7UA 3GMNB 3ORJA 4BQ8A 1XGPA 5D2LB 4ODXA 4HMCA 2JJWA 2WBJD 5FUZH 2F53B 2I9LA 4X0KA 5D1QD 3S37H 4XT1C 3RUGE 1NBYB 4ONHB 5C07E 1T3FB 4X4XA 2CQVA 3L95A 2A38A 4OZGA 3GSNH 1S5IH 3QHZL 5DWUH 1RK0A 3D0VA 3O8XD 3QXVA 1T0NB 4P5TD 2C7UB 3PWPA 1G9NH 4OUUA 1AIFA 1CGTA 1HCFX 1CL7H 2XYCA 3N06B 3BRDA 5HHVL 4PUBL 1TNNA 4PJ7E 1OSZA 2EIZB 4QXTB 2ZSVA 2VN7A 5AZEL 5LWYL 4F15B 1EHAA 2HFFB 3WS6A 4N68A 5D8JL 2BZDA 3WUWG 2X9XA 4RAVB 3DV4A 1MFDL 1NFIB 3CFKA 2A73A 2NY2D 2OI9B 4Y0GA 5AG8A 3KYKH 4D2NA 5J13C 4HLZH 5KSBA 3RY5A 4XCEB 5GS0H 3FT3A 4PRHE 5DD5H 4PJHB 1CLOL 1I1AD 5I8EA 3KPRE 5C8JB 1MJUL 2EDKA 5L2KD 4Y5YB 1UWGL 4HBCH 5E9DB 5AUMA 3GBNL 2BCKA 4ONGL 4LLUA 4Z7NF 3CUPA 1I85C 3S36X 2R69H 1T1ZA 4MZ3A 5B38G 3PHOB 4R4BA 3QH3B 1E0OB 5EBMB 1AO7E 2AEPL 3G5VA 5KVMC 2C4XA 4EKXA 3MRMB 4X6DA 1YECL 4LIQE 1JNNL 3QG6B 3WXVH 3H2WA 2GJZA 3HPJA 5IF0B 1RURH 4FQJL 1OGAA 4DUXA 4KTDL 4XHJC 1EV2E 1ZA3B 2X40A 4HQQH 1NSNL 5I1IH 4JFZL 3TA3D 2MPAL 1RIVH 5DMKA 3QJFB 2CDFA 3ES6B 1AP2A 3BDYH 4JRXA 3GJFH 4KVNH 4AEIL 5D7JA 5CHNB 5F3HA 4PV9A 4MJ5A 2CJUH 3CVIH 3QSKB 1WZ1L 3V4UH 3UTTD 5F6IC 1F8TH 1A5FH 2QQKL 4L4VE 1KJ3H 4FQLL 4N0UB 1ZHBB 5JTWA 1WK0A 3KXFD 2D7PA 3R06A 3GNML 2VDOL 4KI1A 1RIHH 32C2A 2W60B 5L2KB 4RA3A 2VWEE 4U6YB 5C0JB 3TO2B 4JRWA 3V5HA 3ARTA 4JY4A 1F4HA 1ZT4B 2OX5A 3T09A 3WN5B 1RZFL 3QUXD 5E99L 5I76B 5JPNA 4JANB 2E7BA 2CIKB 2XZAH 1AXIB 3JWOC 2E7CA 2GFBB 1P84K 2FJGB 4PGBA 3UJIH 5E2WH 1OT1A 3TZVD 1CD8A 3LIZH 1SYVB 1WZMA 4XMKL 1NAML 4X98A 3ZKND 4R7DA 4TYUA 3VFTA 4E5XB 3OR7B 4ODTH 3IFOB 3SBWA 2QLVB 4G5ZH 4LU5H 2H2PC 2HT4D 4XX1G 5KSAC 2Z91A 5BVPH 3HUJA 4XGZB 4F8TA 3P9WB 1GYAA 1XH3A 2DJUA 3H9SD 2JCCA 4QTIL 2DDQH 2H32B 3QDJE 1BIIB 4NT6A 4QTHB 4PTTB 3FTGB 4RMTA 3UPCA 1HZHH 2P24A 3MA9H 4NC1E 4NO3A 4NKIH 1ZLWK 4RGOH 4P2QA 1YN6B 4XC1L 4M61B 4MDIA 3TO4B 3D2UB 2MWCA 3ARED 2DQDH 2BXZA 3PWLB 3GIVA 1TLKA 1C5BH 1SMOA 4PJXE 3VXUA 3QUXB 2AEQH 5CZXD 1EBPA 3N1GC 3B9KB 4P23D 5IIEB 5C09E 4LCCB 1XGTB 2GUOB 4MHHI 1DANU 2XWTB 5JXED 3SDAD 2DI9A 2PYED 3GZKA 1KJVB 4QGYA 2DLFL 4X5XB 2L7UA 4PJ5B 3IDNB 1AKJB 3ZL4L 4Y4KD 2BOBB 3S34H 5DQ9A 1KN4H 3CH1A 2HTKC 3W0WA 4NCC1 1C5CH 3S3JA 4TVPL 1OTTC 3MRJB 4PJEB 3KJ4B 1K85A 4WWID 5SV3A 1NGYA 4MXWH 1I9JL 3MRGB 5I15L 1XGQA 3UP1A 1IQDB 3QQ3A 2XZQH 1FNSL 2FIRT 1MRDL 4B0MM 3D69B 4NBZB 4I77L 1G84A 4RGNB 4JFDA 3C6LD 4U0RB 2EDQA 1KLUA 3PDGA 2WWMD 3CFEB 2NY4D 4WU5A 5ICYB 1AFVL 1NLBL 2C3HA 4D0BA 3IYLW 3K80A 1P7QA 1BPVA 5DHXB 4L3ED 4MMZC 3LS4H 3O6FB 1AXSB 1ZT7B 4MA3A 1R3IL 4NKDB 2FD6L 5EU5B 5IB1B 4BA8A 2P5EE 4QNPF 2EH8L 4R2GC 4YBHA 5GSRA 1DQQB 1FVEB 4DAGL 1AC6A 1Q0XL 4XCCH 3T0ED 1NC2A 3CDCA 2R2BA 4KVCH 3BRGC 3MV9B 3FKUS 1JHLL 3O4OB 3PGCB 2VAJA 2Z9TA 4GQPH 2VSDA 2Z0BA 1OLZA 1U2HA 1EJ6A 1FBIH 3BIBX 4G8IA 4ZXBB 1NUNB 5LGHL 2CUHA 2LVEA 1QSFD 3WKNA 4APQC 4ODWA 4YDKL 5M95B 3WIFB 4QRPD 4KDTA 4NDMB 3ZE1E 2DQJL 1V7NL 2Q8BL 2CO7B 3W9EB 2DKUA 6FABL 4ETYA 3MOAL 1FGNL 1TPXC 5D1XD 2VDLL 4YX2L 3BGAA 2AABH 4HHAB 5CD5C 1LK2A 3U7YL 2NY4B 4YK4C 3ARBA 4PJCE 3SE4A 2GSGA 3CDGB 2NXYC 1E6OH 3ILQC 5D2LF 4TVPE 4L3EB 4WEBL 3HI1B 4NC1C 1NDGA 5IJVA 1HSBB 1HSAA 1I7UA 5B38A 3WUWB 4EN3C 1K2DB 4L3AA 3V8CA 3D85D 4JZNB 3EFDL 1NCDH 1QA9B 5CSZB 3WHXA 4B5EA 5LJYH 4LDEB 3V52H 2ADIB 3NZ8A 1FZKA 1GZQA 3O11B 3STLA 4OQ1A 1MHEB 3RIFK 5FOBB 2YHGA 3IJSB 1ZVYA 1FVDA 3C9NA 1J0JA 1PG7W 3LEXA 3HMWH 1EX0A 2G5BB 4XCNB 5DHVH 2XA3A 2IH3A 1I8KA 1BQHA 1VFUA 3OHXB 4K7FB 5JR1L 4MNQB 4BFIB 5CSGA 4P0DA 1H8SA 3I75B 4QRPB 2Q3AA 3E8UL 4W6YB 3EKCA 4WWKB 2AERT 3O9WC 5L9DL 2Z92B 3L5JA 4WHYH 1IBGH 5HHOE 2YUXA 4WGWB 3UAJD 4IJ3B 3MACH 4G43A 3CIQA 4F7MA 3BJLA 2N4IA 4Y5VC 5JOPD 4PJHF 2Y07H 4HIJA 3C5ZB 5MI0B 3TH4T 5I2IB 3DIFB 5DLML 3SEPA 3TPKA 5IESL 4OFVA 5B22A 4PJFB 4FQXD 3L1OL 