4ICXA

N-terminal c2 domain of human cep120
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
133
structure length
133
Chain Sequence
SKSDQLLIVVSILEGRHFPKRPKHMLVVEAKFDGEQLATDPVDHTDQPEFATELAWEIDRKALHQHRLQRTPIKLQCFALDPVTSAKETIGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKSEIQISIALETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-terminal C2 domain tandem of human CEP120 shows lipid binding properties
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Centrosomal protein of 120 kDa
total genus 24
structure length 133
sequence length 133
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4icxA00
3M7FB 3ENEA 2WXGA 2K45A 4BGDA 2K4AA 1TJMA 1UOWA 4WWOA 1WFJA 2RD0A 2CJTA 3R7RA 3RPBA 4WEEA 4URKA 4ICWA 4FJYA 3QAQA 4XX5A 3QR1A 5JHAA 3PREA 1QASA 2WXFA 3HHMA 1CJYA 4MJJA 4NP9A 3APDA 3L08A 2WXIA 2WXMA 3FBKA 2YOAA 3L54A 2ISDA 4Y1SA 5JHBA 1E7VA 2K8MA 2KI6A 1E8ZA 2CHXA 4GNKB 2BWQA 4QJ4B 3RDJA 5G2NA 3L4CA 3ML8A 4FHJA 2NCEA 2WXNA 4NS0A 4WWNA 4Y1TA 3S2AA 4F93B 5H4ZA 2WXQA 2WXOA 1UOVA 4A55A 4BFRA 4ANWA 4ICXA 1DJXA 4KITB 4NPKA 1E90A 1E7UA 1DJIA 2ENJA 3MJWA 3HIZA 1RLWA 3FDWA 1W15A 3QR0A 1E8XA 3OHMB 2A4ZA 3QJZA 1YRKA 2Q3XA 4L23A 4QJ3B 4LT7A 5EDSA 3L9BA 2CM6A 4XE0A 1DSYA 3TWYA 4J6IA 2WXJA 3NSJA 4JPSA 3P2BA 1DJYA 4ANVA 3PRZA 3PYCA 1DJGA 1UGKA 2Z0UA 1DJHA 1BYNA 3F00A 4NPJA 4IQHA 2LHAA 3DBSA 2A5UA 1HE8A 1GMIA 4KZ0A 4QAMB 4F92B 3PFQA 4F91B 1DJWA 3APFA 4L1LA 2WXRA 4DK5A 4PS7A 4HVBA 3QARA 2Y3AA 4L1BA 4F1SA 3APCA 3LJ3A 2WXPA 3F05A 1E8YA 2D8KA 1WFMA 1E8WA 3T8MA 4ANXA 2ZKMX 3ZIMA 2CHDA 1RSYA 4TV3A 3TJPA 3ZVVA 3B7YA 5G55A 1A25A 1BCIA 3R7QA 2FK9A 1TJXA 4AOFA 4AJWA 3SD5A 4OVUA 4EZKA 3NZSA 2EP6A 2DMHA 3QK0A 2QZ5A 2K3HA 3JZYA 2NQ3A 5CCHE 2DMGA 2X38A 4G11A 3W57A 1W16A 3ZW3A 3DPDA 3NZUA 5T8IA 4EZJA 4LCVA 3ML9A 4LDCA 1V27A 3L13A 5CCGE 5KJ7E 1QATA 3L16A 4V11A 4EZLA 3HN8A 4ANUA 2B3RA 2WXLA 3IM1A 4FULA 2Q0ZX 4IHBA 4FJZA 4TUUA 2WXKA 2CHZA 5H4YA 2CM5A 2YRBA 3IBEA 3PS6A 4TS6A 4DNLA 5CCJA 3GPEA 1BDYA 2NSQA 2ENQA 4PS8A 4OVVA 4QJ5B 1DQVA 4FHKA 3CSFA 3W56A 2QZQA 1DJZA 4XZ4A 2CJSA 3CSTA 2ENPA 4PS3A 1RH8A 2UZPA 4KZCA 3KWUA 2R83A 4GB9A 3KWTA 4FADA 3TL5A 4WWPA 3N5AA 3F01A 4L2YA 3OAWA 4FA6A 4HLEA 2N1TE 3L17A 2FJUB 4FLHA 1K5WA 4WAFA 2JQZA 2CHWA 2WXHA 3F04A 2V4LA
chains in the Genus database with same CATH superfamily
1AKJD 4JFEA 5MENB 2K45A 4WNJA 5CILH 1KN2H 4D9RD 4LP8A 5B8CB 3FL7A 4JKWA 5E2TL 4ZW8A 1ZVNA 4RSYA 1AKJB 2FT8A 3CDFA 3DETC 2W59A 2J2ZB 4JFZH 4KC3B 1ZSDA 4U6TA 3ZTJG 1JVLA 3VMOA 4EDXA 5J06A 1T1XB 1WFTA 2IXQA 2ZX5A 3QDGE 2H2PC 4QHMB 1IGCH 1X4YA 5GGSY 5B22A 4A2LA 4BCXA 4FKEA 4DZBB 2N7SA 3U6XS 2HJKA 1JD9A 1F6FB 3FQ4A 5DHYB 2W92A 5I15H 1LP9B 5I6LA 4RWYL 3ATAA 3HG1E 2ZPKL 4QRSB 3ARGD 4PG2A 3C09B 3TVMD 1ZXQA 1FCCA 4WFHE 3L3HA 4G9FB 3DVIA 5JIKA 1OGSA 3JV0A 4D8PA 2QQNH 1DBAL 3AG1B 5AFAA 4UB0H 3A21A 4AV0A 4WTXA 5BO0D 3KZ8A 3LSOA 3DUUB 3FQXA 1YAIA 1T1YA 5EU7C 5MEPA 3REWA 1OAKL 3A5VA 3DGDA 2EIMB 5E2UH 3PIQA 3BW9A 2DZEA 3R1GL 4LEEA 3QARA 1M7UA 4PJDF 4BH7A 3E9UA 4LARL 5F7DA 4N24A 2XN9E 4OD2B 1VLXA 2NY0D 2BOBA 4QRTA 3CLEH 1CIDA 3CZGA 5C0DB 2B7DT 1GVIA 3FS9A 4QOKD 3C87A 4R2GB 2Q7YB 2Q76A 4EZKA 2R39A 3F5WB 3LRGA 5LGHH 1UT1A 1NANI 3FRUA 2E27L 4APQD 3SJVE 3TPUB 3ZO9A 4AMKL 2FUQA 2X53A 4ZW3A 3HN8A 3QIUC 5AW9B 3PAYA 5SWZD 2KKQA 3GSRA 2DAVA 4HUKB 3B2VH 3EYOA 4UTBA 3HG2A 1HYRC 2CXKA 2KZWA 4XAKE 3SYQA 3DO7B 2FB4L 3O0RL 4HJEA 1VFBA 1JHLL 1GYUA 3M45A 5L2KB 1HQ4B 3D52A 2BVUA 2UWEB 2W0FB 3C5SA 4K0OA 2VDLH 2KYIA 3QWQB 2P5WE 5DRXB 4FI6A 3VE0B 1IIKA 1ZHLA 3TYGH 8FABA 3N06B 4CBZA 4DGUA 4JMNA 2DMKA 3UG4A 2YA1A 3KXFB 4FQHA 3MOQA 5E8EA 4WI8A 3WDIA 2LGNA 4QXGL 1MHPH 4TSBL 4KROB 3V6OC 1RUKH 3AT0A 2IVFC 4Y2LA 1MIEL 2XDHA 4Y5YA 1A7BA 5DO8A 3CD4A 4LIQH 1NMCC 2AV1B 3HUJE 3KXFE 4JRLA 3MREB 2J57A 1JWUB 4G5AA 4G6AC 3HCVA 2R1YB 1KLFA 1C12B 3TFBA 4MJ2A 2BNQD 4P5TC 3ZE2E 3QUXC 4P9HC 5L88H 3DOSA 3HLAA 4PBDA 1TQBB 4GRLA 1MFDL 5GGRY 4PJ7F 1A4CA 5IWLC 3RG1C 3D0AA 5IUSA 1TKWA 1UWGL 2BSTA 3CN3A 2D7TL 3V2AR 4U0QB 3EADA 4UT7L 5DK0A 2GK0B 4HZLB 4XCYB 3N91A 3PWUB 2C8NA 1UWXH 3L3JA 5TK4A 2Y36H 5KYWB 3LXAA 2HFFB 3KYOA 3QNZA 3TM6A 3COOA 4OCLC 4FZ8L 2WWKO 4KY1L 4ZO6A 3GGWB 3WNJA 5A2BA 3D2UB 5D2LF 4LDLB 4NM8H 5LXVA 4GQQA 4PW9A 1MJ8H 3CZSA 4M3JA 3QBTB 4XOCA 4LU5L 3WJMA 1AZUA 1GY1A 1WUNT 2X9YA 1DQLH 4URTB 4N2NA 5EIQA 5JIPA 1H8LA 3GHEL 2YRLA 5C3LD 3K2IA 4G7SB 2E4TA 1LO2H 4KI1A 2L8AA 2OMYA 4X7EC 3MBXL 5FO7A 1SDAB 3SDCA 3WD5H 2XWXA 1RSYA 1RCYA 4P46B 3KWXA 5TQ0L 4U1LB 3SBWA 1PCXA 5AD0B 1BMGA 3D69A 4OM0L 3RVXD 3G5ZA 3DX7A 5AW0B 4HIHB 1XV8A 4POZC 4B97A 4HDIB 5C8JB 3MMEA 2MCPL 1RZIA 5HVHB 3D25A 4GKSA 4Y8DC 1YYCA 1F4WL 2OZ4A 4YFLI 5BV7H 3LRHA 5I8KH 4N0YL 2X4NA 2VDKB 4WI3A 5EFIB 3PWJA 1PD0A 1BZ8A 4CJ1A 3FO0L 5DJYB 2GTWB 3BZ5A 2C4FU 4ZAKC 3RZCB 1WLHA 4PJAA 1QYGL 3RIFF 2ZQKA 3TFKD 4PJGF 4TQHA 2J8UF 3QIBD 2JF1A 4CUCA 5C8JA 1Y1UA 1JZ4A 4IBYA 2FNWA 2CA3A 1UEYA 1EK3A 3TS8A 1WBXA 2NY2C 1CMOA 3BGMB 2R69H 5E2JA 1E4KC 3TN0A 1AFVL 5CN3A 5BUAA 5TPWH 5ESQB 1KJ3H 2C1OB 3SO3B 1H6UA 4AIZA 5DJYA 1T2QL 1WFIA 4X42A 3W38A 2WJ5A 1H15B 1B0GA 2CGRH 1NPUA 4ZS6C 