4ICXA

N-terminal c2 domain of human cep120
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
133
structure length
133
Chain Sequence
b'SKSDQLLIVVSILEGRHFPKRPKHMLVVEAKFDGEQLATDPVDHTDQPEFATELAWEIDRKALHQHRLQRTPIKLQCFALDPVTSAKETIGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKSEIQISIALETD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centrosomal protein of 120 kDa
publication title N-terminal C2 domain tandem of human CEP120 shows lipid binding properties
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 24
structure length 133
sequence length 133
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4icxA00
2R83A 1HE8A 4OVUA 2CJTA 1E7UA 3F00A 3R7QA 1TJMA 3NSJA 3TJPA 3CSTA 4L23A 2NQ3A 2WXRA 3GPEA 5H4YA 1E7VA 4IQHA 2JQZA 1E90A 3DPDA 3RPBA 1E8YA 1DJHA 3P2BA 1QATA 3L16A 3OHMB 4WWNA 3IBEA 4ANUA 3M7FB 3QK0A 4L2YA 4AOFA 4WAFA 4FHKA 3KWTA 2WXNA 4OVVA 3SD5A 1W15A 4TUUA 1DSYA 1E8XA 2EP6A 4XX5A 4Y1TA 1QASA 4FA6A 1BYNA 3HHMA 1W16A 1DJWA 4J6IA 4URKA 3MJWA 1UOVA 2KI6A 4G11A 2CHXA 3L9BA 2WXLA 4F93B 4A55A 4JPSA 4DNLA 2K4AA 2FJUB 3IM1A 3F01A 4FJZA 2D8KA 3KWUA 1DJGA 3PREA 1YRKA 2A5UA 3RDJA 2Q0ZX 2YOAA 4WWPA 3W57A 4BGDA 1V27A 3W56A 5EDSA 2CM5A 1DJIA 4PS7A 4WEEA 3FBKA 3L4CA 1GMIA 4WWOA 3QR1A 2CHZA 2Y3AA 2CHWA 3QAQA 2WXFA 2WXQA 2Z0UA 3APFA 4LT7A 2CJSA 4QAMB 4PS3A 4HLEA 4NPJA 4ANWA 4HVBA 4EZKA 4F1SA 3JZYA 2DMHA 2WXGA 2WXHA 2FK9A 2WXOA 4DK5A 3TWYA 3ML9A 3HN8A 4ICXA 3L54A 1UOWA 4NPKA 2CHDA 3L17A 4GNKB 5CCJA 3PYCA 3T8MA 5T8IA 4FADA 2NSQA 2ZKMX 4QJ5B 2CM6A 1DQVA 2RD0A 3QARA 2WXMA 4F91B 3FDWA 4FHJA 4KZ0A 4V11A 4XE0A 4QJ4B 4ICWA 1RSYA 2ENJA 3B7YA 2K3HA 1DJXA 4PS8A 3APDA 5G55A 4ANVA 1E8WA 3HIZA 2X38A 5H4ZA 2B3RA 3NZSA 1RH8A 3QJZA 4FJYA 1CJYA 5G2NA 3L13A 2ENPA 3QR0A 2V4LA 4NS0A 3OAWA 2WXPA 2A4ZA 4NP9A 5CCGE 4AJWA 3DBSA 2BWQA 2YRBA 3ENEA 3PRZA 2WXIA 3LJ3A 4Y1SA 2N1TE 4XZ4A 1E8ZA 4EZLA 2ENQA 1RLWA 1BDYA 1DJZA 2ISDA 2WXKA 2K8MA 3ZIMA 5JHBA 2NCEA 3S2AA 4F92B 4TV3A 4QJ3B 3N5AA 3TL5A 3PFQA 1WFJA 2K45A 2Q3XA 2WXJA 4EZJA 4GB9A 5CCHE 3ML8A 4IHBA 3APCA 3CSFA 2QZQA 4L1LA 4KZCA 4BFRA 1DJYA 4FLHA 4FULA 1UGKA 3F05A 4KITB 3ZW3A 3R7RA 2QZ5A 2UZPA 4LCVA 4ANXA 1BCIA 2LHAA 4TS6A 3L08A 2DMGA 3PS6A 4L1BA 1WFMA 4MJJA 1A25A 3NZUA 5JHAA 3ZVVA 4LDCA 5KJ7E 1TJXA 1K5WA 3F04A
chains in the Genus database with same CATH superfamily
4OCXL 4KX7A 1JZGA 1QEWA 1Q9KB 2PWEA 4YHMH 1LEKB 4QUOA 2FX8L 4F8NA 2EXWC 2EDMA 4IKLA 2VKWA 2YPLA 5H8DA 4U49A 5JOPE 1RD6A 5HGBA 1P7QA 3HC2A 1QSED 1TYJA 2VR9A 3Q2CA 3QZLA 3TO4B 5I0YA 4IOSD 4WI4A 3RWGA 1E28A 5F6HI 4YHYC 1ROWA 3SCMA 2BVYA 5JDJA 1ET8A 2C9QA 1T0OA 2K6ZA 4L1SA 2D31B 4PWIA 4RX4A 2MCPL 1RPKA 2RGSA 3BAXA 3C2AL 4R90H 2PYFA 5ECGA 1L5GB 1BM3H 2HP4A 4S2SA 3HG4A 2BVQA 1HHGB 4MZ3A 4WTQA 5CLWA 3GHEH 1D5BA 2YD3A 4CGTA 5KOMC 2Y36H 1NBQA 2GUOB 3KDPB 4XN2A 4G6KH 1H3UA 3CDZB 4I77L 3QIBB 5E94A 2LR4A 1T3FB 4HK0B 1DSFL 5C9JA 4L8CA 5L7XH 4M7ZC 3ARGA 1F6AA 1T1ZB 1BSIA 2XUWA 4K7FA 1P4IL 1S7UB 2V5TA 4P5KA 1ZPLA 2YJLA 2E9BA 2EXYD 2QL1A 2ATPA 4KPHH 5CM1A 5AW9B 1S7RA 3IDYC 4ORZC 3CFNA 1Z5LA 3FH8A 1TPXB 2B1HH 3MRRB 1X5IA 5KVFE 3RZWA 1EZVY 2VM3A 5GGTL 4K94C 4KMQA 2FQFA 3T3MF 4QRRA 4ZFFA 3U0WH 2YC1B 1MREH 4WFHE 5AUMB 4QT5A 2DLEA 5IBLD 3P9LA 4Z76A 3TV8A 1DQVA 2PXYB 5HD8D 5EU5B 4DKEH 3LZFL 3OAUL 3KL5A 2PPDA 3B2MA 1CI3M 4JEGB 2Q8AH 2FH8A 2J1YA 5E5MB 3DJRA 2RH0A 4NQEE 3OXRB 2IWKA 2P5ED 2W0LA 4HBCH 5KOVC 2VLLB 3J2PA 3TJEH 5L8LB 5KSUA 3UTSB 1AO7A 5EZJA 4M5ZL 1IBFA 1BEYH 4KKBD 1S5HB 1OTTD 2EH8H 1SXNA 1HHHA 4ZAKC 2Y1YA 5D2NC 3UPRA 1CDYA 4G1MB 4Q6IB 3EYSL 3QCVH 1NBYA 5BUGA 2WW8A 1QX1A 2H45A 1ZLSL 3U6XS 2F19L 1AG0A 1MQKL 2MKLC 4DKFL 1TLMA 1KBGH 5I1IL 1M9SA 5E1IA 2YBRB 2D7MA 1K5NA 1PZ5B 1FO0H 2IIJA 4K7PX 5K1JA 1R3KB 2KH2B 1KY6A 1Z3GH 4ZTOH 3ARUA 3HE7D 4JZNA 1Z9NA 4L9DA 1DO5A 4HU2A 4UAOC 4OQTA 2BIOA 4UZSA 3O4LB 4FYRA 5CHNA 3A4EA 3CSPA 5ICXA 2O30A 3NQKA 3T2OA 4ZQKA 2Y7LA 2R0WH 4RGNE 3SE3A 1S8DA 4HKBA 1J05B 2YUXA 4NWUL 4BQ6A 2EACA 5F8RC 3I6GA 4KTGA 4PCKA 4XR8C 2XWZA 2B3IA 1CZ8L 1ZDSA 2VXTL 3RWFA 5ABDE 3GXPA 3QFJB 3HE6A 4X8CA 4QPEA 2VDLB 4MSWA 3Q8EA 4FP8L 4W93A 4MDRA 3ESPA 1QUPA 5TPWL 1HH6B 2YIHA 2CGZA 1VFOA 4NQXB 4DP5X 5DWUL 1X4XA 4I4WA 4MJ6B 2D8KA 2X4PA 4JUSA 2BWIA 1FIEA 2OLDA 3BLPX 3F7LA 3FN9A 4NDMB 1UH2A 3P0VL 2DF3A 1SXZA 3LKSA 3L7EA 4X6CA 4M1GL 5E2JA 1UWEH 3TH4T 1M71A 1YEJL 3ULAB 1FV1A 5C86A 3M88A 3KPPB 4HW6A 3VSQA 4LSTH 4Y4KA 2IXQA 5D2LF 4K0OA 1JTTA 4NOFA 2OYLA 2I60H 3BAKA 3SDAC 3OR7B 4XCNA 5E08L 5EO9A 2I5YH 2BRRL 2AJXL 2DIEA 4JFXB 1JDCA 5GPRA 3RQ3A 5EZLB 4HOXA 1R3HB 4QWWD 4FJ6A 2XWXA 2CM6A 3G08B 4U7KA 3HPLA 5IT2L 2ARWA 2YAHA 1JNNL 5F93C 3HHSB 3ILEA 3ZHNA 2DJ4A 4APXB 3PP3K 4RZCB 1H5BB 3HFMH 4UIKL 3IKCB 5DWPA 2WZ0A 1HH9B 5CGMA 3E6HB 5BXFB 2IMNA 3PQYA 4FNPA 3E2HB 3V52H 1AYRA 3HUJE 3DX2A 5IVZA 2BSED 4N2CA 1IFHH 2H47C 3MBWA 4JFWA 4ONGL 2DWEB 3ISRA 1LYQA 3V4LA 3FU7B 4QXUL 1TKWB 3MX0B 3CVHA 1EEYA 3SYPA 2ZX5A 1SJEA 1QLEL 3C8KB 3QDGE 4FDWA 5I9QB 3S3DB 4L1LA 4F1SA 2FB4L 4PLKD 3WDHA 2WGNB 3JV4B 1RUML 2BNUA 3MUJA 5DZVA 3CIAA 5IHZB 2C7UB 2ZOLA 1CQKA 2DQDL 3QEQA 1ZGLA 1NFAA 3OB8A 4K07A 1AC0A 