5DZOA

Crystal structure of human t-cell immunoglobulin and mucin domain protein 1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
107
Chain Sequence
MVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEIVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Hepatitis A virus cellular receptor 1
publication title TIM-1 acts a dual-attachment receptor for Ebolavirus by interacting directly with viral GP and the PS on the viral envelope.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2015-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dzoA00
3KPPA 3RVXC 3BKYH 1ORQB 2F5AH 4G9FB 3BE1L 1W0WB 5EC1B 3WE6B 5E8PB 4CMMB 4JRXD 5IGXH 2OK0H 5C6TL 3EOYG 3KYOB 1FJ1A 3TZVC 3OKMA 1PJ9A 3ULVF 4UOW0 4LU5H 1E0OB 3VXNA 1L6ZA 5DK0A 3BISA 1BM3H 4Z7UE 2UZIL 4KRLB 5F9OH 1N8ZA 3WFBL 3MLTB 1IL1B 3B2UC 4Z7WF 3D85D 2NY1D 1SYVA 3SHSA 3L3IA 1KN4H 1NMBL 1JNNH 3LZFL 4GMTH 4LEOB 5C2BL 2NY2C 3MNZA 2K9UA 3BUYB 1PSKL 5AZ2H 4UMGA 4X8JB 4WTZA 4AQOA 4DVBA 4M7LT 5EZOL 1NGXB 3SOBH 1AHWA 2X4TA 3RWCB 3TF7C 1X5HA 4ELMB 5BV7C 4UT6L 4XVTL 3BI9X 1RUKH 1CLYL 3ULVL 3PIQA 4JPKH 3QHFL 3ECBB 1ZKAA 3VFOB 2XA8L 5CGYC 2OCFD 2Y36L 2ADJB 4U2ZA 2E6JA 1J1PH 3MR9A 3S37X 1FFOA 3RUGA 4EUPG 3BZEB 1UJ3C 1VFMA 4XHJD 3I6LE 2BRRL 4N0UB 4U05A 4F37K 4PJFE 1T04A 1F8TL 1A6ZB 2AK1H 2A2QT 4L4TA 4QYOA 2P8PB 3TH3T 1KLFA 5JO5B 2EIDA 3O2WL 5J6GB 4JG0H 2VR4A 1N6VA 3FRUA 4JANB 1HHGA 5FHBH 4KK9C 5E5UB 3D39E 2XPGA 3V4UH 4BQ8A 1RHFA 1DQJA 5IIEA 1D6EB 3RVWD 3DX9B 4LBEB 5DVLA 3QEGH 4GT7A 4JAMA 3BD4A 2GQHA 3FJTA 3P73B 4RGOL 2Q6WB 2A9ML 4NHCH 3ZL4H 5EBLA 4LSPL 3TVMB 5CP7A 4L9LA 3FO9A 2WW8A 5AAWA 2XQBL 4OM0L 1LK2B 3CCHB 2EDNA 1OGTA 1YNKH 4LCUB 1KELL 1LEKA 3MOAH 1T1YA 4NOFA 3CAFA 3FQNB 4DEPC 4LLDA 4KMLB 4WEUD 3BH9B 4FNLH 1XGTB 1PQZB 2BSRA 3PWUA 3LKOB 1OSZA 4HFWB 1Z5LA 4NWUH 1G7QA 1C5DB 2UWEA 3C6LB 1JRHH 4QT5B 1MLCA 2H2PC 3GKWH 4OZIE 3CFCH 5TF0A 5EUKA 5JOPD 3UPRB 5T3XH 3JSSA 4Y7MA 3OKDB 5FUCC 3SQOH 2WWKT 3RNKA 4HS8L 4R7NA 5HGHB 3VFRB 5IMKB 1X5GA 2O5YH 1GOHA 3T4YB 5L9DL 4M5ZH 2DTMH 4QHKI 3KPSA 1HK6A 5MEPA 3C60A 5ELIA 4Z18A 1IKFL 1SEQL 3NZHL 3GGWA 1IC7H 4P4RB 1KCVH 3KLHC 5EC2A 5FB8A 5J1SC 5C09A 5I9QC 2IMMA 3KPLA 3MXVL 3QO1A 3S8WA 1BHGA 5D2NE 4AK1A 4JY4B 5C7XL 2YPLA 1PKOA 3HZVA 3GHBL 1KEML 4YDKH 4TULH 4PJGA 3RWEA 3U4BH 4U1KB 1MFCL 1DLFH 3UYRL 3WHE1 3ARWA 1J86A 4M62L 1KC5H 4LSSH 3JUZA 2XZQH 5ESQA 1MFDL 2X9YA 2CRMA 5I8KL 4NQCE 2VQ1B 3RVXD 1S9YB 4NUJB 1FNSH 3N85L 4KZDH 2APVA 3OR6A 4WU7B 4Z5RB 1RZGA 1KENL 1QFPA 4HIEB 4N0FB 1J5OL 2FATH 1H8SA 4X9IA 4YDVA 5DD6A 1ZLVK 4UDTA 4KVNH 3C6LD 2AV1B 2IC2A 4YXKH 1EUUA 1WBYB 4XWOC 4YHZH 3I50L 5IROA 4S2SA 2DQJL 5KJRH 1A7PL 3HPJA 4JRXA 2C7UA 4I13B 2YKLH 1G7JB 3QZWA 4OF8A 4BELD 4G7YL 1KPUA 3RP1A 3QQ9C 5FXCH 4WI7A 4XBEH 1R6VA 1RJLA 5CEZD 2VDQH 4F15C 4RRPA 4WI4A 1U41A 4TUKL 5D1XB 3U82B 3NCBB 5EZLB 3KPQA 4D0DB 5E5RB 5KW9L 4TVPE 1YEIH 1NMCC 2DM4A 5EO9A 2H1PL 3VWJC 3UAJC 4KZEH 3ARSA 3VJ6A 3SY0A 1NDGB 5LGHH 2C3XA 1QSEB 3IAGC 1R0AH 3HZKB 4OD1L 3HI6H 4OD2A 3D5OF 3PHQA 4AENB 3CMOL 1E4XI 1KGCE 2HN7A 1N6QL 5CGYD 2WBKA 1KNOB 2FRGP 4OZHF 2VKXA 2OSLB 4UINH 5E2TL 1J8KA 1YNTA 3PP3H 4M6NH 3LN4B 3RX5A 5DK2B 2VSCA 4MA8H 4XPHL 3PXHA 2ESVE 1ORQA 4G9FA 5EC1A 1G9EA 3UZQA 4LFHG 3LEYH 3WE6A 5E8PA 5DDHA 1RZJH 2DRUA 1AC0A 3KYOA 3OR7B 4GBXC 5CJBA 1YDPB 2BNQD 3IGAA 3IDGB 4M1GH 1IC1A 4O02L 4ZUSB 4O58L 3ULUH 2CDGB 5DT1H 1DBKL 2I9TB 4Y19D 3MLTA 3NMEA 1IL1A 5I71B 3I2CH 4P3WA 1T5WA 1CD1B 5D71L 1GZQB 5EU6E 1AJ7L 4LEOA 1NUDA 2VDMH 4R8WH 4XPBL 5EA0H 1XF1A 4HZLB 3O6KH 2H8PB 4RGNE 5I1JL 4ODXB 5FAAA 1CFBA 1NGXA 1T1WB 2J8HA 3O2DA 2RFXB 3RWCA 5E8EB 2EDHA 5DO2D 5IJKA 4ELMA 2AQ3A 3C08H 4NKMB 5F1KC 2H2PD 15C8L 3WNKA 4OF6A 1A6TB 4KK8D 3ECBA 5J1AA 2R0ZL 3AXLB 3VFOA 2CK0L 4PJBB 4L3EB 1L4IA 1S7TB 2ADJA 2B2XH 4LPWA 4UTBL 5IBUG 2PYEE 5J9PB 1CF8H 3DRTB 3MOQA 4UAOB 1GPOL 4C54A 4QTIH 3BZEA 4U6VL 4N0UA 1A6ZA 2F8OA 5K9KB 4F7MB 2DS4A 2V2WB 3KLHD 1KBGL 2XG4A 4RAVB 4Z7WE 4NZTL 3FQRB 5JO5A 3QUYC 1P84K 2X40A 4JCLA 1T89C 5AZEH 1ITCA 5I73B 4JANA 3HPLA 2O5XL 3ISWA 1P4BH 1ZMYA 2DQHL 2MCPH 4FQQB 3LS5L 5ESAB 4WHYH 3DX9A 3IDUA 4Q9RL 2FD6L 4D3CL 1YYLL 4K23H 4LGPB 4BQ9A 1CLZH 3U7WH 3U4EB 5HYSG 4GLRI 4UV4L 3P73A 2HRPH 1Q0XH 2Q6WA 4YBHA 3QH3A 3QBTB 3O2DH 4JB9H 2NTFB 1LK2A 4X6CB 3CCHA 4KY1H 2W0FB 3VFMB 4LCUA 5FKAA 3O0RL 5L6YL 3C5SA 2WQ8A 2Q8BH 1SMAA 3A6OA 3FQNA 3GZKA 1MI5E 2VDLL 1F58H 4XWOD 5F89B 1HDMA 3BH9A 3BSZL 1XGTA 1TNMA 1INQB 4L3ED 5DC0A 3LKOA 1KF9B 2FWOB 2VLJD 2R69H 1UB6B 3FKUS 5A2JH 2LU3A 1C5DA 4EZMA 4PRHE 3C6LA 4HBQA 3QQ9D 4M7LH 4I77L 4YDLC 4QT5A 5ALCH 3UPRA 1QVOB 1UKQA 5D1QB 2OTPA 1CU4L 1G7MB 7FABL 3OKDA 3LIZH 4XVJL 2CKBL 5J8OA 5DJAB 1T21B 3VFRA 5IMKA 3K4ZA 1NGPH 2R0WH 3T4YA 4PYGA 1RHHB 1NCBH 4MNGB 3VWJD 4TRPH 4P4RA 3DNKA 2FBJL 4K71C 2IH3B 3A6CL 5KSBA 2ZPKL 1VADB 5LGJA 3OJDB 3VG0L 3AREB 1MCQA 3KPRE 4JY4A 1I9JH 3DVFA 1BZ7B 1SJEB 3A6BL 5ADPL 5EU7E 4P2RE 4M1DH 1BBDL 1BQSA 4P2QD 4BYHA 3B9AA 2VQ1A 5FA4B 1S9YA 5CEXB 4UV7H 2WWKO 3UC0L 4IOIB 4G6JH 4WU7A 4ZNEE 3CVHL 4GBXD 4HIEA 5HGBB 5ID1B 1CDYA 1D9KC 5F70A 4ZUVB 1WBYA 5FCSH 2Z92B 5HI5C 4JFOA 