4YXLL

Crystal structure of syrian hamster prion protein complexed with pom1 fab
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
213
structure length
213
Chain Sequence
DIVLTQSPAILSVSPGERVSFSCRASQNIGTSIHWYQQRTNESPRLIIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQSNTWPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSETDQDSKDSTYSMSSTLTLTKDEYERHNTYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major prion protein
publication title X-ray structural and molecular dynamical studies of the globular domains of cow, deer, elk and Syrian hamster prion proteins.
pubmed doi rcsb
source organism Mesocricetus auratus
total genus 44
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yxlL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yxlL01
3QISA 1G6RH 4QRPE 2GJJA 3HUJA 1RVFL 4JFEE 5IG7A 2R2EA 1FL3A 1AR2A 4N1HB 2P1YA 3TH3T 4DN3H 4MA7H 1BECA 5EA0L 4X8JB 1V7MH 5CZKA 2J5LC 5KAQG 4IDJH 4TPRL 3IFOA 4Y4KB 1HH6B 2QADC 4FG6D 2EEAA 5E5MB 1CI5A 2VLKD 1R0AH 1MH5B 4R26H 4LOUC 1MWAB 1U58A 2PO6A 5F1IA 2LAAA 4AEIH 2VITB 3Q6FA 4RAVA 2LABA 4PBVC 2EC9T 4YDJA 5MERB 2X4RA 5HPOA 4AEHL 4DJMA 3QEUA 3WJJA 4NO2A 4K8RH 4JPVH 1EO7A 5SWZE 4ZTOL 1FVDB 1JPFB 1NCCL 1MCEA 4ZYKA 1TPXB 4H1LG 4MXWH 4EQ3A 15C8H 3OAZH 1KEML 2H8PB 4OLXL 3AGVA 3C08L 1OGAD 2XIDA 2FR4A 4H1LH 1CU4L 2CGRH 4KJYB 5I1JL 5GGSY 2R0ZH 1RHHB 3QQ9D 4ZTPH 3T3MF 5ICYB 2WUCL 1R5IA 3MJ9L 2AJXL 1NMBH 4PFEA 1CGVA 4F15C 3OHXB 1V5JA 2C1PB 5JQHC 5IW6B 1KULA 3MLZL 3QQ3B 3TIEA 3QJFB 5HYFA 2Y5TA 4QHNB 1DL7H 1Q9LA 4OKVB 4Y8AA 4XNMA 4EIZC 2FECI 1RI8A 1BREA 4OZFG 1Y0LB 1PEWA 2E27H 2R23B 3TBWB 5BO1H 1BJ8A 5F7EH 3CFBB 2V17L 5GRUH 5JXED 1Z5LB 1FLRL 3BZ4B 5LGHH 2OI9C 4XC3H 4MNGB 4OZFH 4X6FB 2BVOA 4X9HA 43CAA 3BZEA 1S7VA 3K81A 3X3FH 5C0CB 4AH2B 3OX8B 5E1HB 3TIDB 3THMH 1KN4H 5JPNA 1F4HA 2VIRA 2WP3O 5BXFA 5DK0A 1ORSB 4JO4L 4AEEA 5ESAA 2P49B 4MXVE 3NGBC 2KPNA 4XMPL 4HF5L 2IADB 2UZYB 1VHPA 4M02A 3U0TA 2C7UA 4TNWF 3EYOB 3LQZB 4ZUSB 1FO0H 1QSFB 5E94A 3ARGB 1SYVB 1M6OA 5GRXG 5HHNB 4DCQA 5F7KC 2K7QA 2HTKC 1GGYA 3IDGB 1U8JB 3VFOB 3C5JA 2XN9B 3MRIB 4CBPA 5JXAH 2NXZC 3PV6B 3U7WH 1E4WL 4W6WB 3LKNB 3X14A 3RZCB 3GBMH 3MNVA 1JK8B 1YEKH 1VGKA 1GGIH 4HS6A 5AUMA 4GQ9L 3ARPA 5BVJA 5C0JA 5HVFB 4JHZA 1KPRB 2X9XA 5MENA 4K7PX 3RBGA 3P0GB 4PP1C 4LFHG 4WRLA 5ERWA 5E00B 3NA4A 5D1XC 3HZVB 3MBXL 1NQBA 2FSEB 3C5ZA 5DD5H 4XHQA 5DJ0A 4XPHH 3VGAC 2FJHA 1K2DB 3OGOE 2RFXB 3LEYH 3ESVF 5EOQL 2G5RA 2PETA 4MCZB 4BSWA 1D7FA 3MRDA 2V2XB 2WAHA 4MX7B 1AHWB 3GNML 4CMHC 5A2FA 2XQBL 3PWPB 4MA1C 2A83B 4R0LA 2A6KA 3BP6B 4OT1L 5LJYH 3PABA 1YEHL 2B20A 1NGWA 3HC3H 1DZBA 3UTPE 5HHXL 3MV8E 4NZTH 3GMMB 4K3EH 2WSKA 2ICWA 1BOYA 1KENH 1RSFA 3QDMA 5E2JA 5FM4A 2V2TB 1KC5H 2JELL 4WFFD 5B8CA 1ZHBA 5CSGA 3IJSB 5KAQF 1HZHL 3L9RA 5LWYL 3NZHL 3QA3A 2VZTA 1CGWA 3CCHA 4U6HA 5D6CA 5HYSA 4RCAA 5A2JH 5MHSD 3K4DA 3MOQA 1VEOA 5E4EC 4RGMB 2MQ3A 1F3JB 3LH2L 2BNQB 1C5BL 2OTUB 2CO6B 1BMGA 4ZUTB 3OG6B 3LCYA 2X4QA 1BM3L 4X7SL 4DUVA 4AZ8A 2NX5A 4JFZL 2C3XA 5MEPA 4XPFH 2FJFB 3EYFA 4GRWF 4YHMH 5EOCL 5DVMA 1FH5L 4WEUD 1IM9D 1NGPH 4J3VA 3QEGH 4K55A 3L3KB 4ALAL 1A02N 5LKNA 1OW0A 5HGDB 4CDHA 3VFVA 4K3GA 1T3FB 3FO1A 3EFDH 3TZVA 4EDXB 1LO3L 1HWGB 1K8IA 2BJML 1IAIH 1A6WL 2A77H 1CDJA 3G5YB 4M6NH 5I16A 5K9JL 4KHXH 5JR1L 4LVNB 9CGTA 1ZVHA 4M03A 4DN3L 5CD3B 3GRWA 4MA7L 2BK8A 1WITA 3RWHA 4M8VA 1V7ML 1TCMA 2A74A 1JF6A 1PDKA 2FHFA 3F5WB 1WLHA 1WBZB 4P46A 1HHHB 1YNLH 1IGIH 3VWJD 2PXYC 1W0VA 1G9MH 3ES6B 5FXCH 4U1IB 4AEIL 1YEDB 1RJCA 4P5KA 3LV3A 3GMOB 4K3DH 1HINH 1DUYA 2QEJA 2JCCA 4GRLB 1BFVL 4QF1A 1ADQA 2R56L 4WHDA 4K8RL 4YJZL 3UTTA 2A0LD 4JEGB 4LASH 4LNRA 4C56A 3KDMA 4YE4L 3EUUA 2DJ4A 2GAZA 2VZUA 4PJ7A 3VXTB 2MHAB 1ORQA 5FYLD 3VH8B 4XRCB 3EHBC 5CSBA 1CDBA 3O4LA 4GKZA 2CGRL 5CIPA 3QWQB 1XGRB 2R0ZL 2Y7QB 1Q0YH 2BOCA 3ARED 4ZTPL 3TBTA 3ULVD 1ZHKB 4L3AA 4I13B 1T5XB 3HLAA 3EOAB 4EN3B 1JNHB 1NMBL 3ROLB 2M8XA 3RPIB 3T0EC 4U1MA 1D3CA 3ARZA 3E2HB 1AJ7H 4L3CA 4HPYH 4KRPC 1JZ3A 1DL7L 2XT1B 1T7XA 5D1ZA 4ZS6D 2V5RA 3WJLA 3IB4A 3GSOA 5MI0C 5FO7A 3FMGH 3QFJA 5BO1L 2E27L 4B0MM 5F7EL 1C7TA 4U0RC 2B4CH 3CSBA 1A4KB 5B22A 5CJXA 3N9GH 3OGCA 4XC3L 4Y4FC 4XBEH 3RIAF 2D0FA 3X3FL 5FYLL 3QEQA 1XZ0B 3SGEH 1C12B 4M5YH 3U0PA 5HI4D 3GSWA 4M62H 1FNAA 3THML 1KN4L 1MAKA 5TE6L 1T6VN 4FABH 4OZHB 4BZ1L 3BUYB 1QR1A 2BFVH 4LQFH 5KTEH 4JPWH 3BOVA 3W5MA 3Q5YA 1DN0B 3IXAB 2HLFC 3CFKA 3H7BB 1FO0L 3S5LB 4KKBD 3TESA 1KB5A 3RIFF 1MPAH 2VLJB 1XF2B 2R4RL 4N0UB 4YBHA 1VA9A 3P77A 5F7HA 4NC1E 1C1EH 5DI8B 4HT1L 3KXFA 3ROOB 1ODAA 3EO1B 2X70A 3T65A 4EI6A 4U1LB 5JNYA 2N4IA 2GJZB 3LSOA 2GJ6E 4P23B 5JXAL 2FLRT 3DROB 2DLTA 2FD6H 5LG1A 2C5DC 3ZE0E 1YEKL 1ZVYA 2D0GA 3ULSB 4LCWB 4F7MA 1FFNA 3HMXA 2NY0C 1NCWH 3CSPA 4MJ4A 5E4IA 1UM4L 1RUML 3TBVA 4MGXA 4GRMA 4HWZB 3GUTA 3LQAC 5DD5L 1X5LA 5J8OA 4XPHL 5BVPL 1CG9B 5C0EA 3EJJX 1WIUA 3BX7C 1ZLWK 3QDGD 2J8UF 1D5ZB 1OP3K 1TQBB 3WCYA 1J8KA 5H2BB 1RPQA 4JQVC 4R90H 1UA6L 5ISZD 3MLTB 3C5SB 1K6QL 2VXTL 1T4KB 4WHTB 1WBXA 3W0WE 4N8VA 4JO2L 2DQJH 4HWBA 4NZTL 4OTXL 4DQOH 4K3EL 3CPLA 4FQXD 3ARDA 1RJZB 1LO5A 1UVQA 2DD8H 4PJ9B 1J05B 1KENL 3GSUB 