1X5AA 3HOGA 5FUZH 3STLA 1Z3RA 1M6OA 4ORGA 2CJTA 3RI5K 1GSMA 4MCZA 4O58L 1FYTE 2WBXA 1IC1A 4I9WE 2AJYH 4ELMB 4L23A 4LLVA 5L88H 2A77H 3VD2A 3CPUA 3WN6A 2O26U 5C0GB 3GM8A 2N59A 1IJNA 2VXVL 4ELKA 5AVZB 4PGBA 1MVFA 5E4AA 2ICEB 2H6PB 2VDRL 4L3AA 2AJSL 1SEQH 3W9DB 2FQGA 5DQ9B 2BSBA 5I8CA 1FNHA 4DIXA 4GUCA 3C08H 2ZONA 3PABB 4JE4B 1HS6A 1VFMA 3QDJB 4PLOB 5FC9A 2ZF9A 1MIML 2E6JA 4NN7B 1FQ9C 2NY1B 2WUBH 3ZGIA 3RNKA 3QC6X 1CWVA 1G1CA 2J7LA 1TZHA 3MREA 3AW5A 1ZANL 1ZA3A 1J9CT 1PZCA 3HR5A 1ZK9A 3FUHA 4WTZA 2DD8L 2CPUA 5B8CB 2VCOA 2VSMB 1NFKA 3WTXA 1DZ0A 3BLKA 4JFYA 3TEXA 2LTQB 2FEEL 4MJ5A 2YPLD 2ZWZA 5CU5A 2DL9A 1B90A 5GS2D 2FHFA 4QXWA 1QEXA 1FHGA 3QDMA 5TDPA 1T2QL 3PV6B 5AKTA 5TH2A 4J6RL 4ZOCA 3RIAK 4F8QA 5J3HC 2JB6B 3SCMD 1A1OB 4WFEE 2AXFB 3L54A 2NW3B 2QHLA 2VQ1A 3BI9X 3LMJH 4RX4D 3LKOB 3VG0L 4R26L 4OGZA 4GKLA 4A6YB 1KIUA 3R8BB 3KR3H 3BUTA 5DYFA 3KPTA 3L1GA 1KGYE 3FQRA 2GHZA 4XCFH 3GMQA 5HI4C 2WANA 3MRNA 4IMLB 4P2RA 4YSDA 1UVQA 2B9AA 3MMEA 5BVPH 4G6FD 3QR0A 3QUHA 1HE7A 3EBHA 4HETA 2R69H 4PGDB 4IGBB 3GHBL 4S1QL 2V9RA 1JHKL 4JHWH 1LWJA 1GYAA 4ILDA 4CW1B 2IDUA 1UWGL 3ARGD 1G7LB 1U8CA 2HLEB 3MRPA 3T3ME 5T3ZE 4QY8A 1LP9F 2EDQA 2OMTB 3QORA 1HCFX 1SJVA 2JI3A 3L1FA 4YEFA 2O6EA 4X50A 1ORSB 1AZCA 3LPGA 3FU8A 4XP1L 3TPUA 1IC5H 5BRPA 3UGXA 1U91B 4QRRD 3K74B 3VFPB 1CTMA 3JSSA 1FL6A 4NXKA 1F6LL 4PRBB 4U1GC 4G9FA 2JKXA 5GZOC 2VR5A 3KL3A 5EFIA 5KYUB 3SO3B 4ZMAT 1RUQH 3G5VA 3VB8A 3DX6A 3ULVL 2JIXA 1KB5H 3GBNL 4L4VB 3F7YA 2KZBA 4OFYA 3MU3A 3JTTB 3D39A 1AO7D 1LO2H 3UAAA 5KVEE 4TUJB 1QQDB 3TN0C 3QIUC 3O41A 2YFOA 5FKAA 4PG2A 1AJ7L 2G5RA 1RK7A 1RZIA 2Q3ZA 3HS8A 3MJ9H 1DN0A 2AQTA 2ZUYA 3IRCA 4PJ9B 1GGYA 5CBAB 4QDGA 5IVXF 4GW5A 5IJKC 3O4OB 5JDSB 1CYXA 4L5FH 2V7NB 3N42F 4OLYH 4KZDH 4OY9A 5CJQL 2BNQB 1HAWA 2YSSA 2DYPB 2EUVA 1QO3B 1AGBA 4ZDHB 1GSKA 1VAHA 4F8PA 2CU9A 2XPYA 3WUWB 1FRGL 2MMXA 2CLZA 2BLFA 4PI2A 1FGVH 3VYOA 1D5IL 1SHSA 4KNQA 2EE6A 1WWBX 4TNGA 3BX7C 3IB4A 5DUBA 5C0EA 1A6ZA 2IPTH 4JDZB 2QQLL 2F74A 4X6DA 5KJRL 4KDVA 3KPOA 3CX5J 3NIFF 5JHDE 3AAZA 1E6JL 1L9NA 2VUKA 2W0PA 3X17A 1T7ZA 5J8OA 4N90D 3EKCA 4LK4A 3RJDA 1A47A 3D3VA 3P4MA 3UTQA 2ZNXA 1DBMH 1WC7A 3PL6B 3V6BR 5GRJH 3PGFL 4F57L 4POYA 2A9DA 1X4YA 3OR6A 2P49B 5IW6B 4IOFC 1A3RH 3HE6D 1M2VB 3M1OA 3BT2L 3ML9A 3NJVA 3W11D 4CSPA 1A66A 1ITCA 3HZVB 3PWJA 5F9JB 3CXDL 4M1CD 3TT3H 4C4BA 2XU9A 3V4VB 2FYVA 5DRNA 1MWAL 1ZT1B 5FM5M 1RJLB 2O6DA 3TEYA 4WHTB 3I9GL 4Y16A 3DJZA 3FQTA 5D2LE 4FA8A 3GSXB 2EZ0C 2AEOA 2GBAA 3E3QC 5GS2H 2JKIS 4OI8A 3JVFC 3QG6B 4LVOB 3LQMA 3SY0A 1BHGA 3ZTNL 1O5PA 2AJVH 2ZCHH 3QWOB 3P69A 3TTYA 2YUZA 3OGCB 3DTXB 5D9SB 1LK3H 4Y4KD 2RFXB 4WY7H 3TL5A 3OLDA 1IGTA 4UQ2A 3UJIH 4ZYKB 5J13B 1J0IA 3MV8E 5EZPA 2XG5B 1UASA 3HC3H 3PP4L 4IRJA 1PLCA 4DP6X 1JNJA 3V9EA 3NA9L 4Z7QB 2IQAB 4FI8A 2CO1A 3UACA 4JN2B 3BDYL 4HJIA 4UOW1 4IIQC 4ADJA 4J23A 2VLKB 1E4XL 1TJXA 2OP4H 3CQQA 4J3SA 1T2XA 2YHGA 3ZO9A 1NLBH 4H8WC 3P30H 1SMDA 2AEPL 4GAYB 4AI7A 4HV8A 1A1NA 3MJ8A 3PQYD 3CXFA 4JFQA 5HYSG 1CFVH 3VFRA 4LGPB 4XXWC 4MZIA 4FYQA 3ULVF 3VGDA 3MJGX 4WUUB 4YFDB 4LLYB 4XWGL 2I07B 3ZY7A 3V95A 4FXLA 1XAKA 2WTRB 1HCYA 2WN3A 3O2WH 4IBQA 5EOCH 4JG9A 4BWUA 5F0LB 3LHAA 1JERA 2I32A 3QEQD 4NO3A 2SEBA 3BH8A 2WNXA 3B83A 4HIEB 4NFCA 1E5YA 2Y22A 3RGVB 1HYSC 3DNKA 3IF1B 3FPYA 3UBXB 2BW5A 1E43A 2Y06L 4PWFA 3SPGA 1T1WA 2PW2A 1GCFA 5IY5B 1AD9B 2MNWA 3MVSA 1QI3A 3IVKB 2OSXA 5CZRA 3WNNA 2BJML 3STZA 2ZICA 5E7FA 1BGXL 2EEFA 3CPLB 2VXSH 5FOBB 2WXGA 4TYUA 2AK4A 1VRSA 4N1EA 1SLXA 3ATEA 4YC2B 3BKYH 1TZGH 1ZSDA 3I6SA 4CU8A 3N40F 3FOMA 4DP7X 1JN6A 4U6HA 2RD0A 5DEJA 1MZYA 2XHNA 4ICWA 3LTVA 3GUTB 5HXMA 3QJSB 4L3CB 3GHEL 5H4ZA 4TTDC 4LHJB 4ZW7A 3NCYS 5K33A 5SV4A 1LM8V 5F1NB 4NS0A 5CJBA 1G87A 5DS2A 1KGXA 3RWJA 2NTSP 2CK0L 5D6DC 2PO6A 2YA0A 5FA3B 5FW6A 3ULVC 3MHZA 1J8HA 1DFBH 1FAIH 1MZZA 5DDHA 2EVFA 3GBDA 2APSA 3QPQC 2ZUQC 4NZFA 4WO4B 5E70A 1KT2B 3FFCD 3QDMD 4KPHL 1CBJA 2FIKA 3L5WB 2A1WH 1JWMB 3MBEA 2B1HL 3F12B 1QPPA 4IHBA 2QZQA 1BZDA 5J1AA 2VERA 1JGDB 1IBDA 3I50H 4BUHA 3AG1B 5J7CC 2R56H 2YK1H 3ARFA 5FV1L 5L4MA 1DVFC 3P4OA 4FNLH 1N8OE 1M1SA 2Y6TE 3MLTB 4P2RD 5BJTA 1BJ1H 2Z93B 1LP9E 1YEGH 3KCPB 4JO2H 1GZQA 5I1EH 5ISZE 4F37K 4AV5A 2EH8L 2OZ4L 4R2GD 3UDWC 5KTEH 3DOSA 3NSFA 4PRIE 4OU3A 3NZHH 2ICWA 1PKQB 2R1WA 1AE6L 2WNWA 5HHQA 4HG4J 3B3IB 4HHAA 1WD9A 2NXYC 3G9VA 3QORD 3HI1B 3NZ8A 2H26A 4I0KA 2FYYA 1TTGA 2PN5A 2VR6A 3PV7A 4AE1A 4KRPB 3K2UL 4HFWA 5FHBL 4BSWB 3S6CA 1MCSA 1OT4A 1K2DB 2R2HA 4B9PA 1N6QH 1UWXK 3MNWA 5DRZA 5HBBA 1MCKA 3L4WA 4TQ8A 1J18A 4G9FD 1QW8A 1S9KC 4ZMTA 3PGDB 5FK9A 4LSQL 4L37B 3UGUA 4M61A 3BWUF 2JIXD 1GGBH 2F68X 3SE4C 5C0BA 1HVXA 2RCSH 1ZMYA 3CX2A 2LU7A 3H2WA 4OFYD 4IK7A 5KBKA 3S8GB 2JE8A 5IVXE 2I9LB 3D39D 2H7WA 3WKYA 4AENA 4JREC 5DJ0A 1EZSA 1P7KA 4OLUL 4Z77A 3QCUH 4O51A 4LSVH 4QRPA 1JPSL 3N1MC 1B2WL 1N7MH 5DEZA 3HNTH 4YHKL 2NTFA 5EU6E 3UCQA 1A1MB 5GHWL 3CVHH 2EO7A 5CCKH 4R5VA 2R4SL 5I8OL 3M86A 3LVEA 4MKTA 2X4RA 2VO5A 2VDPL 2FATH 3CC5B 4W9HC 5LNEA 4HS6A 1MXGA 4UM9B 1QR1A 3V79C 1AIFB 2V0AA 3M1BA 3NIFE 4R4FH 4ETYA 1ZS8B 2NNFA 2MKWA 4Z7VF 1W0YT 1QTSA 2CPCA 4J5VA 4E9RA 5F3BB 