4YXLL

Crystal structure of syrian hamster prion protein complexed with pom1 fab
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
213
structure length
213
Chain Sequence
DIVLTQSPAILSVSPGERVSFSCRASQNIGTSIHWYQQRTNESPRLIIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQSNTWPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSETDQDSKDSTYSMSSTLTLTKDEYERHNTYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structural and molecular dynamical studies of the globular domains of cow, deer, elk and Syrian hamster prion proteins.
pubmed doi rcsb
source organism Mesocricetus auratus
molecule tags Immune system
molecule keywords Major prion protein
total genus 44
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yxlL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yxlL01
3TO4A 3HI5L 4WWKA 5C0BB 1MREH 4QOKA 3TEUA 3CDCA 1JN6A 5HYJB 5IMKA 3K3QA 1Q0XH 4PJBB 4Q9QH 4JREB 3DETD 1Q72L 3QUKB 3DROB 3HAEH 3LRHA 1FDLH 2I07A 3VFOB 2GJ6A 4Q58C 4MJ6B 2O61A 4HUWA 5SWSE 2W60B 4LCCB 3RWHA 4I0PD 3W5MA 2UWEE 2X4OA 5HGHA 2KZ1B 4Z76B 5C6WH 1AXSB 1VFAA 4HWZA 4NFBA 3RL1B 1MFAL 4ELME 2FR4A 5FKAB 2VXSL 4N90E 3LDBB 4QGYA 1YECH 1DR9A 3PWJB 1UGNA 3IFLL 5JQHC 1N2RB 4RMQA 2VABA 4GW5B 4I48A 2XWBA 1R5IA 1HEZA 3VWKA 4LLQA 1T0NA 2I24N 5BQ7A 3T4YA 1YEFL 2KQNA 3GSNA 5GISL 1NCNA 5FOBB 2X4SA 1JK8A 4RQQA 4X4XB 1A9EB 5EOTA 5FB8A 4BUHA 2H32H 4M02A 4XPBL 1U8MA 5CP3A 3DECA 4JQVA 5EORH 4IIQB 3F7VA 1UACH 1Y6NR 3U4BH 3MACH 1PEZA 4JFDA 5GGSB 3WIHH 2BHUA 3SDCA 5F8RC 1MI5A 2R2EB 1T3FB 1OQXA 1DQQA 3P4NA 2JJTA 3D25B 2ITDB 3O6ML 5HI3C 3UAJD 3UBXI 5D6CA 3WIFA 3UTPE 2BXYA 2PNDA 4N9GB 4V1DE 4KDVA 4L4TA 2VDOL 2LU7A 3ZYIA 3FRUB 3QJFB 1A6VL 2FD6H 1GZQB 4Y7MA 1TJGL 5DVNA 2I60H 2EDLA 1D5IL 2J88L 4ODXB 3FO2A 2WQ8A 4NKMB 3GSWA 4XBGA 4P49A 4X5LA 4M61B 1WISA 4OD2A 1EHLL 1EEQA 4OUOA 4HK0B 1AQDA 1RURL 1FAIL 4U1KA 3VFMA 4YPGA 1DQDH 4M7JH 3QWOB 4HBCL 2AJVH 3KR3H 4TNVF 2HFGL 1KUMA 1SYVA 5CS7A 2UWEA 4M00A 5HYEA 4WW1B 4EIGB 4RZCA 4LVHC 3PGDB 2BCKB 4AK1A 2B4CC 3ARFB 2EDBA 4OGZA 1ZHNA 2EE9A 4PLNC 5GGTA 3CFKA 5E2UH 5IROA 3H3KA 1MEXH 4TPRL 5DFTA 4OLVL 1QEWA 4ZXBC 5D96C 3D1MC 5DRWB 3PXHA 4XAWH 3BN9D 3TBTB 5AZEH 2X4NB 4G8GA 3QUXC 2D4DA 4C56D 3PV6A 5KS9E 1F8TH 4G7VH 2BNQE 2YC1A 3QJHB 3QDMD 4YXHL 4JM2F 2J8OA 3OJVC 4YHPA 4AMKH 3DHJA 4KK6C 1DCLA 2EO1A 4PJAA 2NY1B 1U41A 1CXIA 1EO7A 4PRAA 4PJFF 3QFJB 5ANMB 2Y5TA 5EG6C 3RTQA 3DVNA 5LAXB 4HJJH 5C07A 3TO2B 3STBA 4HCRL 1INEH 3U9PL 2YA0A 3BZ4A 4HH9B 4OZFH 5HYJD 4X6EA 4QXUL 4JQIH 1UKTA 1HHGA 2FJHB 3ABZA 4PRBB 3RDTA 3MLYH 4IMLB 1R3HA 1OPGH 2VZVA 5DI8A 2Z31C 5EN2B 1E28B 3FFCD 3GMQB 2GEEA 3IS1X 3VXUA 4JKMA 4PJFA 3FN0L 4I3RL 4KROB 1W8OA 4RDQF 4ERSL 4MDJB 4NJ9L 4FTVA 4Z7UF 4S1RH 3VFMB 1A6PA 4JLRA 5TFSL 1AO7D 3WO3B 2VH5H 3QEQE 1JZ2A 1T7WA 1BEYL 2J4WL 3CUPB 2DJ4A 2ZSWA 4FQQA 3ZE0E 4FABH 2YD2A 3KPRA 3F6IA 4OM1H 4I5BA 4YDKL 3S6CA 4HULB 1BQHG 1A6UL 2VAAB 3T3ME 3ROLB 5B8CA 5CBEB 2VRAA 3OKEB 4ELMB 4O02H 4MQ7B 3ZTJG 5L88L 4Y5YC 4E0RA 4UZGA 2Z31D 5JR1H 4RWHA 1XZ0B 1Q8MA 1I1FB 3QDJB 1A7QL 3WFBH 2DWEB 2O5ZL 2MOVA 1SHMA 3EO1B 4YDJB 4Y5XA 4LCWA 5EBGA 5FOJA 4WFFD 4OZIE 2FZ3B 4N8VG 4OV5B 1EXUB 5GSVB 3MNWA 3BN3B 3U83A 3SDCB 4OSUL 5HDLA 2XKSA 4K2UL 3VFVA 1X5IA 2V5YA 2JB6B 4U6XB 3P11H 3OB0K 3BD3A 5E2WL 4CN6A 2L0DA 3ARFD 4FHBD 4U6TA 4R0LA 4PJ5B 1FCGA 1H3XA 4X4MA 3KAAA 4XWOC 2AK4D 4R8WL 4KQ4L 35C8L 4X4XA 1RZ7H 1OAXH 1VEMA 4MMZC 4N68A 4WTZG 1UJ3A 5CWSB 4OLZH 1CFBA 5I8OL 4F7CB 3OJDA 3WNMA 4OSUH 3Q1SL 5KSAB 2V5RA 4O5LL 1FBIL 5EOCJ 4MLSA 4L9LC 4ODWA 2A0LC 2YS4A 2EKSB 1X9QA 1BOGA 1TQCB 4FQCL 3VA2C 1WC7B 1FZJB 4DKFL 4X6FB 4NZTH 3O9WD 3KPLA 1J1XH 4FTVE 1YJDC 4C56B 1FFQA 3MV7E 4WCYL 4BQ8A 3HNSH 1Z3GL 4L3AA 3TPKA 3ALWA 3HAEG 3OKNB 1U8PA 4P48A 2OMBA 1OP5H 1LO5A 3MR9A 1A3LH 3HZVB 4NN6C 4DKFH 3EJZD 3JWNC 5IF0B 3QI9B 3QCTL 3VGHA 4IRSD 3IXAB 2V9QA 3N85L 3FO9A 4CADA 2VAAA 4PJ8C 5F1OB 3R1GH 1VFBB 2F54A 4NQEA 2EEDA 3SDAA 3VWJD 5KG9A 4PP1C 5KSBA 4KXZI 2HH0L 4TNWK 4XCFH 2BVQA 1CDHA 1INEL 4HCRH 4YIQA 1RZJL 1UZ8A 1VEOA 3WUZA 2VXQL 2X4TB 5J06A 5L2JB 4DN4H 3L3DA 5INCA 12E8L 4DGVH 4R90H 2EKJA 3LCYA 2DQIL 1AGBB 4D0DA 1X5JA 1R5WA 4DAGH 3O6MH 3U2SB 3A67L 3MO1B 5GGRA 4TNWF 4XWGH 3V6ZB 5GGTL 3DO3A 5I1CL 4OBSA 5BMFH 2F53E 5H2BA 4NKOB 4X6EB 2XKNA 3ESUF 5C0AD 1SMOA 2XNAB 4S1DD 3B43A 3GRWH 3MACL 2H32B 4LARH 3MA7B 1YNKL 3DXAA 4ZPTB 1I1AD 1N3NA 3NA9L 4NWTL 5ITBL 2H3NA 4U33A 3F58L 4TPRH 3UAJC 5FGSA 1D5ZA 4R2GD 3L5HA 4ZNCD 3HG1E 3DX9A 1Y18B 1A3QA 1IC7H 3KDMB 3PE9A 2VE6B 3GNMH 5KSUB 2AJ3A 3LQZA 5L7XL 4G9FB 3KYMA 4X7SH 3UBXG 4PJAE 5ISZA 3BWAB 3UTOA 2JK5B 4ONOA 2D7TH 5ID0A 1HHJA 1KB5B 2A2QT 4P5KA 5JXED 5JIHA 1I8IB 5K9OB 4NO5B 5MENB 4YDLB 1F4AA 2F8OA 4JDTH 1U8QA 4Z95L 1CFVH 3QDJD 3FT3A 3ZYOA 3DX6A 4GW4B 3EZJB 4BZ1L 3HAEB 4G6FB 3MLYL 1A6VH 4HG4J 3TT3H 4P9HL 5FYJH 1NGWB 2GJZB 4HK3N 3SQOH 5T1DH 2FIRT 5EZLB 4YHIA 1EX0A 5CZKA 5DEZA 1LO3L 1N3NB 3C60D 2FO4B 5GGQL 3BKYH 3OGCA 4I18B 1BWWA 2NTFA 1A1MB 1U95A 5T5NG 4OBRA 5F97E 1NCTA 2IQ9H 3IJHA 4NBZB 2HJLB 3D18B 3TT1L 1TPXC 3HE7B 3LRSB 5HGGS 3MJ9L 3I6KB 3U4BL 1KIUA 3OKKB 3QZWA 3LV3A 2NY5C 1KJVB 4L4TD 2VZ1A 2EDRA 