3BAEL 2DLEA 2Y25A 1P5VA 1NGXB 1ED3A 1KENL 2BSRA 5TDNA 4WTWA 2H26B 1NPUA 5J1AB 5E7FA 4YIQB 4P9HH 4M48H 4IBLT 4F37K 3PQYB 4Y89A 2X41A 2NR6C 5H2BB 5C0NC 3RP1A 3TVMA 2VZVA 5DRNB 4AH2A 2GJJA 4R3SB 3QIUB 3HZVB 2V9TA 4X7SL 1FV1B 2V5MA 2OQJB 2I60L 5IMKB 5L8KB 3AS2A 3LN9A 1UKQA 3FQXB 5IMMA 2APXA 3DRTA 1G7QB 5CWSA 2CR3A 4GG8B 3X17A 2DQCL 1KTRL 1YNLL 2ZUSA 2WANA 1M7IB 2HJKB 2V7HB 4R0LA 4MZ2A 5F9JA 2HA1A 4BFGA 4E41A 4R4NC 2ZUTA 2R1YA 3SKNB 4GLRI 4XPGH 2XG5A 3QCVL 4U1HA 3L7FA 3AU1A 3BMVA 3VXRE 2NY6B 4QOKE 4PREB 4X7DC 1AR2A 3RIFF 3AMKA 1AGBA 4G6ML 1DFBL 4IMKC 4WI8A 5EUOB 3NN8A 5ALBL 4R96B 5C3TA 4TNWK 1AH1A 1BVZA 3D6GA 4M93B 3P77B 2IQ9L 4PV8A 4ELKA 5EUKA 2YEZB 3BPNB 2ZCKL 4AMKL 3KPNA 3MGAA 5EWIH 2DWDB 4DKAA 1MSPA 4O51A 4LHQB 1FL3B 4JG0H 4NCC2 4YDJB 2E9WA 2BY2A 4G9FD 5EDXA 3VU2A 4NQCB 5I1JL 4MCZA 2XRAH 3DVIA 1LO5B 3ELAT 4DK6A 4MSWB 1KACB 3UPRB 4XVJH 4P5KB 4OZGE 4C54A 5C9JA 1AHWA 1OSPH 1VGKB 1L7TL 3L3DA 4XPBL 3EOBA 1CFSA 3QCUH 1MCBA 3PWPE 4XHJD 1I9EA 4ZFOB 2FDBP 2Z31C 1UWXK 5IVZB 2HKFL 1CFNA 2PO6B 4DZ8A 5D1ZA 3IU4H 4KI5F 4XCYA 3UTSA 3BZFA 4YHPB 3U46B 4TUJB 4BSWA 4Y1AB 1J8HB 1D6EA 1KN2H 1AD0B 2CXKA 1F13A 2QSCH 4TTDC 5HJ3B 3ZTNL 3QFJD 3RGVC 3STBA 4PP1C 5KJRL 1P69B 5BRZD 3U82B 3PWJB 1Z0MA 2FNBA 2VDKH 2XWJA 3HPLB 4KQ4L 4LP5A 5KSBE 1HNGA 3O41A 3RWIA 1XF5A 3T8XA 2HN7B 4PJAA 5J11B 2CKBB 2PW2B 2FYYB 4NKOA 3N50A 3CSYB 3KYOA 1JZ3A 2JCCF 3RPKA 2BVQB 3MOQA 4OI7A 4GLRH 3TBSA 1MCSA 4PRAB 4L1DA 2E8YA 4M1DL 1GAFH 5J8OA 3DV6B 5GRXG 4TSCH 4WI6A 2IAMB 4J3WA 5FB8B 5DJYB 3ZDXF 3NMEA 2R9HC 4X6DE 2AK4A 4OSUL 5CMAA 5KVGL 1OGAE 2BJML 3GJEB 4BH8B 3K81A 4O9HH 3UBXG 4M6OH 3R8QA 2NW3B 3O6LL 5D7SH 5KSAD 3C60B 1JPTL 4Y2DA 3M07A 4ZO7A 2YSSA 3HC0A 1S5HA 4P4RA 5C07D 4JRXE 4M8QA 5DDHA 4PJEF 3UZEA 4UILH 4JFOB 1P7KB 3VFNA 5KVEL 3CLEH 3OAYK 2BY0A 3MROB 1NMCB 2VL5B 3S36H 4QRQB 1RIUH 3HZYA 4JM2D 3QHFH 1KNOB 1YEHH 5L2JA 1CFTB 2YXMA 3HZKA 4XCFH 1QFUH 5ISZA 4ZNCD 1QZ1A 2X4NA 5C0DA 1P4LA 1NLDL 4GKZA 1INQA 1ORSA 1EEZA 2X70B 3QWQB 3HS0B 4BZYA 5IFAH 1AGCB 4X6CB 2CDGA 4HIIA 2M8XA 1ADQH 3O3BB 4B50A 4K3EL 5J57B 4DUWA 4LLVB 3E3QE 1CDIA 1CFBA 1RUQH 3RQ3A 3KPRD 1GOHA 3LQAL 5E8NA 1OAKH 3L3OB 5IB4B 1N3NA 4JFHD 3LQZA 5E6ZA 3P40A 2APTA 1WFOA 3NABH 3UO1L 4JHAL 4RMWA 4HZAA 5F9WC 3SE3A 5I17B 3HUJE 5B8CA 2WINB 1AO7D 1OTTD 1Q9LB 4JO1H 4NFDA 5BS0A 3LDBB 4NWTH 1CZ8L 4ZODA 2JCCE 3P0YL 4HAFA 2DJSA 4YR6B 3WLWC 3TP4A 3P4OA 4H0HB 1U36A 2B39A 2ARJQ 5IFJA 2DTML 2FEEL 2R2HA 5HHNB 1VPOL 2X4TA 1YEEL 3ZYZA 1GRWA 2VTFA 2IADA 3ZDXE 5IB3A 1YPZB 4LAQL 5SWZA 1BIHA 3H7LA 5GJSL 3ARQA 4NIKB 3LD8B 3VXUE 5DT1L 1TJIH 3DO3A 3X3FL 2AJVL 3VXNA 1EFXA 4L4VD 5DVMA 2QBWA 4CNIA 4LF3B 1LO3H 4FABL 2XV6B 4GBXD 5D70H 1IM9B 3GDBA 3MUY1 4U1KB 2W07A 3ZSTA 3S7GA 1TJGH 1IKNA 2OJEA 2L4OA 5JW5A 2P44B 2ZG2A 3MR9A 2ORBL 3SN6N 1EDQA 3QA3B 3RTQA 2AXHA 3NTCL 4PJ9B 3SE8H 2BOCB 3OWEA 1HEZA 3N1MC 3Q48A 1OVZA 5KVFH 3W0WE 2VXVH 4CDHA 3BPLB 4J4PA 4FG6D 1U6AH 1BZQK 4NNYA 2XPGB 5LQBH 3WKMH 1ULVA 2X7LB 1TVHA 1FG2B 2Q76A 3EHBD 4LSSL 1RUPL 2VQ1A 2P45B 1MI5A 4Y4HD 4G6AC 5IB2A 4P46A 4P2OB 1BBJA 2JIXD 4O02L 1EMTH 1IZJA 1JZ4A 3S97C 4PJFF 1JRHL 3X12A 1CE1L 5CD5D 2FL5B 4FTVB 5IFHH 2AXFA 1BGXL 4GMTH 4JFDE 5D7JC 4M7KL 3I9GH 3L7EA 2NXYD 1PW3A 2NY3C 4LHUA 3QDHA 4XP1L 5INDA 4MNHA 2DMCA 3GB7B 4AM0A 3QPQD 4OF7A 3VG0H 5LVEA 1WBXB 4EN3D 2L0DA 2R29H 1S7VA 2XI9A 4RIRB 2W9DL 5F8QC 2OJZL 4IRSB 1LDPH 3ALPA 1LEGB 2VLJB 3IFLH 4I0PB 3D0LA 1ACZA 1OP9A 3ARGB 4MD4B 1KG0B 3CZFB 1A7QL 4OZFG 4JKKA 5F1SA 4KRLB 4U1SA 4AENB 4M5YL 5K9QG 4XPFL 4NRZB 2D9CA 5C09D 4D9QE 2HRLA 3OB8A 5EBLA 3OXRA 4HIXH 3N9GL 2OTWA 4KI5C 1KJ2A 1RHHB 4XMPL 2A6KA 4DQOL 4F9LA 1A6AB 5TGBB 2C1PB 4Y4HB 4YEFA 4LRIA 5LGJB 1DQML 2UZYB 4D3CH 2R0ZL 3DX9A 3O9WD 3N85H 