4ICXA

N-terminal c2 domain of human cep120
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
133
structure length
133
Chain Sequence
b'SKSDQLLIVVSILEGRHFPKRPKHMLVVEAKFDGEQLATDPVDHTDQPEFATELAWEIDRKALHQHRLQRTPIKLQCFALDPVTSAKETIGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKSEIQISIALETD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centrosomal protein of 120 kDa
publication title N-terminal C2 domain tandem of human CEP120 shows lipid binding properties
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 24
structure length 133
sequence length 133
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4icxA00
3QK0A 1BCIA 3HN8A 3F00A 3L17A 3QR1A 4J6IA 1DJWA 4OVVA 4OVUA 1E8YA 2K45A 3OAWA 1DJGA 3L54A 1DJXA 4URKA 3W57A 1QASA 3IM1A 3IBEA 3S2AA 3PYCA 4V11A 4WAFA 3NSJA 2DMHA 3PFQA 4NP9A 1E7UA 2CHWA 3L4CA 1E7VA 3W56A 4GNKB 1RSYA 2A4ZA 4QJ4B 4ICXA 2QZQA 2WXNA 3QAQA 3F01A 4L1BA 3L16A 3KWUA 2WXFA 4LDCA 4XZ4A 3ZW3A 4LT7A 3FDWA 4FULA 4ICWA 3GPEA 3DPDA 4FJZA 3ZVVA 5H4ZA 3RPBA 1RH8A 2CJTA 3NZUA 3F05A 5T8IA 4L1LA 3B7YA 3MJWA 4GB9A 1E8ZA 4Y1TA 3TWYA 4TS6A 2WXRA 3HHMA 5KJ7E 2K8MA 2CM6A 2WXGA 2KI6A 3M7FB 3ENEA 4BGDA 4KZCA 2NQ3A 3KWTA 3TJPA 4FA6A 1UOWA 4L2YA 3ZIMA 1RLWA 4NS0A 2ENQA 1DQVA 4WWOA 4DK5A 4QAMB 2JQZA 3ML8A 4FJYA 4FLHA 1DJHA 3N5AA 1DJIA 4WEEA 2EP6A 2FK9A 2D8KA 1W15A 3L08A 2Y3AA 2WXQA 1TJMA 3APFA 4EZKA 2N1TE 3FBKA 3QJZA 2CHXA 2ENPA 3SD5A 1BDYA 3HIZA 1BYNA 4ANUA 2NCEA 4NPJA 3L9BA 2WXKA 2CHZA 4AJWA 2LHAA 4A55A 2UZPA 5CCJA 1V27A 4FHJA 4TUUA 1E8XA 3R7RA 2Z0UA 4ANWA 4EZJA 4TV3A 3PS6A 4G11A 4HLEA 1CJYA 3PREA 2BWQA 2ENJA 3T8MA 4F93B 1HE8A 2WXHA 3P2BA 4WWNA 4DNLA 3DBSA 4JPSA 1TJXA 4MJJA 5CCGE 2CJSA 5G55A 1WFJA 4HVBA 2YOAA 4F91B 1E90A 3NZSA 2CHDA 3JZYA 3APDA 4Y1SA 4KZ0A 2DMGA 4IQHA 1K5WA 2CM5A 5JHAA 2WXMA 2K3HA 1UOVA 2Q0ZX 2WXLA 2WXOA 1QATA 3CSTA 4EZLA 2X38A 3OHMB 4ANVA 5CCHE 3PRZA 4F1SA 2V4LA 1DJZA 2YRBA 4WWPA 3ML9A 3QARA 1A25A 4KITB 3F04A 2B3RA 5JHBA 1DSYA 2QZ5A 2WXPA 1UGKA 1W16A 2Q3XA 3R7QA 4FHKA 3RDJA 4BFRA 1DJYA 4IHBA 2R83A 1E8WA 3APCA 3CSFA 4XX5A 5H4YA 4ANXA 4QJ3B 4QJ5B 2A5UA 3L13A 4LCVA 5G2NA 2WXJA 4L23A 4AOFA 2RD0A 4PS7A 4FADA 2ISDA 2FJUB 3LJ3A 5EDSA 4F92B 1GMIA 2ZKMX 3QR0A 3TL5A 2K4AA 4NPKA 4PS8A 2NSQA 1WFMA 2WXIA 1YRKA 4XE0A 4PS3A
chains in the Genus database with same CATH superfamily
3IU3A 3MRIA 2JJUA 1O6TA 1HHKB 4QHUB 3QZPA 2OFQA 4WO4A 5DURB 2VLMD 3HG3A 3CVDA 4FG0A 4Q56A 2VISB 3L95B 4GW1B 2BNRE 5IHBA 1ERNA 3QHTC 3FTUA 4ABUA 3MKKA 4OZIF 4FQQB 1A1NB 1T66D 4UZGA 1TQVA 2E8YA 4LCUA 5GGQL 4LDCA 3C2AH 4XNDA 4FQPA 4LT7A 1MCKA 1TYEB 2D0GA 2F53D 4FG6C 4GAAA 4PRHE 5ACZB 2BY3A 4H5SA 4E9TA 4NKQB 4NUGH 5F44A 4R26L 5I0DA 4RVBA 5CZXC 4UV7L 3FMGH 3H42H 3CHOA 5JIIA 1NLBH 1SPDA 2P8LB 4XNMA 3ZKXC 4PJBA 3ARDC 4U3SA 1XXDC 4XPAH 4NZRH 4K5NA 2P8MA 5CINL 2EDJA 3VRJA 4YHYB 4KQ0A 4JDVB 1KF9B 1RU9L 2R0ZH 2AXJA 1YPZE 2ZUXA 1WE5A 4PH8A 2HG5A 3CFDB 5DQ9A 5CFHA 5C0FA 1SJVA 1ZOXA 5EU5B 4XI5C 3LKRB 1RVFL 4I3GA 4GKZB 1U6AL 4ZOBA 4YZFE 1LEKA 3MO1A 3ASOB 2YRPA 1I7UA 4B0MB 2O1AA 4K55A 4BKTC 4Z7UE 1TZHB 2X41A 8PAZA 4NRXB 4U4BA 5I15L 1T5KA 5KSVB 4QHLB 5CZVL 1J9QA 5C2BH 1SMOA 3QPXL 4AQEB 3ILDA 2Y23A 3P2BA 3CX5J 5CCGE 3NG5A 3H9ZA 5EH1A 3ZE2B 1UCBH 3MBWA 4HISA 5I6LA 1QWUA 2IH3B 4H8UA 4RFEB 1FN4A 5JYLA 4HH9A 3RVWC 3S4SB 2MWCA 3PFUA 1G9MH 2APXA 3PUUA 2LLGA 3HMWH 4K7FB 4TXVB 1Z2KA 2PCFB 3AU1B 1FIGL 3IDXH 1HS6A 3HZYB 3X1BA 3SE4C 4ZDHB 4JRWA 2AZAA 3DGDA 2YUZA 4K3JL 4IRZA 5DJYB 4HSCX 2VZ1A 4JRYB 5C6WH 2I7OA 4UT9H 4Y9BA 4H8PA 2GK2A 3CZFA 5I76B 5D1XD 1ZIAA 2FQEA 1C5CH 2BVOA 1C7SA 2DTSA 2X3BA 3A67L 3ZRCC 2H32B 5IBLD 2J1XA 5J6GA 4WGWB 1C12B 1YZZA 1KJ2B 3SCMA 3K2IA 3WTUA 4NM8L 1X44A 4AOFA 4G9FA 5EPMA 2PF6A 4LSQH 1DQQA 3BKMH 5C07E 3WUWG 3W81A 1B4TA 3X17A 5DZPA 2PTTA 2PW1B 3L45A 1IKOP 4WJ5A 4C8XA 2JB5L 4TTGA 2ARJQ 5T1LB 4L5FE 4LLWB 1JF1B 3AFLA 3ARFC 3EHBB 3V0DA 1ES0A 3QIWB 5L2KE 3FFDA 4MXWH 3FN0L 3CJJA 1AJ7H 3V4UL 3W57A 2GSGA 5T1DL 1KCKA 3L3OB 3F85A 4UQAA 4GSQA 4DPBX 3EBGA 1KLGA 1CLOH 2CCLA 2FH6A 2ZP9A 2DH2A 4JQVC 1Z3RA 4C57C 3JUZA 4JFDA 2NXZC 1U58A 3GMQB 3SDCD 2X2IA 1A0QL 4DERA 4G42B 4PMEA 1C5DA 1RK7A 2C9PA 2E8ZA 4BSJA 1MW3A 4HC1A 3MCG1 1S7WA 4P46D 2BVPA 1TYJA 4G8GD 4X6BB 5TPWL 1BWWA 4L1LA 3QWOA 1K6QH 4W93A 3UTTD 2NX5E 3U4AA 3TEUA 1DBJH 2OYKA 4Z1PA 4WKZB 5E1AA 1HQ4B 2Q5BA 4NNXA 2E76C 3KW8A 3QULA 3F64A 3VFGL 3OAYH 2O5ZL 2CO1A 4GAGL 4PJDB 3WEAA 4NQDA 1BVLA 1RZJH 3CHSA 3QQ4B 4Y2DD 5EDXA 3ATBA 3BO8B 5C0JA 1M3JA 4NCC2 4WW2B 1OP3K 1MLBB 2LU5A 4MKMA 1UJ3A 4K9EC 5D8JH 4MJ5B 4CC0A 2VSCA 5E1IA 2DQEH 4GKNA 2W1NA 2CALA 3M1OA 3VNZA 3FH8A 3MRRA 4FTVE 3VRLE 3IJ7A 3GRBA 1N0LA 3DV4A 4MD4B 3TN0B 5JO5B 1KGUA 4Z0BL 2NY1C 3MROA 2MNWA 2BNQA 1MFCH 3D5OF 4X6CF 2Z92A 4F91B 4X6DA 2F54E 2UWEE 1M71A 1SFDA 2VRAA 2VKWA 1NGWB 3PPSA 4JM2D 1F8TL 5MEPB 4YPGA 4BHUA 2C1OA 3VGHA 3WNLA 4UCFA 5DJ0B 2BCKA 3CH8A 2NZ9C 3HFMH 1MPAH 2VDRH 4POZC 1NBZA 2XQBH 4R2GD 4AYEC 1F4HA 5IB5A 1MJUH 4OLEA 2AVGA 1JGLL 4Z7WB 1A7NH 2MOGA 3PJSB 2BIIA 1R24B 4LVOC 3NJHA 4X4KA 4AQAB 4UNIA 3JV4A 2IFGA 2XV6B 1JCVA 2V9UA 4DHLA 1TNNA 1TNMA 5IMMB 4DP8X 