5AOLA

Structure of the p53 cancer mutant y220c with bound 3-bromo-5-(trifluoromethyl)benzene-1,2-diamine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
197
structure length
197
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Exploiting Transient Protein States for the Design of Small-Molecule Stabilizers of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5aolA00
2X0UA 2AHIA 5BUAA 2IOOA 1E50A 1EAOA 1T4WA 4L18A 4IBZA 4LO9A 1TSRA 4GUQA 2J1XA 3Q01A 3EXJA 1TUPA 4MZRA 5A7BA 2MEJB 2J1YA 3US0A 3WU1A 4IBVA 4IBYA 4AGPA 1EAQA 4XR8C 5LAPA 5G4OA 4IJTA 3D0AA 2OCJA 4AGQA 2AC0A 2P52A 3QYMA 3D09A 5AB9A 1HJCA 4LOEA 2J1ZA 3US1A 2IOIA 2WGXA 5AOJA 1GZHA 1YCSA 4A63A 3D05A 4KVPA 3VD1A 3WTUA 3VD0A 3WTYA 4GUOA 5G4NA 2BINA 2J21A 3TS8A 2RMNA 4QO1B 3ZMEA 2GEQA 3IGLA 3D07A 2H1LM 1GZHC 5ECGA 5KBDA 3QYNA 5AOKA 5G4MA 2PCXA 1HJBC 3WTSA 4L0ZA 4MZIA 2XWRA 3WTWA 4LOFA 2X0WA 3WTXA 2IOMA 3WTTA 2BIPA 3Q05A 3IGKA 2ATAA 2X0VA 2ADYA 4IBSA 3WTVA 2VUKA 4AGLA 2J1WA 2FEJA 3KZ8A 4AGNA 4IBQA 1EANA 2J20A 4AGMA 1HU8A 1CO1A 3VD2A 4G83A 5AOIA 5LGYA 1H9DA 4IBUA 3EXLA 4G82A 3KMDA 3Q06A 2BIQA 2XWCA 2J6WA 1LJMA 5ABAA 4IBWA 2BIMA 2BIOA 4AGOA 1IO4C 5AOMA 1KZYA 1CMOA 5AOLA 4L0YA 2YBGA 4HJEA 3D08A 3D06A 1UOLA 4IBTA
chains in the Genus database with same CATH superfamily
2JKSA 2HSIA 4Z7NF 1NAKH 3UDWA 3CZNA 5HJDA 3WYRA 4JZOA 4HEPG 4ZFFB 4FHBD 4PJCE 1OT2A 5I1CH 2ZOOA 4HIPA 2WVVB 3PP3K 1ONQB 4HIIB 3QIUA 3V5KB 3ZT7A 2NXZD 1VB9A 5JIDA 4IU3A 4YE0A 4BZ1A 4GEJA 3TV3H 5AD0B 4IRJA 2H2SC 4PEEA 3FUFA 1NKGA 5DHVH 4LNVA 4CSZA 2K1MA 4Y4FB 3TZVB 4GH7B 3C2AH 4ZPTB 4U1KA 5AKTA 1KPRB 4D9LH 2P7TB 2ZUQC 2PTVA 1G4MA 1YEGL 1CGWA 2FATL 4D0DA 3ZO0A 5CBAB 1UFUA 3QS2A 1KBBA 4XP9H 4AVKA 5MEOB 3BPLC 5EFIB 5AW0B 5IQOA 5EHFA 1AR1B 5DWPA 1S9VB 2JE8A 3NK4A 1OGTA 2ALWA 4HS8L 5EZIH 4B95C 5MENB 5K1NA 4G80B 3C08L 3BSZA 3RDTC 5EPMB 1ID5I 2G5BB 3C9NA 3H55A 4XXWA 3RNKA 5F7BA 3W2DL 1QNZL 1D5MA 4G7YL 1KTKE 4JDVB 1CF1A 4JRFA 3RHWF 4LSQL 2D9CA 5IHHA 3CK0L 1DDTA 1C5DB 3GBNH 3N1QC 3NJVA 4KQ4H 1GGCH 2E74C 4NQVA 5H37A 1XGUA 4CMMA 5CJ8A 1FV1B 4JPIA 3WIHA 3VGEA 4F33B 5IG7B 4I87A 1EBPA 3QDGB 3FKUS 2WKLA 5DRZA 1FP5A 2RB8A 3FHAA 3MOAL 1JK9A 2X4QB 3I9AA 4ZS6C 1VENA 2QPUA 5F7EL 3EADA 4QXTB 1X5MA 5CR1A 1CICC 2FSEA 3MCLH 3ORJA 4WHDA 3B4NA 3LZNA 4ALAL 4QXUL 3TJHD 2CO3A 2ZQKA 4I4WB 4J2XA 2GJZA 4GRWB 1EVUA 2ZUUA 4WI3A 3BH9B 4X5WB 2WTPA 3OR7A 5GJSL 3GS0A 4MD0B 2WMPB 4LSTH 3RJDA 5CCKH 2YD3A 2R2HB 4M3KB 4F80A 3CU7A 4O58L 3TBBA 2XPGB 4X8JA 3RX8A 3HMXH 2YXMA 5C7XH 1X5IA 4N2LA 2A6IB 3ZTDC 2WNGA 2A3TA 3NJNA 3DX7A 2QVMA 5GGTH 4S1QH 4FFVD 1KLUA 1U8IA 4WWPA 5DRWA 1C1EH 3VA6A 1ZSHA 4G82A 5DJ8B 3OG4B 3BLBA 2ZNWA 1PZCA 4QHMB 3P77A 4UZGA 3VNYA 1MCFA 3BKJH 3H0TB 3KNBA 3KS0H 3NABL 3SY0B 3TV8A 5B7FA 4AL8L 3D52A 3P2DA 1LP9E 2GTWB 5LNDA 1YY9C 1MI5B 2YK1L 2ZOUA 2ED8A 3IPBA 4JGNA 1U33A 4JZJC 4F15B 1WBYB 3L08A 3RA7L 4J6IA 3ARGA 4HWBH 1T6BX 3HZ3A 2CUHA 2R4SL 3QIBD 4MWFB 5C8JB 1KBPA 4H0GA 4P23B 1JL8A 1M7DB 1VEPA 3S0PA 1EEZA 3MRDA 3BH8A 1W0YT 2QDVA 1TZOA 4AJVA 2EIEA 4XVOA 3MVSA 3MLTB 3EUDA 4ODXA 3OB0H 4U1MB 1IQWL 3TP4A 1EEYA 1H5BC 1F0LA 1FYTD 2Y7NA 3FB6A 4K55A 3TT3L 4M5ZH 1BEYH 3RWCB 2X9WA 2GKIA 3DTDA 1Z0NA 5B1JC 2NY1B 2WC7A 2HT3D 3QNZB 3U7WH 3P4NB 4EIZC 4ZUSA 1CDIA 4ILDA 4BA0A 4IRSC 4D9RE 2VT0A 4P04A 1O6VA 1WEJL 2BY3A 3ESVF 1MFBH 4FQ1H 3BP5B 4WI4A 1QFUH 3STLB 5K9KA 1L0XA 2FJUB 2WBJC 3LS5L 4XX1E 5G5DB 4HKZB 3O6KH 5I8OH 3PWVB 3UPRA 4QRRE 4P59H 4OQ1A 1CXEA 4N6RB 5G4NA 1EV2E 2YQBA 2UZPA 5JHDE 1MFEL 3HZKB 3P1VA 1J9TA 3PQYE 4OGAC 3T77B 2M1KA 4NC0B 2D7OA 5EBWA 1MSPA 4OCRL 4N1CA 4R9HA 2EO1A 4LESA 1NCIA 3HKFA 4NI3A 2Q7AA 5FM4A 2IBZX 5JR1H 4G6KH 4OF5A 2JKJA 5DJCA 5LVEA 1IIKA 5E2VL 2K9UA 3PWNB 4EO5A 3SCMA 3W82A 4FQQA 4UDTA 1MLCB 4BHUI 1HHKB 1DE4A 1DLHB 2WWKT 2CRYA 4IMLA 5KBLA 2Z31B 2GCYA 1OCOB 3PHQA 2AK4A 2B2XL 3MJ7A 2X6VA 4HHAB 2K70A 3LKOA 3ELAT 3U46B 1EBAA 2HH0L 2I07A 2GJPA 2OX5A 4WWKB 3QT2A 1TITA 2A73A 3W81A 2GEEA 3FSWA 4G9FB 3GSUA 3NPSB 4HZ1A 4DGUA 4EBQH 5IT2H 4XC3L 4MDIA 2DQDH 1DUYB 3BUPA 1LWJA 1FGNH 2MNUA 2VM4A 3BMWA 2XRAH 3MKGA 3VXNA 1Z3GH 1F6LL 3KVDD 1HCZA 1Z66A 4EQ3A 1WVZA 4F7KA 3H6AA 4L0YA 1HZHH 1U3HD 4N0FA 1AY1L 3K2UL 3SDXF 3CZEA 2AGJL 4OU3A 1R17A 2E86A 4TL5A 4HCRA 5BUAA 4NM8H 4XBGB 5EIVA 1IFRA 4XMUA 3IAQA 3CVIH 4X7TB 1YNTB 4D8OA 2PP9A 1MWAL 2YPLD 1EZSA 4R4BB 1LL1A 1Q0XL 4OLEA 2DF3A 4UT9L 5I5JA 2JB5H 4G6JL 2DLTA 4YSAA 4PJHA 1DN0A 1FRGH 2VCOA 4IBYA 5BOJA 3VXSE 3IDJA 2XWDA 5LAPA 3ULVL 5AL8A 5AZEH 1CT8B 3MAWA 3QUXC 2CIIB 5HDBF 3SKUD 1JI2A 1VGKB 4G8IA 2ISDA 3H6JA 2QEJA 1OAYH 3OKDB 3G6JF 3N40P 4AGQA 2P8PB 1KN4L 1UXWB 3MLRL 4OFPA 5AB9A 3ULVD 1KB5L 1LVEA 2ZCKH 1OTTD 3DJZA 2O72A 1IKNC 1OF0A 5EDXA 4ADIA 1IKOP 4XBMA 4J3SA 2GBUA 4G5AA 3QDJE 2I69A 3VG9C 4C83A 4AXWB 4XBEL 3CE1A 2FLMA 1D6EA 2HRPL 4OH2A 2H7WA 2JTDA 1ETA1 1AG6A 2CALA 2FWSA 3S3SA 2DQGL 4U1NA 3RNQB 3H9HB 1G7QA 3GD1C 1RUAL 5LG6A 3OAWA 5I1DB 4JG9A 2PYEA 4PJIA 2A99A 1A6WL 1QBAA 3FONA 1GS6X 1GZHC 4F1SA 4N25A 3D39E 3DYPA 3CXHK 3BISA 1F3RB 4O02H 4EUPB 5I15L 3X11A 1YSOA 2I32A 2WVTA 2VL5A 1ZLUH 