4APQB 3RPIA 3IAQA 1L7IL 4UM8B 4D0DA 4QHUB 1Y0LB 4PB9L 1OP5K 4BCZA 1Q9OB 1SDDB 1YQVH 4LOFA 1GTNA 5EUOA 1LDPL 3AREA 1JXKA 1ZLUH 3HAEB 3RQ3A 4K7PH 1JSYA 2G75B 1QNZH 4KHXH 4NZJA 4PYHA 2WANA 4LLWB 1IQDA 4HJIA 3U79A 4P2AA 4Z6AT 1TR7A 5MI0C 2EYRA 3I75B 2AF2A 3WMSA 1DUZB 2WLMA 2J4WL 3QFJD 2Y7OA 1HESA 4NN5B 3FUJA 3RIAF 1OB1B 2QKIB 2VSDA 1U42A 2A3TA 2B1OA 2C4FT 3ULSA 4CVZA 3T65B 3L9RB 3HVNA 4U6XA 3WSQH 4JDTL 2HZHA 2LHAA 1DQTA 2PYEA 4NQXB 2AJUH 2VM9A 3G5VA 1ZD6A 5IWLA 4QRPD 4GAYB 5E6YA 1NIFA 1DQKA 1XCWA 4D9QD 1YEKH 4YXHL 4FC3E 3Q6FB 4FLRA 3MCKA 2ICEB 4P46D 2XA3A 1OD7A 3II1A 5IHUH 3MX0A 4NHCH 1AYOA 3T65A 1AQMA 3GTNA 1RK7A 1XAKA 4P57B 5KYYB 3DX0A 2CLRA 4DKEH 2CO7B 2IADB 2OMVA 1CXEA 5IB5A 4KQ4H 2WNWA 3T04D 1U4EA 3LN5B 2YZ1A 1QRNB 2GHWB 4C83A 1ZHKA 4GAGH 3QHFH 1R3IH 2VT0A 3LNFA 2FO8A 1JTOA 4GBXA 1USZA 2GIYA 3FCTA 2RAMA 2QL1A 5MP6H 3VYOA 1A3RL 2B14A 1QO3B 5T5NF 1N8OE 1Z9PA 4F2MB 5LBGA 4KJPC 3RZCD 1P4BH 1J8RA 4AJYV 4HHAB 1QR1A 1A6WH 4CMHC 4X6EA 4PGDB 1I7RB 5IVZB 4YWGH 3C5SB 2F7QA 3TXAA 1HTYA 1CR9H 1HOEA 1XH1A 3QWRD 1HCFX 5JR1H 3EGXA 1J0ZA 1CR9L 2G0LA 4NQUA 4Y0GA 1W9XA 2P3YA 4GOSA 3CLFL 1VRSA 4LRIA 1TQUA 4JFXB 2RH0A 4ICWA 1QUPA 3I9GL 3VG9B 4ZXBC 3G6AB 5A2KH 1MREL 4PLNC 2ZUTA 1P4BL 4X7TB 4M48L 1B2WL 2DQGH 3PLYA 1J1PH 2YLHA 3SDDD 1MZZA 3ZDXB 1S9YA 3T6QC 5MP6L 4Q97A 2NNRA 2XTJD 4TLKA 4IJ3C 2P5WB 1I1AA 3HZ3A 3NCCB 5T1KA 4AKQA 1KTBA 4KO7A 3FULA 3QHFL 3ARPA 4X9GA 5ISZB 4XMZA 1H9DA 5DFVC 4FXKA 5FUCE 2BNQE 1FZMA 3PL6D 1QHOA 1TO4A 4LAQL 4OU3A 4MZIA 3MRNB 4N2AA 5G4MA 4PJCA 4WKXA 5C0GA 2OCCB 4FGMA 4IIQB 3O8XB 1I8AA 2P48B 2VWEE 2NNAB 2VL5A 4FFYH 5FA3A 4Q2ZB 1AHMA 2X41A 3F7YB 4YDIH 3HEIB 3K6IA 1U4FA 1XGYH 3LZFH 4NHCL 3AM8C 1EJFA 5F9AC 1RK0A 1HZHL 1NBCA 1OE1A 3ARXA 2ZONA 3SHSA 4AQ1A 1IT9L 1FNAA 3BZFA 1E4WL 2WZPA 5AAPA 2ENYA 1I7UA 2OYKA 2VTFA 3O4LA 3W9DB 5F70A 3GD1C 2K7PA 2YXFA 3JVGC 2HRPL 1Z9OA 1FVEA 4MMYB 5DRWA 2O5XL 1WZKA 1ZEAL 4BK5C 2OMYB 1T89C 3N2JA 4JDEA 3AQDA 1NC4D 3TLRA 1MCQA 2DQJH 4N2LA 1A6TA 3MLTB 4BFKA 1EMTH 4ODXA 1A64A 5DJZB 3GTVA 4LLDB 1E5YA 5GGUA 1OSPL 4G7VH 1FG2A 4UI2A 4KVCH 1JK9B 2R2EB 3APNA 3FN3A 2VJ0A 3C08L 3OQRA 4NQEB 5FWRA 3RHWF 1CBVL 3NZUA 1KPUA 4H4NA 1BVZA 5C0NC 4V11A 2TAAA 1L6ZA 2IAMB 5GSRB 4HEMA 3FQTA 4OIAA 3ZHFA 5KVFH 3RDTD 1AQDB 2F1AA 1AS6A 3RAJH 1L7IH 1LJMA 4I0PA 4DVRH 1BJ1J 1IAOA 4PJEE 1CFTA 5TDPB 3LDBB 2IAMD 2R59A 4ZXBB 1DBBL 3AXIA 3I9PA 2FQEA 4R5TA 4JRYD 4ZOBA 4ABQA 1TF4A 3F7LA 5DMKA 1RKRA 3A6BH 3WTYA 3IFNH 1SVCP 5ILTH 4J3OG 3NK4A 1GZHA 3QNZB 1NIBA 2VXQH 2WXHA 4HK0A 4LQFL 4NAMA 5CN2A 1NCBH 4XNUL 3CVIH 5CJOH 4EI5D 1LWJA 3CQFA 2XU9A 2LLNA 5LWYH 5DUBA 5C0JB 3FT2B 2R23B 5T1DL 1F0LA 5D7JB 3DURA 3HMXA 3MPCA 4QHUA 2OLDA 3ZLQC 4AY0A 3QRGL 1UQSA 4FQQA 4UINH 1KIQB 5I17B 1EUUA 2J56A 5DO2D 5I8KL 1F11A 1L0YA 3IFNL 4ZPVB 2D03L 3JUZA 2YKLL 4TPRL 4IU2A 2ZNXA 3X12A 3JTTA 5C0EA 1IL1B 1FL6A 5CWSA 3FKUS 2BIHA 4HDIA 2Z92A 3NEEA 5EUKA 1FN4A 4JGJA 4OM0H 4C57C 1NGWB 4EDXB 2Z93A 3V7AE 4ZZFA 2QQKH 5HDBE 5KVFL 4EOWL 3MBXH 1OSEA 5IJVA 1LO2L 2CLVB 4C56A 1BD2D 2DQDL 4Y7OC 1DQLL 1CBVH 5FECA 1SDYA 4DZ8A 3R18A 3KDPB 1MJ8L 4PRPD 3T6ZA 3U4AA 2OXGB 4NM8L 4AITA 4Z3EA 5LN8A 2O6PA 4L1LA 3UTZB 5L8KB 2JKXA 5DTFB 4FTVB 3BAEH 1YECL 3ZJAA 4JE0A 1H3UA 1WBXB 1K4CA 1N12A 2JKRM 4FLSA 4XBEH 1II4E 2DQJL 3DIDA 5BRPA 2XTJB 2NY1D 3KPRE 3U0PA 3T5WA 4F24A 4YH6A 3HKZA 1JFQL 5CJQL 1I7ZB 2DQEL 4FABL 3MNDA 1NOAA 1UWGH 1GW0A 1HNFA 1I8IA 1HJBC 4Q7DA 5JA9A 3BESR 1JZ6A 1H6TA 2FEJA 3QDJA 4PRHA 4Z7QE 3L4UA 1YNTF 2DWDA 3LQAL 4XXDA 1BQLL 2ODHA 3D34A 3N1PC 1WZLA 1D5XA 1KFGA 3SODB 1C9SA 2Z9TA 3STLB 3IU3A 3TH4T 1YNTB 4HUCA 1MCLA 4A2FA 1PDKA 4L8SC 5BS0A 5CBAA 4PGJA 4FFYL 1SOKA 3AQYA 5F7AA 3CFKB 1FNSL 2XWCA 4M7LH 3HG1B 4H8WL 4KKZA 1WCQA 2CDGA 4LFHD 4DSYA 2VMDA 3VH8A 1BF5A 1NWOA 2EJ1A 3N1MC 1EV2E 4KZCA 4U6YB 4KNSA 3TL5A 2ERJC 4R3SA 1CICC 3QUZB 4GW5B 3CHRA 2I60L 1UOKA 3CX2A 1ZA3B 2HAZA 3F6IA 1JHLH 5KBLA 4ZYKB 4M48H 1A7OL 1KB3A 1VCBC 2PLTA 4PG9B 1JVKA 2PWFA 1CG9B 1BIHA 3D0VB 1ZLEA 4NQED 4WKZB 4JR9H 5FX3A 4CW1B 2YOAA 3DXAE 1UWFA 4FFZH 4PWFA 2BHUA 3S5LB 2CG9X 2H2SD 3DX1A 2AXWA 4XNDA 3MV9E 4UV4L 3PAVA 4Z0BL 2WXOA 2Z91B 4IS6A 2FD6H 4Y5VC 4IRJC 1A6ZA 3P30H 5C9KA 4PBVC 1R47A 4N2IA 1P6FA 1GGCL 2ZG3A 1C5BL 4C83B 1OWRM 1X5ZA 1BFTA 1OANA 2A73A 4TNFA 4CW1A 2CK0H 3U4BL 2DOCA 3JWDC 3QEHA 4LLQA 2BVYA 4QHKJ 2ITDB 5E6UB 3F5WA 3FT4A 3JVGA 1T22B 2E56A 4Z9KB 5GZND 3EJCA 4Y4HB 3CMOL 5HPMB 5JQ6H 4EPSA 1OP4A 3N42B 1BVOA 3LSOB 1EEUA 1EGJL 1QWNA 3U30B 1XGUA 2QQNL 5IHHA 1E8YA 4BV1A 3BW9B 4HD9A 3BGAA 3MV9A 4J3XA 2FIRT 3KEDA 2WCPA 4YXHH 2W0KA 3TJHC 5IGXH 2ZPKH 1INDL 3ASWA 8PAZA 2X70B 2ZKWA 3GJFA 1F6AB 4NZDA 1JZHA 3GSQA 3EUUA 3V6ZB 1TQBC 1IKNC 3QUYB 4GW4B 4FNPA 5EHFA 3V52L 3IWUA 3IDIB 2CWRA 3TEZA 3ZHLA 2QGEA 4JFTA 4UTBH 2HG5A 3I3BA 2H0JA 2W1NA 5KW9L 4HG4K 1N5AA 4HIXH 2Q0ZX 1H8SA 3M17B 4EN3C 1N7ML 1T1XA 2VSMB 4M5YL 4UV7H 3LZPA 2NY0C 1NKOA 4Y4KA 3SKOA 2J88L 4XOEA 1K6QL 4FQJL 1UM4H 4JJ5A 3ESOA 4ABVA 5DWPA 2R9HD 1Z9LA 2WVVA 1TCRB 3H54A 1CLVA 2XPGB 4UDTB 1HDMB 1KN2L 1S9WB 1A1NB 3OXSB 4TF4A 4LLMA 4X6BB 4FXKC 5EO9A 1B0IA 4OFYA 4N0RA 1RZKC 5IHZB 2V2TB 