3FTXA 2OXHB 4GRWH 1SFHA 4GXUN 4TVSa 1HWGB 2A6JA 4JRLA 4PMFA 3RZCC 4OCRH 2HFFB 5J57B 1CVRA 1Q9KA 5K1NA 1LEKA 2XQYK 3U4BH 4AM0B 1INDH 5DD6B 3QUYB 4R7XA 5CZVH 3H3PH 2FNWA 1R34A 3SGDH 2AMUA 3HB3D 3D3VD 1E9QB 4LARL 5AOKA 4HD9A 3TO4A 2R1YB 1HEJC 3DIFB 1UC6A 4JPVL 1AC6A 1ES0B 2HJKA 1OAKH 2W8CA 3LX9A 2A0LD 2B14A 1VEMA 3MQIA 2D31A 2QVIA 3GK8L 2X4UB 3BWUC 5JA9A 3L1OH 1F4AA 1L5GA 3LN9A 5ALCL 2OCJA 5IG7B 1XCTB 1HHGA 2C9PA 5B1AB 2HUEA 3PUCA 2KLTA 5DVPA 1BQLH 4C58B 2BX5A 2RA1A 1XVSA 2GUOA 4IIZA 2VE6B 4Y16D 3IK2A 3CDZA 5HHMD 1GS7A 1QAWA 3QIBA 1EMTL 5JIQA 2X44D 1A7BA 1T3FA 2LU4A 4HK0A 5TFSL 3V52L 3UZQA 1BVLB 3KDMB 1T1ZA 3LS4H 4OLWH 4B0MM 2FR4A 4N2HA 1S7UA 3UJTH 1S78C 2G2RB 4BKSC 2G75B 3CFMA 4EKXA 2AJUH 4J3OF 2FX7H 2MRYA 5FW8A 4NNXB 4A7SA 1VKXB 3D7PA 4XNYL 2WO4A 2FQEA 2CDFB 5D7JC 3WAJA 3VCLB 2CWRA 2VL5A 3AS0A 3SQOL 4IRJD 4R4BB 2YC1A 3FPXA 5AUMA 5A7BA 2XTJE 3HBQA 3KPLB 3T6WA 2PXYA 4RMUA 4FQ1H 2R2BA 2CXGA 5EU5A 4YIQB 5F7MC 4DH2A 5C09E 2IADB 1J1OH 4ODSH 2H0PA 1KENL 2YUVA 2PP9A 5E5MA 4WSKA 1MHPL 5I1HL 3K2MC 4L0YA 1LK2B 3BDBA 4Y9GA 4BE5A 3UTSA 3ULVE 5IHUH 1S5HA 4P4KB 1Z9OA 3S3CB 5C0RL 2DQEL 2APVA 3MLRH 3ECBB 2YMXL 5D6CB 4G1MA 4Q6IA 2D03L 1U21A 4LEXH 1EHLH 1BFOB 4Z7WB 3ZE2F 3O11B 1UYWL 2WLKA 1ZLWH 2G3MA 2YBRA 3IMVA 1PZ5A 2DQJH 2WZ6A 2ZKMX 4QJ5B 1KPRB 1R3KA 1ZXKA 2WVTA 4FCAA 1UD2A 4LLQB 3R8QA 3DMMB 1JL8A 2WINA 4OF8A 4FQIL 5AENA 1BX2B 4NQTA 2VZVA 1V8HA 4ZPVB 1E4WH 5E2TH 1O9ZA 1EZVX 3HNSL 3TLRA 5HHOD 2OYMA 2XQYG 1QD0A 3O4LA 3VFMB 3KHQA 2G9HB 1UJ3B 3DBSA 1J8RA 5F6IB 2OI9B 4YBQD 2ODHA 3BP7B 3CV5A 4J3OC 1D3CA 3KVQA 5EOCJ 4AEIH 2IDSA 3PUUA 4HGKC 1GY1A 4S1SL 1IQDB 5LWYL 2J1XA 2PTUA 3ZKNC 3QFJA 2QPUA 2AK4D 4N5EC 4BFRA 5AB0A 2WLZA 1MCWM 2ZF8A 3L9RA 3ZRFC 4DPCX 5J11B 2TRHA 4NO0B 3OKLB 4M62H 1HH6A 2XX1A 4EUPA 5DS1A 1ZIBA 4N8UA 4NQXA 1TO5A 3O6FA 4M6ML 3IJHB 3MUY1 4MJ6A 1VFAB 2NY7L 5K5YA 2FQDA 2J1WA 4X8XA 2H5UA 2WXRA 4NDMA 4BK8A 3RY6A 4Q9QL 2PO6D 4HCFA 1I9IL 3ZN6A 4MXQC 1CXEA 2AP2A 3KPPA 2ZX8A 1DBBH 5IUSA 3VSVA 2VXQH 5GRVL 5EO1B 3P0YH 4B6ZA 3MBED 1MFVA 2ZOKB 4NZRH 1UH4A 3J7HA 4YHLL 4OZGA 1FP5A 2PCXA 4JFXA 4GXVH 5EV7A 5EZLA 1DVUA 3MLVH 5EIVA 5AW3B 2AZUA 2COQA 3DXAE 4NO2B 3ARFD 4LCIH 4RMTA 3EFDL 2VLME 4HUUA 2HRLA 2FD6H 1KG0B 4PWJA 4Z7UF 3HHSA 5CSBA 3RPKA 1A9EB 1GW6A 3EAKA 5C0IB 3OKYA 2VMEA 4RZCA 1H5BA 3D4ZA 5I1DA 1E2ZA 1JGEB 5HHXL 1GMIA 2UY6B 2N1KA 1HH9A 5DFWH 1L0YA 3E6HA 5BXFA 2BVTA 3FUDA 4KY1H 3ABMB 2ED8A 3FCUB 2HT4C 1MHEB 1K4CB 3G5YB 4QHNB 2WZAA 2XQ0A 5EIIG 1JZ7A 2DWEA 2HH0H 5DHYB 1BVNP 1N70A 3FU7A 1AZNA 4FL4B 3MUGB 1A5FL 3MX0A 3MA9L 3C8KA 5CCJA 4FQHB 3CHPA 1BJ1J 1ZVNA 3TFBA 3JV4A 4N8CH 3WIIL 1NCCL 1T6BX 5F7KC 2Y0SA 2FWOB 3SE9H 1MDTA 2C7UA 3B7YA 3MROB 2O6PA 1SM3L 1OVZA 3Q5OA 3L3IB 2OCCB 3OLGA 1KCKA 1OEZW 3O3EB 3ULSB 4KK8D 3P40A 5EUOB 4N24A 3WU1A 1CGSH 4ELMA 2YRBA 2FJGB 4JPKH 4OQ1A 5DC4B 5C0GA 3U7WH 4PJIB 4R97B 4W4OC 5CR8A 2ICEA 2H6PA 3C2SA 1P4LA 1IU1A 2EJ1A 4WNJA 3X1BA 4D8OA 4LIQL 3W9DA 3NT0A 5DQ9A 3ZKQD 2EXYC 2LVEA 2CKBL 4K5PA 4HH9B 4Z7VE 4KXZI 4NWTL 3PABA 5AVYB 4GQPH 5IQ9B 3MR9B 3OKOB 4PBVC 3EUDA 2D7PA 3EGSB 5AYUH 1EUTA 1GAFH 1MF2H 2CCWA 2EE2A 5CXPA 3N43F 1NC2B 5I6OA 5C0AE 3NGBC 1BECA 2XWTA 1G9MH 1I8MA 4PREB 1G9NL 1WBZB 5ILTH 3GMPB 3ALPA 1AGEA 3MOQA 4EI5B 4JLRB 2NQ3A 1DBKH 5FYLD 3OKEB 1A7QL 5B8CA 1LO5B 1EJFA 4F7TB 2YARA 5I28A 1QATA 1CS6A 2Y6SD 5HYEA 3N06B 1D2OA 1HIMH 5DMGC 3RWDB 3UMNA 2ZCHL 4PWGA 4N2MA 3CCHB 4PGZA 1CGVA 3FZUD 3R4RA 4HJJL 3TO4D 4WTXA 2JB6A 1XF4B 1Y18B 3FTSA 3TOPA 3WY1A 5LNGA 2AXFA 5C0CB 4A7GA 3JYBA 2NW3A 2KI6A 3HC3L 5C07B 2GBVA 3RY5A 3JWOH 3LKOA 5I30L 3MTXA 5DJDB 2BY1A 5C0NC 2VIRB 4A6YA 5EU7E 2WLYA 4X6FB 1CVSC 4HG4K 3FO0H 4IMLA 4MQ7B 3HE7C 4KBPA 3W57A 3IXTB 3ARTA 4NRYB 5DJ2B 3QIBD 5E6UB 5EA0L 1IGFH 2MTAA 4IGBA 5AW2B 1JJUA 2E9JA 1OD7A 4FFYA 2H3XC 4HQQL 4PTUB 2A6DA 1G7LA 5A43C 4LL4A 1ZPUA 4LPYA 4YHIB 3TA3B 1YEDB 1GYUA 2DM3A 1JXKA 2OMTA 4HT1H 2DTML 4XNXH 1ORSA 2VDNL 4M7KH 4QOKB 5CBEB 3EOTL 1F41A 1NCDL 2NY6B 3NFNB 5CU9A 2BOLA 4FCHA 1U91A 4M02A 3UAEA 1DZBA 3VFPA 2W9EH 3Q6GL 3FH5A 4CNIB 4UT9H 4PRBA 3UABA 4NN6C 1KLFB 4K8RD 2PXYD 5KYUA 4HP5A 2IBGA 3NZSA 1E30A 2VC2H 4L4VA 4GW1B 3EOYG 4I0PC 2IC2A 4QXTB 1MCEA 3FMGH 3ISYA 1OAYL 2B7DT 3JTTA 5BRZA 1JMXA 3UTSD 3L9EA 1DVQA 1QQDA 3AY4C 2HJFA 1YUKB 4FNQA 3SDXF 4P2YA 2YS4A 3SGEI 1FNGB 1RLWA 3WUWG 3JV6B 2WKOF 2FGWH 5JDSA 3WKML 1XTMA 5DEFA 2AAAA 4JVWA 1U3NA 3WNIA 4E9SA 1WAEA 1JFHA 3C6SB 5DA4A 5SX5K 2BNQA 3GJEB 5FWQA 3T65B 2DYPA 3QZWB 1N5YL 1QO3A 2B0SL 1TJHL 4JCWA 2FGZA 4MHHG 3U2SA 3Q8BA 1YLBB 4OIIL 1DQLL 3T1FB 4OQTL 3GTVA 3WUWA 4QWWC 2AEIT 5ABZA 2QLVB 1MRFL 2KPNA 2PTTB 4Y4FA 1J11A 3FO2B 3VAEA 3GRBA 3VH8G 4AYBA 2HPOA 1V7NH 2Y7MA 3FSAA 3O4LD 1G6RB 3W0WB 4FXGB 4AVHA 4JE0A 4WK2B 3QJQB 3GUFA 1S7XB 1KUMA 2BC4B 1A7OH 1QSEE 1NJ9B 4LKXB 3UERA 2HTKC 3B9DA 3PL6A 1SYSB 3BPNC 2A6KB 1M3JA 4G7VL 3D0VB 5IW6A 3QFJD 5F3FA 1M2VA 1T7WA 5CLTA 5ADPL 1YPZB 3T2LA 3HZVA 1RVFH 2IFFH 5F9JA 3LDBC 4E41B 4XVTH 1XGRB 3W3BA 3V9CA 4ZS6D 3UP6A 2VDMB 4I5BB 4B97A 1DANT 1CCZA 2FJUB 1HFUA 2ITEA 3GO1L 4P46B 4PLKC 2JELL 1XF3B 4HCGA 4D3CL 5IFHL 1ZT1A 1NBZB 4QHLB 3UADA 