5D1ZB

Isdb neat1 bound by clone d4-10
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
222
structure length
218
Chain Sequence
b'EVQLVESGGGVVQPGGSLRLSCAASGFTFNKFWMNWVRQAPGKGLEWVADIQVDGSEKNYVDSVKGRFTISRDNGKNSLYLQMNSLRAEDTGVYYCARGRYDYWSGYLSPWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Y10 Light Chain
publication title Germline-encoded neutralization of a Staphylococcus aureus virulence factor by the human antibody repertoire.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 218
sequence length 222
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d1zB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d1zB01
4LHUG 5ILTH 3SDXE 5IB1A 4OZFH 3U4AA 4QXGH 4DZ8B 1RUQL 3KDMA 4R7DB 1HHGB 1FP5A 4HUXA 3NZHL 4NYLB 2J7LA 2CDGB 3VXTB 4RGMB 1FFQA 3O2VL 3U9PH 3VFMB 2VJXA 1RIVH 2WK2A 4P2YA 4QT5A 1V8HA 5DUML 4LRIC 4KKBC 2UY7A 2DQCL 4Y1AB 1U91B 2F53B 2IMMA 2I07A 1UJ3C 5D7IF 1CXFA 4R4ND 2BOCB 4RIRB 4XH2B 4NZTH 5D71L 4Y7MA 1E6JL 3QQ9D 1ODAA 1MPAH 4OT1L 5C0DA 3ULUL 3QPXH 3H42H 3I6LE 3QO0B 4NP4L 2ZUWA 3V6OA 3T0EB 3RIAK 4UIMA 2YEZB 3BO8B 4FQCH 1OSZA 2NXZD 5D7LA 3LEVH 4ZFFA 1N5YH 4L4TE 1G9NC 3AREB 4M4PA 2E6JA 2YPLD 2Q86B 3HS0A 1RPQA 4M6OH 4AG4H 4KI5E 4AZ8A 2APTA 2PCPB 5IOPB 2R0WL 4P46C 3FCTB 2X4RA 5T1LD 4U33A 2H26B 2R29L 1MWAA 3QFDA 5IEKA 1Q1JH 3IDIA 1FGVL 4PR5A 3MBXH 1S9XB 5IGXH 3DVGA 5LXGH 2NXZB 1MCQA 3FRUA 4J12A 1RJYA 2O5XH 3RVWD 5CMAA 1XR8A 4Z7WA 2UV3A 1BHGA 3MRQA 1MIEL 3X3FH 4CN4A 2XRAH 3RKDC 3QEHA 2HTKD 2V5RA 2AEPH 2I07B 3TVMB 4X80H 1RU9L 1A64A 1BAFL 1ZA6B 5EC2A 4HXAH 2D0HA 3RI5F 3VGAC 3LKOB 3T3ME 3W11C 3TFKC 4JANA 5J7CC 1SEBA 1DUYB 5BS0D 5AYUH 1NDGA 3EFDH 3UJJL 1DUZA 2V2WB 4ZFFB 1LNUB 1MRFL 4PJ7A 3OKEB 4PV8B 3UXFA 2VOTA 4MNGE 1MI5E 5DMIL 2HFFA 3F12B 4NO3A 3ULSA 5C07E 2GAZA 1LO0H 3LKSB 4LHUD 4TN9A 3BHBA 1UKSA 2EE6A 2O5ZH 4LSUL 1IBGH 5EC1B 4BFIA 3OJ2C 1FC2D 5F9JB 3TNMB 3ET9F 2CH8A 3IDIB 3O4LA 3H7LA 3VFSB 3U36B 4QTHB 1CYGA 5IHZA 5L0QB 3B2VL 3KPQB 2FJGB 3P30H 4KV5E 5I75C 4OZIA 3SJVE 5KJRL 1T7VA 1HN1A 4HGMA 1IFHH 2FIKB 4IRJD 4JFPA 2XA3A 4OZFA 4LHUB 3CC5A 5J3HD 3B6SB 3L1OL 2I27N 2AEWA 3EHBD 1N6VA 3LMJL 2P45B 2C3HA 4HFUL 1JWSB 3CLEL 3O3EB 4LSDA 3R0NA 1OAZH 1ZT7A 2W60B 5EC2B 1LO2L 3OMZA 1MJUH 4NUGL 4MD4A 2VL4A 4U3CA 1S7SB 3DARA 4WVRA 4XPHL 2HRLA 3UYRL 4JANB 4X4MA 4OLVL 1YNKL 3O3BB 5LVEA 1FIGL 5GPRA 4PB0H 3Q5OA 2NY0C 1K4CA 4XAKD 5C9JB 1OPGH 5FYKE 3QZWA 2EDHA 1RZFH 3GI8H 1LEKA 1OTUC 3L9RA 5FGRA 4D9LH 1VKXB 2AJVL 9CGTA 2CSPA 5HGBB 3PNWA 5T3ZE 4APQC 3KLDA 2DMBA 2YA1A 2AXFA 4IIQB 1I7UA 4PP2A 3OX8A 3Q6FB 1JNNH 4OCSH 2YA2A 2ORBL 4DAGH 1MCOL 2J8OA 3KLHD 4YC2B 1ADQH 5HHPB 5HHQB 1I8KB 4KXZI 4M6ML 1FCGA 4E5XA 5IHZB 1QFUL 3P40A 2D4FA 5ESVA 3ARBA 1KF9B 4K55A 5FO8B 4GBXC 1BQLH 4NC0B 3S9DB 3VWKA 2WLZA 4MHHG 4NKMB 3WKMH 4XTRC 1TLKA 4MCZA 3KPLA 5FAAA 3Q5TA 4LSTH 1J0YA 3QQ3B 1ZS8A 4YXLH 1T7ZA 2A9NH 4WTZG 4N9GA 4MD4B 4PJIB 3LVEA 2V9RA 3FZUC 4OSUL 1YMHB 2D3VA 4YHYB 2FGWH 1N7MH 3QDGE 1T1ZA 5DK2B 1K4CB 1KENL 6CGTA 4I0PB 3HI6L 1NANH 3INUH 5H2BA 2X1XR 2Y5TB 2Y07L 5EWIL 1D5BA 1RULH 4D0CA 1FNGB 3UBXI 3BDBA 1A6TA 4LK4A 3PJSA 3U7WH 4W70A 3L9RB 5JDSB 2BOBA 2D7OA 3ARWA 5KANG 3RAJL 3GHBH 5GISH 1NGPL 2Z91A 3N1QC 2DQFA 2FHFA 2RGSA 1FZJB 1T03L 1KB5H 1ZEAL 4OD2A 3BGFB 5DZOA 1CE1H 2EDNA 2E9JA 1QHOA 3MR9A 4OF3A 3JUYA 2X10A 1MFNA 1Q9LB 2CK2A 4PY8I 4QYOA 1QFWL 3HE6A 3MRFB 1GAFH 4K3DH 5FHBH 1TETL 3F7PC 1P5VA 3RY6A 1SJXA 4LKCA 5I15H 1ZT4A 1ZS8B 2Q3ZA 1ZLSL 3CK0L 3AM8A 3DX8A 3UO1L 4EXPX 1YDPB 5J06A 1UH4A 3AU1B 1S7TA 4YHLH 1D5ZA 4J7RA 4AEHH 1IC7L 4TVPE 1IGYB 2ADJA 3PWJB 4N1EA 4PJGF 1KLGA 5AG9A 3LPFA 3TBSB 1G7PA 4FA8A 4G6AD 5DURD 1N8ZB 2KL6A 3E6HB 4PRNA 1I4FB 4NQCB 5D8JH 5DD0H 1KULA 4PRHD 3PDOA 3Q3GA 1QVOA 1AJ7L 3DHMA 3RGVB 1X5IA 4MD5B 2Z91B 3KAAA 1HXYA 4C4KO 5A1AA 2OP4H 4LCWE 1IGML 3CXHK 2R0ZH 3QXWA 4ZOCA 3UJTH 1JHKL 4OD1H 4ALAH 4MNQA 4V1DA 4NZDA 2CRYA 1OQXA 5L7XH 1QYGH 5D2LA 5MHSD 1KT2B 5I0DA 2F8OA 2FZ3B 3QDJB 3HFMH 3OAYH 1J1XL 4QYOB 5ID1A 4RISL 4PRHB 1XF3B 4KROD 4BELD 3LKNA 3GZKA 2P5WA 3IFNL 1HZHH 1YPZE 3MRCA 3JWOH 4PG9A 3VRLF 3ZL4H 4LKCB 4XP4L 5I1EL 3TWCL 4NO5A 3T1WA 2EDQA 4LKXA 1OW0C 1LO4H 1TIUA 4BZ1H 4GXVH 3WYRA 2YMXH 3UC0H 3CFBA 5IMKA 3G9AB 1ACZA 3VXUB 1EVTC 2VLMD 3RWHB 2Q1EA 3N1GC 4ORGB 5C0RH 2YD8A 4KROB 1IGJB 5FYLH 3LEVL 2YC1B 4PRNB 1M7XA 3LRGA 4JDVB 4RCAA 4L3EE 1IM3B 3TBWB 3PDOB 4HJJL 5BV7H 1QBMH 3ARFA 4UOW0 4KGJA 5B8CB 4Q9BA 4MA8L 4DUXA 4YAQA 5T3XE 5KW9L 2DQDH 4QOKB 2YD2A 4NDMB 1D9KA 3TO2A 5L6YH 4PRDA 5JW5A 1A6PA 4BYHA 3RL2A 3IFLL 2NR6C 5FKAB 3RIFF 32C2A 3N1PC 4N8CH 1UFUA 5IVOA 5D2LB 2GHWB 7FABH 1KB5A 1L7TH 3OB0K 4PRIB 1YEKH 3MGTB 2IAMC 5D6CB 1KPRB 4P3DA 3QIBC 4B7IA 2EE9A 1K3ZA 1FZKA 3SGKA 2BMKA 4F37K 1WBXA 4OB5H 1I1AB 3ROOA 4DW2H 5HPOA 1D5XB 2YD1A 4JFDA 3ULUE 1ZHNB 2H32H 1PW3A 1AGEA 5MERB 3WDIA 2AXJA 4R26L 1MCDA 1GC1C 2BC4A 2X4NB 4HXAL 3QIWC 5HHXL 3BKJL 4NO2B 5A16B 4XNZC 1GC1L 1Z5LB 5GGUA 4KWUA 2ZCKL 5EU7C 2R1WB 1YEGL 4BFGA 5CD5D 1P4BL 4Q9QH 4LAQL 2WP3T 4U2ZA 4FQPA 2DQJL 1E4KA 1RZJC 3LHPL 2AJSH 4PJHA 4GKNA 1VB9A 3ALPA 5JLZA 1S9WB 2VLLA 4MJIE 1RZJL 3IXAA 1SVCP 2AK1H 5SV4A 