4Q9BA 3OXSB 1RK1B 4WUUB 3SBWC 3RWJB 3HZMA 4N9GA 4EIGB 2KUTA 4X8JA 5CEXA 1GXEA 2BSTB 4Y16A 5B39A 4FFVC 3W81A 4JB9H 3EJYC 3WNNA 3B9KC 1EPFA 1FL6A 5DRWB 1PKQA 1GIGH 4NOFA 1UB5A 4WDIA 3BGFB 4M7ZB 4LCCC 4N8VG 3RVWD 3O6MH 5EU4B 2NR6D 4MNQE 5C0ND 1OAXL 5CILH 2WQ8A 2V5RA 2AKRB 2XKNB 3G04A 3KYNB 3NFPB 4ZAKB 4YHNB 4X5WB 1ES0B 4NO0A 1DL7L 2R1XA 3GJFA 1RZ8A 3PXJA 3SGEI 2UYLA 4ORZC 2ZCLH 1F58L 2DRUA 1S8DA 1YJDL 3KPOB 1U8JB 2XY2A 4ENED 4GXUM 4QRTA 3BJ91 4PJFE 5SWQA 1B90A 1UZ8B 1YY9C 3LH2L 4PY8J 1INDH 4LHJB 5E6IB 1BX2B 4O4YH 2P5ED 1HQRA 4GFTB 4UQ3A 4PB9L 4LBEB 4WI4A 4UNVA 2ZJSL 4R4FL 3MXWH 4GRWH 5DSCA 3BDXA 4KTEH 1R5WB 5L8LB 4P5MB 1W72A 1PY4A 2X4UA 4RSVA 3PWUB 2YMXH 3EZJB 1FO0H 3UBXB 5KAQG 2YPLA 1KCSH 1NMBL 4TSBL 3CU1A 3OJ2C 2PXYB 4XNUH 1KTKE 5DJ6A 2NNAB 4A6YA 1JGLL 5DMJB 1INEH 3I02B 1TTGA 3S96B 2QV2A 3O6FC 3QXAA 1X5LA 3LQAC 1B9ZA 1KIRB 3BT2H 4WEMB 3FQRB 1VCAA 1UG9A 1MWAH 2M2DA 5LCVH 4HH9A 1UJ3B 2J88L 2VAAB 5IGXL 1MIMH 4QY8B 5HHMD 3VFPB 4DN3L 1ZXQA 1X4XA 2BVOA 5I1AA 4TVPD 3LKPA 4LSQL 4NNXA 3VCLB 4OT1L 2Z31D 4OCYH 3QCTL 2GIYA 4DOHB 3GI9L 4U0QB 5GS2D 2Y1VA 3OKOA 2VNCA 3SO3B 2OP4H 5ESQA 1MCPH 2EDDA 3MLPA 1B0RA 2HJFB 4E41E 1C7SA 3VJ6B 2FJHB 5GGVH 1CT8A 4UTBL 3U2SA 2ZKHH 4TTDD 1S3KL 3MV8B 4ZQKA 3RGVD 1LE9A 3VD4A 3ZDYF 2OL3B 3EO9L 1IE5A 4JFFD 1BF2A 1T5WB 3FT4A 2GT9B 2EXWD 3HI6L 4TQEH 2P8MA 5JXAH 2LU3A 1T03H 1FCCA 1QVOB 1X4ZA 2YA2A 3QIBD 5D9SA 3DBXB 5F1IB 3EJZD 2NLJA 1DBML 3WEXA 4HJ0D 4WO4B 3FQWB 2V5TA 3RY4A 3L3IB 5EC2A 2BNUB 4LQFH 5D7IA 5HHOD 3RWEA 3AXLA 2YUWA 1EAPB 2GCYB 3C5SA 4EVNB 4LDLB 1WGOA 1WIOA 5E95B 1YQ2A 4Y1AE 1NCWH 1UCBH 1BM3H 2CH8A 3FB7B 3QUKA 2H3NB 3WFBL 2XFXB 2A1WL 2R9HD 3OR6B 5I18L 4OCWH 2HWZH 4F2MA 3IAGC 1IC1A 1NL0L 3ARBC 4MCYB 3MRDB 4NKMA 3SQOH 2HVKA 3ULVF 3HNSL 4KK5C 1JPGA 1T20A 3QPXH 4OGYH 5E00A 4KHXH 5FYJU 3LEVL 3L5WA 1RJZA 1KEGL 2ZPKL 3B2VL 5CKGA 1XZ0A 3BEVA 3UTSE 4WWKC 3VWJA 4OLXH 3RWCA 3ZE0E 2IMMA 4D0DB 3B43A 4I0KA 3DVNB 3MLSL 1MAML 1NCBH 2NW2A 4CVUA 4JFFB 2X10A 4HWBA 1QFWL 1XIWD 3MBEB 4PRID 3C5ZC 5T33L 3FFDA 5F96L 3QIBB 3D39A 1K4CB 2BC4A 4QF1A 1G6RH 5TE6H 4KRPB 1YPZF 4YHOH 2BY1A 3EGSA 3MODH 4J3TA 4RISH 4PJAE 1FH5H 4RGMC 3KLHD 2QQQA 3QAZB 5ACZB 1LGVA 4HUKB 3D48R 5D93C 1VFOA 5HDQL 3VXRD 4QOKD 4LDOB 2DICA 2J8UA 3OB0H 3SDCA 5EFIA 5HPMB 1D5XA 3PWVA 1LEKA 1OAUH 3WDHA 1NFDB 2PCPA 2A74A 2W9LA 4RDQG 4QWWD 5I1LB 1CVRA 1MUJB 4JO3H 3QUMH 4L8BA 1DQLH 2IH1B 1JNJA 1K8DB 3GIZH 5IV2B 4EI6A 1M05B 2AK4E 4GAFB 3EOAA 3I6KB 5JHLH 4DN4H 5T3ZL 4Z5RA 1MNUH 4PJIA 3P73A 1H15B 5GGUB 2IFFH 4ORGA 4BK4A 3TVMC 2CKNA 5I0DA 3B3IB 4DVRH 4NZRL 4O2EB 4LPYA 4YXKL 5HYQB 3T0AA 3IFPA 1J1PH 5GRYA 2EXYC 4HLJA 4X4YB 3MLRL 1W0VA 4GAGL 4UMGA 1IGFL 5CIPA 3T2NL 4J12A 4OZFB 3BPNC 3DSNA 4FQHB 1RVFL 3EUUA 1S7WA 5DQDH 5TDPA 3PWNB 5F70A 2X05A 2OCFD 5DJCB 5F3BA 1SJEB 2VR4A 3SOBH 1Y6MR 4KJWC 1E27A 4R26H 1TZHB 3R0MA 3PDOA 1A9BA 1A6VH 5EORL 2RJMA 4U1LB 4ODBD 4JJ5A 5FDWA 4G9DA 3DX7B 4N8VA 4RCAA 1BAFH 5CUSH 1V05A 3FJTA 4L8CB 2RFXB 3QO1A 2EH7H 1A3RH 2MQCA 3RWHB 1V7MH 2K7QA 4LLQB 3OJDA 4JFPA 1P4BH 4X9BA 5DR5H 1CDGA 1WISA 5DHYA 5KG9B 1O5DT 3QISA 1N8ZA 2PO6C 4PYHA 3FFCA 5DRZB 1IC4L 3O0RL 4M7LL 3VA2C 1JI2A 3IDXH 3QDGB 3TJHC 3BH8B 1QACA 3BEWA 5BS0E 3LN5A 4ZUVA 2X09A 4S1QH 1AHWC 4QO1A 4CDGC 3QHTC 3OAZK 1OGAD 5LBSH 5E2UL 1OCWH 4G6AD 3GM0A 2OK0H 3NA9L 5HXMA 5J11C 3M8OH 3QZWA 4JRXD 1CBVH 2QHLA 1T4KB 3MMEB 5SWZE 1IAOA 1QR1A 5FM4A 3JVGC 3HTLX 2NY3D 3MZGB 5CJOL 3VFRB 4I48A 3RU8H 1C5DB 3OKKB 3LRHA 1ZHLA 4G6FB 5I1GL 1I1RA 1KJMB 1KJ2L 4PBWD 5K59F 4R8WL 3LKRA 4OLYH 1FAIL 2YPVH 5IROA 3MRKB 4EDWH 4HXAL 2AEWA 4LAJH 4NM4H 4PY7B 2UZIL 4M6MH 2DD8H 5L0QC 1KC5L 1G7JA 4OIBA 5AYQA 4DJMA 1EFQA 2A6IA 1MCIA 4UV7H 3GMPB 1KFAH 1KIPB 1JF6A 4Z78B 1OP3H 