2E74C 2EXSA 4R96A 5DJ8A 4DPCX 3VW3L 2DD8L 1MFUA 3MVSA 4R90H 3HBPA 2B1AL 3IEAA 4IOFD 4CNIA 4S1DC 3MLZH 5KYYB 3MBED 1PVHA 3RZCD 1SLWA 4YHOL 3GXNA 4JO4H 4HOZA 1MFEH 4G43A 3QCUL 2AJYH 1ADQH 3GB7A 4L4VD 4QD2E 5IBUG 3KPSE 2VDLH 5DDHB 5BVPL 1RZFH 3RKPA 3TH4T 2ZJSL 1MJJA 3PWVB 3UTSD 1S4IA 1RUPL 2ICEB 3FB8A 3OXRB 3U9UB 1YECH 2KERA 2JKIS 4DQOL 3VXMA 4L1HA 2EH8H 3ZKND 1PY0A 1ZA6A 4JB9L 1NBCA 3H9SE 1CIDA 3E2HC 3V5DB 2XLLA 3ZE2F 3SJVE 4UILH 1LD9B 4B95C 4HS6A 1B3IA 1R17A 1A47A 1P1ZB 3IN2A 3BH8A 1CCZA 5D71H 3D85B 4TUOA 5ISZA 5HHMD 3LV3A 3MRHB 4UUJB 2ZUUA 2AHIA 4XPBH 4AL8C 3DRQB 1U4EA 3AMKA 3H53A 3X11B 4P2OB 3QORB 3RVXC 4KJQC 3HE7D 3WKNA 2UYLB 2X6CA 3KLHC 1MOEA 1DDTA 3MCYA 4Q7DA 5IJDC 3H56A 4JFTA 3PU7A 4B3VA 2JSFA 1X5JA 4F7PB 4R7NB 1IQDA 2Z0BA 1HHGB 3QNFA 3FHEA 1BVOA 2IAMB 5ID1B 1XH2A 3PCYA 1E8XA 5IVOA 4DW2L 1Z9LA 1WICA 5FUOH 5FW6A 4D3CL 3IJ8A 1JHKH 3FQUB 3PS6A 2WQUA 2E7MA 2ENJA 4H40A 1GGBL 2EYRA 4JO2H 1QX1A 5L8KB 2PMZA 2AV1B 3M1BA 3BAEH 3U4EA 1K5WA 3GTTA 3BXNA 3G08B 1WAAE 1TJGL 5HY9A 1N67A 3BQUA 1AGBB 1AD9B 4Y4HC 1UWGL 2CKBB 4FL4B 3ORJA 4S11A 3L7EB 1XDTT 2VKXA 4GXFA 4HUWA 4XNXL 3MHZA 1IC4L 2DLIA 4N2CA 4ONGL 3STBA 3NRPA 1NOFA 3MRFB 1JPEA 2XTLA 1MCRA 2DWDA 1EGJH 5KBLA 2WLNA 4XMLH 4IBTA 5K39A 2OTPA 3DJ9A 4OCSH 2VZSA 4UZSA 3D39A 1HHHA 3MODH 2RD0A 3BUBA 3FT9A 5CR1A 4D9LL 1UC6A 4J8RA 4X98B 1N9PA 3KYAA 2Y7SA 5D7IA 3T3PB 1A6PA 2PLTA 1HILA 4C55A 3G9VA 2WIMA 2P24B 4OI8A 1W91A 3IGLA 1D9KD 2IBGA 2YPVA 2VDMB 1I1CA 1UM5H 3F2LA 3GPSA 1W8OA 4WFGD 3BEWA 3DTXB 3SO3C 5IQ7L 2VXQA 5CLXA 5FWRA 5LB1A 5HHOD 1NBQA 5HDLA 3O3AA 4NFDA 5GISH 4ZFZB 5AYTA 4QLRA 5ERWA 3DLQR 3RWGA 4YAQA 4Y8DC 3OX8A 3QJFB 5HI5D 5I0WA 2FO1A 1OM9A 3OWRA 3PIQB 1U3HC 4YN3A 5LQBL 3MNMA 4DP4X 5BPPA 2ZCLH 3BPLB 3OMZA 1UWEL 2H26A 3P4OB 2JK5B 2MKLC 2WLYA 1GZHC 2ZCKL 4GB9A 3SDDB 3T65A 4RWYL 4JN2B 5IVXE 3RUGB 3T3MF 4YDJB 1LE5B 5C7ZA 3W37A 5EB9A 2A9ML 4C4BA 1DBBH 3S9DB 2ENQA 3O0RL 1KPUB 3WJJA 2C26A 2X3AA 3EO9H 4D7BA 4XP9L 1IGCH 3NJVA 5F1IA 4E5XA 3T0VA 1IGYB 1HXYB 1P53A 2WXQA 3T08A 1IBHA 3O6FD 1VFMA 5MEOB 1UKSA 4K9EH 4U1MB 4DZ8B 3MACL 3WSQH 2WTOA 4U2ZA 3QQNA 4BZ2A 3AXHA 4N90D 1NUDA 3DDFA 3I6KA 2A38A 1IBFA 1CLYL 3L4XA 4WEBH 1ZT7B 4ZOAA 4HPOL 4Z7VA 5BO0D 5I66B 2FWUA 1S7VB 4IRJB 4MQ7B 5CN2A 1NDMB 2YD8A 2PXYC 4I1PA 2AXFB 3EZ8A 1KTRL 3DJZA 5ALCL 5HYJB 3C75A 1QTYT 1QR1A 2VXTH 1LMKA 3UOAB 3ALWA 1DE4B 4P99A 2H1XA 5I30H 1F3JA 1X5HA 1P2CA 5HVGB 3TJEH 2VL4A 4AXWB 3OJMB 1D5XB 1BQ5A 2CA4A 4ZFOA 3CFUA 5FXCH 3TFKC 3ZKMC 4WHCA 3TASA 5T33H 5KSUB 3TBWB 4AGQA 4O2EB 2BSTA 4PJ8C 2IH9A 3AXLB 5C08A 1HI6A 2J1WA 3FU3A 2VE6B 5F7DA 2FX7L 3IFPB 3ZKQD 5K59E 3QDJE 3O4LA 5KSAB 2WTRA 3FT2B 1VF5C 1YMME 4Q4EA 2GIMA 1P7QA 1A66A 3W9EA 3NJIA 1ID2A 5HGAA 2J7LA 4BJLA 4YSCA 1ZJAA 4KPHL 4X4ME 3BSZA 2KS0A 4JN1H 5E8PA 1EFXB 5KBNC 1RP8A 1YG9A 3IDYB 3NCMA 4QXTA 4IKIA 2DPKA 2XVKA 3VMPA 1HKLH 3VFWB 4CVZA 2ZYRA 4WVRA 2FHFA 2WWKO 4MMYA 4MSWB 5CU9A 4RFNB 4NDMA 4ZMXA 3RILA 1YEJL 5TDPB 3M17A 3BKJL 4RIRB 3WFCL 4AKOA 1ETZB 1G7QB 3IPEA 3PHQB 3OB0K 3TP4A 5T3ZL 2H4EA 4FQ1L 1WA0X 2JKRM 2F58H 1CLZH 3RHWF 1CD0A 1RZPA 2X40A 1UA3A 3D4YA 4M7KH 2NDGA 2PWHA 1TSHA 4EI0A 4IOSA 5EO9B 2VDPB 4LEXH 3L4TA 3S98A 3P0VH 4ISVB 1VCBC 3BH9A 5IVZB 5KYXB 3DRTB 1KCSH 4KTGA 3RWDB 3HHRB 3N1FC 4AENA 5AW8B 2YD2A 1XR8B 1U21A 3RX5A 5L6YH 4RISH 4PIRF 1L7TH 1IAOA 5E4AA 4AL8H 2X4TB 2XZQL 4GQPH 3ROLB 3FN3A 5K93A 2R8SH 5TE6H 4ELKA 1FCCA 4LAJH 2PP9A 5D2NC 5E4EB 3Q13A 3MGTB 4TNEA 2EYTB 4UTAL 3H85A 1EVUA 3MV7E 4JCLA 4A55A 1BZ7B 3NA4A 1WO2A 4RESB 1E6JL 3SE9L 4ORZC 1NAMA 1J8HD 4LQ1A 2HT3D 2MNJB 4YXHL 1WBXB 5TE7L 3KPRE 5I1DA 2QQLL 1NFAA 3CFJA 3D4ZA 4LCCC 4XO8A 3ARWA 4OJFL 1U8LB 2CJSA 2LLNA 1CR9L 2O72A 3I50H 1MREL 2HWZH 2AV7A 3UIYA 2V2XA 2FECL 5DHYB 2UUDH 3DYOA 3GSRA 4X8JB 3RLSA 1WH0A 2OYPA 3SDXA 2EQDA 4KAQL 5D7LE 1KXQA 3UDWA 3ZTCC 4BE5A 3AT9A 4E42A 5FFOA 4FFVC 3SPIA 4PJ9D 4X99B 4E0RA 1A9EB 3ILEA 4BZYA 3QDMD 4J3VA 3B2VL 3ILPA 5AL0A 1NGQL 4HIXH 4Y1AB 4FLRA 1CIUA 2VN5A 1TQCC 2VMCA 3UAJA 1P5UB 2V9RA 3QDAA 3DROB 2V3FA 2ZPKL 3A0OA 2WW8A 1M1XB 2EE0A 3MJ9L 1VPOH 2NY5L 4GEJA 2PO6D 4TLUA 1XB3A 3GSOA 4KQ4H 4PRIA 1YEEL 4J6RL 3HB3B 2IAND 4S1SL 1E3XA 1QRND 4BUHA 4WSKA 2O61A 3TBCA 3L2MA 3KDPB 4IMLB 3U4BH 4TNWF 3UJIH 3QIUD 1JVKA 1NMCC 2D31A 4WWKD 3KYNB 3GSNL 5D5MB 3KXFE 2VSMB 1XD0A 4JS7A 3R0NA 2DYPB 1FFNA 2IPUK 3SY0B 4V11A 4Z7NF 3MR9B 1G94A 3COOA 3RDTD 5CGMA 2VUYA 5CZRA 1GGCL 5D7EA 4DIXA 1Y0LB 1KYAA 2BP0A 1T2XA 4FYTA 2WZ6A 2BW5A 1QLFB 4IRSA 3PXHA 4WV1A 4W4OA 4RMQA 5TK2A 2A73A 5A6IA 5J11C 2EDNA 4LP8A 5GGTA 3RIKA 3ZMEA 4NEHB 4KX7A 5KS9A 1JSYA 1XTMA 3RAJH 7PAZA 1AFVL 4G8EB 2ADGA 4PRPE 1XIWD 2LTQB 4HIHA 3QHZL 3QH3B 3WAKA 1U8HB 1CXEA 3OSKA 2ZT9C 5F0LB 4PREB 2Q8AL 4PW3A 4G3YL 2WHVA 4KOCA 4O00A 4Q2ZB 3L5HA 1PZSA 3LTVA 4I5BA 5DSCB 5L88L 3LH2L 2J8UE 5HHXL 1BW8A 2C9RA 1HYSC 2Y5QA 3D4GA 5E7FA 3QUYB 3CWGA 3H7LA 3QDGE 1VB9A 3UXFA 1PLBA 3QEQA 1ASQA 4BFKA 1AP2A 4DEPC 5JOFB 4WFHE 4HFWB 5JIHA 2JH2A 3ZYZA 3C60A 3OJVC 4YH6A 1H19A 1NFIB 3BGMB 2F8OA 5CZKA 3FZUD 1JK9B 1KGIA 3SKMA 5JXEC 1UOLA 1D5BB 4J1UB 3QA3B 3RRQA 4U1NB 3CSBA 3SQOH 4ELMB 3U46B 2ZICA 1TQBB 