3IRPX 2RBLA 3QIUC 4PJ8D 1MHEB 4X99A 4HWBA 4WI9A 3TO2B 3GM0A 3GMPA 4PRDB 5GGTL 1CDGA 1F4AA 4K3JL 3WXVL 5L6YL 1S5IL 1FFNA 5KVGL 1ONQB 1M6OB 3HHRB 5E1AA 1K6QL 5IW1B 1U41A 2DLTA 3U30C 1T04B 5A3ID 1CD1B 5HDBE 3RGHA 1WK0A 1T6WA 1OSPH 3IDJA 4ERSL 4PJFE 3QUYD 1FL5B 4RMQA 5I16A 1RUKH 5D93B 5EO0A 4PY7A 4DZBA 4L4TA 4CGTA 1MCPH 3EIFA 5D1QC 2XZQH 1VPOL 4JZJB 1AGEB 3EW3B 4XX1E 4RA3A 3WHXA 3MV01 3ZKNC 1YNLH 4Y4HA 5ETUA 4P3CH 3B9DA 5T1KD 4I77L 1T1WA 5FXCH 5JHDD 4TSCH 5I30L 4U1MB 4MA3A 1DSFL 1NBZA 1X5YA 2CLRB 5DZNA 5J13B 1S8DB 2YZ1A 2AABH 4L8DA 4K7PL 3HMXL 2QQLH 1D5MA 4YLQT 3TV3L 3BWUC 3KNBA 3EDDA 4JY6A 4LCCA 1H3PH 3SDXB 1WGOA 1U6AL 3UYPA 5JZ7C 4GKNB 1RZFL 3GI8L 3ARRA 4NHUA 5JLZB 4QEGA 1BJ1J 4OFPA 4HV8B 1BJ1H 3DUSB 3GK8L 2VR5A 2AXGB 3T0BA 4NQXB 4X6DE 4PRAB 4TYUA 5CFHA 3ZKMD 1U92A 4EIGB 1F6AB 4UT9H 4PIRF 1A1MA 4WHCA 2BVQB 3TN0A 3HAEG 1AC6A 3Q6GH 3V5KA 4FQJL 3WSQH 4M7ZC 1AKJD 3B43A 4MAYC 1AD9A 3UTSE 3N06B 2B5IB 4DQOL 3VA2C 2AW2A 3A0OA 4PGZA 3DRQB 3H0TA 3SBWA 3SPVB 5GZNC 3M17A 5B38G 4I18C 3IDJB 1OGAD 1ZAGA 3LSOA 3RX7A 3DV6A 3NACH 2EH8H 4DZBB 3WJJC 4MNGA 1MI5A 3EYOA 1FNHA 4LLDB 3SGJC 5C07A 1ORSB 4YXHH 1A14L 4DVRH 4RWYH 5FK9B 4QRRA 3NCCB 4Y19A 2W65A 4KK9C 2XZAL 3JBG7 1PG7X 5DYOA 4XMPL 1IC1A 1RJLA 4HGKC 1RUMH 5JW3H 1BQSA 1NBZB 4KHXH 1FNEB 1ZA3A 4BQ8A 2MTPA 4OM0H 1OGAB 2GJZB 3MFFB 4Y4KD 5K59F 1PD6A 1NKOA 5MEND 1C08A 1RZ8B 3B2UC 5E94A 2E6PA 4ZD3L 3PV6B 5DJ0A 1JHLH 1S7XA 1S7UA 3SJVA 5FUCC 3KHQA 4TTDD 5FOBA 1LEIA 5DJ8B 2A73B 1T7XA 3OKYA 1FNLA 1C1EH 1EV2E 4F9PC 5SWQB 2M26A 2WQRA 3D69B 2APVA 3MUJA 2LU4A 2ZUUA 1ZHBB 5J6HA 1AD9B 2IJ0C 1S9YB 4CN1A 4U6YB 5MENB 3QJFB 5BRZA 4LDOB 3HI5H 3LSOB 5ESQB 1DFBH 1EHNA 3LDBB 3NIFF 4K3DL 5FHBL 1PFCA 3GSNB 4L4JA 1MI5B 2ITDA 2ZWLT 5F7HA 3MA9L 5GZOC 2VDKL 4HIHA 4YGAB 3FJTA 4Y4FD 1W0YT 3K4AA 1QBLH 2EDEA 4JPVL 3TBVA 1JPFA 3OL2A 1IKNA 1I9RH 1HSBA 2WIIB 3UAJD 4M7KL 43CAA 1UACL 1ZHLB 4CVUA 1TQBB 3A6BH 5EPMB 4EN3A 2HWZH 1B4RA 2GK0A 2J6EH 4OF6A 3T4AA 1I9JH 3RWGB 4GUPB 1NGZA 3DO7A 1DDHB 4FQQB 3WUWG 3QI9C 5FYKD 2VXSH 3O9WC 1JNHB 1HYSC 5LCVH 4OD1L 1M7IA 3CVHB 5CIPA 1V7ML 3RDTC 3GO1H 5F93C 1BFSA 2ATKA 4JE4B 4GAYB 3N50A 3STZB 3TYFA 3W2DH 1KJ3L 4HUMB 4U1GB 1UC6A 3KYKL 2Q6WA 2I24N 3HAEB 1A6VH 5EB9A 5GS1B 1Q9KA 4CMHB 2BX5A 1EUUA 3NA4A 1TQCB 2R1YA 1P7KA 4HZLB 5F7DB 1T20A 2IBBA 4LNRA 3SOBH 4G8GE 3CMGA 2YR3A 2Z8SA 4C57C 4M00A 1NUFA 2ITDB 4FNLL 3GI9H 5B38B 4ONHA 3IB4A 4G7YH 1MCWW 4UUJA 2J5LB 4U05A 2BNQE 2EC9U 3OKDA 4UNUA 3TBVB 3UC0L 3U46B 4H25B 2Y7QA 5GSRB 5C0CA 5CSZA 4P23C 2VLRE 2ADGA 3PIQA 3R4DA 4LPVA 1NGZB 3ARVA 1Q94A 1PEWA 1I3UA 5E8NA 3T04D 2HMIC 4JFEE 3O6FD 2XZZA 3C6SB 3X3GL 3D39E 4OCYH 4YX2H 1KCRH 4DGVL 3TJHC 3DIFA 5ACZA 4MA1B 4YE4L 1R24A 4X6CB 5DRZA 1G9NH 1PG7L 3D0VB 1JF5A 1I9EA 2R1YB 3QDGB 4JM2A 5FM5M 3PL6D 4MXVF 1OP3K 3MZGB 1HI6B 1CWVA 3Q5YA 4ZFZA 3RNKA 3O6FB 4RDQG 3MRBA 5GRZA 3WN5C 2FSEA 4YK4B 1J0JA 2FEEI 1KEGL 3BUYA 3OKDB 3BZEA 1ACYH 2A6DA 4NUJA 4PP1D 4LCWA 3LH2L 3OR7A 4GOSA 5BMFL 1JGDA 3H9HA 4WENB 1U3HB 4N0RA 1SEQH 5ICYA 3CD4A 1UZ6E 3B9KC 5CSZB 2GCYA 3F7VB 5ISZE 5IBLD 5I1KL 5J4MA 4PBXA 1ZLWK 4ODVH 3MRJA 4PGEB 2R56L 4OGXL 3UX9B 3ZDXE 5FCUH 3ZTNL 2J6EA 1CLZL 1YPZA 1KIRA 3QQ4B 1I8IB 2Z31C 1EEUA 2CXKA 2D7MA 3EOTH 5FGBC 3WUWB 4MVBD 4LLWB 4RX4D 3L5IA 3MRKA 5HI4C 3PWNA 3FOMA 1RZGB 1DVFA 1FZMB 1YJDL 3KR3L 4HGWA 1CXLA 1I1RA 2O5YL 2BNRD 3MV8A 5GJTH 2CKBH 1S7WA 1YMMA 1CGSL 1RV6X 3CX2A 1MFAL 3SQBA 2F5AH 5EU3A 4BFEA 4GKSA 2FBJH 4R96B 4RNRA 3AB0C 3G6JE 4ZS7L 4L3EA 1N6QH 4U6HB 2LAGB 3H3PH 2FLBT 5SWZD 2YK1L 5D9SB 5HYSA 3WE6A 4P3CL 3BZEB 4NUJB 5J56B 5E2TH 5JOPE 2HH0H 5F88B 3D3VD 1MCKA 3H9HB 1FO0H 1A0QH 4R3SA 2BNRB 1AGCA 4XRCA 4GRWF 5I66A 2QQLL 3OB8A 4MLSA 1B4JH 5CJBA 2XT1B 3DECA 5DK0B 5DJXA 3OG4B 4EDXA 4TUJB 4DK3A 1A2YB 4Z9KB 4I13B 5IHUH 3QG7H 5I18L 1L7IL 3DETD 4XX1G 1GZPB 4XAWL 5J9PA 4LRIA 5L9DH 1MAKA 1DCLA 4K9EC 3U0WL 4NNPH 4U4BA 1DEEB 4FXKB 4GAGH 3SGEH 1YEHH 3FT4A 3LQAC 3D3VB 1KJMB 4LCUA 5CLWA 2YHGA 2HKFH 3BGAA 1DQML 3HC0A 4JFFE 3CSYA 5T3XD 3LQAL 3EGSB 4JCMA 4HGWB 4K8RC 3W9DB 3WFBH 1G6RL 2V7HB 3SY0B 3CFIC 4Y16C 1YY9C 5HHMD 1NLBL 1VGEL 3MLRH 1T89C 4K8RL 5J11C 3VCLB 3DV4A 5F71A 1HE7A 4M7JL 1QACA 4JHZA 2D7QA 4DKAA 2QSCL 4OCXH 2XTJD 1MFCH 1JNLL 1SHMA 4PJXB 4L3EB 2FJFA 1Q72H 4WUUE 4MJIA 2D7TL 2DI7A 3F6IA 1JZ6A 4P46A 2P42B 1UEMA 1O7VA 4UINH 4D0DA 1SJHA 1EERB 4DTGH 4XP5H 1HSAB 4ZPTA 1MLBA 3VFVB 4DOHE 5I66B 4OM0L 3RIFK 4LMQI 1HQRA 5F9DC 5D70H 4JFXB 4ZS6C 1NC2D 4FFZL 1OAYL 1LE5A 2FX9L 1HWHB 4MS8D 2A38A 3QG6A 3EDKA 4PJFA 2BSED 4ISVB 2OS7A 5KSBE 2PN5A 3Q1SL 5TDOB 4H8WC 4X4YB 2CIIA 3QJHA 3HPJB 1OTTC 1T1YB 2DWDB 3GM8A 1UB5B 4I3RL 5CCKH 5INDB 5DD5L 3PABA 1G9MH 3NIGE 1G7QB 1LHZA 3ARTA 2G2RB 1ERNA 2VR4A 4WI8A 1NC2B 2DQTL 4N1CA 3LS5L 4YDKL 2CK0H 2H1PL 3ARUA 4L29A 4EVNB 3TBYA 4AMKH 3AS2A 5JNYB 1GGCH 1MF2L 2AJZA 2CKBA 1FJ1A 4LSSL 1OF2B 4HKBA 4UQ2B 1PY4A 1QLFA 4F33B 2OX5A 5JOFA 2NPLX 1QEWA 4X6DA 2JIXA 4ZG1A 5HYJA 4NRZA 4WWKC 3TPKA 2AEQL 4UQ3B 3ARYA 4UT6H 5I8OH 3LQMA 5HVGB 5C2BL 1A6UL 4N0YL 3U2SA 1N64H 1N59B 3BZDA 2VLKD 4YHMH 3AAZA 3UTSA 1FO0A 2X5PA 4YHIA 2WUBH 5FUCE 4I2XE 