5DVMA 1JOIA 2WCGA 1CZ8L 3KPQB 5I9QB 4HS3B 5J3HC 3U1SL 3THML 3N6YA 2QHLA 1K5NB 1UOWA 4G6FB 3WKNA 7FABH 2ICWI 1UVQA 1PYWA 2YAQA 3ILPB 4IRZL 5C7XH 3BE1L 4CVXB 1YYML 3OSVA 1KJ3L 2GFBA 5JXAL 1YC8A 5E08H 4Z8FL 1EFQA 1G7JA 1KCRH 4LLMB 4NT6B 2QPUA 1CWVA 2IFGA 4X6BA 4BE5A 1M7XA 4KQ3L 4N26A 1UFUA 4LCWD 5EWIH 1JPFB 4M7JL 1T66C 4PJFA 1FH5L 1QX1A 1R33A 1M2VB 3UIYA 3HE7D 2RCSH 4EVNA 3MA9L 5IFHH 1F8TH 3MLPA 1T5WB 3FMGL 1IGYB 3IGLA 3M8OL 4B60A 4I48A 3EGDA 1A4AA 1OCCB 4H25B 4AV5A 2HSIA 3VCLA 4Y2DB 3NEOA 3QJRB 4PJ7E 4B27A 4ANVA 4UOZA 4Z7IA 4N0YH 4QI3A 1CL7L 2VQUA 4O5LH 1F4WH 3HZYA 4IQHA 3DBSA 3KG5A 3US1A 2EH8H 2EXTA 1QBLL 5DD5L 5AVQB 2WMPA 1ZT4B 4H2AA 4OZHE 1G9MC 4KU1A 1HQRB 2ATPB 3LEVH 5IM7B 1KY6A 1QA9B 3F12B 3SYOA 4Q58C 1OPGL 3ARBD 2WLLA 1ZHBB 3KXFD 5LAXB 1PZ3A 3I50H 3C09C 4F27A 1ZWIB 4DFIA 4XCFH 5DRNB 4LU5H 1SBBA 3T2QA 3QQ9D 4A7TA 4AOFA 3B1UA 1HX0A 5EN2A 3NQKA 1B2YA 3FTVA 1XT5A 2YD2A 3QJFB 4RWHA 3LNDA 1EZUA 1QVOA 3POHA 3B9VA 1T4WA 3EIFA 5CCGE 3QIWB 1DVXA 4AL8L 3O6LL 2WLLB 2WD0A 3V5HA 5FCUL 5AZEH 2D9QB 4GG6F 3LKQA 4UT7H 4KDTA 3E3QE 3EDEA 4K3JL 4XTRD 3X3FH 4FXTA 3VH8B 4OCWH 5TE7H 3RPIB 1D5BA 1CVSC 2WZ0A 2CBOA 2IPUK 4OFQA 2CNYA 4FP8H 1MDAA 2X5PA 5FYKE 3CSTA 3QUML 4DJMA 3RVXC 2WUCH 1DZBA 4HUUA 5EUOB 4FF9A 3VXNB 4BCYA 1LD9B 4KXZH 2CRYA 4RZCB 4LPCA 2J8UE 3DSNB 4KI5E 4NI3A 2A1WL 3HZVB 4P23C 5FUOH 5DVLA 3GWJA 3QJSB 4F7TA 3LQMA 5KYUA 3V5HB 1DVFB 2OBGA 4LIQL 4LPUA 4UT9H 4PRBA 5I16B 1RUKL 4H5SA 3S35L 2ADGB 1CN4A 4L8BB 4NWTH 1LO0H 5ID1A 1MHPL 3H0TA 4TSBH 2HRHA 3GLAA 3APMA 3VFWA 3W9EB 5A6LA 4X9HA 5FHBL 3QNFA 1KBGL 2PWHA 2VN3A 1YY9C 1A9BA 1RZJC 4FQXB 2BVOA 3TVMC 1KZQA 3H7LA 5IBLC 1BGXL 3TYGL 2VIRA 1G4MA 3O45A 2A4CA 3AS0A 5F2FA 1B0GB 1UH3A 3MOBL 1A6AB 2GTQA 2W9EH 3MJ7A 2ZSWA 4QTHB 3SE9L 3MDJA 5I5RA 2XVKA 2Y1YA 4JFDE 2X4UA 2V2XB 3IEAA 2OPCA 2OSXA 3O0RH 1P7QD 3UO1H 4JPVH 3G04A 4N2FA 6FABL 4Y9FA 5EZIH 5EUOE 2A73B 1OQXA 1UZ8A 2BFVL 1LDSA 1UXLA 3RY5A 5F89B 1PSKL 2DM2A 1NLBH 4AVHA 5TDOA 1RZIB 3MXVL 4ZTEA 3MCLL 2HTLC 4P04A 4YSOA 4RMWA 4HBCH 4RNRA 4PJ8C 1MVUB 1ZS8A 3K4AA 3PXLA 4I88A 4JO5A 4NQEE 1OTUC 2IDFA 1YDPA 4XPFH 4N9GB 5LGHL 3I6KB 2EIKB 2C9VA 3FUKA 3QCVL 1RHHA 1RPQA 2VR3A 2RFXA 4PFEA 3F83A 4A7SA 2ALAA 3TC9A 4YL9A 1M6OA 3U83A 1WA0X 1VKXB 4UT6L 3CLEL 3KLDA 1XCTB 1PFOA 5A6MA 1KY7A 4NO3B 2WSDA 3SDDB 3VDCA 2L3BA 2AP2A 2W91A 4EF3A 1BZDA 2GAZB 4JL1A 3V6ZA 5F0JB 1CD0A 1OAKH 3LVEA 3VWKB 3VXSA 4NHUA 3SDYL 4LVHB 2C9QA 5B38A 2XG4B 1DBAH 2AKRA 2CUAA 1Z5LA 3MV8E 2E6PA 4LEXL 5CP7A 1EANA 3NIFF 2Y22A 4JKMA 3K74B 3NZHL 2CHZA 3SDDA 5J12B 2APVA 1DVYA 4IRSA 5B21A 2P80D 1BLNB 5A2AA 2ITFA 3AT8A 4R96A 5AOJA 3VFMA 4OUUB 2YGOA 3GRWL 5DD1L 5B1BB 3E80A 2FBRA 1U8MA 1AKJA 4JFED 2IAMA 5GSRA 4N2KA 3N5AA 4Y5YC 3IFLL 1XCQB 3VFUA 3ZQ9A 3ZL4L 3GZQA 3QEQB 3GO1L 2GI0A 4O2FA 4X0NA 4NUGH 3KLLA 3VXUA 4HIEB 1CGSH 4J39A 3ATFA 4LFHG 4NZRL 1VFMA 3O3AA 3VRIA 3CFBB 3UCRA 4UOQA 3WFBH 1ZA6B 5CILL 1F18A 4JFYB 2IJ0C 1DE4A 2X40A 1MFBH 2GCYA 1GSMA 3P9LB 4B9GA 3K72A 4P2RE 2OTWB 4B95C 2NXYD 2EYTA 4EBQH 1AKPA 3K71A 1F6AA 4NKOB 3MLYL 3DURB 2YQ2A 3QDMD 2X0WA 3MROA 4LGPB 4MLSA 2C9UA 4JFWA 3C8DA 1KTJA 2DEWX 3DWTA 3STZA 1AZCA 4KXBA 1CVRA 3FTZA 3CU1A 2I69A 4M43H 2MJWA 3F7RA 1GZPA 3WU1A 1FGVH 2VKWA 1BQHB 5CINH 1U8LA 4ERSL 4PMEA 5I1LB 2CIKB 4JY5H 3TURA 3UTQA 2YK1L 3RWDA 2CXGA 5I18H 5CEZE 3MV7A 4KNQA 2CBPA 4CKVX 1XXFC 5LCVA 2DWEA 2X12A 3APCA 3HMWH 4AT6A 1CFSB 4ODUA 4KX9A 1SOXA 2O93L 4XN7A 2A6JB 1CFBA 5HYJE 3EG9B 3Q43A 3HB3D 4LOVA 3D06A 2N7AA 3AWFA 5EN2B 2UYLB 1B0RB 1S7SB 3BAIA 2GK2A 4FL4C 4AZUA 2W60A 4JCMA 4MMXC 2E9WA 4QT5A 2Q2EB 3QUZD 4XP5H 4PJFE 4E36A 3Q7JA 3S88H 2X38A 3I6GA 3NIFE 1W0VB 2CNZA 1WK0A 4LMQI 3S96A 1SJHA 3GI9H 4YDMA 3O9WB 2NPLX 5B39B 2WXLA 4FEIA 1B3IA 4ODVH 5D7LE 3KVPA 4JQVC 4HLJA 4NNXA 2F54A 3OL2A 4FG2A 4JM0A 5ES4B 1I8MB 4MA8L 5ADOL 3T0XA 3IPFA 4Y1AD 2PYED 4XXDB 1N3NA 5HHVL 2CLZA 4RMUA 4TNVF 5F7UA 1N26A 3CZFA 1QBMH 4TSCL 3VXTB 4K5PA 4PJDB 3WIFA 4N8UA 4NGHL 1W6WA 3ETBF 5D4HA 2E9JA 3HZYB 3CSYA 4DO6A 4E2OA 4YS4A 1QSEA 3W0WB 1YEHL 4MQTB 3BH4A 4DIXA 4F7MA 4U7SA 2QKIC 4XXWC 5F6HJ 1TMQA 3VG0L 3FSWA 3QG7H 4LCYB 5I82A 3DXAB 3F7VB 3GZOA 4JQIL 5EBLB 3MUGB 4H8VA 5MI0B 5J6HB 2YPLD 4TVPH 4JPIA 4FHBD 2LVEA 2COVD 3OJ2C 5FECB 1U8PB 3WS3A 1X5AA 2IH3A 4QWWD 3TCLB 3BWUC 4QRAA 4WWNA 1NKGA 3MTXA 1J8HA 2R29L 2XOTA 2BSDA 2L7JA 2QSTA 3QNYB 3GXNA 3OZLA 4X6DE 4L4JA 4PJXA 1IL1A 4XXCC 3D2UA 2P9RA 1QWUA 4LKCA 5CFHA 1BFVH 4AQ8C 3QQXA 1SYVA 4G6ML 1GA2A 3LRKA 3N42F 4MS8D 2I7SA 2CIIB 4ETQB 4PBXA 4G7QB 2OZ4H 2NOYA 4UQ3A 3N04A 2VOTA 3AXLA 2VDLB 1AHWA 5EO0B 4UNUA 3GJEB 3RWJB 3WLBA 4LVOC 3D69B 5CSZA 1IAOB 4XMWA 4KK9D 2DQIH 3MYJB 3BP5B 5I1DB 4FMKA 3Q3GA 4U49A 4PJ5B 4R8WL 5F72S 3RWIA 1FGVL 1ECYA 3LEYH 4H88L 4JL2A 3CN0A 1IX2A 1UXWB 3ZDXE 1Z9SA 2AQQA 2D3JA 5KEZA 2BP0A 4LO9A 4U6XB 5FK9B 1ASQA 1NC2A 4ELKB 3HS9A 4ZW6A 3CVCA 2NZ9D 4ZPTA 4XNYL 1IJNA 1LVEA 1QI3A 2QEJA 4XVJL 2VNCA 3RWEB 4XNZC 4EBQL 2BRRL 2ZCZA 3GT6A 4PV9B 2F53B 1U2CA 3PXJA 3CFEB 3G7TA 3VXQA 1UHVA 4Z7NE 4JVPA 2GY7B 1HSBB 3OF6D 3MTRA 4MMXA 4OUUA 3UAEA 1JZJA 1UWYA 1R5WB 2YEZB 2YQGA 2D7PA 3PHOB 4PSRA 2P28B 