4ICXA

N-terminal c2 domain of human cep120
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
133
structure length
133
Chain Sequence
SKSDQLLIVVSILEGRHFPKRPKHMLVVEAKFDGEQLATDPVDHTDQPEFATELAWEIDRKALHQHRLQRTPIKLQCFALDPVTSAKETIGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKSEIQISIALETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Centrosomal protein of 120 kDa
publication title N-terminal C2 domain tandem of human CEP120 shows lipid binding properties
rcsb
source organism Homo sapiens
total genus 24
structure length 133
sequence length 133
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4icxA00
4EZLA 4J6IA 2BWQA 1DJWA 2X38A 4IHBA 1E8WA 3N5AA 1CJYA 1UOVA 2N1TE 2RD0A 1HE8A 4BGDA 1K5WA 2WXIA 2KI6A 4FHJA 4L23A 4TUUA 4KZCA 2ENJA 3TJPA 2CHDA 3QARA 4FJYA 1BYNA 3APDA 4WWNA 3T8MA 5H4ZA 3ENEA 4F92B 4AJWA 4LDCA 3L17A 4HLEA 4GB9A 4WAFA 1DJZA 4LCVA 2CHWA 3DBSA 5JHAA 4FULA 4AOFA 3HHMA 2A5UA 3QAQA 2Y3AA 4DNLA 4LT7A 1UOWA 3OHMB 4FJZA 3QJZA 4ICXA 3TWYA 1WFJA 3IBEA 3PS6A 1DSYA 4PS3A 2Q3XA 1DJXA 3ZVVA 3S2AA 3SD5A 3RDJA 4ANWA 3JZYA 2WXKA 3IM1A 1BDYA 4G11A 2YRBA 3APFA 2K4AA 2CJTA 2WXRA 1E8ZA 3MJWA 3L54A 1E7VA 1W15A 2D8KA 1YRKA 4F93B 2WXPA 1A25A 3PYCA 2QZ5A 4PS8A 4NP9A 2QZQA 2ZKMX 3QK0A 2CM5A 3F04A 4NPJA 1QASA 3F05A 2FJUB 4L1LA 3NSJA 4TV3A 5G2NA 2WXMA 1BCIA 3L4CA 4KITB 3QR1A 2ISDA 1GMIA 3L13A 1W16A 5CCGE 1DJGA 4OVUA 4F91B 2CJSA 1V27A 2Z0UA 3LJ3A 3FDWA 4WEEA 4IQHA 3B7YA 4TS6A 5T8IA 2ENQA 4L2YA 4FLHA 3DPDA 4HVBA 3QR0A 1E90A 3M7FB 4NS0A 2LHAA 4QAMB 4QJ3B 3W57A 4XX5A 5CCHE 3KWUA 4FADA 2DMGA 2B3RA 2CM6A 1RH8A 1E7UA 3OAWA 3ML8A 4FHKA 4JPSA 4WWOA 3ML9A 3KWTA 4XZ4A 1RLWA 4ICWA 2A4ZA 5KJ7E 5G55A 2V4LA 3R7RA 1DJHA 4ANUA 3PFQA 2NSQA 3NZSA 4GNKB 2R83A 3HN8A 2WXGA 1DJIA 2K45A 3CSFA 4NPKA 4FA6A 3P2BA 4KZ0A 2DMHA 1DJYA 2WXOA 4BFRA 4MJJA 1RSYA 3F01A 4QJ4B 1E8XA 2K8MA 3PRZA 3L08A 2FK9A 2NCEA 3F00A 3ZIMA 3TL5A 4Y1SA 2K3HA 3L16A 4XE0A 2CHXA 4QJ5B 2EP6A 1UGKA 3HIZA 4URKA 4ANXA 3APCA 5EDSA 4A55A 5JHBA 3NZUA 3ZW3A 3FBKA 4ANVA 2Q0ZX 1WFMA 4PS7A 4DK5A 1TJXA 4WWPA 4F1SA 4Y1TA 5H4YA 1TJMA 4L1BA 5CCJA 3RPBA 1E8YA 1DQVA 2WXHA 4V11A 2WXJA 1QATA 2WXLA 4EZKA 4EZJA 2WXFA 2WXNA 2UZPA 3PREA 2WXQA 3L9BA 2ENPA 2NQ3A 2YOAA 3CSTA 3W56A 2JQZA 3GPEA 2CHZA 3R7QA 4OVVA
chains in the Genus database with same CATH superfamily
2YAEA 5FO9B 3KGRA 1AGBA 1WQVT 2IQ9H 4TYUA 4U1LB 4ZX6A 4DAGH 2G4GA 1I1FB 1ET8A 1I3RA 3HTLX 5EOCH 2E59A 1WIOA 4O00A 4E9VA 4NERA 3D2TA 4ETQB 4FC3E 3I6GB 2JB5L 5EUOB 2FH6A 3QRGH 1SY6L 1AZNA 4PCYA 2X2HA 4IKJA 1JZFA 3DURA 2VAAA 4PS3A 5B1BB 1DHKA 4NXSA 5HYJA 4H8QA 4PJXE 3PWLA 1UXSA 5IHLB 5A2KH 3SYOA 3QUZC 1KPVB 4GMSL 3H4HA 1UD4A 5D5MA 2AEPH 1ZLVK 3I75A 3CAFA 3UZEC 1J8RA 3WEMA 5JHLA 2KBGA 5E0QA 2PABA 4WI2A 1NKRA 3QORB 5CLYA 2ALWA 1AZRA 1L0QA 2JXMA 2Y1ZA 4X8JB 1LEKA 1FZOA 3F84A 1FVDA 4W70A 3G6JE 1G0DA 2X9WA 4BH7A 1AJ7H 4LGSB 4PJAE 2WQWA 3KL3A 5IHHA 3FTGB 3KD4A 4I18A 5FPIA 4NQDB 2X4PB 1G6RB 1MWAB 4N2CA 5GJSL 4XMTA 5BV7H 1OGAB 1UASA 3WEBA 1FP5A 2X1XR 4TULL 1G9NL 2UXFA 2XWTB 4NCC1 4AYFB 2JV6A 2QTVA 3WJLC 2WZPA 4G6FB 3KXFE 1VADA 3QXTA 3T71A 4RETB 3WJMB 1T5WB 4PV8A 1NGQL 4XP6L 3AWEA 1XH0A 4HXAH 1KZQA 3CFCL 4XI5C 4Z5RA 1DDTA 1OAUL 3G5ZA 4IBTA 1KNOA 1ES0A 3UTTB 4WDIA 2VLJD 3ZDWA 3V0HA 2ICWA 5DQ9B 1ET5A 5AAMA 4AKOA 4UQIM 4KTEH 2IGFH 3EO9H 3VQ1C 5E1QA 1XF5B 3D30A 3UTSA 4H8PA 3TEZA 3O3DA 1OOWA 5D7JA 4F8QA 2VZSA 1L9RA 1OY3B 3BUDA 4CADB 3ELQA 2XJLA 1AZVA 3ZYZA 2VQ1A 7PAZA 1D5BB 5FA4B 5K39B 1MJJA 5CSZA 1AQDB 4UZGA 3BVTA 3KXFD 2ZWKA 1HIMH 2OMYA 3HPJB 4TNVF 4UWQB 4J3XA 3X2QB 2V7NB 5AAPA 3OB0H 5CCJA 4Q4EA 2YJQA 3P4NA 2AJYL 2RQEA 4NRYB 4H2AA 4L0ZA 2NRDA 3DETC 3Q8BA 1KLGA 3UADA 4E41A 2WUCH 4D2NA 5I8OL 4MRCA 3BZFB 5E4OA 2EE0A 4NZFA 2B5IB 4M5YH 4PW3A 3T1FA 3O6LL 1VGKB 4IHBA 5FO8A 3VFUA 1MCFA 2X89D 3AT9A 3L6FB 2Z93A 4HIHB 4B41A 4MD4A 3BE1L 3PHAA 3UX9B 5D1QA 3UTZA 5IROD 4AMWA 3KPQA 4ZFFA 3ILDA 2B2XH 2CLZA 5IVZA 5IBLC 3TJHC 3BKMH 5IHWA 3NFSL 4J28A 2BP5M 4WK4B 1FO0L 1RCYA 4Y4HC 2XZCH 1B2WH 1T1WB 2FEEL 4OFIA 3RHWK 1RZ8A 4G1MB 3HS0B 3OR6A 4BFIA 2I07B 2K1MA 3QDME 3QFDA 4FQQB 4ZUUA 3HR6A 2UZYA 3BUPA 4P23D 2F68X 2F74B 2NYKA 2WAHA 1Q9LA 4HF5H 4JQIH 4P4RB 3FUNA 2VH5L 5DWUH 4G2AA 5IWLA 5JXAH 3DOHA 3VDCA 1JYXA 2ZX5A 4ZOAA 1E2VA 1RJZB 1J9RA 4KITB 4GKNA 4YSUA 3O4OC 2BOCB 1Q0XH 3SHSA 2OW7A 4OFKA 1H15B 2CUMA 1NGPL 4MJ5B 5DUML 5EO1B 2CLVB 3DROB 4F2MA 2JI3A 1RPKA 1T2QH 2XTSA 4OFYA 4PPTA 4PYGA 4RQQA 2R2EB 1OV8A 3IDXL 5F1SA 4LP8A 2X9ZA 3B83A 3QDMD 1F3JB 3LZRA 3MXVL 3MRFB 1OP3K 4ZQTA 2V17L 3BEVB 1M57B 3LX9A 3HB3B 1NCNA 4LSVH 4TQ8A 3P3YA 1F4AA 2WOBA 4ES8A 1CD1B 1KJ3H 5K59E 5C3IA 2LU3A 3HN8A 5ALBH 1R6VA 2Q6WA 2H8PA 4FERA 3C2AL 4HIJB 2OXGA 4MBOA 5JHDE 4GG6B 1OT4A 4PJBF 2MCPH 2XDHA 1E4HA 4J1UA 4ODWA 1EJ8A 4XCYB 4OLXH 2G0LA 3V2AR 3C5ZB 4JR9L 2WUBL 1OVZA 2FCBA 1OLZA 2YD0A 4N0FB 4P4KC 5IK3B 3RY6A 1TJMA 4M7LL 3NCCB 3G08B 4K55A 1HSBA 3CX5K 3BI9X 2ZF9A 3FU7A 2K6ZA 1IGYA 1QQDB 2V2WA 3VFOB 2O93L 2ENPA 2J8OA 4GLRH 4HCRA 3IMBA 3Q6FA 4XPBH 4AV0A 4Y8AA 2ESVE 5E94A 8FABB 3QJTB 3QCUL 4XPHH 5F9JA 1UJ3B 5HHMB 3VFSA 1AS6A 3GSOB 3H42L 