2JE8A 4MNHA 2HTLD 1QLEL 5T5NF 4NQDE 4RZCB 4MXQD 3VXOA 1KIUA 2IG2L 1VENA 2WWMC 4P59L 3F65A 2NZ9C 4RFNB 3FQWB 5J8OA 4QXTB 3QJHB 3MO1A 5CJXC 2B4CL 4I9WE 1EAPB 2FO4A 2PTTA 2OQJA 1S7VB 4MQTB 4NNYA 3PABB 1NMAH 1YQVL 4BKLA 1NFIB 4EQ2A 4JRYE 2HT4C 4QO1A 4N5ED 3RHWF 1I7ZB 1X5FA 1SYSA 2H41A 1EHLH 1E6OH 4HKBB 4X4XB 2R4SL 4NWTH 3PWPE 1R5WB 2OMBA 4APQA 3TT3H 1WLHA 1RZKC 5IF0B 2VQTA 3FN0L 4U1IB 5EIIA 1KCUL 2X70B 4QRPD 5DJ2B 3RNQA 3STBA 4HIJA 3T0VA 5HI5C 5C0AA 4GW4A 5INCA 4LAJH 4ENEC 4Z77A 3DTXA 4JFQB 5IR1B 4P49A 1T7WA 1A7BA 1IAOB 1IGTB 1TJGH 2CD0A 1V3LA 4CAGA 2GSIA 1L6ZA 2NNAB 2FATH 4GBXA 1M1SA 4P2RD 5LBSH 5ADPH 1HNGA 4NNXB 4KK5C 3QH3B 1P4LB 1HK6A 3P11H 4PD4K 4PRPA 5TDPA 4S2SA 2NY3D 4M93C 1MEXL 1U8NB 4KDVA 1B88A 1D5IH 4JZNB 3CFKB 2Z92A 2ZUQC 5I1JL 5E99L 4IRZL 3QEUA 3CFCH 3MO1B 2ZJSH 4ZTOH 1ROWA 1R3KA 4CVWA 1IQDA 2FO4B 3TPUA 3AS1A 3LY6A 5CZKA 3ZSTA 4KTEL 4RGNC 5AZEH 4OLXH 4UAOC 4XHJC 4P2RB 5GS0C 4YHOL 5KG9A 4X5WA 4U49A 3TIDA 5GS0L 2NY3B 2GFBB 1CZ8H 2GSGB 4G43A 4M1CD 1WFOA 3FB6B 1R3JB 1XZ0B 3VWJB 4DJMA 4TULH 5GXBB 4WV1B 2ZG2A 4GW5A 1ZHKA 4M5YL 1GOHA 3WIFA 5AWNH 5HHOD 4XNQB 3BWAB 1N5AB 5I1LB 1URLA 1XF1A 4JPWL 3PXHA 25C8H 3MOBH 5D7LD 5INCB 3IDXH 1YY8A 1AXTL 3TIEB 2QJDA 2X1OA 2OK0L 5L88H 4U31A 3D0LB 3ESVF 2VH5H 5H35A 1B0RA 1CCZA 4GG6A 2B7DT 2D03L 3QULA 2DWEA 4FXGA 5E6IC 2W0FB 3H9SA 3T2OA 3VXSE 1P2CA 4G8GA 1FYTE 1Q9WB 1XIWD 4JKMA 4HULB 3WL9B 5DJCA 4KGLA 5LQBL 1J1OH 1R3KB 2P8MB 4YWGH 4KZEH 1GYAA 5CBAA 4LCIL 4NFDA 2JELL 4WU7A 3SDAA 1GIGH 2XI9A 2R8SH 1F8TL 4LASL 2I60H 3T09A 5C0NC 4FQLL 3DXAD 5DEFA 4HPOL 3TGXA 1SYVB 3ME0A 2IBGA 5IB5A 4KDWA 4OLYL 2K3TA 4XB7A 4G8FA 4F2MB 1EZVX 2AV1A 1BVKA 3RUGB 1U8MA 1X5HA 1XIWB 3DX9B 1UCBH 4RSVA 3DMMD 1CD0A 3MGOA 4GW5B 1XGTA 5CINH 2NY5C 2YKLH 2HJFA 4GW1A 2CDEA 4JFEA 4PJ5D 4B41A 1W2KT 3DXAB 3FTGB 4LSQH 3D39A 5F44A 1TPXB 3NPZB 4XPTL 5D2LF 2NY6D 1HHHA 2BNQD 1M71B 5GGVH 1UM5H 3V95A 3BZ4A 3RA7H 4N90D 1RURL 5I1CL 1A21A 2E8YA 3DMMB 5CILL 1FORL 2ZUYA 4KQ3H 2EIZA 1EMTH 1KPVA 3NA9L 5JIPA 4BFBD 1NBVL 3S7GA 4XMLL 1OW0A 4A6YL 4XCYB 2OI9B 4PJ5B 1NCDL 5EN2A 4MX7B 5CBAB 5DFVD 1U8QA 1AFVL 2LVCA 3VFPB 2NY6B 2BNQB 5EUKB 1IAKA 3UTTE 1UYWH 4NZRH 1U8HA 2G60H 3MROA 4GO6B 5GJSH 1H8SA 2MHAA 1AD0A 2IAND 4O5LH 4ZUTB 5MEOB 5IG7B 5L2KA 1KN4H 5ISZA 1U3JA 1P6AB 3WNMA 2VLRB 4BSVB 3HLAB 3MGOB 1KFAL 4ZUWB 5I1HL 4XNXH 1F00I 4QY8A 5BZDA 1YEFH 1YEIL 4X6BA 3FFDA 2C7UB 3IF1A 5FYJH 3K3QA 3I02B 4AIZB 2FR4A 4G5ZL 3NCJL 5DDHA 4MDJB 4YO0A 3OR6A 3ZTJG 5C0BA 4Z18A 3W9EA 5IB2A 5ITFA 3SKUD 2IANB 2OJEB 1I7RB 2IAMA 2VDNL 3HNSL 2NX5E 2CIKA 2VZ3A 1NPUA 3WD5H 3QIBA 3LS4H 3ALWA 5HTSA 3CUPB 3HN3A 4JFZL 2EC9T 1CFNB 2V2XA 1BIHA 4LCYB 3GSOA 4YBLB 1JPGB 1FRGH 4D9RD 5DQJA 1UCTA 3HZKA 2QHRH 1PAMA 3QIWA 4WEUD 1H3TA 3BPOB 2ZG3A 4KTYA 2J4WH 1G9ML 5DS8B 2X6MA 5I1GH 4Z0BL 3Q0HA 1H15B 5GIRB 2I26N 4OCRH 4AMKL 1B6UA 3SDXF 1P84K 3IETB 2VERN 1GGCL 4Z5RB 1TXKA 2FH6A 5KS9B 1YECH 2P7TA 4HFWB 4UV7L 5EU6D 1IGIL 5F6IC 2VR9A 5AZ2L 4HF5L 4N9OB 2EIEA 3KJ6L 3QIUA 3FFDB 4JQIL 1UGNA 3VW3L 1NMBL 2A77L 1HKLH 2G5RA 3FHAA 1BF2A 1ZXQA 2QR0A 4JQVC 4N0CC 5E8PA 3VXRA 5FUZL 3L5XL 2Q8AH 3X13A 5CBEB 3MLVL 5DDHB 3HE7A 4GRLC 4UT6L 3RVVD 1JIBA 1X4ZA 3SO5A 4YHML 4D0BA 3VFUB 1UQSB 3CNKA 4Y2DC 3JTSA 1A9EB 1B0GA 2UWEA 3VXMD 3KPRE 5EU6B 1TFHA 1W0VB 3BJ91 4YPGA 1AGDB 2QQKH 4Y89A 1BX2A 12E8H 5D1QA 5LG1A 4X7SH 1INDH 2V2XB 2ZP0T 3G6JB 5D1ZC 4MQSB 2BVPB 4KI5F 5L2JB 1FQ9C 3MRNB 3QPQC 1FVCB 4WUUA 3HZKB 1EO5A 4Z8FL 3HE6D 4HDIA 4MQXC 3SDYL 4I3GA 3WHE1 3WJLC 1E4XI 5TGBA 2XG4A 3NCFB 3KLSA 2HFGL 1NANI 3ULVC 4JFYA 4JREB 1RIHH 1Y6NR 1KACB 3F5WA 3ULVL 1KELH 1MCWM 2VITB 3O8XC 4YGVB 4KRNA 1NBYB 4L3CB 2CGRL 3OKLA 1EPFA 1HHKB 3W82A 3OF6A 5HXMA 1K85A 5KSBA 1YNTA 2HJKA 3FQRB 5IJVB 4HIEB 1OM3H 5TDNA 5GRJH 2VC2H 1CFSB 1ZT1B 3X13B 5I76A 3LKRB 1TZGH 5ANME 4JFFB 2YXFA 3CMOH 4QRUB 3BGMA 1F97A 1KLUB 5CHNA 2DDQH 5FA4A 3T3MF 1NAMH 4LHQB 2K7PA 1CL7I 4I18A 4XT1C 4G6MH 2Y23A 3D18A 4HPYH 1JI1A 3PDDA 4V1DD 3WJJA 3BI9X 1A6ZB 2B2XL 3SGJA 4QWWC 3I6KA 4GMTL 2H2SD 3P77B 2V2TA 3BX7C 1INEL 1FG2A 4OFYD 4TOYL 5D96C 1NSNL 5E5MA 4LIQE 4XWOD 4W81A 4L4VE 4OLXL 1K9TA 4NN6C 3I85A 3NTCL 3X11A 3GRWH 1N3NB 1FBIH 3QUZA 3UZEA 4JFYB 2EKJA 3F5WB 4KV5F 1YC8A 3BPNB 1E4JA 4I2XA 1EA9C 4EBQL 2ERJB 3ZDYE 1XH3A 2PO6D 1KPUA 2XXMB 4PLJC 4ODWA 4NQDA 4CNIB 4F9PA 2E27H 1JL8A 3CXHJ 1QSFA 1QFOA 4YHNA 3IJYA 4ZUSB 3V52L 3MREB 3BH8A 2V7NA 2JCCB 5DHYA 1F3JA 3VD5A 1AY1H 3C08H 2ZUXA 3MRHB 1GH7A 2DM2A 1UA6L 4JRYA 1REIA 3UJIL 4KAQH 1D9KD 1XGPB 4MDIA 4ODUB 1YYML 1OP5K 3V0VA 1EX0A 5GRVL 3RTQC 1A7NH 5E7FA 4ODHH 1BWWA 2CRZA 3RWEA 5IKCA 1EFQA 3FOLB 4PG2C 1K3IA 5I8CA 2ED7A 2Z4QA 1IAIH 5K9QI 3PWPA 1IQWL 4YEEA 1BM3H 3RKPA 3Q2CA 4G7VL 2Z8VC 2R8SL 3P4OB 2A83B 3V6BR 3SDCC 4DKDC 1M7DB 1SBSL 4MXWH 3K4ZA 3QUZB 4U6TA 4PJ9C 4R8WH 2YUZA 3ARXA 2MPAH 5DC4B 2WM0A 1G7MA 4Z76A 1RVFH 5DJDB 4MCYB 4LF3B 3SKNA 3TA3D 4ZFGH 1F4YL 1W8NA 3GSWA 3CLFL 1YN7B 4ODWB 2DB8A 1FDLL 4OLZL 5F1SA 2QHLA 3O9WA 4JY5H 4ZUVB 4G6JL 1RZIA 2DIJA 3IJYB 5FUOL 1LO5B 2HLAA 3RDTA 2YN5A 4LLVB 1F3JB 3S4SA 1NLDL 4PB9H 1JN6B 3FT2B 3MOAH 3GBMH 1NCBL 3C5JB 3TA3B 