4YXLL

Crystal structure of syrian hamster prion protein complexed with pom1 fab
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
213
structure length
213
Chain Sequence
b'DIVLTQSPAILSVSPGERVSFSCRASQNIGTSIHWYQQRTNESPRLIIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQSNTWPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSETDQDSKDSTYSMSSTLTLTKDEYERHNTYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major prion protein
publication title X-ray structural and molecular dynamical studies of the globular domains of cow, deer, elk and Syrian hamster prion proteins.
pubmed doi rcsb
source organism Mesocricetus auratus
molecule tags Immune system
total genus 44
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yxlL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yxlL01
3GSNL 1V7NL 1BBDL 3JWNC 4XCEA 1YMMD 3QQ3A 4GRLD 3OKYA 1HDMA 4WUUB 3NGBC 1CICC 5I30H 2NW2A 3GFUA 1RUQH 3NN8A 4F7TA 1CD8A 1FLRH 5D7LE 5C08D 5K9QG 4HFWA 3T0ED 5TF1L 3HCVA 4HPYL 1A2YB 2PO6B 3VDBA 1G6RA 4JM2A 2IALB 3BUTA 2FJHB 4DQOH 1ZTXL 5I2IA 3MJ8A 2D7QA 2YPVH 4PJAE 1IRAY 4FQIL 5DK3A 1XF2A 4ZFOB 3O4LD 2B2XH 3FB5B 3NCCB 3IXAA 4DVBA 4HAGA 3GO1L 2VDNL 2NY3B 3ROLB 4Z5RB 5C6TH 1IT9H 1Z9OA 1U6AL 3T0WA 4MJ5A 5SWSD 3FB7B 3PL6B 5D93B 4YHNA 3RHWF 4B41A 4XP6L 3V52H 4JFOA 4KUZL 2DLEA 3RDTB 1VSCA 2PW1A 2NTFB 5DEFA 2FHBA 2VABA 2NXZB 3VA6A 3KLHD 1KF9B 4WWID 1U3HD 4OLVH 4XP1H 3TYGL 4X9BA 3IT8D 1LO4H 5A2KH 4UILH 2XT1B 1MHPH 3BIKB 1BZ9A 5FO9A 1H3VA 1OP5K 3V8CA 1LDPL 4HGWB 2AJVL 1QUNA 1YMME 4M7KH 2I9TA 1IL1B 3UBXG 1KLUA 3BKYH 5AZ2H 2DQEH 4AEHH 5IB4B 3T0BA 1EO8H 5C08E 3SDYH 3T0EE 3DVFA 1VEOA 4MDJB 3TV3H 4P46B 4MD4B 1AP2A 2P5WD 3KPQA 5C2BH 1KT2A 1DP0A 2CIKB 4LIQL 5E8NB 2F19L 3S37X 2HLFC 4NN5B 2JJTC 2AAVA 1EAPA 4KROB 4RAVB 4UZGA 4YHLH 1S7TB 2D7NA 4AENA 3O4LE 4GT7A 5I1AA 3NA9L 1RUKH 5DVMA 4FXKA 3BPNC 4A2MA 3GJEA 4F15C 4NZRL 2VZUA 4LLWB 1R3IL 4PJAF 5SWSE 2FIRT 5F89B 3LRGA 5DFVD 4BK4A 1YJDL 3MLPA 2DM2A 3HZKA 1GGBH 4JFDB 4KJPC 1ED3B 5F7MC 4PTUB 1CGSH 1GIGL 2MCPL 1MRDH 1KN2L 3IYLW 4Y1AE 5LGHL 1UCTA 1XT5A 3ARDB 1F4YH 3RGHA 3RY6A 2V7NB 1FGNH 5TQ2H 1KEMH 4IRSB 1U93B 4K3EH 4WU7B 2VDKL 4OUUB 2ZCLH 4KTDL 2WP3O 5CJQL 3IVKB 2BNRB 4Z6AT 3W39A 4Q0XH 5CBEB 2DS4A 4DOHB 5D71L 2EYRA 4F9PA 3MRFA 3U30B 4RFNC 1RZIB 2XTLA 2ZG3A 4JR9H 1G1CA 2FD6H 4YWGL 5HHMD 1I8IB 4LSSH 1R5IA 5I1KL 3WIIH 4HUUB 4Y4KC 5HVFB 2WINA 3QIWB 1XIWD 5EC2A 1UWGL 5DQDH 3WNNA 4JO3H 1N3NA 4OBRA 5EC1B 3B6SA 5LAXA 3TBWB 5BXFB 4MB3A 4X6CA 3JXAA 4ODTL 