4IIQB 5LXGH 5JHDD 4KK9C 1TMCB 5I8CB 2MHAA 1DZBA 5DZPA 3QO0B 2ATPB 3O3AA 3AT8A 4N1HB 4OJFL 4N4YB 3RFZB 1RFDL 4ODTH 4WAFA 2OP4L 3DBSA 3CFQA 2EO1A 4DIXA 1I9IL 5EN2A 2F1AA 3EH3B 3N42B 4BDVB 4FYTA 1HKLH 1OSYA 1RULH 3IDJA 5CBAA 3W11C 1HILB 2LE9A 4HBQA 1WCBB 4H0IA 1A9BB 4Z0XB 5LDUA 4PRNA 5I28A 1NOAA 1V54B 3QNXB 2DB8A 1MHHB 2BSSA 1CGSH 4WI9A 4DCQA 2NOYA 1J5OL 4M00A 2R4RL 4JE0A 1VEMA 1FZJA 5KBNC 3WHE1 2JELH 3AREB 3SKMA 2PCFA 4NP9A 3FCUB 1LXMA 2KZ1B 3DO7A 2HRHA 3O6ML 4OH2A 1EPFA 5D7EA 4C4BA 2B9BA 3ZTEA 1U3JA 3C5SB 5JIMA 4LKCB 3MNDA 2B15A 4OZHA 2PWHA 4ODHL 3T09A 2BS9A 2GBVA 3NJIA 4JFVA 2FT6A 3Q1SL 4NZTH 1DQDH 5BMFL 1A14H 2F1BA 2OYLA 5I6XB 4IKNA 3DMMA 4XP4L 5F72S 2IG2L 5DUPL 3QEQB 4OF6A 2Z31D 4PGEA 1PX4A 3S4SG 2DF3A 2FQGA 3O0RL 3RILA 1UUSA 5CZVL 1LMIA 1AS7A 2G3XA 1Q1JL 4PJGE 4DW2L 1JVLA 5IBUB 3O4LA 1A5FL 4NRZA 3FUMA 2DQMA 1TLKA 4JN1L 4R96A 1NGWB 2A74B 2VDMB 4GUPA 2UVEA 4P5SA 3REWB 1BVLA 5I6MA 1JZHA 4AT6A 3DSFL 2FWOA 3MLRL 1Z9SB 2WNKA 5JDSB 1UOLA 4JPKH 2EDJA 4DPCX 4Z77B 2QQQA 5KBPA 5JHBA 1HH9A 3ZHNA 3ZW3A 4GW5B 1IGFH 1M7IB 2PYEE 2WLJA 4H1LA 4JDTL 4M48H 3KHQA 2BIMA 3ETBJ 3D50A 3MLSH 4LSSL 4KFMA 4I48A 3KVQA 5F3BB 3GWJA 4Z7IA 5I15H 5DMIL 1PCXA 5ABAA 3ZT6A 5ICZB 3BFOA 1TTFA 3V4VB 4ZAKA 3ATAA 2YWYA 4YFLI 2JJVA 2YBGA 3OKDA 1JHKL 4PV1C 2PR9A 1J18A 1X4XA 1EFXD 4XB8A 4ZFZB 4POYA 5C0JA 3WS6A 3QWOA 1YN7B 1KBGL 5DRZB 5F8QC 1YEJL 5DMGC 3GZQA 1I82A 3HAEB 4NQVA 1Y18A 4B9ZA 4NQEA 2J21A 2PYED 1JWSB 1AHWB 1OGTA 2KQMA 4U1IA 4BXSV 4FG4A 2QKIB 3NEOA 4JE4B 1U8KA 4M61A 4JZOB 1PZ3A 3GLEA 1DVTA 3U4EB 3MRLB 4BIKA 1WRFA 3L4WA 3QUXB 4G11A 4X8GA 5C0IB 1YZZA 4MQTB 2VL4A 2PWFA 1WGVA 2CJTA 2YFOA 4PFEA 4XVTL 2YA2A 3O81A 4XP1H 3OKKA 5LCVL 3U30C 3TH3T 3HG1B 2EIZB 1R3KA 2I32A 3LZQA 4JJ5B 3GMLA 3LAFA 3CU7A 2K4WA 3GF8A 1EEYA 1EBAA 1YY9D 1NEPA 2O5XH 3IVKA 5E7BA 1I9EA 4ZZFA 2D0FA 5ILTH 2A9NL 3WIFB 5GS0C 1MREL 3HC4H 4CMMA 1CYWA 4JFHD 1JPSL 2IDQA 3SKUD 3K1DA 1FPTL 2IFGA 2Z34A 4N20A 4HIIB 1OF2A 1K4DA 2E6PA 2KS0A 4MNQE 1FNAA 4ZPVA 5F7KC 2K78A 4P5TA 2DI8A 3D0VA 2GEEA 4RGOL 3DURB 5INCB 4Y2DA 5J1SC 4M7ZB 5F7AA 4BZ1H 5GZOD 4E0RA 2EXTA 3T2NL 2AJXL 1UXSB 2BC4A 1HNFA 4YZFE 3WUZA 2CUHA 3CCHA 3IFNL 3CLFH 4POZD 1X5HA 5D5MB 2VXTL 2ADFH 1AZBA 1B9ZA 1H9VA 3CVDA 4FA6A 4Q9QL 2X0VA 3C8HA 3DSNA 4UV4H 2XC8A 3ARBB 3OLDA 2O26U 2CA3A 2JXMB 4LHUA 4N87A 4W9CC 1LEKB 3D3VA 1FZOB 5FHBH 1FVDB 2MOVA 1OARL 4QJ5B 1T03H 2Y2TA 4BH7B 4JM2C 1F1DA 3KYKH 1YCSA 2XIBA 4I18B 4MNQD 2CR6A 1FVCB 3A6BL 4G7VL 2XX1A 3NABL 4UM9D 5EF3A 2TSAA 4NO0A 4R4FL 2MKLC 2HKFH 4UQEA 3QISA 4FZEH 4N0CC 3ZKNC 5KVDE 4PRPE 4E9RA 3N43F 5DO8A 4Q6IC 5B3JE 3L4TA 1BFSA 1U30A 2B1HL 2DQDH 5FM8A 1KACB 2RBLA 2JK5B 1TZ8A 5D71H 5F0LB 1CDHA 3VXSB 3O9WC 1OOAA 1EFQA 4EI5B 1LP9A 1ZMYA 1HEZA 4KROC 4WDIB 4YLQT 4IRSC 5FFGA 3QSKB 1YQVL 3RZCA 2ICWB 1H3GA 5E1GA 1JVOA 3RBSA 1C08A 4MLSA 1ZLUH 2EIMB 3P0GB 4NLAA 3UTSB 4BWTA 4OIIH 3O3DB 5IQNA 4IGBD 5D7JB 2E6JA 4NNPH 4RGNC 2XZZA 1AKJD 5I5RA 2FBJH 3ALPA 3T2QA 4PCTA 1XSOA 3INUH 5CSZB 3DUSB 1E3ZA 2OMYB 4QHNB 1CI3M 2ZXEB 3EGXB 4I3RH 2UWEE 5IGXL 3B2PA 4HALA 5D2LA 4ELKA 1JZJA 3TNNB 1QPXA 3TFBA 1F6FB 1KLGB 1HHIB 4E41B 4Y4KD 4MJIA 4FZ8H 3IU4L 3WIIL 4WUUA 3ZDZF 5KSAA 5T5FL 1KJMB 3T1FB 5GIRA 1MAMH 5DQJB 5FO8B 1IO4C 2VDQL 2X5PA 3UBXG 2NY1C 4PVBA 3BGFB 3OHXC 2Z93B 1HL9A 1MWOA 2IAMD 4MD4B 2SEBA 3SBPA 2R51A 3KPQB 3EOBA 1WFTA 1KFAL 1UKQA 2P43B 5IVZB 4UINL 4HJGA 1F56A 1A8JH 1JRHH 4Z7UB 3R0MA 3QXDA 4K8RC 4BJLA 3OAZK 2EDRA 1NFAA 2G9HA 1NAKL 4A2EA 1J5HA 2GT9A 1GIGH 3VSUA 1KYFA 2K3TA 2QLYA 4LCCC 4PG9B 4GSDL 2EUVA 1MI5E 2O6CA 3OKYA 1NGZA 4JQVA 3RGVC 1BA9A 2K45A 2KLSA 3QFDB 3NCWA 2E7LA 2VN7A 4PJ7B 1DJYA 4ZUUB 4Y19A 4XPTL 2UZYB 4NKQB 4G9DA 4AYMC 3HUJF 3GBLA 1S3KL 2GTZA 1IGMH 4R26L 5AAWC 2XZQL 1Q9LB 4FG6C 4PWIA 4UMSA 4JK0D 3F8UB 4U7KA 5E6IC 4L0PB 1KV3A 4R90L 2OA9A 3V5KA 1D6VH 1RVFH 2ITDB 1MFEH 2EDBA 5HHXH 3OAYK 4LOUC 2RMNA 4GKNB 3IJYA 4MWFA 1OM9A 1AGDA 2W60A 4FP8H 4RQQB 4UQBA 4JEGB 3X12A 1MI5D 2DI7A 1FSKB 5C0RH 1FFOA 2ZKHH 1GPOH 4JB9H 4M8QA 5CGYD 4NRXA 4OFQA 7CGTA 5I6NA 1MJ8H 3BPCB 1HE8A 3RVVC 4TOYH 1XB3A 5I6LA 2CCLA 4RMBA 3MGTB 1D5IH 4N2MA 3FB5B 1D5RA 1NKGA 4WWKC 4DQOH 4OZIE 2Q6WB 5GS0H 4WW2A 4HLEA 1WBYA 4LSTH 2QPEB 3GSNB 4HJSA 2BIPA 4OCWL 2W0PA 1C9SA 1IBHA 1EDHA 1GGBH 2YAQA 4H8UA 2YPVL 2H0JA 4J1UB 4ODWB 3S34H 1GS8A 4AY0A 3D8MA 4AG4H 2C4FU 1R75A 4PG2C 4C83A 4OQ1A 4W9FC 4XO8A 2A9CA 4B5EA 4M02A 1EZUA 2ATAA 3RVWC 1CXIA 3D25A 4UTAL 4KUCD 4YSTA 3U7AA 4TRPH 2QEJA 3FU7B 1IGYB 4KTYA 3Q6FB 3MACH 3E7JA 1I7ZA 3FB7A 4GRWF 5E94B 1EAQA 4L1LA 1QSFA 2FLBT 2X4QA 1NC2A 5BO1L 4K2UH 3S37H 3VFSB 2OQJB 2GI7A 2PYFA 1JGUH 2V9TA 4Z0BL 6FABH 1QEXA 1P5VA 3DI3B 4BFOA 1MJUL 2MHAB 1JOIA 2CJSA 3B4NA 1AE6H 4WHYG 3VXUE 2IJ0C 1RU9H 2CK0H 2HFTA 3MLWL 3HE6B 3O3AB 1U8JA 2VRAA 2R0ZH 3KWWA 4OLVL 4ADJA 5BW7C 5INDB 4J3WA 3VXPB 1EAPA 1JNNH 3W37A 2MFNA 1RUPL 3MBEB 1FGVL 1I1AA 1EDYA 3TO4A 4LAJH 5FYLH 2F7OA 4OGQC 1SXAA 4A63A 1MIMH 3IDJB 1KB5A 4HIXL 3S7GA 2VLKB 3SCMC 3UYOD 3MJ7B 5IOKA 5KYXA 1AS8A 2KT6A 2IVFC 2BSSB 3WY2A 4DCQB 3P3TA 4BSJA 4GAYA 4F8LA 3GMQB 1FZJB 2ARJQ 4L8DB 5C0CE 1XSKA 3L4ZA 1E4WL 1NFIB 