2ARJA 5ID0A 1X7QA 2GTWA 1HIMH 3EOBA 5CSGA 3MRPB 3SKOA 5AAMA 3RWEB 4OI8A 5AEAA 3CSGA 4ZOBA 4K94C 1F5WA 5HVWA 2YA0A 2A1WL 1NQBA 3MODH 1QPPA 1LK3H 5ICZA 4LVOB 2NW2A 1BFVH 5TPWH 5CKGA 2HRPL 4F8QA 3DUUB 3R1GH 4CVZB 4NSKB 4NZJA 1MCEA 1T2QH 3PQYE 4XCCL 1JK8B 4KY1H 5JUEH 2DQIH 1J12A 2DBLH 5T33H 3PHOB 3BT2L 1EJOH 2RR3A 1QLRA 2CRMA 1WZ1H 1Q38A 1U9KA 5CZVL 1FN4A 1P6FA 3SKNB 4K9EH 1BD2D 5FF6A 3GRWA 5DSCA 1XF4B 4RFEA 3RY4A 5HSFA 5CJQH 2H8PA 3PGCA 5D7KE 3VMOA 4UIKL 5K9OA 4ZDHA 3PP4L 1X5LA 3SDDD 3VXSA 2V17L 4MB3A 4QHUB 1UWEH 4S1SH 1FYTA 3B4NA 3VG9C 4H0IA 4NM4L 2QADB 3L3IB 1I3GH 4P9MH 4QKXB 5FYLD 4J2XA 3VGHA 1HHJA 3DYMA 1BD2B 2VXUH 5DD3H 3P0VH 3CDFA 4JPKL 1H0DA 2NW3A 4JM2F 3DURB 3QCTL 1H9VA 5SWSE 1T6VN 4V2BA 3KPSD 3C5ZC 3MMEA 1EIBA 2IFFL 4LGRB 1JRHI 4LLYB 5K33A 2EDKA 5D7JC 5LGHL 5E7BA 1CGYA 3WN5A 5ICZB 1WITA 2JF1A 3M07A 1RIUH 4D3CL 1AHWB 3C87A 3K8MA 1C12B 2AQ2A 1WV7T 5CWSB 2IH1B 3JWDH 3K8LA 4OI7A 2Q76A 1QSEE 1JZ3A 3B9KA 4XP9L 4O02H 1NFDE 5F9OH 2XYCA 4J3SA 4WIQA 3EJZD 1EO8L 4RFEB 1FL3A 4XWGL 4QRRD 4Y19D 1DBKL 3U7AA 4H8WH 4RMRA 3PGCB 4TNWK 1V7NH 4ZDHB 1NL0L 4PJDB 4FABH 3FMGL 3GBNL 4R9HA 3N9GL 4L1DA 1YEEL 1YPZF 4DKFH 2RB8A 4J4PC 3U7YL 4JKLA 2H6PB 1J5OL 4NRYA 2EH7H 5FGBA 4L8CB 4XPAL 1ZGLA 1CF8L 2IADB 2C26A 3S3SA 5D2NC 4PJAB 4JG1L 3FKUS 4FFYH 1Z0MA 5LGJB 5EZIL 2HN7A 5EIVA 4AT6B 3A6OA 2JK5B 1HHIB 5IFHL 2BVTA 4ZQKB 3UTTA 3BKYH 2BDNL 4MZ2A 2DQHL 1WF5A 4L8SB 3QRGL 2H32B 2CRIA 3CX5K 2BSRA 4XI5D 4WEBL 3S36H 2P24A 3TM6A 5BRZD 1WT5C 2WZPD 3DO3A 5K9KB 5IEHB 1EDQA 7CGTA 4RDQF 4HKZB 3VH8A 1JTTA 2NYYD 3WO4B 3EUUA 3PGDA 4JFOA 4UOJA 1X5AA 4WNQA 1YYLH 3AFLA 4KXZH 4F7CB 2NX5A 3O2WL 1FIEA 1H3UA 2AGJH 5EOCJ 1YZZA 5EOCH 1DQJB 4J3WA 2ZPKL 4PJBA 5F9WB 3RU8L 3S88H 1XGQA 3G5ZA 5I1AB 5TE7H 5ITBH 3O4OB 4U1KB 5SX5K 2ARWA 5F1IA 4LIQH 3ULUF 2EYSB 4RGMC 4EN3D 2CMRH 4NHCH 1ITCA 3FT3A 1DANU 4Y16A 2VDRH 2B1AH 3MNVB 4KKAC 3W0WE 2VZOA 1T89A 4F80A 3DYOA 4HHAA 1OAKH 5F9AC 2P1YA 1HYRC 2EDXA 1RZKH 4HIIA 3G08A 5D6DC 2OSLA 3T3PE 1RK0A 4U1NA 4PGBB 3WS3A 2C1PB 4W4NA 3U4BL 4B5EA 3MV7E 1GZQA 3T0EC 4KKNA 4BH7A 1VFBA 4Q9CA 4TPRH 6FABH 1J1PH 1BLNB 3NN8A 3OV6A 3BIAX 4HUVB 3AREC 5I0ZA 1IGCH 4X9HA 5IB4A 4YR6A 2A6JA 4QRTA 3BVNB 4FQ1H 3PHQB 1SY6L 2GI7A 3ULVE 2GTZA 3KWWB 4X8JA 5J1AB 2J8UB 4XVUD 1XGUB 3REWA 2K7QA 4FQXD 3NBNA 5KVDH 1U8OB 3CJJA 1AO7A 4NKOB 3FRPA 1BQHG 4LFHD 3K4DA 2LU3A 3KPRA 4HWUA 2XV6B 1T2XA 3BP4B 4PY8J 1TVHA 2NXZC 1IEBA 1MQKH 1MUJA 3FQUB 4PJCE 5JR1L 5C0CD 43C9A 1G6RB 1R5VB 5HPMB 2DMKA 1VHPA 4G9FD 3HUJE 4BSWA 3FT3B 3WFCL 3JV4A 2FYYA 3O6LL 1FE8L 4M5ZL 4FQXB 3WXWH 5HYEA 3TVMC 5D7IA 4KRMB 5FDYA 4M6NL 2HFEA 1MHHA 3QDHA 4LSRL 1ZTXH 2DN7A 1XCQB 4O4YL 4ODHL 1XGRA 3QA3B 2CDFB 1C16B 3RVWC 3ZHDA 4ZYKA 1KOAA 3D2UD 5GGRA 3I2CL 3CIQA 2AKRA 4ELKA 4G9FB 2XWTA 4X6DF 4LARH 4W4OC 1PZ5A 4WWKA 4YR6B 5DVOA 8CGTA 5AUMB 2R0LH 5ADOH 3OXRA 3DGGB 5ANMA 1JBJA 5I8KH 3WIHH 4B53A 3U79A 1OGTA 5CJ5A 3T0XA 1U8JA 2R2EB 3D2UB 3OGCA 3RVUD 5HDOA 4KKCD 2PXYB 1U93B 2XG5A 1KLFA 2Z93A 1N2RA 5L0QC 2VQ1B 4JRXE 5E8DH 5BXFA 2APFA 4M43L 5DHVA 5CJXA 1BQHA 1CR9H 2AV7A 1YEJH 4G3YH 1R6VA 2P8PB 5JA9A 1S3KL 2X4TA 3NZ8A 2E7MA 4Z0XB 2NLJB 5IESL 1JWMA 4HCRH 4P99A 4TNVF 1MHHB 3H7BA 3NABL 1M4KA 3HNTL 1RQ5A 1K8IB 1TZIA 5DJ6B 4ONFH 2M2DA 2NY5H 1PSKH 4NRXA 1WCBA 4LQFL 1QD0A 2AKRB 2WMPA 4HXBH 4OTXH 1RD6A 2XFXB 3MV8D 3D87B 4LRNH 3F62A 5F8QC 3QUMH 1Z3GH 4KUZL 4P2OB 2R2HA 3EHBC 3LPGA 3U0TA 4PLNC 1CG9B 4GS7B 4E41E 4IIQC 5C0JB 5D1XD 1EJOL 3LQZB 4Z95H 3M8OL 2AI0L 3FQXA 1VDGA 1PZUB 2VDOL 3VXQB 4YC2C 5JO5A 1ZLWH 4FP8L 1RZ7H 1IGFL 1DE4B 3EYUH 4XBEL 5C09E 2XY1A 1CI5A 4LEXH 1AIFB 1CFTA 4NO0D 1BQHB 3ILQC 4UT7L 1F3RB 2BERA 1M05B 4JHAH 3VI3E 4NN7B 2FHCA 4P9ML 3IDGB 4RAVA 3NGBC 4L4VB 3ZO0A 2N7AA 1UZ8A 5IK3A 2ICEB 1G7IA 1AP2A 2VLJE 1T5WB 4YHYC 2IPTL 2VZSA 3SE8H 3MNWA 4G8IA 1W0WB 4NO0B 4ZAKB 4I0PC 4HKXB 5EIQA 3O45A 4OLWH 3DWTA 3VFTA 2BXZA 1A4KB 3RL1A 3GJFH 2VDPL 1EBPA 4R4BB 4TQEL 4EDWL 5ALCH 4X7CC 5BO1L 2CLVA 2GUOB 3RWJA 3C8HA 1EEZB 3EFFA 5D7SL 1IM9D 5DUBA 2RHEA 5E6IA 3BGFC 1IKFH 1NEZA 4XBGB 3KS0J 1C5CH 2EDTA 3IAQA 3K8KA 3KS0H 3VFNB 3WIHA 4UDUB 4AM0A 5CEYB 1D6EB 1JGLL 4HBQA 3BAEL 3F6LA 2IGFH 1RHFA 5HI3D 3KPMA 3C09B 4X98B 1TTUA 4GAJH 4M3JA 4POYA 1TVDA 1R0AH 3MC0A 5GRUL 1JJUA 3L95A 3GMQB 1OD7A 3FO1B 4JAMB 3SQOH 1UVQA 1ZSDB 3KPOB 1WZLA 3HRZB 1GPOL 3LN4B 3BKYL 4CVXA 4ZXBD 2ZOLA 2ESVE 1W72H 1G7IB 1QRNA 3CDGA 1T5XA 1BVLA 2DTMH 4J8RB 1A7PH 2EKSB 5IVXE 3X14A 3GIVA 2GY5A 4JO4H 2O93L 2VO5A 3VFTB 4OM1L 1KCSL 1T3FA 1QUNA 2XXCB 3PE9A 5FM8A 4OKVA 4UILL 1BGXL 1F6LL 5T5FH 3VG0L 3VDBA 4MJ6A 2CLVB 4XMKL 3RWJB 1QTYT 1EFXA 5EG6C 3QUMA 3RGVC 3WIIL 5F96H 4ZXBB 1HCVA 2OM5A 1A7RH 3P2TA 3TH2T 4OBRA 5JPMA 1E4WH 3SE9H 3IRZA 3VXNA 3GKWH 2AGJL 2HP4A 4WHDA 5HYJD 4A6YA 5KTEL 4IHOA 4GMSH 3GMLA 4LLUB 4I48A 3LD8B 3PWVB 4OAWB 1CK0L 5ICXA 3RWDA 1N0LA 1S7QA 3FO2B 2W91A 5DJYB 2MMXA 1R5IA 5D2NE 1ITBB 4WEMB 3D25A 4DN3L 1GOFA 3IGAA 4LLQB 5DZLA 3L95B 3HI1A 1C5DA 4M1GH 3OJDA 4NHCL 5DJAB 1CICD 5C6TL 2P44B 1OAQH 1CDYA 1NAKH 5AG8A 4DVBB 1ZANL 3PQYB 1CQYA 5CGTA 3AM8C 1JF6A 3H3BC 4JN2A 1WC7B 1J05B 1J10A 1T5XB 4WU5A 