5SWZD 4FTVE 5D1QD 5AUMB 4XB7A 1N0XL 1B0WA 5EWIH 1UQSB 5F7YC 1VKXB 1MHPH 3CDYA 4BUGA 1CR9H 5CEZH 2BNQA 1HHKB 4WGVB 4I0PB 2JLLA 4JJ5B 4ZTPL 1J8HB 2YD6A 4C4KO 5EU4B 4FQCH 1XCQB 3LD8B 4J12A 2WUBL 2D03H 5FYLL 3VXSD 1MRCH 4QHUA 4D0DA 3HB3D 2WWMC 3MLXL 1U2HA 4XPAH 3VGBA 4EN3B 3REWB 2A73B 5KANG 3OXSB 5IP4A 5J57B 3N9GH 1IGML 2ZCHH 1EEQA 3ME0A 2O93L 1K3IA 5IKCB 3RL1A 1LP9F 1NDGA 3WNNA 5SWSE 2KBGA 3HZKA 5D7IF 4K3EH 1DQLH 1OAQH 5E8OB 2J8UF 4AENA 1KULA 1FNLA 4KDVA 4WW2C 1MIEH 1KNOA 5A43C 2NXZC 4D0CB 2D4DA 2OSLA 4YXHH 4EOWL 4M3JA 4XC3H 5CSZB 2VDOL 1DDHB 4W6XB 5T3ZD 3BT2L 3LN4A 5C3LD 3FZUC 5DK2A 4D0BB 3UTTB 1JYWA 1W8OA 2RIKA 1CXIA 5HDQH 3S98A 3GSRB 1IEBB 4L8SC 5TFSL 4HV8B 1A7QL 5E4EB 2UY7A 2R0LH 3HMXA 1YDPA 4JCMA 4Q9QL 1AD9B 4UIMB 5HI4C 3SDXB 3IDGA 1WJ3A 3MROB 4I0PD 1J8HD 1EEZA 3RWDA 4ZUSA 4C55A 3LVEA 5E7FA 2GY7B 5EBGA 5I1EL 1K6QH 1PDKA 4OGAC 2GTZB 4MQXC 3P77B 2GSIA 4KUZH 3AMLA 3F6IA 4LSVL 1P53A 3VXPB 5I15L 1CD1A 4Z7VA 1GOFA 1GZQA 2Z8SA 1KB5B 4H0GA 1X5YA 2CDFB 5FCUL 1CDIA 3FMGH 1YN7A 1LD9A 1CXHA 3MBXH 1U95B 3LRHA 4HZLA 2CSPA 4OZHE 4Y4KB 5IQ7H 3P11H 4CRPA 1T1XB 2H8PA 3EO9H 4RIRB 2JJWA 1T1WA 2BC4B 2GW5A 2RFXA 4A6YL 5E8EA 2UY6A 5CUSH 4I3GA 1AKJD 4KH2A 4UILL 4NKMA 2DMBA 1CVRA 4KKAD 3WXWL 1A6TA 2B5IC 3AXLA 4QF1B 4L3EA 2FHCA 1BGXH 1GGIL 2VLJA 3BPLB 3CZJA 5D7LD 4HMDA 4OLUL 3REVB 2XA3A 2X70B 3DRTA 3HMXH 3MRLB 4JHZA 4HJJL 3SDAB 4F8QA 2WLYA 3SCMB 1EDQA 3CXHJ 1OTSC 5IB2B 4U1NB 2ERJB 2EDJA 1I7TB 1NCDL 1UWXH 3S3SA 2VDPH 3QAZC 4F7MA 5CD5C 2V2WA 4RAVA 3FQRA 2B0SL 3LKQB 1JGDB 3RVUD 1HINH 3QXDB 3T0DA 3MNVB 5CHNB 1V7ML 3N1FC 3PP3K 4XXCC 5HYJE 4GQ9H 4Z95L 1PKQE 3VWJA 5LBSL 5ESAA 1UWEL 3VFUB 2ARJQ 4WEBH 1U3ZA 3V7AE 4G6FD 1IBGH 4Y4KD 5I1DB 3G6JB 1EGJA 2NTFA 4X6CA 4HK3J 5I8OH 5B3JE 5IG7B 2W0FA 3VFMA 4HUMB 3KLDA 3S3PA 1MFEH 1SBBA 5F6IB 1BJ1H 4LVOB 3MV9E 5EB9A 4JY6B 4Y5YB 2IBBA 4PREB 5HDOA 3D69B 4HIHB 1LO0H 3DUUB 1INQA 1R5VB 3UCRA 4GBXA 2FWOA 4HC1A 3WKMH 1UB6A 4G8EB 3RL2B 4CUCA 2Y07H 3F7YB 3SDAD 4K9EH 3JV5A 1JE6A 2FB4H 5SWZA 1CLOL 1QVOA 4HUUB 5D1QA 3RY6C 5IBTH 5C07B 3BFOA 1G7MA 2CLZB 4PBXA 5IFAL 5DJAA 5EIIB 1FPTL 1KYOJ 1T21A 3V6OA 1YQ2A 4M61B 3E6FB 5LQBL 4EIZC 2CR3A 1C5BL 2Q8AL 4LIQE 3Q5TA 4XP9L 3EYUH 4MNGA 4Q74A 2OR8A 1Y18B 3VXSA 4J8RB 2CH8A 1PD6A 2VRAA 3ARFC 3BAEL 3MQIA 1VADA 1EGJH 1EFQA 4PY7B 2XN9B 5TE6H 3IJYA 2CRZA 4GW5B 4HF5H 5D2LB 2BERA 3MX0A 4NCC2 1NBQA 1BZ7A 3B9EA 1CTOA 4XAWL 3G5ZB 4NIKB 3MBED 5TJWK 3FZUD 3QUML 5C86A 1TZIB 2W9DL 4EKXA 3SGJC 3MRPB 3OG6B 4R7DB 5FA4A 1RD6A 5DJ8B 2A77L 1FE8H 3JWOL 3CFKA 5CEYB 4ONFH 3EUUA 4NO3A 3CUPB 1NCWH 5HGBA 4NQUA 4F9PA 2YBRB 3QYCA 5ID1A 1P7KB 3S37H 4ZUVA 3RDTC 4O5LH 3CIQA 3K1DA 3GMRB 4IMKC 3KJ4C 3S4SA 2GSGB 2Z92A 5T1LB 2NX5E 1T89A 5AUMA 5E4IA 1FGNL 1UQSA 5JUEL 5EU3B 4YBLC 1VKXA 1FO0A 4HIXL 1HHKA 4P5TB 4I0PA 4JJ5A 1J8HA 1NDMB 1S7VA 5EU4A 1XCQA 3MV11 1CDBA 2DLFL 4GAJL 3TO4B 1CBVH 4Y2OA 5FECB 4X80H 1BREA 4LVNB 5IT2L 1A2YA 2LQRA 1JPTH 1TJIL 2ORBL 3FN0L 1WQVT 4K8RL 3LH2L 4U1HB 4WTZG 2XRAH 2FIKA 5J6HB 3REWA 2MTPA 3QDME 1MAJA 2A73A 5CJOL 5FYLE 2Q86A 3T0BA 1KLGB 1IGJB 4ZO6A 1YZZA 3HNTH 4IDLA 4MWFB 3PP4L 3SJVD 2WNGA 5IKCA 3Q1SH 3PV6A 1MLBB 1U8OA 2ZG1A 1KN2H 1TTGA 4L4VD 5E8OA 1IVLA 3BD5A 4MJ2A 1QUNA 3MXWH 4FFYH 1LE9A 4XWGH 1EHLH 4WV1C 1BVKB 3R1GH 5T3ZH 5D5MB 4D0CA 5HHQB 2P5WD 3NCJH 5CSZA 1QSFE 2OR9H 4DQOL 3KPTA 6FABL 5MP6L 3TNNA 3GSXB 5DMKB 2ED8A 1OTSD 2AGJH 5I1HL 3CFDB 1SYSB 4FFVC 4PG2A 1E6JH 4XMLH 4XPGL 3ARPA 4YC2B 1QSVA 4UQ3B 4XMKH 5KSAC 5D7LA 5T1LD 3GSRA 4HV8A 4RZCB 3O3EA 1QFWL 4PJDF 1UM4H 2P5ED 1AD9A 1CQYA 1YEJH 2ZNWA 4UIMA 1NCAL 3GNMH 3MROA 2X1QA 5BS0E 4DWHA 2F9BT 4DOHB 5FM8A 2CIIA 1PY4A 1CXLA 4NGHH 2AXGB 1T7XA 3TO4D 1J1XL 3GMLB 1Y6KR 1IZKA 3AY4C 4MAUH 3LB6D 2AK4D 3CX2A 3P77A 2EDTA 1LP9E 4FQ1H 3QUZB 5D7IE 4D9RD 4HIJB 2VZSA 1FRGL 3TPUB 2J8UE 1DSFL 1QBBA 3T0WA 2Q7NA 3MRFB 2AKRB 1IAIL 4N8PA 1MFNA 1QTYT 4Y4KA 3MRCA 1T1XA 2OBGA 5I1CH 1CE1H 4QEGA 5E2VH 4Y16B 4RIRA 1ZEAH 1IMHC 3L5JA 3U7YH 1FFPB 4WO4B 1ZT7B 3MRBB 2BC4A 5A16B 5JHDE 1F3RB 3NFSH 4QKXB 2FYYB 3LKRB 4PRBB 3QPXH 2YD5A 3RU8H 3GUTA 3W0WE 3RAJL 1F3DH 2VLRB 5CJ8A 2Y4SA 3PWPB 1KV3A 3REVA 2X70A 3NIFF 3MRLA 3SDAA 1DEEB 3SCMA 1M6OA 4ZAKC 1WFOA 1Q1JH 4U1NA 1UGNA 5D6DA 3HCVB 2EC9U 3KYNB 4AQ1B 4H88L 4J6RH 4PJCF 3HC4H 2FCBA 5HHMB 2EE6A 3LKQA 1JGDA 2GJ6E 2XG5A 3QXDA 1YPZB 3MNVA 1QLFB 5C1MB 1J18A 5FO9B 4QRPB 4K07A 3PGDB 1NEZG 3VFUA 2ENYA 1Q9LB 3QUZD 2MKWA 1YQVL 3CMGA 3R8BB 3S5LB 2I24N 1UB5B 1CGSH 4YE4H 2JIXD 5FA3B 3VXUB 5I6XB 3SO3C 5I1DA 4C56B 4F80A 1OAKL 1KPRB 4P5MB 4G8GD 2Y72A 5KBNC 3MBEA 2PW1A 1PG7X 3GSNB 1A14L 1BOGB 2J3SA 4JY6A 4Y5YA 4PREA 5DJ6B 3D69A 4HIHA 5L2JB 3RDTD 3DUUA 2E5EA 4X83A 2K7PA 2VC2L 1R5VA 3HA0A 4P9HH 1ND0B 3IJSB 4TN9A 2M8XA 5CGMA 3QZWG 3RL2A 1MCWW 3HKFA 3F7YA 2C3HA 2HH0L 5IUSA 3U6RB 3IYLW 4XNUL 1BEYL 3MLRL 5FV2A 5I1KL 4ZFGH 4C58B 2CLZA 2GI7A 2JK5A 2K1MA 3LEXB 4LNRB 5EIIA 5JR1L 1XGYH 4M61A 3E6FA 4QRPD 3CPLA 3QQ4A 4FABH 1AXTL 3E3QE 1RY7B 3DGGA 4J8RA 5J13C 1MWAL 2V5SA 1CFQB 5HYIA 3GRWA 1B4JL 1MCBA 2XN9A 3QUKB 4GW5A 4ZOAA 5D2LA 3SJVA 3BGFC 3BPCB 3ETBF 4C56D 5L0QB 2JB6B 1GCFA 1F5WA 