2XKSA 4NZUL 4IS6B 4H25A 3LHPH 3MLZH 2F5BL 4Z95L 1T7XA 3MREA 3FRUB 3M1BB 4N1EA 1E6JL 1K8IB 3WIHH 3O2WH 5IJKC 4KRNA 1P9MC 1YN7B 1FZOA 4PLJD 1PEWA 1J1XL 5KN5B 2X89A 5CINL 5DI8A 3R8BB 1MI5E 1N59A 2VLME 4KPHH 2ATKA 3VXTA 5C71A 3BDYL 1E4WL 4L4JA 4KVNL 2NY5H 5KSUB 4Y2DC 4HUVA 4KQ3H 5GSVB 3MBXH 4OZHF 3CVIL 3EJYD 3BUYA 5AEAA 4EOWL 3KPQA 3LSOA 4ZOBA 3V4UL 1MEXH 1KIUA 4WW2A 5GRUL 2NX5A 4YDVB 2JB5L 1UM6H 5DC4B 3PL6A 1I3RB 5IM7B 3PP4H 3S88H 3KWWA 4WJ5A 4LSTL 3X3GH 5BXFA 4UB0H 2OTUA 3VA6A 2F9BT 4P2QD 2BFVH 1RIHL 1J05A 1SEBA 4I5BA 4JZJB 4Z7VA 4KZEH 5IG7B 4FP8L 4LEXL 1MRCL 35C8H 3NPSB 4LSVL 2A9NL 4N0YL 5FK9A 1W72L 1A14H 3VFSB 4X7TB 3IKKA 1AQDB 3VXUD 5BO1H 2W0FB 4K3DH 5I19H 1AE6H 1F00I 1CF8L 3LDBC 3SDDD 1IEBA 3UDWC 3UJIL 3LPGA 2QR0B 2ADJB 4DKFH 5EU7C 4UINL 3GKZA 4H26A 4KU1A 5ESVB 3TIDB 4HJJH 4NCDA 4EUPA 1FZMB 3OKEB 4XP9H 3RWFB 4OLVL 3MRPB 1HHIA 1NUGA 1T1XB 3ZYIA 4KKAD 1IM3B 1A9EA 4XBEL 4JQVC 3MX0A 5I9QC 3D18B 1XF3A 2FWOB 1H9VA 3KGRA 3W0WD 4ODSL 3SE3C 3ARPA 5B8CC 3GHEL 3SCMA 1PKOA 1CLZH 1PX3A 4JDZA 1IKFH 4NYLB 3KLAB 4D8PA 2EIEA 2D4DA 2E9IA 1BF8A 3MA9L 1P2CA 4BH7B 5DJ8B 3EO0B 4NNPH 5JOEA 2EE9A 4E0RB 1UM5H 1GGIH 2HT3D 4EI5B 2VDPH 3C5JA 5A16B 4R9HA 2BNRA 3RVVC 2DQDL 4GQ9H 3T65B 1E4JA 1SEQH 1T7ZA 2O26U 5HDLA 1C5BL 4OLUH 3UC0H 4Z0BL 2ITCB 1CFVL 4F7CA 3SDDB 4XAKD 5JOFB 4OZHE 5T5NF 3HNTL 3CMGA 3C6SA 3FZUC 3DLQR 3OGOE 4MYWB 1XMWA 4Y5XA 4AQOA 5DMIH 1Z2KA 4NN6C 4LQ1A 1IKNC 2NZ9C 1YMMD 1H3GA 2AJYL 5EZLA 3RTQC 5GPRA 2NXZC 4JDTL 1ZLUH 3RWDB 1NC2D 2VUYA 4GKSB 4D9QD 3KR3L 1CFQB 1V3MA 3G08B 5CGYD 1ADQA 4S2SA 4OCRL 3PV7A 4UT9H 3MZTA 5I8OL 2YPLE 1LD9B 3MRNB 1TVDA 4PRDA 1QLFA 4YHYC 3VFUB 3VGAB 1KXQE 3IDJB 3MJ9H 4DCQB 4MX7A 4RAHA 2EYTA 5HYFA 1CLCA 4IRSC 5CAYB 1XAUA 2ZG1A 4P46C 4I0PC 2C1OB 3P9LA 1NFDF 4NUJA 4YHML 1J5OH 1HDMA 1T04B 1R3KB 5BQ7B 1CQKA 4HWBL 5DK0B 3TWCH 4B7IA 3G5YA 4FFWD 4HKXA 1T83A 3ZE2F 5MENB 4G8GA 2W9EH 5DGRA 4JO2H 2K1MA 4ELMB 3LS4L 5F8RC 1FNAA 1PG7H 3BKMH 1FL5B 1YUHB 4NQDA 1G7IA 5JW4M 3R0NA 1PZ5B 3L5XH 4U1IA 1N4XH 5F44A 4HK0B 1YMMB 3LQMA 4XCCL 4ZUTA 1EEYB 1M4KA 2XN9B 4OD2A 4N0FB 2FATH 2CLRB 5K9KA 2A83B 3EYSH 1EJOH 3HI5H 4AT6A 4L9LB 3PIQB 2J6EH 4M8VA 3BQUC 1WFTA 5EU6B 4U6HA 5TFSL 2VQTA 1D9KA 2DWEA 1IJ9A 1UYWH 2Q7YA 2ZP0T 3MLVL 3PABB 4F9LC 2KDGA 1M71A 4H1LA 2Q6WA 4LRIC 2DMBA 4ODHL 1UXWA 3MUHL 4ZAKC 4I4WA 3CSBA 1WC7B 3DURA 1JYXA 5E08L 3REVB 3ROLA 2AABL 4S1RL 4JPWH 4Y16C 4G6KL 4OCXH 5E2VL 5IK3A 5JMOC 3CVHH 5FYLL 5GGTA 3CX5K 5E7BA 1KB5A 3CD4A 4NZJA 5D72L 5J9PA 2IALB 3CNKA 3AY4A 4J8RA 3MUJA 1WV7T 3MO1A 1S9XB 3F7YA 1MVFA 2VITB 4KHTH 3TVMD 4HWNA 1BD2A 4LEOB 4L5FH 3RZCB 4KXZI 5DXWA 2R8SH 5GISH 1SJXA 1SBBA 3L3HB 2DQTH 1QBAA 2OZ4H 3GRWH 5FHBL 2OMNA 2EXYD 3BGMA 1B0GA 4PD4K 2EKJA 5MEQA 4Q2ZB 3MGTB 2HFGL 3H3PL 3D39E 2PXYC 4JKMA 5JHDA 3MRHA 1CGSH 15C8L 4NN7C 3GSUB 2D7MA 4E41D 5EOCH 5HYIA 5DJZB 2ZCHH 2WSKA 1A6PA 2HVJB 4HUNB 3M45A 4U05A 4JQXA 4ETQA 4YBLC 1DQJA 1IBGL 1KGCE 3H6JA 3JV4A 3W2DH 1TVBA 2J8UE 3IGAA 1A7OL 4W81A 1PZUB 2V2WA 1R3JB 4PGJA 2JK5A 5I6XC 3LN4A 2E6PA 4IMLA 4MB3A 2ITDB 1T0MA 3JWOH 3UROR 3UTZA 5KAQF 5BZWB 3FOLB 5IUSA 2PUQT 2R23B 5GRWA 2YR3A 5F88B 4KROC 3O2DA 1MCWW 3H9HB 4IM8A 5ID0A 1KUMA 4PJIE 3LEYL 3TJHD 4HS6A 1OM3H 1VFAB 1MRFH 1SY6H 4X80H 5FCUL 3BN9C 4M6AA 3ECBA 3LRSA 3QT2A 1YEGH 3B83A 4NJAL 2VH5L 4PFEA 1N7ML 4PR5A 4Y19A 1UA6L 2DIBA 4XZUA 5H94B 3EZ8A 2XZZA 1N0XH 3MGOB 1FORH 4HUUA 1NBVH 3B5GA 3DNKA 2VKWA 3MRCA 5FYLE 3BZEB 1EXUB 5AD0B 4OV5A 3W9DB 1L6XA 5J6GB 2VC2L 4IRJB 3GSWB 5D1ZD 3UTSD 1NANI 4XBPA 3OGCB 2AXGB 2UWEB 1SVZA 2VZSA 3MCKA 2D0GA 2HKHH 4M43L 5AZ2H 3HAEH 1GGYA 5GRJH 4GW1B 4KXZH 4JY5H 3AS1A 5IEKB 3O4LB 2H9GA 4HFUH 3IF1B 1MFCH 5E8OB 3SJVB 1ZGLP 5DD3H 1U8QA 4GAYB 4P3DB 1ZANL 4FXGB 