1JYVA 1UZ6F 2FLRT 3IFPB 3NFNA 3G6DL 1BZ9B 2X2YA 3P0YH 1JHTB 4IS6B 1LQSR 1OAUH 5I19H 4X6EB 5I75B 4KROC 5B22A 1BPVA 2NY0D 4C56E 2AJ3A 1CICB 1JPTL 1QFWI 5C8JA 2G9HA 1IARB 5KVFL 3CCHA 3S34H 3U1SH 1ED3A 1A3LL 5B8CC 1DQQA 3GJFA 3BSZL 3EO1A 1P9MC 4APQD 3L3GB 2R23B 5DVMA 4JKPL 1VESA 3BMVA 1SMAA 3ZE1E 1K5NA 1Z9MA 1MJ8L 1MHPH 1LO3H 4A6YB 3T8XB 2Y6SC 1HH9A 1F90H 1YEDB 2AJXL 5C0AD 4F7MA 5SWSB 5DMYA 5ICXB 2X4SB 3G6JF 3P9WB 5KAQG 1P7QA 4HLZG 4BA8A 1C5DB 3OJDB 2G75B 5GS2H 3O3UN 4Y1AE 3E1F1 1JYWA 2F53E 4NKQB 1I1AC 4PRPD 3VFGL 4XTRD 3FO0H 3SKJH 5JOEA 4PGCB 1VFOA 4KRPD 4Q2ZB 4C83A 4PTUA 1QSEB 4JO1L 5LKNA 5C0IB 3SCMD 4WUKH 3VU2A 1ZTXL 1NFDB 5JMRA 4HUUB 3RIAF 4Z7QE 3ARGD 1DBMH 1SJEB 1MNUH 3IXTB 3I6GA 2R9HD 4PGDB 1XR9A 3OKNB 5KSUB 3EDJA 1GGIH 3REVB 4QGTA 1JZ4A 3A6CL 4NM8L 3KPPB 1F4XH 3TBTA 3QDMD 3O3AA 4JQVA 4X6FB 2F54A 4WGWB 4EI6B 4GRLA 4KRPB 1AR2A 4RGOH 2R0LL 1RUPL 3I3EA 5C0GA 1C8PA 4UTBH 3SCMB 5TH2B 4Y2DA 1WIPA 3TESA 4F7PB 4QRSA 2R1XA 3IFOA 3FN9A 1KJVB 1A47A 1VFMA 2YPKA 3ARGB 3ES6A 3O3DB 1NMCB 4JKWA 4QTIH 5CD5C 5CD3B 2YPLE 3QDMB 5HHVH 4F7TB 5IV2B 5IUSA 3MV7A 3GGWB 5LAXA 3GIZL 1JPSL 1MRCH 5D93C 2YPVL 4MMZC 2VQUA 4C54A 3WJLA 1TCMA 1CBVL 5EZOL 4JZJC 5F1OB 4PTUB 1WBYB 4XXDB 1G6VK 4M3KB 1A4JB 4JGUA 4HCRL 3BW9B 2Q7NA 2DLFH 4NJAH 4PPTA 2QL1A 4HG4J 1S9VA 3DBXA 4F7EA 4M9PA 5A3IC 4FZ8L 1G7LA 2X4QA 3T65A 3O8XA 3QRFM 1RMFH 5J13C 4XP1H 3DVFA 4OUOA 4XC3L 3FO9A 3GMNB 5EU5B 3VGFA 3MLZH 2FGZA 1MAMH 4PJCA 3QEQA 1OCWL 4OZHE 1XF5A 2P48B 5E95B 1F4WL 2BVOB 2NTSP 1AQKL 3HUJA 2W9LA 1T21A 5GGQH 1K8DB 2A6KA 4H1LG 3W0WB 3J8F7 3MJ9H 3NIGF 5BS0E 5DTFB 4K94H 1G7JA 2A9MH 3ES6B 4FTVE 5TF1H 4J1UB 2X7LA 2ZSWB 4JY4B 1PQZA 4X9GA 2WBJA 5CJOH 3VA6A 5IWLA 1FVDB 3QFJD 2B5IC 3VE0A 5DD6A 5IW6B 3F7QA 5K9JH 5LAXB 5BVJA 4R7NA 1OARH 4UTAL 3N85H 1JGUH 1TZHA 4K23H 3U48A 4OLUL 3LZFL 3I9GL 4H26B 4RMTA 2EYTA 3L5WB 1IEHA 2FX8H 3QFJB 2PR4L 3VDAA 1OWRM 3D9AL 1JYXA 5TQ0L 4JN1L 3L6FA 2HT2C 3O6KL 3CDYA 4X9IA 3BE1H 2XN9D 4G8EB 5ABDE 3MCLL 5HVHB 2FD6H 4XZUA 2DLEA 4JRXA 4PUBL 5HHNA 1UM6H 4QF1B 1HINH 2OR7A 3WLBA 1DANT 2BCKA 4DGYH 4W68A 3MJ7A 4HC1L 4LP5A 1B2WL 5L2KD 3T1FA 3IU3B 4S1QL 4U6XA 4KVCL 3T2NH 1OAXL 5FO7B 1UB6B 4N68A 3QXVA 5E9DA 1UM4L 3JSSA 2FRGP 3UTZA 4K7FA 4XAKE 5GHWL 3P4MB 3CH1A 3RTQA 2XN9B 2FL5A 2WBJB 2NR6D 3KYOB 3V5HB 4PLKD 4PG2A 3BQUB 3SBWC 1DJSA 2DKUA 4LSPH 2HVJA 5MEPB 2X4UA 1ZVHA 2IAMD 1TZHB 3GB7A 3F58H 3LDBC 4WFED 4TTDC 3QIBD 4JG0H 2KKQA 4UU9B 1AGFB 3SDCA 3C5SA 4WHTA 4G80B 4KJWD 4PJIE 4PJ9A 3QCVL 1A7OH 4NQEE 4E41A 3OBAA 1W72L 3L7FA 3KXFD 1YA5A 3GUTA 4TSBL 5JPNA 1UWXK 3S35H 3NFPB 1DQDH 1N4XL 5M7QA 4F8TA 1NGWB 4AL8L 1U3ZA 2FB4H 5C09A 3S96B 3N1MC 3TNNB 3W39A 4GG8B 1TQBC 2D9CA 1Q9OA 4K7PY 5HHNB 2DQUL 4OF7A 1T0MA 3MCKA 1N0XL 1DBAH 5FKPA 1T1XB 5E2WL 3BKCH 1MREL 2XZCH 1A7RL 1PEZA 2FIRT 4F9LA 3OKOA 3KXFB 1KIPA 2AK4A 2BSTA 2VL5B 3QIUD 5JXEA 3TT1H 1UWGL 1UXWA 1A5FL 1GGBH 5JXAH 5TE6H 3UTZB 4JHWL 1YN6A 3G5VB 3TZVA 3B3IB 4H1LB 2QQNL 2DM4A 3LN9A 3MLYL 4U1GC 3TYGL 1BEYL 3SE3C 4PREA 1DLHB 1OL0A 4CMHC 1TQCC 4LBEA 4MD0A 1T22B 4ODXA 3MXVL 4XVJH 3ZKXB 3P73A 3L7EB 1LVEA 5ELIA 2XTLA 2EDDA 2ED8A 3HC3L 1UADC 3MRRB 4M8QB 3RVTC 3UTPD 2EEBA 3G5YB 4AQOA 4OCWL 4IM8A 4L5FH 2J5LC 5EFIA 5T1DH 5F89A 3G5XA 3L7FB 4J3VA 3GUTB 3BRGC 2P8LA 2N7BA 1VERA 5JPNB 3NAAL 4CU7A 3P4NA 5IFAH 2PYED 4LEOA 2C4FU 4H20L 5IT2L 1SMOA 2IPUG 2ICES 1WWAX 2VLJD 2Q3AA 4ODTL 1HEZA 2VISB 2BHYA 5IFJA 1KGCD 4ETYA 3IVKA 3HC4L 4ONGL 3MFGB 3S34L 2VDLH 3RZCB 3MRGA 4UNVA 3RPKA 1JTOA 4YH6A 4NOFA 4FOMA 4Y5VB 3O2DL 4YFDB 5IVZA 2BSTB 1UXWB 2WINB 4CMMA 1FGNH 1KN2H 2H2PC 4LPYA 2PYEB 1MJJB 4PV9A 5DMGC 4OIIL 3BP6B 3BYTA 2KPNA 3V5DB 2I5YL 1C5BH 1VEOA 1FLRH 4MA1C 2ESVA 3C5ZA 1TDQA 2VLJB 1PLGL 2DQGL 1VACA 3ARPA 5D7JA 4MAYD 3DRTA 5FYJD 3CFJA 4NGHL 4PREB 4U0QB 4MSWA 3VRJB 4PRHE 5CLTA 4BJLA 5IVXA 3MACH 2MNUA 1E28A 5GZND 1EGJH 4KJYA 4OV5A 5KOVC 3OQ3B 1FHGA 1XCTB 4XXCC 4KMQA 3O41A 5EULV 3IJSB 4JM4L 3O6FC 5A2KH 5EFIB 3BPCB 4NPYB 3QWRD 4GRWH 5B4MC 5MHSE 4QHNA 1RHHB 4YK4C 1ORQA 2VIRA 3RP1A 2F9BT 4U6VL 4ORZC 1PKQA 1UKQA 2DJSA 3QXAA 4LEOB 4PTTB 3MXWL 4KK9D 5LWYH 1U3HC 1TCRA 1FZOA 2DD8L 4HWEL 1NGQH 3UROR 1MFDH 2B0SH 1H3WM 4P9HC 1JF1B 4S1RH 4J4PA 1I1YA 1HEZB 1P1ZA 3IVKB 3FB5A 1KJ2A 1XGYH 3B2UD 5I74B 1AC0A 3VXPA 3IYLW 5D2NA 3MYJA 5FHAL 1OP9A 4Q0XL 4UB0L 1EO7A 4ETQA 2IALA 5C86A 1WTLA 2IQ9L 4CMMB 2F15A 3RBGA 1A6AA 5EOTA 1HOCA 2VLME 4K3EH 3M1BA 3S35X 3UZVB 4RAHA 1KC5L 2LV4A 2XA8H 5CEZH 4O58H 5C9KA 4QTIL 1HKFA 4ODSH 3BIKA 3KLAA 4GQPH 4P5TB 3GMMA 5HJ3B 2CJUL 4LVEA 5IBLC 3DX7B 4JPIA 1WT5A 3MLSL 4I4WA 4Y88A 3QUKB 4F37F 3WFHA 4E42A 3PGFL 4OV5B 3RRQA 1BOYA 4NKDB 1IC4H 4C56A 1DP0A 1IEAB 2VWEE 3E3QE 4GKZA 3OKMB 3IU4H 4F15B 5GZOD 4LPWA 1LEGB 2DLFL 2J8UF 4MVBC 1GCFA 2EECA 1FG9C 1G7HB 1QR1A 3K74B 4XPGH 2A74A 2C1OA 2F58H 3KPNA 4KPHH 4XNYH 4XCFL 5HY9B 1MCNA 1CFVH 4DZ8A 4KZDH 4NWUL 3MBEB 4RMWA 2BFVL 5EBMB 4R7DA 1HHGA 3V6FB 1RFDH 4NYLA 5GGSA 4JDTH 2CDGA 5JQ6H 2HLFC 2UVEA 2F5BH 3BKMH 3VFMA 3OPZH 2W9EH 5ALBH 1EH9A 4WCYL 4Y1AA 3QI9D 3V4PL 1U91A 2IWGA 2F53A 4M6AA 5J1TC 3JV6B 1A6AB 3O9WD 2Z0BA 3RWFB 2BOCA 3BDYL 