2R9HC 1A1OB 2DBLH 2B1AL 1UWXK 2HT3C 32C2B 4L4VA 5F7LB 1HYSC 4KUCF 1E6OL 1CL7I 1DBBH 3PHSA 1TZIA 4FFVD 1WT5C 3MRPA 3MCKA 2EDRA 4RGNC 3S3JA 4Z9KB 4LHUB 5CEYA 4E0RB 3O8XC 4O51A 2MQCA 3G04B 4Y8DC 4HT1L 3MUY1 1OAUH 2R1XB 5I16B 3FTGA 1P7KA 4D9LH 3QQ3B 4D9QE 2FSEB 2X41A 3GMRA 5JDJA 1HSBB 5JORB 3WN5C 2GSGA 5T1LA 3ZE1F 1FCGA 5SWQB 2YN5A 4KRPC 3UTPD 1TZGH 2P5EA 4JQXC 4KHXL 1JP5A 5EU3A 4YDJA 4XXCA 4CW1B 4P5TA 3A67H 3X11B 2J5LB 3ULVC 4JRYE 1NDMA 1IZJA 1A7NH 4K3HA 3NFPA 1I9RL 2QADC 3TO4A 3L95B 4JO2H 4WHYG 1T2JA 4WUKL 3GRWH 3G9VA 1TTUA 2AK4A 3VGAB 1YN6B 4U1HA 5GRVK 4L8DB 5J6HA 4PP2B 4YFLI 4PS4L 1FAIH 2NZIA 4ZSOB 4ALAL 1F4YL 2EDOA 4LVEA 3U48A 2CJUH 4Y1AD 5ALBL 4YK4B 1MLBA 5TPWH 3D2UB 4R4NC 4HFUL 2DQDL 4KVCH 5FK9A 3CH1B 3K2UL 3DI2B 4CMHC 3KXFB 1YMME 1EMTH 4YPGB 1RZFL 5D5MA 5I2IA 1I8LA 5HHQA 5JIKA 2HKFL 4MAYC 5DMKA 3SE3C 4ZAKD 3QCVL 3SE9H 3MUZ1 1SYSA 1NAMB 4UQ3A 2EH8H 5CBAA 3IKCA 1U3HC 4Z0BH 5FUZL 4RZCA 3BN3B 1HWGB 5DYOB 1ZANH 4HKZB 5E99H 3SDDC 3UX9B 1ZA3A 3OKOA 1ERNA 3V5KB 5JZ7D 1NCTA 4K7PL 1JYXA 5F7HA 4I2XA 3MSPA 2BVEA 1A0QL 2AXGA 2DIJA 3EYFB 3GMLA 1JGUH 3BGMA 2BJML 1HKFA 2OI9C 1KIPB 3B8SA 4LKXB 5JW4Q 4BZ1L 3T1FB 5DGQA 1B90A 4YX2L 2EYRB 3CXDL 1H3GA 4YHYC 4Z77A 3MJ9L 2N7AA 5ETUB 3QUZA 1U9KA 4HIJA 3TPUA 4UOJA 2AJVH 2JIXA 4N5EC 4K94L 3SGJA 3D2UD 1AE6L 3FT4B 1X3DA 3CDGB 4Y16A 5FGCE 1K4DB 2MMXA 4KAQH 1FFPA 1IEAB 1ZT7A 3MRBA 5A16A 3F62A 3JWDH 2I5YL 4KMTL 2C1PB 2FYYA 2VLKB 3T0EE 3AAZB 4PRBA 4U1SB 1XGUA 4HIIB 5FYJU 5KVDL 4CDGC 4DKAA 5J3HC 1GGTA 3EHBD 2OL3L 1HQ4B 4IMKA 4ZODA 1ONQA 3O6LL 1WWCA 4MB5A 4JPVL 1UG9A 5JHLL 1REIA 4PJDE 2HA1A 3IU4L 1K85A 4MNQB 4ZUWB 4U3CA 2NQCA 4Z7OF 2J7LA 2F54D 4PJEF 5A3ID 1DEEA 4JZJB 4ONOA 1ZLWH 4NM8H 3HCVA 4OCRH 3KYNA 1A6VL 3QDAA 4KTDH 4Y88A 1YPZA 4ZO9A 1EO8H 3FQTB 3TA3C 2LAGB 5FO9A 4QRPA 4POUB 1QBLL 2PKDA 1HQRB 3VWKB 3PGDA 4IBLT 1FCCA 1Q9LA 1ZT1B 2R9HD 1CXKA 4RFNC 1H3XA 4M43L 1OAYH 2OLDA 3S5LA 1UB5A 3CLFH 3BO8B 4NZRH 4XNMB 5FA3A 2NY0B 1LO2H 2Q3AA 1XIWC 1D6VH 2AEIT 4I3SH 4C56A 1KPRA 1KYOK 2EDQA 1OB1B 1XGQB 3H9SB 1WUNT 1BJMA 2F53E 2G75B 1JNHB 2VLKD 3MUJA 3WS6C 4NQSB 5DJ6A 2VL5B 5L2JA 4JG1H 1ZHBB 4ZQKB 3THML 4LCIH 2NY2B 5CILH 3VXMD 5GZOC 3ARBC 4XP4H 1GRWA 4PB9L 2Z8RA 2OR7A 4KRPD 5IHZB 1ND0A 3IJSA 3OJ2C 5F8RC 2YC1B 4U1MB 1U93B 4PJCE 3BPNC 3LKNA 5I74C 3U6RA 3U9UB 2Z93B 2LTQB 4N0CC 1NC2B 3VXOB 1JHKH 3GIZH 1KTDB 3BKYL 1BFTA 3LEXA 4LNRA 2F5AL 3D3VD 4XCNB 2LVCA 1R3KB 2ATPB 5IB5B 5IGXL 2OK0L 3C5ZB 4NN7B 4ODUB 2P8MB 3VWKD 1DN0A 4N8VB 1CFQA 4QXWA 8CGTA 5H94B 5F1IB 4PFEA 1Q94B 1CT8A 3MRGB 4LU5L 4JJHA 4NT6A 1BM3L 2NY0D 3QUKA 5F9OL 4F57H 3BPCA 2XTJE 5DQDL 1A1OA 5CIPB 1W8NA 2D3VA 32C2A 4LCCC 1MRDH 3RWFB 4X6FB 4YHKH 4DN4H 1JNNL 4GMTL 1I3GH 4XP5L 5F97E 4JFFE 1BOYA 1NMAH 3BZ4A 3B43A 3H6JA 2FNBA 3K80A 3HAEA 1H3TA 3ZSSA 5AZ2L 4YIQB 5DFVD 4TYUA 4FHBD 2R1XA 5I16A 3IS0X 1NGWA 4JLRB 5JQ6H 3SOBL 1GGCL 4CVZB 3QQ3A 1CFTB 2FSEA 4IDJH 1HSBA 5IB4B 4MJ4A 1S78C 3QEHA 5SWQA 3TIDB 4XCEB 1AXIB 1RUKL 3FT3B 3SE4A 4HK3N 4JPKL 4P46C 5I1IH 1NC2D 1XMWA 2VLMD 4CW1A 4BH8B 3X11A 3OL2A 2BVYA 4MZ3A 3NTCH 3L95A 1HCFX 2EXYC 1JI1A 3EYSH 1JF1B 3QJHA 4MDIB 5E00B 5DMJB 4N5ED 2AK1L 1YN6A 4HWUA 5HVWA 4L8DA 4LMQI 3TN0B 4CADB 5KS9B 3RUGF 5DURB 3Q0HA 5IVZB 2XV6B 4JG0L 1I1CA 1N2RB 4OLZH 4MJIE 4ZSOA 1ORSB 5FHBL 4BQBA 3V4UL 2QLVB 1P4LA 3EDJA 5HJ3A 3H2WA 4OF3A 3D2UA 2FEDD 3OGCB 5J3HD 1CE6A 3CH1A 2AAVA 2Z91A 4J4PC 3U2SA 3CVIH 1FV1B 3HAEH 4G6AC 3QEGL 4OFKA 4YPGA 2R1WA 5C6WH 1EZVX 3I02B 1JK8B 2P49B 3K8KA 3ZL4L 3P3YA 5TF1H 3BXNA 3ZE1E 4RAHA 1PZ5A 2WM0A 1JTPA 4F9LC 1NAMA 2ZUXA 4TTDC 5GS1B 1YNKL 3M45A 2PTTB 4BA8A 3MOAL 2F54A 1EJOH 1CI5A 3UTZA 3ES6B 5DYOA 5IV2B 2P43B 4XGZA 3MRNB 1KB9K 3B8YA 5KAQF 1RURH 4FNLL 3TA3D 3QSKB 3V5KA 3MV7B 1OTTC 2EYSB 3L7EA 1OLLA 5F88A 5F6HI 4NWUL 2KZ1B 1JRHL 2F5BL 3EYFA 4OCMC 3RIFK 3KYAA 4ZFFB 1HHHA 1KTLA 4X5XB 3CFCL 2YD2A 4ELKA 4CJ1A 4LKXA 3TP4A 2EYRA 4MQ7B 4P5KB 2YSSA 4ZS6C 3S96B 5DMIH 4XI5D 1SJHB 5HPMB 3SDYH 1QRND 1PBYA 5DURD 1JF6A 5ETUA 2VOTA 4X99B 4RGMB 1FYTE 1MF2H 2BXYA 1OQOA 2O5YL 3SGDI 2R2HB 4M5ZL 2DTML 3MJ8B 3ZZ1A 3WIIH 1IC7L 4R97B 1E27B 1KCVL 5JA8B 3FT4A 3OV6A 1NFDB 4Q2ZB 1C5CH 4LQ1A 1KCLA 3IT8D 1IEAA 4KHTH 1X5XA 4GAYB 4RFEB 5D96B 4ZFOB 2C1PA 2VLKA 1UM6H 4U1SA 4AIZB 3KR3H 1NAMH 2W92A 4HIIA 3U1SH 2BVQA 3WN5A 2WLZA 2GUOB 4YDKL 4TULL 4V1DE 3U4BL 3VXMA 3HG1D 3P9MB 1DLFL 5FKPA 4MNQA 4ZUWA 3WEXA 1KC5L 1O7SA 4LSSL 2XZQL 1R5IA 1YEHH 4M93B 1FNSL 4JZJA 4APQC 1JZ8A 1LNUB 4PJGF 1FAKT 4QXTB 4WWKB 4KFZC 3NN8B 5DRXB 2FATL 5EFIB 4KVNL 4E9LA 5B39A 4YXKL 2BY1A 3T1WA 3D3VA 4I4WA 1SJXA 4YHZL 1GGBH 3FQTA 1EX0A 4PJAF 5HVHB 5KJRL 5IMOB 2H2SC 2YKLL 1NGZB 3VWKA 2BMKB 2BNRB 2AJZA 1ZT1A 3FFCE 3FB6B 3WD5H 3QFDB 1UVQB 5E8DH 4XBEL 5DEZA 4J3WA 4JFEB 2VDQL 4OLVH 4XNMA 2QQLH 2QL1A 3BIAX 3L7FB 4U31A 5BW7C 3M1BA 1A3QA 1E28B 1RZ8B 1OB1A 1QEWA 1XGQA 3H9SA 3TIEB 4LARH 1YEIL 1V5JA 5K59F 1NCUA 2G75A 3UYPA 4HCRA 1JNHA 5AYQA 1NJ9A 3Q3GA 1CCZA 3LOWA 3UDWA 5HHVH 1ZHBA 4Z7OE 4KZEL 4PJEE 2ZG2A 5LGHL 4QWWC 1R0AL 1S78D 3HI6L 4S11A 3QIUB 5IHZA 1ZK9A 2YC1A 4QRRB 4P46D 4YDIH 4DGIH 3MFFA 4UNUA 4BQ6A 1U93A 