3VXRB 1WZLA 3GEWB 4XH2B 4AM0A 3QIUC 5LKNA 5I9QB 1EZVX 4X99B 1J0ZA 2IPUK 3LQZB 3TESA 3X3FL 3O2WL 4WUKL 4YAQB 3O45A 2P5EB 2F8OA 3UC0H 5CP3H 4F7PB 1SEBA 1AQKL 1E6OH 3H2WA 1PG7L 2E9JA 1WBZA 1RV6X 4P2CG 3T8XB 4U1HA 3CLEH 2DQIH 4HS6A 4LASL 3WCYA 3T4AA 1YEDB 3MODH 4WU5B 4JREB 1U3ZA 4J3SA 5HGDA 1TTFA 4I48B 2VIRB 1SJHB 3OF6A 3UPRB 3VFOB 4NUJB 3S5LB 4XCFL 5HHME 4ISVA 3HE7B 1JUFB 2XFXB 4XZUA 2PTUA 1U0QA 4AIZA 3GMOB 4PJ9A 25C8H 4KKLD 1GPOL 1XF5B 1FVDB 2GJ6A 3JTTA 4CKVX 3QULA 1C5CH 3RAJH 2R56H 1CU4L 2NY6C 3QZWA 4R4BB 2ZOLB 4RRPG 3BN3B 3HHRB 4KXZI 5BVJB 3OR7B 4ZUUA 4KJWC 3L3KB 2AJYL 5DHYB 1EBPA 3NAAH 3CVIH 4RCAA 1L0YA 4JM2F 4PY8J 5ADPH 4XVTH 5F7DB 5F1IB 5FYJD 2Q6WA 3D69B 4WEBL 2ZSWA 2FRGP 1MF2H 3HAEH 5EU4B 1RZ7H 1BZ7A 3PNWA 3WN5C 2H2PD 5DMKA 1E4KC 5IBLC 1CLYL 1AO7D 2V2WB 2I9LB 5I17A 5J1AA 2XRAL 5BV7L 1OCWL 3BAEH 5GS0C 3PGFL 5IB5A 1H8OA 4NUGL 1VB9A 2GK0B 4QHMA 1CDJA 3MXWH 2QQLL 2VUYA 4FP8H 5JW3L 3SDDA 4PJXB 4F8QA 1OQXA 2DQGH 4AQOA 3PWPA 3QEUA 1BFOA 2LE9A 3RVXC 5E5UB 4PRIA 2ZUTA 2PXYA 5ID1A 1BQHG 1WZ1L 1N64L 4FHBD 1JRHL 4LAJH 4DAGH 4EUPG 2YUWA 3PWVA 4NNXB 4OLEA 5ISZA 3BZEB 1N59A 1YNLH 5TDPA 3LZFL 2QHRH 3WLWD 2Z31D 3QHTC 4PJ9D 3H7LA 4H26B 4EBQH 5HJ3B 4YBLB 3REVB 1NBZB 4R0LB 4D94A 2WQRA 3IDGB 3BZDA 4NSKB 1CLZL 5J89A 1CZ8L 4ONOA 1HEZB 4X7SH 1F4XL 5DJDB 4X6CE 1TQBC 3HI1A 3R8QA 4IMKA 5FYJE 1ZLWH 4X5XB 1FQ9C 2OR8A 5DK0A 3OX8B 4KFZC 3QG6B 3UJJH 1S7UA 1LEKB 2FO4A 1TZHA 2A6JB 1KELL 3CVHL 3D85A 1YECL 4JDZB 1DL7L 3HPLA 4LCYB 4P2OC 3T1FB 4Y5VC 3THML 3U6RB 2FDBP 1OPGL 4Z7WA 4K8RC 1LO2H 3VFVA 2GJZB 3SGJA 1D3CA 3TO2A 1I9JL 1Q0YL 1OOAA 2A38A 1QA9B 4HD9A 3SDDD 4GO6B 3X13B 2X1WL 1MHHB 3PWPD 5KANG 2A6DA 1FZKA 3DURA 4DN3H 2XACC 1JMXA 3EDFA 2NY4D 1T1YB 2PXYD 5IB1A 3CMGA 3GHEL 2ARWA 4W6YB 2XPGB 5D70L 1PY9A 4XHJD 5ISZD 4OT1L 1NFIA 3C5JA 4DK3A 1I1FB 3KGRA 4GBXC 2WBJA 3KXFB 4CU8A 2XG4A 5MI0B 2VZTA 1QSED 5HHXL 4HHAA 5C0RH 4EI5B 3P40A 4OGZA 3ARBB 2HTKC 4M1CC 1SJEB 5EUOA 4G8FB 3KYNA 3SE4C 5HYQA 2ADIA 3BHBA 2VXQH 1J8HD 4PB0H 1VFMA 2NYYD 3QIBA 3QWRA 4IHOA 4XPHH 5CINL 5DR5L 1ZHKB 4I4WB 4X6CF 4YHKL 3MBEB 5JR1L 4XCCH 2RCSL 4FQLH 4GS7B 4LLAA 1S8DB 3IDYB 1Y6NR 1ROWA 2BSTA 4Y4HD 5JXAL 4IOFD 4L5FL 1YYLL 1T0MB 4GXUM 4U6HA 1DUYA 2VLKA 3UBXB 5FO7A 1CXEA 1AGDB 5EOTA 1FNFA 1J05A 1TVBB 4OAWB 3VFNB 3IFLL 3RWCA 4L29A 3PWPE 3LH2H 3QXWA 5AYUL 4BFIB 5DLMH 35C8L 5EBMB 5D7LB 2X89A 3KPPB 1EERB 5F9DC 1I9RL 5BQ7A 2NY5H 1A21A 5ISZE 4OLYH 1ZVYA 4HUWB 5C0IB 4PJAB 3X14B 1NJ9B 3VD4A 5A40E 1M71B 1X4XA 1HYSC 2O5YH 4X6BA 1ORQA 