2GC4C 3WDJA 3J2PA 4F9LC 5L7XL 4PP1D 1H3PH 4WI8A 4DETA 1LMIA 3QXDA 4Y19B 3DROA 4NKDA 1A3RH 1CZ8L 5TDOB 3QEQE 2NY3B 3D48R 4IK6A 3QFDA 4MA7H 4JQVA 5FGCE 3OB0K 3FQUB 3F58H 3KZ8A 2OR9H 3ILPB 4R6UA 4MD4A 1WFIA 2IQAB 3WUWG 4YSEA 4Z76A 2YARA 4PJGE 3LQMA 4GOSA 5FUZL 2XA8L 3FYIB 4Q6IC 3HE6D 1AS8A 1KGUA 2NY7H 3KLAA 4BH8B 1MXGA 5D96B 5AB2A 1CLYL 4PJ5E 3TBVA 3KMDA 1LEKB 2PW2A 4NP4H 3L3HB 5HHVL 3DPDA 5INDB 1ZVYA 3RWDA 2EVIA 2C3VB 3CHQA 3CH8A 2VDKH 4WW2F 3WKML 1DQDH 2WSDA 4Z3GA 3FRPA 1LEGA 3GSWB 4ZUUB 1HQRA 3ULUC 1HZKA 3HN8A 4ODUA 4YNYA 1BX2A 2R29A 3OVUB 3WS6C 3X1GA 3ESPA 3FTSA 4QHKJ 4M6OH 3HAEH 1HWGB 5DD1L 3L1OH 4W9ZA 4Z95L 3RGVA 1SDAB 1DBJH 6CGTA 2WXJA 5JOEA 2BNUB 2E56A 1K4CA 3OXRB 2Q86A 4PW9A 5FF6B 1ES0B 1NGPH 1MELA 4LCYB 4XC1L 3RBGA 4YBLC 3W0WA 4XNZC 2VZ1A 5JMRA 3G9AB 5LN8A 2J88H 4UNTA 1ZANH 2KZWA 4U2YA 5FAAA 4QTIH 2AQPA 3X13B 3B9VA 3VFUA 4W81A 4DEUA 3CSPA 3UJTL 5D1XA 2EDJA 3MRPA 4HWEL 1M71A 3DX9A 3DXAD 5IB2A 4JO1L 4XGZB 2D7MA 4LOEA 2NRDA 1XIWD 2NXYB 1RAMA 4WY7H 2H45A 1F6AA 3PLYA 3SJVE 1KWKA 5LGKA 1U8KB 3VVWA 1XGYL 3SYCA 2RJMA 1S9WA 2WANA 5ICYB 3QDMD 4AW7A 5IROA 4IDJL 5CU9A 1E2VA 1PJWA 4F3FA 1XAUA 1VZIA 3WHE1 2NYYD 3D3VB 4JJHA 4U0RC 3D07A 2CBMA 5FKPA 2FH8A 4HT1L 4JO2H 4ZXBD 4IIZA 4HH9B 3NSDA 3K91A 3O4OC 4OJAA 4PG9B 1LO4L 1NIBA 5EIQA 4BGDA 1AXSB 2OMUB 4LE8A 3PWPE 4NUJA 1QUNA 5F7HA 1BZ9B 4GAYA 1HL9A 5FA3B 4EE2A 3K46A 2J6EL 3WIFA 1KOAA 3S35H 2R0ZH 4AY0A 4B9KC 4YPGB 4WFHD 3QUYA 1OAKL 1S5IH 4NQCB 1VEMA 3NQKA 5CSGA 3TURA 1QWNA 3DGCR 3ZY7A 4X9IA 43C9B 5KVFE 4NPKA 4HEMA 1MF2L 3BFQG 4XE0A 3PXJA 4ABVA 2CDGB 2F54D 5IMMA 4OZFH 3TN0B 4L1LA 1SXCA 3O11A 3TBWB 1M42A 1H9DA 2V5TA 4U2ZA 4XNQA 1H0DB 1YY8B 3T71A 4XNUH 4NO0D 2IAMD 3OF6A 1NH6A 4E41D 3MACL 1R5IB 4QPEA 3UADA 5D71H 5D5MB 5I30L 3MCYA 2AZAA 4PBXA 1F6FB 1CVRA 5DZPA 1T2QL 1T20A 5TE6H 4UYPA 5IP4A 2VH5H 3FF7A 2RHEA 3HZMB 1NAML 5CKGA 1WC7B 3B3BA 3EG9B 4N2IA 1QSZA 1ZJBA 1T04A 4U1SB 2DKSA 2BP0A 4GIPD 4IHBA 3B2VH 5IFHH 1ZS2A 3VFTB 1RZPA 4YFLI 3V4VH 1PDKA 3NCCB 4KHTH 4LOUC 4YDLB 5LWYH 4OLXL 4L3AA 4JRYE 1RK0B 1SHSA 5DJ6A 3SBQA 1U8OB 1ACXA 5FV2A 4MRCA 4DT2A 1RUML 5DD5L 5KG9A 1OM9A 2C4FU 2VKXA 3N04A 3MUGB 1KZQA 4OIBA 2B15A 2IWFA 2K78A 1MCWW 2YS4A 2XZAH 4Y8AA 3TIEB 3GBLA 1DBKH 4NIKB 4TSBH 1MPAH 4CL7A 1URLA 1AO7D 3P73B 1SDYA 4GT0A 1JHTA 1RVFH 4HGKC 5HVHC 2BHFA 2DAVA 1TVHB 2X12A 5J6GA 1N10A 2ZXAA 2CK2A 2PWGA 3KWXA 3ISRA 3CN3A 1F5WA 1X7QA 3QUMB 4HJSA 1UKTA 2ED9A 1USQA 2IANE 3BQUA 2NUTB 1NBQA 3N55A 2Q7YB 4CNIB 4ZMOA 4M43L 1NWOA 3GUFA 3FQRA 2YA0A 4P5KB 4MJIA 3V0VA 3KBFA 4CJ0A 4EDWL 4P4KD 3DURA 3FT1A 1RUPL 4UTCA 5GSRB 4Z5RB 3QUYC 4Q6YA 5JPMC 2PO6B 1TYEB 4Z7VA 4S10A 1UB6A 4QRBA 4KH2A 2VWEC 4XE5B 4MZ3A 4TRPL 1DQMH 1KCUL 2VLRE 9CGTA 4WCYL 3WE6A 3T65A 4ZX6A 1PZAA 3P30H 3QDAA 1MFMA 2ENQA 2XTJD 4OY9A 5GS2H 3VQLA 2UZXB 3SKMA 4NCDA 5KANI 3SB3A 1GIGH 2OZ4H 3IDNB 2JXMA 3GTTA 3DJSA 3U9UB 4P8QA 4HKJA 2XA3A 3HNSH 1ZVHA 3U1SL 4DP2X 4JKPL 5JOPE 3QJOA 4JFSA 5BW7A 5E2WL 2V4LA 2DQCL 1JPSL 5FLUA 1TTAA 2ED6A 2YQGA 4XZUA 5C0GB 3PWJB 3RPIB 1AGEB 2WINB 3ZHKA 1UYWL 1NJ9A 3L7FA 4X6EA 3AFLA 2BCKA 3L9RA 3LQAH 3CDZA 5ESQA 4NN7B 3BUYB 1EWHA 5FEBA 1WIOA 4TUOB 1OTSD 4WU7B 4XN4A 2GK0A 4XB8A 5E1AB 5EN3A 3O2WL 1IIIA 1XGZA 4WNQA 4XBPA 1FZJB 4NFBA 3BEWA 3UTSB 4GG6B 1HHIA 1AANA 2AJXL 4F7MB 2Y69B 3S5LA 3UX9B 3HG4A 4N9GB 3VFGL 5IW6B 2QGEA 1I82A 1QQDA 3ZOAA 1SHMA 3QPQC 3L3DA 4KMLB 3WEOA 1I3GH 4L8DA 2XFGB 4QY8B 3ARXA 2J73A 2QSCH 3SDCB 4MX7A 4FA6A 1BVNP 1JUFA 3V5DB 1UZ6E 3GIZH 1LO5A 5IGXH 3H54A 4NQXB 4IGBD 4G72B 2VR8A 4QHLA 1LE5A 1IGJA 1KT2B 4NQDE 3GHEL 5J56B 2XYCA 2E6PA 5HTSA 5BPPA 5EU6A 5DEGB 3KM2A 4MCZA 4PGCB 2CQVA 3FQ4A 3VXOB 2N01B 4LAJH 4KJPC 4ZDHB 4CMHB 1DVXA 3BW9A 5AW6B 4QOKB 3GRGA 4BWUA 4GXVH 3R4RA 2F5BH 4LEXH 5FGBC 1SJEB 1T4KB 2E9WA 3WXWL 4JB9L 1PG7L 2VQTA 3CWGA 5IB5B 1ZLSL 3VFNA 1CFVL 3VYNA 4JQXA 4DP7X 4GRLA 1THAA 2Z4QB 4R0LC 3WNIA 1ETJA 3DUSB 4ELMB 1BBDL 1MG3C 1QSEE 3M1BA 4RMBA 4M93B 3ILQC 3JZYA 4C4KO 3LSOA 2Q3ZA 1ZTXH 5B21A 1WWBX 5F88A 2Y7SA 5IMKA 5JA9A 4HC1H 4OFYA 3EZ8A 3H53A 4WDIB 2JFCA 3QQ3A 1DVQA 1LWRA 2FLRT 4RMWA 5DYFA 2C9QA 2ESVE 1JGEB 3APDA 1IC5L 1XQ4A 2WQVA 4MA3A 4IMKC 3HB3D 5D1ZI 1R75A 3LRMA 2P3YA 4JFDE 3MR9B 4L1SA 2VLKA 5AW9B 3DRTA 1CGUA 2FECI 1QHPA 4L8BA 4OVVA 4ABQA 3DHMA 4X99B 4FG6C 3BESR 4MQXC 3AACA 3QIUD 3VYPA 4A7VA 1UCTA 4YEEA 3ZPDA 4OGXL 4RFEB 1XL4A 5D1QB 1S78C 4IRJD 1J5DA 2VXQL 1MRDL 4P3DA 4XODA 3UC0H 1U3JA 1PYWA 5LLIC 1HOCB 4APQA 2YSSA 1W2KT 1ZT1B 2W0LA 3GMLB 2ZJSL 4PRIA 1I85A 3FH7A 5D2NB 3KJ6L 1SJMA 1D9KA 1SMAA 1U3ZA 5DO2D 2R2CA 2UXGA 2LU5A 1EAPA 4JKWA 1T2JA 1B4LA 3DVIA 4KUCD 4ODWB 2BIOA 4K3EH 4KTEH 4MAUL 3IVKA 3L5XH 2HVKB 3WHXB 1JPTH 3ARFA 1MQKH 3C87A 1T1WA 4LRIC 1GRWA 4EF3A 4FFWD 2FJGA 3D69A 3IDIB 3VXQA 5BVPL 3VW3L 1EIBA 1WZMA 3LZLA 3R1GH 3KPMB 1SEBA 3FFDA 4EI5C 4J3BA 3F7YB 2IPKB 4FXLA 1P5UC 1K9TA 2UXFA 4MVBC 4HULB 5HHNB 5IB4B 1JPFA 3BC9A 1AGCB 4PY8J 3BAYA 3CZFB 1BF2A 25C8H 1Q9OB 4M1CD 1DYZA 3GDBA 4P2RB 2BOCA 1JRHH 3EOAB 4BM7A 5HY9B 5T1LA 1QRKA 3QHZL 2UX7A 1CXIA 4N2AA 5HGBB 5T1DL 1ZGLB 3CVHL 1KJ2A 3GSVA 