1N64L 3GFUA 5F7EL 3SE9L 1FVEB 3T3PF 4EUPG 2EXYC 3ZE2E 1EJOL 3MRQA 1P7QD 2V2WA 5F9JA 3ZYZA 3H42L 4QRQA 2QSTA 1NSNL 2VLRB 1YZZA 2EYSB 3B5HA 5DO2C 4YXKH 3QEHA 4UILL 4HUXB 2DMKA 4P2OC 4P2QA 3MLTA 4DK6A 3EUUA 2RQ8A 3OAZH 1FG2B 1J88A 2C7UA 3X13A 3D0VB 5HHVH 4PUBH 2OTWA 1CQKA 4M7ZB 1OB1A 4LCCC 4NJAL 4HDIA 4YE4H 4KU1A 1LO5B 1ZT7B 3VXSE 3GRWL 3VXRB 5IJKC 1T2QL 3EOAA 4PY8J 3QI9D 2GCYA 2M1KA 2G5BA 4ODHL 3GK8H 5E7FA 4XPHH 4HXAH 1V7MH 5F7WC 1R3IH 5J1AA 4C56A 3KPMA 3NIDF 1AXTL 2BFVH 2VDOH 4E41E 4XXDA 2OI9C 3GMOB 1RHHA 5TF1H 4LCCA 1GIGL 32C2B 5CFHA 3QEUA 5M7QA 4HIJB 4MJ6A 1PJ9A 4H20L 2WLYA 4XC3H 1T83A 4P46B 3RKDD 5F1KC 3MV7A 4HPYH 3LIZH 2XQYG 5DR5H 5IM7B 1J0KA 1FO0A 3RWCA 3P4MB 1RD6A 2C3HA 3HPJA 3HS0A 4F7CA 3MRCA 4RAHA 4WUKH 4Y8DC 3T2PA 1S9YB 1E4XI 3SOBH 3RWDA 5CIPH 4IM8A 4Z7QE 1R24A 3KLAA 2FGWH 4YAQB 4JM2B 4WHDA 4MB5A 1F42A 3O9WC 5CSGA 3D85A 3H9ZA 3T0EA 2A38A 3NPSB 4NQVB 4LVNC 3C60A 5KSUA 1B0GA 3O8XB 3CD4A 1BAFH 3KPOA 2PCPA 3CFEB 1OP5K 5I8CA 1AHWB 1MIEH 3DI2B 3QPXH 4K3JL 5MEPA 5E6ZA 3CXDL 4EUPB 3GHEH 4KUCD 1YN6B 1Z9OA 5JORA 4LLYB 5J3HC 1L7IH 4HIEA 1RMFH 3EO1A 4XI5D 4ZFZA 3D0LA 1BQUA 3U30C 5FUZL 5IWLA 1ED3A 1RQ5A 3SDXE 3DSFH 1MELA 3VGAC 1V5JA 1INQB 1C16A 2YBRA 1QRNA 5J4MA 4JHAH 3VWKD 1G6RB 4PJHF 2W9LA 4PJ7A 1TVBA 1WVZA 1WCBA 4IOIB 1WITA 4HC1H 4MD5A 3RZCB 3CVIH 1HWGB 4K8RL 4P2QD 7CGTA 5IBLD 4NDMA 1JGDB 2X44D 2VOTA 3OR7A 2UZIH 1RK0B 1JRHL 3GB7A 4UT7H 5C0JA 1SVZA 4NBYB 3GMMB 3O2WH 3RPKA 4KQ4H 4LSSH 4PJHA 2D03L 2XA3A 1VFBA 5C70A 4UINL 1KTLA 4PTTB 4F7MB 4Y1AB 5E2WH 4KDTC 3MLSL 1D9KD 4DK3A 2QSVA 3DWTA 2DKMA 2QBWA 3N0PB 3MUY1 2OBGA 4HWNA 3O4LD 3TJEL 1IC1A 1H15A 1U42A 2BNRE 2YEZB 3MJ6A 3V7AG 2DN7A 3ZKMC 5CEZL 3BP4B 3BQUD 4GG6E 1DQMH 4P3CH 4XBEL 5E94B 1MCNA 3V6FA 2LVEA 3IS0X 4P3DB 4PRIB 1NFIB 5JHDB 4N0UE 4L29B 4G6ML 1R3IL 3P4LA 1P4LA 5BZDB 1IGTB 1W0WA 4GSDH 3C09C 2RIKA 5I8KH 4JQXA 4RISL 5DJ6B 2ZOKB 1BZ9B 4V1DD 2BVYA 4RGNC 5GGVY 4DKDC 4XMPH 1X5ZA 4MDIA 3O3BB 3UJJL 4Z78B 5KSAA 4R0LC 2JELH 4JZJA 4NRZB 4DN3L 2MCPL 2OQJA 3JUZA 4WW1A 2A83B 3UYRL 4Y4KA 4YXKL 4XCEA 4LVOB 5D7LD 1CK0L 1OB1B 4TUJA 4LLVA 4G6KH 4G3YL 2BDNH 4D2NA 2X1QA 3ELAT 3GGWA 1CIDA 5JXEC 4JO1L 3O6KH 3F12B 3ZKNC 5KSVA 3LS5L 5I75B 4U0QB 1E4XH 2DQGH 1IAII 2V7HA 1FIGH 2IBBA 5ERWB 2AI0L 4QEGA 3X11A 3ZT6A 1WFOA 5C0AB 4U1LB 1B0RB 3EOBA 3MODL 4EI5C 2R8SH 5DZLA 3BIKA 2EDQA 1NH6A 4RAVA 4N9GA 3O2DL 3MRKA 4JPVL 5FGCE 1R3KB 3SDYL 5B4MC 3WIFB 2OZ4H 1KJVA 3DRTA 9CGTA 2DQDL 5DJ0A 3LDBC 4GRWE 5EU7E 5C0AA 1IAOA 4L4VE 1B3JA 3BUYB 1CK0H 3ULVL 4XMPL 1FVDB 5GGSA 3PP4H 4GKZA 4X4ZA 3G6AA 4PJXF 2X1OA 3RDTC 4Z8FL 4JLRB 5F8QC 1CICB 1ZT4A 5HD8C 4NRYB 1KEGH 3HUJB 1HILA 1ZT1A 1UH2A 2DQHL 1VFMA 3CPLB 2Y1VA 4ZSOA 2CH8A 3VXUB 4JO2H 1HIMH 4ZS7H 1S3KL 2OJEB 2A83A 2XV6B 3I84A 4JFQA 5DEFA 1VCAA 3CZJA 3HE7D 3T65B 2NR6D 3MYJB 2FJHA 4PRBA 4TOYL 3O4LA 2HTLC 1OAZL 4NRZA 2Y7QA 1KJ3L 3ZE0F 1N2RA 3FT4A 1YN7A 3QDJE 4Z7QF 3MTRA 4P5KB 1HSAA 1X6NA 3A6CH 5DHVH 3TCXA 3RGVC 1QPPA 3E2HC 3SKOB 5JW4M 2FL5A 2RFXB 5HHMD 3MLSH 4HJ0D 1N59A 3K81A 5IHZB 3EYSH 3AU1B 4XMLL 1U8NA 4LCIL 4OF0A 4X0KA 2X9YA 2YWZA 4PGEB 3IFOA 5HYJA 1BFVL 1K4DB 2E6JA 3BYYA 2LE9A 3B2UC 1JRHH 1AFVH 5TQ0L 5BVJA 1I7RB 3SKMB 5JDJA 5DJAA 1A7BA 5EORL 5LWYH 3FAWA 3UPAA 3QDGB 3ECBB 5DS8A 4JPIB 5EOCL 2XPGA 4V1DB 1A6AA 3O4LB 3SE4C 5F7UA 4WHTA 4MYWB 3VXNA 1BLNA 2PW2A 4M48L 4OQTH 4Y89A 2HH0H 2CKBL 1PY4A 1T5XB 4JM4L 3IFLH 2Z91A 4F58H 1RUAL 4Z7VE 3PL6B 1G7PA 3V4PL 3ZL4L 1HXYA 1C8PA 1AQDB 1ACZA 4Z7OE 3AY4C 5J8OA 1BBJA 4L8CB 2DWDB 2AEQL 1CS6A 2YSSA 2RHEA 1A64A 4EI5A 3SGKA 3QG6B 5FF6A 1GH7A 5D9SB 4KTDL 2N7AA 1UVQA 3QUML 2DM7A 2CMRL 2YD5A 4R96B 3SQBA 3BIBX 1MVFA 3T4AA 4FQLH 3B2VH 3MROB 3S34L 3KPQB 4ZFZB 4HFWB 4LNRB 4PG2A 5SWZB 2AK1H 2PTVA 3BDYL 3IJYA 4JQVC 4XNXH 3QHFH 4YHZH 3VGDA 4BFGA 4U7KA 2CKBH 3QT2A 4NCC1 4N0UA 3MGTB 3PG2A 4UT6L 1B4JH 3EBAA 3INUL 4OAWA 3MRNA 3GMRA 1WC7A 4R7DB 4G8GE 1R3JB 2NXYB 4OUUB 4BQCA 3LKSA 2ZJSH 3QFDB 3V6OC 1G9NH 1GPOL 2APFA 4U1IB 2FBJL 3ARDB 4LSTH 1QFWL 1BFSA 1V8HA 4XC3L 1PLGH 2IQAA 3OAYK 4E5XB 1KFAH 3B9KB 4X99A 2A6KB 3KJ4C 1MCIA 4XC1L 3T0EC 2I26N 4M6AA 3LZFH 4WU5A 2PYEA 3S37L 3SO3C 2DL9A 1BZ9A 4U2ZA 3MV9B 2W38A 4DGYL 2A74A 3RWFA 4HKBB 2OSLA 3HG1A 1CI5A 1WQVT 5FCUH 1L9NA 4Y5YB 4HWZB 1UEMA 3REWA 2EXWC 2WINA 5D2NE 5E9DD 1HKLH 2A1WH 3C8HA 5HGAB 4EDWH 3AS3A 2WWMD 1FZKB 3H8NA 4PRHB 2A74B 3FB5B 3T3MF 5KAQG 4UILH 1YJDH 2ED8A 2B20A 2P5EA 4L1HA 4PUBL 3SPVA 3NZHL 3H42H 3EOAB 2EZ0D 4U7MA 5ALBL 3I9GH 1UXWA 4Z7UE 3RI5F 3KYOB 3HE6B 1HINL 1JE6A 2A6JB 4OLWH 4F9LA 4L4TE 5IEHB 4E0RB 2D9QB 3TJHD 2NLJB 1AXIB 3LPGA 4IDJH 2FEEI 2QHRH 4G9FE 5JLZA 4HAGA 1KTLB 1BBDH 4PTTA 2MJWA 5E8DH 2GJ6E 4CNIB 3GMPB 4F7MA 1I9IL 1JGLH 2QR0B 2ZSWB 4XHJD 1S7XB 5KSAC 5LQBH 5IQ9A 3X12A 5E2VL 5JXAH 2NY5H 1R3LB 2IQ9L 1KSRA 4FZEL 1MY7A 4RFNB 5KVGH 1ZGLP 4GAGL 1F3DH 4LKXB 4OM0H 4W70A 4BFEA 1MQ8A 3BRFA 4JQXC 1AO7E 3TCLA 1TQCC 3BESR 4JG1L 1MI5D 3BXNB 4NO3B 4R4ND 3TT3L 3NTCL 4QCIB 4LLWA 3O11A 4MNGB 1F2QA 2QSCH 3LKNA 4H0GA 5JOFA 2P8MA 1K9TA 4BZ1H 5I1IL 5I16A 3K0WA 2ID5A 1MIMH 4YZFF 1OGAD 2COQA 2DD8H 3GO1L 5EU5A 4PJEA 2F58L 4CU6A 1GAFH 2YA1A 1A1MA 1U95B 