4ICXA

N-terminal c2 domain of human cep120
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
133
structure length
133
Chain Sequence
SKSDQLLIVVSILEGRHFPKRPKHMLVVEAKFDGEQLATDPVDHTDQPEFATELAWEIDRKALHQHRLQRTPIKLQCFALDPVTSAKETIGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKSEIQISIALETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centrosomal protein of 120 kDa
publication title N-terminal C2 domain tandem of human CEP120 shows lipid binding properties
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 24
structure length 133
sequence length 133
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4icxA00
1W16A 4BFRA 2CJSA 2NSQA 3F01A 1RLWA 1RH8A 3ML9A 1DQVA 2CHDA 2ENPA 2FJUB 1TJMA 4F1SA 4HLEA 2CM6A 3RPBA 1WFJA 3PFQA 2A4ZA 5CCHE 1BDYA 4BGDA 3GPEA 2CM5A 3TWYA 1DSYA 2DMHA 2WXGA 2WXHA 3DPDA 4GB9A 4TS6A 4NPJA 4WWNA 2WXJA 3ENEA 3ML8A 4PS8A 4JPSA 1GMIA 2K3HA 4IQHA 1RSYA 4OVUA 2A5UA 5EDSA 5G2NA 2WXOA 1E90A 1YRKA 4QJ4B 4NS0A 4L1LA 3F04A 3KWUA 2NQ3A 2CHZA 3FBKA 3MJWA 4WAFA 4EZJA 5JHBA 3B7YA 3CSTA 3L16A 5H4ZA 4L1BA 4PS7A 4ANWA 4FULA 2B3RA 3NZSA 2QZ5A 3QK0A 3QR0A 4L2YA 5H4YA 3QR1A 1CJYA 3P2BA 4FLHA 2K45A 2LHAA 2Y3AA 1E7VA 3DBSA 4ICWA 4WWOA 3KWTA 3R7RA 2WXIA 2WXMA 3NZUA 2ZKMX 2X38A 3ZVVA 1K5WA 1DJWA 3M7FB 5JHAA 2NCEA 1E8YA 4XE0A 5KJ7E 2ENQA 4ANVA 2K4AA 3OAWA 3SD5A 3TL5A 4TUUA 2UZPA 2Z0UA 3R7QA 4MJJA 5G55A 4Y1TA 4IHBA 2WXFA 1DJZA 4FA6A 4G11A 4LDCA 3L54A 3HHMA 4KZCA 4F93B 2CHXA 4QAMB 3PREA 3QAQA 5T8IA 2CHWA 4V11A 1QASA 3PYCA 1DJGA 2EP6A 3TJPA 3LJ3A 1W15A 3PRZA 3PS6A 4QJ5B 2KI6A 2YRBA 3APDA 3L17A 4PS3A 1QATA 4KITB 4XZ4A 1DJYA 3F00A 2FK9A 3FDWA 2V4LA 3L9BA 3ZW3A 3L08A 4TV3A 4HVBA 1E8XA 4ICXA 3APCA 3JZYA 3L13A 4A55A 4F92B 4WWPA 4F91B 2R83A 1UOWA 2WXKA 4XX5A 2D8KA 1HE8A 1UOVA 3W56A 2K8MA 4WEEA 2N1TE 4FJYA 3ZIMA 1DJIA 1TJXA 4EZKA 4LT7A 3L4CA 2WXPA 3HIZA 4LCVA 4AOFA 4FHJA 3S2AA 1UGKA 2WXQA 1A25A 2WXNA 2YOAA 3NSJA 3RDJA 4L23A 2ENJA 1E8WA 3IM1A 4EZLA 3W57A 4KZ0A 1BYNA 2CJTA 2DMGA 1E8ZA 1DJHA 4ANXA 4FADA 4NPKA 1WFMA 4FJZA 2WXRA 2Q3XA 1E7UA 2RD0A 4NP9A 3T8MA 1DJXA 2JQZA 2ISDA 4GNKB 2Q0ZX 3APFA 4OVVA 1BCIA 3HN8A 3CSFA 3QJZA 5CCJA 2QZQA 4AJWA 2BWQA 4URKA 4FHKA 4J6IA 3OHMB 1V27A 2WXLA 4ANUA 4Y1SA 4DNLA 3F05A 3IBEA 5CCGE 3QARA 3N5AA 4DK5A 4QJ3B
chains in the Genus database with same CATH superfamily
1DZ0A 1X5MA 2NY1B 1KJ3L 4U49A 5DHXB 2RMNA 2GVYA 3GIVA 1ES0A 3QA3A 4HQQL 4YXKH 5KUMA 4UANA 1KN2H 1LVEA 4A2MA 4XWOD 1G4MA 4RA3A 4TUJA 4WFFD 8CGTA 3NN8A 1P7QD 2P3YA 3BDYL 3UMNA 2ZE0A 4KRNA 3ML8A 1ZWIA 4CMHB 5A16B 4PBXA 2NTSP 4YBQD 1GCYA 3I9GH 1KCUL 4NN5B 5CBAB 1JZIA 2VR5A 5DHVA 3AC0A 2VM3A 4WFHE 1YAZA 1FLRH 4IBWA 1AD9A 3HMXA 3I9AA 3RNKB 2ERJB 4ODHH 4YC2B 1DDTA 4H26B 1MCOH 2FDBP 4G3YH 1S78D 4HWUA 3QAZB 4X7EC 1BYPA 4JDTL 5DRZB 3ZYZA 4XMKH 2FGWH 2V33A 3E0GA 1ES0B 3QA3B 2OMYA 5CSGA 3RU8L 1EFXB 4IKNA 5E9NA 4DZ8B 4TUJB 3NN8B 1MWAA 2VXTL 2YLKA 5E6YA 2YQ3A 3N0PB 1TTRA 4QXUL 2X1XR 1ZWIB 3CGTA 4BK5A 4X9FA 4AITA 1R9FA 4FFYL 1TETH 1I1RA 4NZUH 2APSA 5I1KH 1BBDH 1N67A 1DVXA 1V3KA 3D6GA 3D85A 2JQMA 3BAWA 3CU7A 5GRWA 3TEZA 4ZD3L 4ELMF 2E5EA 3CVIH 1XH2A 4LPUA 2XY2A 2XLLA 5DHVB 4X6BA 3T2NL 3X17A 4QRRE 2XWTA 3WFZA 4PS4H 4D3CH 2AK4B 1LK2B 1GKEA 2E9WA 3GQFA 3NTCL 3GBMH 4I18A 4PJ7A 4ZK8A 5IT2H 1AD9B 4OM0H 5HJBA 4YHYC 2E4TA 1TQTA 1JF6A 4HJ1A 3WTSA 3QXUA 5IB2A 1JRHH 2X12A 4KVNH 4L0PB 4A63A 4BFJA 4DOHE 3FUDA 1WAEA 3GTVA 4FG6D 2BNRD 3SYPA 1T1YB 4TOYL 3MLXL 4ANKA 4L3EB 1EJ8A 3AG2B 3QZLA 4A7GF 1FPTL 4LU5H 2X87A 1UURA 3MUY1 1MF2H 1SOQA 2ZXDA 4IK6A 4JAMA 3F12A 4PMEA 4JO3H 4ZDHA 2DQIL 1DN0A 4JHBA 4K15A 4XPTL 2EDJA 3E9UA 4ZX6A 1KV3A 4ORZC 5HI3D 2GC7C 3D85B 3LX9A 2CXKA 2HUEA 3NRFA 4Q89A 1SBBA 4LCCC 1K4DA 2XWTB 1C8PA 2JKJA 2GCYA 5F1OB 4G1EA 4I18B 4PJ7B 5AZ2L 1II4E 4PREA 5DHDA 1MRFH 2KQMA 2XICA 3BUBA 3LZNA 4JO4L 3AY4A 4YEEA 4DFIA 5IB2B 3B9EA 5TQ2L 5BO1H 2E7DA 4XNDA 1XZWA 3N1QC 5CKGA 5J5EA 4Z7UA 1TJHH 3S35X 3VAEA 4F3FA 5C6PB 5HHMB 5ANMA 3GRWL 1CR9L 4XCNA 2ZUXA 3CMOL 4JAMB 4LEBA 5E8PA 5I73B 2WWNA 4ZDHB 1M71A 3F58H 1DN0B 1KENH 5E6ZA 1CTNA 4N9GA 4IBUA 2WP3O 32C2A 2BINA 5I1GL 4AGNA 4LSPH 3NJNA 4WI3A 1SN5A 4JPVH 5IFHH 3I84A 1AC6A 1K4DB 2EC9T 3MLPA 1GCFA 1U2CA 2GCYB 2A9AA 2AEWA 5L0QB 3GBNH 1EAOA 2O6CA 2M2DA 3VTMA 2YQGA 2NZIA 4PREB 1XTLA 1TT6A 2XZCH 1QABA 2B08A 4XBPA 1HOCA 4HCFA 3UC2A 3GSUA 4XNXL 2AV7A 3SO5A 4M02A 3FRPA 4BSWA 1MFVA 3PREA 3FQ1A 4CN4A 5A2LH 3TIEB 3AU0A 3LZLA 3FU5A 4DGVH 5B7MA 4HWNA 3L17A 5ANMB 3ZDXB 4P9HC 3ILDA 1KPVB 1DQIA 1T20A 1UM5L 4O02A 5E8PB 3SEPA 3UJTH 1M71B 3QWOB 3KS0J 4E41A 1I8LA 1F2XK 4N9GB 5CN2A 1GC1L 5DFTA 3L13A 32C2B 4YZFE 2PP7A 5E2JA 1UATA 3U0WH 1J05A 1FE8L 5KVGE 4LPCA 1BQKA 1VRSA 1R34A 1FHNA 1G7JA 3EYQC 4WKZA 3KH4A 4WEEA 5B1KA 1EUTA 3V6OE 3MV9A 4FTDA 4TVUA 2DQUL 2VR6A 4IRJD 3UPCA 4OZHA 3UBXG 3P0YH 1NLDL 4HXBL 1BIIA 1CDUA 2OP4L 1QEXA 3W3BA 1YECL 3GM0A 2HB0A 3SO3C 4RMSA 2R2HB 4IRSB 4TPRH 2EAEA 4XBPB 3CDZA 1AVAA 1TSHA 4FADA 2AV7B 2VDNL 1OAKH 1OF0A 2CBPA 4AVHA 1S9WA 4BSWB 1HEZA 3FRPG 4I3RL 1U9KA 5J12C 1DQLL 4O4YH 5I75B 1T20B 1QHOA 2PTTA 4O02B 4GH7B 1PZ2A 2A77L 4E41B 3AXLA 4JM2A 