2C3WA 4FQXB 5F7YC 1QSEE 4FFWD 5DD5L 3G6JA 1GGYA 1I4FA 3W5NA 1FGVL 3P4MA 2WBJD 3QBTB 5E8PA 1ZGLB 5HHOD 4WV1A 4Q97A 3S37L 3I3DA 3FMGH 1QSZA 2H3NB 2APBA 2WQ8A 2H8PA 3E2HB 3L3HB 4F7EB 5IW6A 2E3VA 4RNRB 4IOIB 3TT3L 1U8MB 2HLAB 3QIBD 3NFNA 2BK8A 4ZOAA 1JNNL 1MI5D 3EO9H 3SO5A 3U7WH 4HMCA 5GGSB 1KC5L 2BNQD 3L3GA 3W11C 3FHAA 1KB5A 3P4NA 4L8BB 2LV4A 4OZGB 4B5EA 3FO9B 2ADGB 1KJ3H 4Z7WE 5IQ9B 1YMMB 4TQEH 2VLKD 3CFCH 4GRLB 3VH8A 3EJZC 3CFJA 4H25A 4XNZB 6FABH 5HI3D 1MUJB 3CH1A 4QT5B 4WHCA 1PQZA 4BSVA 3E3QC 5HXMA 5C08B 2BC4A 4EEEA 4QHNB 3T0EB 5EZIH 1K3IA 2BX5A 4KDTA 1GGCH 1OF2A 5I15L 1LO4L 2YBRA 5KZCD 4YPGA 4LLVB 4DGVH 5CILL 2WBKA 5ECJE 4G6JL 1DQJB 1MHPL 2X89D 3O9WC 2PW2B 4ZO6A 2LU7A 3QUMA 2OSLB 3UTSA 3O4LB 4MJID 2ITDA 1FP5A 3LIZL 2HKFH 3BKYL 3MO1B 5DQJB 5AZ2L 3RPIA 4GRWE 4HWZA 4LARH 2FECI 3OJ2C 2X40A 5HHOE 5SWSB 5IM7A 4YK4B 3UTPD 1MJ7L 3EYVA 2AJ3B 3DVGB 5EUOE 1GH7A 5EFIB 2OZ4L 3PHSA 4K55A 5JQHC 4L3CA 1OAUL 3O6FC 5KVEH 1X5AA 3VFUB 4IOSD 1U3HB 2VZOA 1D5IH 1H3XA 1MI5E 1RUAL 2DLFL 3CCHB 2NLJA 3EIFA 3LV3B 4HWBA 3D87B 3HMWL 1FJ1A 2BNQE 4C55A 4JG0H 4UIKH 2F9BT 1LE5B 4HWUA 4QRPA 4S1QL 3SO3B 2VLKE 5SV4A 4NDMA 4FABL 2VDRL 5E1AB 2VDQL 3LB6D 1S5HB 1QQDA 1A64A 1NAKL 2DMBA 4Z7WF 1EUTA 2NW2B 2UZIH 4BFEA 3QXTA 1KIPA 1XCQA 2P5WB 1F4YL 1EHLL 4HFWB 4OFIA 3EDEA 1J9CT 3AC0A 2XKNA 4Z7VA 3HC0B 4RAHA 2R4RH 1NPUA 4UI2A 1G6RB 1A6PA 5I2IB 3FHQA 2BCKB 4MJIE 1ZLWK 1D6VL 5CP7A 4POUB 4JR9L 2X4SA 1UWEH 3V95A 1S9XB 5F6IC 4DVBB 1CFQA 3V6BR 3OBAA 5L7XH 1AXTL 3P73A 1UM4L 1MPAL 3F5WA 1S7XB 4XNMA 3WXVH 4YHNB 4GRWF 4LPCA 3WHXA 3B9KA 2DI8A 1DBAH 2RGSA 1VADA 4JFOB 2MFNA 1T5WA 5AG8A 1IM9D 3C09B 4XNUH 2VABB 1U92A 1CQKA 4LSVL 5EUOF 4ZUTA 1P7HL 5LBSL 3KYMA 4GAJL 2EDXA 1H3PH 1NCBH 5CCKH 4H5SA 1WFOA 4PJ5A 5F7FA 1BQHB 3BP6B 1FSKC 5FO9B 1Z3GH 3MZGB 5EZOH 4EUPB 5FHAL 5C86A 5HHMB 4K3JH 2I9TB 2ARJA 3TO4C 5FV1L 1KLGA 4OD3L 2PTTA 1U2HA 3DHJA 3CLEL 4M6NH 1GC1C 1TJGL 3D9AH 4AK1A 1AP2B 2AQ1A 2VDOH 4FFYH 3MODL 1XIWB 5DJXB 3ARTA 3KPQB 1MFCH 5DJZA 4MNGE 5F71A 2HFFA 2I27N 2X7LB 2DQHL 5IROC 2J7LA 2QQNL 2QSTA 3DRTA 3EYOA 3GSQB 5D1QD 4ZFGH 1NL0H 1JBJA 4YNYB 4AENB 3WSQH 4HIHA 1QBLL 5I1AB 3WUWA 5AAMA 3VG0L 1J5OL 5BMFH 3GJEB 3TZVA 5D96C 4WWKD 5JLZA 4AEFA 5IJKC 1SVZA 1NANH 5IV2B 3BO8B 1NUNB 5E08H 3G6JF 1IAMA 3IKKA 1R3KB 2C3HA 2NX5D 1EXUA 3B9KD 1VFAB 4EOWL 3DYMA 4JFZH 3L7FA 3BDYH 3W9EA 3DIFA 2XWTA 1RULL 3ARFC 1W0YT 1YUHA 3KJ6H 4ORGA 3KLAB 5HD8C 4XVTL 2D3VA 3I2CH 4NRZA 5EIQA 3U1SL 4S1RL 2EEAA 3ZYIA 2V17L 4GKNA 1DBMH 2VSCA 3W39B 3C6LC 4PJ5D 