4XMKH 2EUXA 1M1SA 2X1XR 5DJXB 4EN3B 2AK4D 5LGHL 2NYYD 2CIIB 3KS0J 3P3TA 1BXVA 5FHAL 2I9LA 1N3NA 4M61B 1CXHA 3AJ7A 3PV6B 4IMKA 4WUKH 3U7AA 5ACMA 1ZWIA 5D1ZI 4XCEA 2B4CL 4PAZA 1AC0A 3KEHA 4QOKD 3RGVA 4LKXB 4U1GB 2R2HB 1TF4A 4XPTL 4ZAKC 1AXTL 3GUFA 2HYMA 3ZR5A 2VAJA 4FXGC 3TCTA 2JKWA 4ONFH 2E7BA 4D0BB 1RUKL 3I74A 1A14L 2XIIA 5IF0B 1QWHA 2FT7A 1WBZA 3BE1L 4Q14A 3T8VA 3BQVA 1E42A 4NOBA 1B4JL 3PABB 5G4NA 3IDIB 4HKXA 4WLCA 5BQDA 5DVNA 2K9UA 1BD2A 2XN0A 3HN8A 3IJHB 5JQHC 1L3NA 3QFGA 4AGMA 4AM0Q 1SXZA 2ENSA 4KUZL 4LLDA 2FSDA 5AB2A 4WWID 2ZKYA 2LQRA 3D33A 1AOHA 3DYPA 2XN9D 4XXDA 4ZYKA 1A6VH 1MDAA 4YNYA 2F53B 2QJDA 3L9YA 1UZ8B 4JFWA 3HS0B 5BRPA 3VXTA 4OAWA 5GJSH 3MRBB 3LZFH 1A9VA 4P5TA 4HLZH 4LSUL 4LZKA 4PRNB 4WTXA 2ID5A 2WOBA 2BINA 1OSPL 3GMOA 4YK4C 3SGJA 1P6FA 4P57A 1TZ8A 4JFQA 4NRYA 4XBGA 3N1PC 1EK3A 5DK2A 5BW7C 3II3A 1HQRB 4KRPC 3T4YB 1JUFB 3RPIA 3ZTJH 1PEZA 4PRAB 2BY2A 4NQVA 1JNNL 5EF3A 1EIBA 1FQ9C 2OMYA 4KZCA 2I07A 1WISA 2X0WA 2AK1L 1URZA 4CU6A 3SD2A 2HJKA 1GHFH 1RLWA 4NKOB 1MEXH 2AP2A 1A1OB 3GHPA 4FERA 2D7QA 2V3DA 4WGVB 5JNYA 1UFGA 5CEZL 1XGTA 3DV6B 2FWOB 5F0JB 3SYOA 3SGKC 3WJMB 4FABH 2MMXA 2BY1A 3F5WA 2PP7A 1IZJA 4ZS6D 1A6WL 5E08L 3DK0A 1FSKC 3QUMA 1BYNA 1OGAD 4U6HB 2Q8BH 3TO4A 3VYPA 1Q0YH 4FHJA 1CXFA 4B5EA 1KCRH 4HSAC 5B7MA 5AB1A 4U1HA 4ZD3L 4GI9A 3LIZH 4BH7B 1MELA 4UQ2B 2DQUL 2NOYA 3NIGB 4K7PH 1DSFH 3SBQA 1XF1A 1L9MA 3ZE1E 3ZT7A 4Y19D 3FRPB 3WN5A 4AYFA 4HVBA 5DZVA 3UFIA 1HOCB 2R2BA 3CDZA 5I6MA 5T1KB 4ODSL 1AZZC 4HCRA 5EN2B 4ZFQA 5ICZA 1YHPA 4P48A 2V9QA 5EU6A 2YXFA 3EH1A 1PPIA 1QEXA 4NC2B 4PQXA 1ZS8A 1BLNB 4GIPD 4Z7QF 4Q89A 4EUPA 4L4TD 1OV8A 4FA8A 2QHRH 3NCYS 4JQIH 4W6WB 1A3RH 3E7JA 1KJ3H 3UL4A 1HOEA 1UD3A 1RJCA 4G80B 2YMXL 4YBQC 8FABA 4HAKA 5DVKA 1HXMA 3T0ED 2F1BA 4OM1H 5DFTA 4NRZB 2K4AA 4IBQA 2UXGA 3HG2A 5I6PA 1EANA 3EO1A 4NN5C 1BIIB 4PW4A 2Y2YA 2FLRT 5F7MC 3QXWA 4MFHA 3QCTH 4LBEB 3HRZA 3FB6B 3R1GL 3SDCB 4PJXE 4XVTH 1JPGA 5J3HC 4AT6A 1U3ZA 2DQFA 3CQPA 3ULAB 2OMWA 3KGRA 4M6AA 4NQDE 4TN9A 3WY3A 1JS4A 5IG7A 4LVNB 1X5FA 1D5MB 1MFAH 1XF4A 2VC2B 4P46B 5I1EH 4ELMF 7CGTA 5AVXB 1OZUA 3QHFL 4CU7A 2NNRA 5LNDA 2CZNA 2L04A 3MLYH 4O02A 4XBPA 4B60A 3DPBA 3RGBA 3UTTB 1S46A 2P8PA 3KCPA 3FOMA 3SQRA 2G9HA 4HHWA 4BFEA 1S9WA 1ZE3C 4U0RC 2IQ9L 1LEIB 4CBPA 2VLLB 4PGDA 1A02N 1NIAA 4LKCB 4XMTA 3HZVB 4Z5RB 4X7SH 4Y4KA 4JO8A 4OZHE 5CD5D 3PHSA 3KGTA 3C5ZB 4HWUA 3WY2A 4I7ZC 3RG1C 3BVNB 2IGTA 1MZZA 4MQXC 4EIGB 1HDMA 1TQTA 2ATKB 1R5WA 1F4XL 3UEZA 4LK4A 1OANA 3H2QA 1I9RL 4HJJL 4ZW8A 4QMEA 1IC5L 5DUMH 2WCGA 4LGRB 2BFVL 2BVEA 1BQHA 1NL0H 4OJAA 5AYUH 3W3BA 4Z8FL 1IBYA 4LARL 4W68A 4GFTB 4DOHE 3JUYA 1KELH 2ADIB 5MEQB 4ZMZA 4OLVL 4JM2B 3UIZA 4M6OL 4C83B 4WWNA 2AQ2A 4D9QE 1UM6L 1MHHB 3P30L 5LHDA 1QSZA 5SX4I 1U33A 1MI5E 5D2NE 5B7FA 3U0WH 3JWOL 1OOWA 4OD2A 1GAFH 4R2GB 4U1SA 1NAKH 4YSSA 4W9CC 3KPTA 3MXVL 1I3GL 5BOZG 3EHBC 4S2SA 4QHNA 2H5UA 4XVSL 2MH4A 3QFJE 3OB8A 3SQBB 4YXLL 4MJIA 2MQ0A 5A7EA 4OZGA 3F04A 1ZDSA 4GXVL 2XTJC 1AOZA 4LNRB 4PJAE 1J48A 3D3VE 3ALPA 3KD4A 4XODA 3DJTA 6FABH 2XXCB 3JTTA 3MBEB 4ODHL 3HAEG 4TSCL 4YE4L 3RZCB 3WIFB 1TZGL 3QUZA 5IW6B 3QXAA 3BKYH 4KZDL 3QXDB 1IAIM 1K8DA 5IK3A 1IE5A 3EGDA 4L4VB 1UOKA 3F62A 3LPFA 3NDZE 4FYRA 4BK8A 3WS3B 5DD0H 2CNYA 4GT0A 3GXPA 5GIRB 1NFDA 1S8DA 2YPLE 1R3KA 4MD0A 4PN6A 5AW2B 5DD3L 5E9AA 3UTSB 1U42A 5AZEH 5DCCA 4L9DA 4WUUD 4HIIB 4B9JA 5D1ZC 4I0PA 2V33A 5JHLH 5ITFA 1I9EA 5KYUA 3DVNA 5ESVA 5GGUB 2GI0A 4MNQD 3MMEA 4XRCA 4PLNC 5ABDE 4LASL 1CDJA 2YHGA 1G6RB 5IW1A 1IO4C 3WTXA 2AVFA 1YEKL 5E5RB 1U9KA 2B0SL 2RCSH 3FDWA 4DP6X 1QKZH 1ZLSL 4OQTL 3VXPB 4JG1H 1KJ2L 4HUUA 1X4ZA 3FNKA 3ESVF 3GSWB 5HHMB 1G7JA 5D72L 5DJAB 3FRUA 4Z7OE 4LFHG 2HTLD 1S7TA 4AMKL 4E9RA 4A6YB 3WY4A 3TN0C 2GK0B 3HPJB 3HE7B 2ZXBA 1MIMH 2HFGH 3ARDA 3W0WA 5JQ6H 5JDJA 3HMXL 4K5PA 4N2MA 1KXVC 4R9HA 4UT6L 4XPHH 3O2VL 4IS6B 5BZWA 3LPOA 4CRPA 4JDZB 1CL7L 1OSYA 2VWEC 3RX9A 1KN2H 4CVUA 1KIQA 1ZKAA 5HYFA 2VXSL 4C4KO 3DYMA 1N19A 4Z0XB 5E2VH 1NJ9B 3BVTA 5EIVA 4H0LC 2CDGA 4Q6IA 3B4NA 4HJ0D 3HJ0A 3KLKA 4J3OF 2TRHA 3B7TA 5DRXB 3CFKA 5L7XH 1KEML 2Y22A 2A74A 3M86A 5CJ8A 4RETB 5CCJA 1V27A 4JR9L 3MJ6A 5J13C 3C8KB 4R97B 3DK2A 1HCFX 3AS1A 4CJ1A 4M62L 2PN5A 3TT1H 4GLRI 4Z9KB 4F93B 3HKZA 3TV3L 3K2KA 3SKOA 4RAHA 2Z31A 4PS4L 3LEXB 4N8PA 4P2RD 1N2RB 3IF1A 4PWKA 1VEMA 3LXUX 5CNHA 4AIZA 4E9VA 1S7RB 5JHAA 1HZLA 5ANMB 2IDQA 3HE6C 2GTWA 2MIZA 4KXDA 3RWCA 4OV5B 4Q9BA 3CC5B 3I2CH 4P23C 2C5DC 3EGXA 5FO2A 3V6BR 1OP5H 4JFHE 1SXAA 3SE4A 5KZCD 1SJEA 1VACB 2EIZA 3BHBB 1H8SA 3I02B 1GL4B 4CC4C 3MGAA 1PLGH 3AREA 3QJXA 3VYOA 1BEYH 5FKAB 5I9QB 1BBDH 4XVUC 3Q7JA 4QF1B 3PGFH 3IAPA 3BPNB 1BPVA 3O41A 1D9KB 4MNHB 1XSOA 2DQCH 5AAMC 2DDQH 4N8CH 3QIBA 2OMBA 3VUAA 4XE5B 1FZMB 2VXVH 3EJRA 1DQLL 1MRCH 4JFEA 2VLJD 4P4KC 2OULB 3NIDB 5HHOB 1E8YA 3TBVB 1ASPA 1JV5A 4NYLB 1U8QA 1L6PA 1ONQA 3WKYA 1HINH 4YDVA 3MNWA 4TSAH 1FI8C 4ZXBA 3WFBH 4K3DH 1OHQA 2BP8B 1PIGA 3QI9D 4JM2F 2XVBA 3H0TB 4QHKJ 3T0AA 5EF2A 2HFFA 1CYGA 1ET8A 4HF5H 3T77A 4LCYB 2OCCB 2D7OA 3MI6A 2DLEA 3EJJX 4XN1A 5MI0C 3LQAC 3TWYA 2FHBA 2SEBB 3V5HA 4JJOA 4M3JA 2IPKA 4FXKA 4ZMNA 