4X5RA 5HJBA 3SKMB 1YC7A 3S5YA 1T1YA 2HLFD 2PCFB 3OMNB 3GRWA 3ARGA 4YQXH 3DO7B 2CQVA 3LS4H 15C8H 3HIZA 3U4BL 2PW2A 3QC5X 4V2CB 1ACXA 1D2PA 5EHFA 3S2CA 4HHGA 5FUCC 5FUOL 1JNJA 2PCPA 3MJ9H 3FU6A 3ULVC 1WUZA 4FFVC 4Z95H 1QR1A 4L3EB 3DMMB 3DARA 1JPTH 4N8CL 2ZX7A 2OR9H 1KTDA 2I60L 3L95A 1LEIA 1H9DA 3MFFA 3CH1A 1CT8A 1Q0YH 2AXFA 3OL2A 3RL1A 4LE8A 4GKSB 5FYKL 5C0CD 1IKNC 2OCJA 4QXGL 2WV3A 1RKRA 3O4LB 5DUJA 2H2PD 4X5PA 3BJ91 1ZLSH 1X5FA 1ZANH 4NRZB 3VWJD 4GUPB 4HKZA 1QRND 2LTQC 5B8CA 1BVLB 4QHKI 2MIZA 1B4RA 4PLOB 2FWOB 4PIBA 1XR9A 3QYCA 4ZUVA 1PKQE 1E9OA 3AS0A 3SPCA 3MODL 2WSKA 2HFGL 1SHXA 4JFDA 1XMWA 1HH9B 2ZUVA 4WGKA 4Q4IA 3UPRA 4Z8FH 4OI7A 1OE1A 2J1ZA 4H1LB 4X7TB 3B7SA 3MUY1 3KGUA 5KTEH 3QZNA 4OI9A 2IDSA 3DPBA 5E6YA 2QTEA 4GRMA 2ZKMX 3MRDA 3UAAA 4W9EC 4OM1L 3IJ8A 1PW3A 4Q56A 5HHNA 1YO4A 2MQ0A 5DF0A 4ZAKB 3QEGL 2Y06H 2APVA 2OZ4H 3OKDB 2FGZA 3GUTA 4G80A 3QWOB 1MF2L 2Q3AA 3FQNA 2DQUL 3I6LE 1L7IH 2HRPH 4CJ1A 1Y18B 3FUFA 1M7UA 5TDNA 4F7CB 1FA4A 2JTDA 3PFUA 3QFGA 5KANG 1I75A 3KYNB 4LLDA 2R15A 5MHSE 1GYAA 2YIHA 4FHKA 4FL4B 1J5DA 4ODSH 4R2GC 4FCHA 4P5KB 3QG7H 3F58H 4XXCC 4GMTH 2X53A 3O6FB 4M61B 5CZKA 2GJ6B 3NCJL 5BCAA 2YAPA 3WNMA 3MRNA 2GAZB 2FR4A 4JHZA 3BUTA 1BV8A 2UVFA 1A3ZA 3ZE1E 4OLYH 5KSVA 1HNYA 3U36A 5GGSY 3ZUNC 3OKKB 1HCYA 3R19A 4AYSA 3MCYA 3CBJB 2PPCA 3S5ZA 3RZWA 3GXIA 1EEYB 4GS7C 4ALAC 3B56A 4Z3GA 5ABZA 3TZVD 3FH8A 3IVKB 4I3SH 3DKHA 1NMBH 1ODAA 4XX1G 2G60H 3SDCD 4HOZA 2B7DT 2EUZA 1NLBH 1XIWC 3MBWA 1G94A 1N2RA 5AOMA 1D7CA 1EJFA 2F7PA 2PCXA 3EFDL 4PJ8C 4J8RA 3QAZB 4QY8A 1AR2A 2DMCA 2MCG1 4MAYA 1OF2B 4MS8D 4N0UB 1CLYH 3T8XA 2D7TH 1FJ1A 4GFTB 2RA1A 4I4WA 4TNWK 2BCMA 1A7PL 3D0VB 3HHSB 4N2AA 1QBBA 4YDLC 5E9NA 3MOAH 4E0RB 2BC4B 5EZOL 3IE4A 4XBEH 5JW3L 3CCHB 3M1BA 1UCTA 3PAUA 4N22A 3O2DL 1RUQL 3SDAA 5DJ2B 3OX8B 5GS2D 4LLYA 3STBA 4OV6F 2ZE0A 5J12B 3DSNB 4LSQH 3UG5A 3MLXH 5GZND 4ERSH 1ZHNA 2CKBL 3ZMRA 1CU4L 2C8NA 3VXQA 1QNIA 1SXNA 1P7KA 3IGLA 1J0HA 4I1PA 3D3VB 3GXDA 2Q7YB 1EDQA 2F8XC 5I0YA 4R0LA 3VXRB 1HFUA 4ZYKA 5EIIA 4JDVB 3QHFL 5D6CA 3PL6A 5IIEB 5DC4B 5HJGA 3ATEA 3MC0A 4IJ3C 4X9IA 1QBML 2BSED 4I7ZC 2XWBA 4JKKA 3TIDB 2JIXA 1U8QA 4LVNC 4E36A 5FCUL 1JZ6A 4OY9A 2A3TA 3SE8L 5FF6A 3N1PC 4CU8A 1LM8V 5AW1B 3MRJB 3TTYA 1IFHL 4IM8A 1JDDA 2FEEI 4TNGA 4KJWD 2AXWA 2MSPA 1WICA 2VDOL 3HFML 1VFBA 3W9EA 1F42A 2W8CA 1LP9B 4GKZB 4MDRA 5D7IA 5CLWA 4KRLB 1FUNA 4KY2A 4QIRA 1OCZB 2OBGA 4Z7VE 3RZCB 4FKEA 3W57A 2OW6A 2ZAHA 3P73B 2MPAL 1QOKA 3ULVH 1HJCA 1C08B 1LHZA 1SN5A 4NO2B 1QSEE 1NDTA 4W9KC 1C8QA 1UZ8A 2P46B 4LCWB 1LO4H 3UIZA 4ZT1A 1JZIA 3RTQA 5BZDB 2F61A 2H0EA 3JTSA 1X9QA 2PN5A 1KSRA 3TNMA 2NY4B 5FYJH 3QUZA 1RZQA 5D2LB 4C56E 2HRGA 3MNZB 3FQRA 1DCLA 2NT1A 3WYRA 3LKRB 4HV8A 4DTGL 4GQ9L 3FUEA 1NJ9B 2BSTA 3HG2A 1JZ5A 1BQHG 1U2HA 3PP4H 4FQIH 4QLRA 3KPSB 5KSAB 1MCEA 1RIUH 1S2EA 1MNUL 4K7PH 3JWNC 2YXVA 3EGDB 1KTJA 1RZ7H 4NQTA 5EU4A 4HT1L 1EBPA 4LAQL 4N8VA 4XAWL 1UM5H 3T4AB 4E9WA 4Q9BA 1QSED 3HI6H 4Z7NE 5MEQB 5C0AA 5F44A 2B59A 2JI2A 2NSMA 2WLNA 5DK2B 4YAQA 1KCWA 1GHFH 3WFEL 1QFWM 5DD5H 2BINA 4P46C 1TQBB 2X42A 3EOBB 4JQXA 4KXAA 4X6CE 2Y0SA 3CSGA 1U92B 1MRCH 1MFCH 3QXDB 3SB3A 2E9WA 4PSPA 4HUWB 4C56D 2ED6A 4TF4A 4L23A 2DQIL 1J12A 2GT9B 2J25A 4YHIB 1HEJC 4WNQA 3FT4A 1MELA 2I27N 2DLIA 2XQBL 4F8OA 5H4ZA 3GI9H 4ZTOH 3WLWC 1NGZB 5CJXC 4WJ5B 3NJLA 1N7ML 4U6HA 2JKNA 1EUUA 5EU6E 4Y19B 1XWVA 3DGDA 4G9DB 3QUKB 1IJNA 1JBJA 2GTZB 5CHNA 1F6AB 2H2SD 2R1XA 4XPAH 4ZO7A 5I71B 2XKUA 3OBAA 3V5KB 2P5EA 3K91A 4AEIL 1ND0A 3WS3B 1KCRL 4EF3A 5HSFA 1CIUA 1AHKA 1DVUA 2DEXX 2VNCA 4XT1C 2ZAIA 1SYSB 4MWFB 5CWSB 2HKHL 5TE7L 2MQCA 1RJLB 5HJ3B 4CSSA 4QRPA 1SOKA 3F64A 3CSPA 3X12B 4MA8H 4B60A 4KBPA 1NBQA 2OPCA 3KL0A 1FFOB 3RLSA 2XN0A 1MHEA 4PJHE 4M8QB 2VDLL 2CK2A 4NRXB 5EU6D 5IHZB 2C9XA 1AR1C 1NDGB 4ALAH 4GI8A 4UBDC 3RNKA 1OWWA 4GT7A 3TYGH 4EN3D 5A6MA 4HKBB 2JB6B 4QAMB 2LHAA 4PR5B 5FHAH 1BBJB 2EUWA 4WW2B 1VZGA 1WBYB 3O8XC 4X9BA 2I26N 1L9PA 5J7CC 4GG6F 1X5MA 3PCYA 4BKSC 3PXLA 1EO8H 1AG6A 1TJHH 4GRLB 2WYZA 5DRXB 2YBRA 1WHPA 4QWWD 2FB4H 3MHZA 2H3NA 1WK0A 4CJ0A 1CD0A 3A6CH 4JFFA 5D1ZI 4WHTA 1NL0L 1IZJA 1ITBB 3FN0L 4JUSA 3SBWC 3SDDD 1A0QH 5E2UH 2FK9A 4NBXB 2ZSVA 3E3QE 4OW6A 2DWSA 3RWFA 4OLEA 5DJZA 2D31A 3ZKSD 5T3XE 4XNQA 4B96A 1W72L 2XXGA 5BRPA 5KBLA 2X4QB 1NC2B 1MH5A 1NFDE 3LZOA 1HEHC 1WAAF 4G42A 2ALAA 4F1SA 2PYFB 5SWZE 3HCVA 4GQRA 4AENA 3BH8B 1DQVA 2BP8B 1OCRB 1NGXA 2YC1B 3PQYA 4QF1B 1AY1H 2I5YH 2Z8WC 5GRUH 3LHAA 4HAKA 3NJGA 4PVLA 1U8JB 3L3DA 3KWWB 4S2SA 1DCEA 1KTRL 2G3MA 1GOFA 1OO2A 4MA1B 1EAPB 4NC1E 1IAII 3L3KA 2XPYA 1XHHA 1F45A 5SWQA 3U7YL 1I1AB 2V5SA 3K72A 3N1GC 4JFXA 5FCSH 2FBRA 2K7PA 2E86A 5D6DC 3N42F 4N3TA 2Z7UA 1KB5B 1A2YA 5T3XD 43CAB 1FCCA 5KYXB 2RGSA 1A9EA 2LAGB 2K9FB 3GSXA 3KLKA 4S1RH 1SVZA 5ETUB 3EUDA 1AO7E 5SWZD 2GITA 4DGVH 5M7QA 4LT7A 5IMMA 2JSFA 4KY1H 1DJXA 3BAJA 1T1YB 2WZ5A 4ZW8A 4FJ6A 3ARGB 2AANA 1D7BA 2AC0A 1HHJB 2EE6A 5C08E 1T83C 4BHUA 2C3HA 3K7UA 1IVTA 1REIA 2PUQT 3Q0HA 2D03L 1QKZH 5TH2B 4WFEE 1M56B 1MFVA 3ARYA 4P4KA 4N0YH 1UD2A 5AFAA 3D39E 2X6BA 1OP5H 5I23A 1QR1B 1XGTB 3HZMB 3F05A 2DJUA 3BAEH 4NP4H 