1CL7L 2V7NA 2E8ZA 2W0FB 5IBTH 5C0IB 3TV3H 5LGJA 1AC6A 1JTOA 1UZ8A 5DJDB 3SJVA 3AMLA 1I8KA 4KGJA 3WN5A 1G7IA 3CDFA 5GHWH 2B2XH 2GHWB 5AAMA 4H0HB 1EX0A 3WL9B 1KLGA 3GZKA 2A6DA 4KK5C 1NFKA 1INDH 2Y23A 5CAYB 2FYYA 5F1OB 1Y6NR 2Y36H 3DXAE 3N50A 3VDAA 5KVMC 2CR3A 4XCEA 5HPMA 3MQIA 4CW1A 3NCCB 2JB5H 1CICD 1VADB 4HFWB 4LVOC 3V4PH 3MNZA 5CHNB 3WFEH 4JY6A 4XPFL 2CIIA 3UTQA 4J6RH 4WI2A 4YHML 4XAKD 3VXMA 2VDQH 5C71A 3IDJA 5K33A 4NCC1 2HVKB 4RBPH 4OZIF 1JWUA 1BGXH 3NIGF 4F2MA 3EFDL 4HWEL 1M1SA 2MSPA 4KI5F 1F13A 3MV7A 4M6NL 1I4FA 2VLKB 2C3VA 3QAZB 4GG6F 4CVXB 3WO3B 1UGNA 4M1GL 2F5BH 1BQSA 4QRTA 1WBYA 2NXYC 1FRGH 1EHLH 2EYTB 5DMGC 1IGIL 4KI5D 2QR0B 3M45A 1G9ML 3QIWD 5EFIB 1MLBB 4HK0A 4N9OB 3CNKA 2FX8H 1CE6B 3BP5A 3FB6B 4L9LB 4K3DL 1HINL 4MA8H 3TO2B 1OGAB 2DQGH 5EO9B 4L8SB 4IOFD 3MA7A 5DFWH 4LASL 3U83A 4BK4A 1SJVA 1GGCH 5J57B 2XZZA 4NO3A 3F62A 4UBDD 2FEDC 3HC0B 4YAQB 1LE9A 3O0RH 5GGRY 4J3OC 4G8IA 4PY8I 3UJTL 1T7VA 3QQ4B 1Q0YL 4I2XB 3QJHA 5EDXA 5HYJE 4Y88A 5K9OA 3HZKB 3I6LD 2P8MA 3BKCL 4ORGB 5J3HC 4Y16B 1KTKE 3VFTB 2NNAB 4DFHA 3ALPA 4U7KA 3V5HB 1AJ7L 1MCOH 4TOYH 4HPYL 1PFCA 1AGCA 2XPGB 2ESVD 2Y07H 3HI5H 3HNVH 3RL2B 3FMGL 2P7TA 2EH8L 1QVOB 5I8KH 3S36H 3O4OB 3HUJF 2RBLA 4R8WH 3EYVA 2HTLC 1XGYH 1NAMH 1KYOJ 2GUOB 3BZFA 3B9VA 5DMJB 4NNYB 1T5WA 4MNGE 4XBEL 2GFBB 1EPFA 3M1BA 3EDDA 2IQ9L 4XX1E 5C0BD 4IOIB 4D0DA 4M5YL 1P4BL 4GMSH 4G80B 1BVKB 4Z78A 5C0CE 4M62L 3I3DA 4FABL 1RUQH 3BPNB 1GPOH 3G04B 1FPTH 1F3DJ 4M93B 4LQFL 1AXTH 5HYSG 5J6GB 1N3NA 2OX5A 1CVRA 5KTEL 2ZG1A 4JPWL 4HG4K 3FQXB 4G7VH 3CXDH 5HHQA 5IUSA 3P9MA 3LKPA 4ZFOA 4BKLA 12E8H 3LS4L 1IC4H 1QA9B 5I9QC 2CDEA 1QSFE 4NPYB 2BSTB 1MPAL 3B9KC 1C1EL 4EJ1C 4U49A 3GSRA 1GGUA 2EDBA 2GSGB 3SDXE 3G5VB 1J18A 4JGJA 2XTJD 3VXRD 5DD0H 2RR3A 5E08H 5I2IA 3WUWG 1UM5H 1YYLH 3EOBA 1SY6A 2UZXB 2FD6L 3WIIH 1DBBH 3WYRA 2HVJA 5FYJH 1JPST 4OLYH 2AJZA 2HT4C 1NCWL 5C6PB 4FXKA 4CADA 1IC1A 2EDJA 3HPLB 4UAOB 3K8LA 4XWGH 5T1DH 3QDJB 1AP2B 1HWHB 3OKLB 3TT1H 3D25A 3T4YB 5C0NC 4Q9BA 1QG3A 2D03H 4HV8B 2EE2A 1R3HA 3WUZA 3T3PF 3MLUH 3GRWH 4R90L 2HMIC 4RRPA 1IGYB 1ZT4A 4JFDD 3PWPE 2VDKL 4BFEA 1AIFA 4MA3A 2FEEL 5DHYB 3HZYA 2DQJL 1X5YA 4DQOL 2NTFA 1AR1D 3CSGA 4PV9A 4I0PC 2BNUA 2CK0L 2DBJA 4Z7QF 1MHCB 5EPMA 2DD8L 3TN0C 4A2MA 4W4OC 3BH9B 3QIBA 3KPPA 5C09D 3TV3L 4UOW0 2C4FT 2PCPA 2ADIA 4QXUH 3LKSA 4IRSC 3OG4B 4HMCA 5F21B 1U92B 5L2JA 2PTVA 3BE1L 4Z18A 4JHWH 3HE6A 1UZ6F 5GHWL 2GW5A 1MF2H 3O6LH 3P9WB 1INDL 3T0WA 4UV4H 1MJ8L 3NIFE 1FC1A 1NMCB 3QO0A 2EXYC 2BNQE 3WLWC 1DVFC 1TLKA 5A16A 1ZT7A 4FFVD 4HIJA 1MNUH 4JZOA 2JB5L 5IVXA 1QLEL 2KBGA 2A38A 5C07A 3R8QA 2HJFA 2O5YH 4PY7B 2BRRH 4J6RL 2J6EH 3UTOA 1U91A 5HDBE 3WIFA 2VDQL 2DIJA 3T0AA 4H1LB 3CZFA 3CMGA 3QUYD 4BFIA 5CGMA 1T0PB 1YMMD 1OAZL 1BGXL 3FQNA 3JVGC 4X6CA 3VFMB 1UQSA 3EYQC 4LPCA 4GRWB 3NPSC 3IXTA 5FECB 3VFRA 3FB5B 3GMPA 4YWGH 4CN4A 1JMXA 3LPGA 3QPXH 4PS4H 4WW1B 4NZDA 4WI5A 1HHIA 3B2UD 4ODVL 3K1KC 5MEND 5C0RH 2YXMA 4K9EC 4G3YL 3E6HA 4GSDL 4O00A 5IQ7H 1T66C 3OKKB 4LL9A 1LEIA 1K8DB 3C5ZD 1FRGL 3ZSSA 2QSQA 5E6IA 5HHOD 4WEBL 3ET9F 1EHLL 3MJGX 2OJZH 3BKYL 3D3VA 5EUKA 2VISA 1DLHA 5FAAA 2YA0A 3QUMA 5JIKA 1V3LA 1EO5A 4HEPG 4OZFB 1XCQB 3DI3B 3WXWH 3KYOA 1HILB 3OJ2C 3ZKXB 2DQGL 4OIBA 2R0LH 3L3GB 3VXNA 4LGRB 1GGCL 3AREB 4JAMA 4PTTB 3BIAX 2DTSA 2XZAH 3NACH 1IAMA 2W91A 1T03H 4QEGA 3L7FB 4KJWD 1KN2L 5TQ2L 5D70H 5F3BA 2O61B 4JM2A 5GGUA 1FO0B 3EO9L 1F2XK 1UB6B 2XKNA 4O2CB 3PHQB 1R3KB 2X42A 4QNPE 4EI5C 1T7ZA 4PJCA 4KAQH 1MCOL 4TOYL 3DUSA 3FFDB 3ZHLA 2CJUH 4C57C 1WT5C 2Y07L 3HI5L 3HNVL 4H8WH 3DVNA 4N8VG 2CQVA 5T5FH 3S36L 4WFEE 4F7PB 4R8WL 2GTZB 5EBGA 4KMTH 4XWOD 5H94B 2ZCKL 1BPVA 4HWBH 3O3EA 5IHZB 2KZWA 3ULUD 3PWNA 4MAYB 5GXBB 5CP7B 2XKSA 3Q48A 3NCFB 3X13B 3UZVB 4XZUB 4UB0H 1CL7I 1RUQL 1GPOL 3ARBC 2B1AH 4I5BB 1AXTL 2E9IA 3TZVD 2VXSL 1V05A 5FUOH 4Z5RA 1J8HE 3IFNL 2Q76B 1QO3B 1T1YB 4KK8D 4G7VL 5F9OH 4TSBH 2AJVH 5KVGH 4KRLB 4X9IA 3DUUB 3SGJC 2P5ED 3FQRB 2MQCA 3IT8D 4QRSB 2JCCF 1IC4L 3CLEH 5F88B 4NM4L 3VXQB 5HI3C 3U4AA 4EEEA 2PXYA 4N0UE 4DK6A 3ZE2F 4PJ7F 5F7WC 3CDGA 1VEPA 2ERJC 4NKMB 3CFDA 3WSQL 5BZWB 4DEPB 2YZ8A 4MJ5A 1PLGH 5E08L 4YDLC 1D5BA 1HHJA 1UM5L 1YYLL 4PRHD 1OQOA 3QIUB 3K8MA 4RGOH 1VFMA 3VGDA 5FYJL 3VXOB 1TZHB 3NABL 4OLYL 4LCWE 1CLYL 4C56D 3I6KA 3VI3E 1XGQA 1MFEL 5BRZB 2EECA 1B0GB 3C8KA 4ZPVB 4XWGL 2EDLA 2Z93A 1ZLVK 3SE8L 4U6XB 4LBEB 2CSPA 3O4LD 4CGTA 1DSFH 2HRPL 3TT1L 3O45B 2D03L 1UWXH 3GRWL 1N26A 1QRNA 1AKJD 5KOVC 5E8NB 3D39A 2JE8A 4FQXB 2BHUA 5TDOA 3NBNA 2J8UB 3OJMB 1SYSA 4LF3A 1XH3A 5D1ZD 1N59A 3QFDB 1A1OA 2IGFH 3BD3A 3MNWA 1F5WA 3D0LB 3QFJD 5AYUH 4OB5H 1ADQL 3D18B 3WNLA 4DZBA 4QXUL 3OR6B 2ZUQB 2B5IC 4JHWL 4OD2A 5T1KA 4PD4K 5FKAA 2UVFA 1CXLA 1E6JH 5BZDB 3QEQD 1KXTB 3BH8B 5LBSL 5T33H 2NTSP 3O6LL 1DANU 3WDHA 3SBWC 1CICB 3DBXA 4DZ8A 1EXUB 4JKKA 3QXVA 3CGTA 1H3PL 1PSKH 5E5UB 4M7JH 4AIOA 1CS6A 2IAMD 5KSVB 1TCRB 1DBAH 1MNUL 4X4YB 3IFLL 3S37H 5GGVY 4M8QA 4QY8B 1M7DB 3LRGA 3BHBB 2O5YL 3V6FB 3FHQA 2FWOB 2BRRL 4G6KH 5DMKA 1LK2B 1YN6B 4HUUA 4KPHH 3KXFD 4M7ZB 4XNZB 3AY4C 1I1YA 5DMYA 3CZJA 3IDIB 1DDHB 3RVUD 1MRDL 5DUBB 1JWSB 4TUOB 4YWGL 