1YNKH 4JM4H 3VXSA 2Q8BL 5FA3A 4PLOB 5JHLL 2EYRB 3MRFB 2IMMA 4K7PY 2E27H 4LOUC 2OK0H 2MNUA 5KVGL 4KTEL 2R0KH 4UBDC 5JMOC 2D7TL 5BRZA 3C5SB 2AGJH 4M48H 3WO3B 4ZO9A 3BT2H 3T2OA 4R4ND 1Q1JH 5JO5A 15C8H 5C0JA 3IGAB 4HF5L 2AXGB 2W9LA 4Z7VE 2AJUL 3MLZL 3KYKL 4YE4H 2C26A 3B6SB 4JHAL 5LAXB 5IFAH 5LCVL 2NNAA 3WFCH 2EDDA 1MCWM 5A43C 1DDHA 3QUZC 5T1KD 4QRQA 1KEGL 3MSPA 4HJ0D 1KCSH 3C8KB 3SPVA 2QHRL 5GIRB 1T03L 5LGKA 1AO7B 3TZVD 1LK3H 5I1JL 1UYWH 2NX5E 1AY1L 5ESAA 2ZJSL 4N5ED 3BN9C 4CRPA 4LPUA 1FVCB 2OS7A 1KJVB 3GK8L 4ODXB 4KGLA 4HS6B 4YXLH 3WUZA 3W2DL 4PJ5E 3UPCA 3JVGC 4I77L 1MCRA 1P1ZB 2MKLC 4OFDA 2HTLC 3LKQB 2CRZA 1FH5L 4BZ1H 4ISVB 1E28A 1X7QA 2AVGA 2Z31B 2M8XA 4PJ9B 1N0XH 4PTTA 2C3VA 2A9ML 2IH3A 4GLRI 1CICA 3JTTB 4NQVA 4XNYL 5BRZD 5FXCH 4N5UA 2DYPD 4XBGA 1WWBX 3QULB 1X5YA 1J0IA 4OZIA 4X9GA 1OLLA 3QZWB 3SGEI 1S5IH 5FFLA 1C1EH 5KAQG 3NIGE 2R2EA 5CIPH 3MX0A 4QXWA 3FQTA 5KAQF 1D9KA 4Z7VF 3PHQA 3QO1A 2AXHA 3GBNH 4LCCC 2BVUA 1K85A 1BZ7B 1YEJH 3PNWB 1CK0L 4BQ9A 5HBBA 4U3XA 5HDQH 1VHPA 4TNVK 4EN3D 3P0YL 4KI5C 5IB5B 2G60L 3R8BB 3WFDL 1KYOK 1HXMB 4ODVH 1GGUA 1QZ1A 3SDDB 4NQDA 3Q5TA 2ICWJ 1TVDA 5AEAA 5T3XL 4Q9RL 3PWPB 3LKPA 1BFOB 5KSBA 3GMMA 5J56B 1RIVH 5DC9B 4V2CB 1EEZA 4XCCL 5DXWA 2NY4B 2PXYB 3O3AB 4P2RA 5ID1B 4HK3N 1WVZA 2ZUXA 3X11A 4NN6B 3UO1L 2HRPL 4JLRB 3PWVB 5ISZB 1N59B 5TDPB 5FYLH 5BRZE 3SKOA 3EJJX 5JUEH 2VZVA 4RMTA 3BKCH 1ITCA 1DSFL 1PYWA 1QSEB 3LH2L 2BY0A 1PKOA 4PGEA 3IF1A 3VW3H 1F4AA 4M7JH 3RIAK 2JJTA 3MLVL 4U3HA 4ZNCD 5TQ0H 5F8QC 3WIHL 1J8HB 3U4AA 3I75A 5B39B 5CFHA 1D9KD 3MJ6A 4O2FA 3NIGF 1S9KC 3MR9B 1KYOJ 4OZHA 3WFHA 5DK0B 2O5YL 2IG2L 3RWHB 4Y4HB 1TLKA 3CDCA 3FRPG 3IRPX 3LKOA 1AI1L 1EHNA 1S7UB 4LP5A 1E4WH 5SX5H 4RGOH 2FB4H 2FO4B 2R8SH 1UQSA 5CJBA 3HPLB 4N0UA 1AR2A 4CMHC 1S7WB 4RMUA 2CRIA 4NCDA 3K81A 4Z7WB 3KHQA 2FGWL 5T1MA 1CGVA 4BK5A 3TO2B 3SJVA 4IRJC 2HJFA 1SQ2N 1MAMH 2ZZUT 4NQDD 3F7VB 3MLWL 1MNUH 5ILTH 4KKBC 3CFKA 1UZ8B 5HPMA 3HC3H 3S4SA 4B0MM 3VFMA 3RWGB 5IQ7L 3V6ZA 1P69B 5HHVL 1DQML 1KJ3L 5IVZA 1I3UA 5K33A 2LU4A 1QBMH 4OGXH 5IHZA 4PRHD 1NFIB 3X12A 5CEZL 5CZVL 2WBJB 4GRWB 4Y4KA 3O41B 2KL6A 3FONA 4OZIE 1FZJA 5HHOB 3NPSC 3EYQC 5DSCB 2B5IB 5CD5C 3B9EA 3GBLA 4K7PH 5EUOB 3MFGB 2VH5L 1CG9B 3WLBB 1TIUA 2IQ9L 4AJ0A 1LD9A 3TH2T 3QIBB 4LEXL 4IHOB 5FA4A 1M7IA 5LQBL 3QIUA 1IJ9A 1KB9K 1MI5B 5GISH 2BSSA 2BNQB 1F8TH 1ACYL 2BSTB 2P8PA 1IE5A 2DQUH 3TNMA 4R2GC 2VLKB 1MHCA 5BVPH 3VI4E 3G08A 4HH9B 4GW1B 4NM8L 4KJPD 1J05B 5E5MA 2X42A 3EOBB 1V8HA 4NQDE 4X4YA 5CJ8A 5EN2A 1PEWA 