5CILH 4ONHA 4OV6F 1LVEA 3P9MA 4OJFH 4MD0B 5CUSH 2FNBA 4EBQL 3O9WB 3K7UA 4XHQA 1WBYA 3W9EA 3LHPH 3O6FB 3HRZA 1FYTD 1ROWA 2NXZB 2NY6B 1YEEH 3VXNB 2IALA 1C7SA 5I1JH 1RZJC 3QBTB 5EBMB 4I0PC 3IKCA 5A2LH 4L3EB 1KCLA 3OF6A 5D9SA 5MERA 4KK5D 1KBGL 3C6LB 4UDTB 1HKLL 5F1IA 1OW0A 2X4UA 4GSDL 3WFCL 2DWDA 5L8JB 4KMTH 3TN0C 5F7MC 4WO4D 4L3CB 1YNKH 3WKML 4L4VD 4S0TD 1NAML 2E7LA 3DUSB 5LGJA 2Y25A 1Y18A 2NY0C 3QUYC 1NANH 3CVHB 1DVFC 2FD6L 1JZ8A 2I9LA 3BGFC 3L7FB 3MX0A 1MFDH 3TM6A 3WHXA 1FPTH 3IETA 5I1AB 5L6YH 3NCYP 3RGVD 4YHLL 3P4OB 5I16B 4N8VA 3IDGA 3JVGA 4IEFB 2EECA 3HZKB 4P23C 3UTPD 2GUOA 5GS1C 4OZGB 3N85H 2YD9A 1K8IA 4ZYKA 5E2TH 3IFPA 2HVKA 3L5WB 3MGOB 1FFNA 2Y07H 4OTXL 4Z18A 4DTGL 3WIHL 1MFBH 1SY6A 2ZNXA 3A6BH 4I9WE 4MVBD 4HC1L 3CU1A 1MI5B 4DZBB 1DDHB 5EO9A 1IGMH 1EERB 1ZSDB 4KJYB 4QRSA 3CMGA 1DE4A 4HLZH 3I50H 4KVNH 1I85A 4Y16D 4NCC2 3SCMC 1DEDA 2F5BH 3QI9A 3C5ZD 1X5FA 1ORQB 4DQOL 1OGAA 4WCYH 2AEPH 3FO0H 4JRYE 1T1XB 2JCCA 4LPVA 1KT2A 3BD5A 1L0YA 1PZUB 5HHPA 1CLYL 3P4OA 3N1QC 4K3JH 5HHOE 4OGXH 1MAMH 3VXMD 4XNZC 3MCLL 1JHLH 2HMIC 3WFHA 1LO0L 4Q9RL 1OSPL 5GRXG 35C8H 5LG1A 1NGQH 4FZ8H 1JNJA 5D1ZB 3ULVC 4RGOL 1NCAL 3QYCA 1DUZA 4JZOA 3KPSB 4K3EL 5CMAB 2I07B 2OS7A 5DFVD 3QIUD 4W4OC 5BRZB 1IEHA 5C0EB 4O51A 1A7OH 5EOQH 1KTRL 4KJQC 3EDKA 1TJIL 1V3LA 1REIA 4U1JA 3OJDB 4WFGE 4PGDA 3OXSB 4LFHG 1I8IA 1AIFB 4L4VB 4PJBF 5K9OA 1MCLA 2HJFA 1QKZH 2FCBA 2XTJB 3AC0A 3FOLB 4M7ZC 5I19L 3I02B 4I0CC 1LE5A 3HN3A 4UDUA 2WWMC 3GMRB 4G9FA 3OPZL 3VFWA 4XNMA 1AXTH 4Q6YA 3O4OC 5JUEL 5IP4A 4N0UB 1YYLH 1B0WA 3QIUC 4FABL 5JIIA 4MD0A 3D9AH 1RI8A 2ED9A 1EJ6A 4WTXA 4HV8B 2E7CA 5CLWA 3LN9A 1QSFE 4LNRA 3H9SB 1E4KA 1F3JB 2BNUA 5TFSH 1JGUH 2DTSA 3KLSA 1RJLA 1F5WA 1GGUA 1GGYA 1MNUL 3ARVA 2PUQT 4L8DB 4P46D 1I4FA 4XNQA 4QYOA 3SDDB 4HWUA 4FFYL 3BEWA 4Y1AA 2VH5L 2VITA 2ADGB 1G9MC 2FH8A 5CJBA 3QG6A 5FF6B 1ZHBA 5F9AC 2DLHA 3ES6A 4HQQL 3CUPA 1PGRB 1CDJA 3THMH 4BFIA 5J6HB 1XH3A 2X4TA 2FRGP 2NW3A 3O6LH 4OFPA 1T04B 1UWXK 2CUMA 5L9DL 5BS0D 4O58L 3SGKC 1UCTA 1WCBB 4IOIA 1ACYL 2DDQL 4MDJA 4MD5B 3IU3A 4DFHA 4WV1B 2F54B 2YKLL 4JKLA 1GGCH 2EE2A 3NPSC 1A14H 4R9HA 5CGTA 5D1QD 2PW2B 2GY5A 5EN2A 4YGAB 4GRLC 1INQA 2NLJA 2P42B 1A1NA 3CDFA 5E7BA 4IOFD 3MBEA 4NNXA 5HGBB 2LTQB 1MCOH 2IPTL 3L3IB 3TF7C 3HMWH 3P0YH 4ONFH 5F7LB 2P49B 4FN0A 4J4PC 3VG0H 3BWUC 2MQCA 4UBDC 5F9OH 2LVCA 5F89B 5D7JD 4UB0L 5CJXA 4JY5H 2QADB 4H1LG 2AERT 3U30B 4PJHB 2BC4B 4ACPA 4I4WA 3EDJA 4JDZA 5C0JB 4P9HH 5GRUL 4GRLA 2G9HA 1UM6H 3HR6A 3ULVF 5F96L 3VRLE 1RZFH 4DEPB 5F3HA 3QXDB 2VZOA 4WNQA 1QR4A 4LLAA 1CR9L 5I18L 4GW1A 3BPLB 2ORBH 2FDBP 1ZEAH 5CJOH 1RURH 2APBA 3U46A 1NLBH 2YMXL 3RWDB 4NM4L 4XPAL 3WNPA 4F58L 3OR6B 4DTGH 4KKAD 4G8FB 3U4EA 5CGMA 1ZGLM 3UTSA 5JXEA 3S8WA 4ZUVA 1YQVL 5TF0A 3MV7B 3QO0A 1OOAA 2HLFD 2DF3A 4HV8A 5KOMC 1P7HL 4HIJA 4LMQI 4R26L 1DUYA 4ZSOB 4TULL 2JJSC 3C2AH 1RZKH 3MRNB 2HP4A 1YY9C 5JW4Q 1NBQA 5JNYB 4LARL 4P2RA 3Q3GB 1Q9LA 1DN0A 1R6VA 3K8LA 3WN5A 4I8DA 1NMCB 4XP1L 5FYJE 2JJVA 3EHBC 3VRIB 3P9WB 5B8CC 1AIFA 4L4VA 1MRCH 3K80A 3SKJH 4YDJA 1QVOA 5DQDL 3TH3T 5HHXH 4PS4L 4HDIB 1Q9OA 1JGEB 1T4KA 3W5NA 4DN4L 3NCJH 3QUYD 3W11C 3QP3A 5F7HA 5DLML 2CIKA 4LK4A 4RGNB 1Z9MA 5E70A 2UZXB 5KS9B 1I1AB 2BHYA 4ZXBD 3F12A 3MLXL 4NQDA 5JNYA 1QYGL 1G7PB 1T0PB 2YPLA 1O7SA 4QRUB 4KUCF 3HI6L 2Z92A 4Q74A 3VA6A 4MSWA 3TBYA 2ZUQC 4OLEA 5BV7C 3W2DL 3WXWH 1OTSD 4CW1B 4WJ5A 3UO1H 2VB5A 3R8BB 4M7KL 1ZEAL 5CJOL 4FNLL 3GHEL 4LSVH 5D1XD 4S11A 2DQCH 2R0KL 1MRDL 3SY0B 2OTWB 3PL6C 1TXKA 1IKFH 1AKJA 3IJSA 3S96B 3QCUL 5DJAB 1IGCL 1T22B 2DYPA 3GSVA 4X8JA 4JFOA 4O9HL 3S36H 4YO0A 4WI3A 2GJ6D 4YLQT 3C5ZC 4RMWA 3T0AA 4UV4L 3EDFA 4J3TA 1F13A 1IM3B 1NFKA 5SX5H 3E6FA 4HWBL 3DX6B 4GW4A 2Q3AA 1I9IH 1J0YA 2VDPL 4FMKA 5FA3B 2NX5A 4DKAA 4G8EA 5C0GB 4P9MH 2BMKB 4AG4H 2FJGB 2VTFA 5AD0A 1FSKB 3UTZB 4LRIA 1RIHH 2Y4SA 5HGBA 3WFZA 4JRYD 3HR5B 3WO4C 1XR8B 4K7PY 5D5ME 5EIQA 3ZE1F 3O6FA 4HC1A 3O9WA 3TV3L 3ALPA 1U92B 1AD9B 3GK8L 1OARH 4HUKB 1S7UB 3OGOE 1JPSL 2BOCA 3D2UD 1KPVA 2EXYD 4HT1H 5D7LE 4QOKD 4XPFH 3ZLQC 3LB6C 5GZND 3ZKSD 4ZTPH 5DGQA 1S7VB 1KELL 4O2FB 1XH3B 1JTOA 4KKCC 4BH8B 3HNVH 3U0PB 3CVHL 3RNQB 2YXMA 3IU4L 4YUEH 4EN3B 1GGIH 1QRNB 4HKJB 1VACB 2EICA 2W0FB 4XPFL 4MNQB 4NM8L 2NY6C 4QXWA 4OKVB 1KN2L 3QXAA 1R5VA 4XB7A 1T89C 1NBVL 2KH2B 4HS6A 4G9DB 2P8LB 4QHUB 1BQLL 4H5SB 4NFDA 3P4NB 2AJZA 2AJ3B 3LQZB 2YZ1A 5GJTH 1T66C 1PSKH 2VUYA 2D3VA 1CGWA 5I19H 4D3CL 5EOQL 2V17L 2GSIB 3L1OL 2X89A 4FRWA 4Y4FC 5K33A 1T7XA 1NFDE 2YHGA 2HT2D 4LHUA 5I1HL 2GJJA 5IUSA 4Q6IA 3RU8H 1JP5A 3MRRB 3RFZC 5IEHA 3QUYB 3FOLA 4X6DE 2X4SB 5C3TA 3MRHA 5E8PB 4LEOA 1CGSL 1OCWL 3LKNB 4MNQE 4F8TA 4KWUA 1U93B 3BDYH 3QCUH 3MCLH 4MQXC 1YEIH 2J8UF 4D0DB 4AY0A 1T66D 2DBLL 4FQLL 1K3ZA 2YZ8A 1OSPH 4RGMC 4O9HH 3S36L 2WBJD 3MRLA 3OKMA 1U58B 2QSQA 4XT1C 1KOAA 2AEPL 3QH3A 4G80B 4A2MA 1CE1H 2GIYA 4NGHL 5KSBB 2OSLB 2VMFA 3HG1B 4JZNB 3S3JA 4LSQH 4OI7A 4M03A 1U58A 3DROA 4WEBL 1CXFA 3P0GB 3PQYD 2R0LH 4D0BA 2ZG3A 5HHPB 1FZMB 3HE6A 3TH2T 1PKOA 1ES0B 3HI6H 4X4YB 2JCCB 2VLLB 3GMNB 3MLUH 1EVTC 4B41A 1CIUA 2BOBB 5I6XC 1U8PB 5J3HD 3MRHB 2H45A 5ILTL 1S7TB 4DW2L 