3SE8H 2MTPA 3WLWD 1BWWA 3SDAD 4UQ2B 2DQMA 4OV6F 1EO7A 4P59H 5GGRA 5GXBB 2FJSA 4XPBL 4AE1A 4X6DB 3H85A 1ET8A 3DETD 3DHJA 1E2WA 4MB3A 1Q8MA 5DS8B 3EJZD 4KVNH 1YDPB 5ICXB 3KCWA 1JF1B 3B2DC 3T3PB 2H2PD 1AIFA 1OO2A 4GXFA 3R7RA 3HAEA 4A2GA 4N8VB 1MF2L 3EJQA 3MV8D 2WW8A 1KTDA 3GRWH 3QI9A 3QJUB 4N5UA 1KYDA 1O9WA 2BP8A 2D0FA 1IBHA 4MJJA 3HNTH 2EDMA 2JNZA 3PWPA 4LLWA 4PY7A 1DVUA 1WV7T 1ZANL 2D7MA 2FH8A 2PR9A 1D5MA 5IFAL 4L0YA 1LO5A 4ZODA 2CHXA 3GNML 4ADJA 3BEVB 2PW2B 4YDKL 3P69A 4JEGB 1BEXA 1HIML 3MZGB 4R84A 3ULSB 1IB5A 2J5LB 4CVZB 4KITB 4MQSB 2X42A 3OKOB 4RRPA 5HYSG 3VXPB 4U3CA 2F5BH 4K94L 4WFFD 2VQ1A 3H6AA 1E8XA 5EZJA 5LCVL 3WUZA 4JFSA 3EXLA 5IK3B 1HEHC 3IAGC 4HKZB 4JHAH 1YG9A 4U1JA 3QDJB 3T0VA 2CKBH 2EVFA 1MZYA 3NCJL 1O0VA 5GGTL 4MDIB 1RK1A 3FU7A 2JK5A 4UNTA 2EQDA 3RB7A 3Q0HA 5AKSA 3PABA 4WFHD 4F8PA 2X9ZA 4GP8B 4YK4C 2G0KA 3HZMB 1JWSA 1ID2A 3HRZB 3WIHA 1CDJA 4X4YA 1FZOB 4LCWB 4O51B 2Y5TB 3RGHA 3VI3B 2UY7A 1BF2A 3CDGB 5C0BE 4JO8A 4XH2B 1K85A 3WCYA 1KJVB 4CL7A 1MCBA 1ITCA 4TQIA 3HBPA 1K8DB 1MFMA 3MRFA 4RAUA 3O8XA 4HBCL 3ZDXF 3T8VA 3A24A 3OHXA 3ZIYA 2VC2B 1J7VR 1JUFA 4P2RB 1MVYA 1PZCA 3CBJB 5E8OB 2H3KA 5AVZB 2QVFB 4GUCA 4NXSA 2WVVB 2C4XA 2X2IA 3S0PA 3SIKA 2XIDA 4H1LG 3ABKB 2J21A 3WV0A 4J7RA 5FW7A 1FG9C 1L7TL 4YUEL 4OF5A 3Q2NA 2H6PB 4HHAA 5DMIH 1OAUL 5HJ3B 3T77B 3RJOA 2Y07L 5CEZH 3EZ8A 3BKJL 5IHBA 3FYIB 5BXFB 4WNSA 4J4PC 1RIVL 1M05B 2WAHA 4S1DC 5EOCJ 1A5FH 2HMID 2FECL 2FUTA 4L48A 5E7BA 1MAKA 4WGVB 4YAQA 4JQIA 3IXTB 1UD4A 2YXWA 4PHZA 5LBSA 1ZLUK 3UYPB 1AD0B 3X13B 1Z9NA 3LB6D 1CL7I 4MJ6A 2GSGA 1S9VA 4BA0A 1F3JB 1LO0L 2R83A 4FADA 3K5RA 1E4HA 2V9RA 1MKFA 4QKTA 5HYQA 2ZCKH 1E9QB 4CILA 1L9RA 5FC9A 3SBQA 3SQRA 2LR4A 3NEXA 2XX1A 1G1CA 4QRUB 4NZTH 3AMKA 1TEYA 3DBXA 3IDUA 3SDCB 2XI9A 3ARFA 2DL2A 4M29A 1AANA 1UGNA 2OMWB 2QGDA 3MGTA 3WAKA 1NAMH 4RAHA 4TM9A 1E28B 1CFNA 2MKLC 3FO2B 4X5XA 2FX9L 2EUZA 5IFJA 2VDNH 3ZK0A 3MCYA 3B56A 4OZIB 2XRAH 2CMRL 3ZKXB 5CCKL 2FSDA 1KFAL 4Z3TA 1PBYA 3ETTA 3ESVF 3NT0A 4GFTB 1RSFA 3NTCH 4MMZC 2FWUA 1TETH 3FUMA 2VUKA 3P0YH 5EIIB 4E9SA 2F58L 3DRQA 2UXVA 4BQBA 3AWEA 3SQOH 3S36X 5JLZA 3CXDL 1KJ2H 3EDKA 5IJKC 2IOMA 4G3YH 1MCJA 1RUQH 1MPAH 3E8UH 5B8CC 3P2BA 4M7KH 4XN4A 1MFNA 4EQ2A 3OM3B 4PP1D 1EJOL 4H25A 4L4VE 3BVWA 4J2XA 3QP3A 5GHWH 5GGSB 1T66D 2VM3A 3KPPA 5DJZA 1ZV2A 1SY6L 3VFPB 1MCWW 4Z3IA 5EBWB 3U82B 3U7AA 4LLYB 4PGBA 1Z2KA 2NLJB 2ZOLB 4G6JH 3C6SA 4Z7WF 2ZX7A 1J88A 5AYTA 1J05A 4F7MB 4IMKC 5DYOA 5LGJB 4ODSL 4DOHB 4F8OA 2ZUWA 4PPTA 2L0DA 4ACTA 3BEWB 5J13B 1LTXA 2JCCA 3GMQA 2ZXGA 5D1XD 1ANUA 2FQFA 3GMLA 3TT3H 2XZQL 1UYWH 1ADQH 4W9IC 3TA3C 5AENA 4TTGA 1FFOA 5C1MB 2BERA 1JPSH 2EDEA 3SN6N 4FL4B 5IB4A 4PUBH 3IM1A 2EUVA 4WSGA 2CM5A 1KCRL 1I8LC 3NBNA 1JPFA 2OCJA 1UM6L 4UBDC 3BE1H 1A9BB 2NZ9C 2I9LB 4XI5C 1F02I 3QQ9C 4NUPA 5ABDE 1ACZA 3BSZH 2ZTBA 4LSDA 1X4ZA 2EDFA 4PJAB 4EQ3A 4EVNB 5F0LB 2ZXEB 1ORQB 1A1MB 1SYSB 3REVA 2ARJQ 2XXMB 3WHE0 4J4PA 2X28A 3IVKB 4OLYH 1D6VL 3K0WA 1YNTA 2YGNA 2XZAL 4KI5F 4P5KA 2OX5A 1JPST 3T0EC 2BK8A 4DGYH 1MCIA 1R46A 2G9HB 1MAJA 2K9FB 4XO5A 5FWQA 5DI8B 5KYYA 1XF4A 1GC1C 5CWSB 1JYVA 3HHMA 2OTUA 1K6QH 4LASH 2G60H 1OOAA 1ZGLP 3OB0H 4DP2X 2VZTA 2FO4A 5I6MA 1WF5A 1TZGL 4UV7L 2FO1A 1BP3B 5IB3A 5DJXB 1S7UA 2AEQL 3CN4A 2FSEA 2VRKA 1L9NA 3PNWB 1WTLA 1X9QA 4XCCH 5G2NA 5KW9H 4IM8A 3BSHA 2AS5M 2YD8A 5BVJA 4L29A 4GBXB 2FZ3A 1A3QA 5BRZB 4BKLA 3V52H 4YHKH 5LXGH 1W15A 4YVNA 4X9BA 2X4OA 3FB7A 2VCOA 4I5BA 2OXGA 3K2UL 4JM2C 5HYEA 2VR6A 3ARQA 3H1ZA 3DLQR 1INDH 3V4LA 1XAUA 3UTSB 1YY9D 5LNGA 1Q38A 4I0KA 3VGAB 1AHKA 5IVZA 1BOGB 1NGYA 3O41A 3LV3A 5E99H 4E5XG 2R4RH 3BUBA 3PP4L 2ZJSL 1CGVA 4N6RA 3IJYA 5TDNA 3P4LA 3FRPB 1E65A 4PJBE 1UCTA 3CHXA 1VFAA 3QSKB 3X1EA 2ZKHH 4LHUG 2CCWA 3CMOH 2HKHL 4IRSD 3NCWA 3STZB 1BA9A 1TVBA 1BG9A 1TMCB 1P84K 4PS7A 5D1XB 5I73B 1A21A 4ZAKB 3F2LA 1AO7D 4ODBD 4CC4A 1WWBX 5I1EL 1MRFH 3LV3B 5CU5A 4RQQB 2H7WA 5IEHB 1JNLL 4N0FB 3L3GA 2CRIA 1AD9B 4XNQA 3MOAL 2JELH 4TULL 3S97C 1JDCA 2LQRA 4G11A 3LNIA 4LHJB 3N9GH 1CCZA 1K2DA 2PMZA 3B9EA 3LOWA 2V7HA 1KV7A 4KUCD 5DMGC 4M9PA 5J0BA 4X80L 3FFDA 2V2WB 4U4IA 2D7QA 4GO6B 1OY3B 4OLVL 4K3EL 3LQZA 2YPVA 4ZMZA 2WINB 4YHPB 5IW3A 2PF6A 5C6TL 4QRQA 1DE4B 1VENA 4JCLA 3GSXB 4X8XA 4PS3A 3DMMA 4QYOA 3IDJB 1S46A 5T5FL 1A4KB 3T4YA 2ZCLH 3LMJL 2OAAA 4GT7A 4YC2C 4A6YB 4WWID 5KG9B 3TZVC 4HKBB 3D0LB 2EDDA 4KKAD 4J3UA 2E7BA 3PQYE 3BH8B 4MGXA 3UTPE 5EEUA 3IK2A 3ZY7A 2H0PA 1HAUA 3FQNA 5D7SH 4HULB 2PW1A 3ZDZB 1XF1A 4KK6C 3UDWA 1Q9LA 1IKFH 1MVUA 5FUZH 4HC1L 2NDFA 2XBZA 3GMRA 4U0RB 1RZPA 4JM2B 1CJYA 5BQ7A 3HG4A 5DFVD 4LCWE 4M7LL 5GSVA 3UERA 1KACB 3PAUA 3MV7D 1AGFA 1CC3A 4DW2L 2KI6A 2EDLA 3DIVA 4D0BB 4HOMA 2HN7A 1BYNA 1KCSH 5C3TA 3ZT7A 3BDYL 3KLHC 4AYFA 4Y1TA 3B7SA 5IJKA 3K72B 1WQVT 1MWAH 1HINL 1N68A 3CFDB 3NJIA 4ORGA 5C71A 1MUJA 3QJZA 4J1UB 3IU4H 1BM3H 3DGGA 3NSFA 3OGCA 3UTSD 4RISL 1TZHA 2FE0A 2IH3B 2F5AL 1VAHA 2VITA 5CUSL 1JFQH 1G0YR 3MBEB 1M3JA 1FZJA 3BO8A 3SCMA 4MD5B 2XWTB 3ZYJA 3BXNA 4PS4L 2J1ZA 1LP9F 3FQYA 5J6GA 4NRYB 1YEGH 3BAEL 4G8FB 2A5UA 4GQ9H 3QA3A 4IBSA 4MHHG 4LSSH 1BV8A 3BZFB 4WNQA 3UH8A 3UZEC 3DOSB 