4RIRA 5D6DA 4EOWL 5BJTB 4XH2A 3TO4D 5TE4H 3MCG1 3PG2A 1DVFC 3RDTD 1U0QA 1VEPA 4M1DH 4QHKI 3QO0A 1RAMA 4R90H 3T0EA 1IAII 3BO8A 5C6WH 1TTGA 1MRDL 2P43B 4E42B 2VDML 3AREA 3DETC 2QBWA 1SY6A 1PYWB 4MA7H 4C56B 2Q86A 3CU1A 3H6JA 4NZUH 1B90A 1NFKA 2FEDC 3WNPA 4IOSD 5D5MB 2PCPA 1EGJA 1U8IA 5IOPA 4F58H 4XVTL 3FCTA 3TO4B 3MLUH 3U0PB 1L0YA 4OZGB 2H26A 5EA0H 4Q7DA 1HH6B 2EDWA 2A74B 4M48H 4IDJH 1S9XA 3WFDH 5BQ7A 4TUKL 2E7CA 4HS6B 4ZSOE 3MRLB 4XVSH 5GGSB 3OAZH 4FQ2L 3EOAB 5KVEH 4P23D 1NUDA 4KVNH 2WUCL 5DI8B 2R4RH 1FL6B 2W38A 2FX7L 4L1HA 5JHDE 3TVMA 1QBBA 3ULUC 5C7XL 1I9IH 3TEUA 1ZA6A 4WY7L 1TJHL 4CUCA 1L4IA 4POZC 2JJWA 4JR9L 2BZDA 3LKOA 5DD1H 5HDQL 1DUYA 5DR5L 3X12B 3FONB 4MLIA 2UYLB 4F3FB 3P9LB 4LU5L 2V2WA 4MS8C 1LNUA 4PV8A 3OKEA 4W4OA 3K80A 3NFSL 3BH9B 3F12A 3LEYL 4HUWB 4M03A 2BNUB 2R69L 3LKSA 1H3XA 1U8IB 1VEMA 3MLTB 3HPLB 4WWID 4YHKH 4O2EB 3MA7B 5D72L 5EC1A 5F9JA 4KTDH 2Q7YB 3TNMA 4TSAL 1O5DT 3V7AE 3DX6B 4XPFL 3S35L 1OGAE 5BQ7B 5I73B 3OSKA 1MJ7L 3U36A 4KQ4H 4QTHA 4XC1H 3VFSA 4Z78B 4OQTH 1FNSL 3KPQA 5DRXA 2FJGA 3V4UL 2YPLB 4QXUH 4KUCD 4OGYH 4KMTH 5EZJB 2FIKA 3W81A 1H5BB 4LHUA 3B6SA 1DQLL 5T1LB 35C8H 3SGDH 4PJEE 5CUSH 1JWSA 3O3EA 5F3BB 1JP5A 3HNVH 4RFNC 4JKKA 4OGAC 2W60A 5AD0B 2Z31D 1BOGB 4KKLD 4ZFOL 1IT9L 1KG0B 1S7SA 1A7QL 1DL7L 4LOUD 1WICA 5DT1L 4ELMB 5MENE 2FWOB 4S0TD 2W9DH 5HI4D 2ATPA 3OXSB 3O3BA 2A2QT 3R06B 4FTVD 3BMWA 5DVKA 3ZDYF 4IRJA 5C9JA 2R0KL 2CUMA 5TQ2H 4YDVB 5FA3B 1VKXA 2ZCLH 3GMOB 5KSAD 3KGRA 1Y0LB 5HGBA 4OZHB 2Z8WC 4IIQA 3U4EB 5IMLB 3Q6FA 2VKWA 1TJIH 1FAKT 1T80A 4K3HA 4DN4H 3HZMB 4RFOH 4QHLA 2AP2A 1G0XA 1A1NB 3OAUH 1H8OA 2VXVH 5BS0B 5HHPA 1JFQL 1I8KA 5HHQA 4NFCA 4FTVB 4Q9RH 1IL1B 3IS1X 3I50H 3RWCB 3UDWC 4N5EC 4NKIH 2KQMA 2NXYD 4RRPG 4PFEA 1SM3L 3KVQA 5DRXB 1CDUA 3LIZH 1GGYA 3DPBA 2ADFH 4Z7OE 5FO8A 3VGDA 1QPXA 4X5XB 2Y1VA 5E2VH 3QWOB 4UDTB 3DSFL 4O9HL 5KSAB 1YQ2A 3BRFA 3AGVA 3VFOA 5F6HI 4S0SD 5HYQB 1B0WA 3EYSH 3I75B 4NKMA 1P4IH 5E08H 3V0WL 4BSJA 4DKEH 5DQDH 5B3JE 3LAFA 3QQ3A 2NY7L 4HT1H 4JO3L 5IM7B 3MV9D 3WS6A 4PJIA 1QQDB 1ZVYA 1FLRL 1YMHA 2NXYB 1PBYA 2ATPB 5BOZG 4JB9L 1QKZH 5DK2A 4I0PA 4MQ7B 3RWIA 1L0XA 1BBDH 5EU4B 4IRJB 3P9MB 2Y5TA 3AROA 1FNGA 3D6GA 1Z0NA 4BUGA 1QO3B 4NJ9L 2NY3C 5IROC 2XQBL 3ZE2E 3HA0A 2XICA 1KEMH 2OZ4H 5JDSA 3VWJC 4WV1C 3HTLX 5EOQL 1Y6KR 3MRIB 3MV9B 1FZJA 1DBJL 5KN5B 5DMKB 2OL3L 4PYHA 4QHLB 1AE6H 4JVUA 2AJUH 4P57A 5GGRY 4NBXB 2Y06H 3HZVA 4G6KH 4NQED 4XBPB 3RZWA 4AEIL 5M94B 5EO1B 3QHFL 1Q9LA 3WBDA 1OT1A 5SX5H 4R0LB 2VABB 4OQTA 2UZIH 5BCAA 4ZS6D 1P53A 2YSSA 3GMRB 3MRFA 3VFOB 2H9GB 1AO7D 1DR9A 3EAKA 3UTOA 1D6VH 4P0DA 1MFEH 4OZ4B 3BN3B 3L5HA 3AS3A 3DSNA 3UBXG 2AJYH 5H94B 1T4KA 3KYMB 4ZUUB 1YDPA 2VXTH 3MLXH 4X6CE 4XNUL 5BVPL 1F13A 4HS3B 3AU1A 4NQEB 2FJHB 2DM7A 3ZYIA 5CEZL 15C8L 4YHZL 1IGYA 4KK6C 4BQ6A 1E4XH 4RMVA 4ODSL 2BRQA 1P7HL 1MHCB 3MRDB 3PWJA 5DLML 1NGXB 4HKJB 3TBSA 3RWIB 5C92A 3EKCA 4HLJA 2NQCA 1A3RH 2BJML 1JCKA 3EZ8A 4LLMB 1N8ZA 1BZ7B 4Q97A 3E6HA 1OOAA 1I4FA 4NQCA 5C08D 1T0NB 3BOVA 1XIWC 1JVKA 1MWAL 4HS8L 4P2QD 4JJ5B 3RGVA 1I1FB 4MD5A 3OAYK 4ZMAT 2PYFA 4P57B 5F97E 4KHTH 1VA9A 3GNML 4MWFB 1A6WH 3HZVB 4HIXH 1KT2A 4WWKD 4YQXL 2FZ3A 1MCJA 4DEPB 3QDJA 1CL7H 1WWBX 1AI1L 5C08B 4Z7VE 2YSSB 4PRHA 1XF3A 3LKQB 3DMMC 2PKDA 2IH3B 3QISA 1NCAH 2CLZB 4M7LH 1T4KB 4WHYG 3STLA 5FOJA 2OI9C 4UV4H 1KCVH 2CR3A 1LDSA 4HBCL 4OJFH 4U1JB 3SDAC 5DWUH 5JHLH 4CW1B 2NY6C 1CN4A 1NFDF 2B1HL 5I1IH 3QEGH 1CDCA 3DOSA 4WTZA 3K2UL 3VXUA 3RWHA 4WW2B 4ORGA 3JXAA 1IGJA 2YC1A 1V3MA 5DHXB 3HG1D 4JDVA 2OTUB 3GSRB 5MI0B 2VMFA 4HWBH 1Z6JT 1IM3A 1FNAA 3TBWA 2F74B 3BYYA 5LJYH 3V6ZB 5B8CA 5IIEB 3GSVB 1P9MA 3L3JB 2DBJA 3E6FB 4QOKA 1NCWH 5DFVC 2OZ4A 3L3OB 4NDMA 2JB6B 2PYFB 4BH8B 1U42A 2BNRE 4LSVL 3FQNB 4J3OC 4JO2L 5FKAA 4YDIH 4DGIH 1R3IH 5HI5D 5ILTL 2BVUA 4PRIA 5DURB 5IB3B 4QXGL 3MGTA 3HG1B 1FAIH 2HKHH 1T66C 2X89D 4QHMB 5D6CA 4FZEH 1KPRA 4HEME 1LE9B 3QUXD 1E27B 1V3JA 2SEBB 5SWZE 3U9PL 3UEZA 1RIVL 3UCRA 1KV3A 5E2UH 2VN7A 4IJ3B 1I1AA 4BZ2H 3D3VE 1D5XA 2F19H 1ZHNA 3STLB 5DO2D 4YHPB 4U1HB 1CTOA 1KTRL 5DUPH 4YBLC 5MERA 4B0MM 5MP6H 4NZTL 4PBVC 3CAFA 1MPAL 1MCCA 2C4FT 2X4NA 5E2JA 3T2PA 2ZKHH 3QPXL 3H42L 4NO2A 5A16A 1CLYH 3BPOC 4K2UH 4NT6A 3QR2A 1KTLB 1Z5LA 4RGND 2R1WA 1IZJA 4FQCL 4AK1A 3QUXB 4L3AA 5KZCD 1K4DA 1N5YL 4PJXE 1JZ5A 5FO9B 4M6OL 4D9QD 4AG4L 4XP6H 3OGOE 4G9DA 2O61B 1S9WA 3MSPA 1PX3A 1JWUB 3O0RH 3QXUA 3ZHKA 4YIQB 3EYVB 1MHEA 2GQHA 3CVIH 2XWJB 5HHME 4AYFA 1Q1JL 5EO9B 1FH5H 1ONQA 1M6OA 3MBXL 4NQSB 5IGXL 1X3DA 2MCPH 1BREA 4XC1L 4H88H 3V4VH 5JMOC 5LXGL 5IW1A 3S37H 4CDGC 5KZCB 5EORH 2O5XL 2XTJE 3T3PF 1T04A 2DIAA 1CD1A 1CXIA 3GSNH 3AVEA 4X7DC 3X3FL 5I2IA 2XRAL 1A3QA 1ND0B 4B50A 1FL5A 3T77B 4XGZB 3QP3A 2UZXB 2X1QA 5F7NC 4PJ8A 4I0KA 2YBRB 2X44D 2AEPL 2R15A 4JZJA 4X80L 2Q87A 1NCCH 1ZLVH 3V7AG 4LP4A 3MJ8B 1MVUB 3ULVF 1MFBH 3FFCD 3RVVC 4JDZB 5HGGS 4EUPG 4NT6B 2WBKA 4U1MA 2DL9A 5AYUL 3BP5B 3IKKA 3A67H 4JJHA 2VSCA 2CLRA 3EFDL 4PS4H 1S8DA 5C0ND 1K4DB 4XNMB 3QUYA 2UUDH 4ZSOA 1KBGH 2RCSH 3MUZ1 4JREC 3SDXA 1CFBA 1KTDB 4G9DB 4PJCF 5ERWB 5IMMB 3D85D 4HV8A 3THMH 1LO0L 3DUSA 2AXGA 3CVHH 