3S9DB 3MRKA 4IBLT 3H53A 4OZFA 5FYLH 3LRHA 4WHTA 1JNHB 1X9UA 1KXQA 3FSZA 4OB5H 5D1QB 6CGTA 1YEGL 4WGWB 4A37A 4MMZC 3G6JB 1Z6JT 3JV0A 1RP9A 3LZNA 3IDNB 1Y6KR 4NQSB 3QG6A 4MXVF 4KMTL 4CVUA 2VSCA 2ARJQ 5AVQB 1N0XH 3QWOA 3S36L 3OGCA 2DBLH 3FN0H 4UINL 2RFXA 5CEYB 4YXKL 4ZYKA 5MEQB 5AZ2L 3ILQD 4Z7UE 1NCWL 3EH5B 4UQIM 2XG5A 12E8H 1W72H 3LRGA 4K23H 2OK0L 2IQAA 3JQOB 2A4CA 2JKNA 1OP9A 4JN2A 1OHZA 4XNMA 2MCMA 3SKNA 1NGQL 2VLKA 3JUYA 5D8JL 2JJTC 1HWWA 2G4EA 2P5EE 2OMZB 4B9KC 3GDBA 2D2CC 4GAYA 1L9OA 4PD4K 4MXWH 1NOLA 3IS0X 2BIMA 4HC1A 1G9NC 1N7ML 1QRNB 1EWHA 1RFDL 3TTSA 3HNTL 4XMKL 3FSWA 2XZZA 1SNRA 1BD2B 3VW3L 4HBQA 4HGMA 4WUUA 3KJ6L 1JYXA 4LLYA 2DEYX 2DQUL 2I07A 2PYEB 4PJHB 2FATL 2XWCA 1DE4B 5JZ7C 3AMKA 3UBXG 1DCEA 2KZWA 2WTRA 1JF1A 3SCMC 1I7TB 4PEEA 4LPXA 4WFFD 4P8QA 2JJUA 2WWKO 5I17A 2ZUVA 4P9HL 2IQ9L 4F15C 4NQDB 3UTPD 4HIEA 3MGAA 2XDHA 4X5PA 4GH7B 1QI5A 1CL7I 3RGVA 3UBXA 5KYXA 1NMAH 2OCFD 2GKIA 3QEHB 2D7TL 4K3EH 4P3WA 3RPIB 1AD9A 4ABVA 3VD3A 1UB5B 1IKFH 2B2XH 2AABL 3IVKA 5LGHH 2VL4A 3K6IA 3ASNB 3VE0A 1C5DB 2QQQA 4LBEB 3WL9B 5AKVA 1W6LA 3CPLA 1ACYH 5FOBA 1C5BH 3HZYB 1R1CA 4NIKB 4NC0B 3AU0A 4CKVX 2ADIB 2DQFB 4C4UA 1F5WA 1G1KA 5L2JB 3GNMH 2EQDA 4DNLA 2FJHB 2NY1D 3ECQA 3UYRH 3OMNB 4GMTH 3GUTA 4N8VB 4L3CA 2YBGA 4FNTA 1IC7H 3SBPA 4LU5L 7PCYA 3WS6C 5I2IB 2IG2H 4FEIA 1E4KA 1ZTXL 3PIQB 3VFTB 1YVLA 1A6PA 5F1NA 1TSHA 4URTB 5FA3A 2Y3AA 2J72A 4GG6B 3TX4A 3LEYH 4LT7A 4H13C 3C6LC 3MLYH 4YWGL 1WO2A 5I75C 4A2GA 1KT2A 4OT1H 1FFNB 2EEAA 3MOBL 4N1HB 4P59H 4BZ2A 2AJUL 3L5WA 1RK1B 4Y4HB 3TWYA 1JWMA 3L6FB 1L6XA 4X6CF 3X1NA 3KNBB 4GBXB 3F12A 3QGVA 2P8LB 3AXIA 3KEDA 4NQVB 2OL3L 4ALAH 4EUPH 4OLVL 3KGRA 3AT8A 5EG6C 2EE3A 3OHXB 3BRDA 4JN1L 4ODSL 4AZUA 4EOWL 2VDKH 3E80A 1INEH 3MLTA 3Q01A 4LSPH 5I26A 5EB9A 3SBQA 2Z93A 5JIIA 5BO1H 3OZ9H 1WHPA 3KCPA 1K8DB 3ZYJA 3G7TA 3GSVB 4IGBD 1OE2A 2W9DL 1DL7H 4W1TA 1U3HB 3D6GA 1KLGB 5TE4H 3ILPB 1EH9A 3INUL 1CICB 3O3UN 4K5LA 4K3DL 3B3IA 2ADFL 1WFJA 3T08A 5EUKB 1KFGA 3HI1A 4GB9A 2ZWKA 3PWNB 1TT6A 4X9BA 4DGYH 1WYJA 4XO9A 4DTGL 1FNFA 3TC9A 4QEGA 4LNRB 1EVUA 3N1FC 5IR1A 1KBVA 4P04A 1I8LA 4RFNB 3W11C 2X4TA 3CWGA 3X1FA 1T66C 5EIQA 5F89B 4L37A 1F4XL 4M1CC 4XMLL 5C3IA 2CMRL 3TIDB 3SDXE 1OAQH 4Q9BA 1WZKA 4L4VD 4C59B 4MD5B 4JGJA 5BRZD 1X5YA 2GB2A 3HLAB 2Y23A 3A4AA 5KSVB 3GSNH 4YDIL 2GT9B 4MX7A 1PG7X 5IESH 5E23A 5CGYC 1MAMH 2QHRL 4G2AA 3MLXH 2YKLH 1Q90A 3CHOA 1HXYA 1XBDA 1A1MA 4KUZH 4WU5B 3UTZB 4Z5RB 5KBMA 5ADOH 3KPSB 4I13B 1EDQA 2Y2TA 3TBBA 1NL0H 2GY7B 4HUNB 1AAJA 2HG5B 3CC5A 5FCUL 4EBQL 4LIQE 2BNQD 3CZUB 3VA6A 3D2TA 4LLDB 3ZGHA 2VLJB 3ZPDA 2DYPD 4XNBA 2F53B 1AIFA 1WZ1H 2WV3A 1WUZA 5AVUB 1ZS8A 4I2XA 2BP5M 5ECJE 4D7PA 4Y4FD 2OXHA 4MNQB 5TE7H 3FTYA 2ZAGA 3GLEA 2HFFA 1AS7A 1TEYA 5FM8A 4OGAD 3DRQB 1PEWA 5ESQB 3WN5B 4AM0A 5IEKB 5DD6A 3SYCA 4FRWA 1N68A 4MGXA 4YHYB 3EDDA 5I66B 2YXMA 4Q9RL 1N0LB 2IDCA 2YPLE 4E9WA 4XHJD 1E9QA 2XKUA 4GY4A 1UQSB 4KI5D 3PL6D 4JY4B 1DBBL 3C09C 4H88H 2R1YA 3JWNE 3DIFA 3U2JA 4NUPA 4NZRL 1ES0A 5GRWA 5DJYB 1OP3H 3T8MA 2P7TB 1W6WA 4UU9B 1OGSA 3CFCH 5DQDL 4GXVL 4LEOB 5T1MB 1LO4H 3WFCL 2X4UA 4KVNH 4J39A 2DI9A 3II1A 4LCIL 3M17B 1XGYH 4FNSA 2EDWA 5IG7A 1XCTA 2VAJA 5ID1B 1FE8L 5KSBB 1JGIA 1NSNH 2FT6A 2J5LC 2V7HB 3DUHA 4MXVE 1FL5B 1J88A 1BXUA 4Z7NB 2VE6A 2VW7A 3EHBD 1RK0B 1ZHKB 4R7NB 4NPYB 4P9HC 4PVBA 4M93C 4OCWL 3EYVB 1E8ZA 1Q1JH 4PM1A 2XRAH 2R29H 2EKJA 3FT9A 4LSUH 1BVLA 3HZMB 3KDMA 3C5JA 2G2RA 4JHBA 3WHE0 2G75A 4Z7AA 5GGRB 2HXAA 5ICYB 2NR6C 4NNXA 4AIEA 1VKXA 3VD5A 4JFSA 1IGIH 1ILUA 4O4YL 2CDFA 2LABA 4JHZA 5DO8A 1NCGA 2IANB 3TVMB 3VCLA 3PS6A 1MI5A 5L6YL 4N8CL 3NEEA 4QRRE 2LFEA 3EDFA 4R4BA 5B21A 4YVUA 1A2YB 1NH6A 5I5RA 2KLRA 3KPLA 3EDEA 3INOA 4FTVB 4YLQT 2X6MA 4NHUB 1IM9A 3ZMRA 4YIQA 4FAAB 2IADA 2MOQA 1F1DA 2VLKD 4YAQB 4ZAKB 2PF6A 2VXUL 2P44B 2EXSA 2XWRA 4LLAA 1KACB 4TRPL 1LK2A 1R6VA 2XY1A 3DPDA 3T0EC 1CGSL 1AO7E 4FFYH 2VERN 4P4KA 4WCYL 3UG4A 1KTLB 3T3PF 5F9OL 1XX9C 2JCWA 1E0OB 3BAEH 1MCJA 3ECBA 3ZHDA 3K6SA 2QQNH 5D6CA 1THAA 4KX8A 4NQCB 4WUUD 1CK0L 3UZVA 1F97A 4ETQB 1SBBA 3VXTB 3O11A 4FKKA 2NUPB 4NT6B 4FLQA 4TNWK 5DK0B 5FA4B 3PXLA 5F96L 5G4NA 4ANKA 5DRXB 1ZIAA 3CHQA 1R5WB 4K55A 1KPRA 3IM1A 4Q4IA 5HGHB 4LLQA 2KBGA 2MNUA 3DMMA 1G9ML 4A1RA 4IM8A 1BX2A 2X1WL 3L45A 4ZPVA 3DDFA 5ILTL 3BZEB 1RZKL 5DU7A 5FDYA 1O5DT 4OUOA 5HDBB 3VFMA 4GMSH 3UG5A 1QBAA 2D7NA 1DBKL 2G9HA 3P9MB 4HJGB 1NMCC 1UJ3A 5EZOH 3HZKB 3RGVD 4B9IA 2CHZA 2IOMA 4LKCA 1O6TA 2UWEB 1HIML 4N90E 3BP7A 3KJ4C 3RWCB 4X6DF 1Q0XH 2VH5L 3QB7C 3ESVF 3SKOA 2EDFA 3P3YA 1IQDA 5GZNC 5EOTB 1CE6B 1SJHB 2QFPA 1YQVH 2A74B 2AQ3A 3FF7A 1H6FA 3LNDA 4UBDD 3C5ZC 4FI7A 4RGMC 3JWOL 2AKRA 4NO0A 3OKLA 2RB8A 4HXAL 5CP3A 2VZSA 1MWOA 2OXGA 3KBPA 2NZ9D 3O3AB 2HZHA 3T4AB 3V4UL 1N2RB 3N3EA 3ZDYB 1VFAA 3WO3B 3LH2L 1NBVH 2H4EA 5GRUH 3MACH 2I85A 1MJ7H 4M7LH 1IGFL 3BUIA 3KYKH 5GJTH 3RIAF 4X6CE 1IAOB 1C1EH 4MLIA 3W9EB 4MRCA 3SJVB 4U4BA 3CLWA 4PG2C 1CMOA 3P4LA 4M7KL 1CLOH 3VG9C 1XR8B 5EO1A 2BSCA 4RWYL 2ZOKA 4JZOB 3ARPA 4ODVH 3DHUA 2R23B 2NW2A 3FT1A 4NHCH 3FT3B 5JIMA 1MFCH 1R17A 2JQMA 2OW7A 3GLDA 3ARQA 4NO2A 3TCXA 2Z34A 1VHPA 