1I31A 3APNA 4H0HB 2GITB 3CLEL 2OJEA 3M8OL 4JQXC 1JRHI 3RBSA 3BP6B 3V6ZB 1CC3A 2CMRL 3TBSB 1OGAD 3DA0A 4UT6L 6FABL 3GXTA 5I24A 3MRJB 3QWOA 5I1AB 3D7PA 1JWMA 3UAJC 5CD5C 1HDMA 2QHLA 5I8CB 4Y4KA 3SKJL 4FC3E 2J12B 3VI3E 4LPUA 1NTDA 4QRUB 3N43F 2HVBA 1J1OL 1FGVL 1WE5A 2WWMC 4RWHA 1BIHA 5HPMA 2EDBA 4WEBH 5MHSD 2BSED 4YUEL 5E6IC 1WLHA 1W6WA 5KVEL 4G6MH 4ALAC 4B53A 3PABA 4PJ8B 2ITFA 2DQHL 3HN5A 1VEOA 4MB3A 2N7SA 4WSJA 4ZW3A 3AUWB 3WCYA 1E8ZA 3QQ4A 4NOFA 4MCYB 5CNHA 5JPNC 1A4KB 3QPKA 3IJSB 4MDRA 3V4UH 3POCA 1CGXA 4YDKH 4JY5L 4AUJA 1Z0MA 2D4FA 5F1NB 5IQ9B 3TPKA 4Q9RL 2R4RL 4UU9A 3ARGD 3NN8A 4L8SC 1EZLA 4BFKA 1ODAA 2ZCZA 4FFYA 1JZGA 3BUTA 4CC1A 1TLMA 3QXVA 2IADB 1I8KB 4XCCH 2F53A 1BXXA 2J4WL 2D31A 3RWFB 2OTUA 3KVPA 5EB9A 4XMPL 1JZJA 4OZGB 1AD9B 4C56A 4HLZG 4AL8C 1BJMA 2V0AA 3SE8H 4HJTA 3MBWB 1INQB 5BRZB 3QIBC 3IMSA 3O8XA 1Q38A 4B9FA 2IDTA 2YRLA 4NAJA 2WTRA 5GGQH 4AZ8A 2YMXL 1VIWA 1J86A 1I9RH 1YG9A 4MB5A 4LARL 1EFQA 1XZ0B 1A6AA 3EYOB 4YHKL 3E8VA 2JK5B 1K5NA 2H41A 2QBWA 4HK0B 5AOZA 1CYXA 3QRLA 2F19L 4Y89A 1G7HB 4MCMA 1A7RL 3TYGH 3KLLA 5GHWH 2X4SB 3HCVB 4LPTA 1BMGA 2A4EA 4RAHA 1SYSA 5CSBA 2VLLB 5F7MC 1NGZA 2XQBL 3D4CA 2FB4H 3K7UA 1FORL 4OB5L 5TH2A 3VI4A 1R0AL 3LRGA 3FMGH 5M94B 4BYHA 2WZPD 1N5AA 4KVCL 2V3EA 3FTZA 3V52L 5D7JD 1XR9A 1OSZB 1T66D 3B9KA 3B8SA 3VRLF 3QORA 4ONFH 1J05A 2L4OA 4UQ3B 2P44B 1F1GA 1SOXA 3HA0A 1FPTL 4NKOA 5I66A 3FQNB 2FBJL 3K6SB 3DV4A 4Y9CA 1KCSL 1Q94B 2YPVL 1RZGA 3TBTB 4MKMA 5DJZB 4X6CA 2YGOA 4KQ3H 1KC5H 1NMBH 3FFCE 3KD4A 3P3UA 5L0QC 1D6VL 2ERJC 5I6PA 4BZYA 5AAPA 2AJSH 3M46A 3V8CA 1MNUL 2XU9A 2H9GA 2Z4TA 4DSYA 2GJ6A 1NBVH 2I26N 4R7XA 2EXTA 3ZVVA 1EERB 2BM3A 5HHPA 3OLDA 5EOQL 1F11B 1G7JA 5GJTL 4AMKL 2ZSWB 4QT5A 4IS6B 5HBBA 4I77L 2JKTM 4QGTA 2B9AA 5IQ7H 5L8LB 1AVAA 1F58L 3DX2A 2ITDB 4Z7QB 1DP0A 1C5CH 2BRRH 1N64L 5IJDC 5FYKL 5ANMB 1NGWA 1YMMA 1FN4A 3IGUA 4LMQI 4YLQT 1UATA 4HUXB 3RX9A 4N26A 5J89A 4AK2A 1S3KH 1B90A 3KAAA 5HGDB 5C09A 2OMBA 2AEIT 2GFBA 5FYKD 3BZEB 1XCXA 1C08B 4GUPB 3TH4T 1YNLL 1RK7A 3K72A 4Y5VA 4RWYH 5J1AA 4QR7A 1QFWM 2RCSL 5CJ5A 5FO9B 1S3RA 1B6UA 3B6SA 2XBTA 3VTTA 3DX8A 1CF8L 1OAQL 5IB1A 4FI6A 2UYLA 3U2JA 3PU7A 4G8FB 3TEWA 5AW3B 2PTTB 2HWZH 1JZ6A 2EIDA 3V5HA 5CUSL 2FEDD 3M17A 1I9IL 32C2A 4TNEA 4A38A 4CKQA 3KPRD 1XGTB 4NN6B 2WXMA 1A14L 1S7UA 1PCSA 1JF6A 3BN9D 1W72H 1Q72H 1AGFA 4JX0A 5CBEB 2UWEF 5I1KL 3IWVA 3MJWA 5GS0H 4W9HC 1JG9A 4FYSA 2FX7L 4NBYB 4DPAX 1J8HE 1XH1A 3MNZB 1NUNB 2ZG1A 1CLOL 3TO2A 5EDSA 1FZKB 4GFTB 4OZIB 3A4FA 2KERA 3QZPA 1TZIA 4AKQA 1XCQA 4B9YA 4LSRL 4B9JA 4QNPF 3H9ZA 3ULVC 2PYED 3AG2B 2AXGA 3GK8L 1OTTC 2EEAA 4GO6B 4MLIA 2HMID 3QEGH 4NZTL 1Z5LB 1VACB 1I8IB 2B20A 3W9DA 5FW6A 1YEHL 3MLZH 5I6XB 3SIKA 1P1ZB 5KSVB 2EC8A 4HHWA 4R90L 2DN7A 3VFMA 4RETB 1P4UA 3RTQA 2IV8A 3Q5TA 5DHVB 4DFHA 2X6UA 4CC4C 1F4WL 3QIWB 1VKXA 4LT7A 2YD7A 3L4XA 1AQKH 2FJHB 5GGVL 2X4RB 3L7EB 3D0AA 4PRHA 2D4DA 1EMTH 4F1ZA 3CUPB 3QE5A 3IS0X 2EO7A 5CEYB 4Z18A 1UD8A 2E47A 4CN4A 3ES6A 3UYPB 4WWNA 5F7YC 4L37A 2NX5E 1A1NB 2YXVA 3X3GH 4KFMA 1P4IL 2ZXGA 1X4ZA 2WXRA 2Y7QA 1A6UH 1TEYA 2YUXA 3C75A 4KO6A 4PJAB 4F57L 2WP3T 5JIQA 2OR8A 3NAAH 4GUOA 3IBEA 1DANU 4U1HB 1KFAL 1PX8A 3DGDA 5KYUA 3FOLA 1D2PA 5E6YA 1YZZA 3OD3A 3O6FB 5KSAB 4TNVK 2YGVA 3GMNA 2I9TB 3DJ9A 5I6KA 4NGHH 4OF0A 3KYMB 1WAAA 5HYSG 1FNFA 2D0GA 2NY4B 4XAKE 4BRJA 3HE6C 2BO0A 4UI2A 2AJUL 2KH2B 3QEUB 3PAYA 3QFJD 1ECYA 3FUJA 3MLVH 4WLCA 2BVEA 3B8YA 1ZV9A 3BIKA 2OPCA 3GXFA 3QO1B 3NFNA 4L4TA 4JFPB 3QRFM 3HNVL 3GIVA 1J12A 5EORH 1OCCB 1R3HB 4RMQA 5HJ3B 4L4VB 4FERA 3PGDB 1U8CA 3W0WD 1QI5A 2CKNA 3UZVA 5EO0B 5EU7E 1BOGB 1R46A 2JJVA 4A7SA 2LTQB 2W9EL 5INCA 2VNCA 1KJ3L 1NDGB 1RZJL 1B0GB 1A64A 1P0SE 2NY5H 2A4ZA 1C8QA 4BE6A 2F74A 2ZD0A 4K23L 4A7GA 1F90L 1YAIA 3D0LA 3ZZSA 4TNWF 1KTDA 1T21A 2DDQH 5D1XD 5C0AD 3F65A 1WBXB 2Y1YA 2ZCHL 4OCXH 5DZJA 3RUGF 3WFDH 3OHXA 4PJDE 1BW8A 5DR5H 1OPGH 2QMJA 2ZCLH 4Y1AB 1AJ7L 4MJHA 4XPGL 2X4TB 2NZIA 4IYKA 1H8NA 4TPRH 1V10A 5DQJA 2CCVA 3N1GC 3Q2LA 5HDOA 2AV1A 1KN2H 3T6WA 3Q2NA 5C0FB 1T4WA 2ATKA 2Q5BA 4ANXA 5IROD 4L18A 4K3GA 4I2XA 2VB5A 4A6YL 1EQWA 4RQQA 3T3PF 2VW6A 3S8FB 3KYKH 4Z6AT 4I48A 3MV9B 4LEEA 4W6YB 1SJHA 3BAWA 5CIPA 1E7UA 3GM8A 4K3JL 4LPYA 3W11D 5ADOL 3JUYA 2DPKA 1E5AA 1BZ7B 4GQRA 3QAZB 3QR0A 4ODSH 2R1XB 2G9HA 3L3JB 4DKTA 1ITBB 3S34L 1ED3A 2ZP9A 3GHBL 4X6DF 3AZUA 5C0DA 1XH0A 1E28B 3DTXA 1VFUA 2AW2A 2NNRA 3BKML 4QYAA 5C0BE 1FL5B 3F2LA 4ZXBC 5HDWA 2Y2YA 1WHOA 4OCMC 4GBXB 4PRAA 2H32A 3BWAB 3MYJB 3MBEB 3HG3A 1REIA 3ATAA 3WDHA 4Z7OB 2FHBA 5MERB 4XO9A 4NT6A 2EABA 1UD4A 1KLGA 2VZVA 1PF3A 1T83A 1NOAA 2GBVA 4URTB 2BNQB 5E2UH 2Y36L 5CN2A 4GSDL 4YSOA 4HH8A 4BK5A 3OF6D 3CJJA 1DFXA 1YO4A 4G8GA 2AJVH 2XDHA 3NJIA 3WL9B 4MMXB 1H3XA 4FD0A 1HILB 3X1BA 4UM9A 1ZLDA 4OGYH 1HXYB 4M7LH 3TX4A 2OLDA 4KUCF 5F21B 5H4ZA 1EEQA 1OF2B 2I85A 3BLKA 1BVOA 3WTTA 5EOTA 1B4TA 3DBSA 4EI6A 2HG0A 2IAMC 2NZ9D 4E2OA 2HFFA 4FQXC 3H3PH 4ODVH 3QDHA 5DRNB 1R9FA 4YGAB 2AP2A 4NQTA 2XQYA 3DDGA 5EN2A 5IVOA 4RDQG 2DWSA 4C8XA 1HFUA 5F8QC 2IIJA 2QKIA 2VE6A 5FFGA 4U05A 3KWTA 3VGDA 4YHPB 4ZD3H 5F1IB 