5ESAB 4L9LA 2O5ZL 3HUJF 4NQXA 4PRAA 1IBGL 1F6AA 3FFCB 3QNYB 3ZYZA 1YC7A 4JEGB 1GRWA 1U95B 2BVQA 4PRBB 5C71A 1IILE 5CZXD 3HAEH 5JORB 4ZNCD 2J88H 1XF2A 3HE7C 5FV2A 3VFRB 2BRRH 3VGBA 2PNDA 3S8WA 5J89A 3P30L 3DRQA 5FYKH 3JVGC 4GJTB 1LD9B 3SPVA 5I2IB 2ZSVB 1IFHL 4MB4A 3D85B 5C3TA 4G6FD 4GSDH 3KYNA 1JRHH 3HR5B 5T3ZH 2K1MA 4PJ8B 1Q0YH 4AQ1B 2OJZH 1F2XK 3WFEH 4LLDA 3B8SA 3C9NB 1OAZL 1ORSA 2OYPA 2P49B 1MJUL 5FK9A 2Q8BH 5F7EH 1AKJA 5I17B 2VLKE 1AR1D 4PB0L 1FNEA 4OD3H 2EICA 1OGAA 2GJZA 3MFFA 5IBTH 3QUYB 1OPGL 5DC0A 4ZSOB 2EC8A 1RZ8A 4C58B 3UMTA 1PJ9A 3PV6A 4D9LL 1RUAH 3BPNC 2GJ6D 4HQQH 3MLWH 1TTFA 2ERJC 5CIPH 4L9LB 2IMNA 5DJ8A 2A73A 4R4FH 4X9FA 5FYKU 1JNNL 5T1KB 1LDPH 5SWQA 4OCSL 4XHQA 2APXA 3D69A 4DAGL 5JHDB 3ISWA 4PJEA 1ADQL 4GH7B 4GQ9H 1XF2B 3EO9H 1ZHBA 2GITA 1EVUA 5IQ9B 2ED9A 4LDLB 4Y4KA 2YD6A 2NZIA 1S9YA 2VDQH 4U6YA 4KH2A 5MENA 3QJFA 5B21A 5F70A 3JTTB 1BQLL 5ESQA 3X17A 3KYNB 3WKML 4QRPE 4PJGB 3GSNA 1S78D 5F8RC 4LSTL 5DRNB 4YXLL 2QKIB 2DM3A 2A9NL 4HK0B 3L3DB 4AEEA 1AKJB 3WEXB 4P9HH 3S37X 2FGWL 4P2RE 1N7ML 1CU4H 4YZFE 3ZZ1A 5IQ7H 4A2MA 2WIIA 4Y8AA 3INUL 4QRQA 1ZHLA 3QUZC 5B3NA 1RULL 4EUPB 2EE3A 5CP3A 5EPMA 3U7WL 3PF2A 1DTUA 1QNZH 2Y36H 3VD7A 1BECA 3RWGA 1ZOXA 4GUPA 4XPBH 1DDHA 3GHBL 4Y4FA 4FQQA 3C8KB 4WTWA 4N8VG 1NCUA 5GISL 3T0AA 1CLOH 3VI3F 1IC5H 1JNHA 1KB5L 4DFIA 4JZOA 4TVPH 4PJEB 2BSSB 3BISA 3CVHA 2DMCA 5HGAA 5JTWA 2GITB 1MY5A 1CE1L 4HIXL 4UNTA 1CDJA 2F54D 4GAYA 4Y4KB 3PP3H 2PW1B 3STZA 4JLRB 1SQ2N 3O6MH 3SE3A 3HAEA 5GS1A 3TA3C 1A1OB 3CFDB 3H9YA 3VD3A 1MCRA 4HZLA 3L3HA 5F7DA 3UPCA 1GAFL 1GOGA 4FQHB 5J6GA 5HHOE 3V6OE 3LRSA 4QGYA 1W72B 5I15L 5D7LE 5B38A 4FQIH 3VMNA 3QXDB 3EYQC 1UXSB 1S9KC 4UOW1 4J6RH 3BEVB 4OCLC 1KCVL 2O26U 5D1ZD 4LVOC 4YHLL 4AEHL 2P5ED 1EK3A 3U46A 4U3HA 4ZO9A 4EQ3A 4H25A 3M45A 1DLFH 5GSRA 4G42B 3TJEH 1GSMA 4QRQB 4MQXD 2M1KA 3RUGE 1R3LB 2NTFB 3VD4A 4YNYB 5D8JL 5DD0L 5KBNC 4BUHA 3ZYJA 1NGYA 2V5SA 4U1SB 4Y4FB 4Z7WE 4TRPH 5JA8B 2E7LC 4WW1B 2OP4L 3O8XD 5ENWB 2R0ZL 4JZOB 3UJTL 3C6SA 3DXAE 4ALAL 5C70A 4UBDC 5HGAB 4L8BB 5TFSH 2QADC 5L7XL 1QYGL 2LU7A 4X6CA 4Z7NE 1VCAA 3QEQD 2PW2B 3D0VA 3CH8A 3HFML 2DLIA 1FAIL 2EXYC 1QA9B 5IVXF 3QDGA 4I3SH 3L3HB 5J6GB 3TP4A 4M4RA 2ID5A 1HZHL 3RJDA 1ZE3C 3EDEA 3RVXD 3LRSB 3JWOL 1HI6A 3ZL4L 4XXCA 5T3XH 1GGUA 1U58B 4PJ5E 3O6FA 5IJKC 4PJ7E 1CFQB 4N0UB 1LO4L 1KNOB 4BZ1L 1RUQH 4GXVL 2YMXL 3QB7C 3NZHH 1AHWC 3R0MA 3AXLB 1YUHB 3TLRA 1RK1B 1CLYL 3O2VH 4N90E 2LTQB 5H37H 3R8QA 1U3HA 5DUMH 2X4OB 2DQCH 5C0RL 2WWKT 5FYLL 4IRSD 3F7VA 5A2IH 1EEQA 3PL6A 4AH2B 5GS2D 3UPRB 1NGYB 5D71H 1E6JH 4YBHA 4Z7VA 1NCNA 5BV7L 1ZLUH 4C59B 1QBML 3QNXB 3ULUH 4PGEA 4NP4H 4OZIE 2DQDL 3QQ4A 1CDHA 1I8IA 3GJEB 3ZKQD 1WSST 3UP1A 4N8CL 3WUWA 4LLWA 4N8VB 7FABL 2IANE 1RZGA 1FZMA 1L7TL 1WWCA 4DK6A 1YEKL 4IRSB 4FXLA 2R0WH 2FDBP 3EJYC 3RX8A 2YD7A 4CU8A 2R29H 4O51A 5E9DD 3F7YB 4L8SC 4O2CB 1FGVH 4R96A 4OB5L 4DW2L 4U6HA 4YDLB 1J0HA 5D5MF 4GRMB 4O00A 4IMKC 5D9SA 3WLWD 1L0QA 3G9VA 4OZGF 5FIEA 1MIEH 5F88A 3TF7C 3ELAT 1OB1B 1NJ9B 5EH1A 2BNRA 3ZE1F 4YDJA 3WO4C 4Q9QL 3SKMB 5DK0A 2YS4A 3PL6B 1RU9H 5KS9E 1BAFH 2AJSL 4TUJA 1A2YA 4Z7VB 3BPLB 1GZPA 2AK1L 4D9RE 5F9WC 4CADA 5SWZA 1BFTA 3UJJH 4PBWD 2EDYA 1DEEA 4FXKA 1YJDC 1T83C 3D3VA 1KJMA 1W8OA 1NC4D 1MRFH 4EXKA 4Q74A 3DNKA 4Q6IB 5DMIH 2I9TB 3EGSA 4WRLA 3W9DA 5HBBA 2V7HA 3SY0A 4NQVA 4Z7QF 2BVEA 5EU6E 4LSUH 3VCLA 2DYPD 1OSPL 4O51B 3CPLB 5IMOB 2MQCA 2AK4D 4ZNEE 1WBZB 4OF8A 1RUKL 5F7WC 2XWBB 4KK8C 2ARJQ 4PJXA 1MCPL 2XZQL 3IDYB 3B2VH 1NC4B 4RBPH 3PHSA 1YNLL 4P4RA 5KJRH 2EYRA 4WI7A 3U6RA 5A2LH 4TSCL 4GLRH 1HSAA 4X7EC 3VXME 3VFVA 1INQB 2GJJA 3L1OH 1DN0B 2AABL 4YDJB 5FECB 2DYPB 3LMJH 5IBTL 4HFUH 2EEDA 3CLEH 1H3PL 1TVBB 2VN4A 4OIAA 5KSVB 4JFXA 1WWWX 1D3CA 1LO2H 3NIDE 4NUGH 2OTWB 3E8UH 4OCMC 2VZ1A 4XPHH 2PF6A 3UYRH 4CADB 5SWZB 2GT9B 2BK8A 4OLVH 2R39A 1YNKH 1FIGH 4ISVA 1AXSB 4UT9L 1NKRA 3G6AB 1MH5B 5TDOA 4LGSB 4X4YA 4TUOB 3Q6GL 3TC9A 1T1YA 3HPJA 3WSQL 1J8HD 2DWDA 2E7HA 1UB5A 2H45A 5INDA 2AJVH 4Y5YB 3DI3B 1G7QA 2XY2A 4NQVB 2G2RA 4FQXC 1NC2A 2UZYB 4HWZB 4EVNA 2ORBH 3SE4C 1X9QA 1MCOH 5JNYA 3NACL 1Y18B 2EH8L 4Z7UB 4UQ2A 1OF2A 4M6MH 1EBAA 1JV5A 3IAGC 1QFUH 3QNZB 2ICWA 4YXHL 4OZHF 4F33A 4DUWA 3ARDD 4DVRL 4P4RB 4RWYL 1KB9J 4P4KD 1GVIA 2EYRB 3U6RB 3ROLB 1H8NA 3BUTA 5HHMB 4M7LT 1RUML 5JW3L 1O0VA 3HMWH 4KHXL 1FYHB 4UQ3A 3FQTB 1N59A 2JB5H 4V1DE 4WFFD 4RAUB 1BIIB 5GRWA 4CU6A 2XTJB 2AAVA 1JHLL 3RPIB 3T08A 2ZUVA 1HNFA 5I1DB 5J12B 4RZCA 2PXYC 3ARDB 4HMDA 4R97C 1C1EL 3KPTA 4P4KB 5JW4N 3S5LG 1KENH 3HI6H 5I6XB 3FQWA 2JCCE 2Y07H 4QXTA 5EWIH 1CD8A 1LWRA 3C60D 1EAPA 4KJQD 4WO4D 1S7VA 1JUFB 2W1NA 3RAJH 1NFIA 5GGSY 1NGPH 3HI5L 1T03H 1DFBL 1I7ZA 3RVUC 1ZEAH 1KIQB 2YN3A 2J3SA 1U8PB 4WFGD 4X4XA 4Y5XB 1JV5B 1R5WA 2ICWB 4U1LB 1QBLL 4U1IA 1Q0XH 1WISA 3C60B 5IF0A 2X70A 4IOIB 5F3HB 4WO4B 1QFWH 2DLHA 5DJ2A 3LEXB 4P2OC 4H0GA 1TETH 1A9BB 1V05A 1I9RL 3LB6C 1UH3A 3UDWA 4JFQA 4DCQB 4GS7C 5IR1A 2GW5A 1IAOA 1IGTA 1ZLSH 5E8EB 3A6BL 2I25N 2W0PA 2HWZL 2NNAA 3HKFA 3UO1H 1S7RB 2J6EL 4NNXA 1I9JL 1IC7H 1P4LA 3QH3A 1OY3B 2DRUA 3ECBB 3E2HC 1OTSC 3BFOA 1UEYA 2VXSL 1U8NA 