4OF5A 4W4OA 3RGVC 4OZ4B 4UINL 1HHIB 4LF3B 3C8KB 2IANB 4M6NL 4WFHE 1WZKA 2Z93A 2EXYD 1R3HA 3KPOB 1NC2A 1RSFA 5TDNB 4K3JH 4MA8L 4LK4A 1KTDA 1HH6B 3RKDC 1I1AC 1BD2D 4XCNA 5IEKB 3K81A 3LEYL 1R3KA 2ATPA 1N26A 5IB5A 1RZJL 3C5ZA 4B7IA 4ODUA 3UO1H 2P8MA 4IIQA 2Z4QB 2ED9A 3MGTB 4JFHD 5T1KB 1FGVH 3E2HB 3RJQB 4N8VA 1JZ6A 1G0YR 5H94A 1ZA6B 5F1IA 1W0YT 1Q94A 3MPCA 4PGCB 5E08H 2VAAB 4NUGH 4G6AD 3UJJL 5DT1L 4M1CD 1ZLWK 2Q1EA 3DSFH 2YA0A 4HCRH 1BP3B 3I2CL 5CIPA 3QPQD 2VJXA 3RWFA 1ZHNB 2QV2A 2OTWB 5C0CB 5K93A 3QDGE 1OWRM 5L2KD 1OP9A 4OSUH 2HLFD 4YR6A 2VDML 4R8WL 1MCSA 3DJ9A 5JW3H 3O6KL 1JYNA 2PTVA 4YIQA 5KVEH 3QIUD 1RV6X 2VUYA 4QRRD 5ISZE 4JLRA 4CVZA 4GUPA 3EOAB 4PLJD 3AS1A 5IR1B 1CFTA 3K0WA 1OTTD 5IB4A 1A22B 4QOKE 5TH2B 3C08L 1AO7E 1CIDA 1A7RH 1U91B 2FX7H 3EYVB 4XCEA 2B4CH 4ORZC 3ZMRA 4X6DB 2BVPA 1JTOA 5FYJH 1DUYB 4BH8A 3T0XA 1RZ7L 2BRQA 3BP6B 3TT1H 2B2XL 3QXUA 4ZS6D 1F00I 1CF8L 4LGRB 4N90E 3CU7A 1I1FB 1JF1A 4MDIA 3GSWB 4GS7C 5T1KD 2DQGH 2YZ1A 1M4KA 4LAQH 3BP4B 3FN3A 3G08A 3TN0A 4CADA 1BPVA 4LCWE 4K7FB 1QRNA 3FB8B 5D1ZC 2A1WH 5IVZA 5GGUB 1RJYA 1OP3H 5AZEL 5KS9A 5ABDE 1N2RA 4LEXH 5CIPH 4U1GC 1ORSA 1P4BL 3GJEB 5KSVB 3B9KC 2MCPL 3EDDA 2IQAA 4LPCA 3H7BB 4K23L 2DLIA 2J88H 5C0CD 1FV1A 3U7WL 3VFGH 5IVXB 4PJ8D 2ZCKH 2APTA 4YHLH 1ITBB 3I02A 2HRPL 1JK8A 4ONHB 1KG0B 3TT3H 3I3BA 1MVFA 4UU9B 1P5UA 3O2DL 4APQD 2PO6C 4JB9L 3WFHB 4KY1L 1OW0C 3HG1A 4ZG1A 5AAMA 2PTTA 4KQ4H 4X6BB 3UTOA 2Q8BL 4LASH 4KWUA 5IV2A 1F58L 4NN5C 1NANI 3V9FA 2P8LA 3UROR 3BDYH 2UYLB 4OBSA 2DBJA 2EYSA 2R69L 4GMSH 4F3FB 1KCUH 4AEEA 4M7LL 4NKOB 5FEBA 4AH2B 1FIGH 5ALCL 4ZFFA 3DYPA 3HMWH 3F65A 5KVGH 3MV01 5DFWH 2IFGA 2VR9A 4MQ7A 4P5KA 3ROLB 3CNKA 3S96A 3W11C 4LRIC 1SJHA 3C8DA 1LEIA 5HPMA 3LIZL 2X7LB 5GJSH 2YRLA 3VRLF 2D7PA 2Y23A 4NM4H 3IDNB 4X99A 3UZVB 5FIEA 1NGPL 4LCCA 2R0WL 3KWWB 3LQAH 3E3QC 2K7QA 5DEFA 1F11A 5M94B 2EYTB 1NCBL 3G6DH 1VGKA 1AGDB 4TRPL 1E27A 4NNYA 2YPKB 4FXGB 5LKNA 1NFDA 4XCFH 1K4CA 3PWNB 2MPAH 1S7RA 2AQ2A 2IAMC 3TLRA 4RFEA 4ZFOA 4ZPVB 1HOCB 4AIZA 5C0EA 5I19H 2CUHA 1FG2A 3IAPA 3QXAB 25C8H 3RGVD 1H8OA 4JKMA 5KSBF 3J8F7 3PL6B 2WINB 4M1DL 3P9MA 1F3JA 1TTFA 4P46A 3RHWK 1JPST 1RMFH 3X14B 4UV7L 2J2ZA 3VW3H 1I1AD 3U46A 5KN5A 3Q6GH 3GM0A 4G6JL 4AT6B 1WC7B 1XR9A 4QXTA 3NPSC 1TJGH 5EIVA 3JWOC 3NN8A 5DRXA 4L4JA 1S7UB 3U4AA 5EFIA 1DQQB 5FO7B 5GSVB 1BD2A 1YMHA 1U8IA 5IMOA 3KDMA 1NGZA 1RUMH 5EWIL 2BMKA 3GDBA 1MHPL 1CR9L 2R0KL 3FB6A 3QFDA 5CEZL 3UTSD 4N5UA 4HW6A 3FFDA 4RMSA 1ZGLB 4FQCL 3SBWC 4WFFD 4JFEA 3PV7A 3TESA 4XT1C 3OKKB 3U36A 2UUDH 2DKUA 2C3VA 4UT7H 2D03L 3L7FA 3MLYH 3DX8B 1MRCL 1RZ8A 3TIEA 2X9WA 4XPAL 4K8RC 1CICB 4F9LA 1YEGH 3N9GL 2ZCHL 4RWHA 4M9PA 2YPLE 5C0AE 4IRSC 4FZEL 1DQLL 4K3EL 3QIUA 3UYOD 4DK3A 1OAQL 4PJGE 2ADFH 4QRRA 4GJTB 1MHHB 3OZ9H 5INDA 4FG6D 5GGRA 1MIEL 1F45A 3R06B 3PDOB 3DV4A 4NFDA 3HHRB 2YD7A 4OZ4A 1HHIA 3UXFA 2Q7YA 4LF3A 2IANA 3LQZB 3QDJD 4PJAE 3OAUH 3MRQB 2RHEA 3KPOA 5TDNA 1HNFA 4XPFH 5LWYL 5HDQL 3DYMA 3TBYB 3T04D 2P42B 3QEQB 2AEWA 2QR0B 3AFLA 2IPTH 5D1ZD 4MD0B 4O2CB 2EDDA 3Q5YA 4EVNA 3EYQC 4HUVB 1N0LA 4JRXE 2CKBA 2ZJSL 1YEDA 2R0LL 2Z4QA 3MGTA 4FN0A 5T1KA 5IWLC 2ZUTA 1CXFA 1N64H 1ZA6A 1OSPL 2KZWA 4AG4H 4PGCA 1T22B 2VAAA 3STZB 2AABH 1RK0B 2KDGA 2FX8H 5ICXB 2XZCH 2V7NB 5K59E 4HGKC 1K6QL 3F7PC 3TH4T 3PQYB 4FFWD 2HFEB 1Z6JT 4JREB 2Y6SC 4KUZL 2NY4B 1FIEA 3TFKC 3BMWA 1ZHNA 2OTWA 1JFQL 2PO6D 5C0CA 2D7OA 4PJ8A 2ZP0T 1VCAA 3JTSB 4ZDHB 3FMGL 3FO2A 3VH8A 2VZTA 3OKNB 3MBXL 5IQ7L 2IGFH 1MJ8H 1TETH 3P11L 2VZ1A 2OYPA 4LMQE 3QWQB 4Z7VF 4FZ8H 4XBPB 5T5FH 5E8NB 1MUJB 1FL5B 1IE5A 3VE0B 5IR1A 1HKLH 1VFOA 5CUSL 5CP3A 1QHPA 5JXEC 5TH2A 4MMZC 1U91A 3FQXB 3NCMA 5C92A 2C1OB 1MAML 4X6DA 1EZVY 1DUYA 4TVSa 3IAQA 2R2EB 3PWJA 1BGXL 5IEHB 4TNVF 3W11D 3EOTH 5J56B 4LDEB 3HMXL 3L3OB 2B20A 3MJ6A 5GRWA 4JFXB 1KXVC 1UXSB 3EJYD 5BO1H 4ZNCD 2FO1A 1I1FA 1VFAA 1OLZA 3QNYA 2X4QB 3FCTB 1JNJA 2VDPL 2VQTA 1J11A 4URTB 4K7FA 3FB8A 3D48R 2DWDB 1HINL 3KNBB 2IAMD 3GJEA 3QR2A 5KSVA 1S7WB 2XZAH 1H5BC 2NY4D 4TPRH 5EOCH 3TWCH 1VEOA 1FFNB 3V52H 1ZGLP 1JWMB 4WEBL 5IVXA 1QLEL 2EXWD 1U8LA 5JW4N 2R23B 2DYPB 1IBGL 1KG0A 3S88H 3MODH 1FNGB 5HPOA 3RX8A 2A6KB 4MDJB 3WFHA 5I8OL 5CP3H 4PTTA 1EIBA 4KXZI 3CK0H 2D7MA 1MFEL 4X6BA 3MA9H 4L8CA 4WI3A 4XX1E 1B4RA 1LO0L 3O3DB 2G2RA 3IJHB 3P0YH 2EDXA 1NUNB 2UYLA 3IETA 1T0PB 2PNDA 5GRVL 4JHWH 3WKML 4F3FA 1MREH 1JWSB 4CVXB 2Y07L 2DLGA 4K9EL 5K9JH 3F8UB 4AH2A 1JV5B 3S5LG 1U3JA 2FB4L 1OQXA 2CLRB 3ZDXF 4O4YH 3FT2B 2HLAB 1VSCA 4N0UE 4TNWK 3ROLA 5E2UH 5IBTL 5JOPE 1II4E 1T3FB 1JN6A 5F7MC 3UTSA 1YEFH 2OX5A 3VRIB 5ITFA 1CD8A 2EYTA 3EYUL 2DL2A 1AGDA 3HUJE 1TQCC 2YPKA 4FXGA 4JR9H 2X1OA 1FL6A 1FFRA 4WI5A 3PWNA 2JTDA 4IRSD 2R1YB 2ZOLB 2BVUA 1EGJL 1P6AB 4Y5XC 2DYPD 4ZPVA 4ZUUA 1CZ8H 1QBAA 1HOCA 4EEEA 3D39B 5TE6L 5KZCB 3VXTB 4HF5L 3QXAA 4J1UB 3IF1B 3PL6A 2WINA 4IRZH 1KJMB 3QIBD 3H3KA 1OP3K 5BVJB 3D9AL 1F6LL 4MLSA 4WTWA 1FE8L 3ALPA 4HC1L 2XIDA 1OHQA 2WIIA 1LWRA 4AT6A 2AJSH 5D70H 4ONFL 2ZUYA 4JM4H 2W38A 3NOIA 1NCWL 1S7UA 3BEVB 5E1AB 1J7VR 5F9DC 5FO7A 3S37L 2DIAA 3ZT6A 5GSVA 3VRLE 1DQMH 1OP5H 4XNYH 4PJ9C 2WK2A 2XXMB 