1Q0XH 4WEUD 4OFYD 3PABA 4PJEA 5I17B 5IVXA 3T77A 2PETA 4ANUA 3GMPA 1J05B 2F8IA 1NCAL 1XH1A 2X2YA 1G7JB 4N5ED 4YXHH 2I27N 1TQSA 3V0VA 3ZU8A 3MV9B 2CHDA 5LN4A 4OZHB 3AAZB 2DKMA 4N2KA 1T4WA 3KLSA 1QX1A 3QXDB 4PBWD 1ACYH 4JPWH 4M9PA 1WD9A 1WWCA 5KVEE 2FT8A 1FF5A 2O5YL 4FYTA 2ATAA 3GJFK 5DGRA 1JXJA 4NO2A 1GXEA 4UV7H 1SDAB 1Y07A 1S9WB 2XX0A 4WWKD 4YO0A 1KIUA 1T1ZA 4Y5VA 1E5YA 1GYVA 2HT3C 3HPJA 4DHLA 4Y5YA 1B3IA 2NY1D 4LVEA 2AS5M 4X8CA 3DOHA 4S10A 1TO5A 2PTTB 4MB5A 2DLFH 4P4RA 3D3VE 4JM4L 3AXLB 4CNIA 3UXFA 4JM2B 3P4NA 1QKZH 3MLRH 4PJEB 3RIKA 3T77B 3RFZC 3GMPB 3N3EA 4TNVF 3FFOA 2WVTA 3HI5H 1WGOA 2R9HC 3N43F 4PCSA 3V0VB 1M57B 2V17H 4GSRA 1M7DA 3BMVA 2J2ZA 3PQYE 1XSJA 3NEXA 3MJGX 3P3UA 4J27A 4L1DA 2V9TA 5A6LA 2EKJA 3OHXA 4NO2B 4TTDC 3GMNB 4KI5D 5EEVA 1KIUB 1T1ZB 2BM3A 3JWDL 1VB9A 3LY6A 4Y5VB 3HPJB 1AZBA 2KZWA 3KLLA 4Y5YB 3RJOA 4PJ6A 1XTMA 4K7FB 3WS3A 4CNIB 4B9JA 1EFXD 4E68A 1N64L 3EFOA 3P4NB 4HJ0C 4P46B 5E94A 5I1DB 3WAKA 4KHXH 1KYDA 3A6OA 1IAKA 3QI9D 5HDWA 3VWKA 1MW1A 1U8LA 3T0BA 1S3KH 3CAFA 3MLVL 4S1DD 3RTQC 2DLIA 2HFEA 2K8QA 3QJUB 3TO4C 5I30H 1M7DB 2J2ZB 3HCVB 4Y4KA 4HGMA 4DEWA 2EIBA 1YNTA 2OYKA 3V52H 1SNRA 4FQXC 2IBGA 4AYDC 5DWPA 4MLSA 1UB5A 2EJ1A 4LKXA 4M1GH 5BS0D 4XB8A 4BRVA 2FQFA 2AK4D 3OHXB 4AMXA 1AMXA 2G4EA 4ZODA 2X4PA 3CZLA 2Y07L 5K9QG 2CO7B 2CGRL 4RLDA 3D7PA 1KFGA 5HHNB 3SYQA 2CD0A 4FFZH 4YHKL 5D55A 1HHJA 1BPVA 2OJZH 2QDVA 3WS3B 4KFMA 5KWYC 1LP9A 3KLHD 2PCYA 3EFOB 2BZDA 3MKKA 2Y1AA 5E94B 1PF3A 4L3ED 5JIPA 1O5DT 1IAKB 4Q74A 1YN6A 5E00A 1U8LB 1JERA 1WA1X 1BDYA 5GJTH 3VH8B 1IKNC 2HFEB 2HFFA 4AYID 4NZTH 2ZOTA 3W11C 4Y4KB 2O5XH 1X5JA 1NOLA 5JUEH 1RZFH 2X1PA 2VL4A 3GC3A 5DF0A 1CDIA 1UB5B 4UIMA 4Q9RL 3A24A 5E03A 1IQDA 1ZS2A 2E4FA 2H47C 3K81A 5GGVL 1TEYA 2V2XA 1PD0A 4FI6A 4K23H 4NFCA 2I60L 1U8QA 1HHJB 1MW2A 2DMCA 5C7XL 4OLYL 3ZKSD 3FB8A 4JVPA 4FKHA 5SX5K 1ACXA 4OF5A 1D2PA 4RX4A 3TJHC 5CD5D 3DVNB 5HHMD 1NAMH 1YN6B 5E00B 3R7QA 2CO2A 2EXYD 4KY1L 3RGBA 2NY5L 2HFFB 3S8GB 4JFFE 4LOEA 1OK0A 5TE6L 4PUBH 3SE6A 4PGBA 2VDRL 2J6EL 5FOJA 3S37L 2Y36L 4UIMB 4PS3A 4JG0L 3RWGA 1TFPA 1YMME 3LEVL 1IQDB 2X7LB 1NMBH 4ICXA 2QPDB 1LMKA 1F5WA 1ZCRA 5FYKD 5CS7A 2PF6A 4KKLD 3CZJA 4GAAA 1HCYA 4QOKA 1D7DA 2D4FA 2FLRT 3SDDC 4ODTL 5CN3A 5I1HH 5MHSD 2OMWA 4QIRA 2GG1A 4ZZFA 3BRFA 4LRNL 2Q87A 4GRLC 2WK2A 1ZVHA 5L4FA 1V7MH 4M3HA 1RZ8A 3L1OH 4NZDA 5HI5C 3V6OC 1JGUH 3VXPA 1F6AA 2VSMB 1L9TA 3OJ2C 3ARDC 3T6VA 2ED7A 1N0LA 1RUAL 1DLFH 2VW6A 1U95B 5I1IH 1G1YA 4WCYL 1FZKA 3K1DA 4PCYA 2YC1A 4AIXA 3DWTA 5DZAA 2W65A 1H0DA 4PW4A 4AW4A 4DN4H 4OIAA 4BWTA 3U7YH 1NFAA 3OKOB 1A0QH 1NM9A 1VEMA 2WUCL 1A14L 1WYJA 4XC1L 4J3OC 5F3HB 2LU7A 2JLLA 1QRNA 3QUXC 4IIQC 4IRSD 4QOKB 3UCQA 3NP3A 1NLBL 3GHEL 2QVMA 5HJGA 1VPOH 3CVHL 4KAQL 4DUVA 1MREL 2OMWB 1QI4A 1MRDL 4J12A 2ICES 1NTDA 1G9HA 5AG8A 2PCPA 4LP4A 1H8LA 1FGVL 1RZ8B 3K6IA 1IJ9A 3PPEA 5BRZA 3VXPB 1F6AB 1JZ2A 5KVGH 3DETC 4TSAH 1RSYA 1N0LB 2E76C 1FZOA 2XWBA 1DBAL 4U7KA 1HL5A 4U1JA 1P69B 2VISA 3IE4A 4LCCB 1I7ZB 5FM8A 3BGMB 4PJ8C 4N2OA 3QQ9C 3QJQB 4QXTA 4U1SA 3MOAL 2W65B 1H0DB 4UIKH 3T04D 1KWGA 1CDBA 5L8LB 1XFPA 2F5AH 1FVDA 2RQ8A 1K8IB 2I7OA 1OOWA 3GRBA 4QWWD 3F8UB 4GBXD 3V5KA 1BHGA 1QRNB 2UYLA 1BJ8A 1MQKH 2ZZUT 4KX9A 2ZX7A 1RURL 4FNUA 1D2OA 1DVFD 2TSBA 3AS3A 3KPLA 4J3OH 4U1IA 3MSPA 2NNRA 3SQRA 4P49A 2EDQA 1NBCA 1RK1A 5CILL 2PCPB 4Y1TA 4OGAD 4ZUSA 3UIYA 3UG4A 3HNTH 5BRZB 2AJSL 2ZX6A 3R18A 4HA1A 3ZQ9A 4JM2D 1MIML 1FZOB 3O45B 1BWMA 3NFPA 4GMTL 4OD2A 3FHQA 5CR1A 2QJDA 1BM3L 4U1JB 1F3RB 4ZUUA 4I1PA 3OLEA 2X9XA 2QGDA 4QXTB 4CVWA 15C8L 2WBXA 2AF2A 3DXAA 3CFKA 1FVDB 2FLBT 5L2KE 5HI4D 4JFQA 5I23A 1WC7A 3UZQA 5IGXH 1TF4A 1CWVA 3JYBA 3Q48A 3FK3A 4ODBD 3S7GA 4QRPA 4RH4A 3V5KB 4TRPH 4U1LA 2UYLB 4LCVA 4AOFA 3V4PH 1YVLA 4WLCA 3WHE0 5K69A 3KPLB 4U1IB 4Z7WF 4KKAD 5JHLH 2ZUUA 3UCRA 1L7IL 5D7SL 1KB9J 1RK1B 2VT0A 4H20L 3NH7H 4ZUSB 3BVNA 3AGWA 4Z5RA 4NP9A 3KR3H 4P48A 3HG1A 3QS2A 5KBPA 4U6TA 1J8HE 4EEEA 4P46D 3RWFA 3NFPB 4ZW7A 2P45B 3CSFA 2ZXCA 4QUOA 4ZUUB 3VXSA 4LBEA 4Z3EA 3S6CA 1QPXA 4GQ9L 1Q94A 3CSGA 1GMEA 5GQBA 3DXAB 1MAML 3CFKB 3QARA 3MRBA 4JFQB 1WC7B 1CUOA 4QJ3B 3BVTA 3UZQB 1JGLL 3EFFA 4KI1A 3MRGB 5DZPA 3QQDB 1KCVL 4QRPB 3QEQA 2XIIA 4U1LB 3TVMC 1EHLL 1IE4A 4N4YB 2P24B 1Y7VA 3FQ4A 3P9LA 5IVZA 5J12B 2LABA 5E2WL 1XXFC 2FH8A 2QLYA 4OAWA 4F1ZA 3VSVA 3BVNB 5I1JH 3AREC 2JCWA 2X4OB 4KRLB 4Z5RB 3J2PA 3QRBA 4FZ8H 1UH2A 1OV8A 1CD9B 2MCG1 4WJ5A 4CVZA 3RWFB 4XNYH 5ID0B 4F7CB 3OR7A 1IKFH 2DWSA 4ZUTA 4LBEB 3VXSB 1PNDA 2BC4A 4FLHA 4DT2A 5AVZB 3T4YA 1QG3A 1Q94B 3R7RA 1RL1A 2DIEA 4WVRA 1XDTT 1BP3B 5B3NA 4NEHB 5FHBH 3FU7B 1FH2A 3CH1A 1SN0A 4P9MH 5MENE 4X8JA 3TL5A 4B5EA 1VZHA 5JIKA 3QEQB 1F58H 1TO4A 4L9DA 5FUZL 2YHGA 5TDNB 3EH3B 1SYSB 3QXAB 2DH2A 3P9LB 1USZA 3HI6H 2QSTA 4OKDA 5IVZB 3JTSA 3VG0L 1Z1WA 4N26A 4PP2A 3DX1A 1EMTL 3LS5L 3GKZA 4Q14A 1KV7A 4OAWB 2AZUA 3E3QE 3MROB 1JDAA 4KK5C 1W15A 3GJEA 2IBZY 1YYCA 4PJXA 1ZV2A 1U58A 4WJ5B 2QVKA 3TV8A 2Q5BA 4Z0BL 3WLBA 3AUVA 5EF3A 3OR7B 1FRGL 1AE6L 4ZUTB 1E4WL 1YUHA 2BC4B 3T4YB 1XCTA 5EFIB 1G6RL 4OLUL 2FWOA 1PSKL 1ZKAA 2IFGA 3LZFL 1J5CA 4FQXA 3IDYB 4OCSH 