3HLAB 4MNQE 4XVUD 5LG1A 3WTUA 2O4EA 3MLWH 5HJDA 4MNGE 3VXME 4WHDA 2BIQA 3QUYA 1RUPH 2HX8A 2JKTM 4HSQA 1JV5B 3Q1SH 4WWKB 3MHZA 5M94B 1FORH 3GMOB 2VJ8A 4PJCF 4B7IA 4O2CA 4PJBA 4EDWH 5I0DA 4FQQB 4ANXA 3ULVF 1D6EB 4XTRC 5T1KD 4MAZA 4PJIA 5ESAA 2FK9A 4WWKD 4ZPVA 1F3DJ 4ENEC 3CFJB 3D18A 5F3HA 4WNQB 3ZE0B 2WQ8A 1BZ9B 1I3GH 1FFNB 1A6PA 1O7VA 3KYMB 5D6CA 3IKCB 5D9SA 4IBWA 2ZOUA 4JG0H 3FSZA 3CE1A 4P2QD 4AYID 4X8JA 2E8ZA 5A16B 3HJ0A 2WP3O 4F8LA 2NXZB 2V17L 3STBA 3O2WL 5AZ2H 4NQCD 3WFEH 4LSUH 2A4EA 3QRGH 3QUHA 5I2IA 5FKPA 2K4WA 2OL3L 3JYBA 2QGCA 4AC2A 1CXIA 4YSDA 4TLUA 1FF5A 4W70A 3KWUA 3ELAT 1WWAX 3VO0A 1CPUA 4RBPH 5I74C 1UA6L 5D7HA 5T3ZH 1NCBL 3L3DB 3II3A 2IAAC 3LD8B 4LQFH 4X8JB 1W80A 2Z64C 3F65A 4MD0B 2QADD 1NDTA 3VFTB 2PPCA 2K6YA 4Z7OF 3FTYA 2AEPL 1HHJB 4HJ0C 3L5IA 4JPQA 5EU5B 4J8RB 1OGAE 2BW4A 4NM4L 2R69A 4X5QA 3D87B 1OF2A 3JVFC 2W95A 1MRCL 4OCSL 3MUUA 4XC3H 4NCDA 5L4FA 4AI7A 4G8EB 2VZOA 3NFSH 2PCPB 2K8MA 4YDLB 1E8ZA 4PJ8D 3L8QA 4N1CA 4GG6A 3PHSA 4QF1A 2JXMA 5ECGA 2DWYA 2WXNA 4U31A 3U25A 1TTBA 5EOTB 3BWSA 1ORSB 5EU5A 1IMHC 5IROD 2K6ZA 2Z4QB 3OLIA 4CDHA 4HKJA 2F7IA 2FHCA 3D85B 5CM1A 4PMFA 1Z3GH 4N25A 4XE0A 4ABWA 4X6DF 5D1QA 4HJJH 5TQ2L 5FOJA 3TCXA 3SDAB 3PRZA 4FDWA 2JKWA 1N64L 2LOEA 2F54D 5GJTL 3HLKA 2W07A 4PJ9D 1BPLB 4YXLL 3E38A 2F18A 2VQ1B 4PRNA 4BIKA 3OB0K 1S7VA 4RIRB 4E41A 2NW3A 3FO9B 1IQDB 2AITA 3UPCA 1KF9B 5LHDA 2ZWZA 3IMRA 1LXMA 3KPMB 2H8PA 4L1BA 5F7DB 1RZ7H 5AUMA 4E9XA 2LU7A 2Q2LA 2K0RA 3VXTA 1TJGH 4Q9QH 2ICWJ 2D3NA 1RULL 1WTGT 3Q3GB 5CN1A 2FATL 2VXTH 4X4YB 1B4TA 5I1KH 2PCYA 2HVJA 3QEGH 4YZFE 3QHZL 2JI3A 2B0SL 3U2IA 2B59B 2AQ1A 3WNLA 3Q8BA 3IGAB 2B1HL 2ZKYA 3PGCA 3KHQA 3V0VB 3QUYC 3MRFB 3POCA 5DJXA 5C0BB 2DTSA 4JE4B 5F6IB 1PCSA 1HKLL 1RIHL 4K2UL 3VW3H 4HCIA 4C4KT 5I0YA 1YA5A 3STLA 4FULA 5F7EH 1VKXA 5TE4L 3VGGA 3VA2C 3EOAA 3UJJH 1TZIB 2G3NA 2XIBA 1B2WH 2DQGL 1K8IA 2FWOB 1FHNA 3KYAA 1BZEA 4JFEE 4HJUA 1Y6MR 3K4DA 4PWKA 3ZO0A 2B59A 1KG0A 3ZGIA 2EZ0C 5D72L 5IVXE 3WKYA 3MFFB 3LKOB 3EFFB 2O5NA 4IBLT 4KAQH 2OXHA 3UO8B 3VWKA 3F01A 4XBGA 1RZ8A 4KO9A 3VE0A 5GGQL 4W9DC 4PJ8B 1IAIM 3P3RA 4N1HB 3AQZA 1THCA 5A2FA 4JANB 2FEDD 4JO1H 4QUOA 5I1HL 5ITBH 5HBBA 4LPTA 4PLJC 1OP5H 1S3KL 2MHAA 3QAZC 3MLUH 3DVNB 1KLGB 2KDYA 4HT1H 4G42A 5J9PB 1U8KB 1KCVH 1L4IA 4NJ9L 5DS2A 1P9MC 4Z7OB 4PGDA 3D6GA 3FTGB 2W65B 1A3RH 3L54A 4X5WA 4R0LC 1JWUA 4MWFB 4L3FA 2VLKE 5F89A 3DXAD 5CJXC 2W88A 4NAQA 5KBMA 2GJ6E 1I85C 1IGFL 4Y8AA 1FFPB 1F1AA 3L95B 2W0LA 1IGML 2VAAA 3Q6GH 4RDQF 2EEDA 4BQ8A 3QPXL 1IC7H 2HT2D 1G9NH 1NBYA 5D7JC 4EUPH 4JBSA 3FOLA 2BP0B 1KDIA 2VW7A 1E4KA 1WDAA 2CR3A 2XICA 4O58L 2R51A 4Z7VA 1AY1H 1E67A 3X3GH 1RZJH 4JRXA 1AOZA 2DQHL 4ZPTB 1G7PB 5HXMA 4I18C 4KUZH 3MRGB 2BJMH 3G6JE 2Y25A 5E94A 1BAFL 3GC3A 4YHIB 5K39B 2OTWA 3I75A 3GGWA 1ETJA 1KBPA 1YEKL 3LHAA 3KPRA 4PW4A 3VI4A 3DO4A 1AYRA 2IBGA 2ERJB 5DCCA 2VUOA 4OCXH 4N0UA 5I5JA 2A74A 3T8XB 5JW4Q 1NAKH 4HVBA 2IBZY 5A40E 3FOLB 4F5CE 4U4BA 5DRXA 5CHNA 5I28A 5DURD 3VXMD 1OAQL 3FUEA 4O02B 4PN6A 1LLAA 2K78A 2B8OT 3LKSB 4FNSA 1GOFA 1A7PH 1LO4L 2YKKA 1OZTG 4XVUC 2J4WH 2OSWA 1IBBA 3TASA 4ZXBA 5I8EA 3IMWA 4OLXL 1U8OA 2YMOA 5KN5B 3UGEA 5I1LA 2PXYB 4FTVE 5DMKB 4KHXL 5DA4A 3VWJC 3WKMH 4K7PL 4LCVA 4R90H 5I1JL 5I0WA 3ZDWA 1GZQA 3W39A 3EGDB 2YAHA 3HW7A 4LGRB 3H56A 1I1YB 3QG6B 4MXWL 2XX0A 5K9QG 4FKKA 4ALAH 2YGQA 4IDJH 5FDWB 4KTEL 3U9PL 2XQBH 4NB7A 5I19L 2X87A 5EC2B 4AEIL 5E5LA 2APSA 4XB7A 2NZIA 5IQ7L 4HC1A 4YL4A 1CGXA 4QWWC 5EZJB 2XTLA 4XNMB 2BSEA 2Z0BA 3S36L 1F3JA 5D7IE 4Y19D 3ZKSD 5C0CA 3GSNA 2J1XA 1NGPH 2A9NL 5L6YH 5CZRA 2EVJA 1HL4A 5FYJL 1UTDA 2NY7L 1LEKB 1K5NA 2XA8H 3DIFA 3GBML 4OQTH 4A7VA 4DH2A 1J1OL 2GITA 4P2OD 2Y72A 5EC2A 1JXDA 1M2OA 1L0PA 1FZOA 4G1EA 2Z8WC 3K6NA 3C60C 2PTUA 3QZNA 3WN5C 1GIGH 4MS8C 4G2AA 2F8OA 4GYBA 5KBDA 1JVOA 3CHPA 4BQCA 3ML8A 5BV7L 5HYJB 2XXGA 1DN2A 4MA1C 3NACL 4Y5XA 5T3ZE 2R4SH 1P7HL 5F0PB 2CHNA 3L2MA 5D1QC 1IC0A 2CIKA 3UAJC 2EVIA 1P9MA 3C6LC 3MLSH 1H0DA 3ZT5A 4HH9A 3LIZH 4R26H 2NNFA 5F1IA 2Y7SA 3WEXA 3OLEA 1U8NA 1R0AL 3BUTA 4HJ1A 3KCPB 5AOLA 3GHEH 2I5YH 1N4XH 3GMQB 1XF5A 5DJ0A 1G6RB 5AW5B 1GS6X 1MFEL 1J5OH 4XMLL 2H32B 3GLDA 1OE2A 3KNBB 4G1MB 4GAYA 1YPZF 4L1DA 4AQAA 5JHDE 3AGWA 4YGAB 4AVJA 3LVTA 2YQ3A 5KANI 3V4VB 1LWRA 3WY4A 3CFTA 1NGWA 1IGIL 3IMBA 5KJ4A 1FFQA 4R2GD 1E6JH 2VQ4A 5GISH 1V7NH 5D1ZA 3KWVA 4U33A 1Y7VA 5SX4H 3GYRA 4GQRA 1WFUA 4PP1C 4GRWB 4TLSA 1JL8A 3WLWC 3B3IB 4AGPA 4RVBA 4WV1B 1BQSA 3D9AH 2HJFB 2DS4A 3REVB 4ESKA 4PGEA 4PTUA 1OP3H 1P1ZB 1NMBL 3VGBA 4E0RA 2AJXL 5HHPA 2WNXA 1QVOB 4PJAF 3BAYA 2LABA 2FWSA 2H1PH 5F96H 1KYOK 2DQTL 1BVNP 3QZWB 2DKSA 4XZUB 3L5XH 1TYJA 2EH7L 3U4EA 1VGEL 1MDTA 2F08A 4HPOL 2YAMA 2A0LC 1PU0A 2KHAA 4FS0A 1ES0B 1PLGL 3OR6A 1CG9A 3LQAC 5D2NB 3PY9A 3SGDH 1WIUA 4NIKB 3AY2A 3KWTA 1J8SA 2JKIS 4KZDH 2EIZB 4GP4B 1NCJA 3B7TA 3WFZA 2AJZB 5ISZE 1EAPB 1P7QB 4YSAA 4PV8B 5FLUA 3ZMNA 1Q72L 1UD6A 4OGQC 4Z95H 4X4ME 3QGVA 1FV1B 1JHKL 2BZCA 1FNLA 2NY4B 2WZ5A 3CG8A 1XF3B 4XX5A 3PGFL 5AYUH 3PU7A 3FUNA 3PCYA 1XGRB 2PKDA 4FYTA 3PWLB 4L3EE 3GDBA 5IMMB 1DQDL 3BVNA 4BZ1H 4HKXB 3N1FC 1SYVB 3NJFA 2WXQA 1TPXC 2CO7A 