3R0MA 3S6CA 1AFVH 3QIWD 2AV7B 2Y6SD 1D5BB 3I75B 4PLKC 1JUFB 3TFKD 5HI3D 4UI2A 4MCYB 1CBVL 4N0YH 1VPOH 4X80L 3DX8A 1JPTL 3MYZA 4X4MA 3ZHLA 4HHAB 1MY7A 3PXJA 4LHUG 4BH7B 4Q97A 2XRAL 5KSBE 3JUYA 4X7CC 2PO6A 3H3PH 1JF5A 2IG2H 1OW0A 4QGYA 5KZCD 5C9JA 3HNTL 2JE8A 4XVSH 3Q1SL 4BM7A 1KN2L 1OARH 4YQXH 3M07A 5HBBA 5C08D 2X6MA 2W60B 1MHHA 3MXWL 4FFYL 5LCVH 5CINH 4JZOB 4XWGL 1EHLL 3R1GL 5T3ZL 4WEMB 5D2NB 5BZWB 3R06A 3PDOA 2R4RH 3NCJL 2OR9L 3C2AH 2CD0A 3O81A 3LQZA 3MRQA 2AGJL 4EDXA 3VFSB 4KRMB 1G84A 3FHQA 1E6JL 4XMLL 1QFUH 4XMKL 3TBYA 4MXQC 3QP3A 4KKBC 3WHXB 5FM5M 4KKCC 2QR0A 3P4NB 1BFOB 4MD0A 4O2CA 1YY9D 1UM4L 3HTLX 3BRDA 4HUVA 2IALB 1YEJL 3S34H 3GNML 4XP6H 4ZYKB 2BNQE 4XNZB 1AIFA 4HMCA 1T22A 4NGHL 1GH7A 3B9DA 1RK0A 5ICXA 2V7NA 5MI0C 4MAUL 4JKPH 2HFEA 4FQXC 1CXEA 4Y19E 2XNAA 3KPMB 1KXQE 2X4UB 3ARUA 2VKWA 4FQ1L 2I60H 1FORH 1IGCH 1PFCA 1DVFB 3DUSA 4P3DA 5FYKD 3U0PA 2EZ0C 3BP5B 3ARGC 5KVMC 4KRNA 2AS5M 3SO3B 5I1CL 2Y7QB 4LVHC 5E2VL 4XBPA 1ZEAL 5E8NA 1MUJA 3U7YL 4RWYH 2V9QA 5D72L 4KQ3H 4X6EA 3NFSL 3NA9H 1A9BB 4PRPE 2WQRA 3QPXL 2NY7H 4AZ8A 3RU8L 1IGYB 1TIUA 5GPRA 3ZYJA 2B39A 4QRTB 4YHPB 3F7RA 2VABA 2GAZB 2XKSA 5IEHA 1HEZB 3RA7H 1KPVA 1EFXB 4JN2B 2CRIA 2FO4B 1L7TH 3L3OA 4JFXA 5FUCE 3GMOB 3TH2T 1UXSA 1Q1JL 1SEBB 2X4QA 2AJYL 3CZFB 3FCTA 5EUOB 4J6RL 2ESVB 3HC4L 4LLWA 2X09A 1AR2A 5J11B 1U8JA 3KNBA 1F4HA 4UNTA 5I0ZA 3WIHA 1S7WA 5INCB 1FFNA 3T0VA 2HJLB 1XZ0A 1JWMA 4IRSA 4W6WB 1O5DT 4Z7VE 4Q0XH 1CGSL 1DVFD 2DYPA 4JM2B 2MNUA 4YE4L 3AB0C 5IF0B 1FNGA 5MEQB 2A6KA 4MDJA 1DTUA 5I75C 3QWRD 3BH8B 2DMKA 3VGGA 3QIBA 3O3DA 5D7JC 3IJHA 4PRNB 2ZKHL 3SGEH 3WNPA 5HHOE 4P9HL 2UV3A 3F12B 1Z3GH 1KGCD 1JWSA 4P2OC 4L3EE 4CVXA 2VLJE 4FQPA 1XH3A 4YUEH 2KUTA 4O2EA 5F96H 2ZUSA 2DIBA 4XCYB 4EI6B 3OKEA 5TQ2H 4X7SH 1MNUH 2CLRA 3FT2A 3GMPA 2XTLA 4OJFH 1VENA 4ZFGL 1T3FA 3F7VB 1U8NB 5ITBH 2G5BA 3QIWA 2KH2B 1ADQA 2PYEB 2WBWB 3WIHH 3TBVB 1T83C 1XGYL 5AD0A 3VRIA 1MCPH 2V5MA 1WBXA 4TUJB 4NBXB 2E7BA 4FABL 2JJSA 3BWAA 4I3RH 1QP1A 4OAWB 3I6KB 3EAKA 3P2TA 4Z7WB 2G9HB 1ZXQA 1MCHA 2VXTH 4NZUH 3D39A 3VXTA 4PGJA 8FABB 4J1UA 3IF1A 4EQ3A 5ERWA 1CDCA 1J0JA 1KJMA 3RJDA 5A2FA 1XAUA 5BVJA 1DBBL 1NLBL 1ZLSH 4P2QE 4MXQD 2C4FU 5EBWB 5JNYB 3MRDB 5J06A 3KYKH 4KTEH 2X1PA 4GAGH 4OFDA 1OAUL 3ZDXE 3BEVA 2BSSB 4D9LL 2NR6C 4N8VG 1MI5B 2VZVA 3BHBB 1OTUC 1ADQH 1TZGL 4KK5C 4PRID 5SWZE 3BP7B 4OF0A 1ES0A 4IHOA 4WFED 3OGOE 3FOLB 3A67L 1H5BA 1D5BA 1A7NL 3I75A 1JUFA 5KTEH 3NH7L 1S9WB 1CDHA 3I3DA 4MCYA 3MV8B 1RJCA 4JO2L 4KKLD 3GRWL 2GKIA 5L7XH 5DMGC 4BH7A 3ARGD 3VXSE 2DQCH 3MLZH 4WNQB 1CGUA 1IAOB 4DAGH 1Q0YH 3B3IB 1FAIL 1I7ZB 4JE4B 3LPWA 2CJUL 3LDBC 5TPWL 1YY8B 2HWZL 3WJLA 4KVCL 4HBCH 5FHAH 2W60A 4B5EA 1JZ3A 4MSWA 4JZOA 1EMTL 1FH5H 1ZTXH 5D2NA 1YEEH 1IGIH 1WIOA 2PCPB 2NZ9D 2C4FT 4NRYB 4Y4FC 4OTXH 3ZYIA 5T3ZE 4LAJH 3SE9L 5FGRA 3VFSA 4PV9B 2V5YA 2EH8L 3WHXA 1CK0H 1A3RH 5GGSB 4Z0BL 1BFOA 1NBZB 2NLJB 5E99L 1ZANL 5TQ0H 4Z6AT 4LSTH 4X4XB 1UENA 4ZYKA 1ULVA 1IAKA 1J1OH 2X5PA 2BOCA 5DJCA 3MV8D 3S7GA 3DX6A 2AJXH 4GG6F 3MRMB 4NN6C 1MQKH 2H9GB 4RDQG 1KIQA 5KG9B 3QNXB 5JW4M 4KV5F 3GMMB 5B21A 5GGTA 1DVFA 1P5VA 1QPPA 2AJVL 1OP5K 2GFBB 3BP5A 1A7OH 4MS8D 3HC0B 1GZPB 5D7JD 1D7FA 2BOBB 2Y7QA 3AROA 3LV3B 4O2FB 3RZCB 4HWNA 3QWRA 4KAQL 1UZ8B 1MSPA 5E0QA 3JWDL 2GTWB 3VD5A 4P2OD 1A9BA 3CX5J 5E7BA 2GT9B 4C83B 1SVZA 5SWSB 1Y6NR 1XF3A 2YHGA 3O4LD 3ULSB 4QRTA 4YHPA 2GAZA 1NCNA 1UWGH 1X5IA 1EFXA 4I0CC 4JN2A 1CFNB 1DL7H 5D7LE 3GMOA 3O41A 5T5NG 3X12B 1Y0LB 4NM8L 2IF7A 1Q72H 4OCRL 2YD3A 2EE2A 1SEBA 5L88H 3CZFA 1EAJA 5EUOA 3DVNA 1UZ6E 4KTDL 1DUZB 3QA3B 3VXRD 1I3RA 4M48H 2ATKB 5INCA 4HMEA 2DM2A 5GGTH 1XF2B 2HJLA 4Q6IB 1YPZF 3EO0B 1OAYL 1L0XA 3C60C 3CLFL 3OX8B 4JM2A 4ACPA 4FXKB 4NZRL 3NIDF 4KKNA 1LO2L 4L3CB 3MRRB 4MQSB 3KAAA 1D6VL 4ISVB 3RPKA 4I3SL 3FOMB 3VG9C 1MQ8A 3BH8A 1KACB 1VGEH 3BW9B 1WWWX 2OZ4A 1KTRL 4NKDA 4OD3H 4KJQC 4E5XB 4JG1L 5EOQH 4OZHB 2NXYB 3QUXC 1J0HA 3T0AA 4LCIL 5CILL 4XP4L 1FLRH 1OTUD 1QG3A 3F12A 1BECA 4KK5D 3BQUB 4P0DA 3HI5H 5E2WH 4PGBB 1GGYA 4Y8AA 5E24E 4U7SA 3SKMB 4XP1H 3T65B 3VI3F 1U8NA 1JHKL 3GIZL 5DUPH 4P3CH 2CXKA 4NQDE 1NH6A 5IROC 3DWTA 2VUOA 3QDHA 4TUJA 2BY2A 2X42A 2ZUQC 5DZLA 2NY6B 4RAUB 4NQEB 5J12C 5GGSY 1RZJC 3I6KA 4MYWB 2FBOJ 2RR3A 1KCSH 5E6IB 2DJUA 3AM8A 2J4WH 3ARGA 4QO1A 3GIVB 1XF4B 1B88A 1OGAD 1ROWA 2HVJB 3ULUC 3ARTA 5HYJB 1PKQB 4F57L 4BSVB 5TDOA 5C6PB 2NY1C 2OZ4H 4UDUA 1FN4B 4MA1B 1MRDL 4Y4FD 3QT2A 4YHKL 3S36H 3TJHC 4DN4L 1I3GL 5GIRB 2P47B 1NMAL 3IDJA 4LRNH 3C5JA 1L6XA 5EBWA 3RHWF 5IW1A 4WFGD 5EBMB 4NDMB 3IDMB 3MRDA 4JO1H 5JPNA 1CS6A 2BSSA 2E27H 5JQ6L 5I8EB 4DUWA 2Z31C 3E6HB 3PWLB 3HLAA 1MI5A 1JHTA 1OM3H 3BHBA 2XWJB 2O61B 1IAMA 3BP7A 4N9GB 5I1IL 4OCNC 1YYMH 4KK6D 4L4TD 2Y36H 4HEPG 4YBQC 3NTCL 1D5XB 2VYRE 4U1LB 4JFYB 4EXKA 5T3XD 1TVBB 5B4MC 5DVKA 5DK3A 3MV8A 3S97C 2NY6D 3EYSL 4DW2H 4NKIH 4NQED 5D93B 4JFDB 4LLUB 5IJVB 3MRKB 5SX4I 43CAB 2ICWB 4WNQA 4YPJA 5DI8B 4CN6A 3KS0J 3B3IA 4OLZL 1I7ZA 3WJJA 2R2BA 2AERT 2FL5B 3SJVE 5DWUH 1YY8A 5MERB 4BKLB 2VDKL 5D7JA 3ESVF 3CVIL 4L4VE 1MCOL 4LCYA 3ARDB 5C0IB 4R4FH 4P2OA 5DHXB 2PCPA 3MGAA 