2NZ1A 3LKRB 4OZFH 1KG0A 4MZ2A 4KKQA 4DKDC 1PIFA 2LGNA 1A9EA 2WO3B 4DESA 4FD0A 5LAPA 4QHKJ 2ZNWA 3H3BC 1SQ2N 3QO0B 1ZGLM 2H3KA 4IJTA 4Q0XH 1JGEA 5B7EA 4MD4A 2MTPA 2XJLA 1F1AA 1S7WB 3BYYA 4QRSB 3B9EA 5FO2A 3G5YA 1MHEA 1K4CA 1YG9A 1OAZH 1UXMA 3BKMH 3BW9B 3UO8B 1SYVA 4TUUA 3FTZA 3P2DA 4GKNB 1OAXH 2QSCL 2R9HD 3BD3A 5DHYA 3U6XA 5I23A 4XN9A 5A7EA 5CJOH 3QEGH 2NSMA 3MUGA 1D2PA 4KRPD 3K6DA 4FQHA 1YHPA 3OB0H 3RY4A 3T2NL 3QJFA 4OUUB 3Q48A 3QNXB 3MPCA 5CN1A 1H15A 3FQ4A 4QNPF 4NKIL 5DK2A 4Z95L 5DD3H 1PZ3A 2HA1A 1JYVA 2VDOH 4ZMQA 3WJLC 3L3IA 3WIHH 1NANH 3NEOA 2BDNL 1BQSA 2HLFC 2BMKB 3ULSA 2XNAB 4WV1C 5EUOA 2FJGA 1NEZA 3P02A 2VISB 2QADC 4GXFA 5E2UL 2HKHH 2F1AA 4PJIA 2WC7A 5HTSA 3SE8L 3L3KB 4CN4A 1DQJA 3ZTCC 3VRIB 4DGVH 4O2FB 3CMOL 1HJCA 5DJZB 2OMNA 2YGQA 3NH7L 3BWSA 4HH9A 3L5IA 5IQ9A 1FH2A 3MR9A 3OKOA 1GTFA 2HUHA 5FV2A 4YJZL 4B9GA 4WWID 1JPTH 1R3JB 4WU7B 5KANI 1IVLA 1G7IB 4Y1AB 1PD6A 1U2CA 1XB8A 1NC2A 2WY3B 3F5WB 3QWQB 4IRJC 5E7BA 2EILB 3ETSA 5F70A 1JRHH 1XGTB 1HSAB 4PREA 5D7SL 5FS5A 3T0EE 2N4IA 3GMPA 4EI5A 2HJLB 4JLRA 4JFZL 2E7LA 4MA8L 1EO8L 2WXIA 3OKEA 1LO5A 3POHA 1FORL 4F7TA 2AVFA 1ZTXE 4HOWA 5L9DL 4GI6A 3RWDA 3TBWB 1N0XL 3DO4A 3BCFA 3CCHA 4ATWA 4YSCA 4EZJA 1DLFL 3BISA 2AK1H 3FUJA 2CIKA 3FFCE 5L2KA 1QSZA 2J88H 3QDME 4XRCB 4HULB 3FUNA 1P4BH 3VGAC 1WS8A 1XF4A 1Y18A 2DLFL 1XEDA 3DETD 1NAMH 2E8YA 4TUKL 2C26A 1QFWH 5C0CA 5KWYC 2QVKA 4NJ9H 3G6AB 4JQVA 1DEDA 5DJDA 1CFTB 3QXTA 2VIRA 4X6FA 3SYQA 4KVCH 4G3YL 1WICA 2PNDA 5M7QA 3IDXH 1CFNA 4MQ7A 3S2CA 1WPCA 4P2RE 3NPZB 1U2YA 2YAPA 5DK3A 3IXTA 3Q6FB 3IPFA 3QHZH 4NRYA 5DJ2A 2EECA 3RX9A 3RKDD 4N1CA 4W9LC 5HHNB 1TXKA 1ZV2A 4P48A 1IIIA 3A4FA 2CA3A 4GSDL 2CA4A 4YHIA 3TA3A 3GZPA 1YEDA 4YBQC 2VDQB 1Z9SA 4U1GB 1YN6A 4IHOB 4QOKA 1ZSHA 5CBEA 1D6VH 3A5VA 2KL6A 4X7EC 5JIHA 1V3MA 3NFNA 4IRSB 4MQTB 3OAZK 3NIGB 4XP5H 4K8RL 2ATAA 1MFEL 3L5HA 2DDQL 1MI5D 4GO8A 1IVTA 1JCKA 3CH8A 4CNIA 5E2WL 1KLFA 2CRYA 3TN0B 4G9FE 1Q72H 1IM9D 2Q0ZX 3VWJC 4LDLB 4R7LA 3T3PE 3C5SB 5HJGA 1CYGA 3ZLQC 4GW1A 3W56A 4QXTA 1QOKA 3GBML 3QJVB 5GS1C 4Q8BA 2O5NA 4WWOA 2PPAA 3D39E 3NPSB 4G7QB 4AW4A 1JK8B 4P4KD 1JNLL 5F7BA 3QZWG 3APFA 4MNGB 3KLSA 1FNGA 1NCBL 2OMWA 5TQ2L 4AQAB 4LQFL 3UCRA 3JV6A 1ACYL 1PG7H 4XXDB 1LO0H 2HSIA 2UVFA 3ARDA 3C6SA 3CH1B 4FKHA 3GJEA 3T65A 5FGBA 5FKPB 3QZWA 3GMRB 2EDEA 3MC0A 3VFGL 3O0LA 5A2KH 1BQUA 4NN5C 2R15A 2XFXB 4XN5A 3T1FA 4Q14A 3UYRL 5HPMB 4HK3N 1DBJH 3DMMD 2PTTA 2ODIA 3QYCA 3FO2A 1U8LB 3DTDA 2QV2A 3TO2A 4XN8A 3BZ5A 4MAUH 4QRBA 1ZJBA 2X1XR 4X6DE 4YSTA 1G6RA 4FXGA 5C6TH 3WLWD 4JZJB 2IPKA 3B37A 4KKCD 5B1BB 4FMFA 4LRNL 1O7DE 4TKWA 1YMMB 1CLZL 1XSOA 3MJ6A 3OM3B 4DEPB 1S7XA 1BPLB 3W38A 4Z0BH 2BC4A 1R46A 3KBFA 1UOLA 3D3VE 4ODUB 4OT1L 1BF8A 1NJ9A 4P9MH 1SYSA 1UG9A 2YEQA 2A6KA 4MTMA 4LLUB 3D0VA 2VDLL 3HMXH 1H3XA 1FFRA 1YPZA 4E41A 3LRLA 1IEAB 1XGRA 3OV6A 4NO0D 5L4IA 4YX2H 4I5BA 1KJMA 4P46A 5I73C 1GGIL 1XF3A 3MYZA 1NBZA 3OJ2C 4BSJA 4QHLA 3RFZC 2B20A 1URIA 2XKNB 3QZMA 4TQPA 4XP6L 4YDVB 1JNHA 5D1QA 4GFTB 1E7VA 5K9QI 4IBSA 2ZKHH 1DVYA 5HHME 2H41A 4ZS7H 2Y5QA 2VN5A 4KDTA 2VMDA 3IDNA 2DWYA 4KK8C 4MYWB 5EPMA 3EFFB 5IB1A 1VZIA 3EYQC 3SO5A 1OK0A 4G8EB 5CEYA 2J6EL 4DGYL 5E1AB 2R8SL 1WLHA 2FEDC 1OL0A 3F6JA 4G11A 2JJVA 4TQEH 5MEQA 1WS7A 2JNZA 1O6VA 3NJXA 5BW7C 3RVVD 1MNUL 2PUQT 2W59A 3OL2A 4YZWA 5IGXH 2F1BA 3D34A 3N1PC 4CUCA 3V6OC 1A6VH 4OGYH 2BSRA 2CUAA 1OAQL 5F1IB 4MJIB 3BN9C 2OMZA 4M3KB 1CO1A 1LE5B 2RJMA 2VITB 3S7GA 4UMSA 2IMMA 1KELH 3EJYD 1NOFA 5IVOA 3Q43A 4XWOC 2EDOA 5IESL 3PG2A 3VXPB 4OD2B 4F9LA 1QRNA 3IDIB 3RA7L 2ADGA 3MLXL 2EEXA 5C0FA 1BD2A 2EE9A 5ADOL 4R0LC 3EO1B 3RWIB 5E2VL 4NC1C 1A4KB 3EO9L 1NIDA 4BCZA 4F2FA 4MA3B 2PYEA 1NDGA 2VT0A 2GJPA 4B50A 1DE4A 3E8VA 3BHBB 1UWFA 1N5YH 5IM7B 3LIUA 2WD0A 4GSQA 5EO0B 1I7TA 5SV3A 4E42B 3LNEA 4G5ZH 1X6NA 1NOAA 4YO0A 3WEXB 1PTZA 4NQDA 2J73A 4BYHA 4CU7A 2AW2A 1DANU 5HHOE 2WNKA 2GJZB 2AFNA 1ORQB 2JI1A 3U1PA 1MIEH 1YQ2A 5E8NB 3RU8L 2VR8A 4ERSL 4ZD3H 2IO5A 5JW4N 3RPIA 1WRFA 1UB5A 1KYOJ 4CVXB 2A3TA 5K69A 1C5DA 4HD5A 4LBEA 4UT6H 4GRLB 3WL9A 5IOPB 3MLWH 5AG9A 1M7UA 4U33A 3HZYA 1T4WA 4NENB 4LNVA 2QPFA 1IBYA 2WLMA 1PIGA 3K4ZA 2AK4E 2CO2A 2UYLB 2EDXA 2ADIA 2DQFA 2XA8L 3NRPA 4MJJA 5L2JA 3VFOB 2HKAA 5DVNA 4KVNL 4W81A 2WGXA 4RDQF 3HG1B 2FJHA 2FT8A 3ZMEA 4FERA 2YPVH 1KEMH 5FECB 1NC2D 4N8VA 4UTCA 4AV4A 2X6VA 4PWHA 1WJ3A 4K8RC 5CWSB 5I2IA 1YAZA 2EDTA 5ID0B 2J3SA 3VFTA 2BRQA 2HRHA 4EI5D 5GRZA 2FECI 1J1XL 1NM9A 1RZ7H 4I3SL 2V5RA 2OMXB 3H7BB 2AGJH 2QPEB 1Q1JL 2ZSVB 4TQIA 5D70L 3V4PH 2X3BA 4GG6A 4K3JH 2ZCLL 3UO1L 2NX5B 4JRXB 5FLUA 2DLIA 4IBUA 1KV3A 5LN8A 5CUSL 4P5SA 4R4ND 1R5IA 3N55A 1RK1A 1DVFB 1MCPH 1P2CB 3AQYA 3L6FA 4M7JL 4Q6IC 4Y4HA 3O9WB 3KNBA 4GBXA 3KMDA 2P8LA 3GZQA 3MRDA 4M9OA 5C0CD 4NQVA 2Y1ZA 4A6YL 3GI8L 5DYOB 4X4YB 4OF5A 1OARL 4AMXA 3OHXA 3VXOB 3KLQA 4L1HA 2HWZH 2OR8A 4KKAD 2DBJA 3EXLA 3B9KB 2KZKA 2WHVA 1VADB 4YHPA 3CFJB 2NLJB 4OZGF 2J4WL 4HS8L 2NNAB 3DSNB 2XXMB 4PRPB 1IQWH 2V6HA 3KLLA 3C9NB 1HX0A 2VYRE 2DQIH 4FFYL 1A3QA 4DETA 1K8DA 3O2DL 3GSVA 3NQIA 4HGWB 4PAZA 4TLKA 1RUKH 3BAEL 3BVUA 4F58L 1HL5A 1U3HA 1KLGA 4HLZG 2WVUA 1CICA 