2B4CC 4X7TB 3IDMA 4QRPA 4HX1B 4JZNA 3CFKA 4ZFOB 3VRIB 5LCVL 3UTQB 4EI5D 4NC1C 2NY4D 3BP7B 3GO1L 4PJIF 2I9LB 2HG5B 3W2DL 3S5LA 4NN7C 1ES0B 2VLKB 1AJ7H 1X5ZA 2A6IB 2C3VB 4E9LA 4P2RA 5EBWB 1A6VL 5E00A 2K9UA 1G1YA 2IPKB 2XKNB 1V3KA 1IGMH 3SOBL 3HR6A 2G5BB 3U82B 1JHKH 5CEXB 3JZ7A 3ORJA 2EDOA 1FV1A 2GFBA 5IROA 2GSGA 4IOFC 3HZYB 3GI9L 3FB6A 5FM4A 1R3JA 1XZ0A 3VWJA 5E4EB 4WV1A 4G7YL 2OL3A 4EI5B 2OMNA 2NY4B 4ZAKC 1J1XH 4PJHE 2UVFA 1LK2A 3BWAA 1N5AA 4XNQA 5I1LA 3T0ED 3BEWB 3QSKB 4QCIB 5F1NB 4RISH 5EZLB 1T0PB 2DIBA 1B3JA 3IFNH 4O2FB 3ARED 3TIEA 5GRVK 3O81A 4XP4H 3C6LD 3D0LA 3TWCH 5I1EH 3ZSSA 4RQQB 1KXVC 1CGUA 3IJHB 5I8EA 3MLPA 2W0FA 3V2AR 3K46A 1Q9WA 3IDMB 4QRPB 1U8KB 5HHOA 4HMCA 2E9IA 3WL9A 4ODBD 4NN5B 4OCYL 4YX2L 1KCRL 2P8MA 3C09C 1CGXA 2Y25A 4Y0GA 3D48R 3C6LB 3S5LB 1G9NL 4HJJH 4E0RB 5FGSA 1BD2E 3DROB 4MA8H 3JWNC 5E00B 1SYVA 5KW9H 1NCTA 5I9QB 4J3UA 1ZWIB 1DEDA 4WW2F 4F2MA 3TVMD 1FV1B 2OBGA 3IFLH 3T4YA 3RUGA 3DX9A 1XIWA 4S10A 5T5NG 4GRWB 2XNAB 4LPTA 1JGEB 1AXIB 2OL3B 4OZFG 5HI3C 2A0LC 5IB1B 3QDAA 4OFDA 3KDMB 4P5KA 1LK2B 1WFTA 4HUXB 3H9ZA 1ACYL 1I3VA 5CEZD 5FYLE 1G1CA 5BZWA 4LQ1A 3DXAA 3FTGA 4QT5B 5I71B 1SEQL 5F7UA 4LNVA 4ZXBC 3V79C 1M71A 3KPSE 3C2SA 2MSPA 5I8EB 4TNWF 4R26H 2HJLA 3DMMA 5C0DB 4PJDE 4ODVL 3BRDA 4JVWA 5HHXH 3CDCA 3BKJH 1QFWM 3QZWG 1GC1H 5HHOB 3C8DA 5DFWH 2ZCKH 4UIMB 5FCUL 3LD8C 1YEGH 1OSZB 1P4BH 4LAQH 5D7LB 4XCYA 3EOTL 1B6DA 4PJ5A 2E6QA 4MX7A 2DQJH 4PJAE 3LHPH 3HS0B 4YFEA 3VFPA 2BNQA 5EUKA 3ZT5A 1RZJH 1AGBA 2BP3A 1AH1A 4QRRE 1BP3B 2CKBL 2JLLA 5GJTL 4Y19E 4AJ0A 2X4RB 3BJLA 1MWAB 3OKKA 2F5AL 3QFDB 4ZOAA 5GGTH 3WKNA 5IEKB 1IVLA 4K3JH 4NCDA 4ZUTA 3T4YB 3WXVH 5IG7A 1S5IH 2FBJL 4PR5B 5KVGH 5LGKA 5MEOA 2VLRA 4BSVA 3HLAA 3F8UB 2BVYA 1K6QH 1N6QL 3DVGB 3SO3B 3FRUB 4ZUWA 3V0AC 1RJYB 3H3PL 5CMAB 4P5KB 2OR9H 1XR8B 4Z7WB 2C7UA 5DEGA 3MRQB 5E2TL 2HH0L 3I02A 1CICC 4ERSH 2IF7A 5BZWB 1FO0L 1A0QL 4AIZA 3QEHB 4N1HB 4MDJA 1B4JL 3ZTJH 1VPOH 4IEFB 2IANA 1R3HA 2OJEA 1I7RA 2JTDA 1BBJA 5D4QA 2HJLB 4JRWA 3QG7L 5IHUL 4I77H 3E8UL 5BRZE 2EDBA 5C3LD 1WUNT 3O4LD 3CUPA 1ZMYA 4OFKA 3QAZB 1SEBB 5I30H 5L9DL 1DSFH 3GDBA 1NDGB 5FEBA 4NNPL 4GAGL 1DUZB 3HMXH 4K7PH 1YEHL 4K71B 1CFNA 4FMKA 1GHFH 3SGDI 2P4AB 3MUHL 3TV3H 4LCYA 4PJ7B 1JPGA 2HKFL 2QSVA 3ETBF 1U6AH 3ILQD 2HFFB 4NO3B 3ULSB 3WFBL 3WO3B 4HH9A 2GAZB 1AGBB 3GK8H 3CSPA 3BHBB 5DS8A 3MLRL 2DF3A 3OKKB 4BFIB 1G0DA 1H15A 5GIRA 3O4LB 4OCXL 1MFCL 3IETA 4Z5RA 4FQJH 5KS9A 4HFWA 4NBZB 1Q72L 4DQOH 2IPUK 5DEGB 4OZIB 1G0YR 4UINL 4I0PD 3AY4A 4JFPB 4DTGL 2X9XA 3IS0X 4XP5L 4OZFB 3CC5B 4BK5A 3HMWL 5CBEA 2XQYK 4KRPC 2J8UE 3NGBB 4EIZC 1R3HB 4FG6D 2JB5L 5D70L 3SCMC 1BBJB 3VFUA 1UQSA 1ZT7B 1A14H 1E0OB 1A9EA 3ARGC 5EU6A 3UYOD 1W0VA 2R9HC 1NMCC 2XZAH 1AGDA 5EDXA 4XMPH 4ZNEA 4MHHI 5DA4A 3G6JA 5GS3A 2BVPA 3ARBD 5L2JA 4W6WB 3MRNA 4R2GD 1G9MC 3QZWB 5HD8C 1FVCA 1LEKB 4ZD3H 5CCKL 4NC2B 4HH9B 5J0BA 3PNWB 3VWKD 2AXFB 1I7UB 4PP2B 3OX8B 3EOYG 2CK0L 4OV6F 3VXMA 3EDFA 5E0QA 1IZKA 4E5XB 5C0CE 1BWMA 2VITA 4G9FE 4YGVA 3ARBB 5ESVB 5GGTA 1NBYA 4L3CA 4R2GB 5KANI 1Q0XL 1HHKA 4U2YA 4M61A 5IJVA 3FQRA 4HIEA 3VWKB 1CFSA 1ZT1A 3LKRA 2EXWD 1LGVA 4NQCD 4MCZB 5I8OL 3KPLB 4JFFA 4QRUA 3MA9H 2OCFD 1N64L 1KLUA 1SVZA 1BF8A 2VDKH 4WI5A 3JVGA 3RGVD 2WUBL 2ZCHH 4N9GB 1MSPA 4JPVH 1WZKA 4X9BA 1T1ZB 1A6ZA 1QFPA 5TJWK 5H2BB 4M7KH 1UACH 1D5BB 4D0CB 3P77A 3QDJD 1A6TB 3PJSB 3ZYOA 2BOBB 5DJZA 3HMXA 5T1MA 1NMAL 3KJ4B 2FO1A 1MCIA 1ZV5A 1AQDA 2DQFB 1N3NA 3VXMB 3NPSB 1EHLL 5DGQA 1E6OL 4OD2B 1V7MH 4NWTL 5EBGA 3MR9B 4K7PX 1WFNA 3TT3L 1KJ3H 1UJTA 3ABZA 3C2AH 3KYKH 4CNIA 1ADQA 4OFYA 4M61B 3VXUD 5HVHC 3HE6B 1JZ7A 3CSBA 4PJEF 4ZUSA 3MREA 2JCCA 4FNLH 1ZT4B 3D5OF 1TJGL 3DX8B 3MRHA 2FATL 5ADPL 5LBSL 1I8MA 1WCQA 1S7TB 1D5ZB 1EEYA 4QOKD 1OQOA 3P11L 1XGPA 4ODUA 2ADJB 2PO6A 4MNQD 5L8KB 4HJ0C 3MV8E 3UZQA 2WBJC 2W07A 1YMME 1KLGB 5IWLC 1D5IL 4NC1E 1G7PB 3FOLA 2Y6SD 3BQUC 3CFCL 2ZJSL 4PRID 4ZTOL 3MQIA 2EDFA 5DJZB 5T1MB 3P4OA 2A83A 3Q3GB 5AZEL 1QVOB 2P5WD 5EUOE 2AEIT 1AQDB 1M7DA 1HXYB 1I1AD 2Z9TA 3GHEH 3X3GH 4MNQB 2C9AA 4V1DB 1CZ8L 5DJDA 4MCYA 4LF3A 4DGVH 2W59A 4Z7OF 4PLKC 4YE4H 4TULL 3G04A 1YN7A 1PG7H 2KUTA 2FCBA 5AWNL 3K81A 2BHUA 4ZUVA 5ID1B 2D7NA 25C8L 3LKNB 3MOBL 5B3JF 1LO5A 2P5WB 3IDXL 4LLVA 5K9QG 3MRCB 4PG9B 5L88L 3KYAA 1H3GA 4KJWC 4NO5B 2VH5L 4LKXB 1JN6A 3FT2A 3ARFD 1I8MB 3C5JA 2L7JA 1FNFA 3TA3A 4Q6YA 1EEYB 1KEGH 2DJUA 4XCEA 2PO6B 2V9TA 4QHKJ 3CFBB 3LH2H 5E24E 5BMFH 5IMKB 3MRPA 3NCYP 4S1DC 1N6UA 3ZE2F 2RIKA 3S3PA 1J1OL 4YWGL 4KZEL 4MZ3A 5I1KH 3ZKXC 1GIGL 4U7MA 4TVSa 3HB3C 4KRLB 2I60L 3DUUA 4I8DA 4CVZA 4NSKA 3ARFB 2BY3A 1JK8A 4YAQB 5CKAA 2R56H 4OGXH 3ZTNH 1CLZH 3PHOA 4JFDD 3BN9D 1D9KB 5JW5B 5JW4M 1HXMA 3RL2B 32C2B 2HT3D 1UCBL 3G04B 1XF4A 5C2UB 2VZUA 2EO1A 1KB5B 1YJDH 2VAJA 3KR3H 5B39G 1CVRA 2E7LA 2O5YH 2OR9L 5CINL 1JZ2A 4QHUA 4P3DB 1CGSH 2YKLL 4EJ1C 1MFAH 2WLYA 1FZKB 2BMKB 4LSQL 3L3IA 5FGCB 1WBXB 4X6CF 3RZCC 3ROOB 2EZ0D 3OB0H 4JFDB 4ZS7H 1JMZA 3IDUA 5GGVL 2MFNA 4F9LC 1UM5L 4Y5VC 4HK3N 3RA7L 2YK1H 1BD2A 4ACPA 5JXEC 2BC4B 4XCEB 5ECJE 3DURA 4KQ3L 1EMTL 4U3XA 3NCEB 3TZVC 1C7SA 5GGUB 3SDDA 5E4IA 4LLYA