5EG6C 5J0BA 4TTGA 1CTOA 1MPAL 1D5MA 5JW4Q 1VESA 4NRXA 1BLNA 4FZ8H 1EEUA 1W0WB 4MWFA 3GMRA 1HXYA 1JCKA 2D7OA 3CFDB 3THML 4HLZG 4JG0L 4FQQA 43CAB 4NP4H 2LVCA 1U8OA 4YUEH 5TF0A 3KPMB 4DVBB 4N9OB 1A1NA 3FFCE 1ZHNA 4NQXA 1RFDL 1QO3A 1EO8L 4XVJL 1DLHA 4NQVB 5E8EB 3OKDA 4LIQH 4C56A 4WHTA 3H7BB 2AK4D 5KVDH 3U9UB 5DUBB 1G0YR 3F8UB 3QWOA 1F6AA 2ZUVA 4X9FA 2AAVA 4XPTL 4Y2DD 1UXSB 3E6FB 3PHQB 3BP6A 1UJTA 3TN0B 4KZDL 3F58H 1KN2L 2OLDA 3DXAA 3UYRL 5IEHA 2FIKA 3K46A 3HE6A 3HG1A 3EDDA 3FRPA 3WLBA 1K5NA 2BY3A 4MD5A 3B6SA 3QFDA 3MA7A 3ARFB 5CBEB 1XR9A 5ISZD 1OOAA 3TNNB 1S7XB 1Q9OB 4MJ6A 2Z35A 3TEUA 4JGMA 3GSOB 4KK8C 1I7TB 4P2CG 4WI2A 5HHVH 4PUBH 3U36B 3QIWD 2EDNA 1A1MB 4PRPB 4UQ2B 2HMID 1J87A 3TBSB 4HGMA 1FN4A 2FSEB 4XRCB 1NANH 4NM8H 3TYFA 4LCIH 1GAFL 1HHKA 1C16A 3GBLA 4PB0L 3BIKA 1MCEA 2AJSL 4HKJA 4TSCL 3SDCC 4AG4L 1OT2A 1QRNB 2XZCL 4M6NL 5D8JH 3RHWF 1JWMA 1F4WL 5E56A 1MFDH 4RDQF 1JHTA 2OSLA 3LV3A 4NO2B 4U4BA 4S1SH 3VGBA 4NN5C 2KZWA 1DCLA 3VXSB 1CCZA 1CLOH 3WE6B 3O3DA 2J5LB 2YD1A 1ITBB 5DDHB 5CP3A 5IMLA 1KLGA 4UILL 1UKSA 5SV4A 2NY1B 5BS0D 3CLEL 4K7PX 3K7UA 3LKQA 3A67L 4E42B 1QUNA 5TPWL 1JPFB 1U91B 2NX5E 4AIXA 4HULB 4XCFL 4HKBA 2YD9A 3BWUC 3Q5OA 2AEPH 1ZSDB 2O93L 4XP4L 1NDMA 3ROOA 1YECH 3NGBC 1BJ8A 1A47A 2C3XA 1I4FA 5T3ZD 5D6CB 4KTDH 5SWZD 3QIWB 4LLMA 4Z7VE 4ZDHB 1WTGT 5IFAL 3VXMA 5T1KB 2W59A 1QEWB 3MNWA 1JZ2A 4JFZH 4HSQA 4IHOB 2MPAH 2VABB 2C3WA 4ELMF 3QUZA 1ADQL 5DUPL 4UIMA 1EFXD 1L7IL 1UVQA 3HR6A 4AEIH 3D3VD 3FZUD 3CLFL 1RUQL 1WZ1H 4XI5C 5DJAA 3BO8A 4JDVA 3UCRA 3VXPB 4GS7B 5LAXA 2QQKH 4N90E 5SWSB 1RAMA 4X6EA 4FQLH 1U8HA 4P59L 3RTQD 2EZ0C 2NXZD 3GNMH 2I5YH 2VDOH 2DL9A 1UC6A 3DUUA 4FFZH 1U95A 4YNYB 5EA0L 1CE6B 2EDTA 1HXMA 2R4SH 5C0FB 5ICZA 4PP2A 4J4PD 1RZFH 3MC0A 3Q1SL 1A0QH 5E99H 3V6OA 1RJCA 3TIEA 4PBXA 4BQ6A 3G6AB 4QHNB 1MI5D 4NQEB 2VLMD 1CG9A 2EKSA 4P46D 2C4FT 5KSVA 1YA5A 4JVWA 4DWHA 3T1FB 3BDBA 2YD3A 2CGRL 4F7TA 4P4KA 3ZKXC 1NAMH 5DJDB 5GQBA 1S7SB 4Z9KB 4Q9RL 1NC4A 5IBTL 3DYMA 4M1GL 5C0EA 4LHUD 5D2NA 1XGYL 1E28B 1JGEB 3D3VB 3A6BH 1LO3L 1X44A 1AI1L 1UB6A 3INUH 3L9RA 5J1TC 2AI0L 4QTIH 4WFEE 3S3SA 1RZIA 1Z0NA 1LO0L 4JFXB 2IPKB 3BP4A 3QQ4A 5FYKL 4M03A 4AK1A 3K4DA 3TBYB 5C0BB 3B9VA 1J86A 3GSVB 3SE8L 2XWBA 3P0GB 3QQ9C 4Z77A 2JE8A 4K55A 4X6BA 5KVFL 4FQCL 4DGIH 3VFWA 2EDOA 3M17B 5GGTL 1U6AL 1KB5L 5LQBL 4U1MB 2PR4L 3QB7C 4MJ4A 5TE7H 4P2RB 1IMHC 5ANMB 1PYWA 1IT9H 3KYAA 5GS3A 4F7PB 5TDOA 2ATPA 3IJYA 1X5AA 1R5IA 2ICWB 4G8EA 5IW1A 1LO2L 3P9MB 1U0QA 2P8PA 3KYMA 5IFHL 3GMMA 1QKZH 4Y16D 3SO5A 2D3VA 4MHHG 2X1OA 4UV4H 3JV5A 1X6LA 3GSNB 3ZL4H 5CD3B 1MH5B 4QRRA 4WI3A 4G8GE 1CXKA 3C08L 3MUGA 4LPUA 3F7PC 4WW2C 3RL1B 3U0TA 4WEUD 4HPOL 5DD6B 3PL6C 4OQTA 3IJHA 4TVPH 2R29L 2P8LB 2NZIA 3OPZH 3KPPB 1FVCB 5IVXB 5GS2H 3IFLL 1I9JH 1T6WA 3RI5K 3BP5B 5TE4H 3FO9B 1IGTA 4CMMB 4NO0D 4XNMA 3CZJA 3UYOD 4Q74A 5I15H 2Y5TB 2G9HA 3QRFM 1JK8A 1KPUA 3SGKA 1PQZB 1MRDH 5I1DA 2FX7L 3FONB 3MV7A 2YXFA 3FQUB 4OTXH 3C8KB 4CW1B 5E5MA 4HIXL 4R6UA 4QHLB 3MJ8B 4GUPA 5CLWA 5KTEH 1KOAA 1R24A 4WVRA 1F02I 4NZTL 5EZOL 5IMOA 3VE0A 2UWEF 1AFVH 1NLBH 5J1SC 1R0AL 3SGDI 5H35B 3VG9B 1CU4H 1S9VB 3O2DL 3SPVB 4K3GA 3DTXA 4D3CL 4Y4FA 3N85L 4YO0B 5FYKE 3VWKA 4ZUUA 2FLBT 2G75B 1CICB 2EH8H 3U9PL 5E1AB 2F54B 1CGXA 1OAQL 1YNKL 4HJGA 3GUTB 3NOIA 3HE7B 4DAGH 4DGVH 3LKNA 4JB9L 4YBQC 3S4SA 1ZLWH 1Q0XH 1GHFH 1AGDB 1BBDL 1FL6B 4HGKC 4R97C 1G6VK 4WHYG 3SCMC 1YYLL 5FO8A 3S3PA 2LTQB 5I8KL 3SKMA 2V2TB 2XKUA 1E4KC 4CU8A 9CGTA 4KROD 4HGWB 4YHZL 4KK6C 3L3GA 1JJUA 4FHBD 5LGHH 1KXTB 2XTJB 4LL9A 4XNQA 5ENWA 1S9YA 4YDKH 1BD2E 4POYA 4F80A 1H3UA 2DQJH 2Q8BH 3WNKA 3QDMA 6FABH 3DSFL 3ARUA 4YH6A 1FGNH 3O81A 1MLCB 1A4KB 2VDLH 43C9B 3NACH 5ETUA 1QPPA 2BMKB 4P2YA 3U7YH 