3K80A 4MA3B 2HTLD 3ZKXC 3P9MB 5D1XA 4KXDA 1J9CT 4HK3J 5DC2A 1CQKA 3LXUX 4WY7H 5C0GB 1U36A 4BFIB 4BGLA 2GYSA 4APXA 3FN0L 1KCBA 1WICA 1KTLA 3NZ8B 1NIDA 3ULUC 4W9HC 2QQLL 2WTRB 1QSFD 3IE9A 3RA7H 1PVHA 2AAVA 4N8VG 2VMEA 1U8QB 2PETA 3CSPA 2V33A 2WBKA 3F00A 5L9DL 5L4JA 5E0QA 3R1GH 3CVHH 4XVTL 3WUWB 4B9YA 5GJSH 4GRWF 3CUPB 2EUXA 4XWGH 3IJYB 1HXKA 4JFDA 1RVFL 3C8KA 4OD3L 4N9GA 3FT0A 4F1SA 1J12A 1ZA6A 1EJ8A 2K70A 3MRBB 2BY3A 3I74A 4J3VA 1ZT1B 4X0KB 1E4JA 4YFDB 3KM1A 1KXQE 4UDUB 4BH7B 2SEBA 4XN5A 5SV4A 3ZVVA 4M7ZC 1CXFA 3LN4A 4GLRI 1KNOB 5IIEB 4UCFA 3RVWD 3VI3E 3O2VH 35C8L 2JKSA 1T20B 2P52A 2IFFL 5AKTA 2XPGA 4I85A 1AGCB 3U0PB 5CU9A 5JIMA 1XZ0A 5IKCA 4WWKA 3GLEA 1QKZL 2HFTA 2NY4D 4JX0A 2J12B 35C8H 3PJNA 4TVSa 5FYLD 3T3MB 3RY4A 5DMJB 1L9PA 3D4GA 1CF1A 4DCQA 1T5KA 1A6UL 2E4FA 2MPAL 5H37H 5HGAA 1JZ3A 5FKAB 4YQXL 2AMUA 1KCLA 1GOHA 4FG6D 4I3SH 4K71B 4H1LH 2PTTB 2OMZB 3DVGB 3MLXL 1OE3A 3V4PB 4ES8A 1A4BA 1J5IA 1BQKA 2C26A 4MVBC 4YLBA 1RVFH 3QPQD 1NWPA 4XWGL 5IKCB 4FJ6A 4CN6A 4JFFE 4GAFB 4PY7B 1B9KA 2WIIA 1DLFH 1NH6A 1U3HD 4LCCA 4R9HA 5LO7A 2X9XA 2UWEA 2GEQA 4NCC1 2MOGA 5TE6H 3BJ91 3VGFA 2EIEA 4QTIH 3SYCA 4HKBA 4PJXE 2YXVA 1V3LA 2GITB 3N43B 5C6WH 4RDQG 1LQBC 1P7KB 2B77A 4M1DH 1FA4A 3ESPA 4GRLD 3KL3A 5HYSB 4I77L 3T3PE 2XSKA 5HGBB 3VXSD 1KIQA 4HS6A 4UOJA 5E9DD 3HR5A 4WUUB 4XMKL 3DOIA 1W0VA 3FHAA 3AG4B 2ZXAA 1ZOXA 4P4KD 2HG0A 5I8OH 4GAJL 4IK7A 4LDEB 3RGVB 1YMMB 3FN9A 4KKAC 4BZ1L 5IMOB 5IVXB 2XWBB 2JK5B 4WFED 1ZVHA 2GKIA 1GGIH 2OK0H 4OZHB 3OD3A 3UZVA 4QJ3B 4WEBH 3VD2A 3BIKB 2BVEA 4HMDA 1QHPA 4M7ZB 5D5MA 3RYMA 3SKMA 4D9LL 5A3ID 4HS6B 3QG6A 5L0QC 2PABA 4JG1L 4UAOB 4ZMNA 3NAAH 2WQSA 5IFJB 3VWJA 1FIGL 1GS8A 5IMLB 1FPTL 4NC2B 3MRRA 4P2QA 5D1QD 3RVTD 5ICUA 4N1EA 1BJMA 1WZ1H 5C0AD 1LP9E 2E59A 3QEHB 1A6TB 1OW0C 1WBZB 3MLTA 3QUXD 1ZHNB 1HE7A 3AABA 5D2LE 5DHDA 2GBVA 2V8MA 3QJHA 4AEEA 3TA3A 3VFGH 4E41D 1SFDA 5BO1H 1T22A 2R2EA 43CAA 1MIML 4R0LA 3VI3F 2DB8A 4B41A 3VGAC 2FYVA 5KAQF 5F96L 4XPTL 5F88A 5GS1C 1NBVH 2CJUH 4U2YA 5IEKB 2HJFA 4OVUA 3P73B 4X99A 4YEEA 3SE3C 4Z7AA 3VNZA 1MG3C 4RESB 2Q9OA 3N85H 2P5EE 1V05A 3VXNA 1YEJH 3II2A 3P40A 5KSBA 5EOQH 4G80B 2IBZX 2ZZUT 1WWWX 2AJVH 4J3OF 4M6NH 3U46A 3MC0A 4R0LB 3WYRA 4D2NA 1UATA 2CKBB 3OG4B 2QDVA 2WQWA 3KR3H 5GISL 3S37L 2EE3A 3SY0A 4TXVB 5D1ZI 4QJ5B 4TL4A 5DD6B 5EBMA 5TGBA 3T0EA 2WSKA 3GS7A 3OAUH 1IGIH 1NPJA 2DYPD 4LHUA 4P5SA 4ZT1A 2XFXB 3QAZB 3NPSC 5F93C 2WBWB 3FAXA 1TZ8A 3OKYA 5DJ2B 3CDYA 3VX1A 4N28A 3RWJA 2HKAA 3SOTA 1NUNB 4GMSH 1RZFL 2QR0A 3SQBB 4ZOCA 4K3DL 5K9KB 2UZIH 3D3VE 4BSVB 1E9PA 2A9DA 2BY1A 3DROA 5JO5A 1LL1A 4MAYB 3E3QC 5FO8B 3ZKMD 1TNNA 2PO6B 43C9A 1GW6A 3FO1A 4IEFB 1A1OA 1R3KB 2HFFA 3KYOB 4EI5B 3WEOA 4R26L 5DGQA 3BIBX 4G8FA 5AZUA 5ESQA 1R3HA 3BD5A 2QR0B 1OVZA 1YJDH 1WS7A 1MFCL 1J5HA 5AL0A 4V2CB 4Y1AE 5KS9F 1Q1JL 2YZ8A 4ZMVA 3KYNA 1Q9OA 1SDDA 2H0EA 4NQCE 2NW3B 3OSKA 2AMGA 4YE4L 1COBA 2PO6A 1CFMA 1PNDA 3FBQA 4IRSC 1RHHB 2P4AB 4IGBC 3W81A 1NOFA 1EUTA 5I8CB 1M7DA 4AE0A 4MXVE 2EKSB 4PB0H 2CGZA 4N0CC 3CDZA 3NA9H 4X6DA 2VR9A 3MXWL 2ZSWB 4QTHA 4IBQA 2VDOB 3S36H 2XYCA 3BAJA 5TH2B 1G1OA 4MZRA 3Q48A 3IGAA 1SBSL 1XZWA 1ZDSA 3CFCH 2DLEA 3OPUA 1SGKA 4QRBA 3UZQA 3F7KA 3WHXA 2NX5B 1Y6KR 2K8QA 1AO7E 4WHYH 4ZSOB 1MJUH 3K6SA 3RZCA 4M62H 3KPRD 3UBFA 3ULUH 4QRFA 2IOIA 2UXGA 4DAGL 3FQUA 4M6OL 2YHGA 5GRJH 3L2LA 4LF3A 4FQCH 1BOGA 2VDOL 2X70A 1C1EH 1EDYA 3HKFA 4Q4EA 4HOXA 5H94B 4G8IB 2D7NA 4H2CA 3MX0B 5G4NA 1XZ0B 4RGNE 2KLTA 5CCHE 5C2BH 3MUJA 4YZFF 3TNMB 2ITCA 5ALCH 4PJEB 5HDOA 1XQ4A 3HFFA 2Z31D 5EC1A 2YPKB 2IGFL 3H2WA 1LO4H 4ZAKA 5I0VA 1ZK5A 4WCYL 1OAZH 1OCOB 2F53A 2YUWA 4DN4H 1WHOA 1UH4A 3MU3A 5JW5A 2VDPH 5F1SA 2F54E 3WMPA 5KVGH 4OVVA 5JIHA 1SM3L 3CVHA 3H4HA 4LCIL 5FV1L 1F3RB 1P53A 1WFNA 3EXJA 3H9SB 4OJFL 2FTAA 5DVNA 4NQCB 3TH2T 2HA1A 4OCXL 5FYLL 5KOVC 3QQ3B 4WK2B 1BMWA 4QHKI 3P9LA 3V4PH 4NQSB 2N1KA 3EFOA 3TN0C 3P4NA 3HFML 4BFFA 2AEWA 4MJIE 1U8QA 5LQBL 5F9JA 4YHZH 3D0VA 4LLUA 2WGXA 4U1IB 3MR9B 4L3EA 5GGVH 4YHYB 4XBGB 5KBKA 1E5UI 2DQHH 1RZJL 1NBYB 1AY1L 4Q6IB 3QPQC 2NY5H 3B2MA 1ULVA 4EIBA 1IZJA 5BRZA 5DHEA 1DANU 3MRCB 3PL6A 4JHVA 3KPTA 1NJ9B 2ISDA 4PJBF 5LBSH 2GUOA 1Q9KB 4QRRD 1KJMA 3KPRB 4UYPA 1HQ4A 1RU9L 3HPLA 3NVQA 5JPNB 3N55A 2XG5A 4QO1B 4ENZA 4OTXH 1MHEA 2OMTB 1M05A 2JI2A 4HU8A 2OYLA 4C4BA 2FEDC 2A83B 1IFGA 1U3YA 3ZSSA 2DJ4A 3FCUB 3RP1A 5EDSA 5FYLE 1LMKA 4FQHB 5E8EB 1IBYA 3RIFK 2FX8H 4L5FL 3P11L 2ZXBA 3JWNE 4KQ0A 3ZMRA 4XCNB 3AITA 1CF8L 4X5LA 5EZPA 3U0WH 1T5XB 2Z0UA 2NY6C 3V0EA 4JFPB 1B9ZA 1PFCA 3K71B 4AYSA 1P4IL 4AMXA 2IAND 4YDVB 3SGJC 4IGBA 1PEWA 4JM4L 5E94B 2YUXA 5K39A 2VZ1A 5D72H 3IFOA 3WEXB 4OLWL 1Q0YH 4NQDA 1T83A 5IHZA 2Y0SA 1MVFA 2Z4TA 1U8HB 4U1KA 1I3RA 4N8CL 1DQQB 5GRUL 1HI6A 2G2PA 5J12C 3HG3A 5G55A 5AB2A 1E40A 4Y4HD 2UY6B 2E7MA 2PWGA 1DDTA 1GSKA 4OJCA 4Z3GA 4LCCC 3M17A 2WWKT 3P2DA 1MY7A 4H1LA 3CZFB 2DJMA 3QA3B 3KJ6L 5CP3H 1OARL 2B0SH 3FJTA 4XXCA 5D96B 5JOPE 1U8HA 2VUYA 4R97B 4OF3A 3E6FB 4U1KB 1MHHB 4OT1H 5BZDA 5EA0L 3SDCD 3W0WE 5B4MC 3HC3H 4H40A 2YPVH 2BLFA 1RULH 2EDHA 3P4OB 2HTKD 4PJCE 3D39B 3GBNL 1GZQB 1TJGL 1MG2C 4FQXC 1GPOL 