4LEXH 4NP4H 4KKNA 3QPXL 4MNQA 4PS4L 3TVMB 3VCLB 2E7HA 5CLTA 1RIUH 2F5AL 4OZGF 4YK4C 2F8VA 2VLKE 3V4VH 1BZ9B 3RGHA 4OZIB 2NYYD 3MRGB 3PE9A 3PP3H 4F58H 4KKCD 4RA0C 4P2YA 4S11A 5EOTA 2ZUWA 4K23L 1X5JA 3G6DH 3QIWB 5IQ7L 2VLLB 3OKNA 5FA3B 1EGJH 3H0TB 1OARH 2ZUXA 2DQIL 4NQCD 3RNKA 3A6CH 1KIPA 2J8HA 4WENB 3DTXB 2OJZL 4I18B 4IHOB 4XBGA 5ESVB 3SDDC 5FYKH 3BDYH 1JPSH 3CUPA 1KB5L 1IAKB 3T1FA 5DRZA 3WXWL 3C60C 1IZKA 5DURD 1OGAE 3KWWA 4Q58C 1JZ4A 1QFUH 3V6OA 4NKOA 6FABH 2OJEB 2XZAL 2Q7YB 2UYLA 3NACL 3RQ3A 5EZLA 1QBLL 5EN2A 1SY6H 4DKEH 5B38B 1T03L 5D70L 4TTDC 4EOWH 3DI2B 5LVEA 4Y5VC 5ITFB 1I7TB 3HMXL 1B2WH 4JFOB 2VR5A 3I3EA 4MCYB 5CJQL 3UXFA 1UJ3C 1YMHA 1Y6KR 4KAQL 3H42L 1JYNA 5C0FB 4RRPG 4NO5B 3MUGB 2YRLA 1IE5A 2CJUL 3SQBA 3PJSA 5KG9B 1L7TH 2D9CA 5ACMA 1C16B 4YIQA 3OKMA 5T5FL 5DC4B 5F9WC 3LAFA 4GXUN 3HS0B 4R3SA 4PV8A 5MEOB 1P4IH 2FEEI 2IALA 2ZNXA 4JGMA 1A3QA 4HWBL 3HUJB 1HIMH 5IG7B 2R2EB 1KCKA 3KPOA 1FL3B 4G6MH 3G6JA 2K9UA 4UB0L 5LXGH 2XG5A 1HI6A 4XP6H 2B1AL 5DF0A 1PY4A 5FUOL 4GJTB 5F9OL 4TSBL 2AJVL 5KVGL 1KPVA 1NC2A 2YEZA 3B6SA 1DJSA 3CLEL 1QNZH 2BZDA 1U58B 2PO6B 5F1IB 3Q6FB 4EVNA 3G6AA 4RAVB 2C4XA 4YDJB 2X4RB 3HG1D 3QEUB 3Q5TA 4XP4H 1W72A 3V8OA 4NO2B 1PLGL 1J0JA 1QP1A 5E8OA 1A7OH 4ZYKB 1F6AB 5HHVH 4Y4KC 4RGOL 3ILQD 1S7QA 4OLVH 2FR4B 4IRJA 2F53A 5GPRA 5KSUA 5DFVC 1VESA 3ARFA 1QSEA 3TGXA 1RK0A 4U1JA 3QI9D 3U1SH 1R5IB 4MS8C 4WWKD 4XHJD 1DSFL 1QLFA 5C86A 1JF1A 1LDPH 3TIEB 4N0CC 4ODUA 2Y5TB 1Q9LB 4YEFA 1IVLA 5IWLA 3CFEA 4XNMB 1MCHA 4RIRA 3D69A 3GB7A 1HSAB 3S7GA 1WCQA 2XFXA 2MCG1 3LZFH 2VR4A 4RX4D 1MJUL 4WFFE 1CD8A 1RJLA 2BVOB 5DDHA 43CAB 3BZEB 1S7VB 3S6CA 2D7OA 3UEZA 1L9MA 4NQTA 5JPNB 5MHSE 2JJWA 4XMKH 3F58H 5BXFB 2XOTA 5DK0B 1QLRA 5SV3A 5ESAB 1E6JL 2HFEA 4NKDA 1CFVH 4R96A 4KY1H 1KJVA 4KZDL 1TIUA 3MR9A 3U0TB 2C7UB 4X6BA 3HCVA 3T2OA 5CJBA 5E94B 1M6OB 1PSKL 4DCQB 4M7JL 3BEWA 1NAKH 3GIZH 3RKDD 1S7XB 2VL5A 3VXUD 2QADD 1OLZA 3S37L 3C5JB 5F93C 3PDGA 2IAND 2AKRA 4G6KL 3X14B 2MMXA 3AU1A 4KPHL 3MNVB 3F6IA 1VGKB 1X5AA 4HS6B 5AUMB 3RVVD 3ZTNH 5BVJB 3MODL 2WMPA 2YC1A 3BPOC 5MENB 3U9UA 3GGWA 3D9AH 3ARGC 5I6XC 3KJ6H 4GRWE 5ERWB 4U1GC 2HT3C 4NP4L 4ZSOA 1GC1C 4G42A 4X4ME 4D9QD 3C5ZB 2F58H 1MCQA 2LVEA 5DJ0B 1RIUL 3V4VL 5HHOB 3GM8A 5A3IC 3LN9A 5JA9A 2FJHB 1MAJA 2ICWI 4QT5A 4LLYA 4OFKA 3LMJH 2NY5C 3E0GA 3G6DL 1PQZA 3DVFA 4HG4J 2HN7A 1EGJL 3EDJA 4V2CB 3RZCC 4BSWB 1OARL 3MRDB 1KBGL 3A6CL 5KW9L 1T89C 3DX6A 4ZFOL 4R0LB 2A6KB 5EIQA 4PGEA 4U05A 5FYKL 3PABB 1NGWB 1JPSL 1W0YT 3BDYL 3H3BC 4XNQA 3TFKC 5DQ9A 4Q0XL 5EBMA 1URLA 1KCUH 3H9ZA 4JRXA 2LE9A 1RMFH 5E95B 4P3CH 3W39A 5FYLE 2ICWB 5CP3A 1X6NA 1QFUL 3TA3A 3QDMB 3A67H 3WEXA 3DJ9A 2FH8A 3WXVH 1GOGA 5B8CB 3ULVE 1ZHBB 1MHEA 3L9RB 1LK3H 1VPOH 3QA3B 1AHWC 1SY6L 3QHTC 4HZLA 3GO1L 2KKQA 3OBAA 3CCHB 2NQCA 4U6HB 5D6CB 5HYSB 4FMFA 2V5TA 2HYMA 1MJJA 1SEQL 1B2WL 5IVXF 4OCMC 4ZXBA 4TVSa 1IKFH 3OXSA 3HE6D 4EUPA 1MVUA 4JO1H 1AE6H 3TBYA 4K7PH 1I9JH 3BPCA 4OQTA 4QGYA 4LLUA 3KPMA 2X4QB 4Q97A 5T1LA 1L7TL 1KTLA 4LSQL 1UG9A 5TDNA 3UPRA 1ACYH 5MEPB 4X6CF 3P9LA 4JKWA 4YR6A 3EYFB 2HTKD 3U46A 2P24A 1P4IL 5TF0A 3VFVB 2Z8SA 1ONQA 4RGMC 1J5OH 1CFTA 3FO1B 3TZVB 1XEDA 2NXZD 2FX7H 1K8IB 5DC9B 4G6ML 4DN4H 3RI5K 1HSBA 4BYHA 5LXGL 4XP6L 1U8PA 3MV01 3HRZA 4K2UH 3RWHB 2IC2A 3OXRA 5GIRA 3B5HA 4PR5A 2RHEA 2A74B 1I1RA 2ARJA 5D1XD 1G0YR 4FOMA 3CH8A 3KHOA 2OXHA 4UNVA 1RUAH 1Z3GH 3GFUA 4ODHH 1QNZL 3RHWF 1W0VB 2IJ0C 5SX5K 3V95A 1DCLA 4P5KB 1YJDC 3LV3B 1DUYB 5LCVH 2JCCB 1CGXA 4QF1B 4LVNC 4XP4L 4R7DA 1EJOH 4M43H 2VZVA 3UTTB 4KDWA 4LNRB 4C56B 3KDMB 5FUZH 2GAZB 4PJ7B 2ADJA 3SGDH 3GMQA 3RWJA 5HHVL 4UDUA 2ARWA 1XF3A 1E4XH 4OLVL 2OR8A 3KAAA 4O2FA 3O4LB 5CIPB 1G7MA 3CU1A 4PJCF 4WU7A 2BOCB 4N8PA 3TBTB 3QDGE 1BLNA 3U1SL 3HLAB 3LDBB 1FGNH 1AKJB 3IVKA 1DP0A 3AFLA 4U1MB 1LGVA 2EKJA 5TQ0H 2OSLA 3TNMA 2X10A 3QDAA 4N8CH 5IKCA 5I73B 4L3CB 2WP3T 2W60A 1JTPA 3GJFK 5IFHH 5D1ZB 2YOCA 1BBJA 3GSOB 3ZT5A 5FO7B 4F3FA 1A3LL 4RNRA 3QFJB 3HE7A 5AYQA 4ODWA 5IJKC 5HDLA 2J8UE 4ETQA 3LZFL 2NZ9C 2YMXL 2FX9H 1P7QA 4EN3C 3OGCB 5BV7L 4LLVA 5F8RC 3MV11 3NCEB 1KIUA 3QEQB 3E2HC 3U0PB 3GSWB 3RTQA 5JO5A 4XMKL 3F58L 3UZEA 4MHHG 1QR1B 1AGBA 4ZAKA 4PRIA 4XAWH 1H3GA 5GS0H 1CFVL 3AUVA 4KRMB 4K94C 3L7EA 4X6DA 1KNOA 2C26A 1GH7A 1TZGL 4KJPC 3CFKB 4X9BA 2VKXA 5C0GA 3MXVH 3NFSH 3BPLB 1QFOA 1KB5B 1NAKL 4G6AD 3GIZL 3QXDA 3P77B 1LNUA 4XAKE 3KXFB 2I07B 2GCYA 2X70B 3T65B 4EI6B 5JNYB 4YHIA 5INDA 3LSOB 2J88H 5F9JA 2FIKA 3N1MC 2PXYD 2DI7A 3AROA 3G9AB 4U3XA 1EO8H 1GRWA 1EAJA 3ZTNL 4O02H 3VA6A 2X4PA 4JKPH 4DKDC 4Q6YA 4F7MB 1FFNB 3D9AL 1U2CA 5F9DC 4D9LH 1DEEA 1JGUH 1MCKA 3KJ6L 3RY4A 1QKZL 1KPUA 5DQDH 5J6HA 3TBVB 4E41A 5CKGA 3KPLB 2M1KA 3GUTB 2F58L 3Q6GH 4NQCB 4OZIE 1JGVH 1QSZA 3NIGE 5C0EB 2APFA 2P44B 4P23C 3LMJL 2DMCA 4KI5E 3ECBA 4PJ8C 3WBDA 1PY9A 1XT5A 1J1XH 3AS3A 2AABH 4M4PA 3T0ED 4GG6E 1WBXB 5C9JA 1QRND 5AD0A 4KRPD 2G9HA 3MLYL 3CPLB 1RMFL 3ARDB 4P3CL 1LO5B 1UVQB 2Z9TA 5KJRL 1B0WA 2V7NB 3A67L 1Q1JH 5LGJB 4WTXA 1UZ8B 3WXVL 5DRWA 1TQBC 1SM3H 3SJVB 3I6LE 1E4KC 5I1IH 1I8KB 2GIYA 4Y4FD 3WN5B 1G7IB 3UTSA 1I7RA 4PJXA 3QHZH 4TVPD 1KLGB 2A6DB 3R1GL 1FNLA 2FYYB 