3QCUH 3LRSB 1QRNB 1JZDC 1EGJL 5EO9A 2E27L 3VD2A 4XCFH 3O2DA 5T3ZE 3PNWB 5IJVA 2DWDB 2BWDA 4OD1L 5MP6L 3K81A 1NFIB 2VC2L 2YPKB 3S36H 3AT8A 4E9WA 1NBYB 3GJFB 3QJUB 4U33A 3RVWD 2OK0L 2X10A 1OCWL 5DGRA 1Y07A 1RHFA 3A0OA 5C0CA 1UM6H 3QJHA 1AHWB 4Z7NB 1PTZA 1G5GA 2FR4B 4KJQC 1CDCA 2F08A 1MLBA 1OAZL 3N85H 4XN7A 2N4IA 4LLWB 5KS9E 3NFPA 2AHIA 3BQUD 1MCPH 5D7LB 2ARWA 2JJSA 3TJPA 4N0YL 4WAFA 3S96A 2X4UB 3CFBA 2H6PA 3REWA 1A7NH 5KVGH 3QI9B 2PN5A 3GXUB 1VFBB 1KYAA 5FIEA 3KYOB 4QLWA 3HZVA 3BKYL 4L1BA 1B4JL 2RGSA 2H1PL 3L3IB 4Z7WA 3IMTA 3MRRA 3NACH 2A74B 4UTBH 5HYJE 1MG2C 1LO0L 3R06A 4G1EA 2AQ3A 3E6FA 3UTOA 1AXTH 4X5PA 3RZCA 2NY0D 4Z23A 5MEQB 3Q3GA 1JMXA 4HKXA 3LS4L 4XHQA 1A2YB 1HT6A 3S97C 2IG2H 5HDQH 5KVDL 3TIDB 2C1PA 1E5CA 3P9LB 5JMOC 1XWVA 3BT0A 3ZE2F 4HUUA 3A6BH 5KYXB 1LE9A 4FA8A 4JDZB 3NMEA 4FQ2H 2OYKA 2J5LC 4KI5C 2O61B 2ZSVB 5E2TL 2F15A 4XNYL 4DQAA 4K7PY 1NSNH 2WB7A 4DERA 5AZ2L 4PTUB 1V7NH 1I1AA 4QMEA 2VQ4A 4EVNB 4YZFE 2BP8A 4PWIA 2Q3AA 2XC8A 4ELKB 3L9BA 3VB8A 4O02B 2Z8RA 5DWUH 4O2CB 1I7UA 1UKSA 1EK3A 3WUZA 2CGRL 1MCBA 3PXLA 3ZQWA 5FUCE 1KMGA 1LNUA 1AACA 4O51A 4JN2B 3KDMB 4S0TD 2B0SL 4Y7MA 4PRPA 4XMKL 4TUKL 4LCWE 4LMQE 2J57A 3QA3B 2XZCH 1E6JL 2XZQL 5LJYH 4AGNA 2C4XA 4OLWL 4FZEH 3BHBA 2COQA 2EEFA 2OM5A 2ZXQA 3IKCB 4J1UB 1DL7L 2Z1PA 1EZUA 3RL2B 4OKDA 1NGQL 5FYJL 1NCUA 3HS8A 4PREA 1OCZB 4YDZA 4KUZL 3REVA 3Q06A 5EU6D 5E8EB 5GGUA 1ECZA 4B96A 4W9KC 1UXMA 3F8UB 1JZHA 5AAMA 1AMXA 2AQTA 1KGCE 3QH3B 43CAB 2Y1AA 5I1LB 4JQIH 5C0IA 4ZUVB 3HBZA 1CG9B 4PBDA 5DRXB 4JPKH 5L6YL 4GRLD 4XN8A 1IC7L 3HRZB 1NCDL 2HTLC 3HAEB 4IBZA 3Q6FB 4JM2A 1IKFH 4POZC 5D4QA 3O9WA 3FF8A 3SPVA 1UACH 2O5YH 1O6SA 2Y5TB 4YDIL 4NO2B 1KGXA 2HJLB 4WHYG 4YHML 3FT4A 1ORSB 3LH8A 3SQOH 4RISL 3L9YA 4MXWH 4I3SH 3JTTB 4R2GC 2DQEH 4XR8C 2OMXA 5C0JA 2P45B 3I9GL 2VLKD 4P5TB 5TPWL 1ASQA 1CU4H 3LRKA 4HWZA 1ZT7A 1P84K 5E8NA 2M83A 4N2EA 4LLQA 4Q6KA 4IEFA 1ZY9A 3N44B 4DK3A 1FE8H 4NJAL 3L2NA 1QSFB 3EH5B 2Y9RT 2P5WE 5E9DB 3AUVA 1JN6A 1FHGA 3LEVL 5EOCL 3NIFF 1FVCA 4HV8A 1DLFH 1MJ8H 5KYYA 2Y6SD 1CFNB 2BDNH 3TLRA 3QR2A 1R3IH 2UZYA 3O4OB 4APQD 3EYSH 3SYOA 2WXKA 5E8PA 3JTBA 5F9WB 4JEGB 2NLJA 1CFSB 2PYFA 4PRID 5DJ2A 4DQOL 5TDPB 2WYTA 2G3NA 5DK3A 5B3JE 4PJHF 4H5SB 1S7QB 3WFEL 1E30A 5CFHA 1FWXA 5ES4B 1YQVL 2GQHA 3GSQA 3H9SE 5GRJH 1FZOB 1RZKL 4XMWA 2V2WA 1L5GB 4UZUA 2QZ5A 4CBPA 3ARFD 4XTRD 3KJ4B 1BYPA 2HRGA 4PB9L 1R19A 4WV1B 3FB8B 2CKBB 2BW4A 3ZZ1A 1O75A 4Y16A 1FNHA 3FO9B 1DUZB 5DURB 3UG4A 5DD3H 5DO2C 1QPKA 4Z77A 5H37H 4OD2A 3MV8B 1G6RL 2AERT 3HE7C 5EBMB 2QELA 5I1EH 3KLHD 4GAJH 2NW3A 3GM0A 5AVWB 4L3FA 4J4PA 2WUBH 2XPYA 4JAMA 5BVJB 4R5XA 3QUZA 1T03H 4PJIF 4WFFE 5T1LD 4M8QB 4ERSH 4OZFB 5J12B 1ZK9A 4RSVA 3D0VA 3IDYC 5H35B 4BFOA 4LSDA 4U3HA 4P5MB 1P6WA 2VW4A 4N0RA 4OCYH 3Q9PA 3KPPA 1A6VL 3C6LA 3SDXB 4F7PA 2W1NA 4LQFH 2KYIA 3EYVA 4FMVA 3FU0A 4J8QA 4X8XA 4Y4KD 1H15A 1G7PB 1AQDB 4JFEB 3FN9A 1JCVA 3L1EA 4HMCA 3T0EE 4X8GA 3TOPA 1NDTA 1L9SA 2KDYA 3ARWA 2ICEC 3FT2B 3W9EA 2K4AA 2E4TA 2XKUA 3AREB 5FM8A 4G2AA 4OBRA 2W9LA 2YOCA 3S4SA 1ACCA 2C7FA 2QVFB 3LPWA 2DLGA 2BFVH 5HDBB 2BSSB 4K71C 5I5MA 1JNLH 4WFGE 2ID5A 5CHNB 2ADGB 3G6JB 3QNYA 4U1JB 2HTKC 4LL4A 3VDBA 3W5MA 3SE4A 1FFPA 2HKFL 4Y5YC 1DJGA 5D4JA 2VAAA 2DWEA 4RGNB 4YHIB 1BREA 5A6MA 4JHWL 1H8OA 2XPZA 4NNPL 3LV3A 3OKNA 4WF7A 5DJAA 5DDHB 1WWWX 2F53D 3QZBA 4PJCA 2VDOB 3VFWB 2CO7B 5CINL 1D7DA 1JNJA 1MREL 4HQQL 1C8PA 4RFNC 4OJDH 4PLJC 1TU2B 2VN5A 3O8XD 4G5ZL 1MCWM 2X6MA 1N5YL 1J48A 5IMOA 4YXLH 3QCTL 4NXSA 2Q76B 1S7XB 2WLMA 4XNAA 5F2FA 3C60A 3MLYL 1NUDA 3MFFB 1Q9WB 5E94B 3DPBA 1T22A 3KEDA 1RURL 2ZKMX 3Q1SH 5DZAA 1V7MH 3G5ZA 2ZPKL 1JV5A 2OL3A 1AKPA 2X3BA 2EP6A 4OQTL 2Y2WA 1OD9A 2VDPL 4B5EA 2F68X 4FYTA 3Q05A 2UVEA 1IUZA 5I75C 3CSYA 2FUQA 3SDAA 1KXTA 1NPJA 5EU4A 4YSRA 3MLWH 4AQ1A 2TSBA 3TL5A 4U6TA 4A2LA 3QS3A 5AWNL 4J3OD 3B9KD 3MRKA 4IOFD 3BVWA 5LG1A 3DX1A 1BFVL 3GBMH 4RAVB 3QORD 4LLYB 5AEAA 3RWGB 3V0JA 3R7RA 4F7TA 3RX7A 3UPCA 1L9PA 2OMVB 4OJCA 2D7TL 2VXVH 3QQ9C 1UVQB 2EE2A 3NCEB 5GS3A 4R26H 4QRAA 2ZWZA 4LSUH 4IBUA 3FTWA 4WW2B 1GZQA 4L3EE 4IJ3B 4QTHA 3X1NA 5ICZA 2YRPA 4XOCA 2EYTB 4UB0H 5D7JC 4ORGA 1FC2D 3GHPA 4GXFA 1BYOA 2VDRL 2BWIA 1WA0X 3CVCA 4N8VA 3ZYOA 3F7VA 5BV7L 3ILEA 4AH2B 2CHXA 5IV2B 2K6YA 2GJ6D 1B0IA 2IWEA 4X9FA 5FHBH 1RFDH 3T1WA 1TTFA 4DZ8B 2QGBA 2DB8A 1N0XL 2VIRB 4LSSH 5FCSH 5HGHB 1KBKA 5DJXB 1XSIA 4PV8B 2XQYG 1BGXL 1L6XA 4M00A 3T8VA 4XVTH 3LZOA 4Z78A 4Z0XA 1TTRA 1R3LB 4E9SA 2F8IA 3GXMA 1MUJA 3PL6A 5E95B 1GCYA 4NO5A 4E9LA 5I1IL 1IFHH 3A6CH 4HIJB 1LP9A 3QQDB 2DLFL 3BAJA 3FN0H 1CGSL 3FT0A 3OZ9L 5IBLD 3MOBH 5D8JH 2EVFA 4YQXH 1EHXA 1ID2A 3LKNB 1QFWI 2YJLA 3ARBA 5BNXD 3VUAA 2CZNA 1FL3A 1RHHB 3GSNA 3ULUH 5BXFA 3RX5A 5KVMC 2YN3A 4Y4FD 3TZVD 5ID1B 4LLUB 1IAKB 3EFDL 4JO4L 1DBBL 3HG5A 4HKBA 3ZGIA 1MW3A 3OKOB 4YBQD 3H2QA 2ADJB 4YVUA 3LZQA 4AEHL 4NLAA 4P2OB 1T7WA 3T3ME 4ISVB 3UGXA 2PCFA 4O5LL 3UTPD 5C1MB 4PH8A 5GSVA 5MEND 2EYRB 1AE6H 2VSMB 2G5UA 5DHYA 4LSVL 4WUUE 1IGTB 4KVNL 4ZMLA 1UENA 1E4JA 4QHKI 3VTMA 2Q6WB 3LZPA 1G5AA 3QG6B 3WTSA 5I76B 2WVSA 2FEDC 2HT2C 