1KTDB 3JXAA 4XO4A 4K9EC 4WGWB 3C08L 3MFFB 1IE5A 2AXFB 3IF1A 4RISL 1AO7D 5SWSE 4OCLC 1YEKL 4P2OD 4D0CA 2L8AA 4BZ1A 2CDEA 5DLML 3P40A 3T4YA 3RU8L 4KRNA 1V7NL 4AQ1C 3MROB 1FAIH 3DDFA 2WLKA 4QOKA 4TNEA 4X4MA 3ZZLA 4BQ8A 5DZJA 5C08D 4ELMB 4DUVA 3S88H 3ILPB 4HKZB 4JPSA 4XMUA 5B8CB 4WFED 1KN4H 3AJ7A 4JHUA 4AYID 5KJRL 5KOMC 5A6LA 1XR9B 2C9SA 4RX4A 4ZUVB 1E9OB 4ONOA 2AV7A 5FV1L 2EDFA 3D48R 4JFDB 2CGRH 4ZRGA 4FFZL 4N25A 3RX9A 2F53A 4U0RC 5L4MA 5SWSD 3CH8A 5BV7B 4D7PA 1AGEB 5F6HJ 3QR2A 2OJ1A 4NFDA 4XNMA 5EBLB 3ULSA 3DPBB 4PJIA 4GRMB 1N67A 4TVUA 3MRDB 1JGDA 2GHZA 1C5CH 4MZRA 5HHNB 3FHEA 5BRZA 3U7WL 2LU5A 4M43H 4Z7QE 1A4AA 5LAXA 1BFVL 4FQJL 3V95A 2WB1A 4AYGA 3GUTB 4Z7AA 3VDBA 3AGVA 4UAOB 3ARFC 3H0TA 4H20L 4G80B 3NEEA 5F7WC 4KKAD 5F9WB 2UZPA 3A67H 3FQNB 4XB3A 4ZTPL 4A67A 3BP4A 5HVHB 3CSTA 7FABH 3T04D 4Y9FA 4TNVK 5TDNB 5FUZL 3TM6A 1CFQA 3W2DH 5F6IC 1GYCA 1MIEH 4D7BA 3LEYH 5LN8A 1A6WH 3BIKA 1YECH 1FLRL 1IFGA 3TJPA 4PGJA 3QARA 1G87A 3IKKA 4PJFA 4MCMA 4C54A 2VLJB 5DO2D 5AL0A 3ZRSA 2FO8A 3MRNB 3QIUD 1FH5L 1QMUA 1J0IA 1TTBA 4KQ4L 5EA0L 2UV3A 3LNFA 5IROC 5EEUA 4I85A 5KSVB 3T0EA 1TTCA 2MNWA 2YQ2A 3HG4A 1SLVA 4TVSa 1HINH 3FULA 3I84A 1HCFX 4PWFA 3QXVA 1YUKB 2VABA 2QSVA 2CR3A 2K4AA 1FWXA 2NXZC 5ERWA 1FNGA 2IFFH 1DQLH 3MBWB 1WTLA 4O2CB 3WUWB 3PYCA 4PY8J 1NCIA 2QZQA 4NQXB 1UWFA 4P23C 3BD3A 3MRRA 4NPJA 2YUWA 1VFOA 1ZT7A 4YDIL 3T8XB 3U0TA 2XICA 5KS9E 1FJ1B 5E8DL 2A9MH 2XI9A 4I4WB 2FX9L 2EDQA 1WUNT 1EX0A 3H7LA 5CSGA 3CQFA 3CFDA 1S7SA 3ZE0B 1J7VR 4RH4A 5LGJA 5KG9A 3M1BB 3SDAB 1FL5B 1UCBH 1B0GA 1XB6A 2YLKA 5D5MF 4LLYB 1R34A 2PKDA 1B4LA 1J8HA 2CO6A 4EE2A 2VJXA 2BPBA 2OFQA 1XGZA 2VDNL 3BPLC 4OJCA 5I1AA 5SX5H 1LO2H 1X5YA 3JT2A 1O6SB 1JYWA 2A6KA 4LLUA 5G55A 3AB0C 4U1GB 5HY9A 2D3VA 4R0LB 2O72A 3PG2A 5FW8A 2ZOLA 3H56A 2ENSA 5EIIB 3VRIB 2VXUH 4K4KA 5C3LD 3PL6B 3G3LA 1ZKAA 4RFNC 3S6CA 2VO5A 4FYSA 1U8QB 5H35B 1WVZA 3CN2A 3H2WA 5IQ9A 3VGDA 5HYQA 3IPEA 1EJOH 2UUDK 2EP6A 1QW8A 5C0EB 4PBXA 2OSXA 2EDEA 4MNHB 5JQ6L 2J6EL 4XN4A 3RDTC 3FQXB 1DBBH 3PJLA 4QNPF 1XZ0A 1VFBB 3W9EB 4Y5XC 4GAJL 1O9VA 1WFOA 4KKPA 2J55A 4GPVA 5D7IB 1JNHA 1UWYA 4S1SH 4TN9A 4AW7A 3N9GH 1IV8A 4HWBH 3CHPA 4B6ZA 1JV5A 5J11C 1CR9L 4KKCD 1OALA 4LCUA 5AWNL 5BZZA 4ZMAT 4N8PA 2AK4B 1DLFH 3D06A 1OANA 4UOJA 4MRBA 1UZ8B 4X80L 3LY6A 4K9EH 1J0ZA 2HLAA 4YHYC 3SGKC 1VZHA 1I4FA 3FUKA 3RTQB 3BOVA 4M29A 3VD3A 4EDXA 4G6KL 1MHPH 1F6LL 2YOCA 3JTSB 3P0YL 4O4YH 2L7JA 1TXKA 3TNMB 2YRZA 3RI5F 2WQRA 1LWHA 4PJ5E 1OAQL 1QSVA 1S78D 1G9NC 4YSCA 3MXWH 3SY0A 4FXKC 4HV8B 3F7YA 3PGFH 1DL7L 2QL1A 2BSTB 3LVEA 3SPGA 3BYYA 2EINB 4U6YA 3OPZL 2OR7A 1H8SA 2NR6C 2YD1A 3EJTA 4N8VB 4X0KA 2GK2A 3CDYA 2NW3A 1PU0A 4JAMA 2F0CA 5C0AB 4PWEA 5MEPB 4YAQB 2YPLA 3RWJB 2WMPB 3SSGA 5T3ZL 2CIIA 2ED7A 2BWDA 3L4CA 3P2TA 2APWA 3D85D 6TAAA 2O61A 4Z7UF 3SDYL 2E76C 4QYOA 4PJ5D 4Q6IA 3VSVA 3CU1A 3LH2H 3A24A 4ZW6A 5KW9L 4GUOA 1I8KA 4FQLH 4UQAA 4WNQB 1BJ1H 1A21A 1V10A 3O9WA 5T33L 1SFDA 3EBGA 4ZMPA 2PP8A 2DWXA 3B2UC 3C6LD 3ECBA 4ZMLA 3W38A 3IXTA 4U6HB 5DGRA 1M71B 1E7UA 1M2VA 4RGMB 2DM4A 3FN9A 2B08A 2BFVH 4ZK8A 1ZDQA 5CHNB 4HZ1A 4CW1A 3KYAA 1F41A 5EU5B 2MQGA 2O30A 2R1XB 4PI0A 3TBVA 3EDDA 4XNXH 2G5BA 4WO0A 2P5EB 1BG9A 1RZPA 5LWYL 2KPNA 4U3SA 4XBPA 1L9TA 5GGUA 4PBDA 1PG7H 3MAWA 4M8UA 2WQXA 3T0WA 3MJ9A 3MX0B 4YHZL 2ZSWB 2A9AA 1CFSA 2BSBA 2BXZA 3NZ8A 3QJSB 2EH7H 2HPOA 4YHNA 2XTJE 5D7LA 4H88L 4UT7L 4X99A 2FGWH 3TVMC 1JPGA 2FH8A 1NIDA 3CVHH 4GIOA 1ZGLB 3GJEA 4NQCA 1TR7A 1MHEB 3AC0A 2Z1PA 1AP2A 3VRLF 5FGBC 5DJDA 3PWUA 4PJBE 3QUML 3RNKB 3V6OE 1OE2A 3D0LB 3SDXB 1NUFA 2X09A 1S46A 4K3EL 1K4CB 3VUAA 4OVVA 1YYLL 1VEPA 2BNQA 2MH4A 1J48A 1U3HD 5J6SA 5DC9B 2J44A 5TE4H 3WIAA 5BS0E 1G9HA 4TQIA 3CLWA 3EFOA 4XN5A 5D9SA 1DR9A 5IMKA 3VW3H 2NW2B 3IJEA 4UT9L 3WU1A 3B2VH 4QTIH 5C2UB 1DTUA 4AITA 1PQZA 4XPFH 1UWEL 2D3NA 4F57L 1NICA 2WO2B 4APXA 1CURA 1FDLH 4U3HA 3ROLA 1BQSA 1YJDL 2DWDA 1KWKA 4R3SA 1CQYA 2CHWA 2IANE 2CLRA 1EHLH 3WE6A 4NPYB 5TF1H 5E9DE 3RWFB 5DK0A 5DJZB 3ZHLA 2AVFA 2R29H 1YNLH 4XNQB 4YUEH 5AZEH 1C16A 3M86A 1MH5B 1ZLVH 3CLEH 2OZ4A 2CKNA 4HGWB 4JO3H 5BS0D 2O5NA 3WBDA 1DFBL 3HCVB 1FYTE 4JO8A 4AENB 1CO1A 5GGSB 1NGXB 2B3IA 1HZKA 1T7VA 1WG3A 2VDPL 4Q74A 3MLPA 3CX5J 5E8PA 5G4NA 3ECQA 3L3DB 4S2SB 3B9VA 5FM5M 5IFHL 3BP5A 3NMEA 2BW4A 3ES6B 4G7QB 1G4MA 4QHMA 5C2BL 4NKIH 1SY6H 5SWQB 4MA7L 2WWMD 5E5MA 1ETJA 1WD9A 1YY9C 2PF6A 4HJ0D 4BH8A 2IAND 3K72B 4KKLD 4PLJD 2HVBA 5FXCH 5FIEA 2LV4A 3FDWA 4Q7DA 3PAYA 5E9DD 4L2YA 1A2YB 5LUMA 1WWAX 5KVFL 5HYEA 1CGWA 5DURD 2GSMB 5EZLA 3TC9A 2Q8BL 3TO2A 1WAEA 5DHDA 1A9EB 1T7YA 4GMSH 2ADYA 1ZHLA 1FYTD 3N04A 4ABWA 2ZOWA 2CD0A 1ZTMA 2OMVA 4XC3H 5IMMB 3LXUX 1GVIA 4J3OF 4YSAA 4E5XA 1IT9L 2WTOA 4B50A 2EKSA 3A4DA 1ADQA 3QIWC 5GZOC 2R69H 2UZIH 2ZP8A 1F4YH 4OCNC 4PHZA 2D4FA 4YPGB 4F15B 5C09A 4PG2A 4JL2A 5CU9A 4J7RA 4POZC 4JFSA 5AOIA 5J9PA 5T3ZE 1A02N 4ZW7A 4LHQB 3Q44A 4YC2B 2ODIA 5GJSH 4OM0L 1XBDA 3STZA 4G6AC 1A6TA 4Q9CA 3K6SA 1X5GA 4K5OA 1CN4A 4QR7A 3B3IA 2YUVA 1G9NH 5K9OA 4XB7A 5FFOA 2NNAB 4AZ8A 3IF1B 1KLUB 4YHPB 3FMGL 5E4AA 3RPBA 4D0CB 1KG0A 1NGQH 1WGOA 3O41A 3KR3L 4XCFH 5IEKA 3T4YB 