2WLIA 2DLTA 4IBVA 4X83A 4ZMQA 4UF7C 4PY8I 2BRRL 5IESH 4FA6A 1F5WA 4NC1C 3O6FB 4A7GA 2XWZA 1DFBH 2WLMA 4AUYA 4C56E 4DK5A 3QG6B 1I7RB 4OGAC 4CJ0A 3QZWB 1T0NB 3E6FB 4X4ZA 5TDNB 5C7XL 2C4FU 3WELA 3ATEA 1LVEA 2LHAA 5L4JA 2Y7QA 4MMXA 3RWHB 4G1EB 1OQXA 5IB4A 1IAIL 5T1MB 3UAFA 1KB5H 3DIFA 3VXUA 1T7XA 2VH5L 2JIXA 2G75A 1R5VA 1MJ7L 3P11H 4LHJB 3D0AA 3K72B 1IJNA 1Z66A 2OXGA 5SWSE 4HOXA 3FU9A 3FUFA 1RZKH 3LY6A 2HMID 4BINA 1F6LL 3PGCB 3PQYD 4M6NL 4O2CA 5DJ2A 5I1KH 5I23A 4MZ2A 5E51A 3FYIB 5AW3B 3ZTNL 1EAPB 1R1CA 2Y3NA 5EUKB 2GSMB 5C0DB 5DGQA 4WDIA 2JE8A 2GJRA 1BXXA 4U2YA 3OGCA 3KM1A 4JHAH 1P7KA 2YSSB 4QRRD 1SOSA 3BAKA 3WD5L 3MV9E 3OG4B 4FXLA 2NTSP 4RLDA 3B7SA 4KV5F 3RY6C 2EE2A 2OZNA 1RUQL 2VRKA 1CVRA 4AGOA 3V6FA 4AQ1B 3GT6A 2BSSA 1MJ8L 4GW4B 2WPGA 2X5PA 2QMKA 5H94B 5JR1H 1U8IA 1PCSA 4DGIH 1CFQA 3L7FB 4XCYA 3HUJF 3ROOA 4H88H 3CSYA 1GC1C 2CKBL 2JMRA 2W5PA 1QSFD 1Z9MA 2BP5M 5IGXL 4FKKA 3O9WA 4WFFD 1A1MB 3JVGA 3JVFC 4HKZA 1P7QD 5K33A 5IHUL 5A7BA 2PWDA 3WTWA 4L8DA 2DI7A 4LPTA 3VD2A 5T3XH 2VZUA 3BAIA 3K8LA 4X5LA 5LXVA 3BZ4A 3CU7A 3IMVA 1YEGH 5FCUL 1QD0A 2Q7YA 1N4XL 3K0WA 4KJYB 4F57H 2H41A 4OFQA 1ZRUA 2ZSWB 5BZDB 2WBJC 1A7OL 1KC5H 2YQBA 3IGUA 1KNOB 4NOFA 1Z5YD 5F9WC 1Q9OA 4N1EA 4Y1TA 4IIQC 4KK9D 4KNTA 2PYEE 2VW4A 2JJWA 2EDQA 1JZ2A 5JDSB 1LE9B 3S35X 2O6CA 1NGZB 4OZ4A 5DJDB 2VDML 3BPCA 3JTSB 3U9WA 2WNKA 2A6IA 3NCWA 4IRJC 5EWIL 2GT9B 4WNSA 3WFEH 3CBRA 4I18B 4NUMA 4ZSOE 2VOTA 4DZBA 3WUWB 1CTOA 2M1KA 2X6AA 1OVZA 4QNPF 1J8HB 3QRGL 4UTBH 5B1KA 4HWBL 3OF6D 1JAEA 2XKUA 1V7MH 2UUDK 1T83A 4NGHL 1P9MC 5ACLA 1DVUA 4R0LB 4FJ6A 3OSVA 1T5XA 2I9TB 4EVNB 2IPTL 1TZAA 1QBLH 1LO2L 1HCZA 1FZOA 3BIKB 4LLYB 2FH8A 2D2CC 1GYUA 4X6EB 5B39A 1G5AA 4UDUB 5F96L 3J27A 1E90A 2CHDA 5LCVH 5D6DA 1T4KB 1FH5H 2X89A 2HRLA 2YXMA 3B2UD 4PJ9B 3W39A 3ES6B 1RIVH 2OJEB 3QDMB 4YHPB 4F24A 1DFXA 2CLRB 3G9AB 4Y4HA 1W72H 5IT2H 3DUHA 4HBCH 1SBSH 4A7QA 2YBRB 4U1KA 3U9PH 2F61A 5DYOA 1WHPA 2PO6B 1E9QB 2ZG1A 1BVKB 4KRLB 5FGCE 1TR7A 2J8HA 2XV2A 1JL8A 4F7EA 4ZW6A 2IANB 3EJYD 5GZOA 4JDEB 1D6VH 5HDRA 1KCVL 1QRNB 2E9BA 1HU8A 1JGVH 4NQCE 4HJGA 4MAYD 3REVA 2EVFA 3GIZL 2Y6TE 4UM8A 5K9JH 3QIUB 4P2QA 4U6YB 4WWKB 4TVPL 3LNDA 4FADA 1KIPA 4QRQA 4A2HA 4M7ZB 1A6UL 1BFVL 3FCSB 3DSFH 2IO5A 4F3FA 4XPFL 4XGZB 2BNRD 3HR5B 1AR1C 3A22A 2PWFA 2XZZA 4UB0H 3RDTB 5FYLD 2I60H 1SM3H 2N3JA 2XTJE 4U1JA 2G2PA 4PG9B 2WWMD 4Y5YC 1ZHBA 4RAUB 2LU7A 3OXSA 4U3XA 3UO1H 3ECVA 1I1AC 4FQCL 4ZUSA 4L8CB 2LOEA 1DLFL 1XF5B 4WAFA 4JZOA 3CH1A 2BVQA 4IK6A 4UYQA 4CMMB 3X1EA 3DX8B 4D2NA 1GVIA 2P5EA 4OIBA 1L9OA 3BWSA 1KTCA 1XIWB 4KDTC 3FB5A 4YDZA 3GDBA 4QEGA 4ZNCD 1U3HA 4XMXA 1S5IH 5GGSB 3VRIA 2YA0A 1FVDA 4HK0B 4JY6A 4NZJA 2E56A 2IFFL 4OF8A 5I19L 1JHTB 4JO1H 4Y4FD 4KNSA 3D8MA 5T3XE 3F7VB 4M93B 4JY5H 4OKDA 5DMKB 5EC2A 3LB6D 3OKEB 3Q2LA 1LDPL 4KKRA 3AUWB 3KPOB 1NC2D 3K6SA 1JV2A 1N5AB 1A4BA 15C8H 4DP5X 2WIIA 2EEFA 3MUHL 4FFYL 4F58L 1M7IA 3Q2WA 1OPGH 2NW3B 4K5MA 2FK9A 2FX9L 3JYBA 3V0JA 2NUTA 2F08A 3KPPB 1WG3A 4MKTA 1YNTA 3QCVL 3HHSA 3KH3A 3T0DA 1OAKH 2AK4B 2J6EL 2XWXA 2VXUH 2EXTA 4K2UH 4P9MH 3L5XH 5IBUB 1L7IH 3FT1A 3QNYA 1XF2A 4N0UE 2BC4B 4IBLT 3SN6N 1SDDB 1RAMA 2DJSA 1UT2A 1MIEL 3FC8A 2VWEE 3KJ6L 1LEGB 4B27A 4N6QA 1GY1A 4IEFA 4BFIB 4QOKB 1UWFA 2QGBA 5I1IH 1QLEB 1SN5A 4LLQA 2JKNA 3T3ME 3GIVA 1N6VA 1D2PA 4PGJA 1K4CB 3X3GH 3ISYA 5PCYA 3I6LD 3WXVH 2FJSA 1K3ZA 5DD1H 3NABH 4AG4L 2JELH 5KSBB 3PLYA 5GZNA 4AQZA 1CFNB 2B2XL 3CZGA 2JV6A 1O75A 1G4RA 5C07D 1W9XA 5D7HA 1DBKH 1ZHKB 2Q3XA 4QWWD 3FO1A 2IWKA 2YEVB 35C8L 4LFHD 1E65A 5EOTA 4BWTA 3RBSA 2B16A 4UM9D 1AXSA 3TEYA 1OAUH 3RJQB 5L2KD 2K9FB 4UTAA 1SOKA 1J5IA 2VIRB 2FJFB 1RPKA 2XN9B 3ARGD 3OHXB 4GRWH 2KHAA 3ARBA 4XE0A 4U33A 1YMHB 2C4XA 5J12B 1VA9A 2UY7B 3INUH 2DZEA 2YD5A 4KKLC 5SX4H 2ZXWB 3CFNA 1BFOA 1FGVH 1RJZA 3WEXA 4AE0A 5IR1B 2JCWA 1EAJA 3C09C 1IKFH 4JCMA 4XNYL 4D9RE 3NN8A 4YR6A 1GC1H 5AW9B 4NP9A 3ABLB 1OE3A 3GJFA 3EYFB 4KK8D 5FUCC 1BXAA 4GY4A 1YEHL 4XO5A 4LCUB 3VWJA 2NX5D 2D4DA 5D4QA 4NN6B 2QEJA 4H5SB 5HD8C 3ZUNC 4ZJ9A 2D7TH 3LXAA 5D7KE 3RTQA 4U6XB 2CXKA 3H8NA 2R29L 2WQ8A 4ODVL 2J1ZA 4CSPA 3OZKA 1ORQA 4JQXC 3HA0A 2NY3C 3MJ9A 4DFHA 3CVHB 4JPKL 1WBYB 2VM4A 4ENZA 4YSTA 4ZFFA 2BZDA 5D9SA 1T1ZB 1IFHH 3HPLA 1XO8A 1CFTA 1OGAB 3N0PB 2JQZA 3ZHKA 1AHWA 4FTVD 3N5AA 3GI9L 3C6SB 5DQ9B 4UANA 2V0AA 3GSNA 1AIFA 1GGIL 4G6MH 3WFDH 4A2FA 1TUPA 4EI5D 1RVFH 2AXGB 1G7IB 2EDHA 3KBHE 3MRJA 4ZI8A 3D9AH 4JO3H 2UZXA 2ORBH 4Y19B 4Z76A 5M94B 1H3GA 5J6SA 3D18A 2F54D 1XB6A 2JCCA 3P4NA 4QY8A 5TH2B 5DO8A 4RMRA 4B9ZA 1QMUA 2AEIT 2Z9TA 3LSOA 3WIAA 3CHXA 3BGFB 1IC7H 2PTUA 2VITA 3RI5F 5J1AB 4HH9B 3C5JB 5AZ2H 5BQ7A 4HZLA 4N3UA 1FIGH 2DLFH 3MU3A 1WDAA 3D7PA 1AE6L 1E4JA 5JMOC 2X1PA 4OLYH 2F7OA 4RAVB 1OCWH 5D70L 3IJEA 3T0EB 4A66A 5GRVL 1Q0XH 4ZNEA 5J6GB 1T0OA 4WI3A 4AEFA 1O5PA 2DYRB 3VNYA 2AC0A 3JBG7 1AACA 3GMLA 4LCVA 3MJ7B 4W81A 4WENB 3KL3A 4PP1C 2G2RA 4WJ5B 3H6JA 2V2WA 1QSEE 5HGHB 2CHNA 4GLRH 3KPSD 5KG9B 2CO4A 1SUJA 2HLFC 2W9DL 3FN0H 3W1ZA 3VXOA 4MXQD 2QGCA 1E5UI 4JKPH 4TULL 3KG5A 4YLCA 1U8KB 3H9SD 3MX0A 4YFLI 5I1CH 4GRWE 3NFPA 1HH9A 2WD0A 3SE3A 2FB4L 3O3EA 1G4MA 