1ZSDA 2JIXB 3Q13A 5GRVK 5IEHA 1QLRB 1S9XA 3QDGD 2X9ZA 1X6NA 1BQUA 5K9JL 3BN9C 1A22B 2G2RB 5DJ0A 4OKVB 1HNFA 4QRRA 3EIFA 2NXZB 2X1OA 3TO4A 5F9JB 3PQYA 5JHDA 1FZMB 4OSUH 2YLHA 2QZQA 4AIXA 1MHPH 1UASA 4JY6A 3L95A 5A16A 3EGXA 4JFQB 1VA9A 3RTQD 3WJMB 2MRYA 4KQ0A 3SE9L 5GRZA 3L5WA 3ULAB 5EO1A 4HS3A 3RVXC 1CUOA 2OMNA 4K15A 3KXFE 4Z7VF 2JKLA 3RAJH 1VGEH 1PSKH 3F6LA 4PRHD 1D5IL 1FVEB 3ZDYF 3FAWA 3GZKA 1PZ3A 2HMIC 1TJIL 2EE6A 2G0KA 4HFUH 5I6OA 3CFCH 4HIHA 1MCIA 2DYPA 1VADA 3QZMA 3DDFA 3T6VA 3G04B 5FDWB 5LCVH 3RL1A 3E38A 2LAGB 4RIRB 4N4YB 1KG0B 1VFAB 2QR0B 3T4YA 2MHAA 3FU9A 1JFHA 2Y25A 3MRGA 3L3OB 3DIFB 4LU5H 4F58H 1MI5D 3MNVA 5AW4B 4IRZA 2BJML 2VXUL 1JJUA 2DEWX 2OTWA 1ZV2A 2EIBA 2FO8A 2VQ1B 1DSWA 2C9SA 2RFXA 4KZCA 3IDMA 3RY5A 1TQTA 5I1GL 1NANH 2L7UA 4FXKB 3BGMA 1BWWA 5LBSA 1WSST 2OCJA 3VTAA 1RIUL 2G75B 2PETA 3FQXA 4L4TD 1B2WL 4HXBH 3AG4B 4Z0BH 2DWXA 3HHSB 1MCOL 1NANI 2P8MA 2Z8VC 4KC3B 1TJHH 3HKZA 1NMAH 4PS8A 4ELDA 2BP5M 3EOTH 3LX9A 1EHLH 2VUYA 3G5YA 3CFKB 4GKZB 1KIUA 1YEKH 4OM1H 3EO9L 3VXSA 5CR8A 4I9WD 4JPWH 3JWNH 3OGOE 4NDMB 2GB2A 2VRQA 4U7MA 4K8RL 1NCWL 1NBZA 1UEMA 3GRWA 3ELQA 4FG4A 3FT3A 4OFQA 1RULH 4JZNA 3ARDA 4KDWA 2VN3A 4PRBA 2FX9L 1JE6A 2W0FA 3LKSA 4DVBB 3U30C 4EXKA 5EZLA 2UZIH 3CDYA 4LF3A 4K8RD 1P4BL 3L4VA 2KZBA 1CDUA 3TT1L 3FTUA 4FI8A 5EV7A 4DVRH 2H0JA 1T0OA 2IOMA 3O3EA 1E90A 3QULB 4TSAL 3GMMA 3D34A 3MREA 2P28B 4PJXE 4WKZA 1UD5A 1RZJC 1RZ7H 2QADC 1L0PA 3QJTB 4K0OA 5ILTH 1LDPH 3OJVC 5B38A 1YUHA 2Z0BA 2VXSL 2KLSA 4H8PA 35C8H 2DJSA 2XVLA 3D39A 4ZK8A 2WNXA 3U6XS 1FYTB 3GI8L 2LT9A 2QSQA 2PCYA 2EH7H 2YQ2A 4PRDA 4JUTA 4S1RL 4AYDC 3MRMA 2NDGA 4M7JL 1U8HA 4A2MA 3X3FL 4PGBA 1YHPA 5KWYC 1EJ8A 1V3MA 3US9A 4Z3TA 2XIBA 1QX1A 1SEQH 3QEQA 3A22A 3FC8A 4KMTL 5ECJE 3VH8G 4QRTA 4HU8A 4UZSA 3GMOB 1IAIL 1I3RA 3HS0B 3DSNB 3FCUB 4P3CH 3TNMA 2VLME 1HZLA 7CGTA 1TTCA 3VFVA 2R51A 4OTXL 4PJGA 4KJWC 3GUTA 1K72A 5IFAH 2LABA 3UAAA 4G7QB 4G8GD 5F96H 3SBWA 3VSQA 2OMTA 2HYMA 1F1AA 2ICWB 3TGXA 4PJ5A 3NOIA 3TNNB 2CDEA 5HGGS 4NRYB 2UXTA 3SD2A 3BFWA 4M61A 4UM9D 1IAMA 1NEUA 4JFWA 4OV6F 3OBAA 2BNQE 4Y2DA 4LVHC 3MRQA 1RSYA 2CA4A 4ADJA 2AZUA 1QEXA 2R2BA 3QJSB 2XJLA 5D2LE 4UTAH 4I3RH 4CDHA 3QRGH 2XN9E 3NCWA 5LAXB 4QF1B 4WI0B 3VA2C 1BOYA 3WAJA 4HUMB 1JHKH 1Z9LA 3SGJC 1WDAA 1Z32X 5ALCH 3V7AG 2AAAA 1V27A 1WCBB 4XN2A 1KIQB 3LNIA 4DP8X 5M95B 3N6YA 3AS1A 1YRKA 3WN5A 1XR8B 3D6GA 1UB5B 1NIEA 2MH4A 4JPVH 2VRAA 1KIPA 4QUOA 1H6EA 1P1VA 2X88A 5CJQL 1NGXB 4PS3A 3H7BB 3HMWH 4MQSB 3RKDD 3BP4A 2V17L 4Y0GA 2BS9A 5CSZB 1OM3L 4JVUA 2Z91A 3JTSA 3CC5B 3G6DL 1OAJA 2F61A 4MSWB 2NNAA 4DIXA 2SEBA 3DJRA 4BE5A 5DYOA 2O5XL 1BSIA 1KYFA 2R56H 1OARH 5FECA 2P1YA 3FU8A 1U3HB 4X0NA 1ADWA 2IVFC 4YMPA 5FFLA 1TQSA 3VFSB 4N6QA 1IGFH 5C0EB 3SJVA 2YZ1A 1FG9C 5T5NF 4WHTA 2WD0A 1DJHA 4E0RB 1LK2B 3PGCB 5I19L 3BDYH 4XN5A 5A1AA 1MVUB 3UAEA 1ET7A 3BO8A 2YPLB 5FOBA 4HJ1A 2QPDB 2CRIA 5K1JA 1EEUA 4DK6A 4FQCH 1HHGA 1AC6A 4PP2B 1Q9LB 5ERWB 1F2QA 1THCA 2BSBA 2X4OB 1R5WA 1U8NB 4M1DL 1JZ3A 3IGAA 5AUMA 4XRCB 3RZCD 2JI2A 4ZODA 4YHLH 3HC3L 3PWPA 3LQZA 4I8DA 1A5FH 3AWFA 1Q90A 5EG6C 2CO6B 2IC2A 3JWOL 5GXBB 4FKHA 2OMZB 4JFHD 5FM5M 3O4LE 4G7VL 1IM9B 4FGMA 4ZO8A 1KJVB 4UOW0 1KIRA 4S1SH 1PY4A 3F62A 3VWKA 4AEFA 4G6FD 1KB5B 5KTEH 2V7HA 2XWTB 5E08L 2NY0C 3BRGC 5HHXH 1UQSA 2FGZA 2R39A 2BY0A 3PIQA 5GIRB 2R0KH 3I6LE 4HIXH 4OI7A 1XTLA 1I1AD 2GI7A 1L7TL 1N8ZB 4JFXB 3STZB 2P48B 3QSKB 5ACZA 3U9PH 1BF5A 1K4DA 3HNTL 3PV6B 5BZWA 1EAQA 3IFPB 2DH2A 3O2VL 8FABA 3S37H 1Q1JH 3E0GA 1A9EA 1Q9KA 4PSRA 5C3LD 1I4FA 3KPLA 2EH8L 1PKQB 4LP8A 1K8IB 5MI0C 4PRPD 1FL6B 2I60L 1CIUA 1N2RB 3V0WL 3CPLB 1SY6L 1T89A 5DMKB 2LVEA 3L1GA 3N43B 3OKMB 3VI4F 5I6NA 2W8CA 5KOVC 3WS3A 4H0LC 5GGTA 5JO5A 4ONOA 1MH5B 4QHNB 3ZKSD 5C0ND 2W60B 4JRYA 3VG0L 4V1DE 1MFAH 4CDGC 3C5ZB 3VRJB 3RY6C 2JKXA 5D9SB 4QAWA 3VXRE 3HE6B 2HJKA 4J3OF 4NYLA 5DHMC 5E7BA 5BOZG 2BVQB 2NXYD 2UY6A 1Y7VA 1RP8A 3SE3A 1YEGH 2FATH 3G5XB 4L29A 4JRWA 1YMHB 1FCCA 5JORA 4AWJC 3HI5H 4ZMNA 1EHAA 3ULUE 4JBSA 1KSRA 2YC1A 4HS8H 4X6CF 4KDVA 4P0DA 3JV6B 3FJTA 4Y5XA 5DJDB 3UIYA 1P7KA 2JJWA 3C08H 2ODHA 4G42A 5DQDL 1KNOB 4PJHE 5IM7B 4PY8I 3W2DH 3QQXA 1R3JA 2WXGA 4G7YH 4AZUA 4JFVA 2EE0A 4U6VH 3O9WD 2YEVB 4LSQH 2IANA 4MYWB 1E9OB 5DUJA 3QJZA 3SOBH 1BD2E 3HBQA 4OUUB 5ICXA 4L0PB 3AG3B 3BSGA 4G9DA 4DKAA 5FK9A 5C08E 3MOAH 4K9JA 4JR9L 3L2MA 5DJYA 3IMWA 4HPOL 3V55A 5JXEA 5F7EH 2VZTA 4NQCD 4AYEC 1S7SA 1A0QL 4NJ9L 4QXUH 4ALAH 2ZKXA 4P57A 4PV9B 3RE0A 3U9WA 4YSUA 5DMGC 1OZUA 2V7NA 4E42B 1O5PA 4HZLB 1YNKL 3DO7A 3WE1A 3B83A 4KKCD 4YLBA 3P3SA 1W16A 3DXAB 2VLRA 5GJSH 5HPOA 2WSKA 4R96A 3SYQA 1R1CA 1UCBL 1XIWB 3DVNB 3OZKA 4O58H 5C70A 3GBDA 1JZFA 1JZ4A 4OI9A 1UOLA 1NCNA 3BEVB 2FYYB 4Y4HB 4QJ3B 1P2CA 2MQGA 1VDGA 1AIZA 3EHBD 4NAMA 4RRPA 2MPAH 1L9TA 2QV4A 2C9UA 2GSIA 2PCPA 2IV9A 1VPOL 4V11A 1SFDA 4AT6B 5B8CC 1U58A 2Z35B 4ZQTA 1XFPA 2CO4A 3P69A 4BHUA 1NKOA 1SF5A 1U8MB 5AVYB 3T8MA 5LDUA 1YLBB 4MMZA 1WHPA 5EOCJ 2P5EB 1R24B 4ZXBB 3LXBA 5T3XD 2Y6SC 4GS7C 4P46A 4AL8H 3MBXH 2EVGA 5DUML 3SDDC 2YK1H 3EYQC 3L6FA 3U0PB 1RL1A 4G3YL 1BFTA 4UQ2A 