4NC2B 2UZXB 5ABDE 3G6JB 4HC1A 5JHDE 2EICA 1JNHA 2YRLA 4XB8A 4LPXA 3OX8A 3K3QA 1SHMA 2AJZB 2AGJL 2GSIA 2V7NB 4R7NA 2XA8H 5C6TH 4H8WC 4LCWA 2V9QA 4HXBL 4BSVB 4OFDA 1ZWIB 4U1GC 3U4AA 3QDAA 3MCG1 1OLLA 4KTEL 3JV6B 2BVPA 3EFDH 5JMRA 2WIIB 3D87B 2NYYD 4S0TD 4JRYB 3FO2B 2YBRB 1X5JA 4WU7B 4GW5A 1HINL 4OLEA 1G7PB 2DYPA 4K71B 3RX5A 5L88L 4CN4A 1JWUA 4KAQL 3HA0A 1BZ7B 2CLZB 2FH6A 3TCLA 3BW9B 4AL8L 1HOCB 3NIGF 1D5BA 2XT1B 4U1JA 3SGDH 1YQVL 5ITFB 5JR1H 1II4E 4JPKH 3U7AA 4OLWL 4UU9B 1BJMA 5ICXA 4ISVA 5L9DH 4D0CB 1MIEL 3MNZA 1BOGB 4H5SA 4Y19E 1N6UA 3K8LA 1NCNA 3QJHB 4F7EA 2BVYA 4KDWA 1RZGA 3RIAK 5DLMH 5IESH 3RJQB 1DBAL 3BAEH 2VERN 2VLKB 4NGHL 1KENH 1KPVA 1L9NA 4FA8A 1Y0LA 2P42B 4U33A 1LE5B 5A2LH 3VWJD 2C3VA 1ACYL 1K4DB 4QXUL 1VACA 2QKIB 5DK2A 3VGEA 3DX6A 3EYVA 1HWHB 4X7SH 1S9WB 2GKIA 2I60H 2EDLA 1ZHKA 3AAZB 4OCMC 3D39D 5EPMB 3U6RB 1I8IB 1J8KA 3BWAB 2E7LA 3GMOB 1T66C 4C59B 4OIIH 2BK8A 3VGHA 2DQCH 5C08A 1D9KC 4KK8D 4TSAL 5CP7B 3GSQB 5HY9A 1F3RB 4LQFL 3W39B 2N56A 2XXCB 1KGCD 5EO1A 3RZCC 2ENYA 1NCWL 1GGUA 1T21B 1BM3L 3QO0B 3QCVH 2BNQA 2P7TB 4HZLA 4I2XB 1XCQA 1GGBH 1F90L 2VZ1A 4L29A 2HWZL 2WP3O 5EN2A 2ARJB 5DJXB 5I1KL 4KUCD 5C0AB 3S35X 1DFBH 3JWDL 5ALBH 4ZFGL 3T3PE 4C56E 2H6PA 1S7TA 3IETB 3QPXL 2QADB 5IHUH 3NZHL 3BZ4B 4EEEA 4KHXL 2IQ9H 3CCHB 1G0XA 1PBYA 2UY6A 4LCUA 1BZ9A 3ZKMC 4AMKH 1CK0L 3X14B 1MREH 5ADPL 3DO7B 3FT2B 1ZVSB 3EYFB 2R15A 3DXAE 5DFVC 4JCMA 3WBDA 1WTLA 3ARDA 5DURD 5ILTL 4Z76B 5HYSG 5INCA 2YK1H 2CLVA 3L3JB 4RAUA 1FC2D 2CPCA 2F58L 2VR5A 3HG1E 3MLXH 2IG2L 4PTUB 4RFNB 4XP6H 3CFBA 3RNKB 4XNZC 1BHGA 3WNMA 1G6RL 5FYLD 2O61B 1VHPA 4YHOL 1L7TH 2WZPD 3MODL 5FECA 4RISL 1FH5L 2QSQA 1X6NA 3BH9B 2DQHL 2PNDA 5DJ0A 5HI4C 1LNUB 4YDIL 4JHBA 5DVKA 2CIIB 5F9OH 4JQXC 2HKFH 4F33B 3MYJB 4J3VA 5FF6B 3V6ZB 3JZ7A 2I24N 1UCTA 1LO4L 4XNYH 3ZTNH 2I9TB 4JO3L 1DQLL 5EBWA 2G2RB 5KJRH 4G80B 1WIPA 4KQ4H 1L9MA 2AV1B 1GC1L 2EZ0D 3KG5A 1HHGA 4DN4L 2YPKB 1MNUL 2GK0B 1FFRA 5I73B 1Q1JL 2C4FU 3TC9A 2GTZB 3IVKA 3CFIC 3FFCD 1DUZB 2R1WA 3MJGX 4ONFL 2C9AA 4C55A 1LP9A 1I85A 4DVRL 5I66B 1BVKB 3FHQA 1FC1A 1G7MB 5JDJA 2Z8RA 5DF0A 4P48A 4M1DH 1J1PL 1I9RL 1HH9A 1U93B 5F7WC 5DD0L 1G7LA 4LGRB 1F6FB 4ZFFB 4QYOA 1RUKH 2GJ6B 2V2XA 1IAIM 2FEEI 2F74A 4DGYL 1JGDB 4ZO8A 3WDIA 2ICEB 5KS9A 3PJSA 3QWRA 3O6LH 5EZIL 3VXME 2W91A 4CMHB 1QBLH 3MJ7A 1ZGLB 2BVEA 5T1MA 1OTUC 3WFCH 3NFNB 4PJGA 4WNQA 5IVXF 4Z7WA 1Q94B 4RMRA 5D5MA 5DHVB 1IAKA 4PJ8A 3X13B 3Q6FB 1ZLVK 4XP5L 1S78C 1P4BL 4KMTH 3FO1B 1U8IB 3BD4A 2PTTB 1V3KA 3QQ9D 3A0OA 2ADGA 1NLDH 4PJDA 3TN0C 1X5YA 4Q6IB 1FAKT 4M4RA 3G5XB 3STZA 3LPFA 1UWXH 3HRZB 2VIRA 1RQ5A 3RA7H 1T2QL 3ZLQC 4K3EH 3Q6GL 3QUYA 2GY5A 5LBSL 1DDHB 5FKPA 3V6OE 2OK0L 4HT1L 4XH2B 1UACH 2X89D 3UPAA 1JYWA 3SY0B 4BM7A 3M8OL 3LQAH 3MFFB 3WL9B 1GH7A 3KPLA 1IAOB 1B2WL 5I0ZA 4Q0XH 3VRJB 1EBAA 2CO6B 1WBYA 1NGPH 1DVFB 5EU3A 1M6OA 3LAFA 3RUGA 3PE9A 3UO1H 4JHAH 2Z4QA 5D2NE 2NX5D 3HE6C 4OLYL 3PL6D 4Z7QF 4PY8I 4MLIA 2ESVB 4AIZB 4XXDB 4ZSOA 5ITBL 1I1YA 4NM4L 3CPLA 2R2EA 5EO0B 2DTMH 2DD8L 1VPOH 5D6DA 5B3JE 1YEEH 1IC5L 1FSKC 3PNWB 4ZYKB 4LMQE 4IOFC 1VGEL 4UV7L 4HX1A 4L9DA 4LNVA 1KFAL 4LAQH 3MRFA 2APWA 4NKQB 3G6JF 5ID1B 5GJSH 3MLZL 4XPHL 1U8MB 4JN2A 5DT1H 5JORA 5TH2B 3K4AA 3X3FH 2AJVH 3O2WL 4N90D 1U92A 3X11B 4O2FB 4RNRA 1TQBB 5IBLC 4J6RL 2CK0L 4KPHL 1I8MB 4U7KA 3WSQL 3FHAA 3OJMB 5D96B 1S7UA 4PGEA 4JPIB 4LLDB 4X6FB 2OYPA 2GTWA 2ORBH 5BZDA 4Z7OE 3MBXL 3ULUF 4GKNB 3H0TB 5F89B 4ZOAA 2IBBA 1MCCA 2VN4A 4QRRE 2W38A 3QNXA 1U8PB 3PP4L 1CDCA 4HC1L 4UB0L 3HMXA 3R4DA 2YWZA 5H8DA 2SEBA 4JR9L 4ODUA 5GJTL 3IFNL 3JWDC 1HILA 4ZUSA 1FFNA 4ZS7L 3AUVA 4LSSH 2BNRD 1VA9A 3NIFF 1RUPH 3RJDA 1TCMA 4KZEL 2AXJA 5J6HA 4W6XB 3V5DA 3H3KA 5BO1L 4J7RA 4O02H 2FJFB 4K3DL 