2P5WE 5TF1L 4NRYA 2XKUA 3UPAA 2PXYB 1HSAA 3VCLA 1T2QH 3AVEA 3O4LA 3RY5A 1U42A 4B50A 4JQIH 3TPKA 4ZD3H 1QLRA 5IJKC 1XGRA 3FO1B 1EJOL 4PR5A 1BIHA 2DD8L 4PJ7A 2QJDA 5TE4H 4ZNEA 1RURL 4WI2A 2P5EE 3D0LB 4X4XA 3GSUB 4X7DC 3IDIA 4YWGH 1INEH 3CDCA 1H9VA 1TZHB 1JPFB 2NX5B 1QFOA 3MRMA 3KPSD 4JFDD 2H9GA 1ZV5A 1KJ3L 2AK4E 2LU7A 5DMIL 1T1ZA 3SDYL 5KG9A 1T0NB 3GMMA 1MF2L 2B1HH 4RMRA 3WFZA 4XH2B 4D9RE 2Z35B 3TO2B 4NZJA 5I8CB 2GFBA 2OTUB 4KJQD 3WIIL 3HC0A 1MFBH 1GZPA 2YA1A 3FB7B 2V2TA 3QUXD 4PJXA 1JGEB 3LV3A 3FQWA 4O2FA 1C5CL 1OD9A 2W0PA 1P2CB 3ARDD 3QDMB 1TDQA 4KHTL 2BXZA 4WGWB 3U0TB 2GTWA 1Q8MA 3TVMC 5IM7B 5IQ9A 1UM6L 5FUOH 5HYFA 3KR3L 5C7XH 1NAML 2YUVA 5FM4A 3U1SL 2PXYD 4NJ9H 3WCYA 3FN9A 3QFJE 4PUBH 5IMMA 1RIHL 1I7UA 3UBXB 1VACB 5GGQH 5E9DD 1PEWA 2AVGA 3DO7A 1EV2E 4CKVX 1CGVA 1CFNA 3L6FA 1YEHL 1QSFB 3X12A 1Y0LA 1I8KB 1NAKH 4HQQH 4GG6E 4RMWA 3MO1B 1ACZA 3C6LC 4PIRF 4I2XE 4DOHE 5ID0B 35C8H 2DQFB 3M8OH 2QQKH 5ADOH 1GGBL 2PN5A 4KV5E 5IOPB 2ATKA 3ULUD 5IB3B 4F2MB 4YLQT 5IVNA 1P1ZB 3NCFB 1U8HB 5BS0B 5HD8C 1XF2A 3WD5L 2MHAB 4ETQB 4ZPTA 4NWTH 2R2CA 5E8DL 4Q6IA 3EO0A 4H20H 4IEFB 3OX8A 1OGAA 5HHXH 4FXKA 3TJHD 2QQLL 4L3CA 2PTUA 3U79A 3MRRA 1KCRH 3PGFH 3FOMA 3ESUF 4OI9A 3DTXB 5D7IB 3QDMD 4LARL 1V3JA 4Y4FA 2OS7A 4G8GE 4ODSH 5I1AA 4EJ1C 2J8UB 3V8OA 2HVKB 2X2YA 1AQKH 1WZLA 1FLTX 2Z31D 5HHVL 1V7NH 1WEJH 5CZXD 4PLNC 5HHPB 1LDPL 5K9QI 2P44B 3LMJL 4QHKJ 5E6YA 3IDYB 5JHDB 1FDLH 4YDIL 4TOYH 4DGIL 5IHUH 2YMXH 4G9FD 2GHWB 4HPOH 4JQVA 4PJHB 1K8DA 4YBQD 2WBJB 3TYGH 4Z8FH 3GMNB 4PGBA 5B4MD 1T7VA 2Q76B 1UC6A 3ZTJG 3SKMA 3W0WB 3T65A 1ZVSB 4NRXB 3IFPB 1UT9A 2B8OT 4X9BA 3WL9B 2CK2A 4MJ5A 1IC5H 1EXUB 4P2YA 4HSQA 1XT5A 1YPZE 2VISA 4RAUA 4NQEA 3UO1L 3NIDE 4QRPE 2ICWJ 1FGVL 4HJ0C 4XMPH 5F3BA 3GIVA 2GJ6B 3I3EA 5E08L 1A1NA 4NUGL 1A3LH 4G9DB 2HVJA 3KLAB 5D1XC 3OJVC 5BJTB 1PKQA 2WANA 1FZJB 1TQBB 4U1GB 4BSVA 3DSFL 3UTQB 4HCRL 2WIMA 4C56E 1FN4A 1IEHA 4NPYB 3VRJA 1IQWH 2FJGA 12E8H 2Z9TA 2YUWA 4OSUL 4HK0B 3ELAT 3T77B 4D94A 2XFXB 3ALWA 5JW3L 5EBMA 5CJQH 4NQVB 5KVEL 3FL7A 4K3DH 5TGBA 3OKLB 3CDFA 4Y2DB 4X4ZA 4HXAH 3WHE0 5DO2C 3E6HA 3PWLA 3VI3E 3QWOB 2P4AB 3PG2A 5EDXA 1LILA 3QISA 2XWJA 1A7RL 3M17A 2FX7L 2O61A 4KK8C 2B4CL 1U8KB 1S8DB 2CIKA 3UTPE 1AGEA 5FYJL 2Y9RT 3TT1L 1LEGA 4HG4J 3V79C 1D5XA 4R2GB 3L3HA 3ZDZF 4U1LA 4JFYA 1KIRB 3EOBB 1GHFH 4WHTA 1FSKB 1G7LB 4Y5VB 4JFDA 2OXHA 4LLUA 4P57A 2DQGL 4LAQL 3MRKA 1TVHB 2DI8A 4YGVB 1I1YB 3HNSH 3LHPH 4JDVB 2A1WL 3DV6B 1BWMA 1JGVH 2ICEB 5GS3A 4LEXL 5DR5H 5I71C 1KXTB 3TVMD 2CKNA 2FL5A 1NEZA 4Y1AE 5MERA 4BKLA 3G9AB 43C9B 2YD8A 5KS9F 3QUXA 2J88L 3EZJB 2XT1B 3VFGL 2ZCKL 3ARDA 4YHLL 1MY5A 3SDCB 4KMQA 4ZS7H 2DDQH 3VFTB 5C0IA 2JJVA 3P4MB 4CNIB 2GITB 2ICWI 3TT3L 3ILQC 2PXYA 3EW3B 2BHYA 3ARZA 4Y2DD 3DOSA 4LPXA 5E9DA 4HKJB 1N59B 2EKSB 4KQ4L 4JO4H 3NVQA 4RDQF 1EHXA 4LASL 5JMRA 3QUMB 1NGYB 2AEPH 2RAMA 3BDYL 3D0LA 1LVEA 4U0QB 2PUQT 3Q48A 3NPSB 4YHIA 3L3KA 1PVHA 4YAQA 2BY0A 5ACZB 4GMSL 4R2GD 3GSQB 2WZPD 4N68A 5HD8D 1AQDB 1KCUL 3G5VB 1TZHA 5HVFB 2PW2B 1JPFA 2AXFA 1FIGL 5E56A 4U2YA 3HMWL 2JB5H 5KVGL 4K9EC 4ODWB 1RQ5A 4LIQH 4F7PB 4JRYB 2DTSA 5I73C 4K7PX 2WUCH 5LXGH 4NM4L 4U6XB 4NC1E 2BCKB 4O00A 3LQAL 2Z35A 3TO2A 3G6DL 4I5BB 3ZTNH 1QYGH 4MD4A 3FB7A 1JGEA 4XCFL 4QRUA 2MPAL 3P9WB 1P2CA 4KPHL 3FHAA 1JCKA 3QDMA 3SDCD 3OG4B 4GKNA 3U0TA 1BX2B 3Q5OA 5IM7A 2GJZA 5I19L 5EOTA 2Z31A 1NFDF 25C8L 3VGHA 2FZ3B 1RUQH 5EG6C 2C5DC 3EZ8A 2MFNA 2F8XC 1YMMB 3HFMH 1BAFH 1W0WA 2VDRH 3VW3L 2F54E 5C0FB 3IRZA 4CMMA 3Q6GL 1I8KA 4M6OH 3OKYA 1TJGL 4CU6A 4G3YH 3MO1A 1JZ4A 5DHYB 3O45B 4FS0A 4ORGB 5J1TC 2AJUL 3EDKA 2VL4A 4KI5C 2X4NB 4HJ0D 4U7MA 1E4XH 2DQFA 1RK1B 2MQ0A 3UBXI 4PP1C 5D1QC 5IOPA 5D1XD 1C08B 1RUML 5CBEB 2BX5A 2E9IA 1U8HA 2MHAA 4KC3B 3V6OC 4ETQA 5CD3B 2VLLB 4G43B 2MSPA 2BFVH 1DBAH 1J10A 1G7HB 3BUYA 2ZWLT 3GBMH 5C0NC 4UT7L 5FYLH 1A1MB 3MLYL 3HB3C 1QSED 4ZFOL 4J2XA 5GRJH 4X8JA 3DTXA 4Z7NE 5D7IA 5DRWB 3TGXA 4R96B 3AREC 5EN2B 2E6PA 4P4KB 2HVKA 4L29B 1YEGL 1EPFA 1XF5B 2VLKE 1WFNA 3C9NB 5DEGB 3TBSB 1N3NB 5HHPA 1GC1H 3NACH 1BQHB 3VXME 2ADFL 4IRJB 2BP3A 1BFVL 3OZ9L 4M8VA 2IBGA 3T0EB 4QHMB 4PJHA 5DD3H 2GYSA 3MRJB 3ULVE 2HT2D 4X7TB 5H35B 1NFKA 2PETA 4F9PC 1CN4A 4PJDB 3OAUL 1ZVSA 5BRZE 3IFPA 3MACH 3WL9A 4XPFL 2CO6B 3WDJA 2P8PA 1EXUA 4U6TA 5J6GA 1HE7A 2IPTL 1P9MA 3D3VE 2FGZA 4MMXC 6CGTA 4JZNB 4I0PC 3DMMB 1D6EA 4LBEA 3LD8C 3BIKB 1N64L 4YXLH 1HH9B 2GJ6A 4AG4L 1A64A 1JJUA 1HWHB 2AABL 3WFDH 2FX8L 3KLAA 1N6UA 2XZCL 3P4OB 1FZJA 3TVMA 3UTQA 2VXVH 1ZGLM 3ILQD 4EN3C 4NPYA 4I18B 5DJYB 4HK0A 3T77A 4ZXBB 3V4VH 1SMOA 1WICA 1I9EA 1MJ8L 1QBMH 2IGFL 1TETL 3BESR 3HE6B 3MGOB 3T3PF 1UM5L 1WITA 3OKLA 1KSRA 4FZ8L 4LL9A 1PQZA 5T5FL 4IRJD 2F53B 4Y2DA 1O7VA 2GK2A 4HFWA 4OQTA 1HKLL 3QWOA 2EDYA 4GLRH 4KKAC 3EJZD 1GOGA 4MHHG 3L9RB 3VFPB 3BZDA 1ZS8B 1S8DA 4PG2C 2IADB 1WCQA 3I84A 3VD7A 3CFEB 2UVEA 1RJZB 4FQHB 2VLME 5DD5H 4JRWA 2B7DT 1UKSA 5IFHH 1EA9C 1ETZB 3EOTL 4FRWA 4PJCB 5E4EC 5HGHA 1J0KA 1KIRA 3EOBA 5BO1L 2UVFA 4Y5VA 4LSRH 3DMMD 2C4XA 4CVWA 3QULB 4HX1B 1NCDH 4HJGB 1TVHA 3NABH 4YGVA 1SBSH 1I1YA 4JDVA 3NPZB 3DV6A 3RVUC 2ICEA 1I8IB 