1KPVB 2GUOB 5HYFA 3CCHA 4JRXD 3CXHJ 4Y16D 5EIIB 1JI1A 3WFHB 3FQTB 3AMKA 5J9PB 3IT8D 2Y07L 5HHOE 3VVVA 2B59A 2MKLC 2QQKL 5C3IA 3D5OF 4J4PD 1KB9J 2BVOB 1U8JA 2AFNA 1JTTA 1QTSA 1IQWH 1S7WA 3D2UA 3QUML 2PUQT 2F54B 5GGSY 1ZLWK 3QUHA 1RZKC 4NLHA 1QLFB 4KHXL 3GSRA 4HUWA 3BIAX 4P9HL 5BMFL 4F8OA 1IU1A 2MSPA 3I2CH 1BECA 2ITCA 4YOKA 3OSKA 3WLBA 4NO0B 3U0WH 1N6QH 2IAMB 1F13A 3IPEA 1TTUA 5ID0A 4E41B 2FCBA 3C6LD 2E7LC 3SKNA 3K4AA 4NQDA 1OGSA 4NQED 2QTEA 2CGYA 4QEGA 1YC8A 4NNXA 3DBXB 1RZIB 3MNMA 3FRUA 4PJ9C 5I71C 4ZFQA 1SQMA 5HVFB 4NCC2 4JFUA 4JJ5A 5LGHH 2HT4D 1CFBA 3WIIH 3F5WB 5J1SC 1SMOA 3B1UA 4EAEA 2Y24A 1NAMB 3IXAA 3O3DB 1QSEA 4L5FH 5LGJA 2HKHL 2P5PA 3K1DA 4WGVB 5TF1H 2WLLB 1BAGA 1F4AA 3WFBL 1F3JA 4K94H 5BRQA 3X12B 4RA0C 4JFEE 2D8KA 3ABMB 3MI6A 4UIMA 5HI4C 1G7LA 1I1FB 2Y1ZA 2ESVA 4FXGC 1ML0A 1JZ7A 2UWEB 2DI8A 4JPSA 4BSWA 3DMMA 3NUKA 5DK0A 3GMPA 2WQSA 5DS2A 1WAAF 4JFDA 5E2VH 1AO7B 5JLZA 3DRQA 4PYGA 1WAPA 4TSCL 3HN3A 5ICUA 2O1AA 2QQNL 2XWCA 3UXFA 3ZJAA 2JKRM 4OIAA 4QHUA 4XMTA 2DMBA 4UQCA 1QOKA 5F89A 1A7BA 5AW8B 1OP5K 5GPRA 1W8EA 3L54A 2H4EA 2B2XH 1UT1A 1YDPA 2W65A 4OLVL 4I18B 4ZOEA 4XMXA 5KOMC 1OB1B 2O5NA 2X0UA 1GZPB 1HH6B 1YN7B 4CKVX 3BZ4B 1DEDA 2NT0A 1GC1H 3U25A 1EJFA 5AVTB 4MAYC 2WPGA 3TYFB 3T4AC 3RKPA 2VR7A 2PXYB 4P4KB 4ZFFA 4XC3H 3MLPA 5FWRA 3C60D 1Q0EA 1A7QL 3ME0A 1NCBH 2WVVA 2ARJQ 4HIIA 4A7GF 5B38G 2X2UA 3US0A 4OZHB 4S0HA 1JGIA 2Z9TA 4UBDD 1NCOA 4YHOL 3V4PB 2O6PA 2XTLA 3SPJA 4OBSA 2VWEE 3C5JA 4K7PX 3Q2VA 3LIUA 2NTFA 3CVDA 4PLNC 3HC4L 3P4OA 4N20A 3W39B 4G11A 4JRLA 4F37F 1U8PA 2QJDA 3SDAD 1HHHA 1PEWA 3N1FC 4N8CL 4B27A 3MODL 4J3WA 3K6OA 2DEXX 3QXAA 1M1SA 2CRMA 5J4MA 1UKQA 3Q8CA 3EFFB 3BAIA 4J3OH 1Q0XH 1J1XL 2XTJB 3CH1A 2HX8A 4XWGL 5GS1A 5IHZA 1ZRUA 2WGXA 5EFIA 3WMQA 2D3NA 4JHAH 4UT9H 4UNIA 3V6FB 5CEXA 4G6JH 4HGWB 4M48H 4CRPA 1PLCA 4KK5D 3T0WA 3BP7B 1OP4A 3BAEL 4YO0A 5TQ0L 3G08B 3KHQA 1JXKA 4DTGL 2YAFA 2IJ0C 4UNVA 1I9EA 4NWTL 4N3UA 4JM4H 3GO1L 3MLRH 5FO7B 3WFCL 4IOFC 1NKRA 5FFOA 4XVSH 1HQ4B 4KK8D 4XO8A 5IG7A 1MFUA 3BUBA 4GQQA 5I74B 3VGFA 3WUWB 1URZA 3HUJE 2H3KA 4DH2A 2IGLA 1D5ZA 4NXKA 4XBEH 3D4GA 2HG5A 1T80A 2HRPH 1KDJA 3ARSA 4HIEA 4F2ME 1RCYA 4XPBL 3MRLA 3QJRB 3ULSB 3VI3A 3GLEA 4ZNEE 2WBWB 1HCFX 2DQGH 4O9HL 1RUAH 1RIHL 5DHDA 5SWZB 1T6WA 3BH9A 2HLFD 3MRBB 3B5TA 3TCLB 2WMPA 4ZMTA 3F7QA 1DJSA 2R2HA 3EFOA 3PL6D 3QPXL 4XT1C 1UXLA 3QK0A 2BSRA 3RUGB 4IGBB 5BV7C 5CEZL 3ATEA 5L7XH 1EXUA 4G8AC 3FOMA 1MY5A 3AB0B 5DMIL 1NCJA 2DMKA 3ARBD 4F2FA 4M4RB 2RQEA 1CZ8H 3PFUA 3K5SA 1GOGA 3AS3A 4ZQKB 3D18A 2WO4A 4OCNC 4YBHA 5H2BB 1QPXA 3SY0A 2AJYL 3OZLA 3F7RA 1UM5L 4HS6B 4KK6D 4NZJA 3T3PB 4R3SB 2B3IA 5FUZH 5IVZB 2XA8H 4Y2OB 1GY1A 1SLUA 1CXFA 2YJQA 4W9FC 5CILL 2DQJH 4FAAB 2IXQB 3FQWA 1A9BA 1UJ3A 4MGXA 2WLHA 4EMZA 5C8JA 1MJUH 4IIQA 1V3KA 3RWIA 5DD6B 4Y4FC 3LEYH 3TZVC 2X1WL 3KW8A 2A5UA 3TA3D 5DC0A 4X6DB 1T1ZB 4NBXB 4HFWA 4MJ6B 5LXGL 5JDSB 5B4MD 3DI3B 3HB3B 4U1MA 4D9RD 5DS8A 3OL2A 3C8HA 1E4XH 4OF8A 1AR1C 3KPSE 3WNKA 4Z95H 4JZOB 1HL8A 1OT4A 2DM2A 3PHAA 4P4RA 3VWJA 4XCNA 2EADA 4ESKA 5JZ7D 3QIUB 3TO4D 5JHDD 2H3XC 3NK3A 3PQYD 4Z8FH 1E4XI 4IU3B 3G6AA 4XC1H 5AAWA 1WTLA 4WNSA 3CZUB 4UV7L 5AOJA 4IRJB 1MJJA 2NY2D 5T1KA 5F9OL 3INOA 2X2YA 2FE0A 5BJTA 5G5DA 2R0WL 2QHRH 4DK5A 2M26A 5IHWA 1YYLL 3DNKA 1SNRA 2FQFA 2D7PA 4Z7WF 4LHJB 5AVRB 1WH0A 3RB5A 2Q9OA 3GS7A 2A9NL 3UJTH 1JS4A 2H1LM 3AM8A 5KBDA 2BHZA 1P6AB 3CHSA 4UILL 5LKNA 4GMTL 4ZAKA 2DYPD 2NNXA 3WENA 4A2HA 1AD0A 1OGTB 3C8KA 3W56A 3FFCA 3V4VA 3IPFA 1XGYH 4QTFA 2HVJA 3QFGA 4EN3A 3C9NB 5DT1H 2XNAA 1RU9L 1TOXA 4ZSOE 1D5MB 1B0RA 3PWUA 4IDJH 1X6LA 1SDDB 3FB5A 5KEZA 2DTML 3V0EA 3P0VH 4NQVB 4CMMB 3ZMNA 1XGUB 4NUGL 4XX5A 4JPIB 2HX9A 4NFDA 3SO3B 4YJZL 3ZKMC 3UYRL 5DRZB 1HI6A 1JK9B 2XXCB 2FSEB 1GPOL 5E0FA 1MCQA 3OWRA 4GO8A 3KM1A 3A4EA 1UA3A 4B97A 4OR1A 2J6EH 2GJZB 4GQZA 4XCEB 5TD4A 2F8VA 3FHQA 3K8MA 4WZ9A 5FKAA 3BPOB 2RBLA 1OAKH 1OGAB 3IU4H 1QUPA 5BRZD 3BGAA 4MS8D 4L8CB 4P23C 3IFLL 1MF2H 4FG2A 2UVFA 1S7VA 4X8JB 2ILLA 2JJUA 3RIFF 3T0BA 3NZHH 4FS0A 4LDOB 3DX7B 4UOJA 4N22A 3VXSD 1KLUB 3EDKA 1U8IB 5DRWB 2WHVA 4Y5YB 4Z3EA 4Z7UE 1BQSA 1X5LA 3KPTA 1QG3A 5IHBA 3P77B 1YEJL 3MACH 1BFSA 4B7IA 3KNBB 3ARDD 4EZJA 1ZA3B 3HFFA 1ZHBA 2NY1C 2APBA 3WKYA 5C2BL 4DW2H 2F58L 3KH4A 5F71A 1TZHA 1BDYA 1B9KA 5L9DL 3QDJD 4TVPL 1J0IA 3EGSA 1J8HA 3EBAA 3B3IB 2EUXA 4QO1A 3ARGB 1CT8A 3BMVA 2Q10A 1OW0C 1QFHA 4IJTA 4J12A 4EIBA 1SBSL 1VGKA 1YEDB 1XB3A 2OZ4A 1EEZB 3MRDB 3ZE2B 3BH8B 4OLXH 5IVNA 1EHNA 3MXWH 4FNLL 4JM2F 1RUKH 4ODXB 2J44A 1RUMH 4K8RC 5DD5H 1W0WA 3AM8C 3CN4A 2OTPA 1EEYB 1J5OL 2WQWA 3SDYL 4GAGL 3WTUA 3FB6B 4P9MH 4CVUA 3ZE0F 3MA9L 3IDGA 1WISA 3I9PA 1SQ2N 1ZHKA 3BD5A 4GI8A 3SGKA 1FSKC 3IGLA 3BUIA 1A7PL 3MNWA 4CU8A 4ZUSB 5F6IB 1Q8MA 2HCZX 1CI5A 3QEQD 4FQPA 3AU1A 4OIIL 2COVD 5K9KB 4XH2A 1HIML 4JG1H 3WLWD 2Z31C 3DX6A 2NX5A 3ZW3A 3UPRB 2VUOA 4Y88A 3RWEA 2ATAA 1CD1A 5DUPL 5DU7A 2DL2A 4TQEL 2VO5A 1HTYA 1FH2A 4WWKC 3S98A 4Y19A 3AQZA 5EBWB 1HC1A 1RUPH 4FF9A 4KZ0A 5EUKA 3AGWA 3NPSC 4KKBC 4PJ5D 3H42H 4YVNA 4QHPA 3KPNA 2LU3A 3LIZL 1TZGH 1U2YA 2L0DA 4Z1PA 