5TH2A 3LQMA 5F72S 3SKJL 5HHMB 3KNBB 2IFGA 3VFRB 3H0TB 1DN2A 4P2QB 1TZGH 1QZ1A 4TSCL 5DD3H 3KJ4B 5I17B 5KTEL 1WBXB 4EOWH 1S5HB 3U7YL 3RRQA 3MV8D 4PTUB 3QH3B 4DOHB 4LCIH 1HHKB 3RWGA 2V2WB 4PJIA 4G6AC 5IBLC 4QHUA 1NFDA 2X42A 4ETYA 1AR1C 1YNLL 1UCBL 1FFNB 3PGFL 4QTIH 3WKMH 1VACA 5GS0D 2GTZB 2W9DH 3MOQA 1IEAA 4HMEA 5CHNB 5FKPA 5JIKA 4EOWL 4ZFFB 1D9KC 1VGEH 1HH9A 3IETB 3IDJA 1EUUA 5C07D 3I85A 1C5CL 3L7FA 3MRFA 3ARRA 4NYLA 3D69B 1I3RA 3UBXB 5AUMB 3QB7C 2DQHH 1HHHA 2XTJC 3WFCH 1WIPA 4KXZH 5E9DB 1QSFD 5EZJA 4CUCA 1KLFA 5I8CB 3VXSA 5LJYH 2BVTA 4K71C 4XGZB 1IZJA 2HFEB 3A0OA 1KBGH 1YEFH 1Q38A 3F7PC 4NM4H 1XR8A 1V3JA 1VPOH 3SJVD 2XZQH 5KZCB 4LKCB 3HC4L 2IH1A 1TZHA 2VR4A 3NMEA 3G5XB 5F9DC 3L3OA 4NNXB 4MCZA 4UB0H 1EA9C 3C6LA 1F4YH 4OZGE 4WI6A 3G04A 1FAKT 4MWFB 4WI7A 2VXSH 1NGYA 2R0WH 1J1XL 4PG2C 3GM0A 5LAXA 5C09D 3SE9H 5JW3L 5E1HB 2JK5A 3QR2A 5DEGB 5DRZB 4OJFL 5JHDE 5JPNA 2XTJD 5EIIA 4KAQL 1Z5LA 4Y2DD 5EUOF 3RIAF 4CU7A 4U1MA 1OQOA 4DJMA 1RUPL 4R3SB 4MAYA 5K9KA 4ONFL 1WBYB 4GQ9H 3WNKA 3C8DA 3D39A 2WBJB 3O3EB 1FNFA 5BW7A 4PR5B 1DQLH 5I1IH 4PY7A 3S4SB 3U79A 5IVZA 3W81A 2KL6A 5D6DC 1L6XA 1J05B 5BRZD 1EFQA 3NTCH 4FZEH 2BDNL 1SJVA 3O6LL 1J8HA 1IQWH 3PWNB 5DO2D 3ECBA 2YKLH 2XWJA 4ZOBA 4K9EL 3PWPE 5AD0B 3L5IA 1ZT7A 2HRPH 2DQEH 3PXJA 4HLJA 4IDJL 1ZVYA 2MCPH 3VG9B 3X14B 2NY5L 2IG2L 3ZYJA 2V17H 4P5TC 3VFUA 4XNUL 4WHYG 1O5DT 4U31A 1HN1A 4HQQH 3DUHA 4MA1B 3V4VH 1JGUL 3TBSA 2VR9A 3OKLB 4XNMB 1KXQE 4J1UB 3NZHH 2VN4A 1I8LC 1MFNA 5JPNB 4ZFGL 1FL5A 3KS0J 2OTPA 3AUVA 1U36A 2XACC 4LFHD 3QCVL 1IAOB 4P2OD 4Y8AA 1M7DB 1DQJA 1OLZA 4K23L 4Z9KB 2HA1A 1QEWB 2CDFB 4Q0XL 5JHLH 3RTQD 5DJZA 4Y4HA 3BSZH 5HD8D 3ROOA 1DSFH 3FONA 3H3BC 5INDB 2P7TB 3BPCB 4OQTA 5IESH 2HFEA 1FFRA 3WJJA 3LB6D 3QIBA 4N0CC 1HILB 1ZT1B 4X6CA 1UENA 3Q6GL 4NRYA 1KGCE 5GRJL 4BSVB 3WHE0 5C2UB 2HJKB 1CICA 1ZT4B 1FFOB 3IAQA 3KPLB 4K7FA 3DARA 2WINB 4PIRF 3KG5A 4Y4HC 2BSRB 3CX5J 2N7BA 1EEYA 4C83B 4JY4B 2CLVA 1IQWL 1BOGB 3D39E 1P5VA 4Q9CA 1S9KC 4WW2C 4PV9B 3EOYG 4HS3B 2KKQA 5DVLA 3ARBA 1NGQL 4MDIB 3F6LA 4GQ9L 3OXRB 3BGAA 3OR6A 4NO5A 1CQYA 1DQQB 1MY5A 1E4JA 1UJ3B 2DIBA 5I1EH 2R2EA 1LNUB 4YXHH 4KAQH 3QCTH 2UY7A 5ID0B 4OZHB 1IBGH 1JGVH 1FC1A 4XTRD 1PBYA 2O61B 1DEEB 2YD4A 3PHOA 4EN3D 3RUGB 1LP9F 4LF3A 4OCRH 3U48A 1IKFL 3FO0L 2LTQC 3FQWB 3BP4A 2C26A 2XFXB 3WV0A 2K3TA 2UUDH 5B39A 3D2UB 5C09B 2OQJB 5M94B 3I50L 3MREB 1I75A 3IDYC 3UTSB 2DWEA 3KPQA 1WUNT 1JGVL 4L4JA 4PLKC 5I1DA 1BFOB 2KBGA 3BZEB 4JRXE 4M7JL 4U3XA 3PWNA 5A3IC 4MAYC 2F74B 1JZ6A 1LP9E 4XTRC 4R97B 1CZ8L 1MFEH 4NQUA 4MA7H 4KJPD 2M2DA 4JZNA 1UA6H 1F58H 4HIHB 1CXEA 1UQSA 4N8PA 2CLZB 1FPTL 1HHIA 2ZCKL 4ZXBB 2W9DL 1GVIA 3MV8E 3ARTA 2CRZA 5GRWA 1VGKB 3WIHA 5K9KB 1MCWM 1G0XA 4ZO8A 3QEQA 3QUKA 3Q6FB 4Z0XB 5FYLL 4HWEL 4UIMB 2BC4A 1EO8H 1XCQA 5JMOC 1JN6B 4NQEB 3B9AA 3LRGA 4QHLB 1CDBA 2QTEA 1G6RA 3PABB 4I3GA 3OG4B 3VI3F 4LSUL 5GS0L 3BEWB 2O5YH 4MA8L 1C1EH 3ZDZE 4F7EA 1VEPA 3IKCB 3SDCD 3QNXB 4BELD 5IF0A 1WEJH 1QQDA 4M6ML 3MBXH 1OT2A 3N1PC 4JRXD 3VH8A 5DUML 2DQTH 2F53B 3QFJA 4XNYH 4NWUL 5ANMA 3RTQB 1NAKH 2XFXA 2XG5A 4KMTL 1XF2A 5MEPB 2NCMA 5J13C 3IFOB 5T1LA 4POZD 3IU3B 3ZKMD 1HNFA 2UVEA 4X7CC 3SDDC 3HFMH 4NQXB 2PO6C 1YEEL 4D8PB 2AQ2A 5D70H 4M7LT 2V2XA 3KYKH 3W0WD 2WBWB 1TNMA 2EH7L 3EOTL 3QQ3A 1R5VB 1MRFL 1JMZA 1X44A 2I25N 5D5MF 5E56A 1NCBH 5C08D 4WUUB 2YK1L 4ZQKA 5FGBA 2VN7A 1I1AC 4PJCF 5MEND 3BH9A 4Y2DC 2YR3A 5CUSL 2WV3A 1RJLB 4ALAL 2HT4D 4EBQH 1UB5A 1CE1L 5HGDA 1DBBL 2AJUL 3G6JB 5IFHL 5F96H 5JORB 2DQEL 2FJFA 3NCBB 3QRFM 4NNPL 3DSNA 5F9WB 3ULVH 4M8QA 5EIVA 4QRRB 2NZIA 4XMKH 4Q2ZA 3U9PH 1S7RB 5I9QB 2WUCL 2R8SL 3TJHC 1FFOA 2YPVL 4ZUTB 1SJXA 4G8GD 1IL1B 3P0YL 2N56A 2VQ1A 4M5ZH 4PD4K 2QADC 4E42A 1ZLUH 1JGLL 2G5BB 1MLBA 1U8KB 4BFBD 3DV6A 1RV6X 1NLDL 4NNPH 5DK0B 2AKRB 1KCRL 3OXRA 4RA3A 3L1OH 4HBQA 4TSBL 5AZ2H 2KDGA 4HEME 4LGSB 4IMKA 5DVKA 1X5LA 1W72B 2VDQH 3JWOC 2A73B 4BQ6A 5BRZA 3X13B 1BIIA 1M7DA 1FG2A 5F7NC 4Y19A 3QWRD 1FORL 4QRRE 2VXUL 5C3LD 2B7DT 2L7UA 4WEMB 2N4IA 4XP4L 4DZBA 1T7VA 3ARGD 4KI5D 4XCYA 5F9JB 2DYPB 3GSVB 4X8JB 5I1GL 4M1DH 2CGRH 5LBSL 5DFWH 4X6CB 1YMMB 2EDKA 5D1XA 3HCVA 1JK8B 1NANI 4RQQB 1KNOB 5EOTB 3SJVE 5FB8B 4KGLA 3IFPB 1YJDL 2A6KA 4YH6A 1QLRB 5E6IA 5IOPA 4LBEB 4M62L 3JV4B 1G9NC 3LV3B 4TN9A 4HZLA 4M4PA 5DUMH 1RUKH 5DXWA 2P44B 1X5KA 2BNRD 4R7DA 4JFFB 3BZ4B 2ARJB 4M43H 3T04D 4BQ9A 2NTFB 1NCWL 4PRIE 4CL7A 3QIWA 2GSIA 2ZJSL 3K8MA 5IVXA 1QRNE 3RPIA 2VDKH 5HHNA 3RY6C 2O5XH 2VIRB 4PRIA 3ILPB 4GS7C 1G9NL 2CKNA 5IQ7H 4HS6B 1TJIH 4D9QD 1RJZA 4HUMB 2FSEB 2NY1D 5DTFA 4TSCH 3R1GL 3GSXA 1MCSA 1UVQB 4OLYH 1DJSA 4XBPB 1DVFD 1HOCB 2PO6A 4L3EE 2XOTA 3WS3A 3AS0A 3VI4F 1RSFA 4WHYH 4P57B 3C87A 3V4UH 4FQXB 2O26U 3U0PA 4F9PA 2ZUQB 2VQ1B 1BBJB 5BV7B 2UZIL 4UT7L 3PGDA 4WWKC 3TIEB 3JTSA 2VDNH 4JFYB 4KTDH 4P2RB 2I9LB 4P23D 1TCRA 4NHUB 5E9DA 3B2VL 1X5YA 4QRRA 1YMME 3DX7B 3MV9D 4OIIL 3SKNA 1FV1B 2DQCL 2R0KH 4V2CB 4OCRL 1NC2D 4JFYA 4X80L 3UO1L 5LKNA 3RBGA 4I77L 2F5AL 1A4KA 3QPXL 3U4EB 3BH9B 1G7JA 1GJIA 3ARDD 5JOFB 4ZQKB 3S35L 3C5ZB 1KTDB 2X4QB 4NZJA 3MQIA 1XGPA 4XBPA 3ZL4H 2B39A 2G2RA 3TN0A 1FBIH 4XX1E 43C9A 1AGCA 