1KJ3L 4LVEA 3TA3D 5EUKA 3SKMB 3OWRA 3SD2A 3PWNA 5I1JL 1PNDA 4MB4A 4QOKD 2Y1AA 5T8IA 1TZOA 2NY6D 4NZUH 1E6OH 5D72L 4LNRA 2WIIB 1EGJL 3RVUD 5HDWA 4U0QB 1U58B 5F21B 3GSUA 3O45B 5DHXB 3TF4A 1N12A 1DEEB 4JREB 1FZJB 1FBIH 4ZS6C 4L4JA 1JF5A 1T1YB 3DGDA 5DVMA 1IKOP 4MD5A 4NOBA 3VFUA 1MCOL 1I3GH 5B7MA 3HLAA 4XTRD 2ZPKH 5KSVA 2A9ML 1TMCB 2GT9A 4JNXA 3SDDC 1D7BA 2Z35A 2L8AA 5BV7C 2EDHA 1HTYA 1Q0XL 5T5FH 3UAJA 3TURA 4KZEH 3L8QA 4WU5A 4Z5RA 3T6XA 3UTZA 1JXDA 1F18A 3V6FB 4ELMF 3LRKA 1O9WA 3PJNA 1D5XA 3NK3A 1U8HB 2HG5A 2GFBB 4KTDL 3A21A 5DGRA 2X40A 3RZCB 2YPKA 4LLDA 2VLJA 3BKCH 2V3DA 5JHAA 2F53A 1TR7A 3ILQC 3N50A 3IETB 1RIUL 1DVZA 3KPQB 3VNZA 1UATA 1OTUD 2HX8A 4RA3A 1IX2A 1UM5H 4MNQA 4QGTA 2BCKB 1HQRB 3X3GH 4M7LT 4N2GA 3BFWA 4KFMA 1P1ZB 3DRQA 2Q5BA 5GRUL 3W0WD 5IEKA 3GMOB 2ZXBA 5I66A 1BAFH 2R0LH 2X89A 1H5BC 4XBGA 4FHKA 4ONOA 2EAEA 1YEEL 3OKKB 2V37A 4JUTA 3B2VH 3FB6B 4JY4A 4OCSL 3GDCA 4QF1B 4DFHA 2IDTA 1U4EA 5H37H 5TTRA 5DJYA 3HC4H 2P7TA 3IEAA 4IKJA 4UU9A 1T21A 1BXVA 1FNLA 3NABL 3HKFA 4H0LC 4LEOA 4O02B 2XVBA 4RNRB 4YO0B 3FW6A 1UD6A 4XO3A 1BQHB 5T1MA 1OP3K 3V4VL 3BGAA 3ZTJG 4E41D 1ED3B 2K78A 1XV8A 1BG9A 3M17A 4JDTL 4P46D 3BIKB 1BYPA 4A67A 4EN3B 4P2OC 5ID1A 5KSBA 4CL7A 2V7HA 4JM2B 3MV7A 1C08B 4A7GF 5D1QD 1B4JL 5MI0B 2WWMC 1OCZB 3JV5A 4HIXL 5H94B 2CIIB 1ZHKA 1I8IB 3EYVA 4FQLH 1ONQB 1AANA 4HVBA 1BFTA 3VD4A 2BFGA 1MVUB 4C4KT 3IGAA 2R0KL 5BS0B 4Q6YA 1U3ZA 1E2WA 2D7OA 2E9GA 3QEGL 5GGRA 1CUOA 1M57B 2YR3A 4PW4A 5ICYA 1U8QB 1G7PB 3F84A 1N5AB 1KB3A 4OBRA 4FFZH 4NBZB 5JIPA 2IANA 3ULUD 4KKRA 3Q3GB 1XIWB 3AGVA 1TITA 1X5MA 3H2QA 4QRTA 5EDXA 3V7AG 1A2YA 5IMMA 1RCYA 2ZXQA 5JNYA 4AUUA 4FTVA 2C3VB 4NHUA 3SGDI 3QJXA 4YAQA 2FHCA 4ZAKA 4U7SA 5D2NA 5IB5B 1S9XB 1S2EA 1S6NA 2V17H 3IJEB 4FTDA 4HC1L 5E4OA 2FLRT 3HI6H 3UTSE 1PJ9A 1DUZB 2NY5L 2XCMC 4JM4L 1NICA 1KTLA 3PHSA 1OHQA 5I8KH 3T4YB 5IIEB 3EOAB 1QRND 1U93B 2Q3XA 3DYPA 4N22A 2JKSA 4PGCB 3WO4B 3NJJA 1BD2D 4NQCA 2P9RA 3E9TA 3SKJH 5DXWA 5AEAA 1WHOA 1YECH 4ETQA 5CEZL 3VXTA 2PYED 3FO9B 2NUPA 4NT6A 2HFGH 5DK0A 3FYEB 5FA4A 3BJLA 5IMLB 5ALBH 4IKIA 5DR5L 5DRXA 4RETB 5EF2A 1R5WA 4JO1L 4N20A 4UUJB 3A6CL 5EZIL 3NVQA 3CG8A 4OVUA 4P2QB 1OAUH 2XVLA 3PAZA 4XAKD 4OZIB 1QVOB 1M2OA 1JRHL 3PGCB 1XGUB 2OKMA 4NQDD 5LXGL 2GY5A 3B5TA 1A0QH 2HRGA 3RTLA 3WLBA 2FCBA 3BZEA 5I74B 2XQBL 3O4LE 3MRJA 4HJGA 3P9MA 4U1LB 4XPTH 3AG2B 5DUML 1RZJC 3V8CA 2UWEA 3R18A 2DYSB 2QTEA 3DYMA 2E59A 4G42B 4WI8A 3RWCA 2DQCL 2Y07H 2EIZB 4HEPG 2J55A 3QIWB 2UXGA 2J88L 4IKKA 3HHMA 4UQ9A 3S35L 1T83A 2WJ5A 1P4BL 4N2BA 5DHDA 3SGKA 4G8FA 1CE6A 3R1GH 1QPXA 2A74A 1SGKA 3QFJE 1GJWA 2HYMA 2V5MA 3ATBA 4N0FA 4HH8A 4KI5F 6FABL 5BVJB 3CFDB 3NCJH 3NESA 4HEPA 3U9UB 4GEIA 2H2PC 3T4AA 3O3AA 2O61A 1N2RA 1WFTA 1SF3A 3SO3C 1B0GB 4KQ4L 1BQ5A 1JGUH 1FL3A 5TK4A 2OTUB 4D0BB 4YDLC 2YEZB 2B1AH 3H0TB 4LXFA 1IAOA 3VDBA 3W9EA 4YXHH 4BZ2L 5CZKA 2VZUA 2UY7B 3SJVA 2X0UA 1ROCA 2Y5EA 3KBEA 3LRMA 3GEWB 1T89A 4PJ8C 3MFGB 4PJ9C 2CNZA 2VQTA 1GS6X 4OM0H 1IE5A 1AOHA 1XR8A 1HSBB 4Y4HD 3B2UC 3FQWB 3H3KA 4JZOA 4GBXD 4XP5L 4KK9C 4OZGE 1F4YL 4N86A 3KPRB 2KC0A 2ESVB 1P53A 1II4E 1KGWA 5I1GH 4KQ0A 3B8YA 4X5RA 1ADQA 3LKRA 4N4YB 2VMJA 5JHDA 3F7KA 1NGXB 1IT9H 4JFHD 4KXBA 1M4KA 2EC9T 3QJRB 3QO0A 5LAXB 3MRGB 4Z7QF 3V10A 2OJZH 3KH3A 4OGAC 4R8WL 1I7UB 4QRSA 1BVKB 2X3AA 3FUMA 4OM1L 1U3HD 2JJSC 1CICD 3BW9A 5AOLA 4FG0A 3WJJA 4JGMA 2ZJSH 1IGCL 5LN4A 4XHJC 2APTA 4PR5B 3MYJB 1LO0L 5JPNC 3D4CA 3FQ2A 4X7SH 2Z31C 3CZJA 4CJ1A 4F7EB 3RDTB 3QNXA 1L9PA 4M43H 3GRWA 3WNJA 2VLRB 5GRYA 4WFFE 5IBTL 2OYKA 2DWDA 3C5XA 4HWZB 4WJ5B 3EGXB 2HT3C 4NUJA 3QDHA 1NFDB 3UTPE 2JF1A 5KYYB 1DJHA 4KNUA 5T3XL 2YZ8A 3TIEB 2BMKA 1FUNA 2XNAA 3FULA 3VMOA 2Z7ZA 4ELME 3RVTD 1KTDB 3VD1A 5DD0H 1KYAA 2GVYA 3UAJD 3ORJA 4IDJL 3R19A 4LVOC 4K7PL 3VRIA 1Q38A 3IKKA 1VACA 4O2FA 3TNNA 5BUAA 4LMQE 5C92A 4HKZA 3CFQA 2FWUA 4N8PA 1A8JH 1G7JB 4NP4H 3HI5H 2VLJD 5EOQL 4M1DL 3ZDXB 2F53D 1R3JA 4YX2L 4CC0A 4PUBH 4WU7A 3VQ1C 4Y1AA 1G7IA 4OF7A 2F2HA 3U1QA 3G5ZB 1W91A 3F5WA 1N26A 4WEBH 4RSVA 4G6MH 1F3JB 1VFBA 1CR9H 4MNQD 3MRHB 4WEEA 3CVIH 2HJLA 4F9PC 2RACA 3WFEH 1BJ8A 3TP4A 2C9RA 3X11B 3RWEA 3NRFA 3QPXH 3QHFH 1U8JB 4KQ3L 1KEGL 4JFEB 2X89D 4F8LA 1A14H 4I87A 5KVFH 1T4KB 3TBWA 3MCKB 1JWSB 3R0MA 2CKNA 3L7FB 4GS7B 4RAUB 2WSPA 4XRCA 1IARB 2MQCA 1XCWA 5FM4A 3V7MA 2WQAA 4D9LH 2Z8SA 2I69A 2WXMA 3WDJA 1F4HA 4RFOL 4KC3B 2AEQL 3EZJB 4FG2A 3RBGA 3G5WA 1TVHB 3APDA 3G6AA 2VUYA 4HFUH 4NCDA 1CFTA 1FLRH 4JFUA 4MMYA 1IRAY 4JPWL 3GJFB 4JQIL 5HYFA 1MRCL 1TETH 4GI8A 2VMFA 1KWGA 2Z3FA 1I9EA 4NJAH 3MV7D 3RWHB 3LY6A 4CA4A 1HKLH 2I27N 2WZ5A 4YSEA 3LJ3A 3Q6FA 4Z3IA 2OTPA 2Y72A 4M8RA 2MCG1 2ATKB 4EAEA 3L4YA 3WSQH 3X14B 1AYOA 3RGVC 5I6MA 3BO8B 1LDPH 4BQ9A 3PFUA 4ODHH 4XCCL 3T9WA 1QTYT 1KCUH 4FLHA 3RB5A 1CTOA 1Y7VA 4NN6B 5GZOA 3JTSB 4IHOA 1GPOH 3WELA 3BVWA 4UTAH 1JZHA 1P5UB 4OGXL 4HAKA 4IRSA 5HVGB 4NZ8A 2IAND 5B3JF 4I0PB 1NQBA 3B7UX 4PIBA 2AERT 3M6DA 1TQWA 2Q86B 4YC2C 1AQ8A 1E7UA 1WWWX 3TN0A 1HDMB 3QIUA 4FTVD 2W94A 4AMWA 5F0JB 1GGUA 1XH3A 4ZAKD 5AW1B 3C5SA 4XPHL 4S1RH 3F83A 5DMKB 4L4VE 3RUGB 1Z9MA 3L16A 3UH8A 5BRZE 4M5TA 5IJKA 