4L1HA 1HX0A 3FUDA 2J5WA 4WI7A 4E68A 4Y2DD 3IETA 4FULA 5DJCB 1MXDA 1PQZA 1RIVL 3EXLA 2E7CA 3WNNA 2BNRE 3JV0A 4MAZA 1AFVL 4P05A 4TRPH 1D7BA 1KCUH 3SCMB 3MX0A 4FQQB 4UDTB 2BIQA 1DE4B 4WCYH 1DEEA 5B3NA 3A4AA 4IMLB 4X7SH 2GCYB 3SQBA 2WCGA 2CGZA 4F24A 3WD5L 3PHQB 2AK4B 4X9HA 5HJGA 3DHUA 1EHKB 2GYSA 2BCMA 2Z7UA 3LKOB 1XF5A 4U6XB 5CGYC 1OSEA 2I07B 1NL0L 3BZFA 2OX5B 2X1PA 5D1ZA 4HC1A 2A73B 3U1SH 4JKPH 3VD4A 1FAKT 4X80L 1LK3L 4GUQA 3VU1A 1MFCH 2DQCH 1KJMA 1VESA 3WEXB 3NCJL 3POHA 4MDIB 4HOWA 1JVOA 3TF7C 3NIGB 1UYWH 4QRQA 3VXNB 5C86A 3NRQA 2OSWA 3TV3L 2LU4A 4V33A 1WP6A 1M6OA 4N0FB 3BAKA 4PJDA 2E0PA 3LNHA 4N1HB 5G4OA 5GGRY 4FLHA 1OLZA 3SJVD 3O2WH 5CZVH 4PWKA 2GK2A 3C2AL 2AJXH 3PPEA 3NIFB 5KBKA 1DTUA 3ETTA 4MNQE 1XL6A 4ZFZA 4H8UA 4QXGL 3VXME 2NR6A 2ZX8A 5GGSB 1D7CA 4ANUA 4APXA 1OALA 1PW3A 3KYNA 2VDLB 5I1HL 1TMCB 1DN0B 3BVTA 3IDJB 5E8DL 2PABA 4JO8A 2WM0A 1LGVA 2VDMH 4G8IB 2XUWA 2EINB 3KPRB 3PWPD 5ETUA 2MOGA 2OCCB 2YPLE 4KRLB 3GBNL 4KQ4L 3TVMA 1GGCL 1R34A 1WFOA 1N4XL 4KITB 2E46A 2A0LD 5FWQA 4NX0A 1FO0B 3IN0A 3W57A 5C0BA 5FYLL 3THMH 2Y06L 4C83B 3P02A 3VWKD 1HNGA 3QO0A 1ZLSH 2NY3C 4Z7AA 1CFVH 1LTXA 1D6EB 2OMUA 3IK2A 3MCLL 4PJCF 4XNMA 5SWSE 4K73A 2JCWA 4RGOL 2X44D 1PX3A 4PJBB 3I02A 3FUNA 4U1NB 1NCHA 1G7QB 4EI0A 2UXVA 4QIRA 1H19A 3ULVE 1UWFA 3S3BB 3CQPA 2PYEB 4LOVA 3P4MA 4PJIB 4L1TA 4HG4J 3S36X 4KRMB 2VZUA 3FONB 3HFMH 4KKAD 5GZNC 4FTVE 3OAYH 5D96C 2CH8A 2FYVA 4LSTL 4BWTA 2IMMA 2OMWA 1KGIA 3Q48A 5FO8A 3NJKA 1F4HA 3HMXL 2VL5B 3JWOC 3V9CA 5C7XL 1G9NH 1IBBA 3VAEA 1GXEA 1D3CA 2E75C 3DX3A 3FU5A 3IMBA 3E80A 3TBWA 4S1QL 2H3NA 1BLIA 2B4CH 4XO3A 3UZQA 1BQHG 3QXDB 1H0DA 1ORQA 3PAZA 4NKDB 3FDWA 4LLVA 1P7QA 3P9WB 2F0CA 3WJJA 1R5IA 2PP7A 4BA8A 4OGXH 3HAEG 4NZUH 4MD4B 4JRYD 4DGYH 4Z76B 2VXQH 5KUMA 1HNYA 2F8OA 1ROWA 2YAMA 4ZBJA 3KLAB 2FGWL 4LO9A 5ITBL 1EO7A 3V7MA 4HWBL 4RLDA 1CDGA 3TBVB 1F1DA 5DUBA 2PW2B 2OSXA 4PN6A 3LD8B 3MV11 4YSQA 2KHAA 4AIZA 3FRPB 1F4YL 1LEGB 4DPRA 1HQRB 5FUOL 1UWXH 4N0CD 4ODUB 4YNYB 1K8DA 2NXYC 1JSYA 2HAZA 3TIEA 3H7LA 1YECL 4M5ZL 3V9FA 3RGVB 1EUTA 5I16A 5KS9A 2IAND 1GYUA 4L2YA 5B22A 2NOYA 1F8TL 1K4CB 3HC2A 2Q86B 2FIKB 2J1ZA 2KI6A 5I2IA 1FJ1A 3JV4A 5CGBA 2BMKA 3W0WB 1CLCA 3CDFA 1PKOA 4MA1B 3EDJA 4PI0A 4PHZA 5HI5D 5JXED 4E9YA 3V8OA 2NSQA 1AHKA 1FNSL 1CTNA 3CVHH 5I8OL 1GS8A 4PG2A 5HYJA 4CNIA 5L2JA 4PGZA 1W80A 4P59L 4YXKH 3VFUB 3CLEH 3M8OH 1IM3A 4NKIH 2VR6A 5D1XB 5C0AB 3MRPB 1LP9F 2CMRH 1M71B 3HI1B 5IB2B 2VLRD 3FW6A 4YGVA 6FABH 1K6QL 4J28A 4HJ0C 4X6BA 1F6AB 3NEXA 4B0MM 4W93A 5EH1A 2PO6A 3FHEA 4NZRL 1F42A 5JR1L 1IVTA 5T1JA 2X38A 3VGBA 1FGVH 3FCTA 1KXVC 2MCG1 4LFHD 2IWKA 4H25A 5DVLA 4F3FB 5JOPD 1A4BA 1QTPA 4YUEH 5E51A 4KKCC 3S2AA 3HG1E 3TN0C 5A3ID 5KVEH 2X87A 2PTUA 1NIDA 1IEBA 4OZFG 2CA3A 4XPTH 4JM0A 3QDME 3VCLA 4NUQA 4NUJB 2NW2B 4U1LA 1QUNB 2VAJA 5IR1A 3KPOA 3BCDA 2R4RH 4YR6A 4GAYB 1GYAA 3WIFB 2ZXEB 4WUKH 3UTTE 1CPUA 2HLAA 5E23A 3S8GB 3D1MC 5C0GA 2ORBH 3I50L 6PCYA 4HETA 1FGNL 3MMEB 4LCWA 1PZ5A 1UUNA 4N0UE 2J4WH 4W9DC 4NHCH 2R1YA 4MXVE 2BS71 4YDLC 3FO1A 4XMPH 1HZHL 5IMMB 1X7TA 1GYCA 3ZYJA 3O11B 3HRPA 1WFUA 5A2AA 1GCFA 4XNQB 1FZJA 5E7FA 1B3JA 3PNRB 4K5PA 3PXHA 4OT1H 2YMXH 1A1MA 2VJ0A 2X6BA 4LARH 3TTSA 3AADB 4YHKH 5D7LD 4I1NB 2EDQA 3L9EA 1YEFL 3JVGC 3MROA 4JUSA 3ZUNC 1PZUB 3QI9D 3AQYA 1A7RH 2MCMA 1CBVL 2BP0B 4J7RA 5ANHA 1I3VA 3FN3A 1QMUA 3F7PC 2Z3FA 5DC2A 4DEWA 1IGYB 3FL7A 1PDKB 5K9QI 3QJQB 1QSED 2UV3A 3AXLA 4M7ZB 2ICES 5DJ6B 4P9HC 1ULVA 5EUOE 3M7FB 3KE0A 5KG9B 1YCSA 4ZX5A 2ESVD 3DO4A 1W72A 2IGTA 4F7CB 2YO3A 4YE4L 5IB5A 2DYRB 1IBYA 1FPTH 2J8UE 4R8WH 3DMMD 3OKEA 2PO6C 4FFZA 4WQOA 2J8OA 2VABA 2PR9A 4GB9A 4LHUA 5A43C 1KCSH 2YPVH 3LKPB 4HUNB 3HPJA 1JHTB 1A4JA 3ILDA 2P80A 1AGDA 1D6VH 2GTZA 4WEEA 1ANUA 3DVGA 4LCCA 4Q4EA 2OV0A 2P5WA 2XV3A 3AW5A 1MNUH 5KANG 1X7QB 4O02L 1CIDA 2C26A 2VOTA 1IJ9A 1AG0A 4GG8B 3BQUB 5C6PB 5GJTH 1V8HA 2AQ2A 4FN0A 5K59E 3FQRB 4GW4A 3V0VB 4MJIB 4I77H 4DPCX 3HBGA 1F58H 3DURB 2ZX6A 5IVXE 4UQIM 1N64H 2W07A 3JUZA 1XGPA 5DF0A 1E4KA 5FUCC 4MA7L 4W9GC 4IBQA 5C6TL 2OL3H 3F58L 4Z7VB 4AM0Q 3H9SA 1UB6B 4OGQC 3ZDYB 4CN6A 2DS4A 5T5FL 3NGBB 3PP4H 3CU1A 4JANA 4NN7C 5ALBH 2RCSH 4AQ8C 1TDQA 3WE6B 3T65B 2OXGA 1DFBL 4BFRA 3IB4A 3QQNA 4JN1H 3QNXA 4OZHE 5EZJA 4EDXA 4IK7A 1CF8H 3TTYA 4HISA 3SKMB 1CFQA 3F05A 5JW4N 2CUAA 2C3XA 1DQDL 1QBML 2JXMB 2YAOA 3RIKA 3FZUC 2L7EA 1E8YA 2E7BA 3P11L 4CU6A 2E9BA 2DLIA 1IBDA 1K3IA 5CUSH 2VJXA 5DZLA 4YWGH 1JGUL 3ZT6A 1I9IH 4AX3A 4M6OL 4KI5E 4HWUA 1PGRB 4RSYA 4TLUA 3CMGA 2Q87A 1A14H 3BKCL 4XZUB 3SDCC 4PQXA 2CLRA 4A68A 3ZDXE 4G6AC 1KB3A 3FUHA 3UBXA 3L7FB 1LO2H 4X6EB 4Z3HA 2CBPA 5I1KH 2C9RA 2BCKB 3L9RB 5ESQB 3VXUD 4ZG1A 1I8AA 4KDTC 1GW0A 2BOBA 3E6HA 1ESOA 2GK0B 5HY9A 1CLOH 3RJOA 4CMHC 2Q7NA 2J88L 4HUKB 4WNQB 4XBPB 5HGBA 1ZGLA 1GGUA 1HHIB 4AYFA 1XGQA 3IMRA 3S5LB 4LSRH 3FPYA 3T0EA 5FB8A 2MJWA 1QQDB 3APCA 1KFGA 2JH2A 4KK8C 4L8DB 4PJGF 4AK1A 4M93C 4M8VA 4NZTH 3D9AL 5IKCA 2AXFA 2LFGA 1FG2A 4MX7B 1GJWA 5ESVA 1U4FA 4I9XA 3GI9H 4R90H 1JUFB 1KYDA 4DOHB 1M7IA 1L9QA 4M6AA 4QHLB 1LE5B 1IX2A 4XPAL 3DARA 2J21A 1IGJB 