2A6JA 4QGTA 3MV7E 3TBTB 1VB9A 3P4NA 1UQSA 5JLZA 1CE1H 1BGXH 4WFED 5HGHA 4M7KH 5CZVL 1EERB 1JNLH 1M7DA 5E2TL 3WFDH 4TNVK 4L8DB 2HH0L 3EAKA 4LSRL 3CXDH 4LCYA 4U49A 2ZOKB 5FCSH 5HD8C 2W9DH 2OJZH 4LLYA 2MHAB 3GMLB 3QRGH 4MAUH 4RA0C 2IANA 3FB5B 1PLGL 4OAWA 4YPGA 5DC0A 4L8SB 2BX5A 4M62L 4YFLI 1TNMA 2ED8A 4NO5B 4ZPVB 5C0CB 5LXGL 4XPFH 4I18B 3ESVF 3ULSA 1FFPB 3BHBB 1PD6A 4MAYA 5CCKL 3N9GH 4NNPL 3V6OC 2VZTA 5F7HA 1HNFA 4XMPH 1A4JB 4APQA 1JF1A 4DQOH 5HYSB 1K3ZA 1E4XI 4GQ9L 1GC1C 1ZA6B 5FDYA 1RJYB 1KULA 4KKBD 2R0ZH 1AGFB 1SEQL 2YC1A 4OLUL 3DUSA 3ZSSA 5I1CL 1QSEB 4JPVL 5DVOA 1MAJA 1BFVH 3QDME 1FZJB 1K6QL 1BJ1J 3T0DA 1T6VN 3T4YA 4G8GD 3MRLA 5D2NC 4NRYB 4MD0A 2VE6A 4ZTPL 3ULUE 3DVFA 3VMOA 4PYGA 2E5EA 4OV6F 3IKCA 4NQDD 1H5BA 2ERJC 3B2UD 2FHFA 3DI2B 5DGQA 4MNGB 3K8MA 5K9JL 4DEPB 3LOWA 3PV6B 1KCUL 5CEYB 5C0IA 5DEGA 5FHAL 4ZMAT 1OAXH 5IVOA 1KT2A 3KDMB 1YMHB 1KTDB 1FLRL 3BUTA 2Y36L 4JFEB 3EYOB 2D7NA 1ZLSH 4NSKA 1T66D 3VDBA 2VQUA 3RVUC 3KNBA 1D9KD 4U31A 4J2XA 1G9NC 2BP3A 2D03L 2VLRA 5IW6B 4QRUA 3QEGL 5FYKD 1JTTA 3LKOB 1FYTB 1DTUA 2A6DA 4PB9H 5CFHA 4OKVB 3GSRA 2XQYK 4PRNA 2JJVA 1WEJL 1JUFB 3NBNA 4JAMA 1W8NA 1YNTA 2V6HA 1KIQB 2IQAB 4KJYA 2VXQH 5IHZA 3MTRA 5MEPA 5ERWB 1MHHA 4PG9B 3GSXA 4MVBC 1EO5A 1A22B 3VXQA 1XF2A 3RDTA 3HR5B 1PG7L 4IOIA 4TSBH 1NMBH 4YGVB 3BKML 4NQDB 4PS4L 2GITA 2XICA 3EFFB 4YFDB 2FR4A 1DN0A 1WWAX 1C1EL 5C0GA 3VG9C 1ZOXA 5BMFL 3F5WB 1BD2D 3MCLH 1OGTA 4OJFL 1UWEL 3FB8A 1E4XH 4HEME 3AS0A 2NTFB 3T08A 4JY6B 4ERSL 3EDEA 3OQ3B 3P2TA 4GMSL 3SGKC 4U1NB 1WITA 2J6EL 1EK3A 4HUWB 1QFWI 2P5WB 5IGXH 3KAAA 4JFQB 5JHDD 3O3EA 5T5FL 1U58A 4DN3H 4FXKA 5HI4D 4LSQH 4OT1H 2J12B 3QCTH 5C08E 5I1JH 1MCKA 3GI9H 4Y4FC 5KW9L 3LKSB 4CADB 3UEZA 4BYHA 5CJBA 5HGDB 2XTJC 3LMJH 1KCRH 1NGQH 2G5RA 1XGRA 4Z18A 3MRBA 4UTBH 4DUVA 4WV1A 3SGJA 2BNQE 1H3PL 1S3KH 1MLBB 4GW4A 1IGJB 4X4ZA 1YEFL 3RPIB 2VB5A 4DKEL 3EO9H 4FNLL 4Y7MA 1WF5A 1ZMYA 3HI6H 4QHUA 1HIML 3GK8L 3H8NA 1XR8B 4PG2C 1U8KB 3FN3A 4HIHA 4RWYH 5MP6H 3ZKQD 2HG5A 4L5FL 5HHPA 3F7RA 1AGEB 1AD9B 5GISL 2R8SL 3BP7A 1V8HA 4LPVA 4MJIA 2Q86A 4HK3N 2FX9L 1A6TA 2OZ4L 4Y19D 3BKJL 4ZG1A 5HVWA 4BJLA 1OD9A 4HEPG 3DX8B 2X1PA 3ULUC 1TZIA 1CGSL 1S7RA 1U3YA 2DF3A 1IGYB 1MFNA 5D7LB 4NQTA 5DEFB 1CN4A 3FQTB 4YZFE 3VH8A 3TNMB 1C08A 1LK3L 3LEVH 4IIQB 2RHEA 3IAQA 4MB5A 3VRIB 1OTUD 3PHSA 3U0PB 1KEGH 1BQLL 1IEAA 5I8CA 1DEEB 1ZS8B 2J4WL 4N5UA 4NPYB 3U4EB 4NZDA 1I7ZA 1RZKC 3MRRB 4LNRA 2W0PA 3MLSH 2DQUH 4R90H 3JWOL 1S78D 5HYJA 2ZSWB 1OL0A 3QEHA 1IFHL 5T33H 1U3HB 5DA4A 1VFBB 2WP3T 2X4SB 1F3JA 1MCOL 3JSSA 1I1CA 3QEQB 1ZAGA 1P6AB 3NVQA 3OTTA 1I1FB 1AR1C 1Z3GL 3CFJB 1NGZB 1OM3L 3V6FA 4JGJA 2EYSB 1LP9E 4MXVF 4OF8A 3C09C 1MCNA 1YEGL 5HDQH 3I6GB 1CDUA 1A1OB 2LU4A 1NBZA 3IDMA 1N0XL 3NFSL 1ND0B 3TT1L 4C56D 4HMDA 2KL6A 3QULA 5T1LA 4HKZA 3NCMA 5EOTB 2VLLB 2GQHA 1RULH 1T7WA 3BPCB 3FQNB 1YDPB 2Z93A 4ZPTA 3CMOL 5KS9E 8CGTA 4J1UB 2EDWA 5DUMH 5AZ2L 5GRJL 1A3QA 3T4AB 3DXAD 4YLQT 3KPSA 3QI9B 4I9WE 1FLTX 4HFUL 1FFOA 3HE6D 3HG1D 3DUHA 4OF6A 4LOUD 5DTFA 4G3YL 4PJGE 5IKCB 4NZRH 3U7WL 4Z7WE 1XGUA 2XQBL 4YXKH 5D5ME 1SJHB 3HCVB 1RJLB 2XIDA 4FZ8L 3T0BA 1HXYB 4OD3H 3MLRH 2QADC 3GHBL 2JB6B 4EDXA 4NP4L 1IGFH 2IF7A 3T2NH 4IOFD 2BSSA 5EOCJ 4QT5B 4D9RE 1RVFH 4YUEL 3OKNB 3GMNA 4GRWB 5D2LA 1J0YA 4DZBB 3IDGB 5F9AC 4PJDE 2VXUH 4AJ0A 2R2CA 4YC2B 2F53A 4WY7L 1MQ8A 1NBYA 4ONHA 1FO0B 2LQRA 1T3FA 5I30L 5EORH 2B1AL 4RFNC 3AB0C 4LIQL 3HMXL 1C12B 3P0VH 1T0NA 3ZDZF 5IBLD 2C7UA 4RZCB 2ESVE 3I50L 3BKYL 2W92A 1D5IH 3BE1H 5E03A 4ZNEA 3K1DA 1CD1B 2PYFB 5KOMC 2EIZA 4QXTA 4N8CH 3T77B 3F58L 1MQKL 1MWAB 2B4CC 2HFFA 2QHRL 4CVZB 3V5KB 1MY7A 1IC4H 3O0RH 3TPUB 3ARDC 2P4AB 4M7LH 4RAVA 1NFIA 1T1WB 1F2XK 1T22B 3HFMH 1RPQA 4V1DB 4MXVE 4Q58C 