1ZS8A 1IKFL 2ESVE 5I30H 4NGHH 3L3DA 4OGYH 1B9ZA 4PJ9C 3G9VA 1HHGA 4KKLC 1AE6L 4XCEB 5HPMB 1I9JL 4CW1B 2KZ1B 4OCSH 5L7XH 4F9LC 4OLZH 3MNZB 1WTGT 1ACYL 4JY6B 3SPVA 1U8KA 3O3AA 2DBLH 2CIIB 2QKIA 3BISA 4MDIA 1BD2D 3UTQB 3VXMB 2XWTA 2VDNH 3IDJB 3MROA 4ETYA 1A6PA 5IP4A 3VI4F 1JWUB 1ZEAH 2YUXA 5D7JA 1J5OL 1JHLH 1SMAA 4F2MB 2N56A 3VRIA 3HUJE 2FX7L 4HHAA 4U6VH 4DN4L 4LIQE 3MV7B 1I4FB 2C3VB 1FAIH 3A6BH 5FDWA 4RMQA 4K2UL 4PD4J 5FCUL 4WWID 2NY0D 3NAAH 3OAZK 3F65A 1AQKL 1X3DA 4MNQD 4QRTB 1WBYB 2XZCH 3DSFH 3ALWA 3QO1A 1CT8A 1Z3GL 4ODHL 1V7NH 1UXWA 1XGPA 3VXRE 4U1KA 5J11B 1CDGA 1FJ1A 4OF8A 1A1NA 4HK0B 3BP5B 3QWOA 5E8PA 1EJOL 4M43L 3Q5OA 3BWAA 1WIOA 3MA7B 4E0RA 4G7YL 2XA3A 1X9QA 5FUZL 1IKNA 4NO3B 2EO9A 2GYSA 2VERN 2QBWA 2D7MA 1LE9B 1E4XL 1PX4A 3OKEA 4G8IB 3QJHB 4PJDA 5K9OB 2P8MB 3N85H 1HCFX 4Y5VA 4OV6F 1FGNL 4L9LC 5DEGA 1UEMA 1ITCA 1PEZA 3WHXA 5TQ0L 4QTHA 4L8SC 5EU6A 4N8CL 1KTDA 1S9XA 5FGCB 1AGCB 4JO3H 5IFHL 1PKQA 2VLRD 1ZA3A 4UNUA 2YD2A 1OP3H 1J9CT 2P7TB 3BWUC 4PJBA 4NM8L 3EYVB 1VERA 3PQYA 3T3PE 5C09E 3G6JF 4U1SA 4Y16C 2HH0H 4KZEL 1T5WB 3M1BB 2YUVA 4OUUA 5DEZA 1DBML 4D0DB 3N1GC 5CP3H 4Z78B 3S88H 3KLSA 1VCAA 1QRKA 4W68A 1AGFA 4Z7QE 3P4NA 4FQIH 4XAWL 1N3NB 3Q1SL 4YXKH 5GS0L 3O4OC 2HG5A 5HHQB 1KCLA 1FNSH 4N5UA 2J5LB 3P9MB 4UT6H 3LKPB 4ZFOB 4BKLB 2BSED 4BUHA 2QADB 2CDEB 2CLRA 3MXVL 8CGTA 1UZ6E 3ZSTA 3TLRA 4DGYH 4GOSA 4OSUH 2NXYD 1NEUA 3BPNC 3ELAT 2J88L 4JFYA 4JCLA 3BVNA 4M93C 5D6DC 1FDLL 5DMGD 5I2IB 4OCXL 3EOBB 4QLRA 2VDOH 4OGAD 4DW2H 4K3JH 5EU4A 2HVJB 4JKPL 1CXEA 5I17A 5MENE 2AJZB 4NNXA 3VD7A 4CADB 3OAYH 5HI5D 5F6HJ 4WU5A 3SKNA 3Q6GL 1JWMA 5I1CH 1WZ1H 4IRJD 1F4WH 5HHOE 2LAGB 2IPTL 3D25B 1JGVL 1WF5A 3ARFD 3EZJB 4HBCH 5L8KB 1R3HB 4NO0A 5I15L 4HUVB 5F96L 4L8BA 1NC4A 5FB8A 5HDQH 3RU8H 1ZT4B 5J9PA 2R1XA 1S7TA 1NBYA 4X9FA 2AABL 3IJYB 3MCG1 1AIFB 4JY5H 4MA3B 3RWCA 1PVHA 3HZYB 1I3UA 1T2QH 1RIVL 2NTFB 4WI6A 1JZ6A 4PV9B 2BNUB 5DRNA 4UAOC 4UOW1 3V5DA 5EPMB 2VQUA 4OBSA 1MAMH 3RY5A 5JMOC 5KOMC 3QIBB 5F89A 3KPPB 5K93A 2PCPB 2ADIB 2HTLD 2F8XC 1SM3L 3LKSB 5I1IL 5L2JB 3STZA 3D85A 1HYRC 2LU7A 3HE6B 4LSPL 4JDVA 1NBVH 3MREA 4XB7A 2HKFH 1HKLH 4HEME 3QHZL 5M95B 1P4LA 1PJ9A 4OGYL 3UCRA 1FORH 3UP1A 3QO0B 3CVHA 1JL8A 5A16B 1ZT7B 4HIJB 4WI9A 4OCSL 5E56A 4JZOB 1V3KA 5IVXB 2YPLD 1BQHA 5CGTA 4OLZL 2E6QA 5C07B 1A6TA 4LLQA 4OLEA 4LCCA 4KVCH 1U91B 3P30H 4JQIL 3O9WA 3WIFB 3ULUE 2VR9A 3MO1A 3CZFB 2Y9RT 4E5XA 1YEFH 2WANA 4OF5A 4BFIB 3VFWA 1NMCC 1WWAX 1ZEAL 4PREA 3ZYOA 3WO4B 4X6CB 1F90H 1JHLL 1UQSB 4NQVA 1RZ8A 4WUKH 2VZOA 1C08A 3IXTB 3VFRB 3GMPB 4UT9H 1I85A 2BSSA 4J12A 1HHIB 4K8RC 1KELH 4JG1H 3A6BL 4W4NA 3E6HB 3VGAB 2ATPA 2HT4D 2JJUA 5EU7C 3NAAL 2Y1VA 1CR9L 3OKOB 3JV4A 2XZCL 2HKHL 5E6IB 1JE6A 2P45B 1S7RA 1K3IA 1Y18A 5EUKB 4NBYB 2VISB 1DLHB 3QUMB 4MA1B 5BV7B 1P9MA 1CFBA 2QQNH 4PRHE 3MBEA 4WO4A 3KYOB 1BF8A 4PLKD 2CUMA 2WK2A 5IB3A 1NFIA 4PB0H 2JCCE 2Q86A 4Y19A 4LAQH 4OCWH 1NH6A 3X12A 2FHBA 3QNZA 5EZIH 3VXNB 4C56E 1JNNH 4JAMB 3ZE2E 4NFBA 4WI4A 3S4SG 4I0PD 1IGMH 1P7HL 2R2CA 3O4LE 2H3NA 3CVIH 3NFNA 3TN0D 4PRNA 3VE0A 1VKXA 5F3BB 1JGEA 4JM2B 5GGUB 3MGOA 3HKFA 2YD7A 3VGEA 2XKNB 1PKOA 1RUKH 2D7TH 3R0MA 3DNKA 1YECH 4KMLB 5FM5O 3ZKXC 1MFNA 2F74A 4PJCB 3UPAA 3QH3A 3DUSB 2GY7B 3AREC 3HB3C 2J8OA 4JO3L 4WUUA 3DVNB 3BRDA 2PW1A 1T80A 3BP4A 3QFJE 3WLWD 3HR5A 1DVFD 1GCFA 5T1LD 2W1NA 2X1QA 3IGAA 1JZ2A 4ZS6C 2HH0L 3O3EB 5C08A 1QPPA 3PWNB 3QEQE 1E27A 5DEFA 3CK0H 5GGTA 2X1OA 3S88L 3BIBX 3ZKNC 3NZ8A 3LKQB 3U0WH 4B50A 4FTVA 4Z5RB 3SKUD 3EYQD 3E6FA 1M71A 3ILPA 5GGRB 1BHGA 2DM7A 3FRUA 1UC6A 1FNSL 4UT6L 5FUCE 2I5YL 1OAKH 4KXZI 4ONFH 1B6DA 1HKFA 2XXMB 1WFTA 2A9NH 4DGYL 2PXYB 1ZTXH 4MAYC 3JTSA 3CDGB 3KXFE 4OQTL 3CFDB 4KROD 4MD0A 2AV7A 1RJYA 4EKXA 4XP9H 3BO8A 4KV5F 4MNHA 1N6VA 3DO3A 3IDYC 1D5BB 1HHJB 4I3GA 3SY0A 5HXMA 4DW2L 3KPSD 4K3JL 2YS4A 1CLZH 4HJJL 3ARQA 1UKQA 3QCVH 2IPKA 4LK4A 1YNKL 3I6KB 3PXJA 3VWKA 1XGQB 2H26A 3I85A 5GS1A 1H3UA 3C8KB 4U7MA 4MZ2A 4O58L 2Z93B 4HWUA 5I1CL 1A6ZA 1F4WL 4NQCE 1TZIA 2OBGA 3U4EB 1ZMYA 4RFEA 4ELKA 4DEPC 1Z2KA 1GXEA 2E7LA 4HBCL 2D31A 2DQCH 4MLSA 1QRNB 4YZFF 5HDQL 1IC5H 3OV6A 3RU8L 3QIUC 2AI0L 3MV8D 4Y5YC 3D39B 4OZGE 5TDOB 3PWVA 5MI0B 1P5UA 2WZPD 4CL7A 5KSAA 4EI5D 4JY5L 2GK2A 3GIVA 4Q9QH 1SYSB 1T2QL 3B2VH 3LN5A 4LF3B 2EZ0C 4WFGD 1FN4A 2OMNA 2VN7A 5K59F 1A1OB 2PYEA 3MNWB 4JVPA 1MAML 1FL6A 3RA7L 1EAPA 2MFNA 5TH2A 4DZBB 3SJVE 4H26A 2B1HH 2JKXA 3CD4A 4OD2B 5T1KB 1LHZA 5FKAB 4FQXC 1NBVL 3MZTA 3CXHK 2NY4B 4L3ED 4J7RA 2HKFL 1HKLL 3FT2A 4HS3A 4RBPK 5C70A 1DBKH 5IB1A 3DBXB 4KKAC 4DZ8B 1JYXA 1U8LA 4BK5A 1FYHB 2ICEA 4PRID 1FORL 5ESQA 5D7SH 2X40A 3JV6A 4YNYA 4ZO9A 3FAXA 4LSVL 1NMAH 2KL6A 4M8QB 5DRXA 2ZUQC 1H15A 3IRPX 2DL2A 4JZNA 4KVCL 1CYGA 5HI3D 3P30L 2VWEE 4HUUB 3T77A 5L2KD 1YEFL 1I1YB 1CICC 3RWEB 1JPTH 1OD9A 1G9MC 4KDTA 1F90L 1U8OA 2BCKA 1N6QH 4WUKL 3OAUH 5EBLA 1P69B 2QLVB 3M17A 4MNQB 5DZOA 2CKBH 1KELL 4JG1L 4X7EC 1EDQA 2XWJA 4X7FC 5EOTB 2Q3ZA 2VLMD 3OKNB 2HA1A 3WKML 5GS2H 4PJ8A 4XNZC 5D1QC 3RNKB 1KIPB 1GHFH 4MHHI 5BCAA 1BQUA 5DJXA 3GM0A 4XBGB 3L5XH 3JWOH 3CUPB 2QQNL 3T1FB 4FXGA 4P99A 1HQ4A 5DRZB 1EIBA 1RZGA 3WV0A 