5D7IA 3SJVD 4LSQL 3LMJH 5M94B 2CIIA 5KSBE 3TJHC 4GXUN 5KZCB 2RJMA 1DQQA 3VMPA 2DLIA 4V2BA 3CXDL 1C7SA 4FXGB 3DX6A 4LVOC 5T33H 3BXNB 1F58L 1JGDA 5I75B 3UJIH 3G04A 5BQ7B 5EU7C 4MJIB 2YD2A 4PRHE 3VD3A 4DW2L 3ARED 4TVPE 4X6BB 2HT4D 1RJYA 1VFBA 1A5FL 1I4FB 3S7GA 3P4MB 4IIQB 4RFEA 4UV7L 3WO4B 2EE3A 2V9TA 3H42H 3H9HA 4K2UH 2YD8A 5E8PB 4K71B 2VE6A 1KTLA 4K7PX 4OZIF 4ODWA 2VR4A 3H9ZA 3QI9C 5IW6B 1MFNA 3OWEA 2OJEA 1WUNT 4OZHE 1XR8A 4X80H 1JGUH 4Z7UE 5DHVH 3WN5A 3G6AB 3OKLA 3QSKB 1F3JA 4Z0BH 1E4KA 4U05A 1QACA 1FG2A 3IFNH 2J8OA 1BVKA 3SDCC 4L8SB 1RJLA 3FTGB 3S35X 3PP3H 4N0UE 1KB5B 3P4NB 3QAZC 3WKNA 4OV5A 1FDLH 4J8RA 4XP9L 3UTZB 3MLUH 3OPZH 3JV0A 3SJVE 4CJ1A 4H25B 4F9LC 3CH1B 5B4MD 1CVRA 1CFVL 4OD2B 1PQZB 1T21A 2DJ4A 5C09A 3VI4F 4BSVB 4M4PA 2JB5H 4JJHA 2BC4B 5A2FA 1NFKA 4OFKA 3DO7B 3F6LA 1WFUA 5CCKL 2R1WA 2IEPA 2YBRB 4YPGB 5F21B 2FR4A 2FECL 4MNGB 3TGXA 5KSBF 2BXYA 1CL7H 5I6XB 2ICES 5EZOL 4JKLA 2Z92B 4U1KA 2APXA 3QUMB 4ZTOL 2Z35B 1EMTL 2R4SL 3MV11 1A7RL 1EBAA 5DD1H 3TPUA 1TZIA 2ITDB 3FN0H 3LN5A 1ES0A 3UYPA 3RPIB 3D2UD 1Z6JT 1U8HB 5C0ND 1JPTL 4M6NL 3MQIA 4KK5D 3KPSD 3QA3B 3BISA 2HAZA 5JXED 4FQCL 3EYVB 1J86A 2EH7L 1HWGB 4DGYH 3I6GA 1IM9B 1CIUA 1K2DB 3E8UH 3L95A 4L3CB 4ODUB 3MRMA 1NL0L 2BDNL 4LNVA 1YMHA 2I5YH 2NLJB 1MIEH 2IBZY 5CHNA 3QPQC 5E4EB 3KS0H 3L1OH 3LQMA 1AJ7H 1KB5L 3BD3A 4OZHF 1JIBA 2GITA 3EYFA 4DJMA 1UEYA 4P2OA 1QBBA 4O58L 4OB5H 2BJMH 4NDMB 2CDEA 4JGUA 3VWJC 2NPLX 3OAUL 5TF0A 1LO3H 3V0WL 3NCYS 1QQDB 5EIVA 5DVLA 1F02I 5D7IE 1JGEB 5EO9A 2DBLH 3RWJA 1KIPB 4PG2C 1XCQB 1A7OL 3ALPA 3KJ6L 1N6VA 3ZKXC 4C54A 4C4KT 1T7ZA 2XKNB 1S7QA 1GAFH 1RMFL 2X4QA 4Z7VB 5D1QB 3RU8L 4F58H 4ZD3H 1IGJB 3ULVH 4DVRL 1T2QL 5CP7B 2E27L 1IC4L 4NQUA 4OI9A 4WWKB 1FBIL 2VR5A 4GBXA 4JANA 4X6FA 4HUKB 3KPSE 1JP5A 1CFQB 1CT8A 3DUHA 2VKXA 5SX5K 4M8QA 4XNMB 3BGFB 1UM5L 3HNVL 1T4KA 3MBXH 2B1AH 2NX5B 1LQSR 3B9KB 1K6QL 3SE4A 4BQBA 1T5WB 3ILPA 3TBVA 1JPFA 4KJYB 5KVMC 4Y5YC 3WFCL 4HWBL 2PYFB 4ZUTB 5TGBB 1TCMA 3KYMB 3N1QC 4H5SB 3PUCA 1UACL 4H0GA 5CGYC 5ICXA 5HI5C 4PJ5B 3BH9B 2WSKA 4XAWL 1L7IH 4UNUA 4WI2A 4GG8A 3F58L 3PGDA 4PP1D 4M7LL 3IU4H 3MLTA 3JWDC 2VLMD 3RA7L 2VXSH 3RIFK 1B6DA 2CMRL 3CSYB 2VISA 2HVKA 3BGAA 1KLGB 3PWNB 2PTTB 1FYTA 4NQXA 4M7ZB 3UTTA 4XPTH 1D5XB 3L7EB 5D7IF 4NQEA 4E41A 4JDTH 4U3CA 5DJZB 4FQHA 2WANA 4QTIL 3IDNB 3FQUA 5CJXC 3MROB 3PWJA 3EYOB 3DRTB 1AXSB 1PSKL 4N0FA 5T1KB 2YWYA 3WUWB 3IXTB 4PG9A 3DXAA 4R9HA 4W4OA 1ZGLM 3TZVB 4M62H 5A2JH 5JLZB 1X9QA 1KJ2A 1IC1A 4JY4A 4HIEB 5A2IH 2E7HA 1L0XA 