3V0WL 4OZ4B 4LGSB 1IL1B 1Z9OA 4XCEA 4JJHA 1Q9WB 3F12B 3TLRA 3VFVB 3VXOB 4ZSOE 5SX5K 4PJHA 5E2UH 3CU7A 5C8JA 4J3SA 1HKLH 2X5PA 3OZ9L 3NA9H 3VXMD 1LEIB 4NM8L 3UTOA 4LCIL 5C2UB 5E9DA 1C16B 4D9LL 5GGRB 3QUZD 1FNEB 3HHRB 2ILLA 3DJ9A 2CSPA 5CJOH 3PHOA 2WUBH 3QH3A 3QNYB 5EBMA 1TIUA 2LV4A 5I1GH 1KJ2H 3BESR 3MRMA 2NY0C 4R8WH 3QG6A 4S1SL 3UTQB 1FAIH 4HIEB 1EEQA 1HQ4B 2D0HA 1DBJL 5IF0A 4OD1L 4HXAH 4TUKH 1I7RB 2CRMA 1ZA3A 4U2ZA 2UZIH 1TETL 3OKMB 3QJFA 3WFEL 3ES6A 1KC5H 1F11B 2WBJB 1YEDB 4UUJB 4MB4A 5D1QB 3VD5A 5CHNA 5HTSA 5T3XL 4W6WB 5HGAB 3O8XB 5FGBC 2B5IB 5F7DB 3WO4B 4NZUH 4P5TB 5E8PB 4GRMB 4HS8L 2F5BH 3MOBH 4Z95H 4N0UA 1ZHBA 4QKXB 3UJJH 5JQ6L 4LASL 1E6JH 1GZPB 2Q7NA 3BKCL 4XWGL 4P4KD 5J12C 2DQIL 2W60A 3BIAX 1J1XH 5CINH 1Y18B 2JJTA 3S6CA 2Y4SA 1E4WH 5EULV 4U6YA 5C0JA 3TO2A 4WHDA 5J3HC 2X4QB 3FOMB 3L3KB 1ZT4A 3WN5A 5D7KD 2NY2B 4L3CB 3ZT7A 4EOWH 4JANA 5C0CE 5I76A 3NPZB 1G6RB 2CIKA 2OM5A 4XWOC 5GRUH 2GFBA 2FJGA 2EYRB 2JB5H 4PJ8C 4M02A 1WZKA 4P9HC 5DS8B 4LSTH 1SYVA 1I1AB 3WD5L 5IOPB 3DHMA 1QFWM 2I5YL 3S5LB 3OR7A 4E5XA 3DUUB 4FFZL 3IFOA 4FQ1L 4YXHL 1HHJB 2DTSA 2R4SL 3GBMH 1BVLB 2IANE 3OAZH 1MRCH 4FP8H 4LEXH 4LSVH 4XGZA 2A9NH 4N0YH 3O3AB 4NFCA 1D6VH 1W72H 1QBML 4OCSH 1R3HB 1A0QL 4TRPL 2H32A 3QUMB 1BIIA 4QTHA 1CF8H 4PTTA 3FTGA 4XVSH 2WK2A 3QUYC 2DQFB 1KLFA 4A6YH 2E7HA 4UINH 1PFCA 1HYSD 4POZC 4YXLH 4MNGE 4KK9D 3KS0J 3ARXA 1YN6A 4NFBA 4ZS6C 1ZTXL 3QP3A 4M61A 4OLVH 4JFYB 3TO4A 3D2UA 1KTLB 3TA3B 4XBEH 1JYVA 3PWLA 1W8OA 3VI4F 3A6BL 4QRRD 3UJTH 1AXTL 3RVXC 4MVBD 4AQ1B 1GPOH 2Y23A 3QUXA 4ODSH 3B9KA 3INUL 4C83B 4ZO6A 5IIEA 3GHEH 4X4MA 3UTTB 1FNLA 5T3XE 4Z7NE 1YY8B 4KV5F 4X9HA 1WCBB 4NQSB 4LCCA 1PJ9A 3IDUA 5E94B 1XGTA 3KXFB 2GUOA 1BEYL 2XWTA 5IB5B 5BVJB 5D6DC 3BPOC 2XTLA 5D96C 2VKXA 2BRRH 1KJVA 4HS3B 4X5XA 3WDJA 4GG6B 3MV7D 4PJ5A 4XBGB 3IDNA 1AKJA 2DLTA 4DGIL 2BOBA 1FHGA 1A6WL 3IDIA 5J4MA 5TE7L 4Z0BH 3MRJA 5E5UB 1CFVH 1IT9L 4PJEA 3V0VB 5GS1B 3K74B 2VLRE 3BISA 5DO2D 2VXSL 4PRBB 4Y4FD 1TITA 1F2QA 3HNTH 3TZVB 3MRGA 3VWKD 3DMMD 1R5IB 5IW1B 5BV7L 1IQDA 1KELH 1QKZL 3D69A 4UV4L 5GGQL 1G7HB 2AJYH 2MJWA 3U30C 2VUOA 3MRIB 4JDTH 1J0IA 4PLKD 3L5IA 3KR3H 5KZCD 2P5WE 3CFEA 3H9SB 5ICYA 4K7PY 4OCRH 1VKXB 4YAQB 3O2VL 1WZLA 3OPZL 5I8OH 4OZIB 3G9VA 2JJUA 5DYOB 3BVNB 4ODVH 3O6FA 1AXSA 1ZT7A 4NKDA 5TE4L 5EU5A 5IB1A 2Y5EA 1Z5LB 4K23H 3QDMD 2W1NA 1DQQA 3AREB 1FVEA 4YHMH 3QEUB 4OTXL 3G5ZB 4OI9A 1H3WM 4L8SC 4HWBH 5KTEL 4PGCB 4P57B 1SM3L 3MLWL 3RL2B 3RVTD 3MV9A 5FXCH 2FZ3B 4I18C 4P23B 3PGCA 5C70A 2VDML 5JIHA 2DQGL 1TENA 1CU4L 5GXBB 1MFAL 4LCWD 4ZXBA 5FO7B 3VGGA 3DMMB 1S7QB 5JNYB 4Q9QL 3MJ6A 3WIFA 4HG4K 4NDMA 3SDAB 4CUCA 3TBWB 2PYEB 3W9EA 4DGVL 3GKWL 4UAOB 1S9KC 2AV7B 4Y4KB 1GHFL 2VXTH 4HFWB 1R5VB 4HWEH 2RB8A 4HHAA 5EIIB 2DYPD 5KZCB 2RR3A 3ZYOA 4RQQB 3CDGA 5GRVK 4GRWF 3K4ZA 2ZNWA 4MAYC 1F6LL 3VD7A 5TFSH 2YD8A 4L3EA 3HI1A 4LLWB 1AR1D 3MLVH 1HSBA 5ENWB 3WUWA 4BK5A 1K2DA 4JZNA 5CSZA 1QA9A 1Q0YL 3FB6B 2ADIA 4MJIE 4K3HA 3O11A 4GRLC 4ODHH 4BKLB 1MHEA 4MQ7B 5FOBA 4LKXB 5E08H 1ETZB 3C6LB 3HB3C 3IJSA 3NACL 4HCRA 2M26A 1VADB 2MOVA 3WNOA 2CD0A 4S1RH 4XCNA 2G5BA 4FQIL 4G6KH 1FCGA 2EO1A 3ARRA 5E2VH 4CJ1A 4CVXB 4YHKH 3K8KA 5CIPH 5DZNA 5FYLH 2YD4A 4LVNC 1JE6A 2L7JA 3OHXA 2XA8L 4K7FA 5C6TL 1H5BC 5D72H 1N5YH 1FQ9C 3QEQE 4MNQA 4BFIA 3I75A 4KJPC 4QRPA 2ED9A 4N0CD 3TJEH 4WWKA 2FCBA 3CFCL 2Z92A 2HJLB 2O5YL 1P84J 3P11H 3IXTB 3NIDF 3QG7L 1X7QB 3T0EB 3C5ZA 5FHBH 5I2IA 3VFGL 1WBZB 3DIFA 3HAEG 2OMBA 4PJFA 5HYJE 5C08D 3VD9A 4K8RL 1NGXA 1OHQA 1QBBA 4WRLA 2HFGH 3H3PH 2H26A 5J1AA 15C8H 4GXVH 4YIQA 1QSFB 3A6CL 3QNZB 4JPKL 3PQYA 1MVUB 5H2BA 2DI8A 5DRNA 1HH6B 4LK4A 1WLHA 4R3SA 3QIUA 3HZVA 5GHWL 1FV1A 5D1XB 1A6ZB 2OQJA 3NCJL 4G8FB 1OWWA 2ICES 5IMKA