3TVMC 2K7PA 3KWWB 4LAQL 3TCLA 3NTCH 3L6FA 4PJXF 1JNNL 1KIQA 3QIWC 3RY6C 1JHKH 2UYLB 5EZLB 2LFGA 4OM0H 5EN2B 5HYQA 5KSBA 1IGML 3MRJA 2HP4A 2OM5A 3CVIL 1RURL 3RZWA 4I18C 3H8NA 2APWA 4IOFC 4JFFD 5B39A 4LHUD 1WISA 1RUKL 4UBDC 4QOKA 4B7IA 2YPKA 1YECL 4FFYH 3UTSD 1MQ8A 3E8UL 5CMAA 2ZUTA 3ZT7A 1YMHB 5F1NA 2UY6A 2EC9U 4GAYA 3PJSB 1AD9A 5DSCA 8FABA 4O5LH 1WSST 3EOTL 2CD0A 1S9WA 5BS0D 3OKMB 1NUNB 4RISH 5I0DA 4KC3B 1NDMA 2XA8L 2I9LA 3EGSA 4IM8A 5DD6A 3U2SA 4IDLA 3HPJA 1I1FA 4CNIA 4R3SB 4PV8B 1T0NA 2IALB 1W2KT 1FL5A 5K9KA 3RWIA 3KPOB 3CK0L 3G6JB 4M5ZL 2ITDA 3FQTA 1IQWL 4Y4HA 5D7JD 4Q9CA 1HI6B 1KJ2H 3PP4H 5EOCJ 2VXUH 2CDGA 3V52H 3T2NL 1VFBA 5DO2C 1KPVB 2YEZB 4V2BA 4NQDA 1A0QH 3B6SB 1D6EA 4JVUA 1F4YL 4ONFL 3DRTA 1NJ9A 2A9NL 4FZEH 4EVNB 1BQHG 3G6AB 4U3CA 3CVHH 2NLJA 2CO7B 4S1SL 5IW1A 1W72B 4U2YA 5E8OB 1U93A 3KNBA 4R97B 5ID0A 4YHNA 1A9BB 3FO9A 2EIEA 3PDOA 4D9QE 1S7QB 1CLZL 3BKJH 3C60D 5DVNA 4IRJB 2F53B 3MRHA 1J88A 3QCVL 4ZFGL 5KSUB 3ARFB 1QSEB 2PO6C 4MDJA 4PBWD 1RK0B 4U1JB 1E0OB 1CF8L 3MV9D 1OP9A 4XNXH 5IB4A 4L4JA 4NZRH 5ELIA 5A40E 3WJJC 1J0HA 1QLFB 4PJBF 1JF1B 2DQCL 5DYOA 4ODUB 5EIVA 1IC5L 3UDWA 3CFEB 3VG0H 3GJFA 4RIRB 3D69B 5ACLA 2RAMA 5EU6D 4GW5A 3GB7B 1MREL 4P3WA 5EB9A 1D9KA 2XFXB 3MRBA 1RV6X 1S78C 3B2VL 3TM6A 4OCYH 2IWGA 2YWZA 1I3RA 1NGZA 1CGSL 4WW2A 3MCLH 3MTRA 3QULA 5HHMB 5DDHB 1CE1L 2EICA 4MWFA 5FFLA 3I75A 3VA2C 5CUSH 1A22B 3RVXD 1AR1C 1OP5H 2WQRA 2HFEB 4BH7A 3OMZA 4NKDB 5K9QI 4ERSL 4R96B 3AB0B 1KJVB 3MR9B 5CBEA 4PRPA 2OQJA 4X6BB 1DBKL 3WFCH 4LHQB 3UAJD 3SE3A 1ZOXA 2AXFA 3HCVB 5F7DA 4ZD3H 1A7PL 1T20A 2BNRA 3BEWB 5D7SL 4P2QA 3S35L 1JBJA 2X1WL 3RKPA 3W2DH 2DQUH 1PG7X 1UH4A 2VL5B 3C6LA 1IL1A 1NMAL 2W65A 5IVXE 1UFUA 1G1CA 4BSVA 2H1PH 4OFYD 3HN3A 1A7NH 1OAUL 2AKRB 4HXBH 3VDCA 3AU1B 3ZKMD 5ALBH 5T1MA 3FT4A 4JFEA 4DAGH 4Z7WA 2BRQA 1JPTL 2YC1B 1INQA 3GGWB 2VXVH 4X6CE 1N6QL 3QBTB 1RZ7H 4OF3A 2NR6D 4ZSOB 1EH9A 3DYOA 4HMEA 4FQ2H 2OTWA 3QXWA 2CKBL 1U3HA 3UZQA 4Q6IA 1FNEA 4QT5B 4LLYB 1CGYA 1A6VL 3RJQB 3GKWH 4P3DA 1PQZB 4U7SA 3C09B 4JZJA 2HN7B 5DFVD 5DLMH 3QNXA 4L9DA 4HKZA 1YN7A 2VQTA 1GHFL 4K71B 1N0XL 3DX6B 3B2UC 1IZJA 1X5HA 2HT2C 1MUJA 4HCRH 4PGEB 1NUDA 3JWOL 3RWDA 4XNQB 2CRZA 5SWZA 5MEQA 5DQ9B 1JFQL 2JJTA 4N0CD 5EBMB 2P5WD 4JRXB 3AC0A 1I9EA 3C5ZC 3CSYA 3W39B 2IH1A 5L8JB 5D71H 3PG2A 3NTCL 2LV4A 3TA3B 2FL5A 3WEXB 2MKWA 4X4ZA 5I19L 1JHKL 1E6OH 3ARRA 1MHEB 4MAUH 4OV5A 4HZLB 4OM0L 5CEZD 3MRCA 1HYSD 4LAJH 5FYJU 3EOYG 2V7HA 1I8LA 2BSRA 2R69H 2GI7A 1ZANH 2YN3A 5EORL 1MJJB 4ZXBB 3D85D 3BN9C 3KVQA 3OXSB 2R0KL 4FFYL 2GSIA 1G6RA 4EUPB 1H8NA 1MVUB 3TBYB 1WVZA 3BPCB 4XBPA 4LLUB 3KPMB 1GYAA 5B8CC 5T1LB 4O5LL 5ICXA 5TDNB 2QSCL 3UPRB 4RISL 4DWHA 4YR6B 3OQ3B 2AK4A 1IARB 1CIUA 1CZ8H 5CD5C 3U46B 5C0CD 2AVGA 2W59A 2BX5A 3LB6C 1ONQB 3O6FA 3HAEA 1CFTB 4LP5A 1Z9MA 5SWSA 5C0DA 3O9WD 3GK8H 4IBLT 4UU9A 1Z0NA 3MLPA 1K9TA 4LDOB 1EEYA 3L3IA 1IC7H 1HSBB 4HD9A 1FFRA 3H9YA 3MRMA 4DVRH 3PP4L 1U8PB 4DOHE 3HRZB 5E7FA 2VXUL 2E9WA 4F7CA 5EO1A 5KZCD 1U8HA 4OF0A 5GIRB 3OXRB 5A1AA 3GSXA 4PR5B 3V52L 2HT3D 2ARJB 1A0QL 2BVYA 4NSKA 1OW0C 4KROB 5A3ID 3DYPA 2XN9D 3TZVC 3NCJH 4PGJA 3CVHL 1ETZA 3KPSB 3CX2A 4O9HH 3RZCD 1GOHA 1UWXK 4R7DB 4OFIA 1ZWIB 1J10A 5F6IB 2ADJB 3GMQB 3RWJB 3TFKD 4UDUB 1J0YA 3T4AA 1XF3B 2DWEA 5B21A 3BKJL 4O2FB 4Y19D 2IFFL 4P46C 3S8WA 1YEEH 4JCMA 1G7MB 5D7IA 1IGTA 1IT9H 4WU7B 1EBAA 5IK3A 2DQTH 1BLNB 1G7LA 1MCJA 4NYLA 3IVKB 4WI3A 2JF1A 2VZ3A 2DLHA 4XNXL 4FQCH 4A2LA 1Z6JT 4NZRL 2OSLB 3Q2CA 5IKCB 1QBMH 1SBSH 4OI9A 4FQHB 2W60B 1QRNE 1O7VA 1KLFA 1BBJB 1UENA 3VG0L 4ZFFA 4F3FB 4D9RD 1YEGL 4RNRB 2LVCA 3HE7B 4ODWB 1ZT1A 2ZOLA 4TYUA 4XNYH 4ETQB 2EC8A 3LQAH 4PYHA 4C54A 4X99A 1P7QB 4LLVB 3VFUA 5JA8B 3ZYIA 5H37G 3LY6A 4M9OA 3STBA 4PJAE 4APQA 5I73C 5BMFH 2WINA 4TVPE 5JO5B 3RTQB 3WLBA 5D1ZC 5H37H 3WJLC 5C08D 1AGBB 4ZAKB 4PRIB 3V8CA 5B3JF 1FZOA 3QRFM 1EJ6A 2XI9A 1SHMA 3L7EB 1KNOB 1QPXA 5F7FA 3WFCL 5FGBA 1A7RH 3UBXA 5M7QA 5C0GB 4DVBA 2IBZX 3JBG7 5CJXC 4ZD3L 4OFPA 1CDHA 3QXDB 1LNUB 1BD2E 2DQUL 1S9VB 2GCYB 1T1XA 5F7LB 4U3HA 4KJQC 2H1PL 4UI2A 5D9SA 4YHIB 5INDB 3Q3GA 3T0XA 2FIKB 1A7NL 2CRYA 4EXPX 1D5XA 4HXBL 3HMWH 4PG9A 3QPQD 5J56B 5ALBL 4GKSA 4M1CC 4DAGL 3CU7A 1SEBA 1XMWA 1TETH 5FUCC 2X4PB 3HI1A 1UM6L 3BPLC 5E03A 1DEEB 1RZ7L 1KPUB 4YGAB 4E41B 3BFOA 2HWZH 4FQ2L 4MNQE 5BQ7A 4Y1AA 3VI4E 2APVA 2UUDK 2E5EA 3P73A 1A7QL 2V9TA 5JZ7C 4TQEH 3VWKD 3GKWL 1J1PL 3J7HA 1KJ3H 3ECBB 1A5FH 2NY2B 2D3VA 5CSZA 3JWNC 4GLRH 4Y5YA 1DQML 4MQ7A 3NH7H 2C3HA 3KPRA 1KG0A 5C9JB 4HCRL 3BZDA 4KKCC 3FQUA 3FN3A 5AD0B 3FFCA 4U0QB 2G9HB 1UADC 4P9HL 4XXCA 1LDSA 3QXAA 5D71L 1KEGH 5I1AA 4YX2L 1BOGA 4FQPA 1T2JA 5DRWB 3V6OE 4LHUB 1E6OL 1T6WA 2X4SA 2PYED 3FN0L 2F9BT 3KS0H 3NPZB 5JW3H 2BVQA 3IKCA 2YD5A 3UTSB 1I7RB 3T0VA 4PJXB 2R69L 3H3KA 3K46A 5DD3L 3MUY1 3BKMH 1ZANL 4BA8A 4IOSD 4YDIH 1TXKA 1ZS8B 1KCVL 4CJ1A 3ARDC 3L3DB 2ZOKA 3U79A 5BS0B 1HHGB 2PTTA 1CXIA 3D48R 5F3HA 5SX4I 2A9ML 3DWTA 4UV7H 4IIQA 1S8DA 4Q9RL 5ADPH 1I8IA 2W9LA 3SPVB 1OB1A 1U8KB 4LGPB 3O3AB 3WN5C 3TJEH 4MDIB 2EDKA 2QKIB 4UIKH 4MZ3A 2XWTB 1SMOA 1CZ8L 3H9SA 5B3NA 1DBJH 3E3QE 2AV1A 5D7JB 2FDBP 4AG4H 