4N0FA 1FNEA 2XX1A 1H0DB 2WVVB 4NBZB 3LZNA 4JZJB 4ZTPL 1JWUB 4Y16C 1KFGA 4H1LH 1P4BL 1EH9A 2R27A 3ECWA 3F05A 2R1XA 4F37F 1NDTA 2XKNA 4KWUA 5JPNA 4OZIA 5EBMA 1KZYA 5E1AB 3HZKA 2HKHH 4KJWD 5KN5B 4V1DE 1XH0A 1I8AA 1VLXA 2JB6B 3TO2B 5H8DA 5C0BA 4GAGH 5C0AE 1L4IA 4BCYA 3EO0A 1BVLB 1U95B 4ENEC 4NP4H 2X6UA 4PJ5E 3S35L 5IBTL 5B3JF 2AQSA 3G6JE 1VKXA 1HSBB 3VI3F 4K3HA 4Z7NE 4B6ZA 4AC4A 1LMIA 4EDWH 5KOVC 4L8SB 2GJ6A 3WO3B 3ZK0A 3IS0X 5D1XC 5IQ9B 2DMKA 4WFED 2G3ZA 2ZE0A 3C12A 1CI5A 3O2WL 2LFEA 4LOFA 1CLCA 1EAQA 3TBBA 4BQBA 3C6LC 1LP9A 1KCLA 3RWJA 4P06A 1HE8A 5HHQA 3P40A 4MB3A 4BH8B 2HKFL 2Z92B 2XQYG 3Q1SL 4NO5A 1PZ5A 1MVUB 4GJTB 4JLRA 4YDIH 5ESAA 5IKCA 2VLRA 5HI3D 3U7YH 4J3OC 2Y06L 3MLRL 1SY6L 3B3IB 5EV7A 3VTAA 4F80A 1EXHA 3LZQA 3EJQA 2WXLA 1VRSA 4APQC 3ARVA 1OGTB 2Z6FA 1CG9B 4N2NA 2EICA 3VGAB 4A7VA 3F58L 4H20H 4R8WL 1AO7E 1NBZB 4H0IA 1R33A 4N9OB 3VG0H 1DQDH 3MGOA 1DBML 2Y1AA 4GBXA 1ILSA 5DJZA 4FXGA 1XMWA 1HN1A 1UWYA 1X5LA 3JYCA 3LPGA 5H37A 5F7BA 3K6FA 2XDHA 4MJID 3VW3H 2P5WE 1F11B 2FIKA 5LUMA 1SHSA 3AB0C 3SPVB 3QPQD 4WUUB 5DRNA 4R5XA 5DHDA 5HYQA 3S36X 5HYSA 4FQIL 3MOBL 1MCSA 4Y2DC 4MNQB 2BJMH 4YO0B 5LWYH 4DGUA 5GRYA 5IROD 1RURH 4U1IB 1MCWM 1D5IL 1MJJB 2Q3ZA 3ZMRA 1B6DA 4XT1C 1VFOA 4PJ7A 1JFHA 1H8NA 5GRJH 2Y2WA 2YD0A 5D2LF 2FL5A 5IFHL 4D0CB 3HRPA 1ZA6B 3UZEA 5CEYA 2Q7AA 5GGVH 9CGTA 2K1MA 1TJIL 5IY5B 5IHZA 1BX2A 4I3SL 1RUMH 5MENA 6TAAA 1K4DB 4NZTL 1GW6A 2ZQKA 4HS6B 3VB9A 3DVGA 5TTRA 4OQ1A 3MLUH 1BOGA 2WQWA 2Z93A 2K78A 3NQIA 5CIPB 3S5ZA 3STZB 3H7BA 4O58H 5I1GH 4LEOB 2XZAH 4FG6D 3CLFH 4P3DA 2A1WH 3MXWL 3VI4F 2X2UA 3ASWA 3NEOA 1HIML 1TZOA 4XMUA 1JD9A 2OMXB 2AEQL 1JDCA 4JKLA 5CZXD 5DZOA 4PJHB 3MLWL 4KY1H 1QRKA 4QAMB 2BP3A 4FLHA 3ARDD 4LOVA 4GW5B 5IP4A 5EBGA 4PRBB 5KVMC 1VGKB 1MHCA 2MHAB 3P0GB 3SGKA 4WW1A 4EO5A 5LGJA 3L9BA 4NJ9L 5DRWA 2AQRA 2F6AA 4AEIL 4NO0A 3LRGA 1MRFH 1NGYB 3EYVB 3MRKA 4P2RB 2CK0H 4L8BB 4XI5D 3BZFA 5E4IA 1R3HA 3A3YB 3F7YB 4PJCF 5K1JA 2EYRB 4A38A 4OKVB 5E56A 1MWAB 4HLZG 1LQBC 2ADJB 3KYOA 4OV6F 2HA1A 1B90A 5EU3A 3RNKA 4AH2A 1CDGA 2NNAB 4YLBA 3IMBA 3PP4H 2CM5A 4MCZA 3FT3A 5KZCB 1V3LA 2I26N 1RZ7H 4JJ5B 3ZTJG 2CAKA 1HHKA 2RIKA 1XBDA 4QHUA 5DC2A 3RVWD 1A64A 2VISA 4XAKE 3L95A 4GW1A 1DCEA 3BN3B 2QVMA 3DXAE 3MOAH 5JHBA 1A4KA 5K39B 1JNLH 4M6ML 4LSPL 1KG0B 2K3TA 1NWOA 4RZKA 3BRFA 4YDLB 1AQKL 2P7TB 3CSFA 1A1NA 4QKXB 2ED9A 4QJ5B 4XP5L 5I1HL 1YMMD 2VLJB 1BP3B 2FNWA 2J71A 3LYRA 1ZTXH 3IFLL 2X1OA 4J8RB 4N24A 1USZA 4ZQTA 1UXWB 5ACZA 3N42F 4UI2A 3OKKA 1BAWA 5ESQB 3TCLB 1TMQA 4MD5B 3TX4A 1L0YA 2P8LA 2PR4L 1J0JA 3QI9B 5SWZE 1RK1B 5FF6B 1AG0A 3ARFD 3K81A 4ZBJA 5TQ2H 3O3AB 2OPCA 5K9KB 2IWGA 4L37A 1TFHA 4JDVA 2QQNL 1G7HB 3WKPA 3RWGB 5JORB 1CGTA 4OGZA 1KCUH 1BAGA 1N10A 1WCQA 3BT0A 3CFDA 4KTDL 3NFSH 4YBLC 1AIZA 5EU5A 1SLUA 2E4FA 3KPLB 3LKRA 1CD8A 1IB5A 1ZLWH 2H26B 1UWEH 2NXZD 4GKZA 4O5LL 4OI7A 1FRGH 3OAZH 4OLWL 3WI9A 4N68A 2O93L 4NRXA 2DLGA 3CMOH 3F12B 5FUCE 4QHLA 25C8L 5E8EB 3MLXL 4X80H 5CEXB 3U30C 5F7YC 3TNMB 1KCBA 4BQ8A 5HYIA 2CLVA 2IH3A 4RFEA 5JHDD 3T6WA 3MV7D 2XXGA 4LGPB 1L5GB 5CCKL 1DVQA 1X5ZA 3S4SA 2PPFA 3KDMB 2GSIB 1CF8H 3TA3C 1A3QA 1CLVA 3N2JA 4J12A 1G6RL 2D03L 4K7FA 2PCFA 3AU1A 5F7LB 3KPRD 5EUOB 3HZYA 5DEZA 5F7EH 4ZDHA 4FNSA 4M48H 5C71A 5HHVH 5A6MA 3B1TA 5DJYA 5K9QI 4JRYA 1S7XB 3WIIL 1CFSA 3PQYB 5TF0A 5I76A 3QB7C 4D8PB 1CLYH 1GH7A 4Z7VB 1NCWL 4J3XA 2EE3A 4FQXD 2H32A 4A6YL 3V8CA 4QO1A 4OQTA 1C12A 2AF2A 2D7PA 1KJ2A 1I3VA 3JZYA 1H3PL 1XV8A 5E6SB 4F9LC 3FUDA 2E4TA 4ZS7H 1T03H 3TU6A 3EH5B 1IV8A 2K4WA 2H9GB 2NY1D 5DQJB 2PW1A 5T1LA 4LLWA 1XCQB 1JF1A 3QFDB 4LIQH 4QRRB 2EO7A 3G5WA 3V2AR 3HG0A 2GY5A 3QIWA 2IBBA 3HMXA 3SDYL 5AEAA 4UT6A 2WQXA 2Y4SA 4PY7B 4NHUA 3L3OA 4YUEH 4LL4A 4YE0A 1KXTB 3R4DA 4PWFA 2AJSL 1DCLA 1PJ9A 4XOAA 2NZ9D 5E9NA 5DHVB 4POZD 3LKQB 1HI6B 1AD0B 3GMQA 2OCJA 4ABQA 1FVEB 2FX8H 5F7DB 5H2BB 4G42A 3CFEA 3RFZC 2XX0A 2ISDA 4W6XB 2E7DA 4MB4A 3ZZLA 4QTHB 1QSFB 2BIQA 4L1SA 3SODB 4U1LB 5FLUA 4OFKA 4X6BA 1R34A 1NIFA 1K72A 1P7QB 4HMDA 1J12A 2P46B 2DQMA 2FQGA 2CBOA 4WKZA 4W1TA 4S1DD 4PGBA 1HQ4A 1LO0L 1NIBA 1ZTXE 2GFBB 2H6PB 2R56L 3CDCA 3DX7B 3S2AA 4E41E 3ATFA 2RR3A 4PJDA 4I2XB 2W81C 2YAEA 1NDGB 4HK3N 4LHUG 3QQ4A 4QXWA 5B8CC 2X10A 1EERB 4ALAC 4WW2A 4PRPD 3M17B 5FR3A 1G7LB 1Z1WA 2C4FT 4FFZH 4MJ5A 4S1QH 2OSWA 4H2AA 4FQ1H 5EFIA 3KYMB 3BFQG 2G4GA 5DLMH 3V52L 4RRPG 1SVBA 1S78C 1EEZB 2FWLB 4KU1A 2XPGB 4CN4A 3MYJB 5E2UL 1FNFA 4IJ3C 4MD4A 3TN0A 5JO5A 2F5BL 5PAZA 4NLHA 5DHXB 3BH9B 4WSGA 4YFEA 3IWVA 3QDGD 5H37G 3CQQA 4MRCA 4R4ND 1J0KA 2E7HA 1INDL 1U30A 4NFCA 5INCB 2CRYA 5I74C 2GCYB 1QQDB 5K1VA 2D8KA 1NGWA 1NUFA 1PL3A 1MCEA 5MEPA 4ZW3A 3KLDA 5DMIL 4PR5B 2IG2H 2PPCA 1XGUB 4H44C 4WY7H 5DJ0A 2Q3AA 1E9OB 5C0RL 3RVXD 2VDQB 1RMFL 4KJQD 4GQQA 4G8IB 2VR7A 3KLHD 1J0HA 1E6JH 1T5WA 2FO8A 1UYWL 4Z7WA 3PJSA 3WO4B 2LT9A 2Y0SA 2VUKA 1ANUA 1CN4A 3ZRSA 4GOSA 3T04D 4PGZA 5IMMA 1II4E 2X2JA 5B3SB 5DZLA 3V7AE 4WEMB 1PNCA 4GI6A 1TCRA 1MREH 2X70B 4E9LA 1FFRA 4MWFB 1JFQL 2EILB 3GJFH 5KYYA 1EMTL 1A7PH 2KC0A 4DTGH 4LXFA 5ICYB 4E42B 3B7UX 3GMNB 4MAYB 1AAJA 1XWVA 5CJOH 2TRYA 1MH5B 1IC1A 1Z9OA 3ILPB 3B2VH 