3BJ91 4XVJH 5BOZG 3V5HA 1JK8A 4DQOH 1E4KC 3FQXB 3JYCA 1YNKL 4MNGA 4GIAA 5LGJB 1QYGH 4LPCA 4ZO8A 1W15A 3NTCH 1BIIB 5TF1L 4OAWB 1IM3B 3PDDA 4NQCD 3ZSSA 4XXDA 4WO4C 3L9BA 3H7LA 5BO0D 1FPTH 4GT0A 4UZUA 5AOIA 2BNQE 1E5AA 4OW6A 3ECUA 3GMRA 5FKPA 4CBPA 4HAGA 2QGCA 1FIGL 2ZP9A 1JZIA 1G5AA 2V9QA 2XFXA 3LNGA 5HPMA 5DZPA 4LF3B 4G8AC 5KSAB 1PFCA 1CBVL 1U8LA 3QUMH 1KTJA 3QR1A 4P99A 2CGRL 1YEIH 2QPSA 2YRZA 3BPNB 2CJSA 3PAVA 5E0QA 1YMMA 4IU3B 4AJYV 2Y69B 3ARBB 2IF7A 1IC4L 5EORL 2P46B 4RFEB 2CBTA 3DBXB 5JW5B 1NCOA 3CZSA 4KI5E 3AMLA 3SDYH 1O9VA 2NSQA 4LLUA 4XO4A 3ZL2A 1C12B 1FNAA 2NSXA 2R9HC 1AQDB 1JXFA 4HJTA 3CFKB 3RJOA 4YLBA 1IEAA 3RIFK 4AIXA 1SVZA 4DF9A 4ZUTB 4MMZB 1AACA 1Q94B 4NUQA 4ZMWA 2XYBA 2M8XA 1FZMB 1MFDH 1I8LC 3EH3B 2XKNA 4Y2DB 3WHE1 3FN3A 1PS3A 1EFXB 4YDVA 1SOXA 3FJTA 1KXQE 1OD9A 2DKMA 3ZZSA 1QBLH 4WNQB 2IBZY 5DFTA 4UIMB 3EFFA 1AG6A 1P84J 3SPVB 2EVJA 2Z91B 3SJVD 4B60A 1SUJA 3UTTB 3ZMNA 3QH3B 5AZEH 2Q2EB 3FYIB 2FHBA 2P80A 5CSGA 3VX0A 4G8EA 1MLBA 2P8PA 2UZPA 3ES6A 3EJUA 3RAJL 5E1AA 3LKNB 4IIQA 4LSDA 4BHUA 1E6OL 4W9DC 4DZBA 3ETBF 1TU2A 3BUDA 5GGSB 3TYGH 4Z7QE 5SWQB 4BXVA 4KWUA 1JK9A 1Z0NA 1WA2X 4NM8H 5JHDD 2VLKE 1EJ6A 1CFBA 3DROA 3KM1A 4MJIA 5F1IA 5I5MA 1UCBL 5HDQL 1XL4A 4XXWA 3L5XL 3UTOA 1TJGL 2V33A 1LE5A 4HF5L 1KULA 2VITA 3TNMA 5JIDA 2KDYA 3RHWK 3GPSA 4K94H 3VXPA 1JV5B 3MRCB 2QTVA 4OD2A 3IDIA 4OJAA 2DI7A 3QUYC 2PR4H 4B9FA 5EN2B 2ZOUA 1DVSA 1AMYA 4YSOA 3EO1A 5DJXB 3RWIA 3D0LB 4MA7H 1A4KA 1V55B 1WGVA 4NZJA 4WUUE 4PTTB 3QSKB 4MA3A 5FAAA 2XWDA 1OGPA 4F15B 4JFOB 3ESMA 3BHBA 2GC4C 3H9SB 2HMID 3GI9L 2O5ZH 5CEZE 5IM7A 35C8H 2F5BL 5EO0A 1DJGA 3CDYA 3PJSB 2A5UA 1R3IH 2NY0B 5JXAH 4Z7WF 3WEXA 2MQ3A 3ZDZB 5JOFB 3X3FL 4LHQB 4IU2B 3H85A 4UQDA 1QFWM 2RHEA 2GJZA 4Z3JA 2WQ8A 4X2UA 2UZXB 5E8NA 3IU4L 5DZAA 2ZOTA 1SHMA 5DURB 3WV0A 1RURH 2AC0A 3KYNB 3NCEB 4OCYL 1FNSL 5CIPB 2X28A 4ENZA 4GRLA 2QBWA 5IOPA 2YGVA 1CQYA 4NENA 3ZJAA 3HC4L 3LS5L 4GAAA 3O8XB 2RQ8A 1ZHLB 2WLIB 1UB6A 2AXWA 1C7SA 1NAKL 3I2CL 2X4QB 4Y8DC 3VFOA 3ZDWA 4HWUA 4Y1AD 4QTIL 1ZWIB 4XB8A 3EH4B 1F00I 2WJ7A 5D6DA 5FECA 4WW1B 3FO1A 3IN2A 4TNFA 3KEHA 5ID0A 3C6LB 3IE4A 5T3ZH 2C9AA 2F7QA 2WLLB 1K4DB 1FZKB 5I75B 3A6BH 3JZ7A 2ZXEB 2OMXA 3H7BA 3VRJA 3ZBMA 3WFZA 2I9TB 4HMEA 5E1HB 4KGJA 3PDOB 4F92B 5BUPA 1UEMA 4BE6A 3ZR6A 2NX5A 3DGGB 4JRXA 3F64A 1OB1B 5ETUB 3VFVB 1UCTA 2Z92B 1DVFA 1P2CA 4PV9B 5J6SA 4H8PA 1FC1A 4ADIA 4DUVA 4MD0B 5HPOA 1UADC 4D8PB 4ZW8A 5DYOA 2EH7L 3VXOA 4LOEA 4RZKA 5KVEH 2ZAIA 3GM0A 1FZOB 2D0GA 3BAYA 4KJPC 1J5OL 1VIWA 1DSWA 2WUCH 2JVUA 3UDWA 3K6OA 1MCHA 4YQXH 3B9KA 5A6LA 3B7TA 3ECWA 1VADA 3CFJA 1W9XA 2NLJA 5C3LD 2NNAA 3L4TA 4KHTH 3DSNA 3DMMC 4WWNA 4AMKH 1L6PA 3C9NA 4IDLA 3IGLA 3HI6L 4HEMA 3QFGA 4MS8C 2K8QA 4HGWA 4NFDA 4XMZA 1B3IA 2DV6A 3WLWC 2ICES 4KKCC 2XTSA 5B3JE 1CU4H 4X6BB 1PKQE 1OF0A 2OI9C 3KLAB 3NOIA 4ZODA 2K70A 3SKMA 3VI4B 5GZOD 3FF8A 4MLSA 5I0VA 5I8EB 1WV7T 2C9SA 4IRSD 3AS2A 3QWRA 3SE4A 2WIIA 1L3WA 3LEVH 5F44A 3GFUA 3MOAH 1CLYH 1U58A 3WFBL 2FLBT 3O45A 3DURB 5J11C 3TN0D 1RAMA 1DEEA 3QIUD 4E68A 3FSOA 4XPBL 3BVTA 1FZJA 1KIPB 4G8IB 5IJBC 1T1YA 4QHKI 3BPLB 5FUCE 4CC1A 4UANA 3LNIA 1WZAA 2L7UA 5T3XE 3LZOA 4DO4A 5AAMA 3PXHA 4G7YL 4IEFB 4NZDA 2QLYA 5A2AA 3B4NA 3QUXC 4YUEL 3TFKD 2FAUA 5EUOF 4A7UA 3V6FA 3R1GL 4JRYB 5DJ6B 4EMZA 3X2QB 1U8HA 2GFBA 4PJIF 3RZCA 4GKSB 4CRPA 1KJ2B 2L04A 3CBRA 4ZMVA 1KBPA 2B77A 4N0UB 3AM8C 3IETA 5JXEC 3S37H 3KPQA 7FABL 4I2XE 4AE0A 1G6RL 4PJAB 4I77H 1HQRA 1Z2KA 3ZL4L 1EAQA 4P5TB 1P1ZA 3UP1A 1DSFH 3OPZH 1XWVA 4Q9CA 3GMOA 2CO6B 2AQ1A 2X3CA 3CFBB 3BKJL 3R06A 1YMMD 3CD4A 1P4IH 3HAEH 3ROOB 4X9HA 4ABUA 4F2MB 2VW4A 3GMNB 2GSIB 5IJVB 4P0DA 2E74C 5EF3A 3OKKA 3CSFA 1PD0A 2W88A 2WWKT 3H4HA 4K2UH 4WWKC 3FB6A 1UKTA 4DFIA 3JUZA 5GGTH 3L08A 2A2QT 2G5BB 2OSLB 2W60B 2HFEB 2VDML 2QDVA 4O02A 3KE0A 3J8F7 2Q76B 3FCTB 4FL4C 1BLNB 4NYLB 4RNRA 3LZFH 1BQHA 3OAUH 2FUQA 2R0ZH 1YNTB 5H2BB 4X0NA 2TSBA 3OG4B 4LL1A 1NLDL 4U1JA 1NM4A 2VTFA 3BIKA 2EZ0D 3QQNA 1N4XL 3AABA 4RLDA 2AITA 4LAQL 2BP8B 4JM2A 2CR0A 1IT9L 1C08A 3E9UA 4M5ZH 4NNPH 4NXSA 4X0KB 4WI2A 2E6PA 2Y7OA 3TM6A 4XN1A 4ZFQA 5H94A 2CIIA 4TUOB 3AADB 3VYNA 4AOFA 4YSUA 1OANA 1J0YA 3KVPA 1ONQA 3EYSH 3LPPA 5D7JA 1MVUA 1ZLSH 2C7FA 2VW6A 4B53A 1V10A 2F19H 1MQKH 1T1XB 32C2B 4DKFH 5I1IH 4R97C 2P80D 4U1IB 3ULUL 3L3JB 3FCGA 3W81A 1U8QA 1G7PA 3L4ZA 4XNAA 2PABA 1N5AA 4X7SL 3IPEA 5IQMA 1IAIH 4CDGC 1HNYA 1XIWA 3PREA 4TVUA 5G4MA 2UUDH 3GB7B 1I3VA 3G9AB 1U8PB 2GTZA 2C3VA 3I6LD 1OK8A 4HKXB 5KVDL 2VSKB 5AW4B 3PE9A 4LMQI 1HILB 1ZE3C 1UACL 2Z6FA 4MJID 4OKVB 5E95B 5IB5A 5MEPA 5IVNA 4NRXB 1S9XA 2OMUB 3QS3A 4HOZA 3V5KA 5CSZA 1T0NB 4NWUH 2XV3A 1DUZA 1CD9B 4EI5C 3GEFA 1HEZB 1VESA 2BNRA 3BE1L 3EOAA 3GKWL 4MCYB 2VDQH 1CZ8H 2VXTH 1U93A 4ODXB 3V0EA 4ICXA 1S7QB 4GNKB 2CUIA 5E6IC 2A6IB 3QUGA 1QLRB 4S0TD 1CD8A 2H1XA 1NFIB 5L4JA 2EKSB 4PYGA 4Z7WE 1TCMA 4FP8H 1R9FA 1ETB1 3TU6A 4L18A 3THML 1DJXA 4NP4L 4R4NC 4W6WB 5IMLA 4PBWD 3QVAA 5M95B 4UUJA 2V2XB 4PUBL 3E6FB 1E5UI 1RXLA 5DWUH 1HYSD 2BY3A 4P2QA 3VTAA 4JDVB 1DQDL 3D51A 4OZIA 3PGCA 1QHOA 1XGUA 2GTQA 5IFAL 2I25N 5E9DB 2ZXGA 4J3TA 1QABA 3CVIL 