3WFHA 3QB7C 4S0SD 3VRIB 2H2SD 1YQ2A 4HHAB 4YQXH 1SJEA 1JNLH 1IC7L 5HGHA 4YK4B 3HZMA 2CH8A 3CXHJ 2VWEC 4XCFH 2VLJD 1S7UA 3QO1B 4ONHA 5ANMA 2LTQB 5D1QA 1CT8B 4WV1A 5CZVL 1UXWB 1XGPB 3B8SA 2GJ6A 4P23D 2VYRE 4U1KB 1GZPA 1FJ1B 3NCJL 4ZOBA 1A1NB 4PJ8D 1I1AC 1KCRH 4O9HL 3P0VH 1Q9OA 3QWOB 5F44A 5KSBF 1C5CH 4G8GD 1L0XA 5E8PB 5F1SA 3V4UH 3VFSA 3BWAB 4NUGH 4E0RB 1X5GA 4N0FB 1KGCE 1R5WA 3MV9B 2W0LA 3QRGH 1FNHA 3OKEB 2GEEA 3VD3A 2F53E 1IT9L 4QHLA 4PJDB 1QSEE 3R4DA 5J11C 2QQLL 4Y5VB 5FHBH 1U8IA 4XVJL 1F6FB 5DEGB 3P4MA 3B5GA 3ILQC 5DZNA 3WHXB 4QTHB 3TT3H 2J3SA 1T83A 4OCLC 5EU6B 1KTDB 3LKRA 1S9XB 4YFLF 1QBML 2AXGA 4FHBD 4RQQA 2VAAA 4HJGA 1PKQB 2R2HA 2M2DA 1ZA3B 3GJEA 1J7VR 1GAFH 5JOPD 2GITA 4XHJC 5DHVH 4KU1A 4PJBB 3H2WA 4PJ9D 4MD4A 4FQLL 4XNYL 3PQYB 4KKLD 5DJCA 2MWCA 2NY3D 2A6IA 4U1SB 3D2UA 3K2MC 2VXQH 4CDGC 3RI5F 1XCTA 4B5EA 4OUUB 2XXCB 4HIEA 5EG6C 4R2GB 1AGFB 3P4NB 5GRVK 2XICA 3DX7B 2GTWA 3QP3A 2HG5B 3EJYD 4DUXA 1A7RL 2YPLE 1JRHH 2CLRB 5E24E 5JOEA 5F97E 2ENYA 4QYOA 5TPWL 4JDZA 3IJHA 4AQ1B 3U4BH 1A3RH 5CBAA 1VFAA 2C4FU 5ENWA 4JFYB 3BVNB 2AK1H 3QWRA 1X44A 1B3JA 4AM0A 2VC2L 3CFIC 3HMWL 4KK9C 3RKDC 5CWSB 2VZ1A 3HAEG 5EU4B 2Z8RA 5I1EH 5I17B 2AEQH 5E2TH 3P0YH 4NNXB 3HAEH 5JW5A 4JPIA 2HWZL 4WU5B 4ZSOE 3SKNB 1Q8MA 2Z91A 1JWMB 3RVVC 3U6RA 1IM3A 3ARXA 3EBAA 1MH5A 4NO0B 5FB8B 1NC4B 1A5FL 3OB0K 5I74B 1AFVL 2P5WB 2VITA 5J9PB 2KQNA 4HKBA 5ITBH 2H32H 2VO5A 2R1XB 1NBYB 3RIFK 3RWCB 2HFGH 3CC5B 4HC1A 4LSSH 3CH1A 3VXSA 4DGIH 5DRNB 4JRXE 3IU4H 3V5DB 3QXTA 1R5VA 3S34H 1AC0A 4GO6B 5F89B 1U36A 2R29L 5I76A 3H3PH 3MC0A 5HYJA 4KRNA 4M7KL 3D85B 3STZB 4Y16D 5D5MA 4FA8A 5JW3L 4JDVB 3MREB 3TO4A 4LKXA 1EMTL 1JIBA 3BKML 1P4LB 1FBIH 2W9EL 1RFDH 5C9KA 4JRYD 1PYWB 1J0ZA 4B53A 1X5FA 4OZ4A 3CVHB 3QIBC 2I25N 5TE7H 1RY7B 5TGBA 3B5TA 4PRPD 2OL3H 1BQHB 3TBWA 4X83A 5ADPL 2BP3A 4CVZA 4Z7WF 1A6TB 3NOIA 4LLQB 3HE6C 2BNRD 4N1EA 3SHSA 1XIWA 1L0YA 4P2QD 4GAFB 1I3GH 4LCCB 2DF3A 4MNGA 3O9WB 1T04A 3ZHKA 3FTGA 4KQ3H 5JW4Q 4PREB 3TIDA 4ZDHA 2BXYA 4AG4L 1DUZA 1RZ8B 2DM3A 2G2RA 3BPOB 4NQVB 3ZZ1A 1DQLH 5T3ZD 5KZCB 5I6XB 2BSSB 2EIBA 4U1GB 1JNLL 1X4XA 3WNMA 3LRHA 2ATPB 2X4NA 5TE4H 3BJ91 5T3XD 1F02I 2YZ1A 4QHKJ 3PV7A 3VD9A 3HNTH 3UBXG 1HE7A 3JV4B 1QFPA 1YYMH 2YSSA 1S7RB 3MLSH 3WO4C 3SDXA 5DJAA 4GAJL 4JM4H 5I8OH 1JGDA 2ID5A 4PJIF 1KCRL 3JWDH 2NY6C 3AM8A 3MBEB 3KPSE 5IB3B 3P0VL 1NFIB 4M3JA 2Q86B 1C5CL 4Y19B 1HQRA 1B4JL 4NUGL 3X12B 3QNZB 5FIEA 2R8SH 1KPRA 5GZOC 4C4KO 5I1GH 4FQQA 3W11C 3HRPA 1MI5A 4Y2DA 3F7PC 5T3ZL 5E6IC 4W81A 4P49A 2H3NB 3NFNB 3QDJD 5IJVA 4PRNB 1VKXB 5FV2A 1JGEB 4KV5E 3MGOB 4POUB 1NAMA 5BV7C 2XV6B 1XR9B 4N68A 5FHBL 5T3XL 4DGVH 3JTTA 4CVWA 3TT3L 4KVNL 5HHPA 1YY9C 1MFDL 1QFWI 3C8HA 3QH3B 3BP7A 4RFNB 5DTFA 2Y06H 4WFGE 5F6HI 4WUUB 4GT7A 5M94B 2PW1B 2Z31A 1GAFL 1D6VH 1UYWH 3BP4B 1NEZB 5HD8D 3HR5B 2A6JA 4JM2C 3GSQA 4YZFE 3LPWA 3IGAB 4ZFZA 2VXQL 4MXQD 1BAFH 4D0BA 3KR3H 5C08B 4ENEC 3PWJA 1JPGA 5CJOH 4L3EE 1E27B 5DEFB 5AWNL 2PYFA 3ZT6A 1JTTA 5K59E 3NZ8B 3O6FD 2Q8AH 4GAGL 4FTVB 1Q38A 2Z92A 3BAEL 4PRIE 5SWSD 3E6FB 1NUGA 3ILPB 4KH2A 2P46B 2BNQA 1NGQH 1RZJL 3FRUB 2VOTA 4P5TA 3MZGB 5DXWA 4K8RD 3WUWA 3WFBL 2Y4SA 3OR7A 4XCYA 4PUBH 5I75C 1QFWM 1G6RL 3JTSB 3U4BL 2BVEA 3CFJA 3WFDH 5L2KE 1A3RL 1TDQA 1CGUA 4MD0B 2AV7B 1RJYB 3L3KA 5D7IF 3BO8B 4MNHB 3R06A 3SY0B 4G6AC 3WIHA 4A6YH 5J1TC 4FFZH 4IDJL 5I1EL 3RPKA 1TJGH 2AEQL 1R0AL 5KBNC 5E2TL 4R26L 3VWKB 2H26B 5GS1B 3RGVC 2VLME 5FDYA 1WTLA 4RAHA 1A6ZB 1TZIB 5JLZA 3F5WA 4RFEB 4ELKB 5IOPA 1YNTA 4P4KC 5IV2A 1HHHA 2D31B 4JPVL 3WNKA 4MXWL 4BM7A 4WFHE 15C8L 4S1QH 1LEKB 5KSAB 4WJ5A 2NY1B 3GIVB 2HFGL 1BJMA 3LN5B 1FC2D 4LSSL 2PF6A 5ECJE 2DLGA 1FN4B 3HB3D 2PYEB 3IU4L 4F57H 1FL6B 1EAPB 5TH2B 1HDMA 3IF1A 2VE6A 4H88H 3VMOA 4JGUA 5JHLH 1K5NA 3H3PL 4JFFE 1LMKA 1EEUA 4H26B 2ZJSH 1NBZA 3BD5A 3X17A 2J6EA 3UTSE 3F8UB 3FT2B 4XPGH 4PJXE 4HS3B 4JN2A 1FBIL 5IB1B 3ZKND 1P5VA 3TH4T 3QUXC 1U8LB 5GRUL 3O3DA 5IEHA 2ICEB 4KUCF 4TUJA 2X89D 5ESQB 3MOBH 5LGHL 3LEXA 5BS0E 3U48A 2QSTA 3JV6B 4YNYB 3L1OH 2BMKA 4KWUA 5DRXB 1H15B 1H8OA 2DYPA 2V5SA 4JZNB 1I3GL 2NY4C 3T77B 1J86A 4J2XA 4KQ3L 5GJSH 1RAMA 4MAYD 4LFHD 1MCCA 1U8OB 2BCKB 1N7MH 3PUCA 3ZO0A 4U6TA 5EBLB 5KVFH 3M17B 1J8HA 2OS7A 3LHPH 2BY3A 2IBBA 3ZL4H 2NCMA 4MB4A 1FNFA 2XWJB 4K07A 5TE4L 2FO4A 1QBAA 2VQ1A 3HNTL 1FHGA 1UXSA 4Y1AD 5FM5M 4PJ8B 3U7WL 3M07A 4HS8H 1YYML 3GBML 2ED7A 1GGIL 2DLFH 2D2OA 4G8GB 3MLSL 5DJXB 4XP5H 5I8OL 5JHDA 1NANH 1WFNA 4LKCA 1EZVY 4FXGB 2WBJA 3JWDL 1HQ4B 4OD3H 1RZGB 3QIUD 2DIAA 3KPRD 3TCLB 3KYMA 4YHPA 3L6FB 3S96A 2R8SL 2YRZA 5A2KH 5I1GL 2NW2B 3LEYL 1BZ7A 5B4MC 4P2CG 2EZ0D 5C0AA 5BRZD 3MV9E 5HYQB 2H6PA 5KSBB 1DFBH 1OAYH 3VXPA 2OZ4H 5IQ9A 4I48A 1A4JA 4YFLI 1J87A 4I8DA 5B39B 1OSPH 3HC3L 4QOKB 4KQ4H 5DQJA 2YPKB 4DGVL 1P2CB 2DAVA 4CAGA 4ISVA 5CMAB 5F1NB 3ZYJA 4C58B 5EU6E 4GAYB 3V6OC 1NCUA 3MUZ1 2NY3B 5DSCB 5D2LA 2Y06L 5FO8A 1A47A 1KC5L 8FABB 5C8JA 4YXLH 3SGKA 4KKAD 1S9WB 1MWAH 1NDMB 2I9LB 3BGFC 3EGSB 2YBRA 1RJZA 4N9GA 3IAQA 3PL6A 3PQYE 5DD6B 3U2SB 5GSRA 3HPJB 1I1FB 2C1OA 4CNIB 1T0NB 4HC1H 3KR3L 1CD9B 1FL5B 5K9KB 4JPKH 4YO0A 3RWIB 1OTUD 5CJOL 1JZ8A 1RK1A 