4Y4HD 2C3GA 2OYLA 1GSKA 2XWEA 4FHKA 3PWVA 1LWRA 4X5WB 3A4DA 1GPOL 2BNRB 2ICEA 4LIQE 2YD3A 3OXRA 4OGXH 4JRXA 3U9UA 1Q4NX 2V7HA 2CIKA 1N7ML 4Q9RL 2IH1B 3TEZA 4NAMA 2WKGA 3V5DA 1Z9SA 2ZKMX 4AUUA 4PJFE 1YRKA 3I9GH 4HXAL 3S7GA 3I6GB 4HETA 3NJFA 3DIVA 3EOTH 3S36L 2YGOA 3AITA 4BUQA 4OFIA 1QASA 2OM5A 2XA8H 1JE6A 3D85A 3BUIA 3NACL 3NSJA 3MRHA 4UUJA 4AV4A 2B20A 2NQDA 1RHHB 3DRQA 4LNVA 3BVVA 4P2OA 2PPAA 3BZDA 3QORA 4I1RA 4WV1B 4Y4FB 2UYLA 4ICWA 1HL8A 2B15A 2WNWA 3ESOA 1YPZB 2NY4B 5KVDH 1JI1A 5A6LA 5KS9B 3RYMA 4R7NA 2VDKB 3VFTB 4F7PA 5DRZA 1NC2B 4OCYH 1REIA 4FLOA 2IAMA 5ID1A 2ESVE 2FR4B 4DPRA 3QEUB 5GS0C 2XA3A 3FQUA 3EOBB 1PZ3A 5ICXB 5GRUL 3SKUD 3HAEB 3WIHL 2AV1A 3S3DB 2ZWNA 3EH2A 1FFPA 2QSCH 4ZPVB 4WI4A 3G08A 2ZUQB 1EJFA 1GOFA 2LGNA 1ZVSB 3B9AA 3KYKH 7FABL 5HVWA 5FK9B 2EH7L 1AGBA 2E6QA 3OJDB 1AD9A 3D50A 3APFA 2CKBA 4UT7H 3IVKB 1C5BH 3L7EA 4X9IA 3BCDA 3H4HA 3OKOB 3QC6X 1F1DA 2F1AA 4RZCB 3MRFA 1QSVA 2DJMA 1UA7A 3Q6GH 1J86A 5I73B 2FTAA 4DGVH 4TVUA 1G84A 1TT6A 1N59B 1X5AA 4KFZC 4WI5A 3V4VH 2WKOF 1ETB1 5TJWK 1T0MB 3WTVA 1NA8A 4A7SA 3M8OH 4X98A 3U6XS 3QWQB 3X3FH 4XB7A 1ZANH 5C07B 3NBNA 4S0SD 1NPJA 3FFCE 2R2CA 3RGVB 4E9YA 5E6IC 5HVHC 2V4LA 2PXYD 2ZOWA 4UM9B 4HQQH 1MQKH 2CRIA 4CL7A 3NP3A 3DTXA 1N5YL 3PNWB 2COQA 3NAAH 3L3HB 2WO3B 3E80A 1KBGL 4YHZH 4LRNH 3IGAB 1E8WA 4XX5A 5EOQL 4ZFZA 1LO4L 3LAFA 3QEHB 4HFUH 4HWBA 1PX4A 3L13A 1PTZA 3QJFA 4NN7C 3TFKD 3PIQA 1BQLH 4CW1B 5F6IC 1NM9A 3ZKMD 1XGYH 4Z78B 2AEWA 4P59L 4PJ8D 4DVRH 2J8OA 1LWHA 5GGSY 3P4OA 2JK5A 3SDDA 2LR4A 5C09E 4JN2A 2DBLH 3GMPB 4YDJA 2MNUA 3RNQA 4PTTB 4I8DA 1NKRA 4TOYL 4GMTL 2K8QA 3TBSB 2ZKHL 1KPUA 4HU8A 4YDKH 1CU4L 2BY0A 5C0RH 4GUCA 4OCRH 1KULA 3PF2A 2YD6A 4NQEE 5AL8A 2YMOA 1IGYA 1HXYA 1V3JA 4XVOA 1TYRA 3RL1B 4ALAH 1DVXA 2ZXGA 4JFQB 4JBSA 4DETA 1CYXA 4YSDA 1GRWA 3KNBB 1XB8A 2PUQT 4JM4H 4U1MA 4DZ8A 1CPUA 5CJQL 3RPIB 3QUHA 2X1QA 4MBOA 3QJUB 3QAZB 3CC1A 4ZUUB 1JNNH 4FTVB 3CVIH 3T2LA 3FU5A 3WJLC 4HKJA 1ZT7A 5I66A 5KVDE 4OF6A 1W8NA 4EI5B 1S7VA 4IRJA 3KMDA 3HUJE 1J88A 4MQ7A 4RFOL 3FQNB 1NDMA 1H9VA 5JNYB 3KLSA 2AXFA 2HN7B 5CEZH 5HYJA 3BUYB 1OAXL 2F54B 2MFNA 4GRMB 1DE4A 1MCFA 3CN1A 3X13B 1LYQA 1ZMYA 3HIZA 1E0OB 5BO1L 4X4YA 4G5ZL 2H6UA 1P9MA 4KNUA 1F4WL 3TVMC 1WIPA 4TUUA 2OZ4L 1ZT4B 4AXWA 1D5XA 4LHQB 3N06B 4AZ8B 4KMTL 4JUSA 1MI5D 5I2IA 2R69H 5I1AB 2YUXA 2C3XA 4F7MB 5HHNB 5KSUA 3TBWA 4O2EA 3AY4C 3AXLA 4ODTL 1QP1A 2Y1ZA 2ZAIA 3MZTA 1OT4A 1A7QL 2J2ZB 2VE6A 3QFJD 4XAWH 5AWNL 5EZLB 5I17B 4HAFA 2BX5A 3TGXA 5KSAA 1GIGL 5I8CB 2BHUA 3FT2A 3KBEA 3D3VD 4WCYL 1KOAA 1ZS8B 4KGJA 4K94L 4KZEL 1N6QH 5FUZH 2ZUWA 4KBPA 2IEPA 1S9VB 1EFXA 1QHPA 2F1EA 1I4FB 4LE8A 5IEHB 1F3DJ 4FFYA 4M7JL 5I1KL 2Z91B 4BFRA 3OAUL 4QNPE 2RJMA 1MQ8A 3PP3H 2YKLH 3Q8CA 1EQWA 4M8VA 4FFVD 4YZFF 4MSWA 2YMXH 4L3EE 4PJGF 1WFTA 2YPLD 5DVOA 2YSTA 4EDXA 2RBLA 2J44A 4Z7UF 5TDPA 1AKJD 4IDJH 4Z95H 4RIRA 1G7QA 2CBMA 3PHQA 2IALB 3Q0HA 2I5YH 3QZBA 1R3LA 5CILH 4CMHB 3ATAA 3H9SB 3P0YH 4HUMB 1EO8H 4X0KB 2P49B 1PKQE 4HS8H 4N2BA 5IEKB 1M56B 3DIDA 3BDYL 4BEIA 4HT1H 1ZXKA 4AMXA 2UVEA 3FTGA 1JPGB 2FQDA 5EO9A 4HV8B 2CRMA 4ISVA 5IVZA 3H4FA 1JWMA 5KYXA 3BP7B 3RWDA 3SPJA 3QJHB 3UZVB 4DPAX 1XR8A 1JHLH 4KO9A 3EOAA 5AG9A 4PJIF 3LOWA 1RPUA 4P5SA 3C6EA 4XBPB 2JTDA 2X4TA 3ROLA 3LQMA 2P8PB 4IM8A 3ZHLA 43C9B 1A22B 3RU8H 1SN0A 1U8PB 2EYTA 3CU1A 1AC6A 3NH7L 3OZ9H 2HRPH 1BZ7A 3KR3L 3VD4A 3EYQC 1AZRA 4DFIA 2L7UA 5F2FA 1WBXA 4G8AC 2G60L 2AXHA 2KDYA 3Q8EA 3V0VB 4G7VH 1XD1A 5GS0H 3CDFA 2DM4A 5KVFH 1DQVA 2HLEB 1HDMB 5ALBL 3UBXI 3QQ9C 3CUPB 2Z4TA 5HJBA 3MJGX 3SBRA 1BMGA 3S37X 2KPWA 3QEGL 2WYTA 2F68X 3FBKA 5DD5H 4X8JA 3PDGA 1CDYA 2Q6WA 3VJ6B 5BVJB 1EBPA 4PJEB 5GS3A 5ELIA 2G3XA 1RV6X 1HYSD 4X99A 4BQ9A 1A9EA 2KLRA 2ZCHL 4UINH 1KN4H 1IFRA 1W6WA 1N0XH 4FQLL 1YEIL 2ZX5A 4N28A 4Y1AA 5CEZE 3DROA 1FE8H 3GNML 1M1XA 3C08L 3EFOB 4DKEL 4HWEH 5JXED 3EH3B 3CVHL 1LL1A 5DT1L 3IFOB 4OD2B 4U1SB 4JFHD 1NCBH 4ETYA 1L9PA 2JKJA 4ABWA 4YDMA 3K3QA 2R29A 2VDRB 3UPAA 4LHUD 2ED6A 4JGJA 2YGNA 5CUSL 2AJZB 1URIA 2QSVA 4XVSH 3KYNA 1AYRA 2QHLA 2CMRH 4BGLA 3O6KH 5D5MA 2ZWLT 4OM0L 4MJIB 1QYGH 4OZGB 2DYPA 4M9PA 3SY0A 1NANI 1EHLL 3MR9A 4GXVH 2Y36L 2WWNA 3TONA 1NTDA 2IMNA 2P47B 3QSKB 4YX2L 1P6WA 2HVKB 3FCTB 5ANHA 1Y0LA 4MAZA 5TFSH 4C54A 1TZGH 3VRLF 5I1LB 5JW4N 1T7YA 4JMNA 5G2NA 4JREC 1QLFA 3FTZA 4ZAKD 5L4FA 3IFNH 5LBSH 4P49A 5F9OH 1JMZA 2O5XL 1FPTL 2WB1A 3CFBB 5E8OB 1OM3L 2UWEF 4G8EA 2DQTH 3LXCA 1I9JH 3QH3A 2BDNH 1DQKA 1U8HA 3EBHA 3AXIA 2KUTA 4PREA 3VG9C 4O9HH 2Z4QB 3VYNA 4GMSL 5LXGH 5IVXB 5IJKA 4L0ZA 4Q2ZA 1ZD6A 1IIKA 5DSCA 3TYFB 3R8BB 4KHTL 4KQ3H 2A4CA 1CE1H 1JXJA 3L16A 5E7BA 3V0WL 4N2OA 4OF3A 3QUYA 1ZLSH 4OQTH 1JN6A 4YBHA 5JOFA 2XTSA 3CQFA 3UG5A 4HFWA 1CMOA 3VD0A 4MQTB 3I6SA 1NFIA 1E5ZA 2GBUA 3BGMA 4I3RH 4X5QA 1JK9A 1UD5A 1E5AA 4PGCB 4EEEA 1MN4A 3ZKXB 1D5BA 2QLYA 2ZX9A 2WXRA 4C56D 3DUUA 3EXLA 3ARDB 4U1NA 4ELMA 2WLHA 4AVKA 4EN3A 1EFQA 2UZYB 3CD4A 4KRPD 2CIIA 2VABA 2X9ZA 4CADB 3BRGC 4M61A 5FYJU 3IU4L 3PV6A 2N0KA 2YC1B 2ICWA 3EDJA 4TQPA 1BZQK 5KAQF 1WZMA 1BDYA 4JMXA 1NMAL 1KFAL 4LKXA 4YEEA 2R2HA 5L4IA 5KVFE 1KJMB 2LU4A 3P02A 5SWSD 5DK0B 