2RMNA 4HBCL 4FNRA 5GGVH 3MJ6A 5EU6B 4MCZB 3T8XA 1ZHNA 2VMEA 1GYWA 3BJLA 3TJEL 4BV1A 1WT5A 4JMXA 3BW9B 1A4CA 1YJDH 3UABA 4G1MA 1PZDA 4IKKA 3EOBB 5E00A 1MFDL 4JCLA 1P4IH 3VFNB 1HWWA 4GRLB 1MJ7L 2CKBL 2A77L 4F57H 2X6CA 5CGTA 3M1BB 5D1QC 4LLDA 2JCCE 3LSOB 1UD3A 4GSRA 4JG0H 2R0ZL 5F3HA 5F88B 5IMKB 4NNYA 4ZFOA 3ZLQC 1UH4A 1IGIL 1S6NA 1A02N 1J10A 1S5IL 2GSGB 3QQ3B 3DJTA 5D2NC 2IADA 2R2EA 3NJMA 5DURD 4MA3B 4K3DL 4KK6C 3E9UA 1TCRA 5TE4L 3NDYE 4H88L 2VN4A 1M53A 2VLKB 3BOVA 2AJUH 1OWWA 1IGMH 4NQSB 2CDFA 2BP3A 4L8BB 4XNUL 3VWJD 2ZUVA 4XXDA 1Q0YL 2IDUA 3HNVH 3ZZLA 4DP9X 1GYVA 3EYOA 5KZCD 4L9LA 4P3DB 3N9GL 4PJFB 5T1KD 1C16A 1PYWB 5JUEL 5TE6L 2VH5L 4APQB 3WAKA 4AQAA 4KV5E 4FP8L 1G7HA 1KJ3H 4H8VA 2EZ0D 5DVMA 2X4SA 2FSDA 3GJEB 4PRIB 1GGIH 4JLRA 4BINA 4K23H 1JK8A 1XD0A 3PWLA 4WO4A 3K5RA 4LQ1A 3S6CA 4PLKD 1JGVL 4KHTL 1EAPB 2J72A 2ZYSA 5LWYL 1A7OH 1OEZW 3BT2L 4L3EA 3DUUA 4BDVA 5GZOA 2C3WA 2I7OA 3IVKB 4ZAKD 4F9PC 3QVAA 5HVWA 3T6QC 4UQDA 2NY2C 2ZKHL 3ARFB 3FFCD 3CPUA 1OHZA 3FH8A 4XPGH 2XBZA 3D69B 4YSPA 3KWUA 3VXQB 3NZ8A 2ENSA 4B6ZA 4EN3D 1WS7A 3P0YH 4UQ3A 2X7LA 4KROD 1SEBB 3FFDB 1QFPA 1CXHA 1DBKL 4TSBL 1U3YA 1MPAL 2EACA 1DQJA 4A6YH 2DYSB 3ECBA 4PSPA 4IRZH 5CZXC 1AIFA 1JPFB 1OPOA 5DJZA 1RVFL 4YIQA 2GAZA 4P2QE 1QW9A 1IL1A 4K3JH 1JERA 2BOCB 4PJEB 1F00I 1NOLA 1J88A 3DOSA 5DI8A 5T1LB 3CFEA 4IBLT 1KEGH 1JDDA 2EIZA 4LLMA 5IJKC 3EJYD 4ECNA 4PJ8C 3CFJA 1KJ2B 3GSVB 2WIMA 4BFNA 1YYMH 2OJEB 4N90E 4OVUA 1XMWA 4UAOB 3BKMH 5FDYA 5L4MA 2ITDA 3QWOB 2TRHA 1JWMB 3QXUA 2O6FA 1Z9MA 3GTNA 4TMPA 5ANMA 1HDMB 3SPCA 3ZTJH 5L88H 1HK6A 2R83A 4PVLA 5J8OA 4Y4KB 4BUGA 3GINA 3QC6X 4YC2B 2Z7YA 1A1OA 3SEPA 1RD6A 2AQSA 1E9PA 4KZEL 5HPMB 2Y36H 4ODBD 2GVYA 4GSDH 3X2QB 1FLTX 1OGAE 1OLLA 2W91A 2C9AA 2NNCA 3RFZA 3PUUA 2VMCA 3GB7A 4I3GA 4KOBA 4UTBA 5JHLA 4X7EC 4MXQC 2JKNA 3P30L 4MS8C 4YK4B 1ZAGA 2CPCA 3EJZD 2J20A 4YXHL 3QQ4B 4Q8BA 1ZHLA 4WUUA 1GIGL 4BFIA 4HCIA 4YHZH 3HNSL 2MFNA 1YUKB 2Z65C 1J8HD 2EILB 1QLEB 4UU9B 3NN8B 5GS2D 3NJJA 3RU8L 4OFVA 5DSCA 1M7XA 1M1XA 4MMYA 2XG4A 4DO4A 2WGNB 5SWQA 1DJWA 3HC0A 4JO3H 1CI3M 2F53B 5JW5A 3P3RA 5L2KD 3IJ8A 4Y9EA 3MGOA 3MJ9A 3ZU8A 5KVEE 2OTUB 3CTTA 3ZTNH 2OYLA 3KBEA 2EO9A 1EGJH 1E50A 1OO2A 2YA1A 2WXLA 3U6RA 2V9RA 8CGTA 3CNKA 3O8XB 4TTDD 1RSFA 5E6UB 1NM4A 4OD1H 2WTRB 5MP6H 4AZ8B 4XMZA 2RR3A 5HJBA 2ETWA 3QHFH 4WJ5A 1A6AB 3KXFA 1E9QA 4U4IA 4BCYA 4E5XA 4QYOA 2JMRA 1XSJA 1K5NB 2VR5A 5CP3H 5E1GA 2GIMA 1CQYA 1O5DT 1OAZH 2AEQL 3ABKB 2NX5D 1SYSB 1CS6A 4X2UA 5IGXL 1NGZB 1PZ2A 5TH2B 1MKFA 1Z3RA 2PWHA 4N0YH 3RDTA 1MFVA 2VKWA 1GHFL 4P2CG 3V6BR 5BOPA 2GC7C 1N5AB 1RV6X 2ITEA 3BX7C 3DX0A 4RZKA 1XR9B 4R5VA 3L4UA 3UO1H 3B9KB 1S7RA 5CEYA 3MLSL 2H1PH 3LOWA 1L9RA 1Z9SA 3QORB 4GW1A 2F5BL 4K5NA 1J05B 4NKOB 1RH8A 5I66B 5D72L 4NPYA 4XAKD 1A6PA 3DV4B 5B3SB 1CICA 3OR6B 3S5ZA 1LEIA 4PV1C 1RZGB 3P40A 1ZTXL 3LS4H 1QD0A 1KDIA 4KX9A 3UAFA 4DEPB 2CIKA 2DEYX 2ZX7A 3GSOA 4JE4B 5KVDH 1WA2X 2CJ3A 5BS0E 2HB0A 3EF7A 4X98A 2H9GB 2GJ6B 3WTWA 2ZOLA 5D1ZD 5HHMB 5HHPB 3DTUB 1RJZB 1G7JB 3Q9QA 5E70A 4LCIH 2MCPH 4QT5B 5DFTA 1MVYA 4JW3A 2Z6FA 4Q74A 3KLDA 1IQDB 2A9ML 5E2TH 5AVSB 2Q8BH 5AZ2H 4WJG3 1XAKA 2ZAGA 2JIXD 1NGWB 1TQCB 2VISA 1FN4B 4NN6C 4J6RL 4PGDA 2F6AA 1UZ6F 1KGYE 2VLJE 1UC6A 1UUSA 3PGDA 5TTRA 3NJGA 4UANA 5C09B 4PJ7E 4LNRA 5JTWA 4HLJA 4N9OB 3UC0L 2GHZA 3HI6L 1ZKAA 2CGRH 3ZE1E 2GFBB 1IE5A 2EDYA 4P49A 4JZJA 4PPTA 3HLAA 3K72B 4Y5VB 4F8LA 5J1AB 1B0GA 4U6HB 2MNWA 1X5FA 4TQIA 1L3NA 2XN2A 5FXCH 3TFKD 1DCEA 4XMKH 4FEIA 4TUKH 3NIGE 5IFJA 3WI9A 2NR6D 3B6SB 1S5HB 4H20H 4PJXA 1DQIA 3DX8B 3PV7A 2ENJA 4KK9C 3G5VA 4HVBA 5IB1B 2ZAIA 1E6JH 4K3EL 2XZQH 2UYLB 3L5XL 3S88H 4NB7A 4OLWH 1AP2A 1OTUC 2BOLA 5FYKE 2ZUXA 1MQKL 3V5HB 2X09A 3Q7JA 5FR3A 1P9MC 2R69L 1DL7H 2A6JA 32C2B 3R1GL 1H5BA 4NZDA 1JYNA 3KEHA 5FYJH 1S46A 2WO2B 3ATFA 5C0FA 2PP8A 3QRBA 4OF6A 1S7UB 5I6XC 2WKOA 5D6DC 1DBAH 3ZK0A 3TVMD 5B1JA 3QIWC 4RAUA 3U2SA 2YSTA 1YN6A 3NG5A 2UY7A 4AE1A 25C8L 3WO3B 3NPZB 5I0YA 3QG7H 4I0PD 3MV7E 4BZ2L 4IRSA 5KVFH 2NY6D 1IC7H 1TZIB 1NCDH 2WBJA 1X5YA 1XCQB 3AVEA 4OCSL 4AC4A 2A83A 1SXAA 2B39A 4LB8A 3HBPA 2AXGB 4HX1A 5C07E 3DSFH 4ABUA 2E9JA 3W9DB 4ZNCD 1O6TA 4OZ4A 5F1SA 5T1MA 3VXTA 4K7PL 3AAZA 3PJSA 4N2DA 4XWOC 4ZW6A 3MYJA 4U3SA 3RTQB 3VFMB 5KSAC 3O6FC 2XWJA 3I9GH 2JELH 5MERA 1VKXB 4NI6A 4FNSA 1TQVA 3FYEB 4OJEH 4DN3H 1NC4A 3JVFC 4MJ2A 2BNQA 2NY4C 4PRHB 3L5HA 3LB6D 4ANVA 4NJAH 1GOHA 4BFEA 1UZ8A 5D7IE 5DC9B 1P7QD 4G6ML 5D2LA 1ZVNA 3ES6B 3ZBMA 1BF8A 6PAZA 5EOCH 2XN9A 4L37B 2R23A 4BSVA 5F7DA 2Y7QB 2B1HL 3V4UL 3CZGA 4NQUA 4WHCA 4YDKL 4QWWC 1D5BA 4DQOH 3PCYA 5DHXB 4ZUWA 4DKFH 5ADPH 2F1BA 2LTQC 1G7IA 1XH3A 2YEQA 3WFEH 3VGGA 5KYUB 3IE9A 1ZPLA 3HZYA 3FOLB 3WO4B 5IESH 3OJDA 3KWWA 2WV3A 3FO2A 4W4OC 1A65A 5I17A 1NEZA 1JXDA 1X3DA 4PVBA 1A21A 1I8MB 2XWBA 4PB9H 3ET9F 1T0MA 4ZFGH 3E8UL 3SE8L 1XF2A 3ASOB 4JFTA 5C3TA 4AVIA 3B7TA 3BIKB 2B9BA 2ZKWA 1HH9B 2ZUWA 2WB1A 4L4TB 4LPWA 5F3BA 1RPQA 1ZT4A 1G6RH 3C6EA 3MXVL 1H3VA 3GIVB 1NBYA 5E99H 4KZDL 3VI3F 4JFZL 3ZHFA 4K5LA 1U8CB 3BPNB 4D3CL 1P5VA 3UZVB 5T33H 2RALA 5DZNA 5INCB 1YPZE 1UJTA