2Y22A 1EXGA 3GO1H 1A4AA 5DRXA 4P57A 4K8RL 1EZLA 1XD1A 4X8JB 5KN5A 4P3DA 3BISA 3T0EC 5CFAA 2AXJA 3IDJA 3M7OA 3JTSB 3DVFA 4PP2B 5JZ7C 4L8CA 3D06A 3GJEB 3CJJA 3TT3H 4RRPM 4PJXB 1GJUA 1NAMA 1A6WH 2ZOOA 5EDXA 3V2AR 1EUUA 5B8CC 1U58B 2QQNH 5F71A 1WCQA 1OAYL 4J6IA 3NSCA 4N6RB 3WLBB 1HIMH 4QRRB 2DMKA 3WUWA 3K4DA 2Q10A 5FA4A 3AY2A 1YUHB 2DY2A 2L4OA 3TO4B 5I5IA 1GSKA 1G7IB 1J5IA 2VXVH 3BH4A 4MA1B 1HZKA 1NGYA 3SDCA 1RH8A 1W8OA 3HC2A 3P0VH 4FQXB 4LPTA 4TQIA 2BWIA 5DRXB 4P57B 1QFHA 2HTKD 4Y9EA 4XMLH 2JB5H 1MG2C 4P3DB 3QXVA 3ULSA 3OWRA 1JNLL 4QKTA 4XXDB 2ATPA 4YSEA 3T09A 4ZFGH 4Y19E 1FN4A 5AW0B 5KBMA 4UTBH 4FQ1L 3RL2A 2WHVA 2Z4QB 2XVGA 4L8CB 1KIQA 3SGJA 2ADFL 3I9IA 1NAMB 2MNUA 2EEFA 3B9KA 1ZLWK 5JXEC 4ILDA 3MCG1 4OLXH 2YIHA 3NOIA 1BZ9A 3BGFC 4X9HA 5JR1L 4DP6X 2J3SA 2VQUA 1HCZA 3UOAB 4R26L 1X3DA 3WUWG 1NICA 2VL5A 2YAQA 2MOVA 4O2EA 2X9YA 1L5GA 1NGYB 3SDCB 4TNEA 4M00A 4Z7NE 5F7MC 1K9TA 2WLJA 4M3KB 1J5HA 3U0PA 3SCMA 3U2JA 3HRZC 2FJFA 5C0IA 3DA0A 4MB4A 2GIYA 4TLSA 3T5WA 2ATPB 5HP5A 4MA8H 4MFHA 4ZJ9A 3RVVC 1FN4B 1EANA 5JIIA 3LXCA 2D7MA 4KKPA 1KIQB 1JK8A 1QRND 3WHE1 4GEIA 1J5OL 2MH4A 3GK8H 3B9KB 5CAYB 4V1DE 3AQZA 5JHDD 5CXPA 1ITBB 4JN1L 1BZ9B 4FYSA 1U92A 4XAKE 1Y0LA 3BKMH 5EUOE 2VL5B 2YJQA 4AM0Q 4O2EB 3MO1A 1ZPUA 4KKCC 3NVQA 4HPOL 1WAAE 3L3KA 3U0PB 3D50A 3SCMB 3CHPA 5AKTA 2MEJB 1I3VA 3P4MB 5C0IB 1DBKH 2GKIA 4M93C 4FJZA 2EDKA 3U25A 5L9DL 3LIUA 4NUGL 1UM6L 3NABH 4G2AA 3SKJL 5F3BA 2NR6A 5CNHA 1JWSA 3GINA 2NY2C 2GY7B 2E6JA 4J7RA 3QUXA 1AFVL 2MQGA 3FZUC 2E7MA 4K94H 3F7RA 3C87A 4HUUB 4DP0X 4A67A 2FO8A 1UWGL 1U92B 3DO3A 4S2SA 4WTZA 1Y0LB 4HIJA 4M8VA 4PRDA 4UDTA 2BSSA 2VZ1A 3MTRA 4JCLA 4CC4C 3A6CL 3V5DA 4MXVF 1AGFA 2XUWA 3MO1B 5CP7A 4NBXB 2F54A 2E46A 2IFFH 1I9JH 4HKJA 3BX7C 3RX9A 2R7EA 5ALCL 1H6FA 3L3KB 4HCRH 1UVQA 2WBJA 1DVYA 1GMIA 3EYQD 2D3VA 1A7PH 4F37F 3MLUL 3CHSA 2AVGA 2KLRA 4YLCA 5J56B 4OGXL 1ASPA 5F3BB 1JWSB 3V4PA 2HT2C 5JHBA 2QV2A 3QUXB 4IIQB 5JHLA 1INQA 3SDYL 3MLZH 2BRRL 3C5ZC 5DZVA 1HXYA 5C0FA 2P5WA 4GAGH 1SN2A 3BVDB 4OCWL 2I25N 2ZAGA 4BRJA 3L8QA 3FO0H 2CE6A 4LPVA 4HIJB 5IVNA 1TPXC 4UDTB 4WTZG 2BSSB 3RVTC 3CZFB 3V5DB 1M7XA 1JPSH 4HMDA 5AVSB 5FYKL 2X6VA 1A21A 2X6CA 1AGFB 1IEAA 2CH8A 2FH6A 2F7OA 3VMNA 4HOXA 4XPGL 3IMWA 3IT8D 2R7EB 3T0WA 3O6FC 1UVQB 1LM8V 3MRQB 2L7QA 4PJ8B 4XPAH 3RWHA 4CKVX 2KHAA 3L95B 3QIUC 2BSTA 4JFDD 3OVUB 3CUPA 4LCWE 2XZQH 4I1NB 3KYNA 4MD4A 4N8CL 3P3YA 2KERA 3V4PB 1JGIA 2NNAA 3E9TA 3E3QC 5KAQG 3MRFA 1INQB 2R69L 5DUBA 4YDKL 1HXYB 1NCTA 5C0FB 3NG5A 3NRQA 2C3XA 1KTKE 2D7OA 3L3JB 4N3TA 5I0XA 1FH5L 5HGDA 3HNVH 4MJ2A 4OTXH 3ZIMA 4J4PA 4G82A 4FCAA 2HT3D 5EN3A 4BFIA 4ES9A 3C08L 2BP0A 3AU1A 1KXTA 4PR5B 2K70A 4MS6A 1KCRH 4GY4A 1QW8A 4HC1H 4S0TD 1JVOA 4NPKA 1DJXA 5I1CL 4YL9A 3CSPA 4ODVL 4WFHD 4FC3E 1U6AH 3GLEA 5CZXC 2R9HD 3ROOA 2ZIDA 2TAAA 2XPZA 1HWWA 2BSTB 3FUJA 1UACH 3CUPB 1XBDA 2AJXL 1UQSA 5CU5A 3KYNB 3QZWB 3SHSA 4MD4B 3MJ9H 4O02L 3BWAA 1A1OB 1RZQA 3DDFA 4H8HA 2NNAB 1ZE3H 3MRFB 1QFUH 4HF5L 5DUBB 2Y7MA 4HWZB 2H45A 1FO0A 4TTDD 3G6AA 4PTTA 5EWIL 5I19H 1J1XL 1JZGA 3IAPA 1YNKL 3GTTA 5HGDB 3WTXA 4J6RL 4X9BA 1AG0A 3MODH 1S46A 5EBWA 1C7TA 3Q7JA 2BP0B 2PW1A 3AU1B 3KW8A 4TVPE 1KXTB 1H5BC 2IO5A 4C4UA 4WWNA 43C9A 5D72H 3NGBC 2XWJA 4HJ0D 2GBAA 4QRRD 3N42B 5ERWA 4OUOA 1A8JH 1Z0MA 3OKLA 4JREC 3ROOB 3TO4D 3RTQD 1TVBB 1TTGA 1F4AA 3G5YA 5HDQL 2QQQA 1I8MA 1UQSB 1HZLA 3VMPA 3X2QB 2ARJQ 2VH5H 35C8H 2E6QA 3BWAB 1E3FA 4FQXD 2J8OA 1F0LA 2R2BA 5EO0A 4OIIH 4FEIA 2XBDA 3GSWA 1FIGH 4MMZA 5CGYC 2W60B 3SIKA 3G6AB 4PTTB 4BEIA 1F02I 4FTVE 2K4AA 1BAWA 1RPQA 4HWBL 5EBWB 3N85L 5CGMA 5I24A 2FCBA 4M48L 2PW1B 3FS9A 5CLZA 1J12A 2DTMH 4JG9A 43C9B 2EYSA 2NDGA 2XWJB 4MVBC 4GSDL 5D70L 1I9RH 3EZ8A 3KYMA 3PDGA 4XODA 4G8IA 5ERWB 4OY9A 2ZWSA 3S9DB 1ZANH 2OZNA 5AOLA 1DJSA 3G5YB 3GLAA 1YEJL 3WFDL 2PN5A 3TN0C 1RZKL 3O3EA 4R90L 4ODXA 3DURB 3LQAL 5HYSG 2R39A 1R24A 5DS2A 4D0DA 3UBGA 2R2BB 5EO0B 3OC5A 4UTBA 2WBKA 4MMZB 3G04A 4O5LL 4QHKI 2ORBH 1U4EA 1DL7L 1FIEA 3MLTA 2BOCA 4NKDA 3LRLA 3ZE1E 5CINL 2IQ9H 1BVKB 5LQBL 2MQ3A 3A4FA 4JMXA 1CK0H 4I3SH 4NNPL 3ZYOA 3TJHD 5CJXA 3KYMB 1TOXA 4AE0A 4Q97A 3KCPA 1XL6A 2AGJH 3DYPA 4G8IB 4EOWH 4YXKL 1OSYA 3ESUF 1N9PA 2A3TA 2WC7A 3KPNA 3O3EB 3UO8B 5I6NA 4HFWB 1KF9B 4ODXB 4N85A 4YFDB 4AM0A 1R24B 4D0DB 3N1PC 1I3RA 4NENA 2Q7AA 4MASA 4KKNA 5EN2B 3G04B 3FH5A 1CF8H 1X9QA 4A04A 4M1DH 3RZCC 1UWYA 2DLTA 3MJ8A 4YN3A 4XO4A 1YZZA 4K71B 4NDMA 3L81A 2X5PA 1SDYA 2BOCB 3MKGA 3WV0A 1FLRL 4NKDB 3SDDD 3W5NA 2CDFA 4P05A 3H7BA 4ODHL 3HZYA 4GRLD 1PGRB 3OXRB 4G3YL 1FQ9C 2W92A 3E8UH 3O41A 3KCPB 5HI5D 2ICWB 1T0NA 4NAQA 1GAFH 4CJ1A 3QR0A 4XMKL 3TBSA 2FGWL 4UI2A 2L7JA 3ARDD 4HS8H 4PJ7F 4LLWA 5KSUA 3AADB 1CFQA 3KPNB 3Q44A 1R0AL 4GO6B 4FI8A 4OF8A 4WW2C 4AM0B 3LTVA 3AM8C 1A02N 4IBYA 4UMGA 2EH8L 5I8CA 4PVNA 1I3RB 4NENB 4X4YB 2QPFA 5ALBH 4P2QE 1TETL 2XX1A 1UA6H 1XV8A 1REIA 4F7MA 3L3IA 5I1KL 3L5JA 3SE9L 2P8MA 3CVIL 1JV2A 3R06A 4J3OD 4D3CL 1OGSA 2BVUA 2DQEH 2K0RA 3JSSA 3QUXD 3HZ3A 2A7BA 4WI0A 3GBML 5IT2L 5ABAA 4OM0L 1RZ7H 3H7BB 3BGFB 2D7NA 2YGNA 5IEKB 1NBZA 3FAWA 1JRHL 3ECWA 4KVNL 1UWFA 3MI6A 2BNUA 5A2IH 