2EIEA 2W9EH 5K9OB 1I3UA 3LH9A 3PREA 5F7WC 4ORGB 4M62H 3UC2A 2H7WA 3S8FB 4KHXH 1HH6B 4JFUA 5BS0E 1VGEH 3DGGB 4D0BA 1FF5A 2GJZB 4XCFH 4MVBC 2F18A 3K6IA 3N43B 4XMPL 3PABA 4QXGL 2V17H 2WVTA 3IDIA 2GTWB 1ZSDB 3CSTA 3RWCB 4JCWA 3WMSA 4HSQA 3IJHA 1AGCA 3MV9D 4GPVA 4KOBA 2F5AL 3EGXB 4RGOL 3SOTA 2VMJA 1XCTB 1RHFA 2LVCA 1SJEB 3EH4B 3KL5A 1YMMB 1H3WM 4DN4H 5CKAA 1F90L 4Z6AT 3S48A 1V5JA 1G9HA 3KL0A 4MAUL 5IQOA 2O5YH 2B39A 2F53A 3GZOA 5CP3H 1A5FH 1BAFH 3Q3GB 1UZ8A 4G6JL 3HS0A 4M00A 2L4OA 2YJLA 2J72A 3FQRB 2WLKA 4FI6A 3LN9A 3MRBA 4OCNC 4PLOB 4TUKH 3TIDB 4PRNA 3GHEH 5IMKA 1IFGA 5EDSA 3FOLB 5J1SC 3ZL4L 3DMMC 4W9DC 3S2CA 3T0BA 3WXWH 4B97A 3ARFB 4YBQD 1YJDC 4X9GA 1HQRA 1MRDL 2XRAL 3B34A 4PRAA 2FO4B 4M3KB 2EKSA 1OCCB 2Y7LA 2XG4B 1TVHA 2ZWYA 4OT1L 1SY6A 1F6AB 3GXFA 5C0CE 3TEWA 2BZ7A 4NKOA 1A1OA 2KH2B 2NXZB 5J3HD 4HIQA 1C16B 4XNZC 3PJNA 1WT5A 1ZLUK 4AWJC 3DV6A 2MOVA 1JGUH 4AGNA 5CHNB 2ZF8A 3HI6L 5IIEB 2PYED 2QT6A 1QNZL 3JWNC 3D48R 4KVNL 5DFVD 4RGNC 1MCOL 2GC7C 1YLBB 4JPVH 4U6HA 2LABA 2JQAA 4N85A 1IGJB 4UBDC 3QS2A 5JHDB 3NZHL 4J4PC 2FEEL 3MV7B 3SBPA 2VTFA 1CICC 1GYCA 2R23B 3DHMA 2DEXX 4LCIH 4UQ2A 1QBAA 4BH7A 2XWRA 2VNCA 4KFMA 5KEZA 5JMRA 3PWJA 3U1QA 4UOZA 2EIMB 2GC4C 3DHUA 3KPRB 5BV7C 4PWEA 3GM0A 2FGWL 4H2CA 1HOCA 1XEDA 3NPZB 3CZUB 1UB6B 5EN2A 4DO5A 1MDTA 4IGBC 4LVHC 3BUPA 5C6TL 2FATL 1TU2B 3N0AA 4LCWE 2BVUA 1KIUB 4PB9H 1OO2A 5D1XA 5LBVA 4MQXD 2WXKA 3CFCL 1BLNA 1JPSL 3BD4A 4AY0A 4OGQC 1T20B 2QQKL 2Z0UA 1IAIH 3DIFB 3TBTB 4DF9A 2E3VA 2NY1B 2YZ8A 4OIFA 2JIXB 2G75B 2MQGA 5IV2B 1YNLL 1BG1A 4G80A 1DQIA 1OE1A 3SGEI 1FDLL 1N70A 4C47A 4AYBA 3AM8C 4H1LG 3NCJH 4DKFL 3REWB 4NRZA 2Q0ZX 1KPVB 4TF4A 3QS3A 2OSXA 4JANB 2WINB 4FEIA 1C8PA 3L4WA 4OLXH 1BIIA 1U36A 1BZOA 4NQCD 3WYRA 4LBEA 4G72B 4YC2C 3FB6A 5D7JC 1UG9A 3SDCA 1CGSL 5B3JE 5HPMB 4KKAC 4AK2A 3NMEA 2MPAH 4LVOB 3TT3L 2AQNA 3VI3E 1OXYA 4HPYL 4Q58C 1BZ9A 3MA9H 5D4HA 4PGEB 4P46A 3SDAC 4G8GA 1IBZA 3O8XC 4XOBA 1TOXA 5CN1A 2EAEA 3N41B 4XP1H 1L9TA 2XTJD 5E5LA 1MWAL 5D1QC 4KKCC 2YAQA 1WFMA 2O6DA 5CGTA 3VXQB 1FORL 1LEIA 1JPFB 2VLLA 2AFNA 2W8CA 3CXDH 4J5VA 4Y2DA 1W0VB 2J4WH 4LKCA 4PVMA 1JP5A 1QI3A 2E86A 1QPXA 3HZVA 5E99L 4Z5RA 3CNKA 3DX6B 4PRPB 2AJXL 4NQQA 3VD1A 4WTWA 3LZLA 4JUTA 4NUPA 1YQVH 2AERT 4TLSA 3BVNA 5F3BB 5D1ZD 1SF5A 2OI9C 1BM3H 5T3XD 4GG6E 1TQSA 2Q20A 4DP0X 5DJCA 3HI1B 3L3IB 3QDGB 3P4MB 1P4IH 1WEJL 3EG9B 1Q9OB 3MUZ1 3K5RA 5K59F 3EYSH 1IBGH 4JG9A 2BRQA 4G6AC 1OTTC 1GOHA 3EGSB 2ADIA 5MEQA 3N1GC 4JM2A 3BPCB 4C83A 1NGPH 5EWIH 4NM4H 1MHHA 2PABA 1R46A 4JHVA 5I24A 2OV0A 3TLRA 4DZBB 2K7PA 4X7TA 4GUQA 1NCHA 1HTYA 1QW9A 2AANA 5AAWA 4JKMA 4PB0L 3GJFK 4GH7B 3SOBH 3UP6A 1ROWA 2H0FA 1QFUH 3BSHA 5FCSH 4N26A 3S37L 1HNFA 2AABL 3FPXA 5TK4A 3SQBA 1CGXA 2L0DA 4I77H 4RDBA 3CVBA 4KVCH 3U1SH 4LNRA 5CMAB 4LPUA 4YQXH 1AGFB 1HAWA 1FYTE 3VXSE 3MBEA 4GQZA 3WIFA 3RZCA 1E40A 5F96H 5IW6A 2YPKB 3MUGB 2AGJH 3ZMNA 5I0XA 3GZPA 3QXDA 1M6UA 4L4VA 3VI4E 1T2JA 3FSOA 4K9JA 3ZQ9A 4Y4HB 4DAGL 4RMUA 1LHZA 1WC7B 3UTSA 3ZJAA 2V5SA 2V5TA 2IDTA 3HI5H 1C1EH 4OIIL 2EJ1A 3AG1B 3HE6D 4HIIA 1G9EA 3B2PA 2GABA 3V95A 1FNSH 2DN7A 2FAUA 5KVGH 5IMLA 4P23D 5GGUA 4WIQA 1KCVH 1R3IL 5A2AA 4CA4A 3GXDA 3WTTA 5EA0H 5DLLA 5KBPA 5IQNA 1G6RA 4AUJA 1VJSA 1Y07A 3V0HA 4U49A 5KTEH 1QVOA 2DEWX 1JYVA 1GY2A 1JVOA 3VXPA 3WY1A 4N8UA 4PJCE 2L7JA 1GGUA 3CK0H 3FU6A 1ORSB 4D9RD 2H1LM 3D30A 3GSWA 4XVUD 5BCAA 5B1CA 3SKJH 4P5RA 2OK0H 3IRZA 2IADB 4TQEH 5E9DE 1KGCE 4A6YA 1ZHBB 5JHMA 2J3SA 3CHQA 5BRZE 2GK0A 4KO7A 1EZVX 3HE7A 1YJDH 3HPJA 3NZ8B 5DYFA 3CZNA 3IDGB 1KV7A 3SO3B 1KDJA 4PV9B 3K91A 4HDIB 2IDFA 3CFTA 1N8ZB 3M1CA 2XVLA 4P4KD 4XC1L 4GSRA 1ND0B 4UQDA 2FDBP 4A37A 4JDZA 3O11B 1T4WA 4ZTEA 5D7KD 5FO9B 3Q6FB 5IFJB 5IUCA 4MCNA 4Z0XA 2GBTA 1KBWA 1NJ9A 1U3HB 3FQ4A 2A83B 1B2WL 2VJ8A 2C7FA 3CN3A 3ZT6A 3ME0B 5DRXA 2IFFH 5TD4A 3DOSA 3N55A 2AQTA 4U6VL 2IGFL 3JWNH 4FZ8H 1U0QA 3UTPE 1HCVA 2CE6A 3C8KA 2CO3A 4MA8H 4JEGB 4M5YH 1A8ZA 2B08A 4CVWA 4WGKA 1DUZB 2DM3A 3HN5A 5CBEA 1OF0A 4BGDA 1DANT 1KGXA 4JE4B 5F6HJ 2JLLA 3LKOB 5DR5H 3LEXA 1N2RA 2YK1L 1K2DB 3ZTDC 1DJIA 1S7RA 4K3GA 2FX9H 5ANMA 1ACYL 3FL7A 5FV1L 3T3PE 5BV7H 2CUHA 1TJMA 3KVQA 3N41F 2YD1A 4FQJL 4OV5A 3AZUA 3MLSH 3QCVH 4XXWC 1ZEAL 2E9IA 4NPJA 5KVEH 2J6EH 4OGAD 1ED3A 3LHPL 2P42B 1RIHL 1VACA 1XF2B 3QJVB 3I02A 1TQUA 2B14A 4EPSA 1V54B 1J1PH 3CDYA 4YLQT 5FKAA 3D25B 1BM7A 4CKQA 2VDPH 4IEFB 4LSRL 4QF1A 4WTZG 5A3ID 4WI2A 2UXVA 1NBVL 1D9KA 4MNHA 2PXYB 3IMWA 3T09A 2LE9A 1G6VK 4A04A 2AKRA 3CTTA 3HTLX 4M5ZH 2BIPA 1EEUA 3BW9B 4NBYB 5HHOA 2J8UF 3PRZA 4ONHB 3RUGE 4G6FD 4PCKA 2JQMA 12E8L 4PP2A 1JZ7A 1W16A 3FO1B 2VDQL 3BDBA 4PJXB 35C8H 1QSED 5EOTB 4OCXH 4PJ8B 3LDBC 2CLZB 1NINA 2AZUA 2BP8A 3NGBC 3ULUC 5FA3B 1ADWA 3EJTA 2JJTC 1BZ8A 1FA4A 4L4JA 1D3CA 4LCYA 1TTCA 5KVGE 1S9KC 4WWPA 4J6IA 1JG9A 4OVVA 3P3YA 1E9PB 1JZJA 2PKDA 5E1HB 3WEXB 4I48B 4HXBL 3TESA 4ZK8A 1FL6B 1JK8B 4ODXA 4JG0L 3LXBA 1U91B 4OZHB 1IQWH 1XSKA 3SBWA 4QKTA 1SQ2N 3QG6A 1I7RA 4J3OG 2EVIA 2DQDH 3QZWA 5I18L 1NANH 1T0NA 4JFOB 4POUB 1FIEA 5MP6L 1MW1A 2P44B 1T0PB 3E6FA 5KOMC 5TDNA 4V1DD 2MTAA 5FYLL 5KANI 3Q2NA 2XT1B 5C0AD 1E3FA 