4YJZL 1DQVA 3HUJF 4M6MH 4PY8J 1RZ7L 2DI8A 5LDSA 4DK6A 2Z1KA 4NLHA 5CP7B 4HS3A 4I0PB 1JZIA 5C9JB 1G7QB 3EJSA 2P26A 3MRHB 3BI9X 4XNBA 1RQ5A 4TQEL 4P48A 5EPMB 1H5BC 4FA6A 3VJ6A 1FO0A 1MFVA 4K8RD 5HHOA 2NLJA 2ZOLA 3DARA 1UJTA 3O9WA 1I82A 4JM2F 5GJTH 5C0ND 2FR4B 3IDNB 4MYPA 2AJ3B 5IROC 4BWWA 4C55A 4WHYG 5CBEA 3H0TB 5IVNA 3GBLA 4F5CA 2DQUL 1NAMB 1WS8A 4BZ1A 3GQFA 1T21A 4EMZA 1QMUA 2YO3A 1NFDB 4TYUA 2VLJE 4NZFA 4PJIF 3IKKA 1TLMA 1VB9A 4PRPA 5DD3L 2K1MA 2YAFA 1OK8A 3W37A 2F19H 4MAUL 1M42A 3A4AA 3TO4B 4HXAH 1YQ2A 4ZTOL 1ECZA 2BWQA 5ABAA 5EORH 2X4TA 4TVPD 2WZAA 1JYNA 3IDNA 4Z7VE 1YPZE 4GINA 5AQ0A 2D3VA 3LKSA 3GJEA 1U6AH 2ROXA 4IOFC 4ATWA 1KYFA 4AQEB 4FLQA 2GJJA 4OCSH 2AVGA 1ZE3C 1EFXB 2EYTB 5C08E 2GT9A 3DHUA 3ISRA 4HKXA 4I2XE 5CJBA 4HUMB 3NABL 4Y2DD 4LL9A 1AQHA 1BXXA 4TUKL 2AEPH 3GMOA 1VSCA 5I73C 1RJYA 4NI6A 3RTQA 2H41A 3S6CA 4Z77B 5INCA 2AQRA 3SCMD 2MH4A 4TSAH 2FJHB 1N9PA 4QXTB 4I9WD 3GUFA 4Y7MA 4TRPL 3DJSA 1Y07A 5I6KA 3C12A 4Y16B 3U7WL 3RWEA 2OL3H 4X7DC 3QZWA 1HZKA 4XMPH 1ONQB 1OM9A 4E9TA 3PHQA 3DTXB 3D33A 1L6PA 3WFEL 3SBPA 4P4RA 1MCWM 1C5CL 2VE6A 1RJZB 3KHOA 1WRFA 4TUJB 5D2NA 4DPBX 3LXBA 1I9JH 2PPDA 3OX8B 1VPOH 1MNNA 3VTMA 2R1WA 3U1PA 4NO2A 4HUVA 4HEPA 4NERA 4TNWK 3S35X 2B16A 4KY2A 4CVUA 4OZGA 4BWTA 3KLAB 5PAZA 1A9EB 3V6BR 5HDLA 2DWDB 2QVKA 1OPOA 3CDCA 3T4AA 1ND0A 3UBGA 3N41F 3N44F 5B3JE 5DEGB 1ZPUA 1ROCA 4RBPK 5MEOA 1E3FA 4GPVA 1R3LA 5H37A 2I85A 2KMWA 5DLLA 2UZXB 3OVUB 4Y5XB 4EUPB 4RGOH 5HVWA 1FVDB 4NWUH 4FNQA 3SEPA 2APFA 2QFRA 3UP1A 3MLWL 4KXCA 5I0XA 3RB5A 4XRCB 4GIAA 2QFPA 4YPJA 1H0DB 2NYZA 5LBVA 4MYWB 5LN4A 4KFZC 4P9ML 3EYFA 4D9RE 5CJXA 1U0QA 5FA4A 1OB0A 3IVKA 3UBXG 4QRTB 3I6KA 5C0DA 5CUSH 2D73A 2F5AH 4QGYA 1QLRA 3BVTA 5IOKA 2WP3T 5EF2A 4YHOH 1G6RA 2O61B 4KTYA 4HOZA 4ZYKA 3SGEI 1MY5A 2V2XA 3FT3A 2Q8AH 3LRMA 3Q01A 3TYFA 1JV2B 1NDGA 2DLTA 3GSVB 2J2ZA 1MWAL 5DZ9A 1F90L 3RUGF 4NO0D 4Z7WA 2ESVB 5GRYA 1WP6A 4Z7QF 1UZ8B 4O4YH 4F93B 2GG1A 5DS8A 1NC4B 2YAEA 5E9DA 5JNYB 5FYKH 1AMYA 3SPCA 1I7ZA 1YEWA 1KWGA 4DZBA 2UY7B 1CQYA 4U1NA 3S5LG 2O61A 2XPYA 5D4JA 3S5YA 3GRBA 3FCGA 1BBDL 3JWNH 4HUWA 1E4XI 3GSXA 1K8DA 5FGBC 4OFVA 3WL9B 2C5DC 4NZUH 3T2NL 1QFOA 2VXQA 2YRZA 4M4RB 4XPGL 3D39E 5HI3C 3CAFA 4IRJA 1JIBA 4RRPM 2EKJA 5AVUB 3L1FA 1YEFH 2Q10A 3D30A 1AGCA 4HJSA 4JPWL 1DSFH 4P57A 1T0PB 1X5KA 3ARFC 1ZDQA 2CO4A 4AXWA 4R4ND 2E9BA 5FYKL 4HX1A 1QLFA 4YIQB 3P4NB 3JV5A 1ZTXE 2A6JA 3VYPA 4HH8A 4JFDB 2C9SA 5I75C 5IMLA 1WFMA 3DKHA 4RMQA 2XQYA 5MENE 4J27A 2IG2L 3QCTL 1FWXA 3SDXF 4L4TD 4LSQL 4NN5C 2FJGB 4YGVB 1S78D 2W60B 3MLVL 1MLCB 5EF0A 2ADIB 4YPGA 1XH0A 1I3VA 2XWEA 3BPOC 1PEZA 4YHIA 1DBJL 1AD9A 4XNQB 4UZUA 1HSAB 2ICWA 4F8TA 2Q5BA 1I9IH 2J5LC 4K55A 1W16A 1QLFB 1N0XL 1Q9KA 4G8GE 4YIQA 3ZHNA 2HH0H 4LCCB 3AY4C 2QMJA 2W5PA 3B2PA 2N0MA 3NFNA 5CD5C 4GXUM 4KK8D 4P8QA 5HHNB 2FYYB 1U8MB 3LZLA 4XPGH 3C60B 1KEGH 4N20A 5I1EH 4XT1C 2ICEC 5EZOH 2NSQA 3LH2L 1E6OL 1GXEA 3TJHD 1JNHB 1ZPLA 4OUOA 2OL3B 3QQDB 1YO4A 1T80A 1ZTXL 5JXEC 2F61A 3C60D 3FO2A 3SDCC 2VR7A 1CLZH 1ID5I 6CGTA 5HYIA 3T4YB 3T4AC 3FTGA 2FGWH 3W2DH 2VXUL 5DLML 2YARA 3TZVB 2VLLA 4TOYH 4JFQA 1A6VL 4O4YL 3CVBA 5E99L 3VWKD 4HCGA 1FCGA 5T1KB 3UMTA 3FFCA 3EOBB 5DVOA 4LBEB 3OAYK 4WI5A 3L7EB 2IPKB 3M88A 1WZMA 4RFNC 1KIPB 3L95A 2UZYA 4GLRH 1TTRA 2CDFA 4X5RA 5JIDA 4PJXF 3W0WD 4BD4A 2HFGH 1XF2A 1PZAA 2ZUVA 1NPNA 3WNOA 3KYMA 2LVCA 3FK3A 3TCLA 1EEZA 3OHXC 4IKLA 4L1TA 4L3CA 4Y5VA 2VDMH 1FVCB 3CZLA 3GK8H 4A38A 43C9B 1YNKL 4XCCL 4JY6B 1R24A 5D7IF 3JV4A 4XMUA 3GM0A 2HVKA 5E6RB 2X6UA 3HNVH 2ZXQA 3TH3T 4OD1H 1S5HB 3QR0A 5E2VH 2QELA 4LASL 1L9QA 1N67A 2GT9B 3W9DA 4ORGB 3CJJA 5BZDB 5DR5L 2N3JA 1ASPA 1U33A 4GXVL 4JZJC 4LKXA 2OQJB 4DGYL 1HH6A 3SYPA 5DYOB 5LGJA 3BMVA 3KPOB 4MD0A 4OJAA 3KLKA 4NPJA 2QDWA 4HFUH 2VN6A 2CLZB 4QKXB 3KAAA 1D5IH 4Z7UF 1AVAA 5I8CA 3N50A 2XKSA 1J1XH 2Y1AA 1HHIA 2YWZA 4MNQD 2P5EB 2EKSA 3LS4L 4JFHE 5CP3A 4MKTA 4QT5B 4R4FH 1QPPA 4A63A 4DF9A 1BF8A 1JV5A 4XP1L 4TUJA 3VFOA 4FCHA 4GY4A 1IE4A 4PIBA 4ZI8A 4Y2NA 1HHGA 2G5BA 4L8SB 4ZRGA 4PM1A 3VXMA 3ZRCC 3RVTC 3SKNB 1RP8A 2XZQH 4GMTL 3K6DA 2WWMC 1D7DA 3PE9A 1UVQB 3ILPA 5LJYH 4XCYA 5EBWA 3KS0J 3IJSB 3D8MA 5B1CA 5DJAA 3KBFA 3TGXA 3ZKQD 4LDCA 3NPZB 3LPPA 1OHZA 2IF7A 1UUSA 2OI9C 3I6LD 4ODSH 4FZEH 3T71A 1KULA 1SF3A 3RTLA 3CC1A 5DUMH 4YBQD 3GSNB 2CRMA 4ZUTB 3FQWA 4G6JL 2W07B 3C8HA 4G8GB 5KVEE 2QGBA 1H8NA 4XP6L 3T0EB 5DVPA 1P84J 4DEWA 1D5IL 3VUAA 1U6AL 3M7OA 4FLHA 5AUMB 5GHWL 1ZSHA 4E41E 3Q1EA 5AD0A 3QFJE 4WW2A 1GTFA 1M56B 1DEDA 2D31A 1TTUA 2HLAA 2DF3A 2ICEA 1OXYA 4HIIB 1OGTA 3WENA 4W4NA 4M7KL 3FHEA 1DQIA 1DFBL 2F19L 3CBKB 3DUSA 4OCRL 3VQ2C 1WIOA 5DR5H 2EC8A 4P3DA 1JMXA 3EO0B 1KB5B 2CR0A 3MREA 4K71C 1KJ2L 1Z5YD 3APDA 3ULUD 1ZK9A 5IQNA 3NGBB 4OIIL 1E50A 4EAEA 5DD0H 1F4YL 2PCPA 3FPXA 5E56A 1RPKA 1Z9SB 4XHQA 3ILQC 1AXTL 4CC0A 3TA3B 2KDGA 3GK8L 2D31B 3OX8A 2XRAL 4C56B 3BFQG 4GIPD 4QLRA 5MEPB 3QO1A 3ZKMC 2JIXA 1HC1A 5ID0B 5L2KE 1XMEB 2ZF8A 3ARTA 4GG6E 2J8HA 3P2TA 4D94A 5JZ7C 1FE8L 2NYYD 3NSJA 1NM9A 4NYLA 1GRWA 1IE5A 4TQ8A 4XR8C 2XKUA 4LPYA 4DKTA 1UGKA 2HKFH 3INUL 2FSEB 2BDNH 4W9LC 2ZOKA 4GH7B 3W2DL 