2MPAL 1FL5A 4MB5A 1U8OA 2OR9H 3DECA 3S3JA 5JQ6L 2WWMD 4MA8H 1MCPL 5IHUL 5AYQA 4PJCA 4FMFA 2JELH 5FM4A 1OWWA 3ARSA 1OAYL 1I7ZA 1EX0A 1PVHA 2BVPA 3OHXB 3W9EB 2P7TA 5EOCH 2XWTB 2WUCH 5L9DL 2A6KB 1FAKT 2EE6A 4GKNB 4JB9H 1YEJL 2H2SC 7FABH 1P7KA 5ALBL 2VLME 5FA3B 5GS1A 5C1MB 3AUVA 2E9WA 4JHWH 3TWCH 2R0WH 4XX1G 1L9MA 4Z78A 5BRZB 3KLDA 2DYPB 4PJFA 4XC1H 2J6EH 1FYTD 5EG6C 5JIPA 3LEYL 2GY7B 2FX8L 4LEOA 1UFUA 5BO1H 1G7QA 1MJUL 2HVJA 3BPOC 1S7VB 2IJ0C 4LSRL 2OX5A 3O9WA 3Q5OA 4R7NA 3FB6A 4NZTH 5ERWB 3EBAA 4ZXBB 4NWTH 5TJWK 3TJEH 5HYSA 4QRQB 3N0PB 1CBVH 1U42A 4MCZA 3MOQA 5F9OL 3DXAD 3UYRH 1WAAA 4HX1B 4EN3B 1INDL 1R24A 2AJSH 3P77B 3PP3K 2WUBH 5IFHH 2XICA 5ESAB 3Q2CA 4WY7L 4OI8A 2C9AA 3QCVH 2Z91A 2E7LC 3WS3A 3O6FA 4CVWA 4MVBD 3OJDA 3S34L 1CXFA 4PB9H 2NZIA 1PLGL 4AZ8A 2EIZA 1FAIH 3S6CA 1Q9LA 2HWZH 3UZEA 5EU3A 1XFPA 2AJXH 3CSBA 1BD2D 3PXHA 1WZMA 2PO6C 3HAEG 1ZHNA 4UDTA 3JSSA 3OV6A 1RUMH 4PJ7B 1X7QB 5JPNA 3OKOA 5F9JB 4PTTB 1X5HA 1FYTE 5E99L 1NCTA 4P5TD 4FQJL 4KY1H 4OGAD 5IEKA 4Q74A 4X6DE 3U2SA 3O2DL 4HCRH 4UU9B 3UTTE 2D0GA 3HMXH 4NQEE 1T66C 4E41E 4OZIB 1J8KA 3QWOA 4KHXL 5D93C 3PL6C 2LQRA 3HRZA 3PGCA 5EDXA 4CADA 3HC3L 1WIOA 2R2EB 3LKNA 3FQTB 3RDTC 5FYKL 5I66A 4YGAB 1D9KB 4H8WC 4ZODA 5F7WC 3QO1B 2NXZC 3DXAE 5TE4H 3GBMH 3JV4B 3GNMH 2P44B 3SOBH 5ESVA 2VL4A 3VXMA 5GRVK 4P2QA 1QSFA 3FOLA 4U1NB 1R3HB 4Q7DA 5IMKA 4QTHA 4NKOA 3NTCL 1JNHA 1FL3A 3EDJA 5C9JA 1AD9B 2HH0L 3WFBH 4C59B 3ARPA 2EDRA 2BFVL 4NQDB 2EECA 1S78D 4ALAL 3ZKMC 2YUXA 1TTUA 1D6EB 3LKPB 4FZEH 4P46C 5KSBB 2I24N 1BAFL 5I8OH 3MREA 1I3GH 3PDOB 1RD6A 4KRLB 3S35L 3SKNA 3EOTL 2DDQH 2DD8H 2UWEA 1C5BH 3U9UA 2BZDA 2NY1D 43C9A 3TO4A 4KROC 4P9HC 4GH7B 4AEIH 5JHDA 1IGCL 1KTDA 4PRHB 2ZPKL 3SKOB 4PJFE 1G7MA 2A6IA 1F2QA 5EIIB 2IBZX 1PYWB 1MCOH 4EI6A 2WIIA 2DTSA 1J1PL 4PGEB 3IF1B 3MV01 1JVKA 3KS0J 4IDJH 3QCTL 3QG7H 5IROA 2W59A 1YYMH 2FBJL 5EBLA 2Z93B 4JGMA 3B2UD 2G2RA 4LSUL 3SGKC 3B3IA 5C0DB 5EU5A 4TULH 4OZHB 3ARDC 4PS4L 3RQ3A 4NHCH 1CS6A 4Z7UB 3O6KH 4P23C 3LKOB 1NDMA 3K8LA 3VXMD 1EJ6A 1OP3K 4NCC1 4P2QD 4IMLB 1TVHA 1SYVA 2BHZA 1UQSB 5ETUA 1OAQL 2HN7B 1MIMH 4NJ9L 4UINH 2DM3A 5DJ6A 1KGCD 3U30C 5D1ZD 1C16A 1QNZH 4X98A 3QEHA 5T1MB 5CZXC 3SJVB 1DLFH 1NFDA 3ARFA 4ZFZA 3MMEA 3STLA 3O3BA 3I84A 3KAAA 4CAGA 4HZLB 1A6TB 1U8QA 4YX2H 3L6FA 3C6LA 3CFKB 4NKDA 3QIWC 5HPMB 3S4SB 3IFNL 3VDAA 5I8EB 5F6HI 1R3JA 1ZVSB 2L7UA 3AREB 2EDEA 4TVPL 3S88L 3T2NL 3TO4D 5F7EH 2HJLA 4YUEH 5EOQH 4M00A 5JHDD 1WC7B 5IHZB 3X12B 5ENWA 2JB6B 5DMJB 1YY9C 2OL3A 3FONB 5I9QC 