4F15C 3E6FB 3QAZC 3PWVA 3S35X 1WFTA 2GQHA 6FABL 3MC0A 4KRMB 5IB4B 4IRJD 4D8PA 4OLZL 2Z8VC 3VFSA 3FFDA 3U6RB 4YDLC 3W9EB 5FDWB 4LEXL 5FYLD 5FHBH 1AH1A 2HG5A 3ORJA 4I4WB 5DRNA 4TQEL 4OCWH 4U05A 3G5VB 2F53A 2EDYA 5MHSD 3VD7A 5A3ID 2VDKL 5FV2A 1NMAH 1JTTA 3WS6C 2VL5B 4YGVA 4FP8H 3JTTB 5CHNA 5IQ7L 5DUBA 4NN7C 3ARZA 3OJ2C 1R24B 3KLAB 4OLXH 4Y1AE 1EBAA 2X1PA 2SEBA 4GKNB 1BQLH 2VDRL 4KY1L 3HS0B 5ACZB 1IAMA 1MJ7L 4MSWB 1CFQB 3TVMB 5JR1L 5JHLL 3WJLC 2QQKH 1IC5L 4S1DC 4UOW0 3DLQR 4DKEL 3QUZC 1AXSA 1VFAB 2JCCF 3WKNA 4HW6A 2B1HL 1T1WB 4PPTA 1F6FB 4XPAH 4M1DL 3RY6A 3GSNL 3QDGD 1F4XH 1OD9A 4N1HB 3O81A 3PP4L 4Z7WE 5IW6A 1SEBB 2A73A 4TSAH 4BZ2H 4MX7B 1KIQB 3EO9L 4GT7A 4MB3A 4JJ5B 2BOBA 2CGRL 4Y5VB 3LOWA 1I9JH 1W0VA 3SDDD 2OL3H 1I8KB 3NN8B 1NGXA 5C7XL 2BVUA 1Q9LB 4LF3B 5C0BD 3RX8A 3GBLA 2E8YA 2OR8A 4G43A 2DD8L 3GO1H 2CK2A 1E4XL 3QDMA 5GS2H 3REWB 4JPKL 3O6FD 1TQBB 3F7YA 3LN4A 1CGUA 5E2JA 1OT1A 3WFDL 4FQXD 2OJZL 5HDQH 3BZFA 1MCRA 2UUDK 3ZDXF 4Z78A 4OB5L 1ZS8B 5C0EA 4ELMA 3WL9A 4N0FB 3V5HB 1U93A 4NRXA 4WW2B 3FT2A 3DOSA 1B2WL 5HBBA 2E7MA 4HD9A 4OUUA 3RY4A 2C9AA 5GS2D 2XA8L 5HHME 5ESQA 4XP6H 2FHBA 4YR6B 1P84J 2QADD 3K4AA 4MZ3A 2W0PA 1FGNH 4RMSA 3QHZH 2E27L 2NYYD 4J3OC 1ORSB 5JA9A 1CFVL 1QO3B 5E99L 1MAJA 4J12A 3GMQA 2ESVB 4GRWB 2GK0B 1KT2B 1EFXB 4QWWC 3VRJB 2VDLH 4WDIB 2YPLD 5ALBH 1T5WA 1OAUL 5C08E 4PJ8B 2E9IA 4JPIA 5TDOA 1C12B 1EHLH 3EYOA 1MVUB 2CLRB 1CE6B 5HY9B 3QNXA 4KY1H 1YYLL 2BMKA 4PJ7E 1JMXA 5GRYA 2LV4A 1D6EB 1UB6B 1QSED 3AREA 2DL2A 5DHYB 1LMKA 3WDHA 4PRHD 3O2DA 3JBG7 1UKQA 4PJGE 1PEWA 1YPZE 4RAUA 4L8CA 4PGEA 1FL5B 1IM3A 3PWPD 2DLFH 2HG5B 4GAYA 1E27B 3VGAB 5IT2H 1WZLA 2GFBA 1P5UA 3OX8A 4TRPL 1J8HE 5IB4A 1D3CA 5DD5L 5L2KB 5DC4B 5HYSB 4WO4C 1AGDB 2HLAA 4PJFB 43C9B 5KTEH 3T0VA 3AY4A 4ZPTA 1T22A 1IMHC 2VITB 1RZJH 4LLMB 2A9NL 4QYOB 3RVTC 3HZKA 3SDDA 2IMNA 3V2AR 4APQD 4BUGA 1YPZF 1DP0A 1NL0L 3LKOB 4KVCH 5CIPA 4K07A 5SX4I 1KCSH 3MUHL 4WY7L 4HJ0C 1QBBA 1AGBA 3U7WL 4NKIH 5D7IF 4KRPB 1TCMA 1XMWA 4PRDA 5JHDD 2PCPB 3CFEA 5L2KA 2NXYD 1QBMH 1TCRB 3AU1A 3OX8B 1WFNA 4L3CA 5GHWH 4YIQB 1BQHA 1FVDA 3VCLA 3MXWL 4PBVC 3PV6B 4OIIH 1CLZL 3VFGH 4WEUD 1L7IL 1IM9D 4MJID 3KLHD 4PJEE 4L3EA 1ZAGA 1Q72H 3EYFB 3CLFH 3IXAA 3GSXB 3SY0A 1C5BH 5ENWB 4U1JB 1H5BC 4YZFE 3C09B 4BYHA 1U91A 4H0IA 3L6FB 5I1EL 2EIEA 4JHZA 3CSGA 2BP3A 3D25A 4PV9A 4WI8A 3VXPB 3IYLW 5IV2B 1ND0A 1QBLH 1T3FA 4NZTL 2CRIA 5EZJB 4Y4KC 1TPXB 1RHHB 1KPUB 4FQHA 1LDSA 2YPLB 4PLJD 4ELKB 1GSMA 4AH2B 4UTAL 1QSZA 1F97A 3QNZA 5J1AB 1IKNC 2IPKB 4X6FA 1KJ2H 1EO5A 4XBGB 2XXCB 2ICWA 1HH9B 2H2SC 5E1AB 5EUKA 4JN2A 4HUNB 2A0LD 1MOEA 4XVTL 4OCYL 3EO0A 4ZFOB 5I9QC 5SX5K 4FFVD 2P7TA 3BPCA 5L9DH 4N0FA 2B5IC 3SGEH 2DIAA 3JV4A 3VI3E 5MEQB 1WF5A 2R4RH 5DVMA 1HEZB 3VWKB 4BH7A 3AVEA 1FE8H 5TF1L 4QKXB 1QVOB 1H3PH 1J87A 2IFFL 3ZO0A 3MLTB 5EBLA 3NH7H 4PJCA 4GW1B 3QEHB 3PP3K 1ZSDA 2X9WA 3CVHH 5F7FA 3ARPA 3UZQA 2YUXA 4WNQB 2YPLE 1DDHA 4PGBA 2QR0A 5LBSH 1MPAL 1QOKA 2V2TB 5IB2B 5JQ6H 4XXCC 5AYUH 1BJ8A 2JB6A 4U6XA 1BIIB 3NN8A 4GMSL 3D9AL 3SDXF 2XYCA 4ZFGH 2FGZA 3TV3H 3KWWA 1AQKH 5ACLA 5TPWL 2AGJH 1J9CT 5DK0A 1MWAL 4X4YA 1DANU 2D9CA 3MV11 4JPWL 4X4ME 3I3DA 4LDEB 1VESA 4U7SA 3VFPA 2Z8SA 5IW6B 1NC4D 4MHHG 4YNYA 5L2KD 4LU5L 1CFTB 1LQSR 2F19H 4PY7B 3S4SA 4ZMAT 2EDDA 3NCYS 2X9XA 1XF3B 5IHUH 3FN0H 4X6DF 4KPHH 1N64H 2XZZA 1OW0C 3AS1A 4NKDA 3S5LA 1RZ8B 5MEOB 3O3UN 4LCUB 3QPQC 3SDYH 1X5AA 4L3ED 5DT1H 3E2HB 5E94A 4M6OL 2C3VB 4OFYA 4CMHB 3MOBH 1OM3L 2BSTA 4Q9RH 3P77A 4FQPA 5ACZA 5B38A 4UDTA 5F1IB 1D6EA 1UB6A 3AREB 3LAFA 1WT5A 2JKXA 1C16B 2WP3T 4UIKH 4RBPK 3T1FB 2CUHA 2VLKB 1BZ7B 2ATKA 1NUDA 3O41B 5DMGD 3CDGA 4OKDA 4YDIL 1RVFH 1DTUA 3MRMB 5TQ2H 3UXFA 5BOZG 1EEZA 1Z0NA 4ZSOE 3S3SA 5GGRY 4PB0H 2XXMB 3W2DH 2PETA 3WXWL 1MEXL 3VXSB 4WFFE 4FQXC 4LRIC 4OLWL 2FH6A 1I3RB 3UBXA 1FNGB 1DBJH 3LKPB 3MRDB 5TE7L 4R97C 3RHWF 4KMLB 2CD0A 1WBZB 1YMMD 4K8RD 3V7AE 4H5SA 2AQ3A 2XNAA 4G9DA 1JCKA 4QOKE 1LE5B 2XKNB 3EO9H 4QHNA 3T4AB 2OXHA 2FBOJ 2GITA 3VMNA 3O11B 3N1MC 1DBAL 1VADB 1WLHA 4I13B 4NO2B 5SWZE 3W39A 5DK2B 3NCJL 1ADQH 3M45A 1WEJL 3NFPA 1ZHNB 5DD6B 1SYSA 5E00B 5FCUL 4JFEA 2D7OA 5FECB 3Q6FA 1FAIH 5I1KL 3H9SA 5GXBB 4G6MH 1T80A 4XWGL 3D5OF 1OWRM 5TE6L 1VERA 1IZKA 1RZ8A 4UU9A 3F7YB 5MEOA 2R56L 1T5XA 3QWOA 5IWLC 1IC4L 5EO1B 2YD3A 5FYLH 4GLRH 4NHUA 3TP4A 3X3FH 1MFDL 3O8XA 1B0GB 4PGCA 5ALCL 5I71B 3FQNB 5LCVH 3PHSA 4YX2H 2E3VA 4HK0A 1GC1H 5EU3B 4OCYH 2FBJH 4TUKL 5DD1H 3WFEH 1S9XA 4ORZC 4NOFA 1YNLH 5TH2B 1NCUA 4DGVL 5A43C 4FQXA 4R26H 3EYVB 1PYWB 3PDDA 1NMAL 4JDVA 4N8CH 3C8KA 1BJ1H 5HHOD 3B2UD 4OCWL 3ARFC 5DMKA 3FMGH 2NXYC 4UQ3B 2VLKE 5IM7A 5DD3L 4U6HB 4X0KB 5IGXH 4KTYA 4A2LA 4N0YH 4ZNEA 1NDGA 3LEYL 1XF5B 3GSRB 1ZLUK 2VQUA 4CMMB 5JZ7C 3QUXB 3BPOC 4ZOCA 4G80A 3L5XH 2AJSH 5E6ID 5TPWH 2CDEA 5GRUH 4NP4H 3ESVF 5BS0B 1IGYB 3P40A 1FFPB 5FIEA 4BH7B 2P8PB 4B0MM 2XWTA 2R0LL 4XB8A 5KAQF 3QIWC 4PFEA 2Y6SD 4HZLB 3CFCH 3CZFB 4M1CD 1CDCA 2F58H 3GDBA 4CW1A 3QFDA 2ZNWA 4JN2B 4LCWE 1AJ7L 1R3JA 1FFPA 3ARED 3DVGB 1MREL 3RZWA 4LHUB 5D4QA 3OL2A 1FYTA 1FDLL 2VLKD 5HYQB 3V79C 4XCYB 4JRXA 3DXAE 5E6IC 1CGSH 4FQHB 3R8QA 1I1AA 4M6OH 3QIBB 