4LEOB 3O41B 5GISH 3DK0A 4HCRA 1T0NB 2NQCA 1Z3RA 3MNWA 1AQKH 3QUYA 3WNIA 1UOWA 3TBSB 3IETA 1LL1A 2D8KA 2XJKA 3DETD 3P40A 4XN5A 5FV2A 4DETA 4ZG1A 4RA0C 5GPRA 5KSUB 3HI1B 3ZDZB 2WQUA 1ADQA 4LU5L 3DGGA 3WTVA 4PJ8D 4AX3A 3QQ9D 4YQXH 5BW7C 2YOAA 4JHWH 4X6DA 4XNMA 4FGMA 4Z7UF 4JHVA 3U4AA 1HX0A 3ELQA 4KGJA 1EIBA 1G94A 1LLAA 2P8MB 3CSYA 2WW8A 2J55A 5EUOF 2HLFC 3R06B 4NZFA 3EYFA 2OCJA 5E6IC 5DZNA 1SUHA 3D3VD 3F2LA 3VFOB 4WI0B 1CYGA 5JQIB 2SEBB 1UFGA 2X2UA 4Y1AA 1NBZB 1RIUL 3T71A 4KWUA 2BNUB 5T5NG 4CC4A 3KVDD 3OHMB 3EOBA 4XHJC 2AEQH 3DHMA 1OE2A 3JVGA 5BO1L 3WNOA 3MNWB 3QUYB 3ELAT 4YIQA 3IETB 3X14B 4HEME 4N1EA 1TJHL 3RIAF 4WSJA 3PQYD 3WELA 1QPKA 5T3XE 1ZLSL 3CFMA 4UM8A 3DGGB 2F19L 1QA9B 3FQTA 5GSVB 5A3IC 5EU6A 2HX9A 3F58L 4JPKL 4XNMB 4XBGB 4XP5L 3EYUL 1MHPH 4BUQA 4LSPL 3BN9C 3DX0A 3KS0H 2AMUA 5IFHL 3CSYB 3EBIA 5ILTH 1WA2X 3EYFB 3O9WC 4P2AA 4HD5A 3G5XA 2L04A 3IXAA 1N8ZA 1T7ZA 3GBNL 5EOQH 3S96A 3TNNA 2XN9A 4ADIA 1QWUA 2A4EA 2EO9A 4Y1AB 2AI0H 5DJ0B 4NIKB 1EV2E 2XZCL 4HC1A 2BSCA 2V2WA 1PMYA 3DBSA 5IOPA 2Z1KA 3EOBB 5GS3A 4WZ9A 2ZF9A 3FQ2A 4YIQB 4OZHF 5F97E 2WY3B 1VKXA 3VWJC 4PTUA 3SE4C 3V8CA 4DVRL 4UM8B 4LGRB 1DVUA 3FQTB 3MJ9A 4FAAB 3CFNA 5EU6B 1CO1A 3EOTH 1LE9A 1YC7A 2AJZA 2XA8H 2AABH 2F74A 2MPAH 5E99H 1ND0B 3NA4A 1JZ3A 3U0WL 2A74A 1JNHA 1ZMYA 4R4NC 2IAAC 3JZ7A 4RGOH 1F13A 1KOAA 3F3HA 3C5ZB 5DVLA 3TVMD 3G5XB 3IXAB 1LXMA 1N8ZB 1FZMA 4KTGA 1AGCB 2Q8AH 3VFGH 3TNNB 3P0YL 4E36A 2ITDA 2XN9B 5IVXF 2XYCA 4Z77A 2ZP8A 4ZNCD 4FS0A 4CW1A 5CCKL 2R1WA 4L9LA 5IOPB 4TPRL 3ARED 1YYLH 4CBZA 3PV6B 5FW7A 4EAEA 5LUMA 4Q2ZA 1TQUA 3VJ6A 1U3JA 3RDJA 4P3CL 3TO2A 3O6FB 1MZYA 3VB9A 4PTUB 1EGJH 3PXHA 3GEFA 4G6FB 1DHKA 1F97A 1LE9B 3Q13A 2AJZB 1Q0XL 4P9HL 4XBEL 5I6OA 3KE0A 1OGAE 1UA7A 5M94B 2A74B 2LTQC 4N0CD 3MN8A 3U9PL 4YNYA 1TJIL 1C1EH 5GRUH 4MNGE 1MLBA 3TZVA 2Y1VA 3DIDA 2IBBA 4G59C 4RVBA 1FZMB 1GGCH 2A9ML 5DUJA 3KBPA 3EKCA 4F9LC 4UNUA 4F58H 5EF2A 4JPWL 3UYPB 3APMA 5DEJA 2R1WB 4R3SA 4KK5D 4JFZH 3LZRA 4UV7L 5GGVY 4JFFD 3WD5L 4P3WA 3VJ6B 5HYJE 2MIZA 3TO2B 4NOFA 1CN4A 1ID5I 2XSKA 5I2IA 3KXFA 1D5BA 1YMMD 2DLFL 4M7ZB 1WZAA 4Z23A 3SGEH 3ES6A 1IVTA 5JOEA 3VVVA 4FQJL 3KBHE 1QKZL 1QFPA 3IFNL 3MLRL 4ODSL 3RHWK 3KWUA 3H3BC 4UUJA 4Z95H 4YNYB 2Q6WA 3BP6A 3K0WA 3WNPA 1MLBB 4IOIB 3TZVB 3SGKA 1GA2A 1DBJL 4M43H 2XACC 1B4JH 3C6SA 4Z0XA 1OM9A 1J1OL 2P5EE 2FSEA 3HFFA 1W72A 1GIGL 4R3SB 1IBBA 1EZVY 3WXWL 3K6FA 5D9SA 5C09A 1F3DJ 4NB7A 4PCKA 4RCAA 4Y9GA 3ZJAA 2DKUA 1LMIA 1IRAY 1YNTF 4FE9A 1V55B 2C3WA 3NCYP 3KLHC 3ESNA 1U3YA 3QH3A 3KXFB 5T8IA 4I89A 3QQ4A 4C59B 1D5BB 3LKNA 4N1HB 2F7PA 3ES6B 4Y19B 3LPPA 4LFHD 1PU0A 5F1IA 4KHXL 2XCMC 2Q7NA 4IGBC 4KTEH 3P9MB 4UUJB 5DTFB 2FE0A 4BQ8A 2WAHA 2CCLA 4H2CA 3DMMC 3T4AA 3UTTA 4U1NA 3UEZA 4KKQA 3T6ZA 4XMWA 4NYLB 5ADPH 1LP9F 2ICEA 3C6SB 4P5TA 4M61A 3V52L 1NOAA 2FSEB 4N2BA 4UOW0 4M1GL 2V9UA 4JDEA 5MEQB 5D9SB 1T6BX 2FX9L 3DX9A 5C09B 5JXED 4MNQE 4Z7NB 1BQHA 1WTLA 3FTUA 4GSUA 1XO8A 1QSEE 2X4QB 3LRHA 2NY3B 4M6OH 1RPKA 5GHWH 4FFZL 3QH3B 4CU6A 2QVFB 3QQ4B 3LKNB 4YDJA 5F7NC 5C08A 5DQ9A 2OJZL 1BFVH 2RACA 3TN0B 3RVUC 4CSSA 2KT6A 2X2HA 5L8KB 3CFBA 3UEQA 5KVMC 2VR7A 5LDUA 3FNKA 1T7XA 5DD0L 5JO5A 2VMFA 2J5LC 3DARA 3EOAB 4U1NB 3APNA 4NZTL 4OT1H 5TK4A 3ARBC 2K9FB 1RUPH 3OPUA 4M5YH 2D73A 2MRYA 1TLMA 3TPUB 4M61B 1UENA 1J9SA 1RZFL 3EJZC 2YJLA 1CG9B 4IU3A 4Y4HC 4JDEB 3DX9B 1EVUA 2DDQH 4LSVH 5EZJA 5B7EA 3TU6A 3WJLA 1J10A 3HPLB 1BQHB 2EDBA 2LV4A 5D1QA 1BQHG 1C7SA 3S3PA 2ZNWA 4O58L 1DZBA 5AW4B 3RUGA 3EUDA 1HNFA 1IBZA 2R27A 2XRAH 4QHMA 3ZO9A 4YDJB 5DQ9B 2CAKA 3FHEA 5L2KD 4UOQA 3B7TA 4BZYA 1HL9A 4KKCD 1BJMA 4WW2A 3JV4A 3CFBB 3MNVA 1NAML 3MR9B 4X5RA 2EE2A 4XOBA 4F2ME 3W0WE 4DP5X 4PGZA 5AYUH 1A3RH 2PXYC 2VMEA 3M17A 5TDOA 1XQ4A 3F7VB 4PUBL 1DANU 2DTSA 1WO2A 4ABVA 2NY2D 3UTOA 3BKJH 1QD0A 3D30A 3FZUD 4IU3B 2WCGA 2IWKA 2ITEA 2OJ1A 4XNUL 3SYCA 1LDSA 2P44B 4YFLF 2QPSA 1UEMA 3QJTB 3B2VH 4K2UH 5FYJE 1ODAA 3PF2A 3HLAA 1J8HD 2JXMA 5D1QB 3KPPA 4FFVC 5LKNA 2E86A 4IDLA 3VFMA 1E6JL 2G0LA 1ZLUK 3VTAA 5CUSH 1TMQA 4ZUWA 3CQPA 5T3XH 1YEIL 4QHMB 1MCQA 4HETA 3QRFM 3VMOA 4A55A 4WW2B 1V7ML 3JV4B 4FZEH 2AW2A 4BA0A 3MNVB 1K6QH 4LEXL 3L1OL 2Y72A 1N3NA 1JGUL 5B22A 3T2QA 5TDOB 3M17B 1DLFL 1XGUA 2B77A 1IM3A 2AEOA 2HT2D 6PAZA 2Y0SA 1A25A 2OMBA 4F8TA 2BLFA 1WP6A 1KLGA 1ID2A 1QSZA 3FB5A 3C5ZD 5FYLH 4GIOA 5DYOA 3COOA 4MAYA 3U7YL 4AC4A 4I5BA 3HLAB 2RD0A 3WEBA 3M88A 3KPPB 5DFAA 1A7OL 5HHPA 5J13B 3VFMB 1JZ6A 4U3SA 1G7MA 5I6KA 3ALXA 3RVTD 2C8NA 4GG6F 5EC1A 4LCWB 2AVFA 2YFNA 3H6AA 2G60H 4CL7A 3DRTA 3LKRA 4X5LA 5FFLA 2NNCA 2D31A 2WXLA 3O6FD 5MEND 4YSRA 4ZMYA 1O9ZA 4XPFH 1N3NB 3HBZA 5IBTH 3QIUD 1PJ9A 4G6FD 5KVGL 4TSAL 3NCMA 4G6MH 1WV7T 4GUCA 1XGUB 1IM3B 3TV3L 4J23A 3V0AC 2ZXAA 1EHXA 1KLGB 4R7DB 5EU5A 1AJ7H 3FB5B 3CHQA 3TYGH 1BXXA 4H5SA 3EHBB 4UIKL 4DQAA 4WK4B 3E38A 5DYOB 1F41A 5IG7A 4MAYB 3BD5A 3MLSH 4I5BB 5ESQA 5MEPA 2YLHA 4OQTH 2VKXA 4U1KB 5DZJA 2CUMA 5ELIA 1KXHA 5HHPB 3L4TA 4ZXBA 1G7MB 4RGMB 4LDOB 3ZY7A 5EC1B 4FULA 5BV7C 1G43A 5HSFA 1JCVA 4N87A 1EGJA 3DRTB 5F7AA 3UGUA 1URLA 2NUPA 3NEOA 5CJBA 3PWPE 3NJMA 4PW3A 3HNTL 3L4ZA 4PP1C 3IE9A 3B1TA 