3MOQA 2WNGA 5AVUB 4MTMA 3LD8C 4PJ5D 2UX7A 3RWHA 4G1EA 1ORQB 3RVUD 2HFEB 4N0CC 5E8NB 5T1MA 3SZ6A 2WXGA 2XSKA 2NR6C 3VWKC 2X44D 2WBJD 2MPVA 4DOHB 3K72A 1KLUB 4PJBF 1DVYA 1L9SA 3AADB 1Q94B 1OD7A 3JWNE 3PGCA 3IDMB 5FOBB 1CZ8L 1TETH 2QKIC 3TWCL 1EAPA 4LVEA 1MI5B 1X5MA 3BSGA 4QWWC 5D2NB 4XXCC 4BSWB 1WJ3A 5C0DA 2DTML 2OTWB 4HEMA 5J89A 1XL4A 4UOW0 1RD6A 2VDKL 3QFJB 1Q38A 2YSSA 5F21B 3X12A 1UACH 1E4HA 3ARGC 3T8MA 4IDLA 1D5RA 4LCCB 3DC0A 3NJNA 4G6KH 5DWPA 4MJJA 2MCPL 3F83A 3TV8A 4AQ1A 4BSVB 4PJAB 4OCLC 1V10A 5JQIB 2RFXB 5KVEE 1UZGA 3VVWA 3UJJL 1UD6A 1AO7D 4P9HL 5AALA 3DO3A 5H94A 2I32A 1JYNA 1YUKB 3L7FA 4DCQB 1F4YH 4TSBH 4KK8C 2X4UB 1QUNB 2R39A 5AD0B 2P5WD 2YPLB 3AQZA 2OR9L 1FNGB 4CDHA 3IJEB 3BVXA 1IM3D 3WGVB 1TQCB 5FDWB 2XPYA 3FHAA 2QTVA 1SEQH 2GAZB 4JPWL 1JWSB 3I3DA 4ETQA 1IRAY 4M3HA 1T89C 5I8OL 2AQ3A 2W0FB 5KJRH 3EDDA 4TLKA 2WM0A 4KKPA 3ZE1F 4QRUB 1CDIA 1BQSA 1X7QB 5F1KC 4P04A 2ZSWA 5BZDA 2W07B 3MV8A 3V10A 43CAA 2CPUA 1RFDL 4LOUC 1UWXK 4Z7OB 3QUXC 1AR1D 4PLJD 5JDSA 4AQ8A 3MX0B 5DJDA 4L5FL 3NFPB 3JTSA 1CGYA 3GRWL 3S34L 1MCHA 1RQ5A 5D1QE 4I18A 5IWLC 4QRPE 5BZZA 1GZQB 3WUWA 1IE4A 1HWGB 1I1AD 2WP3O 4HIJB 3OB0H 1KEGL 3DURB 2ZX8A 3G5XA 2H0PA 5J11B 1J8HA 1TZIB 5E2WH 5DS8A 1U8OB 4ERSL 3CHPA 4OSUH 2XY1A 2VL5B 3BLBA 1OW0A 4R0LA 3D08A 2W92A 1E8ZA 3H9YA 4OZIB 2I9TA 4EVNA 1WFIA 4G70B 5G5DB 1ZIBA 4Y0GA 4UMGA 1MNUH 2XFGB 3BIKA 4ZTOH 5LAXB 3HR6A 4X6EA 1JERA 4PFEA 5C0BB 3RVTC 5FYJH 4UDUA 5FFGA 1UOWA 2NNXA 1VCAA 4NHCH 1G9MC 5FAAA 1T4KA 3SGDI 4PJ9A 4ADIA 3ES6A 3MUY1 2OJEA 3QDMA 4YHPA 3C2AL 4OZFH 2XQ0A 4X5XB 4DEPB 1H5BC 4NUGL 1JPTH 2YBRA 5HTSA 4Q0XL 4EIZC 4M1GH 1WPCA 4JGUA 1BVNP 2B5IC 3FMGL 3H42L 2AJUL 2PO6A 1E9QA 1EZVY 3CX2A 2R1WB 4JHWH 1BVKA 1NLBL 4ANWA 2KLSA 1FG2B 2IANA 4XPAL 4JDEA 5HHQB 2V8LA 1QRNA 1CXKA 4NZRL 1I8IB 3EFDH 2HKFH 3BPOB 4LHUB 4NO5B 2C9AA 4FAAB 1CQKA 1EJOH 2ROXA 3QIUA 4U6YA 4UQ9A 4WWKA 2OL3H 4AYGA 4GRLC 3MRQB 2DS4A 4MXQC 2OJZH 3FCSA 2OMZB 2OJ1A 4XAKD 2QGEA 1O9ZA 5LGYA 4XGZA 3DXAD 3HR5A 3IS1X 4KDWA 4R7DB 1FP5A 3OHMB 1JTOA 3LZPA 3RDTA 3V9EA 3AMLA 2YAOA 3PWUB 5AUMB 3FAWA 3Q2VA 4PG9A 3RBGA 3QP3A 4RAUA 3MC0A 1E50A 2CWRA 4ZAKB 4NKIH 4L8CA 1NC4D 4F2FA 2BERA 4FXGB 3ZO9A 1AQHA 2Z7YA 5C2BL 3VFOB 3DX8A 4ZQKB 2EIKB 3WNIA 4E9QA 2Z8VC 1UCBL 1XIWA 1M9WA 4OCWH 2N59A 3AG2B 4H8WC 1GMIA 3BZ5A 2OZ4A 2Y07H 4HK0A 5SWZD 3ULUH 2WUCL 1G9ML 1JHTA 1SYSB 3DHJA 1FL5B 2DQIH 3E6HB 3HMWL 3P9MB 4RSYA 3SGEH 3HLKA 3IDXL 3V5KB 4BK5C 3ECQA 3F7VA 4ZO6A 3GLDA 1MNNA 1WZKA 1G9NC 1RZJC 5DMKA 3OKEA 1EO5A 1OPOA 3E1ZA 2Q10A 4PRDB 2YN5A 3FTWA 3KPOA 1U93B 1GCFA 1N5AA 3T6VA 4KKLD 1QI4A 2ZP8A 4NCDA 4OGYH 5A40E 3TC9A 2APBA 2XWBB 1Q8MA 4M8UA 2QDWA 4LSQL 3BKML 3WL9B 1D6EB 4C56B 3KPPA 2DF3A 4YK4B 1BX2B 4I3SH 3UYPB 1URLA 5I5MA 1RUAH 2YJQA 3MNZB 2EO1A 1WA2X 4PBWD 5CF3A 1AXIB 2GITB 3AVEA 4Y2OB 1FBIH 1B0IA 4KRPB 4PBDA 4MXWL 1AJ7L 1EXUB 4I13B 1K8IB 3JTBA 5HD8D 3WNMA 2BC4A 1AMYA 1AS8A 4BIKA 1MHPL 2C9UA 2H1PH 2WY3B 4AITA 1CLOL 3BAWA 2H2SD 4AC2A 4BFIA 4TRPH 4F5CA 3NIFF 4MS8C 4QOKA 4BZ1H 4KO5A 2NY3D 2J20A 3BI9X 1DJHA 3G6DH 2WANA 5SWSB 2VC2H 3H9HA 1V7NH 3UACA 1K4CA 3MZGB 3A23A 3BEVB 4F8PA 1FSKB 2YFOA 5FYJE 2VQ4A 5KSBA 4ZOEA 1CFNA 1K6QL 2BM3A 2DQJH 2NUPB 4KX9A 1VDGA 1DBJL 3MRKB 3UPRB 5AB0A 5A2KH 4HLEA 3GBMH 1ZHKA 4F8OA 3L5JA 1OY3B 1TPXC 1YEDB 5AVSB 3S5YA 5EU3B 3RNKB 3MV9B 1RZJL 1XCXA 2YD7A 5GHWH 4DUXA 1ET5A 2VIRA 3L4ZA 2FJFA 2XN9A 1WS7A 3OHXA 5D8JL 3D12B 1YMHA 5SX5K 2DQEL 2UY7A 2APFA 4FFTA 3WENA 2P28B 2PW2B 2WLJA 2VM9A 5FGBA 5IR1A 4X6CB 2VJ0A 1LK3H 4MNGE 1A4KB 1SMAA 5E5MB 4LSPH 1SF3A 4Y5VC 2KZWA 3EYFA 4JFVA 1DVZA 1MFCL 1R75A 2D7NA 3NA9H 3MKGA 1RZIB 2I85A 3W2DH 2EXWC 5INDA 4HGWB 4XWGH 1UB5A 4EBQH 3QQDB 4BQ6A 5IB2B 2VW7A 3OKKB 2BFGA 4E41D 1AKPA 2CO7B 4NN5B 4BFFA 5DZNA 1DJWA 4U6XA 1I7ZB 1H3UA 1TEYA 3HFML 2ZAHA 4KJPD 1WS8A 2VDRL 4PP1D 2PR4H 3OR7B 4CSSA 2ADFH 1E6OL 2XQBL 5D7IF 3KS0H 1MJUL 3CVHA 1GS8A 1NPNA 1A7NL 1WBYA 4IU2B 1E7UA 3ULUE 2HLFD 1T1ZA 2PYEB 3FONA 4L37B 3UTOA 3H1ZA 5J4MA 3J07A 4YL4A 3VFUB 2A3TA 5IHWA 1OGAA 3HBGA 3WLBB 1SUHA 3C6SA 1IGML 2GIXA 2EE6A 2HLAB 2E46A 3VU2A 4R90L 3M45A 1RZGB 3OMAB 4ZSOB 3V0AC 3DTUB 5DUPH 3MLZL 3QNXA 2AXGA 1G7IA 1FHNA 4U0RB 1YYLH 4O5LH 3HC4H 1CBJA 4JO4L 4MLSA 4Y19A 3GKZA 2EEAA 4PJGE 1MFEL 3MPCA 1ADQL 2ED7A 3QUGA 4Y16D 4XO4A 5D2LA 4KKZA 5TH2A 1RZFL 4Z3EA 2Y24A 3ILQD 2J73A 2XZCH 3PL6C 2CLVB 3DKHA 1YECL 3VXRE 5J1AA 2JXMA 1B0WA 2JF1A 3C5JA 2EH8L 2MEJB 3TURA 4L4TA 2MCAA 2VERN 1BGXH 1U3YA 3N6YA 3L4YA 4G83A 4ENED 5AVQB 3U48A 1H9DA 1J1XH 4HGMA 3THMH 4UILL 3UTQA 2F74B 5DJ6A 4F9PA 1KB5B 5HDQH 3EBIA 4PJIE 1INQB 1MFBH 5ITBL 4RAVA 5DQDH 1CFSB 1NSNH 2NNFA 3S96B 3ZSSA 4CSTA 2R0WH 6CGTA 3T0EA 2BWQA 5FPIA 1ZLDA 2DYSB 1KY7A 4A6YH 4QO1B 4BM7A 5E8DH 3ZPDA 4AJ0A 2X9YA 4XPBL 2YOAA 3UTTE 3C6LD 3MJ7A 3VFNB 4NQCB 3V4PH 3VA2C 5DZAA 4ZPTB 4MA3A 5CJXA 2EABA 5HGHA 3DO7B 3D05A 2JJSC 5KG9A 4XNAA 1XCWA 5AKTA 5JOPE 4ZT1A 1ZPLA 1U3NA 3FFOA 5DXWA 4J3OD 2K6YA 4NHUB 4FZEH 4APQD 1QHOA 3CX5K 4KC3B 5D7SH 5FUOL 2XTJB 1S3RA 2QZ5A 1OAYH 1JHKL 1Q0EA 4NNPH 4QXUH 1U8KA 4I0CC 1UXMA 4JO2L 2WBKA 4Y9GA 3GXMA 1NPUA 4GKLA 3T4AC 4ZMYA 3CFEB