1YEIL 5IEKB 2QKIB 5FDYA 5KVGL 4HF5H 5GGSY 1YEHL 3EFDH 4LQ1A 1RUQL 1P6AB 5BV7H 4D3CH 4JFHE 4S1QL 1XCTA 2WW8A 1U8QB 1JGEA 1T4KB 5GQBA 4RNRA 4DVRH 1PKQB 2VERN 3PJSB 3QG7H 3VXME 4PP1D 2AK4E 4IRSB 4RFNC 2ZUUA 5ERWA 1QSEE 4KUZL 1WGOA 4K2UH 5CKGA 3DNKA 3VCLB 3LS4L 1NEZA 2H2SD 4PLOB 3JWDC 3Q3GA 4NQCA 2FO4A 4YUEL 3WUWA 3QZWG 2EDXA 1NBVH 4RSVA 2FX7H 5GRZA 2DJSA 4OF7A 5AYUL 5KVDL 4PJEF 1R3HB 5D7JA 2HT3C 1LO2L 3GUTB 4PREB 4ODVH 3HNVL 1ERNA 5DJ8A 4MJ2A 3UYPA 5D93B 4GJTB 3DI3B 3CK0L 2FYYB 2MMXA 4LASL 2FLRT 4TNVK 1Z9LA 1B90A 2P5ED 4G8EB 5DJ6A 5C0GA 3UMTA 4HT1L 4I2XB 2XT1B 1QBML 3P30L 3OBAA 1G7QB 1HZHH 3QQ3B 4GAFB 1KPRA 1RZKC 1HHJB 1KB5A 5CEYA 1FE8L 3BXNA 1RIHL 1CGVA 1NSNH 2AABL 2JIXA 3WIIL 2VIRA 1NEUA 5CJ8A 3LD8C 5BO1H 1T21A 3G08B 2Y06H 1UXSA 2YC1B 2W0LA 5EZIH 5T5FH 4HWBH 3QWRA 4AIZA 5F88B 5AZ2L 1MHHB 2OJZH 1EEZB 5CCKH 1A9BB 4OF8A 4J8RB 3ZSTA 3S96A 5DRWA 2ADFH 4WTZA 4PRNB 1CGXA 2B4CH 4PJ9A 1BD2D 2CLRA 3EJYC 4XWOD 1G7IB 4GG6B 4AL8H 4MNGA 4ODTL 43CAA 1QLFB 2AK1L 2DLGA 2H8PB 4RZCB 4CGTA 4NZRH 2ICWJ 1N7MH 3MRGA 4XGZA 4FQ2L 4FFWC 4MQXD 3HCVB 2VDML 4JR9H 3QIBD 1JF1A 1HHHB 3CSYA 3NGBC 1ORSA 2GY7B 3ZKND 3PV7A 4LPUA 4NO0B 4FNLH 3UJIL 1HSBB 1NAMA 3KJ6L 4C56E 2DLIA 4GXUM 5EU6E 5HGAA 4ETQB 4PJ7F 4NKDB 2WBKA 1S7SB 2CPCA 2FEDC 4H26B 2P5WA 3TH4T 3ULSA 1N5YL 8FABA 4L8SC 1F3DJ 3UJJH 4HIHA 3BUYA 5FYKL 4MXQD 1CDIA 1V3MA 1RK1B 4WW2A 1F4XL 5C0RH 2CIKB 3WL9B 1RUAH 1LO4L 3KPNB 1I4FB 1MFBL 4L4TB 4MGXA 4HCRA 5I1DB 4RAVB 2QQLH 1FG9C 4ZO9A 3TPUB 3D0LB 1TJGH 4U1SB 3RL2A 5C6PB 4OF5A 4PGJA 3QFJE 1RJCA 4RX4D 5ANME 3F65A 5IKCB 3BKCL 3LKSB 3ZT7A 2W92A 4XP6L 1S5HA 3RI5K 1UCBH 1TTUA 3G6JE 5LWYL 5DQDH 2BSSB 4NWTH 4PJ5A 2V7NA 1IL1A 5T3ZD 5ITBH 5E0QA 4PRHA 4P99A 1FZKA 1VA9A 1KIPA 1G7MB 1MF2H 2X7LA 4LRNL 1LHZA 4M6MH 3T0EB 4KI5E 5I15L 4Y4KB 5T3ZE 1MRCL 3TYFB 5EBLB 4WFHD 4WGWB 3UTTD 5CEXA 5K59E 3MV9A 4G8IA 1WWCA 4Y5XB 3K1DA 1M7IB 3VE0A 1MQKH 3TPUA 4LIQE 4FG6C 4G8FA 1SQ2N 5FYJD 5ILTH 3EW3B 1CDYA 3A6CL 4R4BB 3MJGX 5E5UB 5TE4H 5GISH 4X9FA 3NOIA 1EBPA 1MWAB 2NY7L 4NUGH 4HK3J 1MCBA 2NX5E 3C2AL 2F54D 5EU6D 5HJ3A 3ARBC 2EDFA 4H26A 1W0WB 4XXDB 5DMYA 1OAUH 2NR6C 4ETQA 3ARUA 1Q0YL 3QRGH 1YQVH 2VSDA 4ELKA 5JPMA 2J8UB 1UH3A 4P3DA 3DVFA 2XRAH 4FTVB 3S35H 4JO2L 4JRYA 4N1EA 3KVQA 1I7TA 4KRLB 5J1SC 4L8BA 2Y6SC 4NHCL 3KHQA 3BKJL 3LEVH 4CVZA 4IMLA 3O4OB 4O4YH 3HMXL 4JANA 4PGZA 1CGYA 2XA8H 4NO0D 5KANG 1Z3GH 3MFGB 5ENWA 4FQ2H 4DKEH 3D0VA 3RWJA 4ZNEE 3BVNB 4Z7UB 3T2QA 1WK0A 4F7PA 3EZ8A 4HFUL 1I7RA 4N5ED 3IXTA 1DE4B 3LSOB 4PRAB 1C7TA 4FQQB 1ZXQA 3L7EA 1JPGB 3EYQC 4JG1H 2DKUA 4JY5L 4KV5E 1WTLA 3ZKQD 3MLZH 3VI4E 3G08A 3EDEA 5EULV 4JFPA 3GBMH 5D2LE 1IRAY 3MUGB 2LU3A 3QIWD 4ZXBA 4OLXL 4X6BB 4LLDA 3CAFA 5F93C 1YQ2A 1TVBB 4M1CC 1SY6H 1AI1H 3AXLA 3N1FC 2HVKB 3V9FA 1E28A 5HVWA 4P2OB 4TTGA 4ZUSA 2ADGA 4RIRA 4GBXC 3D3VA 4U1GB 1MUJB 3QDGA 1OAXL 2R1XA 3BEVA 1YEKL 4AEIH 1NCCL 3DO7B 3QIUA 2Q3ZA 4Z5RA 4O2FA 1A7RH 1JUFA 3TO2A 5C86A 3MYJA 2LABA 1QNZH 4J3WA 1BP3B 3OQ3B 1XF4B 1CL7I 3SHSA 4M8VA 3DV4B 4EUPA 3CK0H 1FV1A 3ULUE 2ADJA 2HLAB 2VNCA 3DVIA 4XCNA 1A4JB 5HYSA 4LIQH 4O2EB 1WWWX 3G6AB 3MLPA 4M3JA 4KDWA 5GRVL 4X9HA 2R2BB 4CKVX 4YEFA 2DI8A 4OZHA 3FO2B 1CU4L 1A0QL 2HJFB 5JUEH 2AV7B 4YK4C 4D94A 4ONGH 3V0WL 3S9DB 1S78D 1PKQA 4U1NA 2X4RA 4LHJB 3SO5A 3W9DA 1U8OA 1RJZB 5ISZE 2Y7QB 1NCCH 1MVUA 3QDHA 1FO0B 3MLVL 4O51B 4B50A 4YHOH 2VXUH 3H9HA 5JIPA 4YBQC 3EOBB 1NUNB 2QKIA 4P9ML 4EDXA 3KDMA 2I5YL 5DMIH 3KPTA 3REVA 5HTSA 5GS3A 1A4JA 4I3RH 1NC4A 5BV7L 3VXQA 3UTTB 5A2KH 3HI1A 4U1KB 4ONHB 1OPGL 2PKDA 3GGWB 5GS1B 1G9EA 5CINH 2X10A 4OLYL 2DBJA 3RHWK 3P0VH 3C6SB 3T0ED 3VXTA 2ARJA 4LLVB 3IDJB 1L6ZA 3IGAB 1U8IA 4WFGD 2R1XB 5C9JB 5DUPH 3LEXB 2RAMA 3TIDB 4Y16A 3WBDA 1R5WB 1OAKH 4OGXL 4YWGL 2VABB 4AZ8A 2ZG1A 2BNRA 5T1KB 2X1XR 3IDIA 4MCYB 5C0NC 4HUXA 2BVQB 1BM3L 4KJYA 4NHCH 4QRSB 5D2NC 2X4OB 1S7XA 3L7EB 4MAYD 1J12A 3EAKA 2VLRA 5HGHB 2W07A 1I9EA 3NBNA 2IGFH 1NCBL 4JFFE 3RZCC 1DQTA 5SWSA 4X80H 3PWPA 3F7VB 4R4NC 5HDBF 5JLZB 1T83C 3TFKC 3L5XL 1U8MB 2Y9RT 2ENSA 4MAUL 1KEMH 3UCRA 3QSKB 3WLBB 4JM4H 4GMTH 1S7TA 4JANB 5SWQA 3TO4B 3KYOA 5L7XH 5EA0H 3QO1A 2AKRA 1FJ1B 3L9RA 1PYWA 4CVUA 1IFHL 2HJLA 3WN5B 4RDQG 2D0GA 5J56B 4YHNA 5E2TL 3BIAX 3CDYA 3MLWH 2LQRA 4WUUD 5CGYD 1ZLWK 2DQTL 3MUZ1 3MJ7B 3UX9B 4BM7A 1K4CA 1UT9A 3VWKC 4EZMA 2QLVB 3V0AC 1NPUA 3EJJX 4DFIA 1C1EL 3EIFA 3RWFB 4JGMA 3FCTA 1NFIA 4OD1H 4KHTH 5JHDA 3TBWB 1FVCB 4JB9L 2PYEB 4JCLA 1J7VR 1I7UB 4KK5C 3RNKB 3JWDL 5IMKB 5M95B 4WI4A 1UWGL 4X99B 1H15B 3UZEA 1CDGA 5J11C 3G04B 1SJHA 5CD3A 2W9EL 3GRWA 4QHNB 1A2YB 4F3FB 4X7FC 1TZHB 2P5EE 1Y6KR 2R69H 2X40A 4Q6IB 3KYMB 3ARQA 4WI5A 1OAZH 4L1DA 1MFEL 3NIDE 3MLWL 2V7NB 4PJGA 1P69B 3VFVB 5J12B 3WEXB 4ZOAA 2CK0H 4EI6A 5HHVL 3BHBA 1QLEH 2GTWB 3FFDB 3U6RA 3MLUL 1OY3B 3MROA 15C8H 2ZCHH 4KROC 1JZ4A 1BZ7A 4YAQA 3NCCB 3ARBD 3BD4A 4MXVF 4LPXA 4LSQL 3C5ZA 4EI5B 4XZUA 4MVBC 2VDQL 4WV1A 4FXGA 2YPKA 4MNQD 5H94B 1FVCA 5FO8A 5CAYB 5CILL 1UZ8B 1GGBH 2C3XA 2VLRD 5HYIA 3PQYA 1U92A 2EYTA 1MIML 3Q1SH 2DAVA 3TC9A 2Y06L 1ZHBB 2YPVH 3TNMB 5GS0H 1A3RH 2H6PA 1BIHA 4NQVA 2XPGB 4V1DA 1LEIB 2R29L 5D7IA 4KK6D 3QDAA 