2EEBA 3ARQA 4MXQC 4U0RB 1KGJA 4Q56A 4H88L 4HUXA 3LNDA 5G55A 5HHOE 5I0YA 5F93C 1SUJA 2YAHA 3U1SH 5EU5B 4QAMB 4J2QA 4YHMH 1UCBH 4H5SB 1DP0A 5KVEL 5IG7B 4YSAA 5MEPB 2JCCA 1SEBA 1ANUA 1URZA 3AG4B 1E5CA 1IGMH 1NCBH 1ET5A 4ZXBB 4XZUA 1B2YA 5A6MA 3DO7B 1KXQA 3GXIA 2OKMA 3BFOA 5DT1H 3V0EA 4Z3TA 2CUAA 1WZ1H 1URIA 4P4KC 2V7NB 4XVSH 4KROC 4CC0A 4FHJA 2VE6B 1PG7X 4NHCH 1EO7A 1Q1JH 3KR3L 4GI6A 4UQAA 2X1WL 4Y19D 4L4TE 3I3DA 4LSSL 4ZUVA 4HUXB 5EO1A 4PYHA 4HX1A 4MD5B 5E6UB 2DEYX 3O6ML 4WSKA 1TNNA 1NFKA 3IU3A 4S1RL 5CGYD 1CGUA 2NXYB 4K3JL 5C1MB 1MHHB 4NOBA 1IC0A 3G6JF 5KYXA 4JG1H 1MDAA 2YPLE 3A67L 3EBAA 1A6UL 1GYAA 4XZUB 4NCC2 3FCTB 2DJSA 2IDQA 3WIFA 4NRXB 2CALA 4B7IA 4AEFA 4MVBD 4OBRA 4XXCC 5I1JL 1MVYA 3LIZH 4FZ8L 5J6SA 1Q9LA 3TN0D 4ZUVB 3GLDA 4PJFE 5EO1B 1XSOA 4HX1B 1IKFL 2X4SA 3I6KA 3N9GL 3NK3A 5KTEH 5EIIB 3ZE1B 5C0DA 4V1DD 3BZ4A 6FABL 1CTMA 1OW0C 5KYXB 4XAKD 2RFXA 3ILEA 4P9ML 1CIUA 4P2YA 2ODHA 4AWJC 2Z64C 2EDTA 3UYRL 2LHAA 4IBVA 5B21A 5IFJA 3IWUA 1CXEA 4FQIH 4AEHL 3T2LA 5C86A 1UC6A 1B4LA 3HG5A 3L9YA 4F37K 2OMNA 1WK0A 1CLOH 1ZHLA 1LK3H 4G7RB 2YPVH 1SQ2N 2VW7A 3L4WA 2QHRL 1CTOA 1MI5E 1GW0A 2R0ZH 4F93B 4XX1G 2JJSC 5AOIA 1MCSA 3HG4A 2X4SB 3I6KB 3PRZA 5C0DB 5FCUH 3L08A 4FNQA 4HEPA 2YK1H 3RZCD 2PP9A 2JNZA 3CXDH 4HUVA 1HJCA 4OCSL 3GO1L 3HEIB 4FOMA 3TBWB 4KO7A 1JVLA 4MKTA 1RIHH 4L8SC 2IH9A 2G75A 4WTWA 1T5XA 4DEPC 5IFJB 2D2OA 2X05A 5FAAA 2VQTA 3GDBA 2WKOA 3EJSA 2KC0A 1ZHLB 4FG4A 1OANA 4KMTH 3IDNB 4V2CB 3TT3L 1IGCH 2F8OA 3PNWA 1I9EA 3WNJA 5J8OA 3WKPA 1ASOA 3MRJA 1LHZA 2YUWA 5KYWB 2X89D 1GYUA 4KNUA 2QQNL 5GGQH 4LCIH 5KW9H 4WNQA 2OMXA 4G9FE 1HIML 2Y6SC 4DIXA 5IQMA 3O0RH 3O6LH 5DA4A 2VXVL 1NCDH 4N1CA 1R3HA 1H3UA 3PAUA 3LMJH 3P0VL 4HUVB 1DFBL 2NXZB 4DO6A 5FYJH 2H3NA 4JKPL 4YSDA 4XMLL 2JB5L 4OFVA 4HH9A 3H55A 4M1CC 5AKVA 1MEXH 2DZEA 1T5XB 4HEMA 1ULVA 3OMIB 4P04A 1KWKA 4GEJA 4TQ8A 1PJWA 3VSUA 2VAAA 4H8PA 1CXLA 2L3BA 1I7UA 1GZQA 3QUZC 2BCKA 4X9IA 3RGHA 1V7NH 5FKPA 5I8OH 3PNWB 4A7UA 5LXGL 6PCYA 4R5XA 3MRJB 3VXUE 3WJJC 4LCWD 1I1FA 1PKOA 2X9ZA 2ZOUA 4OLXL 2NYKA 2P9RA 4I88A 5EZLA 4WNQB 1P2CA 1CYWA 1QI5A 1L9RA 5F7FA 2J5LB 4ZYKA 5EULV 4WO0A 3FO1A 4FXGA 3ARBB 2V5RA 1R3HB 1T0PB 4L2YA 5ICXB 3OJMB 2VLJE 1WHPA 3LKSA 2HLFD 2AQQA 2H3NB 1OVZA 3OQ3B 3RI5F 5E6ID 5KANI 5EPMA 3V79C 3MDJA 2FHBA 2QFRA 3L7EA 2MHAA 1YC8A 1VIWA 3A0OA 2VDQH 4BQ6A 4JY6B 3IDMA 4IMLA 1GZQB 2BCKB 3G5VB 4ONFH 1X7SA 5FGSA 4XHJD 4FA6A 4PJBA 5EZIH 3WEAA 2AQ2A 4G9DA 3D39E 3GK8L 2IPTH 5IMLA 1AAJA 4Z78A 1I1FB 2WMPA 1JI2A 1OTUC 3RP1A 2YXVA 2XG4B 4MXWH 4OI8A 2R4RL 2GK0A 5EZLB 12E8H 2EILB 2OYPA 1M6OA 1P2CB 4DKTA 3VI4E 5I1AB 3S2CA 1OB1A 1C5CH 5T1LA 4GUQA 4PAZA 4QLRA 4ZYKB 5A3ID 3IVKA 3GS7A 2PR4H 3FO1B 4FXGB 2PXYB 1U8KB 2G5UA 3SZKC 1MCWW 4X6EA 3P3TA 3BN9D 4MX7A 2QELA 1ZTXE 3IJ7A 3LKSB 3O9WD 2BNQA 4JRFA 1HI6A 4OQTA 4TVPD 4H0LC 4P23A 3BLPX 5EPMB 3J8F7 1AH1A 2C9XA 3I75A 3NABL 2MHAB 1NCUA 4MDJA 3IDMB 3KVQA 4OLWH 3UJIH 4ZXBD 1UM4L 3EO1A 4PJBB 3FUNA 5D2LA 4UMSA 2AJYL 5IMLB 4Z78B 2NDFA 2WMPB 5E9DE 3WE6A 3VWJD 1ZGLM 1D9KA 4GNKB 4NQVA 4E9TA 1PIGA 2GK0B 2X6MA 5KAQF 4KRMB 1M6OB 4PH8A 4WY7H 4B5ZA 5GZOC 2IWGA 1OB1B 4LVHC 2FYYB 4HWEL 4O51B 3UAFA 1T7WA 4U6VH 1QFWI 3IVKB 2IFFL 2AK1L 4X6EB 2GJRA 4FTVD 1R6VA 1ZEAH 3FUHA 4MX7B 1DBMH 4HCRL 5DK2B 4R4ND 3V8OA 2BNQB 1HI6B 1A7PL 2DF3A 1HILA 5LBSH 3UO1H 2FD6H 4P23B 3S5LA 4LIQH 2A4ZA 3I75B 5HYJA 1FYTA 4P59L 4MDJB 2ZSVA 1JP5A 4JDVA 2UWEE 3MLZL 3EO1B 3VQ2C 5D2LB 3MNMA 4AV5A 4PB0H 1OGAB 4MJIA 1R47A 1JHKH 3HE6C 4C4KT 1CURA 4NQVB 3TCLA 3FO0L 2P80A 2BVPA 4ANWA 1TMCB 1BZ7B 1AXSB 2G9KA 3FTGA 1S3RA 3Q2VA 2VXQH 1SF5A 3V7AE 5F9DC 3K8KA 1SHWA 1M9SA 2XWXA 1MW0A 3NFNA 2XYBA 4M7KH 1OAZH 4LEEA 2YAOA 4PJGE 5LCVH 1AKPA 3QNZB 4WHYH 4XPAL 2HX7A 5CR8A 3S5LB 2CA4A 2XZQL 4U7SA 4XI5C 1OO2A 3S5LG 1K5NA 1VEOA 5HYJB 2ZP0T 1FYTB 4U05A 1IJNA 2CHXA 3VD5A 2ZSVB 2MKWA 4HSAC 4JDVB 4FXLA 4WEMB 2IF7A 1H3VA 2OMUA 4HK3J 4I2XA 2B3IA 4LLQA 4FFWC 5K9KA 4MJIB 3KBEA 3HNVL 4NQCA 4OTXL 4D0BB 3K5RA 4U7MA 2PUQT 3TCLB 2BVPB 1BQSA 1JF5A 5DWUH 5F0MB 2OSWA 4FFTA 3FTGB 3QNYA 2ZWLT 1I31A 2ODIA 1P84K 1NL0H 3MRIA 4U33A 1VFMA 1KBWA 3NFNB 2Z31A 4TSBL 5AKRA 4UQBA 1FNHA 2IAMC 4Z1PA 1E5BA 1HQ4A 5FYKU 4HU8A 1XH3B 1CXFA 1U6AL 1VF5C 1UADC 3ETBF 4YE0A 5E6RB 1UACL 4BCYA 1NC4A 1K5NB 2QADC 1PX8A 4Y5XC 4ANXA 1E27B 3IMSA 3MJ9L 4TXVB 4PRPA 4G7YH 1RMFL 4LKCB 2FR4A 3I6GA 3NEEA 3TGXA 1QFUL 2OMUB 1LYQA 1YYMH 5I19L 1GGIH 4I2XB 2VN4A 2YPVA 1UJ3A 1YPZA 5K9KB 1GS7A 2EC8A 3RWJA 4NQCB 1Z9SB 2EIDA 4L0ZA 2PKDA 3MODL 5E2VH 3EJRA 1WJ3A 2EH7H 5CCGE 5D96B 3B9VA 4P4KB 4GMSH 4IHOA 3QNYB 4I9XA 4WWID 1HN1A 4P2QD 1P1VA 5DS8A 3MRIB 1YDPB 5D72L 1UYWL 3CLWA 2OTWA 4B9IA 1HQ4B 4IGBD 4M5TA 3B83A 5IIEB 2YFOA 1A9EA 4NM4H 3MRKA 3BP4A 3DMMD 3BEVA 1NC4B 3UC0L 3QZMA 3RBSA 2EVHA 4WV1C 2VH5L 1HAUA 35C8L 1QSEB 4PRPB 3BJLA 3P4LA 4YSTA 1HNYA 1KLUA 2FR4B 4KQ0A 3I6GB 2PTVA 2FUQA 3RIAK 3KPRA 1IKOP 1FIGL 4DKDC 4YAQB 4NQQA 5D6CA 1YPZB 1L9PA 3AT8A 2OMZA 2IH8A 3RWJB 1VFOA 2NT0A 1QFWH 4X42A 4HKBA 1M9WA 1JHLH 3CFCL 4AYMC 5AVTB 4UINL 4J8RA 4QO1A 4IHOB 2I5YL 1SLXA 3D4ZA 1Q72H 2DTML 4L8DA 1KBBA 4H25A 3PP3H 3RVUD 4JQVC 