1FZJB 2Y36H 4PJFF 1P7QA 2X2YA 3BD4A 1HNFA 3RNKB 1HYRC 1MRCH 1NCDL 1GZPA 5DS8B 4ZS7H 5HY9A 1CL7L 4PRAB 3AY4C 3VFWA 1FE8H 1S3KL 2YD7A 3QUZA 1LD9B 4QY8A 3RUGE 2KQNA 2VXUL 1Q0XL 2YS4A 1M7IB 5K9KA 4OGYH 3VXME 3MLXL 4OCSH 5SX4H 2BSSB 4FS0A 4P2QE 5I1CL 4OM1L 4NO2A 4JREC 1L0QA 1LO0H 4MA3B 2IGFL 3L5WB 3TNMB 3M45A 2L4OA 4HXBL 4OF8A 1WAAF 4TRPL 3FN9A 3HE7C 4XMLL 4X7DC 1MCEA 3SE8H 2YMXL 5E5MB 5E8DL 4MQXC 5BOZG 5IBUB 1N2RB 3EFDH 1WSST 1JZ5A 3BH8A 5D7IB 4M5YH 4OLWH 3ARFD 2CIIB 1ORSA 3JVGA 2RR3A 8CGTA 1DBBL 3FCTA 1DQQB 3KYOA 3ULUC 1P5UA 2DQFB 1NGXA 4G43A 4J3WA 3DX6B 3MJ9H 1CDIA 3N1GC 2UWEE 1JGDB 5IMOB 4AMKH 3G04B 5JHDE 4LOUD 3LEVL 1KCLA 4LPVA 3D2UB 3DOSA 4UBDD 4ZO7A 4Y8DC 1RJYB 1UA6H 1UENA 4XPFL 5EOCJ 4HUVB 1YEHL 3KPSB 5JZ7C 3GSRB 2DBLL 1A3RH 4WCYL 5C0EA 3H9HB 5AWNH 2C3GA 5K59E 2VE6B 1KTLB 5DEZA 1P7QD 3PWLB 1OAKH 1S9VA 1GAFL 3BKJL 5I71B 2HMIC 4HS3A 2O61A 3QO0A 1RK1A 2ATKA 5CEXA 4LCCA 3S36H 1MJJA 3DUUA 5FGSA 3OKLB 4JJ5A 1JGVH 1F3JB 5CMAA 3RUGF 4HAFA 1FG2B 4QNPE 1BVKB 2FH8A 4KMQA 1W8NA 3AROA 3TN0C 2IFGA 3BDXA 4M6OL 3IS1X 1H3GA 4OV5B 2EH8H 2F74A 2NZ9C 4NBZB 4RISH 4J8RB 1G9EA 3SKJL 4JO4H 3TIEA 5FV2A 3ZE1E 4MX7A 1KTKE 3KDMA 4R90H 2DQCH 4FQQA 3HN3A 2ARJQ 1T21B 4EQ3A 3C5ZD 1H0DA 4YBLC 1WISA 5F7LB 2BVTA 4ONGH 1A1MA 1FIGL 2R23A 1HHHA 4MAUL 2R1WB 5KSVB 4ZFFA 5EZLB 1SY6H 2Y6SC 4K3HA 1VFOA 4OD1H 4NO0A 4XP5L 1IGFH 5GZNC 1G7JB 3KR3H 2FWOA 1BVZA 3QH3A 1UH3A 4J3UA 1AR1D 3GSWA 3TPUB 1FL6A 1TZIB 2UWEF 3LN5B 4UT9L 4N8VA 4MQ7A 3OXSB 5DD3L 1U36A 2ITCA 4IRZH 5C07D 5FGCB 2AK1L 5T1LA 1YEGL 5D8JH 1AC0A 1A6VL 2IWGA 1G0DA 3I6GB 1TQBB 2L7JA 3SBWA 5MEQA 4NT6A 1FC1A 3L95B 1V3MA 3TCLA 5K59F 4NNPH 4JFFA 1G0XA 3MRMB 2YPKA 4UT6H 3IDJB 1HKLH 3S36X 1YEEH 5IW1A 2EYTA 2AEQH 5CHNB 5H8DA 4XNXH 1FFRA 5GS0L 1RVFL 3WKMH 3HAEB 4QRTB 1RZGB 2GITB 5B3NA 2B1HH 1GJIA 3ROOA 3FT4A 4LL9A 1A4JB 2HFEB 4M61A 2CDEB 5ITFB 2PYEA 4QNPF 1JL8A 4GKOA 4IRJA 3V7MA 2JK5A 4QXTB 3T2QA 3K2UH 2ZUYA 2J5LC 5EO9B 4ODHL 4ETQA 4NP4H 3RIAF 3ZE1F 2IBGA 2E8ZA 5MI0C 4Q9QL 4R8WH 4M3JA 4U1LA 2UUDH 2X4QB 4EI5C 3ARBC 1NMBL 2WWKT 2G5BA 5C92A 3FZUD 1U95A 5IEHA 1ZE3C 4QCIB 1JGLL 5BS0A 5I19L 2M26A 2R0WL 4JANB 3QNXA 1KNOA 3MBEC 4GS7C 4M8QB 1TJIH 3IDYC 4YXKL 1T4KB 5GRYA 1OTTC 1BQLH 5GSRB 5T1LD 4JN2A 4BSWA 3MUGA 3GGWA 5EORL 1LMKA 3ILPB 1JPFB 4P3DA 3C60C 1K8IA 1I1RA 4MD5A 4QXGH 1C8PA 5I1LA 1E6JH 1IQDB 5GGQH 2C5DC 2P46B 3QUXD 4Y2DC 1Q9KA 5H35A 1IKFH 5KTEL 4NC1C 5ICXB 3QFJA 2DI7A 2A73B 4QLRA 3BP5A 2Y07H 5B8CB 4H20H 4GG8B 4K8RL 3PGDB 2AJSL 3H3KA 1X44A 1SEQL 1BEYL 