5EZIL 4WVRA 3TASA 4OZFA 3ZJAA 1AQHA 3MJGX 4QOKB 4EOWL 4XN8A 5HY9B 3FYEB 3TIEA 3CZFB 1XSJA 2XWJB 1CK0L 4NAQA 5B7FA 2Q5BA 2XWXA 1KPUA 4N28A 2EXWD 2UY7A 4OGXH 1GS7A 2XZAH 4J4PC 3BQUB 4BELD 1UB6A 2AV7B 3BSZL 4MCNA 5DUBB 2WJ5A 5BOZG 5EBWA 1P6WA 3ABMB 3PWPA 3SCMA 5DEJA 4R9HA 4J2XA 1Z5LB 4GBXD 4XNMB 4PJIB 1DSYA 4A6YH 2JQMA 1JGDB 3K4AA 4IGBC 4WNSA 5KAQG 1CTOA 5BRZB 5LAXB 1SPDA 1PY9A 4LSRL 3QDJB 3EG9A 3U25A 5J13C 1ZS8B 3H0TB 1KT2B 4QKXB 1RK7A 5D7KD 4XNYL 2WAQA 1KTCA 1CXLA 4LMQE 3U1SH 3INOA 1SJEA 1YEDA 3NZHL 5J6HA 5L0QB 4Y4KC 4B0MB 5I73C 4I0CC 4NHUA 1WIUA 1OCCB 3OD3A 3LKOA 2KKQA 2WQ8A 5F7NC 3BIKB 2FBOJ 3NFSH 4UUJB 4PJFB 2WLHA 1TUPA 4AGPA 3HKFA 4M1GH 5BQ7A 2Z4QA 1IKNA 2IAMC 3JT0A 1MRDL 3UBXI 2F54A 3QCTH 5FWRA 2GJPA 5H2BA 1T04B 3EF7A 3MRPA 3BVWA 3T0EB 1OP3H 3GB7B 4L05A 3C5XA 3MBXH 4XVJL 3SZKC 1AKJB 3AABA 4OLWL 2W9EH 4BKTC 4X4ZA 4KKBD 1USZA 1FYHB 1DDHA 1NCCL 5H94A 5LVEA 1F11B 2E5EA 1NANI 1FNEA 2XFXA 2E9BA 3BJLA 2AEQL 3P1VA 2DQEL 5FGRA 1ASPA 3GXPA 3RWIA 3IE9A 3H7BA 4LVOC 3ME0A 4ZI8A 5KEZA 1T0NB 4I9WE 4M6AA 5IB1A 4QJ4B 1ZGLM 3GFUA 3ARDD 3EBIA 3ZRFC 4W9JC 1OK0A 1OL0A 2R1YA 3CMOL 3GJFB 1F3DH 1NGPH 5DUMH 1P4BH 2WW8A 1AYOA 5LQBL 3WTSA 3MRRB 2P8MA 1RERA 1KIRA 3ZL4L 3P77B 1UA6H 1ZT7B 4I0PD 2WP3O 4F58L 3IDXH 4X2UA 4YOKA 4FE9A 5KVFE 4A7TA 2QMJA 5CKAA 1L0YA 2OM5A 2FVNA 1HVXA 2RR3A 4TM9A 3MXVH 5E7FA 1A9VA 2EEXA 1TVHB 3D4ZA 2IMNA 4NC0B 1OB1B 2NQCA 3LKNA 3MCG1 5LGJB 1T4WA 1P6FA 3WO4C 5B39G 4IOSD 1MCIA 3K8LA 5HD8C 2YGPA 1B0GB 5E56A 2ZYSA 1QAWA 3C09B 2OK0H 4NQSB 1GH7A 2CO6B 2LR4A 1NGYB 2NX5E 1IQDA 1G9EA 3FB8A 5I1AB 1U95A 3VD7A 1ET7A 1RIHL 1ORQA 3C8KA 4XTRD 5CGYC 4OU3A 1MQKL 4LLUB 2C7UA 4W6XB 4OFPA 4XNUL 1S5HB 1U36A 2GSIA 2M26A 1XEUA 4LO9A 4KOCA 4WWNA 5FDWB 4AX3A 4HDIA 3N2JA 3CX2A 4H0GA 1F2XK 4XXCA 3U9WA 3K8KA 3IDYC 4LLVA 4JR9H 2WUBH 3FSVA 3SO3C 2GC7C 2Z7WA 3ESMA 2JF1A 5HYQB 5IQ9B 3IDUA 3O11A 2I85A 3SD5A 4I77L 1N5AB 4BE5A 4WTXA 3E6FB 1KBPA 3Q6GL 4ONHA 1ROCA 3FQUA 2HRLA 5L2KA 1XAUA 2NX5D 1UM6L 3EF4A 4HHWA 5T1LD 2MNUA 5A2JH 2GFBA 5C6PB 3ZTJG 2DTSA 2IH8A 3H42H 3X1NA 1W80A 4BSWA 1LP9F 2J3SA 5FK9A 5ITFB 4PAZA 3DV6A 2CA4A 4AM0B 1JV5B 1XV8A 1A1NB 4ILDA 4PJCA 4U0QB 3QJXA 3ARXA 2IQ9L 4LPYA 4LXFA 4LCUB 4DAGL 5CJQH 4S0SD 2N0KA 3FO9A 5DXWA 1TTGA 3ISWA 3V8OA 2RCSH 4JRYA 5T8IA 4CILA 1PZUB 1I9IH 1BPLB 1I4FB 2MJWA 1JK9B 4EDXB 3QRGL 1KV7A 3BN9D 1G7LB 8CGTA 4M3HA 3O3UN 2ZIDA 3PWVA 3HE7C 2B3RA 5I9QB 4JO4L 3TPUA 5D2LF 1J5OH 4WV1C 3L5XL 2BHFA 3SY0B 2WQUA 3CVIH 2YEVB 4B9CA 2DBLH 2XNAA 1VZIA 4GNKB 2XY1A 4KDTC 1CGVA 4OT1L 3VGHA 1ICTA 3BAIA 3O6MH 4U6YB 2O5YL 4LEEA 2VERA 5DHYB 2Q8AH 4YL4A 2K8MA 5F96L 4QO1A 5I76A 2A77L 2YPLB 3S5LG 4GO6B 3GS7A 3MREB 1SEBA 4TPRH 3WJJC 5BMFH 2HLFC 3QHTC 4XP4H 5JXEA 1ANUA 4XCCL 5DUPH 1O7DE 2XXCB 4JDEB 5HGDA 1NM9A 4R97C 3CMGA 1NBYA 3ATBA 1I8KB 3HUJE 4UF7C 4EZKA 2CUAA 3O0RH 2DJ4A 4OGAD 1KENH 3BCDA 3MLZH 4OCXH 3S98A 3SQRA 4F8PA 5KVDH 2O6PA 1Q1JH 4AQ8C 1B6DA 2BNRB 3ECBB 1NBVH 4NN7B 1J9QA 5FO7A 3BDYL 2OTWA 1M2VB 4HXAL 2AJ3A 3OB8A 2EICA 5A40E 2WXIA 2KI6A 1PFOA 2J56A 5LBSL 4BWWA 5T1JA 4ZMVA 2ZF8A 3TBVB 2WD0A 3DVFA 4A7QA 1DP0A 2K0RA 4CBPA 4KTEL 3EO9L 1IAIH 4XBPB 2B1AL 2H2PC 4LRIC 1ETZA 3QQ4A 4Y2NA 3RL2B 5TK4A 3P9LA 1CFSB 3MV7D 4ICXA 2XV2A 3NZ8B 3IBEA 3P3RA 4K15A 3ZDXF 4N6RA 4Y5YC 1WT5C 4X99B 1QLFA 4LSSH 1HIML 2A0LD 4NQCB 4JFQA 1CVRA 3ZL1A 4BZYA 4TQEH 2J2ZA 3HG3A 4ODUB 2IWGA 4B0MM 1PL3A 1AXSB 1EWHA 1JHKH 3PWUB 1ZVNA 5DK3A 1DLHA 3MOBH 4H0LC 1BX2A 4NT6A 3F04A 5A16B 3EH1A 4FFWD 4ZMXA 2NY2B 1YEJH 3PY9A 1CBVL 2CXGA 4WW2F 4UNVA 4XO3A 4P46A 5DFVD 3VJ6A 4JY5L 3EFOB 5F7LB 3QZLA 1VSCA 3CDZB 2BHZA 3FONA 4K3HA 2P48B 3DPDA 5JTWA 3EYFB 2ZYHA 1ILSA 1TQCB 2B2XL 4FCAA 4BRJA 4GRWE 2E8YA 2BJML 3MKGA 4FXGB 1G0YR 2DWDB 2RAMA 1E50A 4R3SB 4DH2A 1QRNB 3BKML 2CLRB 5G5DA 1KYUA 3K4DA 3KWTA 4XVTH 2ED8A 1MCWM 3CFTA 2A4ZA 4GAGL 4RFEB 3SE3C 1B2WL 3BPNC 1MHCA 5KANI 4WHDA 3PGDA 2OMBA 3AQZA 2P8PA 1TENA 1YVLA 4JFEA 1IC5H 4UV7L 4YL9A 2HCZX 2FUQA 4BFRA 3EHBC 2BZ7A 3BVDB 4YJZL 2A9NH 2KC0A 4JQIL 4OCRL 3QJUB 2AXGA 4Y5VC 5MEOA 4OUUA 4X4XA 2NY0C 4QHMB 3QQNA 3RFRA 3OSVA 3W39A 5EEZA 4UIKH 1I1CA 5EH1A 3SKJL 3HAEG 4UZUA 3ZYJA 4B97A 2ZOUA 1QATA 3IGFA 4Q6KA 2NT0A 2WXFA 3ABKB 3SDCC 5A2CA 5HHQA 1T2QL 2A1WL 1S9YB 1T5XA 3Q2NA 1PNCA 4RGOH 2EILB 2AJXH 3BWSA 3HLAB 3TO2B 1FL6A 2C9VA 3BH9A 1J1XH 2YSSA 3EYQD 4EIBA 1EO7A 2WVUA 3V5HA 1ZHLB 1HCZA 2CRZA 4Q9QH 2G5RA 5DVMA 1RJYA 2E56A 3O8XA 4IYKA 2C7FA 2YUZA 2GY7B 1OP4A 4E5XB 4RBPK 3P9MB 1CGYA 1KJ3L 2EKSB 3ZUCA 3KLQA 2VO8A 5ALBL 4EQ3A 1G6RL 1MWAL 1HDMB 4H8HA 3REVB 4QHUA 1ZVYA 5C09B 1D9KC 1MY7A 1S7VB 5J9PB 4LQ1A 4NKOB 2QV2A 4L4VA 2PMZA 4LU5H 2WCSA 1BD2A 4G7VH 3NABH 1YMHA 5GZNC 3STZB 1F1AA 1A6TB 4OLXL 3SBWA 4F33B 3T65B 3B3IB 3QZWA 5K9OB 3LKQB 3NIFE 1PY4A 3TZVB 1A6UL 1IU1A 4ZMYA 3VXME 5KYUA 2B1HH 3HBPA 1KG0B 1TPXB 1NWPA 2QVTA 3VGBA 2OL3H 3FRPB 3O41B 3WY3A 1G7QA 3MO1B 5DRNA 3BZDA 3GXNA 2BX5A 2CBMA 3NH7L 4OZFB 3NGBB 1RHHA 1BMZA 4APQC 1M3JA 1X5KA 4ELMF 1YQVH 3E1ZA 4LP4A 2G75A 4QRFA 3K0WA 3WFZA 1KPUB 2EKJA 1W6LA 2DMKA 4KJWC 2VSKB 1CICC 4N5UA 4XXWC 1DVQA 4FLHA 4KJYA 3ESPA 3NJNA 5HDBE 1JZ7A 2HAZA 5I6OA 