2N4IA 3DLQR 1MHCB 2YEZB 1NL0H 2L0DA 3T08A 4NBYB 3RGHA 2ADGB 2XZAL 5LBSH 2WAHA 4TPRL 5EOCL 5JMOC 3TWCL 4AY0A 5ACMA 3V52L 4U1KA 3TNMB 3SDCA 5F9WB 1EH9A 4EDWH 1QRKA 4H25B 3C2SA 3VFTA 4ZFZB 3P4MA 4J3VA 4Y4KC 4CNIA 3GM8A 3S88L 3MODL 4NUJA 2XTJB 4OQTH 4Z5RA 2F53D 4G7VH 4N0FA 4H5SB 4HKJA 3CK0L 4JFFB 1N59A 1ED3B 4KJPC 3MA9L 2P48B 2AV1A 1QA9B 3DX7B 4KI5D 1NUFA 3ZDZE 5FGBA 4EI5B 3P0YL 1PX4A 1NGYA 4PP1D 3WO3B 1G7JA 3RTQB 4JHWL 2YWYA 3BRGC 1MREL 3GSQA 4P9HC 3SDAC 1IM3B 3VFWB 4UTAH 3SCMC 4GW4B 4F33B 4ZUTB 5K9JL 1A6PA 4R90H 5D6DC 2ERJC 4OFIA 1VDGA 4ODWA 3V95A 2FX9H 4O4YL 1INDH 1ZOXA 2VXSH 5D1XA 5E2UL 5A2LH 4PJ9B 1H3VA 4MX7B 5JLZB 4JRYA 5EZLA 5C0ND 5BCAA 1F4WH 1YEFL 2BCKA 4U6XA 1QRNE 5KS9E 5LQBH 3WS3B 3K8LA 5GRXG 3ARED 4NSKB 1P4IH 2E9BA 4GSDH 4I5BA 4NCC1 3WLWD 1QSEA 3CFIC 4JR9L 2FEEL 1BX2A 1MH5B 1OCWH 4MJIB 4HULB 1CZ8L 4DKEH 3X13B 2H26B 1A47A 4RMQA 2XTJD 5GSRB 5C70A 5GS0D 2FZ3A 3MBEC 3X3GH 3VDAA 4IRZL 1G6RB 5F6IC 4LVOC 3HG1E 4WU5B 4Y5YC 3ROOB 4F7EB 2E9WA 4V2CB 4AEFA 2X10A 2FLRT 1S9VB 5C0FA 4EI5D 3WMSA 2JELH 3DARA 4OUOA 2AJSL 5D70L 3OR7A 3RIAF 1ZHLB 2HAZA 4JM4L 5JXAH 1AR1C 5DHYA 1Z9LA 4OF7A 3SKNB 5F1OB 3V6FB 3H9ZA 1BLNB 2CDGA 1WTGT 2O5ZH 1DQML 1P7QB 4GRWB 1L7IH 3MCLH 4XNYL 2I9TA 3GBNH 5JIIA 1FGNH 4ODTH 5CBEA 1AFVL 4NO0B 4Q58C 1BVLB 3HR5B 1X5FA 2NY3B 2R4SH 1HILB 2ARJB 4CU8A 2VLLA 2XQYK 1DR9A 4EN3D 1CD0A 5CWSB 5L8JB 3PE9A 3P30H 4N0YL 1VPOL 1UA6H 2ILLA 5MI0B 4XZUB 5GISH 1SHMA 1NFDE 5FFLA 4ODXA 1HIMH 5EN2A 3EYOB 3H3PL 4P4KA 4MJID 4L29A 2IG2L 1RUAH 1XF5A 1QFWI 3C9NA 4L5FH 5DEGA 3TBSA 2HT4D 3O6FB 3QI9B 2HJKB 4XVSL 1N3NA 2RJMA 3DPBA 2D7NA 1OARL 1RFDH 4YQXL 5C0BB 3V5HB 3UTTD 4MLIA 5LCVL 4IRJA 4LVHB 4NBZB 4PJBA 5CINL 1S7TA 3ZKXB 4QHMA 5JTWA 5J9PA 2R4RL 3MRJA 4DQOH 4FXLA 3C2AL 1DJSA 1WCBB 3IU3B 5H35A 5DD0H 4V1DB 2FJHB 4CL7A 1J0IA 5C2UB 1A4KB 1MCEA 5K9KA 1YNLL 1G1YA 5DF0A 1F4AA 1QFUL 2Z8WC 1JTTA 1IAII 3AC0A 1P7QD 1BD2E 1ZVYA 4HS3B 3JZ7A 5AG8A 4P5TC 3J7HA 3DMMA 4FQQA 2Y25A 2VITB 2X1XR 3EDEA 3S34L 2NY3D 1J0ZA 2MKLC 3BIKA 4XP6L 4JFHE 1EBAA 2QTEA 4HUKB 3R0NA 3TO4C 3QG7H 4P59H 3U4EA 3UP1A 5B8CB 5GRZA 4LVNC 5DRZB 3P4OA 4G5ZH 3LB6C 2C3WA 2UZXB 2XZZA 1T80A 4HXBH 3MOBH 4JKPL 1E4KA 2HFFB 1W72B 2NW3B 3ZO0A 4HG4K 3FFCB 4I18A 4JPWH 4BSJA 1MHEB 2ITDB 4HUNB 2I60L 1FORL 3P40A 1IGCL 4ZXBA 1G0DA 3QI9D 4KJPD 4H1LB 5L2KE 4GXVH 2VO5A 3MGOA 3HE6A 4XVUD 5C0BD 5D8JH 4BK4A 5F89A 1BFSA 2YK1H 4P48A 3O6MH 2M2DA 2F53A 2OJEB 4RWYL 1IQDB 1I8LC 3AS2A 4QRRE 4KQ3L 1NPUA 3NA9L 3F58L 3JWDC 3SCMD 3L9RA 3VFPA 2NY7L 4PJEB 5HY9B 3EBAA 2QHRH 3ZKNC 4WCYH 3TYFB 4YC2C 1QNZH 4FQHA 1T7YA 3MREB 3RA7L 5IB1B 1ETZA 4PJCA 1L7TL 1T4KB 3OAYH 2BSTB 2V9RA 1RHHA 4PG9B 3S35X 4LSQH 3H9HB 1RVFH 2ZCLH 4HX1A 3OAZH 5LVEA 1C8PA 2IH3A 4UQ2B 2H3NB 1MHCA 3OJDA 3AREA 2ADGA 3N1QC 2JJTA 1IGTB 1RAMA 1SJEA 1BQLH 3QUZC 3T3PE 1BBJB 3L5XH 3TNMA 5C0CE 4R0LB 1I85A 1DQTA 4H25A 4Q0XL 4ZFZA 3WDHA 5JPMB 4UUJB 5CEXA 5MENB 5HVGB 2BHZA 4Y16C 4IOIA 4MJ6B 1OAKH 3MZGB 1ZSDB 2GK0B 4H26B 1D5IH 2QSQA 1L0YA 4H5SA 3I85A 5D4QA 1S3KH 3QDGB 4JHAH 3D25B 1RULH 1AR1D 1ED3A 5AG9A 3V4PH 3QCTH 4RNRB 1MCKA 3DX7A 3MLUH 1GGUA 2VNCA 1JWUB 4EI5A 3MA7B 5C07D 4JVUA 1J88A 5ISZB 1Z3GL 3U30B 4KGLA 1IM3A 1BMGA 1IJ9A 4YUEL 4GW4A 5F96L 4QOKB 3OB0H 1NCCL 3GJFB 1AO7B 5TQ2L 4X7SL 1GAFH 4LLVB 4OJFL 4HZAA 3OTTA 3SGKA 4MX7A 5JLZA 5ITBL 5LAXB 1PZUB 3WIHL 4EN3A 3WS3A 2EECA 4NNXB 2XN9D 3OXSA 4N1HB 3N50A 1MOEA 4OUUB 1UFUA 4I3RL 3O2VH 4DFIA 4LCWB 5LJYH 5AYUH 1YJDH 2PR4H 2DB8A 3V6BR 1Q9KB 2VXTL 4BSWB 4NZUL 5GS0H 1MH5A 4MJIA 5DK0B 5I6XC 1KT2B 5MEND 2H26A 2DQEH 4D2NA 1QQDB 2YR3A 4LSUH 1DDHA 3LDBB 3HZYB 5BMFH 3WO4B 4JKLA 4PTUB 1G6RA 4D0BA 4OBRA 3UTTA 3C09C 3ROOA 4F7EA 4M5YH 1T20B 2XYCA 1ZLSL 3GI8H 4OIIH 1S9VA 1IEBA 4RA0C 2D9CA 1ZHLA 4HH9B 3KYKL 5ISZD 4GAGL 4DVBB 2APBA 4M7ZB 3NGBB 3SDXA 4TTGA 4P5TD 1U3YA 3SE8H 4XC1H 1TVDA 2ADIB 1BLNA 1AHWB 1K9TA 3OBAA 1AO7D 1P7QA 3WUWB 1ADQL 2W1NA 1A6UH 2E8YA 4KHXH 3D1MC 2GTZA 3IRPX 3DSNA 1BIIB 4NO0A 1BVLA 3VXPA 3DVIA 1HILA 2ARJA 4UB0H 3INUH 5KTEL 3UTSE 4N90D 4MQTB 4OV5B 2YD4A 3MR9B 1AC6A 3BKJH 5KANI 5CWSA 2IQ9H 3V7AG 1KB5A 4WFFE 2CDFA 1S7QB 2QKIB 5IW3A 1U95A 3F6LA 1F2XK 1T04B 4NN6B 3RWJB 1WV7T 4LCWD 4XZUA 5DTFB 1RU9H 2VDNH 2DQCL 3MLZL 5EIQA 3EYOA 3H7LA 4DAGL 5DC4B 4KROB 1Q0YL 5DRNB 4R3SB 1HHGB 1PAMA 2NMSA 4ALAH 5L0QC 1G6RH 3QI9A 2HJKA 4XPTH 4GKSB 5GGVY 5C0BA 4HBCL 5GJTH 5FHAL 2XQYG 3KHQA 3ZKND 4QF1A 4JAMB 1FH5L 1ZTXL 3GEWB 5CLWA 1YEEL 1UKTA 1EVUA 1IGIL 5EBLB 4X7EC 5CP7B 1WCBA 4L9LB 3IXTB 5CZVH 1AGFB 4OTXL 2BDNH 2FJHA 4O9HL 4V1DA 5IB2A 3SKJH 2K3TA 3T2NH 3QDJE 1I7TA 4GRWH 2P45B 4F37F 5DZNA 1CK0L 4TSAH 5SX5H 1M05B 1A3RL 1PY9A 4EIGB 4M7JH 3SE4C 2JJUA 4HS3A 5CHNA 2DAVA 3ZKMD 5TQ0L 5JZ7C 4M8QB 2EEAA 4LSTL 1VB9A 2VITA 3TCLB 3VA6A 2Y06H 1KB5H 1OSZB 3BPOB 1J1OL 1G7QB 4OCSH 5B8CA 3PDGA 5DRZA 2AJXL 1MLCB 1MQKL 2HG5B 1W72A 3G6JA 5ILTH 4NC1C 4Y16D 5IG7A 2D7QA 2ITDA 3RNKB 4FMKA 4WO4D 3ZYOA 3Q6FB 4R7NB 5FYKL 1JNLH 4G6MH 4YK4C 2IMNA 4H1LA 3BMVA 4K94H 1CD9B 1A7OL 2HTKC 1CFVH 5DJ2B 5E2JA 2HKHH 5FB8B 5I66B 4GG8B 2OJEA 2VLRD 5CJXA 3TBTB 3KPLB 2YRZA 3PWPD 4G8EA 5F8QC 