2JJSA 2OTWB 4ZFZA 3TNMA 4XPBH 3G5ZA 1ZVNA 4RDBA 4EI5C 2QQLL 1TKWA 4UZSA 1A9EB 3MRKB 1NGZA 4ZO7A 1ZANL 3BEVB 5I9QC 2CG9X 2NW3B 2WWKO 3ARBD 3WXVH 3O8XC 4EKJA 1MFAH 1RCYA 3T6WA 3ESOA 4LQFH 4BYHA 3EJZD 2R1XA 4Y4HD 1KLUB 5EEXA 3OL2A 4NXSA 4XMXA 1S5IH 3KPRB 4RFEA 1EQWA 1FG2A 3U7WH 5C07A 3U4KA 3MACH 2ORBL 2P28B 5D6CB 4RFOL 5T3XD 1F11A 2R83A 3DECA 3ECVA 3RILA 3WGVB 1CFTA 4F2MB 4ETQA 3W0WB 1RIVH 2VUOA 4KQ4H 3RWCB 1L9QA 5JPNC 1J0HA 2IQ9L 4BZ2L 1LEKA 3P30H 4L8DB 4NKOB 2V0AA 1HL4A 4H25B 4UTAH 4X8XA 2OW6A 1CK0L 2XFGB 3HBGA 4I3SL 1EDHA 4ZFZB 4I13B 2YUVA 4QYOA 4MAUH 3TNMB 2AGJL 2FEJA 1TKWB 2JIXA 3MRMA 3QZOA 1NGZB 4WHCA 1VAHA 2PXYD 3PP4L 5HDBE 2EE3A 3S3DB 1VENA 4GOSA 4OLVH 1KJ3H 4P2CG 4K73A 3H9YA 3D2UA 4DH2A 1DQQA 2R1XB 2DWEB 3F64A 1N7MH 3F7YA 1UZ8A 1F4YL 1A65A 3VFSA 5DK3A 4DEPB 1FG2B 3MJ7A 4MLIA 4N0YH 1ZA3A 1LDPL 2HZHA 3C2AL 3BDYH 4M1DL 3DTUB 5IW6A 1NM4A 1F11B 4FFVD 2IG2L 3HBQA 1CI5A 3UPRA 1IB5A 1CFTB 4H8WC 5IEHA 2JWYA 3JVFC 2YGPA 5C7ZA 4N8UA 1LEKB 2XBZA 3K6OA 4PJAA 4HIIB 4IBTA 5I1EH 1F6FB 3ZR5A 4F5CE 3ZUCA 4QYOB 3E8UL 3K4AA 3QFJE 1G6VK 2JIXB 3MRMB 3WIIL 2OPCA 1GAFL 3MRCA 1RAMA 5EORH 2Z34A 3EDEA 5D1ZC 1JD9A 2YD4A 3A5VA 4LE8A 4XE5B 5FOBA 2NY4C 5T5NF 4BFNA 4XWGH 1H15A 1ILSA 4JDTH 1DQQB 1U0QA 5G4OA 3QDGE 1UZ8B 3E80A 5ENWA 3VFSB 2VDQB 2YAFA 3KPTA 2BSDA 3MJ7B 3M1BA 4ICWA 1ZA3B 1TENA 2VXTH 4HSQA 2ZT9C 1BX2A 1WIUA 4WF7A 5F7UA 5IW6B 3QUZB 1MCIA 3WMQA 3F65A 5AVQB 3K2KA 3QJOA 4JPIA 4DKAA 3UPRB 3WY3A 2NY0B 4YSUA 3TFKC 5IEHB 4X6DF 1NPUA 2WSDA 3RY6A 1KZQA 4L3CA 1RZ7L 3Q9PA 1OGAD 2Y5QA 4PJAB 2K7PA 3T2NH 4H1LH 5DGQA 5HHOA 2X0VA 1T5WA 3DOIA 4XOAA 2FECI 4JK0D 1TQCC 3VXME 1LTXA 1AQKL 5BQ7B 3MRCB 2ZYRA 1EBPA 2NUTA 4QHUB 2VZTA 3BH8A 5LBSA 4CU8A 4IIZA 1AZRA 1RLBA 2F2HA 1U3ZA 5FOBB 2FBJH 2I7SA 5DJXA 1H15B 5DURD 4G7QB 4NKIH 1SPDA 3MLXH 3NJHA 5EZOL 4YQXL 5LG6A 1PQZA 2I69A 2B20A 3UG5A 5LWYH 3M1BB 4PJCE 4DPBX 1BX2B 2PR9A 1CGXA 1O7VA 5HDLA 5AFAA 5HYJD 3FFCA 1M3JA 2BIOA 1AQ8A 2FL5A 2DQIH 4JPIB 5L2JA 4GRMA 5BVPH 3T2PA 4XPTH 1BYOA 2MTAA 4NN6C 1JPTL 4RESB 4L3CB 2VXQA 2EEAA 4YGVA 4OSUH 3QDJA 2LLGA 4HGKC 2YD0A 5HHOB 2V5MA 1H8NA 4KDTA 1T5WB 3GSOA 4RFNB 2P80D 4QXWA 3RTLA 4X5QA 5AZ2H 5IK3B 1NCCH 1XEDA 5LCVA 4PP1D 4CUCA 4WEBH 4XO5A 4OZFH 2NUTB 4K55A 1AXTH 4ABWA 3BH8B 4MXQD 2P5ED 4J1UA 1Q9OB 1JXGA 3NJLA 4DZBA 3Q3GA 5DJXB 4YDNA 4Y16C 4HG4K 4M4RB 2HPOA 3GXUB 4Q0XL 2N56A 3JV6A 1T2QL 4R4FH 5HYFA 3U1QA 1MHPL 2OTUA 4AYSA 5KS9E 3GXNA 5ILTL 3QORC 2CM6A 2GABA 5CHNA 2IGTA 2FL5B 4GRMB 2OA9A 1HS6A 1BQ5A 1RJYA 1BJ1H 2IBZX 5I1GH 1BXAA 4ZOEA 4AJYV 1P6FA 4YGVB 4C83A 1X44A 3QDJB 2AI0L 1U3NA 1T2XA 3O4LE 3NJVA 4QJ4B 2UXGA 4F7PA 2B1HL 2NLJA 4P4KD 4KROD 5AVYB 1Q4NX 3PL6C 4F8PA 3VD9A 4WAFA 3PHSA 3U48A 1HH9A 2IANE 4GUPB 4PVLA 2E7LC 4J1UB 1OLLA 4DZBB 1TG8A 2ZYIA 2UWEF 2AFNA 3Q3GB 3VRLF 2ITCB 3TYFA 3EF4A 3RLSA 3ZVVA 1Z32X 4MNQD 3S3BB 3JV6B 2VIRA 1PVHA 4X5WB 5E99L 2OTUB 5HHXH 3N44B 3TJEH 4ABQA 1QSED 5CHNB 4RGOL 5I16A 1LD9A 1H3WM 1Q0EA 3OLGA 3QZPA 4TQEH 3N1MC 1D3CA 1GC1H 1RJYB 5DC2A 2JKRM 3VFGL 3B2UC 2LQRA 1WEJL 3VU2A 4ORGA 4TVPL 3NIGE 2NYYC 4GS7B 4HUCA 4UBDD 1AQDA 3QUGA 1CFSA 2YMXL 4U6YB 4F7PB 3BN3B 3FCBA 4FNRA 1E8XA 4NJ9L 4ZAKC 2P47B 3Q6GL 1A3ZA 3OF6A 4BE6A 3APCA 5BUPA 4YUEH 7PAZA 4YSCA 1HH9B 5T5FL 4D7BA 1ODUA 3O3UN 3ARFC 3BE1L 4XX1E 3CDGA 4GKNB 3TYFB 3BSHA 1L9SA 1WGVA 2OX5A 3OMAB 1EGJL 2Z9TA 4LSUH 1J0IA 5ESAA 3P2TA 4ZO8A 1BEYH 3RG1C 4I3RH 2VIRB 1KIRA 2M26A 2XETA 4L48A 4UT7L 4U2ZA 4XXWA 2KBGA 5J1TC 5B3SB 2VAJA 3MV11 3VG9C 1CXKA 2YAEA 5I16B 4RWYH 1LD9B 3SDXE 1C1EL 4EDWH 2B5IB 2W1NA 4PJDA 1MI5B 4NBYB 1R3LA 1I3GH 3R0MA 1E4XI 1PFOA 3MXWH 4PY8I 5FO7A 4PVBA 4JL2A 2F61A 1AQDB 2LAAA 3GD1C 5FHAL 1ZXKA 1CFSB 4JFZL 2DLEA 5C0BE 3UP1A 3WIAA 5JTWA 3W0WD 3FU3A 5AW6B 1H6TA 4YFEA 2DQJL 5J1SC 3GS0A 1NJ9B 2IAMB 5DFVC 1MNNA 4A7SA 2YKLH 3FU8A 3Q6FA 2DQ6A 3SQBA 5GZNC 5HPOA 1RLWA 3Q8BA 1QRKA 5ESAB 5FYJD 2ZUYA 4FQPA 1OAJA 3S3SA 2AKRA 4Y5XB 5D6DA 5DLML 3CU1A 1YY9C 1JBJA 3RWEA 1A6ZA 3BAIA 4BGLA 1ZLDA 4JM4H 4TNGA 4PJDB 4HMCA 4IJTA 4UILH 1MUJA 1R3LB 2FHFA 4M43L 2XV2A 1B4JL 5T1KA 2EIZA 4JGMA 3PIQA 5EEUA 3RYMA 4UTAA 3B7YA 3FT4B 5IV2A 5BOPA 1CPUA 3UTPE 2QT6A 2XKSA 1YJDC 4YK4C 4RMTA 5EIVA 3LS4L 2WLMA 4HLZH 4Z7OE 4JGUA 3CQFA 1IC4H 1MLCA 1UZGA 3MRDA 4FQ2L 1OCRB 5IHLB 2R23A 1T6VN 3JWDH 2JJUA 2AKRB 4KXDA 4OJFH 3CN0A 3BLBA 1A6ZB 4UU9A 3INUH 4MQSB 1JDCA 3RWEB 4A7TA 5LGKA 4LASH 3VGEA 1HH6A 3EUUA 4M1CD 3VXUB 1HK6A 1MUJB 3QB7C 2AQRA 3BUYA 5ADPL 4OB5H 4XZ4A 3VB8A 5T1KB 1T2JA 2EIZB 3QUZD 3VQLA 3PIQB 4ZTEA 5JW5B 5IV2B 1AG6A 3DIFA 1B6DA 1MHCA 3ULVH 2HN7A 1R19A 3BWUC 3SDAA 2VERA 1QR4A 2OR9H 3GB7A 4X2UA 2UX6A 1F56A 2VB5A 2AMGA 2VLJB 4M6OL 3IJSB 1QTPA 3S88H 1VGKA 2J72A 4NRYA 3W37A 1EZUA 1MLCB 3MRDB 5EOTA 2R23B 1NAKL 4B41A 2GK2A 5IHUH 1BFVL 1D6VH 3O8XB 4LAQL 4DESA 2CGRH 2VJ8A 4R7LA 3QNFA 2AP2A 1UA3A 3QFDA 3OB8A 1YNLH 3RUGF 1WFMA 4UU9B 2NSXA 1P9MC 3EDFA 4FN0A 2DLGA 2CK0H 1HH6B 3MC0A 4OT1L 3BUYB 1HHGA 2ZPKH 2J88L 1RUPL 3M1OA 1D6EA 1BFOA 3QEUB 5E1GA 3VI4B 1X4ZA 3PWPD 5IHZA 4H1LA 5JPNB 1XMWA 2NY6B 1MHCB 3P2DA 2DDQL 2HN7B 3MBWB 4LSVL 3AABA 4NWTH 4ZMXA 1OTUD 3GB7B 3KLAB 