3QCVL 5EBWB 2IOMA 1HHGA 3L9EA 4ODTL 2G0KA 5ANMA 3VXMD 3BD5A 3AW5A 1A7NH 3IWUA 3SCMB 2FATL 3OAZH 1IBDA 3MV8D 3KS0J 5IGXH 5F1IA 1IGCH 4KRMB 1TFHA 4XBMA 4MXQD 1AZUA 3IFPA 1LE5B 1SBBA 5HPMA 1TJGH 4M1DH 4N9OB 4JFYA 5C0GB 2VXSL 1LQBC 1UD8A 5T5FH 3TBWA 2DAVA 5CP7A 3RPIB 3WSQH 3LXAA 1T83A 5KYWA 2JKSA 3U2IA 2XHNA 1U8NB 3IMVA 3L1GA 3SJVE 4MX7B 3BVVA 1IGJB 1SJEB 1YEDB 5FYJU 5IMLA 3HZKA 4R5XA 5J6HB 4EEEA 2WTRB 1QR4A 4HSQA 5EEVA 1KFAH 2ADGA 3OAYH 4NHUB 3U83A 4MHHG 4UINH 3LKOB 1VAHA 2WXHA 4DVRH 3VFPA 3AY4C 5FAAA 5F1OB 1LNUB 3TA4D 1DVFC 1NAKH 1A14L 5AVXB 4MAZA 1E3XA 4HGMA 4TXVB 3SYCA 2W0FA 2WO3B 3ZSSA 4GSDH 2KERA 2F54B 4YN3A 5JPNC 3NJKA 3BWAB 1DEEA 5F71A 5LAPA 3MRPB 2G2NA 2J5LC 2DH2A 5I8KH 1S7UA 4XPTH 1SMOA 2LTQB 35C8H 3U6RB 1BAGA 3BGMB 4J3UA 1ZD6A 2CO7A 4Y16C 4HS3A 5EUOE 4F92B 2FZ3A 1FNEB 2WIIB 3AADB 4R90H 1G7HA 3OJDA 4GB9A 1JGEB 4ZFOB 3RWIB 4KMTH 5FKPB 4W68A 3QWRD 4M6NL 2R1YB 3SE6A 3H53A 4JPKL 3O6KH 4PJAA 5MI0C 1WFIA 3GSQB 5DHXB 2P8MB 1KIRB 3BFWA 2H2SC 1DANT 4IHOA 4F24A 3BRDA 3TA3B 4AVKA 1L6PA 4OLZL 1FZKA 4NZ8A 3E2HC 3MLSL 2D8KA 4RDQF 5DJXB 3ZE0F 3IDGA 2FEDD 2YD8A 5DRWA 3DOSA 3ARFA 5GGRY 4HOMA 5C70A 2R56H 3B34A 4ZODA 1EERB 4NQDE 4IBLT 3FB8B 3RJDA 4OCWH 2ERJC 3ZHDA 2Y5TB 3TEWA 1C5BH 4YSOA 1OGAE 3HR5A 4HWUA 2Y7MA 4MB4A 2GSIB 4J39A 1KGCE 4M62H 1ZVHA 4PJ9D 4EN3C 4G7SB 2X89A 1RZJL 1T21A 3BP6A 3BW9A 5E5RB 1AI1H 4UTAH 1RLWA 4JVWA 3O11B 2LVCA 5IROA 4NUPA 4DP2X 1PSKH 3PP3K 4UT6L 3UTTE 5KYNA 2DM3A 2X1QA 4WTWA 3NZSA 1KCSL 3O0LA 4ONHB 5HDOA 1YAIA 3RUGE 4QWWC 3VXNA 3V0AC 5L2KB 1BQKA 2Y1YA 5BO1H 2ZXDA 4GS7B 2E4FA 2R39A 4JCWA 5IB2A 5HXMA 2NCEA 4UQ3B 3DK0A 5D7IF 1OGAD 3EH5B 1YPZB 1UGKA 3CFBA 3DV6B 3MLWH 1KGCD 1FZMA 4KRPC 1OTSD 4RAVB 4OLVH 3RTLA 3MRIA 4G6FD 5AVQB 2FT7A 5ILTL 3QEUB 5A2AA 4R5VA 1MVYA 3FO9B 3D33A 3UC0L 3ZE2B 1ZT4A 1XR8A 4AQOA 4D8PA 3L9YA 5IKCA 3MQIA 2VN5A 3HC4L 4TKWA 5FLUA 5CP3A 5F2FA 1S9XA 3WKYA 5I19H 3UTTD 1BAWA 1C5DB 4MDJA 4HIXH 1JPFB 1INDH 1F8TL 1YNTA 3PWVB 3QP3A 3B7TA 4J23A 5D7HA 2QQLL 3TPUB 1PNDA 3CZNA 2M8XA 3UYRL 3EYSH 5ECJE 2EC8A 4N2GA 4A66A 1R3HA 1E4WH 2XNAB 4LKXA 1XCXA 1ZLWK 3E3QC 1E42A 1AZZC 3FNKA 3U4BH 1B4JL 4X4YB 1EXUA 4JANA 3S35L 3GLZA 3GPSA 2X2JA 2VDKB 3DOIA 4RDBA 5LNDA 2BW5A 3SDDB 5IFJA 3FU8A 5FUOH 2VTFA 3WOVA 3SY6A 1IUZA 4R4NC 2H9GA 4LMQI 1T6VN 3BT0A 2K6WA 3CHXA 4M93C 3DGCR 5FM4A 3KYKL 1SEBB 4DSYA 4NAJA 2ADIA 1CXHA 4HLZG 1N8ZB 1SY6A 2X4OB 4N8CH 3SEPA 1AC6A 4ZMQA 5A7EA 1UVQA 1KCKA 1RD6A 2I60H 2X3CA 3QULA 4NC1C 3QJQB 1LYQA 2HKFL 3RDTA 2WXPA 1WFUA 3LNHA 3TBCA 2VMCA 3W0WA 5ADPL 2QGDA 1EEZA 3A3YB 4FZEL 4QXGH 5J8OA 3DVIA 2MOQA 1XF3A 2ZONA 3QS3A 5G2NA 4IMKC 2F18A 1UXWA 4BWUA 4P2CG 5GHWH 4QTHB 2AJ3B 2HLEB 2VGLM 3DVGA 3DX3A 3FTXA 5DU7A 2EC9T 1IIIA 2BHUA 3OTTA 3MODH 5JHDA 1GR7A 2HFGH 3SZ6A 2COQA 1ETZB 4AIZB 4F7TA 3P9LB 3W3BA 4Y7OC 5AENA 3CNKA 5DYOA 4JGMA 3B7RL 4N6RB 4QRUB 1I7TA 1QLFB 3INUL 4FNQA 1E6OH 2NYYD 1PZ2A 4FXKA 1UM4H 5DLLA 5EF0A 4OM1H 4JFQB 1FCGA 4ZBJA 2EYRB 4BQ6A 3QEGH 2VLRA 4Q6YA 2WGXA 4LEOA 4I5BB 4NZJA 5E6RB 3VH8B 4GG6E 2MTAA 4J5VA 1IEAA 1DLHB 2ESVA 2JLLA 2NR6A 3T08A 3EXJA 3CHQA 3SDXF 1WZ1H 5CD3A 5CAYB 2CBQA 1MF2H 1R46A 1BYPA 2VISA 4ZFGL 3CBRA 4P46B 4MB3A 1ZTXL 3KNBA 5FA3A 3VJ6B 5I1KL 4TUKH 3D2UA 4P2QB 3R8QA 3HB3D 1YMMA 1FFRA 1JE6A 1M7XA 4KKAC 5C0FA 3HRZC 1X7SA 2KLTA 1CXKA 2LVEA 4HAFA 4TUJA 3RIKA 9PCYA 1JRHL 1QPKA 1LE9A 1WAAE 5E4EC 5HHME 3Q5TA 4L18A 5DI8A 1XCQA 1MFBH 5G5DB 2BOBA 2XPGB 1GIGL 2E3VA 3I6SA 4OCSL 3PGDB 2MTPA 4W9ZA 3VXTB 2UZXB 4HOWA 5K5YA 4JFEB 4WK2B 3C5ZD 1XCWA 4YBQC 5DO2C 4GG8A 5FWQA 3QIUC 5E2JA 4ATTA 3FZUD 4MA3B 1UJTA 4W1TA 4BFNA 3SGDI 5I75C 1XD1A 3IKCA 1KGUA 5DJ0A 1D6VL 1QFOA 1RVFL 4PS4H 4H13C 2AXGB 5MEOB 3EFDH 1MFEL 3L7FA 4OUUB 2R2HA 1PVHA 4X4XB 1FC2D 3W39B 3TVMA 3DRQA 4BKLA 3MJWA 3FT9A 1Z2KA 3ALXA 4OSUH 1A25A 1FO0A 1A7PH 1G5GA 1AGCB 1NCAH 1T5XB 5FGBA 1FFTB 5C0RL 4D9QD 5JW3H 1GPOL 1MFNA 1E27A 1JZGA 4JHWL 3O2DH 1RUQH 2YSSB 4JRLA 4M5ZL 4N2BA 1MJ8L 4PJGA 4EPSA 1RJYB 3O8XB 2CKBH 4DEPC 4GAFB 2FYYA 1X4YA 1BZOA 1QEWB 4DQOL 2AEWA 2C9PA 1K3IA 5GS0L 4W9DC 2XV6B 4DKDC 3AS1A 2GSGA 2ATKA 3C60D 3ARQA 3QEQE 1P7QA 4QHUB 2WO4A 3QQ9D 1WBXB 3RA7L 2PXYC 3WNNA 4AIXA 5IB3A 4S1DD 5E4IA 1BZQK 1YMHB 4AG4L 5EO0B 1CFTA 3ARED 1G7IA 4HCIA 2KLRA 2AXJA 2PYEA 4AQZA 4QXTA 3L3OC 5HJDA 2DL2A 1NOLA 3K6DA 4YK4C 5KYUB 2CO2A 4LSUL 2H6PA 5DHVH 4D94A 1F58H 1ZS2A 3HFMH 2VDOH 1G7QB 3IDIA 5DRNB 5T3XH 3GZOA 4KPHH 1RHHB 1WZAA 3L3IA 3OF6D 4MXVF 3S37L 3QEQD 1R5VB 3D7PA 2G75B 2C1PA 3EXLA 4G3YH 1AE6L 2DJSA 1RU9L 4N9GB 5DHMC 2FEJA 4KJYB 2R0ZL 3VI3B 4B9JA 1M1SA 1J9TA 4N86A 3KPNB 2VUKA 1HHGB 1JNNL 4JZJB 5ANMB 3QDAA 5D4IA 5BNXD 4K7FA 1XGPA 4FQXB 4E9YA 4WI7A 4PJIF 4M6ML 1X9UA 4HH9A 4ECNA 4DO4A 3DHMA 4XOAA 1CD9B 2KYIA 3HI5H 1QUNB 2CE6A 4NZUL 5F9OH 5HPMB 4L9LA 2H6OA 4JFYB 4WU7A 2Y7OA 5IB5A 3DX4A 4ONFL 3UO1L 3QIWA 3RE0A 4AEHH 4PRHD 2D0GA 5KYWB 4LAQH 1PIFA 2FIRT 3TURA 1ZTXE 5HGBB 2XA8L 4ABVA 2ZYRA 5JLZA 3OJMB 15C8L 3FQWA 2ZKWA 3JVGA 4MDIA 3HZKB 2J1XA 1N4XH 1GSMA 4H44C 2ADGB 3BZ4A 3KWVA 1NAMB 2NNCA 3KLLA 4GUCA 3H4FA 3GS0A 1S7RA 2WCGA 2CGYA 3R1GH 2DQIH 4PJFF 3GSWB 2YD3A 3HG1E 1JPTL 