1HYSD 3JWDH 2A6JA 2D31B 4HWEH 2F19L 3C9NA 4HH9A 5C0AE 3UYRH 2PW1B 2FATH 2VLJE 5EUOB 1F00I 2DQUL 3ARWA 5E8EB 3ZT5A 5BVJB 5SWQB 1MHHA 5I30L 4G42B 1X7QA 1SM3L 3T0WA 3ZTNH 1B9ZA 5FO9A 5B3JF 4U49A 3M8OL 1OTTD 1UWXH 4ODBD 4PRPE 2C7UB 5C92A 5E8DL 2OR7A 2DS4A 1WT5C 1KN4H 2F9BT 3O0RL 3I3EA 4FQIL 2FX7L 4P3WA 4G9FD 4Z7VA 3LMJH 5ELIA 1X6LA 1KN2H 1HYSC 5J9PA 3K2MC 2X4NA 4LPYA 3TBTA 4PRPA 1TFHA 5KVEH 3HFML 3OPZH 2F8XC 2NNAB 4GMTL 3HTLX 3VJ6B 2NYYC 2DI7A 2AK4B 5CEZH 4B5EA 3B9KA 1QKZL 2R15A 3QZWB 3OKKA 1U2HA 1D5BB 3BQUB 5E8NB 3OZ9H 4AL8L 4LEOB 2CLVB 3GSQB 1U8IB 4NJ9H 5C0DB 3HB3C 3SN6N 4C83A 5D1XB 5EU4A 1N6QH 5HHOB 1S5IH 4OAWB 1PLGL 3KXFB 3EFDL 2H41A 3OGCB 2BNQB 2EZ0C 1YEJL 3LZFL 1GZPA 4K9EH 2HWZL 3MNWB 2ICEA 3FO1A 2FX9L 4YFLI 3FRUA 3TLRA 4HS8L 5DJCB 1GHFL 5ETUA 1QUNA 2XIDA 4UOW1 4XCFL 4HGKC 2VLME 1QR1B 2AABH 2J8HA 3FONB 2P45B 2HWZH 4NQCE 5MENA 1QBLL 3LD8B 1D5MB 4IS6A 5D2LF 4EQ2A 1QFUL 1OWWA 4U0RC 1F8TL 3QPQD 4G7VL 3DSFL 3AMKA 1UFUA 3BI9X 4FTVD 4OFVA 3UPCA 4YQXH 3SE8L 1J5OL 2W65B 3LKRB 1RMFL 4XNXL 1BQHB 4JFDB 4KKNA 1T03L 3SE4A 2Q1EA 1CF8L 4OZGF 2E8ZA 1U6AH 4WTWA 5I74C 2HKHL 4TUJB 2ADJB 1I8MA 1FLRL 3HC4H 1MCFA 3BQUA 1LK2B 1BLNB 4ONGL 3V0WH 3ULVE 1M05A 4O2CB 5GJSL 4QHKJ 1MCQA 3O3BA 2ICES 4MD4B 4UNTA 2BY1A 3LVEA 4MQSB 1OP3K 3D3VB 3ARDC 1HK6A 3MO1A 1KCSL 4X5XB 1UWEL 3B9KC 3MFFA 4CDGC 1I7ZB 4O00A 4XRCA 5T5NF 3OB8A 4S1SH 5IB1B 5I66B 3QUXA 2DRUA 4JO3H 3T2OA 4TUKH 2J1KA 3IDXL 4IRSC 1A7RL 1XGTA 4GAYB 3T1WA 1O0VA 3V52H 1IC4H 3E3QC 3GI9H 4L8SA 1EPFA 2BY0A 4ENEC 1KCUL 1OAYH 3DGCR 4YBLC 1NUFA 4UBDD 4NC0B 1N4XH 5EUOA 4GG8A 1YN7B 3B9DA 2HLFC 1PG7L 3L3JA 1CE6A 4KC3B 4KI5F 4ODHH 1G7HB 1GGBL 2R4SL 1CICD 3TNMA 4KJWC 5CEZD 4AEEA 4BKLA 3GMMA 4AEFA 1XFPA 1FL3B 5I1JL 8CGTA 4JFFD 3F7RA 3BH8A 5K9JH 4PJ8D 4RMRA 3ULUL 2APVA 3QCVH 1S3KH 5D6DA 1F4YL 4S2SB 3KYNB 5SWSD 4PJEB 2HRLA 5DDHB 2QQLL 5ESQB 1FZJA 4BFIB 4FXGB 5J6HA 15C8L 1P7QA 2ZCHL 3U0TB 2DICA 2OP4H 2QJDA 3FO9B 4UAOC 4QY8B 5EPMB 2OM5A 4AT6A 1E0OB 2PXYA 3CH8A 1P4BH 3CFBA 3IDNB 4JN1L 3TCLB 2HFFA 1F4HA 3GBNH 3O45B 4G8IB 1IQDB 1HI6B 1Q1JH 4PJIB 3TYGL 3VRIA 3GJFK 3MOAL 2GTWA 2DYPD 1T1ZB 3BX7C 2MTPA 5L8KB 4YC2C 1HXMA 4JPVH 2VDMH 4PJGB 5DZNA 1PDKA 4PG9A 1AD0B 2D7MA 1MLCB 3FQRB 3FQXB 4YX2L 3VFRA 1DEEA 4APQB 2EIZB 2X4PA 4ODTH 3VFNB 3LS5H 3EFFA 4UDUB 2GYSA 2HN7A 1EXUA 2B4CL 5GSVA 3MRPB 1RIVL 5IHUL 2H1PL 4XCEB 5KJRL 5D7SH 3VFTB 4AMKL 3K2UH 5IVXE 3T1FA 1H8OA 2VLLA 1BBDL 3GKZA 4LU5H 4U1SA 3C60C 4JZJB 4OT1L 1FNSL 4MZ2A 2PTTA 1EHXA 3HPJB 3GJFB 2OXGA 1KIQA 4LAQH 2QQNH 3ZMRA 1FQ9C 3I3BA 1F6LL 4I0PB 4N1CA 4ESKA 2R0WL 1AE6L 1IGIL 3F5WB 4LCUA 1VB9A 3IDUA 4E41D 4OLVH 4MA3B 3ZZ1A 4M6NL 4OD3H 4OI9A 1HZHL 3WFHB 1VPOL 4PJDE 5HDBE 1J0ZA 1WZMA 3F5WA 1NAMB 3JVGC 1M4KA 2PF6A 2HFGH 2JTDA 5D2NB 4ISVB 4MAUH 25C8H 2YUZA 5C0BA 5ESAB 4HZAA 4Y2OA 1F4WL 1U8JB 2CKBA 2GHWB 1C5CH 2QQKL 2MHAB 1FHGA 5E8PA 1SBSL 1VGEL 2FIKB 1OAQH 3AMLA 5EC1A 3WE6A 4JVUA 4Y88A 2BJMH 1N6UA 4WI9A 3TJEH 3X3GH 1KG0B 2Z35A 4YFDB 2BY3A 3KJ6H 1P2CA 1HKFA 1G9MH 1CFSA 3CMOL 1NBYB 2EEAA 2AXGA 4Z7WA 2Z93B 4JY6A 1Q94B 3RY5A 5DT1L 3SCMA 3Q48A 4P4KC 1J1PL 1NQBA 1RIUH 5HYFA 4HJGB 5IR1A 5I2IB 2B2XL 3O2WL 3S88L 3KYAA 5EZOL 3HLAA 3BKML 3RU8L 4R96A 4NNYA 5F21B 4RRPG 3UYOD 2ICWI 3LEXA 4NZUH 4HWBA 3WJLA 4L9DA 1F11A 1YC7A 2I9TA 1FP5A 1PD6A 2BK8A 2H9GB 5GJTL 3FJTA 3G6DL 5FYKE 3QUMH 1TITA 5GS1A 1AQKL 4S10A 4QHMB 4WU7B 2WBJA 3O3EA 4LSDA 4P2QE 2IAMD 5EZLA 3ET9F 4K94L 4B7LA 3DUSA 4Q6IC 3V6OE 5EC2B 3B8YA 3VFWB 3JTSB 2EH8L 1G6RH 5K93A 4JAMB 3QXUA 1ZLVH 3DX8B 3N1GC 3BMVA 3FT3B 5JZ7D 5D1ZC 5BCAA 4U1NB 2FO1A 3V0VA 3QJFA 1HOCA 2PO6B 1QYGH 3B9KD 2Q7NA 2CJUL 4HHAB 4UMGA 2MCG1 4YDVB 4ZD3H 1XCTB 2UWEF 1QACA 4M1GH 3MNVA 3BWAA 2FEDD 3O3DB 5D6CB 5J0BA 1U8NB 5C0CE 4K94C 3HRZB 4K3HA 1N59B 1SYVB 4LNVA 2ZOLA 5C8JB 4LSPH 5I66A 5A40E 1P53A 2CDGB 2PYEE 1D5ZB 5ITFB 2DJUA 4PB9L 3VW3L 1BQSA 1KCVH 5I1HH 4Y4KD 4QRRD 5DVOA 3DMMB 4LL9A 1EGJH 1YEGH 4DGIL 1W8NA 3CLEL 1ZVHA 4ODXA 3DETC 3PDOB 5DQJA 4X7DC 5KW9H 4J23A 4HPYL 4X6CF 5JO5A 4LLWB 5DEFB 4ZUSB 4P2OA 1JWUB 3MLZL 1OGAB 4NQTA 3WFBL 1A7QH 3TBYB 4NO3A 1C08B 5F6IB 1J11A 1NFDB 3DURA 1VENA 1MCHA 1BVKA 5ID1B 4NM8H 1IAIH 2DIJA 4YK4B 1HHKA 5IFAH 4GKZB 2PR4H 5HI5C 4GXVH 1YY8A 3X12B 1JPGA 5IQ9B 1WBXA 4NUJA 2UZYB 1MRDH 3HMXH 3SDXB 4OF6A 3RWIA 4KZDL 4MXVE 4Y19B 2GKIA 5I1GH 4PJDF 2GAZB 1F6AB 3DUUA 5C0CB 1A9EA 2FIKA 3CXHJ 3WHE1 5CLTA 4NPYB 5TDOB 1A6TA 3C6LD 1UZ6F 5IMOA 3IAPA 1U8JA 3G6DH 5AG8A 5C1MB 1B6UA 2HT3D 2Z8WC 1DBJL 4HIIB 2P5EB 3SPVB 5J12C 3D18A 2ICEB 4E42B 1AR2A 5F7EH 3ZDXE 3ZDYE 3EGSA 1DN0B 5F9OL 4G6AD 4OIBA 3LPWA 4P46C 6CGTA 3L3HB 1RZIB 2B1AL 4C59B 1MI5E 3VXOA 5K59F 1H9VA 5DLMH 4FQJH 4D0CA 5TE4L 5EZOH 3NFSL 3MXVH 2VR5A 4Y2DA 3QEGL 5GZOD 2NW2B 5D1XC 1RIUL 2ZUWA 1GOGA 4Y5YA 4PBWD 5HHXL 3GSQA 2FB4H 2D7NA 2YN5A 1N4XL 3H3PH 2VO5A 1FZOB 4JM2D 3FQUA 1UB5B 5HGDB 4XP1H 5C7XH 2DQFB 3GIVB 5T3XD 3G9AB 2OK0L 1UYWL 1K3IA 3BPLC 4LVNB 5I0DA 4OM0L 2EDHA 4LPWA 3HNTL 1MHEA 4ZPVA 3GKWH 5BXFA 4ALAH 4IDLA 1M71A 1OAQL 3NCEB 4KPHL 1MJ8H 3BOVA 1AC0A 4U2YA 2IANB 4Z7VB 3WLWD 3R4DA 1BVLA 2XQYK 4D0CB 4R7NA 3FQXA 2XN9E 1RZGA 4NQXA 3QULA 3MV01 