4QHUA 2ITDB 3FQTB 3H9SD 5EZJA 3MLVH 1JCKA 2VH5H 4Y4HB 2Q8AL 1OOAA 3G08A 4M61A 4LQ1A 5IMMA 3L3HA 2CDGB 1BJ1J 1VFBB 3NIDF 3JV5A 4NQDB 1NGPL 1D6EB 3QEGL 3E3QC 3ZE0F 1VADA 3Q0HA 3OAYK 3DRTB 3KYNA 1NJ9B 2APBA 5CINH 2E6PA 3WFDL 2NLJB 1KCSH 1I1AA 1IAIL 5D1QD 5IW1B 2A77L 1UB5A 4UUJA 3O8XA 2XZQH 4KHXL 3C2AH 1SBBA 1U93B 3KNBB 5ID0B 4JE4B 4YHNB 3FO9B 3L5WA 3PDOB 4NWUH 4FFZL 1CDUA 3TVMD 1U3JA 3MRQA 1QUNA 3MRHB 1AY1H 3V0VA 3TYGH 1YNLL 4MDJB 1UT9A 2EIZA 4FS0A 1U6AH 4OGAC 1AGEA 1JN6A 3UJIH 5IB4B 3FB7A 4JFHD 3O2DA 4MMXC 2EYTA 4R97C 5DYOB 4J8RA 2QHRH 5HI5C 3GJFB 1QBBA 2P5WE 2ADGA 4IRJC 2JJSA 4GW5B 1D9KB 3MRBB 2Z0BA 2XKUA 3DGGA 4S1RH 3ARFC 43C9A 1T0MA 1N5AA 1JI1A 4U6YA 1I3RB 1NGZB 4XPBH 4JANA 4WW2B 2G5BA 3QULB 4ZG1A 3I02A 5CEZE 3L3JA 4MWFB 1KLUA 1F97A 3F7RA 3I75B 4P0DA 3D2UD 4F33A 5IWLC 2ZJSL 4JRYB 2J4WH 5CGYC 3LKOA 2PW2A 4HUKB 2OP4H 4BH7B 1IBGH 3EKCA 4LU5H 4NNPH 4Q7DA 4PRPB 5CBEB 2OQJB 2B0SH 4F7TA 4JDTH 2AXFB 4OGXH 2B4CL 1R3JA 5F7DB 2XPGA 3T8XA 5JXEA 3N9GL 1IJ9A 1T20B 2BNRB 3DPBA 3GI8H 4P2QB 2B8OT 2RJMA 1HNFA 3C6LB 5DO2D 1IL1B 2W65B 4BSVB 4K7PY 3FAWA 4DKAA 4M00A 5GZNC 1V3JA 3IU3B 4I3SH 4NNYA 5A43C 1N64H 2BFVL 4GG8A 1EGJA 3EYSH 5T1MB 3AB0C 3FT4B 4JFEB 4I3RH 3IDMA 3H6JA 4Z7WB 1INQB 4PGCA 1N7ML 5C6TH 3I50H 5KVFL 2OTWB 1U3HB 3ZL4L 3BW9B 3FQXA 4Q6IB 1FNEB 5EBWA 2CLVA 5BOZG 4P3DB 2XN9E 3IETA 4JZJB 3RVTD 2PO6D 3QNXB 1MLCA 3TWCH 4HKZB 1YN7B 3PF2A 4HLJA 4OGZA 4HS8L 1CLOH 1IGJA 1GGBH 3F7YA 1MUJB 4IRZH 4LHJB 4P57A 3RWDB 1PD6A 3NN8A 5I1HH 2NMSA 5SWZB 5MEQB 1WEJH 4RA3A 4OD3L 3X11B 2XWBA 3CSYB 1FG9C 3TJHC 5D5MF 2IH1B 3STLA 4Y19E 1MFCH 2FL5B 2VL4A 4PJIB 2YA1A 2IG2H 3VXSD 3C09C 1S78D 1JYVA 1MFBH 4OV5B 3V7AE 3FO2A 1PG7H 4NHUA 1DFBL 1OAYL 4PLKC 3WIHH 3MRCB 2YKLH 4K71C 3V0WH 2V7HB 2BSRB 2EDOA 2RCSH 5IW3A 4HK3J 2V5YA 1MCPH 4GW1A 3RUGA 2R9HD 4KQ4L 5DUPH 2GSIB 1G6RB 1A6UH 3BYYA 4PJGA 4D9RE 3QNYA 5HGAA 1GIGH 5AG9A 3TA3C 3VFPA 4XBPB 4RFOH 1LQSR 1Z9OA 5IBTL 3JUZA 4YXLL 5ICXB 3KLAA 2AK4B 4HIHA 1FP5A 2B2XL 4Z7NF 4PPTA 3BGAA 3UJJH 4E9LA 4ZXBC 3T08A 2DJSA 4HC1L 3HAEB 3O6FB 4JPKL 5C08E 5SWSB 1CD1A 2Y36L 4UU9B 3KJ4B 3ZE1F 3F6LA 1EEYB 3L3IB 3MLVL 2VH5L 4CMMA 2FIRT 3MRMB 3V4PL 4F7CB 1FG2A 1MFAH 5EO1B 3SDXF 1U8HB 3CFCH 3OJVC 3WFEL 3GSXB 4BZYA 2R1WA 3HNSH 4FZ8H 1IFHH 5JDSA 4NSKB 1IM9A 4RMRA 2YD1A 4BQCA 4WGWB 4N90D 5B3JE 5CINL 4PY7A 2DI8A 1ETZB 1KCSL 2VZSA 3O2VH 2XZQL 2ZKHH 3RL1A 4Z0BH 3VW3H 2HT2D 3B8YA 1YC8A 3DMMA 3NVQA 2DQDH 2WUBH 3T4AB 3REVA 2F5BL 4WVRA 2DWEB 2HRLA 2YUWA 4AIXA 1LE5A 1NDGA 1P6FA 4KROC 1AY1L 5D7IB 1IGTB 3TYGL 3K1DA 1JUFA 3WD5H 3DVGA 1MHPH 1G7LB 1MI5D 1U6AL 3VWJA 4NYLB 4Y2DD 1WWCA 4JFPA 3UJIL 2FX8L 1K8DA 4MA8L 4ZOEA 5F6IC 4J4PC 2QHRL 4W6XB 4ZFFB 3BN9D 3C6SB 4NJ9H 2Z4QA 3O0RL 1ZT1B 4S1RL 3QDMD 5KVEH 4X99B 4LVHC 4HDIA 1VEMA 4BSJA 3UBXI 4XPBL 2PYEE 2YPVH 5DJYA 4JB9H 3VFUB 1ACZA 5EUOA 4UT7H 1PGRB 4APQB 2WINB 3VG9B 3WLBB 5CD5D 3C8DA 5I71B 3AS2A 3P3YA 3LB6D 2M26A 1R6VA 2OP4L 1FVCA 1IBGL 3HE7C 1FZOB 1R3KA 3GDBA 3HR6A 5I8KL 4LU5L 4NNPL 2B0SL 3UBXB 5HDBF 4JDTL 4POZC 1XGYL 3FO0H 1F4XH 4DVBB 4OGXL 1NAML 4LPUA 1CBVH 2NX5D 5FGSA 3GI8L 1YPZA 4M1DH 1LEGA 1T1XB 3GHEH 4OAWA 5FYJD 4GMSL 3RTQC 5D9SB 2Q6WA 4PRAA 1I7ZA 3Q3GB 1BFSA 4ZAKC 3LRSA 4OZHE 1D5XB 4H5SA 1DQTA 1FPTL 1LO2H 2ZP0T 2JIXA 1N64L 4PG9B 4POYA 5L8LB 5JDJA 3EYSL 3IDYB 5IHZA 2VTFA 1PAMA 1SEBB 3CXDL 2I60H 3X13A 4LSTH 4IMLA 3G5ZA 2K1MA 4JFXA 1OGTA 4MLIA 12E8L 4F37K 3I50L 2F54A 4AJ0A 4TTGA 4PJ5A 2WWKO 2VLJE 4Y1AB 3RGVA 4TPRH 1QHPA 4YHOH 3MRFA 3P73B 4Z7OF 3K4AA 4P46D 5BW7A 2FJGA 3C9NA 4S2SA 4P4KA 2E3VA 3QEHA 3I6GA 5DD0L 5MP6H 3O3BA 1CLOL 3VRJA 5CSZB 3WIIL 3WKNA 1GGBL 4Y5YB 4MQ7B 1DBBL 3KPRB 1KG0B 1ES0A 4G8GE 4IRZL 4NKMA 3UTTD 3FQUB 5I1HL 2CUIA 1WAAA 1WEJL 3FFCB 3ISWA 4O51A 4QRUA 4N5ED 3QXAB 1FFQA 1ITBB 4NWTH 5T1DL 4OIAA 3ARSA 4OLXH 3MGTB 1MFCL 4Z7VA 5I1AB 5AG8A 3SE9H 1IAII 1BOGB 5HVWA 1JF5A 2X4SB 1MFBL 2NY2C 3QDGA 3TH2T 3MLUL 1PG7L 3WIHL 5KSBE 2BVQB 3IKCB 4B41A 3V0AC 5ISZA 2RCSL 5LQBH 1RZIA 5D93B 3PWUA 4I77H 1MCPL 1MVFA 4QOKE 5DUPL 2ZOKB 1XGUA 3QUXA 3CAFA 5JOPE 5IHLB 1GIGL 3DRQA 5F3HB 4RFOL 4ODTH 1T22A 4IIQB 3O2DH 3N06B 4KTEH 1QR4A 2V17H 1I8IB 1OB1B 2E9JA 1FLRH 1HHKA 5D2NA 4X6EA 4HQQH 4PGBA 1R3LA 1WZMA 1MF2L 2DWDA 3H9SB 3D18A 4ZOAA 3SO5A 1YUHA 2AV1B 2D7PA 4KJQD 4UV4L 2P8LA 5HVGB 3WFHB 4ZUUA 1BX2A 1WZLA 1IAIM 2QSVA 2WV3A 1SJEB 4TNVK 4GFTB 4M1CD 4FP8H 1K3ZA 1EV2E 5HGHB 3W81A 1J0KA 3HZMB 2AJ3A 4R4FH 2EKSA 3CFCL 3I3BA 4E42A 1S9YA 4PLJC 1T7WA 3FL7A 5SWQA 2J6EL 4FZ8L 1IFHL 4ONHB 5ANMB 1A21A 4YGVB 2BY0A 4G43B 5D1QB 2FHCA 4GUPA 1T7YA 5D7JC 4WV1B 5JZ7D 3HTLX 1SJHA 2GJ6B 1GZPB 3VDBA 1NGYA 3T2PA 2GT9A 1Q9OB 3O2VL 4RSVA 4AIZA 3P40A 3VFSB 4GQ9H 5KANG 4Z0BL 3VW3L 3SGEI 5C0RL 1ZGLP 1N5YH 2WBJD 2DQDL 1R5WB 1C7SA 1X5ZA 1OL0A 1KIRA 2LTQC 3OWEA 3VCLA 1FV1A 3MUJA 4QHLB 1KB9K 2P48B 5EOQH 5C0AD 5D2LF 4KHTH 1U8IB 3N1QC 1QQDA 3AXLA 1A6AA 3PGCA 3P4MB 3GBLA 1JZ7A 3LKRB 2AXGB 3C87A 4GG6A 4RQQB 4ELMA 3SCMA 1IKNC 1OP5K 5D7LA 2UUDH 4OT1H 2KDGA 2R0LL 2VAAB 4HJGB 5IVZA 2R2HB 2DMBA 3GJEB 4XCNA 1K4CA 5ALCH 1G9NH 3LN4A 2BC4A 2GITB 2MQ0A 3ARDD 4NJ9L 1JVKA 4MD4B 3O6KH 4Y0GA 5DJCB 1YDPA 5KVEL 