2PETA 2OR9L 2W0FB 2BVUA 3FSOA 1Q0YL 4G70B 1X7QA 1CFNA 1DEEB 1YY8B 3R4RA 4N5ED 2PO6C 5F1NB 1YEEH 1ETA1 1S7UB 2XVBA 4KJQD 3UZVA 3KM2A 3H9SD 1F00I 4JJOA 4M56A 3MYZA 2GI0A 4YR6B 1ZLSL 1Y6KR 4XCEB 1G7HB 4J4PA 3QUXD 3DUUB 3C8DA 3VQ2C 4DGUA 1KCRH 2X41A 3C6LC 4PIRF 4OIBA 5DR5H 1O7SA 3WNIA 4L37A 4K8RL 4CVUA 5TE7H 3HG1D 4MD0B 5D1ZA 3ECVA 2EXSA 3UAEA 3CZKA 2PCYA 3FQTA 4HPHA 3AMLA 2X2UA 4XMZA 2VDLH 4NN6B 4GUQA 2NTSP 3WELA 1I8IA 4PRPA 2HPTA 1PLBA 5DRWB 1UADC 5EF2A 3B9DA 3DOSB 1U93A 1KWGA 4LL4A 1L9OA 5HGAB 3IDNA 5K1JA 4G8EA 2IF7A 2NLJA 1E4XL 4Y4KA 5J0BA 4JW3A 3F12B 1JTPA 1W0WA 4HSAC 4NOBA 3HR5B 3U9UA 5HYJD 4KO9A 3ZOAA 4PY7A 2J6WA 4R7DA 1KEMH 3WDJA 3IN2A 3LEXB 3D9AL 3FRUA 3JWNG 1Q38A 1T21B 4MKMA 4XMLL 4QNPE 1U3HC 2YAMA 3FO1A 3BP6B 3BW9B 2GBUA 3L9RA 4WTQA 5HVGB 1U58A 3VXSE 4DFIA 3QG7L 3MN8A 3F58L 3FN0H 1I1RA 4NUJA 2OMZA 4H40A 5CLTA 4PMEA 2WN3A 2XTJC 2YD7A 2FECI 4FLOA 1G7MA 1W72H 1RK0A 3VXNB 1BVNT 4OLYL 5JW5A 1HL8A 3UTSE 3MLYH 5LBGA 5IB2B 1A3LL 3KW8A 2QT6A 4Z18A 2NXZB 5F7MC 5DD0L 2MEJB 4HJJH 3Q2VA 3CFBB 3VE0A 3V6OC 3V55A 5C0DA 1DBML 2B77A 2WZPD 4I3SL 3KJ4B 1NMBL 2VE6A 4HQQL 5KN5A 4RSYA 3PDOB 4D8PB 3NOIA 2V9RA 5ES4B 4MZ2A 1S9XB 2KUTA 3P30H 1QFHA 1E5BA 1GMEA 4A2DA 4F9PA 5E08H 4XH2B 4E41E 2NY3C 4MDJB 5K9QG 3H6JA 3ZSTA 1QACA 1N6QL 3VFMA 5F7YC 5J56B 3MUGB 2OYKA 4YSQA 2ZWZA 3UTSD 1T66D 1V3MA 4NJ9H 3CG8A 3MOAL 5D7JD 2WWMC 1R3HB 5LCVA 4NSKA 3UC2A 5JIQA 4KKLC 4PLJC 1MCHA 1PFCA 1UWGH 3NFPA 3AM8C 1EXUB 3MLXL 4JANB 2HVJA 1RH8A 5IFJB 5JNYA 4Z7UE 2I9TA 3OWEA 1L7TL 2AVGA 3US0A 2D03H 1Y07A 4YSSA 4ORZC 2H9GB 1SFHA 1E9PA 1D5XA 2WLIA 4HS8L 3VGGA 4E41D 4FNLH 3FCSA 2ADIB 2WXGA 5A1AA 5AOLA 1UVQB 1UHVA 3QULB 4PJ7E 2NY7L 4QAWA 1NMAH 2MKWA 4CA4A 1YEKH 3AY2A 3E38A 3W0WB 1AVAA 1BYOA 1DE4A 1EEZB 4JGUA 5DLMH 2WWOA 1KJ2H 5L4FA 3MOQA 5D1QD 1XF3B 3NZUA 1UXWB 3VVVA 3RPKA 2WNGA 3LNDA 3CFEA 3LRSA 3N3EA 1L0XA 3QZWG 4IDLA 4ETYA 3P11L 5KJRH 1V3LA 2HX7A 1NZRA 4WSJA 3JBG7 3ULVL 3VGAC 3IJ7A 3DK2A 3J07A 3LV3A 4YHYB 1IBGL 3UDWA 1BQ5A 3HC3H 4NC2B 4F7TB 1B0RA 3VRLE 1EXGA 2MCAA 2VMJA 1QZ1A 1MCJA 4HWZB 3HE7A 4I88A 1LO4L 1UT2A 2XWCA 4K5NA 3VG9C 3WG7B 2APBA 3APDA 3IS0X 3PJSA 1JWMA 4WV1A 3KYOA 2AABL 2EXWC 2ZWLT 4OAWA 5B38G 3K46A 1FV1A 4CKVX 2RALA 2XN2A 1Q4NX 5AVUB 1OKEA 1YN6A 1T89C 2OL3A 3LNGA 1BFVH 4FQJH 2VLRB 4N2IA 3ZQXA 5D2NE 4LEOB 1SF3A 1XSIA 5EOTA 4BUQA 4H20H 3KJ6L 4GBXC 3VMNA 4BFFA 2QPSA 4OFYD 3AXLB 1RIUL 1JI2A 4AEFA 1MCCA 3GNMH 5T1KA 1RZ7L 2DL9A 4OIAA 5ISZA 5FUZH 4JVPA 1ZV2A 1UM5L 2DIEA 2EIBA 2W07A 3KNBB 4POUB 1WC7A 3HMXH 4XMKH 5FA3B 3RWEA 3VXUA 3D2UB 2G3ZA 2OMNA 4B5ZA 2R0KL 1GHFL 5J6GA 1YMMB 3S96A 3WNPA 4OD2B 1G7JB 4AUUA 4Z76A 2R0LH 5C0FB 1PLCA 4HSCX 4TUJB 4JY4B 5TJWK 1G84A 4AI7A 2J7LA 4YHOL 4ZUSB 1FH5H 5DI8B 1XCQB 4KQ4H 4XAKE 5DJ6A 3NBNA 2VLME 1FL3A 3CTTA 4GP8B 2WHVA 4ES9A 4ZW3A 3GI9L 4MCYA 3WI9A 4GLRI 1J1OL 5FM5O 1K85A 1DANU 5T5FA 3I3BA 4GG8B 5F3HA 3UAJC 5EBMB 2GJZB 1XH2A 2A73A 2H6UA 3T0XA 2XBTA 3EBHA 3TEUA 2WWNA 1JFQL 1BVOA 5DJ0B 2VLKE 1DVZA 2R2HB 2VL5B 1O75A 4Y5YA 5CIPH 2DLGA 1A7QH 3OPUA 4KKBC 4U1JA 3TVMB 4YDIH 3DRQB 4BKLB 4MB5A 4XAKD 5F7EH 1YQ2A 2DQHH 4KOBA 5I2IA 4CVZA 4O51A 5EC1A 3ARTA 1FO0B 3N44B 3GS4A 2UUDH 1RUML 3NP4A 3ARDC 1H3TA 3HE6D 3V0VA 2EZ0C 3F83A 4FAAB 3HPLA 1KXTA 3EJYD 1GW0A 4MCZA 4PJGB 3SYPA 4ALAL 4Y9EA 2Q1EA 2PW1B 3MBED 4HKXB 3RY5A 4P99A 2WXNA 3JVFC 5EU3A 2FYYB 2EIDA 4X0NA 3TWCL 2X6CA 4J8QA 5FHAL 4L3EE 4AC2A 4WI8A 2ATKB 2VKXA 3FN3A 1IEBB 2JJSC 4IOFC 2V5TA 1IC0A 3SGJC 4BGDA 3IDMA 2N7SA 4R7NA 1PKQA 3VU1A 3V9CA 2Y3NA 3VWKB 4LBEA 4PTUA 3UJIH 3IGKA 1CFTB 4J3OD 2FB4L 2W0KA 5FOBA 1G7IB 1OT1A 4XTRC 1SLXA 3O4LE 3WUWG 2VB5A 4QXTB 3SE3A 3A6CL 4DWHA 3L17A 1UH3A 1X4ZA 2WSPA 2NMSA 3DX7B 3MCKA 5JQ6H 1A0QL 1UOWA 3ZRCC 1VCBC 2P5WB 3SOBH 2BY3A 5GS1C 3EIFA 3TF7C 5F70A 1LO0L 1BQRA 2GBAA 3DMMD 4L3ED 3EDKA 3T0DA 4MYWB 2H0PA 4U1MA 3NRQA 1CR9H 5DDHB 1JF1A 5EPMA 3MLUH 1JXGA 1FIEA 2UX6A 2WJ7A 4Y5VA 5AWNH 4IEFB 4W6WB 1F86A 3KCPA 2YPVA 2FJHA 4OJDH 5GRUL 4BSVA 4OKVB 2QMKA 1ED3B 2Y6SD 1P84J 3ZKXC 2VLLB 5EG6C 3O4LD 3EZJB 3SDCA 5AZ2H 1AIFA 3NSJA 3N41F 4L0YA 1FN4B 5E95B 2CMRL 2VIRB 4G6KH 1B0WA 3IK2A 3P0YH 3LD8B 3B5HA 3BGAA 4UTAA 1LGVA 2D7NA 4S1QL 4LPCA 4CGTA 1OAQH 3LNIA 4HH9B 3AZUA 1AMXA 3W81A 4K5PA 3QR0A 4NS0A 2EE3A 1V55B 5GISH 3KLSA 2EEDA 4HUUB 4L9LB 4S1RL 3GI8H 4UTBH 4Z7WA 1UZ6F 2EADA 2CPCA 3D05A 1RZIB 5EEYA 3OPZH 1IAMA 1HI6B 2QSCH 3MI6A 2ITFA 2WKGA 4L9DA 4MQ7A 4AM0Q 4EO5A 5JLZB 1D9KA 3S4SA 1KCUH 3ESUF 3FQWB 5I16A 4UYPA 4PB0L 4MDIB 2GJ6E 4O58H 5GZNA 2XN9B 1A4KA 2YS4A 4ZAKD 3BZ4B 1QKZL 2E46A 5T3ZH 3Q06A 1FC1A 4RAHA 1MCLA 1OB0A 3RWGB 4N0YL 3LH9A 4U31A 1NOFA 1A3RL 4OCMC 1S7RB 4DUXA 3EDEA 5KW9H 3FFCA 4F2FA 43C9B 4DP5X 3ZR6A 5TPWL 4NP4L 3BYTA 1M42A 5T33H 5CUSH 5ITBH 4NQED 1X7QB 1OIOA 3G5VA 3JV6A 3P4MB 4APQA 5KYYA 5J3HD 5C9KA 4WLCA 2B20A 4DOHB 4NUGH 3UZVB 3L1EA 1I7UB 1FAIL 2YOAA 3VNZA 3FAXA 1JERA 3O6FD 3A4AA 2GJ6D 5DZAA 1CICA 2NY6C 4XXWA 5CD5D 1S7XA 1NH6A 2IPUK 4N0UE 3QDHA 1KN4L 1M05A 1N10A 4GO8A 5IW6B 4ONGH 4C59B 5I1IH 4FHJA 4YHZH 1QNZL 3V6FA 3L2LA 5D1ZB 5TDPA 3BPOB 4UT7H 2VITA 3VVWA 1F90L 4IK7A 1KYDA 3FQTB 4AEEA 