3QO1B 2I5YH 4KMTH 3OXRB 4AEIL 3EHBC 2YPLB 5GHWH 4PJEA 3HZVB 5C0AB 4WHDA 4TQEL 4PJGB 4HUUA 5C07A 5I17B 3RWHB 2R8SH 1CDGA 3HZMB 3MREA 1UWGL 2CUMA 5HHMD 5IB1A 1MCLA 5ESQB 1M1SA 3W9DB 5A3IC 3I6GB 5J4MA 1WBZB 1DL7L 2DMCA 5K33A 2BSTA 1JMZA 1QZ1A 2IJ0C 2EKJA 1Q72L 3H9HA 4PJAB 1Y18A 3KPNB 4JO3H 2AXJA 5J7CC 5DD6B 4UDTB 4UQ2A 1X5KA 2H3NA 1TMCB 2VQUA 1A02N 1W72H 4S2SB 4PY7A 3VXUD 4JRXB 3NCCB 5E6ZA 4M48L 5EUOF 1X6NA 4ZTOH 2HRLA 2H45A 4HS6B 5GGTL 3G5ZA 4H1LH 1BBJA 1AI1H 5D7KD 3UBXG 4R0LA 1WZ1H 2KL6A 4UUJA 1OVZA 4R7DA 3C8HA 3BRFA 5MENA 3NAAH 5DJ8A 4XXDB 4MJ6A 4X7FC 3D85B 3IFNH 3CUPA 2NY1B 3FO0H 4S1DD 3D25A 2YBRA 3CGTA 1VGEL 4GRLB 4RNRA 5DC9B 2F58H 4OD3L 4AYFA 5FM5O 5C0AD 5EOQL 1JWUA 3VJ6B 3SY0B 3VFVB 1FLRL 1UEMA 5ISZA 3PHQB 1XGPB 4OGYH 4CN4A 4JZJC 3NA4A 4Y4HB 2HN7B 3DRQB 4QOKA 1CL7H 2FECI 4DKFH 3GJFA 1AO7A 3HI5L 4X9GA 5E2WL 3TM6A 5FECA 1AP2B 1EO5A 2VMFA 4XP1L 2DN7A 4ZOBA 4OQ1A 1NBVH 5GGVH 5LAXA 1QACA 4JKKA 5DUPL 4P3CL 2P46B 3DXAB 2QSCH 4NNXA 1KLGA 1IGJA 5DDHB 5DQJB 3RI5K 3VWKC 4MWFA 4OUUA 1CGWA 4LLYB 4YO0B 4ENED 3IGAB 4U0RB 1KCSL 4LCWA 2J4WL 1Q9KA 4BSWA 2NY0C 4PGDB 2FIRT 3BEWB 1KT2A 3OAYK 1BVKA 3MNWB 1XR8B 5F7EH 1QQDA 1B2WH 4LHUD 4PRAB 4OFPA 2OZ4L 3O9WB 4OLXH 5DQDH 3HZYA 4N8CH 5A40E 3GSXA 4PTUA 3OAZK 1T5WB 3CFDA 4QXGL 3S36L 4GRLD 4XP5H 1T20A 3HE7B 3UDWC 4XAKE 4LRNL 4HLJA 5DFVC 1B0RB 2A83B 1MCFA 4HH9A 3DHJA 4JO1L 2V17H 3E8UH 4CDHA 3GJFH 4OGZA 2E27L 1GGCH 2ADIA 4W4OC 4Y4HD 1PYWB 5H37H 1Z9SA 1X6LA 1OM3L 4QHLB 3WUWA 2LTQC 4ODHH 2JKXA 1BIIA 1G6VK 1OAXH 1YYML 2B4CC 5J1AB 3RNQB 4UOW1 1OT1A 4OV5A 1YA5A 3V8CA 3DXAD 3C5ZC 4NN7C 3AS0A 3CXHK 3BJ91 4IIQC 3MRFA 1S7QA 2AKRA 4K2UH 2QKIA 4DW2L 4NKIL 5CCKH 3RQ3A 3RWJA 2VZOA 2CDEB 5DTFA 2HTKD 4M4RA 1QR1B 3KXFD 3PNWB 4WO4A 3W2DH 5DRNA 3OB0K 4R3SA 3B5HA 3HPLB 4WHCA 4LPVA 3LKRA 4BFIB 3HUJB 4GKSA 2FEDC 4ZOEA 3O9WD 5DWUL 2DQTH 4R26H 5GS2D 1CLCA 4P23B 4HKBB 2VLRA 5C08E 3HE7D 1OPGH 1JRHI 4JDTH 3PWPA 3VD9A 4R4FL 4QXUH 1JGLH 3QH3B 1EK3A 3OSKA 3IXTA 4M4PA 1AGFA 4YJZL 1T2QL 5DUBB 1U58B 3TV3H 3JVGA 4JQIL 2EC8A 4ZD3L 2MOVA 5FKAB 3C5SB 1X5AA 1M05A 1FVEB 4RISH 5TE4L 1F13A 5F1SA 1QLFA 4PJIF 1G7IB 1HDMB 1UACL 4HGWB 4M8QA 3TCLA 4Z76B 3TZVB 4YWGL 1INEL 3DETD 4OT1L 2F5BH 4PJ7F 1N4XH 5I18H 5GZND 3MLSH 1TPXC 1F90H 2GEEA 3VXUA 2HG5A 4X4YB 3B2VH 4X5WB 4Q6YA 4XI5C 3TN0C 3PHOB 2BSED 4P5MA 3MCG1 2DLEA 3Q6FA 4OGXH 5T1DH 3GSNA 2B1HL 1BOGA 1AH1A 2Z0BA 3EFFB 4G6KH 3LQAC 2J6EA 3NCYP 5DJ2A 4DTGH 5FYKE 1MFBL 5T1MB 1BJ8A 3NIFE 5I66A 4P23D 4GG8A 5HXMA 5KSBB 3TBTA 5LGJB 4MNQD 4YHMH 3OXRA 2HJFB 5DJZB 5FUOL 5C0AA 4PJXF 4NJ9L 5KVFH 4C4KT 1B9ZA 5C0DB 4PUBL 5GS1C 5BV7B 5I17A 1H3PH 3RWHA 5GGQL 3HNVH 3ZE0F 3HZMA 2W07A 3W9DA 2W9LA 3I6GA 1WBZA 2E7MA 3LKSB 3K4AA 4UT9H 3DYOA 1G9MH 4XTRC 3T2PA 1YUHB 1NAKL 4HQQL 4PJAA 3KPNA 2FGWH 3DIFB 1UJ3B 1G9NH 5DJXB 3TZVD 1FZOB 3BGAA 3LN9A 5CGTA 35C8L 2C26A 3M8OL 2QQKL 3NCEB 5ADOL 4JFOB 2A6DB 2FECL 4NJAH 2W91A 3GSNH 2JB6A 4HS6A 1J05B 4PGZA 3WDIA 4NOBA 4RGMC 2BNQB 3B2UD 4NWTL 3H9SD 3NFNB 2J6EH 4J3TA 1KN4L 5IESH 4H20L 5SX5K 1WF5A 5HHXL 1UH3A 4R97C 2LAAA 4EQ2A 4XXDA 5F6HJ 4Y19B 1KCRL 2NY2D 4LHUA 3PGFL 4E0RA 4QHUB 1OOAA 3D85A 4DN3H 3G04A 5D96C 4ODSL 2DM3A 3HRZB 4GRLA 1AQKL 5JORA 3D6GA 1MJUH 2R39A 1T6WA 1MCIA 1V7NL 1WEJL 3RL1B 3VFVA 4ESKA 3EIFA 1FL3B 4DEPB 1TJHH 1XGPA 1FDLL 4TOYL 4M93C 5FOBB 5IHUL 4Y4HA 2YMXL 1J1PL 3DRQA 4HPOL 5ANME 3IDXH 4PRPB 5FYJD 2F15A 3TYGL 4Z8FL 3N1GC 3WUZA 3C5ZD 4ONGH 4I9WD 4TSBH 4WWKC 1AP2A 4HAFA 4MGXA 3L1OH 1TFHA 4S10A 4LPUA 5EUOE 3R8QA 1LE5B 4C57C 3EFDH 3BWUC 4E41B 1ZE3C 1IC5L 3IFOB 5HVHC 2OJZH 1RUPH 4PP2A 3DXAA 5CAYB 5DQJA 4U6HB 4LLYA 4YO0A 4KK9D 3KHOA 1UEYA 1MPAH 3V5DB 3UJIH 4AJ0A 2XKNB 1PG7W 1EEZB 4FP8H 4M6MH 4XMPL 3RWDB 1DQDH 2W65B 1UYWH 3KXFA 1BQHG 4PGDA 1JMXA 1A3LL 3BEWA 3MNWA 5I9QB 4M1CC 1XR8A 3UJJH 2IBZX 4NHCL 1F6AB 3QPQC 4PRAA 3O9WA 2GSIB 4L1HA 2ZZUT 1CFSB 4B0MM 1IQWL 4Z7VB 1YECH 12E8L 2HLFC 3HE7A 4W4NA 1YN7B 1LD9B 5L8LB 3QIUC 1B0RA 2A83A 5CJQL 2RBLA 4BJLA 4HKZA 4MB4A 4K3DL 4PLJC 4HXAL 1PYWA 1ACYH 2CXGA 4PRPD 1C7TA 3S35H 2JCCB 4QHLA 3V0VB 3GKWL 1KIPA 5B3JF 3T09A 1UCBH 5HHOB 3T1FA 5T3XL 4PRIE 1RZ7H 2I26N 3RNQA 4L1DA 3SQOL 2VLJB 4E41D 4WFEE 2UWEF 3TN0D 1N5YH 4KDTA 3T2OA 1F6FB 4WI9A 1GHFL 5C0RH 1U92B 3E2HC 1H8NA 4F15B 4I48B 2CDEA 5MHSD 1QR1A 3CDGA 2EE9A 3HNSL 1K4DA 1OAZH 3LHPL 3PNWA 1JGVL 5DR5L 1NMCB 4V2BA 5JA9A 4BFIA 1U0QA 3AAZA 3HUJA 5GS2H 1R24B 3VWJB 4N0RA 1HQ4A 1TLKA 4FA8A 4PJ8C 4P23A 4HKBA 1RI8A 4G8FB 4ZS7L 2DDQL 4MCZB 4UIKH 3SGDH 1IFHH 4DKDC 4KZDL 4XTRD 1CQKA 5DUBA 1U58A 3MV7D 2CO7B 4DGYH 1TXKA 4P2QB 1FVEA 1X5ZA 4JO4L 2DQUH 5DVMA 5HHOD 1G7IA 1FYHB 5DD1H 4HGWA 2AEPL 5EPMB 4Z76A 1HQRA 5FDYA 4GBXB 3FAWA 3TZVA 2E3VA 5EULV 4H8WH 1F97A 1MCJA 2BVOB 3BO8A 3MV8E 2JB5L 3O3AB 3MLPA 1JHLH 4X4YA 3QO0B 5SWZB 4X5WA 2V6HA 2BZDA 2NY5C 3PHOA 4LIQL 3GJFK 2N7BA 4JY5H 2WUCL 5LXGL 2HFGH 4DVRH 1C7SA 5D6CB 3RVVC 3EFFA 4NQSA 3ULUF 5TDPB 2VL5A 3EDFA 3ZTNL 1QYGL 4ZQKA 5T1MA 3UAJD 3LS4H 3VXSB 2CGRH 1E4WH 5DXWA 3MMEB 3QHZH 3B4NA 4NKQB 4U1MA 3GI9H 2MWCA 2HJFA 5DJZA 3IJYB 3ZE2F 1VFBB 5C9KA 3U9UA 1RUQL 5C0DA 4WWKD 3O4LE 2MCG