2F19H 2A6IB 3D2UB 2NW3A 2JELH 4I2XE 2YPVL 3SJVD 4OLWH 1XCTB 1TVHA 4JB9L 4HW6A 4UT7L 1QD0A 3OPZH 1S5HA 4XXDA 5LWYH 3I2CH 4HIEB 2YN5A 4GMTH 3T3ME 1EFXA 4CU6A 4JRYE 2QTEA 5FKPA 4H8WL 2ESVA 3VD4A 2GTWB 1C5BH 1B6UA 1AO7A 4BQ9A 4PRPE 1AGDA 3FO0L 1F4XL 2Q20A 4UMGA 4X7SH 3RVXC 4KMTL 1CBVL 1BJ1H 1QFHA 2BNRE 4P2QE 2WNGA 3LVEA 4JDZB 3IJHB 4M1DL 2DKSA 4PJHA 3VXMD 1FH5H 5C0BA 5CBAB 4R2GC 1VFAB 2EO1A 5ENWB 1VENA 3UAJC 4ALAH 4AM0B 1LO2L 2L0DA 4AEFA 5T3ZE 1ZA6A 2VSCA 1LO3H 2I9TA 1I1AD 1F8TH 5I1LA 1ED3A 2BJMH 3IFOB 1IQDA 2KUTA 3MV7D 1A6WH 3JWOC 2I60L 3O8XD 4R4BA 4Z7WE 4LSTL 5J06A 5K9JH 5JR1H 4JQXC 3H7LA 5JW5B 4D2NA 3FONA 4JPIB 5T3XE 2YD6A 3ZKMC 4X7CC 2Z91B 3U6RB 3VJ6A 1IM3B 4YHOL 1V3MA 4IMKA 5J13B 3AAZA 5MP6L 2YD8A 1N4XH 3D5OF 3VXRA 2NR6C 2J7LA 4X7TA 4HKBB 4BUGA 4PJEA 3O3UN 2IFGA 4M6OH 4HGKC 2DTMH 1ZSDA 4OLUH 1BFVH 1T21A 5IEKA 3VGGA 2R56H 3ARUA 4P2OA 3CH1B 2C3GA 4UNTA 3VXSB 2NZIA 2BXZA 4GS7C 4YE4H 1F45A 2YA2A 2GY5A 1F6AA 1R5VB 4ODXA 4LDLB 4NWTL 1C5DA 1DN2A 3QDJE 3SE9L 5I76B 1ZGLA 4PJIE 5D72H 3UPCA 5HYJB 1G0XA 5I74C 5D5MB 1SQ2N 4WNQA 3BEVA 7FABH 4GRWH 2BVTA 3TO4B 3FOLA 4LKXB 3RWFA 3RAJH 5LQBL 5FOBA 2HLAA 4JFDA 4I77L 1WC7A 5HDOA 2X05A 4OZ4B 5DGQA 2IGFL 1UWEH 1WJ3A 1HYSC 5CJ8A 1OPGH 4MSWA 1JMZA 2VABA 5TGBB 4ODTL 4LDEB 1XGTA 4XPAH 5AYUL 5C1MB 4OB5L 3O2DL 1HSAA 1QHOA 4KTEL 4CU7A 5C09A 4CVZB 5J12C 2VIRB 1XIWB 4UQ2A 5ADOH 2D7QA 4AY0A 4KI1A 1D5IH 4ZS7H 2AK4E 1T04B 1EHAA 3FTGB 4HQQL 2CUHA 1XFPA 5FYLH 4NQEA 1HN1A 5T33L 2ZSVA 3F12A 4ZDHB 5TE6H 4Z6AT 1DUZB 2G2RB 4BZ1H 3ULVH 5SWSE 4LVEA 4L29A 4KK9D 1H3TA 4AMKH 1ZKAA 1FFOA 1DBAL 4FP8L 1IEAA 1CLCA 5FYKD 4F7EA 4YPGA 2X4NB 4R4FL 1CFQA 4U1NA 4LCCC 1KJMA 4G8FA 1MCRA 3O9WC 5EU7E 1O7SA 3AS0A 1OQXA 4J3XA 2R4RH 2R15A 1S7XA 1MEXH 5JQ6H 4HT1H 1VGEH 2YSSB 3SDXB 5DJAB 5C0JB 3W9DA 3QUYA 1YMMA 4NKQB 1JGDB 1I85C 5I1DA 1NGXA 1A64A 4LEXL 4HSQA 1HQRB 1HXYA 5TFSH 1N5YL 4F58L 4C83A 4BQBA 4FQQB 4MMZC 1MI5B 4W6YB 1UM4H 4Y2DB 2EE9A 3RUGF 1RUMH 3FOMA 4L8DA 1RZKH 3SDCC 1M7IA 5IJVB 4PJGF 5D7IE 3JXAA 5HHOA 5BVPH 3SE4A 1NAMB 4O4YH 4G8EA 1P9MC 4RGNB 3MACH 5ID1A 4KHTL 3MBEC 4KUZH 4WO4C 1FQ9C 3JTTB 3DO7A 1UA6H 1MIEH 3LEVH 5HHPB 1K6QH 2VXTH 3BP7B 3BYTA 5DTFB 1I1CA 1J12A 4JO2H 2EEBA 2ZG2A 6FABL 3F7QA 4OTXH 2Z31B 1G9NL 2G60H 2FCBA 5ALCL 4DKEL 3B4NA 3O6KL 2PNDA 3OB0H 4L8CA 3QIBD 2A6JB 1QSVA 3GSQB 2F19L 2E6JA 4EOWL 1M7XA 1CL7H 4XVTH 4ZFZB 1U8MA 2X4UA 2YR3A 4G9FA 4OLWL 4D0BB 4WCYH 3KYKH 4CN6A 4X7DC 1S3KH 3OPZL 5DUMH 3PWJB 3MJ7A 1JPGB 3WS6A 3WHE0 2WLZA 3I2CL 3MLXH 2PYFB 1LP9A 4RFNC 3OKDA 4J1UA 3TPUA 5GRJH 3F7VA 3OSKA 4GMTL 4HULB 2VN4A 4JVWA 3RRQA 1YEIH 2Z92B 3ESUF 2NX5B 5F9AC 5JORA 3IDUA 3MCKA 1REIA 5E0QA 4P5TB 3WUWB 3PHOA 3OR7B 4XCYB 3TC9A 4MB3A 5C07D 1MIMH 4NFDA 2APTA 4PG2A 3CFJB 1HIML 1QEWA 4Z9KB 2WIMA 5I16B 3JV0A 3R06B 5JTWA 1ZLSH 3LOWA 4HWEH 5JIHA 1U9KA 2NY6D 1F8TL 5D72L 1NBQA 1X4ZA 1UWGH 1OLLA 2P5EA 4P46B 3ZMRA 2VUOA 2XG4A 4P9HC 3DMMD 5GZOD 5C7XH 3QPQC 4Y5XC 4M1GH 2QQKH 1U2HA 4Y1AE 1CXHA 3W11D 3P4LA 5JLZB 4PGZA 5E6ID 4NFCA 5IOPB 2J2ZA 1YNTB 2LU4A 5IV2B 1BVZA 1NSNH 3D3VD 3DETC 3MJ8A 2CR6A 1A7OL 1N4XL 4JM2F 4J4PA 4PRHA 3ULVF 1ORQB 4M6OL 2DTML 5EUOF 4WJ5B 4OLUL 3KPRE 2BY2A 4GKZB 3N0PB 1YY9D 4M6MH 4QHKI 3VWKC 1E4JA 5GS1C 3FFCE 2UY7A 5BRZE 2XRAH 4D3CH 2W9DH 5DK2A 1HDMB 3IF1B 2VE6B 2E7LC 3D6GA 2G75A 1K5NB 4JM2D 3UJTH 4XVUD 2W38A 3RX8A 1LDPL 4Q2ZA 3BKCH 7FABL 1NBZB 1AKJA 2BOBA 3SDAA 5KSAC 2X1PA 4ENED 1YPZF 5FOJA 2NY1C 1S5IH 3RAJL 5CZXD 4JN2B 3MRPA 3MPCA 1NLDH 1E28A 2V5MA 5IEHB 4F9PA 3O3DB 4TUJB 2DOCA 3LEXB 1UWEL 5FA4A 1TVBA 2GK0A 1OPGL 2EH8H 3KPNA 4XPAL 3IFPA 2BMKB 3GKZA 3EJZC 5ADOL 2DYPB 1D5IL 4ZS7L 1HCVA 1I7UA 2IQ9H 2O5XH 3FZUC 5DJ6A 4XVSH 4KY1L 2UVEA 1P4BH 3H9SE 1ULVA 5B38G 3RVWC 2JIXD 2EXWD 3ULVL 3H9HA 1F2QA 1J8HB 4LCYA 4AMKL 2IAMA 2CRMA 5GGSA 1U95A 3O6MH 3MMEA 4XT1C 4C4KT 5H35A 2F54D 2FO4B 3TNNA 3LS4H 2VQ1B 4OFDA 1WAAF 2H2SC 4PJ5D 5EULV 1UXSB 3RGVD 4NN5C 4LARH 4UQ3A 3BMWA 5GRVL 5IT2H 1MEXL 5ANME 5JQ6L 1VGEL 2I07A 4KDTC 4PTUA 4OI7A 4L4VA 4Z7VF 4HUNB 4P4KD 1IAOA 3S4SA 5JHDB 4LKCB 2VSDA 4QO1A 2WBJB 3NIDE 1WIPA 4GRMB 1FNGA 3MFGB 3KYMB 4YHPB 3S96B 3VFGH 1BIHA 3O2WH 5TFSL 1BZ7B 4FFWD 5C0AB 4L4TA 2D7NA 4BJLA 3S3JA 2H6PB 3VXPB 1RZKL 3KPLA 1T1ZA 5IQ9B 4I48B 4NQCA 1A4JB 1WK0A 3MYZA 4JFHE 4LIQH 3BQUA 1FZJA 4O4YL 3MACL 4N8VB 4KUZL 5DQJB 1EA9C 1H5BA 1MIEL 1X5KA 2PTUA 1KCUL 2MKLC 3D39D 4ISVB 3LEVL 4OZGA 1LD9A 3VRLF 4LPXA 4IEFB 1AH1A 2VDKH 1D5MA 5FO8B 5D2LB 1EHNA 5C8JB 1DQQA 3QUXD 2G60L 5J0BA 1LK3L 1VPOL 2MPAH 2CK0H 1L6ZA 2YBRB 4N9GB 1CD0A 3PL6B 5GSRB 2C1OB 5C3TA 4XVTL 5E5RB 2ZSWA 4WCYL 3KYKL 3IDXH 1S3KL 1TTFA 5DUML 1NCAH 4YO0B 5T1KD 3BE1H 1RK1B 2NY4D 3MLXL 4OCNC 4QHUB 4GKNA 1CXFA 4JO1L 1N2RA 4K7PL 2NY3C 5EZJB 5GRJL 4MQXC 1LO4H 4RAUA 2X9WA 3G08B 1YEIL 4M61B 5IMMB 1MJ8H 3L3HB 1CVSC 4HX1A 3MXWH 5FM8A 3MRKA 4C55A 5E7BA 1TTGA 1JJUA 3BRFA 5DVLA 3TYFA 1MIML 3KYNB 1QLEH 4U1HA 5IFAH 3ZDYF 3EJYC 1I1AB 2CK2A 5GGQH 1UB5B 4UUJB 4Y4HC 3O8XB 5IMOA 3MRNA 3EO0A 1ZLSL 1OAZH 1L9NA 3L5WB 4KK6C 5IFJA 3BRGC 1DQJA 1WWBX 4WTZA 4YC2B 3HFMH 3MRQB 1UWGL 3EDKA 3V0VB 4ODVH 4MQSB 5DT1H 1RUAL 4RDQG 4G3YH 4ELMF