1PX4A 1YHPA 2H2PC 5HHOD 4GKOA 1H19A 1AR1C 3WE1A 5JXAL 3PFQA 3KL3A 1W9XA 4WK2B 2NSMA 4NRYB 3BPLC 5EOTB 1S7QB 3GNMH 4KMLB 3BRGC 1B9ZA 4WTXA 4JB9H 2JB6A 3QEGL 3US1A 3K2UH 3QFDB 1QLRB 5I0VA 5KOVC 4UQDA 1E4XH 1QBAA 1SOSA 4OLYH 2DQCH 4BFKA 1OP3H 5AYUL 1A3RL 1WF5A 3PWUA 4BELD 1OM3H 1TYJA 1HHGB 1OLZA 3QGVA 2Z7WA 4N5UA 4QD2E 1BFOB 3BKJL 1OE1A 3C6LC 1X5XA 5IHZB 4H1LB 4UDUA 1I8AA 2H41A 4H1LG 3VTTA 3ZTJH 4PG2C 5E4IA 3HA0A 4L4TD 1ZIAA 3FULA 5HGAA 3BSZH 4PJGA 2DL2A 2YSTA 3ARGA 3D25A 4OZFA 5IW3A 4JG0H 3W39A 3LEVH 4QTFA 2WNWA 3H6JA 2VGLM 3KWWA 5CUSL 3RGVC 1JPST 5GZOD 2IVFC 3QRGH 5T3XL 3VGAC 4QDGA 5ID1A 2XA3A 2B4CC 5D1ZB 4JX0A 2JB6B 2NY4B 1QASA 1KGXA 3PYCA 4B9ZA 2YPLD 3DUSA 4FZEL 4GP8B 2FNBA 5IWLC 1K6QL 3AROA 4QJ5B 2CBMA 4KITB 4ODTH 2VUYA 5JYLA 2PTUA 3ESVF 2FQDA 3QFGA 5KZCD 1OWRM 3WO4C 1P5UC 3PWUB 4LRNH 1IGFH 1QAWA 3KLKA 4LCYB 3ZTNH 4NERA 1L9NA 4NLHA 3O2DH 3ZDYE 4DPRA 2Z0BA 3SBWC 1JVKA 3BUQA 3SY0A 4JGNA 3H9SA 3NPZB 1U93A 3BWUF 5SWSA 3B56A 1RUAH 4B9FA 1SVCP 4EZKA 1G9MC 5HGAB 3HE6D 4B3VA 4OIFA 4QHNA 4PJGB 4ZSOE 1E5AA 4M6NH 4OZFB 2WXNA 5D8JH 3W39B 3QZNA 4OZFG 3CD4A 4UT6H 3ZK0A 3KWWB 3ZT6A 2EUZA 5IESH 4AJVA 5ID1B 4IKLA 4MSWA 1R3IL 2DAVA 2WUCH 4JRYA 1E8ZA 5DMIH 2F8XC 4E5XA 1A14H 5FV1L 2G30A 2G60L 5D4JA 3OKEA 4HDIB 4MQXC 5MP6H 2PYEA 3DUSB 1AGDA 4OF7A 5DD6A 2ILLA 2B4CH 3BWSA 4XPFL 4YR6A 3B5TA 1I85A 1MREH 3APFA 3CLFH 4N2DA 5IBTL 1MRDH 3HN8A 1NPJA 4ZFFB 4LPYA 4XI5D 4ENEC 2EDNA 2J8UE 4G6ML 1Z0NA 4KPHL 1IILE 1V3LA 3CHOA 4YDLC 1VGEH 3NDZE 1FHGA 2GJZB 2ZWNA 2W95A 2OZ4H 4P5RA 3SY0B 3TYGL 5TE4L 1BREA 1AJ7L 5DJCA 5IHBA 1U93B 4NN6B 5SWSB 3PHOB 1MI5D 3CBRA 2G4GA 2DWDA 2ZX5A 4FFWD 4WTQA 2DBLL 3WHXA 1P4UA 5B3JE 3GPSA 3VVWA 2R56H 4BIKA 4TM9A 1G9MH 4P99A 5FK9A 5BCAA 2WGNB 1MXGA 4JRYB 4C4BA 3IRPX 4E5XB 2VLKA 2Y7QA 2ESVE 3FB7A 5CGBA 5KS9F 4E5XG 3OKEB 1XD0A 2IAMD 1XB8A 2JCCF 3LNEA 4L3AA 5JA9A 1DDHA 2PYEB 1YN7A 1AGDB 5HHVL 5DD6B 3TF7C 1IGYA 1HAWA 2IWFA 4YR6B 2GSIB 5ESVA 4HSCX 3IFPB 1FNGA 1KBGL 1VHPA 2QADD 5CILH 1QYGH 1DVSA 4LHUB 4HJSA 1UWXK 3AW5A 5GS0C 2X4TA 3U1SL 3MHZA 2XJLA 4YHML 2FJHA 2WYHA 1UCBL 3G9AB 5DJCB 1JFHA 2X70B 3NCWA 3NAAL 4GMTH 2QKIC 3WHXB 4G9FD 4TLKA 5EO9B 1OGTB 1N18A 3RDTA 2WXFA 1NCBL 3X13A 3WBDA 3L54A 5IMKA 5FK9B 4J3BA 5IQNA 3QULB 3ULUF 1J0YA 3ZSSA 3HG3A 5JPMC 2Y7QB 2Z7ZA 3POHA 3P73A 5DT1L 5SWZE 4OUUA 3LCYA 3BEWA 2LFEA 5D1XA 2WN2A 1DDHB 5E8NA 5BV7L 1ZDQA 1MH5A 4H0GA 1IGYB 5AAWC 3PWLA 4XVSL 5IZ7A 1IEBB 2ED6A 4NHCL 4AGMA 1Q1JL 3LH9A 1L7IH 4H40A 5K39B 1FNGB 5D7SH 1FFRA 4H20H 1C5DA 2JF1A 3UTSE 5DXWA 5J89A 2BH0A 3LN5A 3MU3A 4J2XA 4KKRA 2X4TB 2FJHB 5FECA 1BV8A 3VXUD 2BOBB 4N2FA 2A99A 3LPFA 3IRCA 1LILA 5GS0H 1V10A 4G8GE 1SVBA 1S9KC 3IMVA 4JG1L 1T22A 4K5PA 1EJFA 4UOZA 3RDTB 4X50A 4XNZC 3X13B 1V3MA 1I4FA 1RU9H 5IMKB 5AOJA 1MAMH 3H42H 4G5ZL 3HC3H 3HZMA 4N24A 3UMTA 4H7VA 3P73B 1PTZA 4OUUB 2FB4H 4QXGH 1SRDA 3BEWB 4EI5D 2VLJD 3IGAA 5D1XB 1IC1A 5E8NB 3S36H 1MH5B 4KJYA 4QEGA 3V0HA 3PWLB 3LIZL 4WGVB 4W9ZA 3EJTA 1XGQA 5BQDA 4Y1SA 2IALA 3T3ME 3ZMNA 2QFPA 3O8XD 4E9VA 1UD2A 1C5DB 4GRWE 3LN5B 2AANA 2Z65C 1PEZA 2VABB 5KTEL 5F9OL 4Z7AA 5FECB 3D39D 2UY6B 1TR7A 1D5XA 1MJ7L 5DJDA 3CFJA 3A6BH 4F5CA 5KSBE 1T22B 1O6SA 1AY1H 4OVUA 3WG7B 4JKWA 3TFBA 1I4FB 3FJTA 2E27L 3FAXA 2VERN 1F2QA 4GW4A 4Y8AA 3JYCA 4LMQE 5HDBB 3CX2A 4HLZG 2GJ6E 2FIKA 2J6WA 3F84A 2BHFA 1YAIA 1G9NC 4LLAA 1XVSA 4GXFA 1PZ5A 2OAAA 5CIPH 3IGAB 1CLOL 3QDGA 4KRPB 2QZ5A 1JXKA 1T1XB 2APWA 4KJYB 2ZOLA 2YZ8A 4YBLB 3TCTA 5K9OA 1XGQB 3VG0H 2IALB 1WT5C 4U1MA 5TGBA 2R0ZL 1EMTH 1DCLA 3TH4T 1NCOA 4KK9C 2VLRA 5C6WH 3AMLA 4PWFA 1YA5A 3AQYA 1KULA 1SGKA 2C5DC 4GYBA 4RAUB 5IB1A 1D5XB 5FCUL 5DJDB 2YK1L 1AO7E 5E9DD 3CFJB 4Z0BH 2DOCA 4DERA 2VOTA 4Z7OF 1ACZA 3WO3B 3ILPB 1O6SB 3FQUA 3VXMA 3DX3A 1G6RH 3L45A 3O6KL 5JQ6L 4GW4B 1PSKH 4CGUB 3BKCH 3QWRD 1XGTA 4GO9A 3PXJA 2E8YA 4MNHA 4AQ8A 5AEAA 2P8PA 3QDGB 4KMTL 2ZF8A 1IGCL 5E2UH 2H7WA 1USQA 2AQSA 3BVWA 3FT9A 5GGQL 3ZKXB 5D1ZD 5TGBB 1D5IH 4K5NA 4XO9A 2JI1A 1TIUA 4CSPA 5KW9L 1T6WA 2NY4D 1MKFA 2VLRB 4PFEA 4R97C 1A2YB 2XY1A 4G42A 4POUB 5E9AA 5B1AB 5EG6C 5J4MA 1E8WA 2X4NA 5IB1B 1OAYH 1CDJA 5DD1H 3LMJL 1Z5LB 2VDKL 1UB6A 3TH2T 3KPOA 2ZYSA 5FYJL 5KEZA 2G3ZA 2RH0A 3QPQD 4NO5A 4AL8C 2J6EA 3FQUB 4ZMLA 3BSZA 3VXMB 3TFKD 2APVA 4W9JC 3IPEA 3TXAA 3MOBH 1MEXL 1NEZA 4BKSC 1LEIA 3ZSTA 5I6XC 4IBLT 1XGTB 4HH8A 4LSDA 4BSJA 4MNHB 3ZYJA 4PRIA 5FGCE 3Q8EA 3P0GB 1V7NL 3BMWA 4XMPH 5I0WA 9PCYA 3VO0A 5I8OL 4QRUA 2BXYA 4QI3A 1HWGB 5D5ME 4PJCB 2WTPA 5CF3A 2R29H 3MMEA 3WS6C 4G43A 5FWRA 4AGPA 5CCHE 4WO4C 2ADFH 3H53A 1GZHC 3Q06A 3MREB 4WUUE 4G42B 1OAUL 2QLVB 3O2DA 4DK3A 2X4NB 3QQ3A 3TC9A 2FWLB 2OR7A 3RBGA 2FO4A 4GIPD 1YSOA 1YUKB 3BGAA 4EI6A 2XU9A 2OW7A 3KPOB 4JPQA 4LPWA 4ZNEA 5ACLA 4AYBA 4NO5B 3ZTJG 4ZZKA 2NW2A 3S34H 3A22A 4Y0GA 1CZ8H 1P7QA 1UGNA 1LEIB 1MCEA 3BPCA 1NEZG 2C4XA 5CU9A 5LHDA 4APXB 2X1QA 1A6PA 1WVZA 3OPZH 4HU2A 5DJ2A 4QHLA 4ONFL 1P7HL 1EEYB 1O9WA 4PRIB 2ZKMX 1BAFL 1Z9NA 5EZIL 3BPLB 3EXJA 5FUOH 2IPTL 2XVBA 4LMQI 3JWNE 4APQC 4J3VA 3IRZA 3MMEB 2GIXA 4ZT1A 4Y2OA 1VESA 12E8L 2ZICA 4NQEE 2V2TA 1UD3A 1J5OH 1C5CL 1GJWA 1OPGH 4Y16D 5D7IA 1PLAA 