1PQZB 3PWUA 4N90D 1X7QB 4OGYL 1XIWA 4YXLL 1TJHL 5D2LA 2FZ3A 3IJYB 3RAJH 3BN9C 1FGNL 2AGJL 1HI6A 1IQDA 3CC5B 4OCSH 4KI5C 4FFZL 3RDTD 4K8RC 1N5YH 2P8MB 3BUTA 4HG4K 5A2JH 5E4EC 1NMCC 2I60L 1A1NB 4KTEH 5I1LB 3P73B 4MNQA 4EI5D 2H6PB 1AE6H 1IGIH 4MXQC 3HNTH 3ROLA 5B8CB 4EEEA 3CFJA 3RWIB 3TA3B 5JDSB 4QHLA 4XVUD 1CT8A 2KZWA 5C2BL 4KK9D 1XCQB 2ESVE 5B4MD 1PG7H 4PV8B 4KKCD 1VFUA 4DVBA 4IRJB 3QEQB 1RULL 5E03A 3DRQA 4J3XA 4LSUH 2AJXL 1T04A 4LOUD 4UINH 3FQTA 5IMMB 1JZ5A 2FB4L 1AP2B 3PWLA 1F2XK 1JRHI 5KG9B 3MMEA 4RGNE 12E8H 2NTSP 3MXVL 4PJ7B 3MRGB 5CZXC 3NABH 2MPAL 1FNEB 2P24A 1QRND 3OKOA 1A14L 5ACMA 1GPOH 2H26A 1NGZA 3EYUH 3GI8L 3MA9H 4TULH 4UI2A 1UA6L 4PRID 1QRKA 5DURD 3VDCA 3INUH 4OZIB 4XPGH 4LLYA 3FHAA 1Q1JL 1PKQE 3SKMA 1B4JL 4LPCA 3RUGF 3BHBB 1KC5L 3RGHA 7FABH 4U1HA 1BGXH 5DWUH 4PJ9C 4X5WB 4NN7B 3QHFL 4HXBH 1RZGB 1NLBL 2YMXH 5IHZA 2EDOA 1ITBB 4LASH 1LGVA 3E6HB 2HAZA 3TESA 1BZQK 4WO4A 1BAFL 1HSAB 4RFOH 1T1YB 3AFLA 1BD2E 2NY4B 3WXVL 2CXKA 1ZGLB 4LVOC 4PGDB 1OTUD 3QUZB 1WJ3A 1ZOXA 4YFEA 4XVSL 1TMCB 1MJ7H 4HS3A 1KN4L 2WWKO 2OLDA 3O0RH 1IAKB 3FCTB 4UAOB 1I3VA 5D7JB 1A22B 1LK2A 1FL6B 1U8LB 3EO0B 4P0DA 4U3CA 5ICXB 3SEPA 4KHXH 1QBAA 4OTXH 1MCEA 4K55A 1I8MB 5I75C 3L95A 1LEKA 4CVXB 3NH7L 1QHPA 4JGUA 2O5XL 4WY7H 3L3HA 5BJTB 4CN4A 2Q86A 3TIEA 4XH2B 1ZWIA 1QTYT 4KVCL 1GIGH 1RAMA 1F45A 5FHBL 4RWYL 5I8OH 2G60H 1LE9A 2VKWA 3VXRA 5IFJA 4HF5L 3UEZA 2X2YA 4I18C 1R3KA 3PJSA 3VXUD 3Q6GH 2GI7A 5GRJH 4ZD3L 1Q9OB 1WFUA 5CSZA 3G5ZA 4UT9H 1DQJB 4UTAH 5IFJB 3X11B 4L9LA 4M62H 3E3QE 3DXAD 4KI1A 2Z8RA 1MAML 1DSFL 4ZUWB 1NBYA 4KFZC 1HDMA 5D72L 1AR1D 2Q86B 5C0FB 3OKLA 1CGTA 5F7DA 1VFOA 3NFNA 4KKLD 1K6QH 4PRDB 4NN5B 3L95B 4KZEL 1DBKH 2F5BL 3SDCC 1XGRA 2NPLX 1B6DA 2E9WA 3GSOB 5DHVB 2GSGA 1Y6MR 4RFOL 3I6KA 4Q7DA 3FN3A 4PJXA 5FFLA 4ODSL 4N8VB 4OM1L 4YDKH 2X89D 1EHNA 1H3WM 3VJ6A 2NNAA 1YMMA 3PWJA 3WJJC 2YWYA 4CDHA 4AENB 1U2CA 1HWHB 3O3AA 1J05A 2PO6D 2R1WA 4PR5A 3ZHLA 3SGJA 4NKIL 2P47B 2R29H 3TGXA 4M5ZL 3M1BA 1R0AH 3V6BR 4POYA 2G9HB 5ICZB 4CN1A 1FN4A 3C6LC 1Z5LB 4U6HA 4X6DA 3V6FB 5T1MA 4OZ4B 4UQ3A 3FRPG 4QRPB 5ICYA 4JFXB 2FL5B 4GRMA 4KQ3H 3PNWA 1CVRA 4MNHA 2IBGA 1JHLL 4OZFB 5T33L 2VQTA 2AJUH 1DBBH 2BRRH 1CVSC 3L3OB 4HUUB 5DQ9A 4KKBC 2HN7B 1KLGB 4FA8A 2BCKA 3D6GA 3T65A 3BGFB 2EIZA 1JL8A 3HG1D 3FQRA 5HVGB 3CPLA 4DCQB 5GSRB 3DGGA 4JM2C 3BP7A 1KGCD 4X7SL 4RGND 3FZUC 1DBAH 5KN5B 2FJFB 3MRFB 4ZOEA 4Y4FA 1IC7L 3O8XC 3OG6B 4NC1C 1AHWC 5FUOH 3DO7A 1BX2B 2J5LB 5FKPB 4P5TD 1W72L 3O2VH 1DQDL 3NA9H 3VD4A 2V6HA 3FOMA 3RZCD 1UM5L 1JHKH 4NQED 2BVPB 1TETH 1T2JA 2E5EA 5E99H 1ED3B 4H8WL 5DJ2A 3BIKB 3KYNA 4X6BA 4LKXA 4MS8D 3H6JA 4M93C 3H7BA 3BH8B 1YMHB 2XN9D 5D2LB 4ORGA 1Q94A 2E9BA 1FL3A 4P3CL 1DQML 4XBEH 2DQIH 1H5BB 1SVCP 3W82A 3DGGB 1OP3H 1AHWA 1CFSB 1D9KB 4Z0BL 3E8UL 3KPOB 1JPFA 4YEEA 1LEGB 3FN9A 5D1QB 4LSTL 2QL1A 3MRMA 3SGDI 2CSPA 1HH6A 2VISA 5K9QG 1M71B 3OSKA 3MOBL 4JM2A 4N0CD 1CYGA 3VDAA 1FO0L 3T0DA 3SO3B 4LAJH 2OR9H 3OXSA 4MS8C 2YUWA 3GBNL 5B38B 3ZDYF 1H0DB 3NVQA 4ZDHB 4FS0A 3QEGH 2Q76A 4PJCE 2ATPA 4OZ4A 2WWKT 4MLIA 2AQ1A 1ZTXH 3GSUB 1EMTH 4FXKA 2J8UA 4ZUUB 1D6VL 1VGKA 4JZOB 3RKDC 5EWIH 4QXTB 3PQYE 4BSWB 1MFCL 4NIKB 3B4NA 5IB3A 3GMOA 5BZDA 3LKQB 3H9SE 5J7CC 3BE1H 3M17A 2JJTC 3MV8A 4L29A 3VRLF 1I9JL 1VHPA 5E8OB 2IGFL 1JNLL 3DHMA 4YHNB 5DSCA 1EAJA 3DMMD 4MD4A 4GRWH 2F5AH 3GJFA 1KACB 3DYPA 4I77H 1T20B 3MRBB 1WAAA 4PJ9D 1EAPB 1IARB 4U6VH 1T1XA 4WWKD 3D2UA 4BJLA 1MPAH 5B39B 3L3KA 1N0XH 4LLUB 1G7LA 3EFFB 3S97C 2R0ZH 3MRRA 4HSQA 5F6HJ 5C0CA 5LVEA 3ZDZF 4R0LB 1GC1C 4FOMA 4DGYH 3VXMB 5J1TC 1QD0A 3MGTA 4N5EC 5EOCH 3IRZA 2A6IB 2Z4QA 1A6ZA 3DJ9A 3TNNA 4PJDB 4PLKD 4OV5A 2R4RL 4JB9H 1LWRA 2Q8AL 1J0HA 3IDIB 5F7YC 4NKQB 5IVXF 2W91A 2CRYA 2VYRE 2BNRB 1AI1L 1OSZA 5LQBL 1XZ0A 1GOFA 2Q7YB 1A7NH 1FH5H 2WLZA 1JWUA 1MHCB 3QQ9C 1FRGH 3QNYB 5IESL 2W0FA 1NFDF 1SMAA 5CBEA 2W0KA 5DA4A 3HE7A 1JNNH 2J3SA 3HPLB 1FIEA 1OGTA 3PP3H 3G6JF 1A4KB 4XAKD 1ZWIB 4O02L 3C5JA 3VXRD 1QFWM 3QNZB 4I18A 1IGFL 1HQRB 4CVXA 3SKNB 4XPHL 1FLRH 3PHQB 5EU4B 2IEPA 2M26A 3JV5A 5AAWA 5LGJB 3VD9A 2CJUH 1MJJB 5IG7B 1IAKA 3QQ9D 4WHTB 1QLFA 2H8PA 3DTXA 1A21A 5EDXA 5GIRB 5HYJE 5EU7C 3UDWA 2JJSA 3CNKA 4XNUH 1ZHLB 2R23A 2CO7B 7FABL 5I8EB 5DFVC 3GZKA 3DYOA 5F88A 1K4DA 1P1ZA 4AEIL 3QUZD 5DWUL 1T89A 1TDQA 1TZIB 2R2BA 5D8JH 2C1OB 1XGTB 1ZHKB 1INDH 1JHTB 4M48H 4YHPB 5EC2A 4HJJL 1WIUA 1CFNA 1TLKA 3RPIB 4JHWL 3DX9B 3RGVB 4J6RH 1P1ZB 5CEYB 1WSST 3HB3D 1B4RA 5C0ND 3OV6A 4UV4H 4GAJL 3MJ9H 4XCCL 3KPSE 5LGHH 1NMBH 5HHQB 1FIGL 3U9UB 2BVEA 2D0FA 4PJFE 5I8EA 4PJ5D 5MHSE 3BEVB 4HUVA 2X6MA 5DHXB 4Y4HD 1XAUA 2AEWA 4IIQC 1J8HB 1Q9KB 5I71C 2B0SH 5CD5D 4G6FD 5FM4A 2DMBA 4NNYB 1P9MC 4WGVB 5JOEA 3FTGA 3BSZL 1Z2KA 2CIIB 1KJMB 3STZB 5JW5B 3RQ3A 1NCWH 4HGWA 3MRIA 3SCMB 5IFHH 3PIQB 4RFEB 4Z7WB 5DEGA 4M9OA 5DRZA 3SDAB 4ZUWA 4J2XA 3HPLA 4Z77A 3IXTB 1LD9B 1XGYH 2LAAA 4RMVA 4MMXC 1QSFB 3M8OH 3MRKB 3E1F1 1D7FA 1OSZB 1LP9B 3OAUH 2IH1B 4PJIE 4Y1AD 2C4FT 2ITDA 3RVXC 4U1LA 2ESVA 2IBZX 1H3VA 2JE8A 1DFBH 3HRPA 5D71L 1A6ZB 2FX8H 3IJHB 4XVJL 3F58H 1FORH 5DYOB 2IF7A 2X41A 3FB5A 5BJTA 5IBTH 2B5IB 1RUML 2Q20A 2NY2D 3C5JB