2Q76B 2DYPA 1A7NL 1OTTC 3L3OA 1KCUL 1CLZL 4TUOB 5IB1A 4XH2A 1I1AC 4I3GA 4FXGB 3F58L 2GI7A 1KLGA 4ZMYA 1FBIL 2IANA 3NJKA 4OV5B 1JPEA 3GMNA 3RURA 3E1F1 4FAAB 5ETUA 3K6SB 1XD0A 2MQ3A 3NCEB 2OYMA 4GEJA 2CALA 4HWEH 3PP3K 4LLVB 4MWFA 4E5XB 4N6RB 5E1IA 1RD6A 4J3SA 5JUEL 1CDUA 2B39A 4M5TA 2YUVA 2R2CA 4CJ0A 4NP4H 2P8LA 5GIRA 5L7XH 1DCEA 1T04B 1I1RA 4ZUVA 5SWSA 2ZAIA 3AB0B 3ZN6A 5C0BA 3N40F 2VDKH 4ZMWA 1FYTD 1INQB 1S78C 4NFBA 1CDHA 4Z0XA 2DKUA 5IBTH 2WQAA 3Q5YA 4LQ1A 4GG8B 4A6YH 4NN7C 5SX4I 1MNUL 4J6RL 3L1GA 3Q2LA 4JM2A 4U1JB 4HJGB 4PVMA 3NJNA 4KK8C 5F7NC 3Q8AA 4TNEA 1KG0B 3FONA 1AGFB 4HF5H 1E0OB 4BUGA 4P4KC 3U9WA 4F7KA 3MNVB 1TG8A 5EEVA 1RZQA 1LK3H 3EBGA 5A43C 4JFQB 3LD8C 4ZQTA 2WKOA 4QOKB 2VDRL 3S37X 1NFDE 1QI5A 5JXED 3V5KB 4UAOC 1X5MA 4QY8A 1TQWA 4JO4H 4OSUL 4DGWC 3Q06A 5D2NC 2C1PA 3FT9A 4URKA 1BBDH 4HPHA 4AMWA 5AW1B 4MQXC 3DHMA 4ZTPH 5LCVH 3QH3B 2LAAA 4P5KB 5DK0B 4G43B 1EO8L 2A2QT 2CJ3A 3FZUC 2J44A 3GBEA 1FZJB 2VO8A 2EDKA 1TENA 2NXZC 3OXSA 3DK2A 4P3CL 4G9DB 5D55A 5ADPL 1HNYA 4HKZA 4NS0A 4NRYA 2WTRA 3GNMH 1KXTB 3DHPA 3WNIA 1RJLA 3ULVD 1P4LA 2VDMB 3NA4A 4IJ3B 3BZ4B 2KS0A 2CUMA 1ADQA 3O3EB 1PD1A 5FYLH 4G8GD 1MHEB 3HNTL 1MWAA 4NDMB 1JCVA 4YNYA 3CUPA 1CFVH 1HI6B 2ZNWA 4Q9RH 3UJIH 4PJCB 5I0ZA 2GB2A 3AS3A 1E5AA 3KPOA 2HJKB 2F53D 5ACLA 1XGPA 4HLZG 3VXOA 2MNUA 2Y06L 4F7PA 2IGFH 4AQEA 5CZXC 1GMIA 4QAMB 1GZPB 1SXZA 1UASA 3AVEA 4XPBH 1LEIB 4KMTH 3FRPG 2WHVA 2X4RB 3TTYA 3L3KA 1DR9A 4PVNA 5JHLA 1FIEA 3FXIC 1AQKL 1DQML 4MFHA 4QRRB 5GZNA 3TZVA 4FA7B 2OMBA 3ZDYE 5I6NA 4WO4C 2PTVA 3CPLA 3OWEA 1E8WA 3B6SB 1A7RL 3RIKA 4PGCB 3LIZA 4NKMA 2XWRA 2Z6FA 32C2B 1NCDH 1ZT7B 2NY1B 2FJHA 2P5PA 2YQBA 3L3OC 5EEZA 5D5MF 4JHWL 4PRAB 1SJEA 5IVXF 3DNKA 3E2HB 1BFOA 1T0MB 2BHYA 1J8KA 2AQPA 3U0TA 1OHQA 1QG3A 4O2EB 3G5YB 5DFWH 3GB7A 4H0IA 3L3KB 4Y5VB 1R17A 2WVUA 1ZT4A 4P2YA 2F9BT 1YNLH 3CFCL 1SBSH 1M9WA 4P4RB 1ZLSL 1MCPH 1X7TA 3TTSA 2CDEA 5AG9A 2YRBA 3T0DA 1MEXH 1QSED 3EZJB 4PJ6A 4MX7A 4WTZG 3RI5K 5KVEL 1FUNA 3ESMA 5FHAL 4NENB 1QRNE 2V7HB 3BIAX 4Q6KA 3BFWA 4NC1E 4NKOA 4G6KL 4QHNB 4JQXA 2UZPA 2KUTA 3G5YA 1Y0LA 2Y2TA 5HHXH 1JXJA 4EKXA 4K5NA 4DTGL 3B1TA 4YR6A 5HJBA 2L7QA 2VLME 1O5DT 1CICB 1BFSA 4LRNH 1KTKE 2WXGA 4XNXH 4UU9A 3BDXA 4L9DA 2DTML 1HAWA 2Y5QA 5HHOB 1S7RB 2OMXB 1QSVA 3O4OC 2P1YA 1UKSA 2JLPA 3BGFB 3GF8A 2AZAA 4FQXD 3RL2A 3RPKA 4WI9A 3ZRFC 4F58L 2YBRB 3DK0A 4OKVA 4Z18A 1W72H 2DI9A 2AK1L 3H3KA 3GRWA 3F7VA 4E0RB 1CXHA 1NFDA 3WGVB 3ARSA 5KZCB 3FB5B 4QJ4B 4XWOD 3AM8A 3QUGA 3OZ9L 4PJFF 2YC1B 4MDRA 3V0DA 5H4ZA 2MSPA 2P7TB 1E30A 3MRNA 2LFEA 5BS0B 3VWJB 5F8QC 4NJAH 3RX8A 2X1PA 3QYNA 5DD3H 1PG7X 1I8KB 2DYRB 4TVPL 2BOCB 2AGJL 3L6FB 4IOIA 4Z7VF 3U6RA 2FT6A 5DJAB 4L37B 4MHHI 3BQUB 4PR5A 4YSSA 1IC4H 4H1LB 1JGLH 3OAUL 4AQ1B 3ESNA 4AW4A 1KXVA 2FNBA 3CFNA 1DJSA 1A8JH 4WGKA 2HVJB 1TCMA 2Z1PA 2J43A 7CGTA 5JZ7D 1F58L 3MBEA 2MRYA 4N0UE 3QS2A 1MCFA 5BUPA 1KYAA 2VISB 3N85L 1JWMA 2UXFA 1QTPA 2MNJB 2JQMA 3RX5A 1KIRB 2A99A 2ZXWB 3GBNH 4YLCA 4NAJA 3WIFB 5KSBB 1D7BA 4RAVA 2YPVL 4Y2DC 3HN3A 2DLHA 4FQ2H 4K9JA 2QPSA 5D1XE 5AYQA 4XNAA 1URLA 3PHQB 4G7RB 3HE6A 4X9FA 2YR3A 1IEAB 4FKHA 1OARH 4UANA 3V8CA 3S88L 5FO7B 4GRMB 5D70L 1U3ZA 1FSKC 4XP5L 5HHOE 3GSUA 4HYTB 3K8LA 1ERNA 2H8PB 1KB9J 4XOAA 2C7UA 2ODIA 2BRQA 3EGSB 2NSMA 3KYKH 5H4YA 3V0WL 5LDUA 2H1XA 1GYAA 2PWEA 5LNEA 3U6XA 1O75A 1AGBB 1TJIL 3NAAL 1VFOA 2P49B 4N8CH 1A2YB 1MAML 1MW2A 4D9LH 4BSWA 4OLUL 4XMTA 3NJVA 1A4KA 4F7EB 1MCNA 3LZRA 4HWNA 4KWUA 3DX9B 5EIVA 3O6FA 5F7LB 3PPSA 2JJUA 1B90A 1XGUB 4AEHH 2VIRB 3O45B 4BK4A 4DP6X 5IOPA 1ZSDB 4AX3A 2YSSB 3EOTH 1YCSA 1EBPA 3FF8A 3QORB 4OH2A 5FGCE 1P5UC 1TJHL 2FX8L 3MO1A 1I4FA 4S10A 4F3FB 5INCB 4BSWB 4FOMA 5DJCA 4W6YB 2NX5E 1KJ2B 4M1DL 3H9SA 3IRCA 5DRZB 5FGCB 5C0EB 3BH9B 4OTXL 4I5BB 5F0MB 2J8UB 2I26N 3MRGA 4NFDA 2HXAA 4MJ4A 1OF2B 4FNLH 5EO1B 3T2LA 3BZ4A 1U92B 4ZZKA 1A3LH 1D9KA 3RBSA 2GY5A 2AK4E 2NNXA 1NCIA 4PGZA 2ZWLT 3T8XA 3ULVE 5HI4D 2A4ZA 3FZUD 4Z3JA 1JJUA 3RUGB 2NXZD 3DV4B 5ISZD 1F1DA 3WE1A 2B1AL 3G6DH 1NC2B 5CGYD 1J8HE 2W65A 3FFDB 4MD5A 3WG7B 4KO6A 1GMEA 3TNNB 1DO5A 3J7HA 1KGIA 4L9LB 3VGEA 3O8XD 3QS3A 3NQIA 5AAWC 3AROA 1X44A 2B15A 3O81A 1GCYA 5E6IB 4HAKA 4KTDH 4HG4J 4YHNB 3S9DB 3SKJH 3HI6L 3BVXA 3V4PL 1NIEA 3DECA 1QKZH 5CIPA 4HWBL 3JTSB 1BBJB 2F7OA 3S8GB 1EIBA 2Y3AA 2QMKA 3VXSB 2FQGA 1TQTA 2DRUA 2P5WD 3F05A 1TDQA 5BVPH 2XN9B 1KJVA 4LHQB 4LSPL 2HPOA 4OB5L 4PJGE 1OAZL 1JK8A 1YYLL 2H4EA 3PF2A 3RWFB 4B50A 3A22A 1ZVSB 2YPKA 4XCNA 4D7PA 4HAGA 1Q0EA 3IJ7A 4BQ9A 1WC7B 1ZLWK 1LEGA 1MCKA 1OQOA 4O2EA 5C2BL 1FSKB 3SOBL 1OT4A 5IESH 3TV3H 5KTEH 3ZQWA 3UGXA 3ARFD 3QCUL 5CBAB 1T5WA 2DI7A 1JXGA 1XVSA 4MVBD 2BVQA 5E9AA 5IP4A 4OZFG 7PCYA 2PPFA 2E47A 2VN7A 4FQCL 4Y2DA 5F7HA 4DCQB 3LKNA 1WA1X 2DM7A 4M6OH 4I0CC 2I9TB 5E8NB 2QQLH 4KJQD 4U6YA 4XC1L 4YSCA 2WKGA 2EVHA 4M62L 1AZVA 5JNYA 4Y4KC 4HP5A 3QCVH 2WMPB 3KPSE 4HWZB 2VZSA 2BSSB 1I31A 1OGAA 1RV6X 4UDTA 3BLPX 4EIZC 5IB2A 5JW4R 3RGVD 1ETB1 2AERT 1SEBB 1KEML 3VB8A 1NCAH 3T2OA 1V7MH 2CHWA 3QI9C 3JTTB 4Z5RA 1MHHA 2CU9A 3NA9L 5I74B 3MCLH 4W9FC 3S48A 4GKOA 5DZLA 2ZAHA 5EU6D 1DQDH 2YOCA 5GRVL 3DX3A