3MZTA 4JL1A 3QQ3B 5I74B 4UB0L 2OZ4A 1F4WH 2CMRL 2VYRE 4KKBC 2FO4B 2J44A 1U8OA 1OSZA 3QORD 4LHUD 5GRVK 4HIHA 3K5SA 5G4NA 4FJ6A 2NW2B 2ICWJ 5JDJA 3ZUNC 1KGIA 2DM2A 3GSQB 4R0LA 3VX0A 3RPIB 3FOMA 4AY0A 3PWJA 3L2NA 2GITB 2RA1A 3BPCB 3FH7A 2XQYA 3BPNC 5IROC 1OF2A 3RFRA 3O3AA 5L9DH 2HVBA 4NUGH 1UM6H 3Q8AA 4GQRA 5BJTA 1NCNA 3PL6D 3HIZA 1KNOB 5FA3A 1NBVL 3ZDYF 5I5MA 4Y2OB 4NAJA 2V2TB 2NNXA 4MA7L 4YGAB 4WY7L 3SDXA 3MFFA 3GMQA 5D7IB 5C0JB 5KYUA 1P5UB 4NKMA 3WO4B 1TUPA 1NC2D 2HKFH 3NIGB 1CD1A 4LQ1A 1ZK9A 4WQOA 4RAHA 1ZEAL 1U8OB 3U2IA 4EDXA 2BNRA 3S37X 3ARPA 2E9BA 4HIHB 1TZAA 2DQHH 2DM3A 5C0BA 4W9EC 4W81A 3WDIA 3JBG7 3UO1L 2FD6L 2BDNH 2CJUH 4FHKA 1EZVX 4HJUA 1ZDSA 2JK5A 3FOMB 4LIQL 3B2UD 3HS0C 4NP4H 4GW5A 5C0AE 2NYYD 2BSBA 3PDOB 1OF2B 4DAGL 4LLYA 4XMTA 3O3AB 4G80A 2C3VA 2A6IA 2X6UA 4HUNB 3VFPA 2VSKB 4JLRA 5DMGC 1CMOA 2O72A 5FA3B 1FNEB 3FFDA 1JHKL 3ARFD 3SDXB 3V5HA 1FFTB 4ALAC 3MFFB 2VXQL 4FMKA 2Q76A 3GMQB 2VN7A 3Q2WA 4TVSa 1ZLWH 1M7IA 5KYUB 4NKMB 1FL5A 5FM4A 1J8SA 1YY8A 1CD1B 3E7JA 4JQXC 4Q9CA 3BPOB 4I85A 4M7KL 4DKEH 1I7RA 2ZQKA 3ZE2F 2BNRB 5LCVL 5FYKH 4PJIE 5C0BB 5C0GA 3WUZA 3RKPA 1ZJBA 2NZ1A 1I8IA 1OIOA 4GW5B 3HVNA 4ONGH 1IE5A 4LLYB 5DVPA 3V6BR 2CIKA 4G80B 2C3VB 2A6IB 3VFPB 4JLRB 5GXBB 4PJ9C 4MJJA 3IF1A 3R1GH 4N2CA 3BT0A 3BD4A 3FFDB 2J71A 5DFVD 4K7PH 2APXA 2OS7A 4G83A 2VC2H 2R69H 2ZAIA 5DWUL 4YDKH 4KTDH 5GZND 3TJPA 2Q76B 3KNBA 4Q9BA 1FH5H 1KUMA 5I82A 4N3UA 4GRWH 4X9YA 1YY8B 4JRXE 1FSKB 4L0YA 3C08H 2VN3A 1YY9D 4OIBA 4E9QA 5GRVL 2EABA 2Y6TE 4ZRGA 4AENB 1NFDA 5C0GB 1X7TA 3CCHB 4C56E 5AUMA 4Y89A 4OV5A 5L88H 1I8IB 2QKIB 4GW1A 5TDPA 3HVDA 1N70A 2OXHA 4G7YL 4ODVH 4ZMVA 2E47A 3D12B 2CIKB 3QFJD 4BKLA 5IHWA 1ZK5A 5MERA 5JPMB 3EGDB 2MSPA 4AYFA 1WTGT 1I1CA 2WXRA 4XVOA 5E2VL 5TQ0H 1G7HA 1VFBA 4BK4A 2P5PA 1A4CA 4IRJA 2EH7L 3QDGD 4HF5H 1IAMA 1WBYA 4U3CA 4LVOC 5I17A 3D09A 5DJ8A 4KO6A 1MWOA 3UROR 1MCLA 1BCIA 4CDHA 4NNYA 2WLIA 4MDRA 1RXLA 1CDGA 2Q3AA 2NZ9D 1HESA 4OZGE 4N90E 1NFDB 4NM4L 3N6YA 1TEFA 4HK0B 3H2PA 5AUMB 5EU3A 1X9LA 3F7KA 4OV5B 5TDPB 4QRQA 3F01A 1G6RA 1M2OA 3G6DL 3WFCL 3ATDA 3I74A 2OXHB 1BVNP 4MDIA 2C34A 2YQBA 4RMUA 3FTXA 1LEGB 3PPSA 3LD8B 4OFYA 2C9AA 5CIPB 3VXMD 3T3MF 5CJOL 5MERB 2X2JA 1E6OH 2K6WA 3I85A 3I9PA 3BAYA 1UWEH 3IDUA 5IB5B 2CO1A 1AACA 4AYFB 1ZS8A 2GTZA 4HHAA 2CRZA 5AAMC 1R5VA 4PGEA 1G7HB 1VFBB 2X4RA 1JHLL 3FC8A 4H4NA 4IRJB 1TZIA 4L1SA 5T33H 2WWKT 2C3GA 2D0HA 1L3WA 1Q72L 2DEWX 4NUMA 1LO5B 5DJ8B 3EAKA 3AUWB 5F0LB 1O6TA 3D0VA 3N85H 3VACA 3GEWB 1SQMA 4M48H 4HZAA 3QJFA 4NNYB 2WLIB 3EOYG 4XPBL 4ES8A 4DGYH 1KGCE 3F62A 1BAGA 4WWKA 3P69A 5EU3B 4NQSA 4BWUA 3GZKA 4MGXA 4QRQB 4EIZC 5FW8A 4RMWA 3WXVL 1G6RB 1MFAL 3WGUB 1SMDA 3UAJC 3HUJA 4MDIB 4N2GA 3HC0B 5C0NC 5T3ZE 1S5IL 1SFDA 2FHCA 3SE8H 5HD8C 1YEJH 3ZLQC 3JWNC 2YD9A 2EP6A 4FLRA 4NKQB 1V8HA 1KLFB 5A16A 2GTZB 2H2PD 1ZS8B 1XWVA 1FWXA 1R5VB 1AR1D 4HHAB 4PGEB 1N12A 1DJYA 2R29A 2FK9A 2X4RB 4HVBA 1RIVL 2WANA 4KQ4L 1G5GA 2WZ5A 1QBLH 4K07A 3EJUA 1DL7H 1NA8A 4NN7C 4YBHA 1LO3L 1GOHA 3SE3A 4UTAL 3D0VB 4F91B 3QISA 1SY6H 1N26A 1HE8A 4MAUL 3W56A 3Q43A 1OCOB 1ROCA 2BERA 3VE0A 5GGSA 2GI7A 4MS8C 1RZIA 4F20A 4WWKB 2IMNA 3RNKA 1CE1L 3Q5OA 4NQSB 3ZE0F 4ONHA 4J3UA 2A6DA 2WIIA 5EIQA 4OLVL 4L23A 5BUAA 5DRZA 3O4LD 3HUJB 5KSAC 1N7ML 3C6LD 3JQOB 1EFXA 3D4YA 3QO0A 4N0YL 4UAOC 4HOMA 3CZUB 4MWFB 1WFUA 5JHMA 2B39A 2RALA 2VNCA 3QI9A 4NZJA 2IAND 4OLEA 4R5VA 3LHAA 4XP1L 4FA7B 3MQIA 2DI9A 3IJEA 1PZCA 3RGVD 3JWNH 4B96A 1QVOA 2WLLA 2AJ3B 3MBXH 3IJ8A 3VFUB 3C8KA 3ZZ1A 3BUPA 1U8JA 3VXTA 3QJRB 3BKYH 2B2XH 3ZX1A 2WD0A 4BZ1L 2XZAL 5BS0A 5I66A 5I1EL 5A7BA 1P84J 2AK4A 1LK2A 1FC2D 3VE0B 4PCTA 4DPCX 5GGSB 1S6NA 1RZIB 2C7FA 3ABGA 4I3GA 4LRIC 5EORL 2XHNA 5DJAA 4ONHB 4R2GC 2WLZA 2A6DB 2WIIB 3D34A 2H3XC 1C5BH 1CT8A 4XWGL 5IJDC 1T1YA 2VDOH 1E3XA 3II2A 5D5MF 4ZOCA 4L29B 1NEPA 2O6FA 3QO0B 4L3EA 5I18H 2WN3A 3QI9B 2H6UA 1R0AH 2CR6A 1HSBA 3ZRCC 2EH8H 3OXSB 3IJEB 3PFUA 4A2GA 1GZPB 1QVOB 2WLLB 1Q0YH 1NMCC 3C8KB 3C60C 3SE9H 2CBOA 3A47A 2JELH 2J8UB 1NGQH 2ZUWA 1U8JB 3EADA 3FO9A 4JO2H 4OCRL 4H8WL 3VXTB 5BS0B 4MQXD 2N01B 1ZY9A 5I66B 3F83A 4JFOA 3DSNA 4UZGA 3GYRA 3AXHA 1GGUA 2EUXA 5IJCC 1JGDA 4LNRA 5TFSL 3U4EA 2WZPD 4ENED 1SXAA 4DP1X 3BVXA 5DJAB 1IU1A 4MRCA 2Z35A 2FBJL 1CT8B 3MV01 4IYKA 5I8KH 1KTLA 2DIAA 3B1UA 3FHAA 2HX8A 4NKIL 1PL3A 5C0BD 4LVNB 5LWYL 1X5FA 1A7NL 2ESVB 2KZBA 2R59A 1KXVA 1HSBB 2HSIA 5HHQA 3TH3T 4URTB 2A0LC 5JW4M 1VADA 5BVPL 3RWIB 2ENYA 2EADA 2E56A 4XX5A 3FO9B 2WO3B 5LBVA 4P2OC 2X88A 5AW7B 4OSUL 4JFOB 5AW3B 3DSNB 4M8QB 4Y2DC 3TLRA 1Y1UA 3VI3A 3VA6A 2X3BA 3NCYS 1PLGL 4AC2A 1NCCL 1JGDB 4LNRB 2KZKA 4I0PC 4KHTL 4WEBL 3TEWA 3U4EB 2I26N 3PNRB 4W9DC 2VQ4A 1AXTL 1RIUH 1EAPA 1IO4C 4L3FA 4NZ8A 2Z35B 2YD2A 1X5AA 1KTLB 4M5ZH 3ZL2A 4KUZH 5GS0D 2WPGA 4XN7A 4KJPC 1Y6NR 4N0UE 3UTPD 1KEMH 4AK1A 1TSRA 3T3PF 3TIEA 1IFRA 3QCVH 4R4FL 1ZLSH 1E65A 3FF8A 4H13C 2F19H 5HHQB 1KPVA 2K6YA 4I0CC 1NCHA 2VZSA 2H0EA 3O11A 1GOFA 3QWOA 4JPKH 1ICTA 1VADB 4XP5H 5LAPA 4FF9A 2R69A 3EYUH 5IW1A 2FT6A 3K74B 4WI2A 1U8HA 4PD4J 1OP4A 1TTBA 3UTSB 1GOGA 1FL6A 4JQIL 4XCYA 2RBLA 3VI3B 2VRAA 5I1LA 2HT4C