4LLWB 4M48L 1TFPA 1WFNA 4M1GH 3CC1A 4U1LA 2F1EA 5I19L 4H20L 3UROR 1YEJH 4PHXA 4Y5XC 3UIZA 1SXAA 5CINL 4G42A 2EIZA 3HKZA 3IJYB 4RGMB 3WNPA 4UF7C 1P1VA 3QIWA 3Q44A 3TA4D 1YEHL 1ZXQA 4GRLD 2BRRH 3VU1A 4L3EB 3FB7B 3QRGL 1B2YA 2YGNA 2EDKA 3ZE1F 1EEZB 4QRQB 1IJ9A 4XGZB 3AT0A 4TTDD 3F04A 2EC8A 3QT2A 4AZ8B 5IT2H 1JNNH 2IH1B 1FLRL 3CFDA 5BVJA 5AB2A 1F58L 1TJIL 4RRPA 2O6CA 1P84K 3BQVA 3D4GA 4KOBA 2DICA 2G3ZA 3L3OC 1TETL 4HUXB 4H8QA 1HKLL 1YPZF 4H44C 3QPQD 1B0GA 3U83A 4FQQB 2YEZA 5IB2B 4HUWB 1PSKL 1HZHL 2CE6A 4FXKC 4GQZA 3DUSB 3H0TA 4ONGH 2BSDA 4E9TA 2WLHA 3NSYA 4ODHL 2NX5D 2UY7A 4JRXD 2VR7A 5DMIH 4QXUH 3F8UB 1QLEH 3QHTC 3VU2A 1EAPA 3G6JF 1PLBA 4YH6A 1DVFD 1HSBA 2FB4H 2JKLA 3FQWA 1RUMH 1OSZA 2Y7SA 2UXTA 2DQDH 5B38B 2FSDA 3DWTA 4X4ZA 2E27L 2ESVA 4GSRA 5FGBC 4C55A 1V27A 2E46A 3II3A 3B9KD 1TENA 1NGXA 4S1RL 5FCSH 3KH4A 3ULUF 1OTUC 1R24B 2JLLA 4RWHA 3DDGA 5A3IC 1J8KA 2VXVH 1KCRL 3MRGA 5CP7B 2EYSA 4I3RL 5LAXA 4C47A 3JZYA 3TV3L 1SHXA 5F8QC 1BVKA 2AJSH 3D18B 4F8TA 1BIHA 3RGHA 5IWLC 2F18A 5K59F 4UNIA 1EA9C 4FADA 4JANA 4V1DB 1QG3A 1A9VA 1FFQA 3GMMA 4Y89A 4PR5A 3MYJA 4PLNC 1MIMH 4H8WH 3LV3A 2BK8A 3QWRD 4TULL 2V2TB 1QKZH 1TTCA 4F7EA 3RDTA 4FZ8L 4K9EC 4WV1B 1W0VA 2VLRA 4JJHA 4KO5A 1GIGL 4HWZA 4WJ5A 2QADB 3QC5X 4PJHF 2YAEA 3MRMB 2JKTM 1NFDA 2DD8H 4W4OA 5C0JA 1BVZA 3HVDA 4HISA 2E7DA 5DO2D 3TIEA 1P9MC 4XO5A 1JD7A 2ISDA 2JKRM 1BZOA 1QSFB 4PCYA 2NCEA 4Z9KB 5EUOE 4S1DC 2NZIA 3U6RB 1KTDA 3MBXL 4X7FC 1T2QH 4HWBA 5D1ZI 4J6RH 4KDTC 4PJIE 3MV9B 3TESA 1CFMA 3S5YA 4ES8A 2LHAA 1XMWA 3VXSB 4FMKA 2EDJA 3LH9A 3VG0H 4R26H 1G7JA 5I16B 3RZCD 2IAMC 3DIDA 1I1RA 1EO5A 3FQ1A 3ULUC 3G5ZA 5EULV 5HP5A 1F3JA 2EIKB 5JHLA 1D5ZB 3MRHA 4P57A 4JBSA 3T8VA 5GS0C 3GHBH 1PW3A 4S1QH 5MERA 5DD1L 1JVKA 1KXTB 1UWGH 2DTSA 4KJWD 1HN1A 4WNSA 3X11A 1XZWA 4LGSB 3VGAB 1U8JA 1CI5A 1XD1A 1CG9B 3MNVB 3MCKA 1JWSA 4M00A 4N0CC 3VJ6A 2H2SD 1NPNA 4RAUA 3K1DA 3IFPA 4NQUA 2V5YA 3KG5A 5TF0A 4E5XA 4XP1H 3VDAA 1HHKA 3HBPA 4LZKA 1NCIA 2X1OA 5HYSB 4GG6F 1NANI 1MG2C 5GJSH 1EV2E 5C0CE 5D1XC 1TVHA 1X5ZA 2YWZA 2NUTB 3KYMB 4BZ1L 1N6VA 4JHAH 3ULVH 2K4WA 3GBNH 1ZLUK 1J0ZA 2VRAA 5T5NF 3AREC 3GJFA 4JM2D 3RILA 3RWHA 3UJJL 4YSPA 1CFSB 1OXYA 1FG9C 3QNZB 1S78D 1AJ7H 2ATKA 1IGML 3NP3A 5FYKD 1XQ4A 3X14A 2B08A 3BO8A 2R1XB 2PR4L 3BP4B 3EUUA 5D7JD 2GJRA 1VCAA 4ZX6A 5I76B 3L17A 1MNNA 3CE1A 5CJQH 3ZYZA 2B5IB 3LZQA 4FZEL 4KZ0A 1JRHI 3EH1A 2EDRA 2QGDA 4QOKE 4TNVK 4AYFB 1QHQA 15C8L 4LEEA 5D7KD 3ROLB 4I0PA 1WE5A 1XIWD 1JFQH 3OAYK 2QDWA 3K4AA 5GS1B 1D5IH 1A6WL 2Q86A 1MCFA 1SY6A 3DSFL 1HDMA 5F0MB 5KJRH 4AJVA 2QQLH 3BP6B 3IDMB 4IOIA 1VSCA 2ITFA 1HHJB 5KN5A 1E6JH 3SIKA 2E0PA 4AVJA 3RUGA 5JHBA 2WIMA 3ZIMA 2A83B 3KGUA 4DP8X 1KTRL 3FQXA 4JY5H 4LASL 4Z0XB 1QFWI 5LGJA 4F7KA 2BNRD 1BIIA 4OAWA 4F57H 4IBTA 1A8ZA 3DX7B 3FRUB 1YN7A 3SHSA 2ORBH 2GI0A 2J43A 1H8OA 4U0RB 3BT2H 1BREA 4GT7A 4J27A 3CXDH 1M7DA 4NSKA 1KPUB 4PP2B 2J2ZA 1QRKA 2JKWA 3DTUB 4Y4HC 4AQEB 3IDJA 1MWAH 4NO5B 4GBXC 4BK5C 4H1LH 1MUJB 3BDXA 4P2QD 4JFPB 4LF3A 3I9GH 5KSAA 3OHXC 3VXUB 2W0FB 3WAKA 2ED7A 1KWKA 3N0PB 3TBCA 2QVFB 4BH7B 3T09A 1WWCA 4L2YA 1UZGA 3W0WE 3ZTNH 3ZKND 4XX5A 4ZI8A 1DSYA 1A65A 3ZE1E 3ARBA 3OKNB 2XPZA 4RFEA 2CLRB 3DBXA 5ACLA 2F0CA 3VGHA 4DPAX 4XMWA 4CC4A 3QIWD 4P05A 3RX7A 1TUPA 1CICC 3MNZB 2FBJL 2E7CA 1QFOA 3PP4H 4GW4B 4L4TB 1MVYA 4MMXB 4N6RA 5T33L 5DVOA 1AQDA 3NA9H 4UILL 2Z8WC 3Q9PA 5BQDA 2NOYA 3DRTB 3DK0A 3BDYH 1YPZE 3IAQA 3Q9QA 4M5YL 5IW3A 4E41E 3HW7A 4WWPA 1E4XH 4MMZA 4ZUTA 1Q94A 4MWFB 1OE3A 1U2HA 3W5MA 2XI9A 4YQXL 1J9SA 5AL8A 3S8WA 2AEPH 4GKOA 4RFNC 4Y2DA 2ZD0A 1ZVSA 1EFXA 2C34A 4WI0B 5HDLA 5D1QE 2BCMA 4LDOB 1OLZA 4P49A 1DN2A 3B7RL 3G6JE 3BGFB 1HXMB 4OJEH 4WNQA 4XO8A 1PX3A 2C3WA 5KSBF 4UIMA 4W4NA 4AWJC 3MCYA 5FIEA 4B0MB 2BVEA 2CDEB 4H5SB 4RMQA 4Z7NF 4XWGH 2PCFB 3REWB 3UTTA 3QH3A 4XCEB 5F7FA 1HYRC 5E5LA 4YR6B 4RESB 4HSCX 1MCIA 5G55A 4YHZL 4B27A 5JORB 3APNA 2MWCA 3OVUB 3FB8B 3ULUE 2XIIA 2TRYA 1ADQL 1VA9A 1XXFC 3MOAL 4UV7H 2ESVD 5GGSA 2CHNA 3ZKXB 3CSGA 5SWQA 1XF5B 4OKDA 1G9EA 3RB7A 4ZPTB 2Y06H 2HT4D 4NC2B 3RVXC 2HRPL 1W2KT 1U8KB 1FG2B 3WY4A 5FYKH 4R0LB 1J86A 2UZYB 3DI2B 3OD3A 3I6KB 3IFLL 2Z4TA 2WBJB 1S5IH 1BMZA 3WN5C 3MRCA 4NUMA 1PX8A 2BJMH 4G43B 1QRNE 1BGXH 5EN2A 2K0RA 2QEJA 3F85A 3R7RA 1J1PL 4QXVA 1BD2E 3D0LA 5E6SB 4D7BA 3EJTA 2UX6A 4MASA 2IBZX 3PDGA 4F1ZA 2PYEE 1KFAL 4JFOA 5E8PB 5KJ7E 1TQUA 1QLFB 1E2VA 1HE8A 3H9SA 3GRWL 4J28A 2BHUA 1EJOL 3PJSA 3RDTD 1YYLL 5AOZA 3R7QA 3G5XA 4EPSA 1XH0A 2DAVA 2VLRD 4TN9A 3S37L 4QI3A 3O6LH 4XAKE 3EFOA 4XI5D 2J6WA 5JOFA 4NQDE 3ZUNC 5GGUB 4POZD 3O81A 2JFCA 3WHXB 2CK0H 3OPZL 4A2EA 1J48A 5DJ8B 2UZXA 1WBYB 1WEJL 3OKMB 2AI0L 5I18L 1FGNH 4YDKL 2FRGP 1W16A 1OOWA 4GPVA 4K2UL 5HDBF 4ALAC 1SDDB 4LCYB 1BM7A 2OM5A 4LP5A 5KZCB 2K4AA 1ET5A 1XSKA 2UWEF 3O8XA 1ZHLA 2WLIA 3WS6A 4TVPD 2EEDA 2OJEB 2X4QA 4LVNB 2R0ZL 5INDA 3QYNA 3TVMC 1DJIA 4J3OH 2CRIA 4AEFA 4PJXB 4NNPL 5DMGD 3C6LA 1B9ZA 1G0YR 2OZ4H 2WLLA 3O3BA 1K4DA 1FZKA 2I9TA 2X4OB 3N2JA 3WEAA 2ADYA 1AE6H 4P3DB 4DKTA 3GSQA 1PQZA 1A4BA 4GG6E 4FG6C 3DGGA 3U30C 3ZDYF 3T6QC 2Q2LA 4WEMB 3K2UH 5FHBH 2FWSA 5C0ND 4ZNCD 1JD9A 3WXWL