5L4JA 3CV5A 1QLEH 2EDKA 2YQGA 2HJLA 3FOMB 5HDQL 4YLBA 1O7DC 4HJEA 4PRPB 4MZ3A 3DXAA 3QUMH 1NQBA 1DBJH 1U93B 3D3VE 3FSZA 3PNRB 5I74C 1N0XH 4M43L 3VXRE 2O6FA 3ZDZB 3IDNB 4GEJA 1YYLH 2V2TA 5D1XB 5CFHA 4XN1A 4P5TD 3ZIYA 4Z7VA 1IAOA 3A67L 3VMPA 3BAWA 1QFPA 4Y4FB 4PGBA 4Y2DD 2FJGA 1HQRA 3IGAA 3U9UB 4BQBA 7FABL 1UD6A 1WLHA 1N8OE 1S8DB 4GW4A 3AY4A 1UWEH 4F57H 3EYUL 3W2DL 4CC4C 1SXSA 1C12A 1DVFA 4KTDH 1MIEL 1R0AH 3FHQA 3FRUB 3LEYL 4FFWC 1NA8A 1YJDH 4WTZG 3L5WB 1S9VB 4GQQA 3FO1B 1YECL 3L9RB 4X9YA 1U58B 2VXVH 1RUAL 2P26A 4LHUD 4NUJB 2R9HD 3X13B 4DZBA 1T80A 1JD9A 3D3VD 4FD0A 4LLQB 2FX8H 3VXRD 2Z91B 2P45B 4C56A 4BRVA 1RK0B 4HZLA 1JXJA 3EZ8A 4Y16A 2IWEA 5JW5B 2E7CA 3MV7B 3WEOA 1NEZB 3GM0A 3MNVA 4WO4A 1S7QA 4LCWE 4N2EA 3VE0B 1YPZF 5A2LH 4LLAA 4P05A 1NMCB 4ACPA 2DYPA 5C0DB 2J5WA 1DJIA 4XMPL 5H37G 1U42A 2QADC 4WI4A 5KN5B 1XGYL 1HAWA 1X6LA 4K5MA 5D2LE 3ZE2F 4MA7H 4XN7A 3NCFB 2DQFA 3QE5A 5F88A 1GXEA 3ARPA 1ETB1 4MMZC 2E47A 4HJUA 4PRIB 4X6CA 1JN6A 3KPSE 3RZCD 1GSKA 2F8IA 5KVFH 3QHZH 2F5BL 3VFMB 2Y1VA 2Q8BH 1P5UB 3ECWA 3IEAA 3MUJA 1RIVL 4DP7X 5JDJA 3PUCA 4NSKB 1CYGA 1KBBA 3VX0A 3OMAB 1BLNA 4LCWD 5DT1H 4C47A 4Y1AA 2FO4A 1IT9H 3NFPB 4WUKH 1JAEA 3CC5A 5JNYB 2NY4D 3PPEA 2I9TB 5F1KC 1YEFL 4EN3A 3EYQC 4IU2A 4JCMA 1ZSHA 3QIBC 1AXTL 5E8NA 4KTGA 5L8JB 1MXGA 1D5XB 2WLIB 4NBZB 4OM0H 4MJID 2VXUL 3FCSB 3OXRB 1RPQA 5DZLA 5C86A 1FG2A 5KSAD 2ZUTA 1M1XA 4XXDA 1IM9A 4KK8D 3VD1A 3HHMA 3D69A 1K5NA 1Q9WA 3CDGA 4Y19E 3A47A 1JRHI 1UQSB 2WSDA 3NA9L 4BFBD 3FMGH 4RWYL 1UOKA 3KHOA 4QHLB 4CMHC 3IJ9A 3QA3B 1A4CA 2QGEA 4PJHA 2TRYA 3O2VH 5JA8B 4IBZA 4YFLF 3O2DA 2YHGA 5EULV 1DBBL 3CN4A 4EOWH 4KO7A 3I3EA 2KDGA 3EH2A 3LRSB 3PUUA 2CKBA 2F9BT 4YS4A 4EUPB 4K3JL 3LRLA 5F7FA 4S1SL 3N9GL 2HN7A 4HWBL 5JUEL 4Z7OB 1ZHKA 3LV3B 4NNYB 1DLFL 3QNZA 4WU5A 5AVSB 1W16A 1B0RB 3BKYH 4JDZB 4F9LC 1RP8A 4Y19D 2W65A 3HE7B 2CPUA 4IRJC 1JWMB 4WV1B 1IRAY 3KYOB 5IVNA 3FT2B 2IPKA 2L7UA 1JGLL 1J5IA 3UG3A 2IH3A 3MXWL 4FS0A 1YG9A 3NPSB 3SQBA 3B6SA 1N3NB 3ATFA 5EOTB 4QT5A 4FKHA 2YXWA 3N1QC 4XNYH 5FECA 5IVXB 1HYSD 5T1KB 1U8OB 4X98A 4MXQC 5ISZB 2W07B 5HDWA 2WXOA 1NFKA 3RWEB 2W88A 4JX0A 4CVXA 4G6JH 3C75A 3V4PB 1LLAA 3N50A 3CDCA 2P49B 4NKMB 4JRXB 3S96B 1JXDA 4E9XA 2ZUWA 2DLFL 1RY7B 1AQKH 5HVWA 4PLKC 2V5YA 1CPUA 4L8SB 4JS7A 3CQQA 3JV0A 2QJDA 1JZ2A 5H4YA 1UH4A 5DJ6B 2OI9C 4IMKA 4FQLL 1FFNA 2CO3A 4XVJH 3GUFA 2GUOB 3L3GA 2KZBA 3I9PA 4GRLD 4HUNB 4PREA 3HMWL 4MCYB 1A6PA 5CS7A 4DPAX 4MHHI 1HWWA 2EACA 3QGVA 3SKNB 1U21A 4H25A 2DQEH 2VDQB 2ZXAA 1IIKA 3EO0A 4BFJA 1WS7A 1MJ7L 4UDUA 4YXLH 1MVFA 1WO2A 1J05B 2AQ3A 4IU3A 5C08A 1OHZA 1AG0A 2X6MA 2F15A 1ZXQA 4FEIA 3CMOH 4AV4A 3KMDA 3PIQA 5LQBH 1I3GL 3S36H 5JA9A 3ZL4H 1NC2D 5GRJH 3D39A 4ZS6D 1U91A 1WISA 2FIKA 3VFWA 2EH7L 3H2QA 5AKVA 4O51B 5EC1B 4CVZB 1HWGB 4MJ4A 4F5CE 2P3YA 2OMUB 5L7XL 1PZCA 2JI1A 3CVHL 4KNTA 5I0VA 3H3BC 1HOCA 1OHQA 4P9HC 2VDRH 2RHEA 3HPLB 1RPUA 3DO4A 1IAIM 1IM3A 2MRYA 2XU9A 1EHNA 2Z3FA 4JBSA 4G83A 1I1AD 1B2YA 3TO4D 5EU3B 1RIHH 3NRFA 4PRAB 2HT3D 3I74A 3LQAC 2LLGA 3OZ9L 4XNUH 2FEDC 2ZWSA 3N55A 3NESA 5GJTL 3WFBL 1NSNH 3GSUA 5CEZE 3VW3L 3BQVA 3PGCA 3HRZA 3IDMB 3VFNB 3B2VL 4R7NB 4QTIL 4P3WA 4XPFL 4K23H 4LBEB 4PTUB 1EEUA 3SOTA 4NYLA 5JW4R 3OGCA 4GRWH 4EKXA 5IV2A 3ARGD 4AIEA 5CEYB 1EXHA 4WI0B 5B1JA 4PM1A 3BPNB 4ELME 2HA1A 3Q6GH 4KHTH 1VJSA 2O1AA 5GPRA 3MCKB 3AGWA 2Y36L 3ZO0A 5IY5B 1N70A 5K9KA 4HH8A 3DTDA 3LPWA 3NN8A 5ESAB 4PW4A 3L1OH 4WFHD 2R29L 1YNLL 1X5IA 4KJPD 4YUEL 3HN3A 4ZUTA 5AZEL 3QORC 4CU7A 1GA2A 2HP4A 2H32A 1QO3A 2WVTA 3CLEL 3TV3L 3VO0A 4JFDE 3OC8A 1TCMA 3UTPE 1OXYA 5CEZD 3KL5A 1JF1B 1OAJA 1DQIA 1H5BB 1MCKA 4P3DA 4XNZB 5MENA 3KCPB 1S9KC 2FJHB 4BSVB 2FWLB 3FYIB 2IGTA 1BWMA 3VU2A 3VI3F 1PZSA 1IGTB 3L2MA 3QJHA 4NKIL 3BP7A 3EFFA 4WGVB 4MS6A 4P49A 2ZZUT 4WQOA 5AOKA 1M6OB 2QQNL 4JO4H 4A2LA 3LKPA 5I5MA 2VZOA 2E74C 1GGIL 3L5XH 3TGXA 2OYMA 5FO2A 3RAJL 4JFWA 4AWJC 1W72A 4XWOD 5DJCB 3KM1A 4JFDD 4PJ9B 3UTPD 4Z7WB 1CDGA 1S7TA 4OT1H 2DD8L 3HNSH 1EZSA 2O5YH 3QJRB 4XC3L 1E9QB 4RMRA 2CHDA 1D9KB 1M9SA 5EFIA 5F96H 3F7PC 1E4XI 3TYFA 5I16B 2A77H 2PXYA 2R69L 2VLJE 1AH1A 2UZIL 1MCOH 1F4YL 1ID2A 1A4KB 4MYPA 2KZKA 3VB9A 4XCCH 5MP6L 3L3OA 3QAQA 4QI3A 2WZAA 4RMQA 2EQDA 1L0PA 1DO6A 1QBAA 2EDMA 4EKJA 2V5MA 3FFCB 3P3SA 4X9FA 1JHLL 5KS9A 4NO5A 1HH6B 2HG0A 4KHXH 2YAHA 1BQLH 2R23A 3BDYH 4PJEA 4XCFL 2B5IC 4LFHG 1NDMA 3NK4A 5MERA 2X3BA 4FQCL 1R3JB 5LBSH 4XMWA 5BOPA 2XWDA 1TQVA 2CXKA 1UENA 4G8AC 5I24A 4J12A 1S7XB 4MMXA 1E65A 4RAUA 32C2A 1E28A 2L0DA 5ADOL 3T6XA 3TCLA 3U0PB 5CLXA 2B1AH 4PD4K 4U3CA 5FYKU 5CEXB 4OVUA 1PYWB 3ZE0E 3D18B 4OGXL 3LJ3A 2XZAL 3ULUF 1EVTC 4IMLA 1I1YA 2DQJH 1DUYA 5DSCA 2ZXCA 3QWQB 4FRWA 4M7JL 2VITB 1G4RA 1HC1A 4NAMA 1WA0X 3QEHA 3LMJH 3L2NA 4S11A 3ZGIA 3VQMA 1BXAA 3DX9A 3APMA 2CZNA 2HJLB 2Y7NA 4A6YL 1SHWA 1BIIA 3DXAB 3WMQA 1KJ2A 3NCYS 5A2FA 1L9MA 2X7LB 5CGTA 4YHLH 1FG9C 3CSFA 4NPKA 3LS5L 4MAYD 1OTTD 2NYYC 1CBVH 4WRLA 2VC2H 4WI3A 1QSZA 3L08A 3WFHA 4JY5H 1V8HA 4U2ZA 3U1SL 2FJGB 1HQRB 1Q72H 3IGAB 1B3IA 3GHEH 3GMNB 4LF3A 3UP1A 1R1CA 3GHPA 4DGIH 5M95B 4R4BB 1C12B 3SDAD 5L2JA 1PD0A 4FFZA 2BJMH 5JW4M