2F5BH 5D6CA 3CZFA 3DI3B 4LLDA 1KPUB 1AD0A 2E9IA 2PYED 2VISB 4TOYH 2HVKB 1TZGL 1NMAL 1FYTB 1SYSB 4FQXC 4MJ6B 1CCZA 4LDOB 3NH7L 4X6DB 1KCRH 4GKZA 4ZSOA 1Z9MA 5MERA 4KQ4H 1B2WL 1Z5LA 4FQHB 2AJXL 1DE4B 1NAMH 3ARUA 3ORJA 4D3CH 5DA4A 4N9GA 1RUML 2AEPH 3E2HC 1F2XK 3QHZH 4HJJH 4NN7B 4JE4B 3X17A 5H37H 3K3QA 3DXAB 3C08H 4NFCA 1CXLA 4X5WA 1KJ2B 4JQIH 4XHQA 5FYLD 3B83A 1FL5B 5HGAA 2O93L 32C2A 1RY7B 4HJGB 1G9MC 2BRRL 4DZ8A 1KUMA 4GRLC 3QI9A 4YHMH 2B0SL 3T3PE 3HG1D 5I73C 4XNZC 2E6PA 2FNBA 5IHLB 1R0AH 1DLHA 1CR9H 1BD2B 3RVVC 3SDCA 3S96A 3B5GA 4GKSB 4JO2H 1P7KB 3QFJD 4MYWB 2VXVL 3NFPA 4R2GD 5DI8A 5GS1B 1YQ2A 1UH2A 2EXWD 2PYEE 3CDFA 3BEWB 4XP4H 5GPRA 4G8IA 4F9LA 4P5TB 1BBJB 1IAKA 3O2VH 3V6FB 4Z78B 4PJFB 2A74A 3P9MA 1JTTA 3R0NA 5E00A 3FRUA 5FYJU 1NDGB 4S10A 1MFAL 3ALXA 2E7BA 4V1DA 2KPNA 4FZEL 2VLJD 4LEOB 4G9FA 2DAVA 1G7QB 4FNLL 4HPOH 2PKDA 4LCIH 4P9ML 3VD5A 4KZEH 4KMLB 1ZXQA 4R7NB 4WI5A 3WXWL 3ET9F 2Q86B 2E5EA 4OKVB 1XGYL 1JNJA 5AD0A 3KLHC 5HYSB 3ESUF 2BHYA 3GKZA 4OZFH 4AEIL 1KJ2L 2XQBL 1QFUL 2O5XH 4G7YH 3KWWA 3FT2B 3P3YA 2MSPA 3RNQB 4JPIA 4PYHA 1OD7A 2GEEA 2HP4A 3SO3C 1NCCL 5T1DH 3HG1E 2XZAH 2FX9H 1C5DA 2Y06H 5FKPA 3R1GL 5H2BA 3WS3B 5HYFA 4KMTH 4OLZL 5E03A 3D0VA 4NHUB 1NQBA 1BM3L 1OTSD 2EIZB 2X4NA 4JRYB 1QOKA 3T3PF 4LU5H 2OP4L 3QFJE 2DRUA 3SY0B 3O6KL 1PKQA 4XBEH 5AG9A 3SDCD 4UDTB 1ZHNB 2NY1B 3P0VH 4JFXA 4PGZA 3VWJA 2X5PA 5JPNB 4Q9BA 1AGCB 4KHTH 4WTXA 5GGRB 1Q72H 1ZT7A 1W72H 3ES6A 3C9NB 2P47B 3HFMH 1KCKA 1DLFL 4RFOH 4PG2A 4ZSOE 3D39A 1EA9C 3DX7A 3QWOB 4V1DD 4XMPH 4RIRA 4YX2L 1RZJC 1DFBH 3HRZB 3MJGX 3PGCB 4J1UA 4CADB 4B53A 5HI4D 1A7BA 4MXWH 5TE7L 3MOBL 1WTLA 3C09C 5J9PA 5A2LH 3RKPA 3RUGB 2ICWB 3VD7A 3B2VH 3DX9B 4XNQA 2VOTA 2IAMC 4WNQA 5F7EL 5IJVA 3VXMB 5BJTA 4P2QB 3FOLB 4TUOB 3O3EA 4POZC 4R97B 4QTHB 4NKOB 3B5TA 3KG5A 2QR0A 1BIIB 2JTDA 5D1ZB 4X8XA 2YWZA 4M1DH 1FL3B 1J1XL 4L4JA 3T3ME 5C9JB 5I1HL 3ZT7A 4ZS7L 1A7NH 4Y5YA 2IPKA 4KZDL 3U4BH 5E8OB 4MLSA 4Z77A 3WFEH 3IJHA 2GAZA 1UT9A 3H0TB 3BIBX 4KWUA 5J6GB 2PTVA 4MA7H 5IBTL 4MHHG 3NCJL 3OB0K 3QPQD 1TFHA 1XIWC 1IAOA 3VFTB 1MCCA 1QTYT 4LF3B 1FRGH 4Q2ZA 4HBCH 5DA0B 1QSVA 5D7SL 4NQSB 4JPVL 3SKNB 2UWEB 3U9UB 43C9B 3TO4B 5HTSA 3VWJD 3KPTA 1FHGA 1J1OL 5JHDB 2HJKB 1KTDB 1IGMH 3MJ7A 1DBJH 4TPRH 1KOAA 1BIHA 5DC4B 4P5MA 1PX3A 5ESQA 3WE6A 2MCG1 4EI6B 4V1DE 3MYJA 2WIIB 4EDWH 1IEBA 1QP1A 3MCLL 1NC4D 3HI6L 5CJXA 4LPYA 3BMVA 3WNMA 5FEBA 5DJ8A 1FO0A 3QUKA 4LDEB 5E2JA 3NZHH 1DANU 1HOCA 2ZSVA 3GMRA 1CF8H 2Y5EA 4L4VA 1MJ8H 4ZQKB 4F7MA 5D96B 5E6YA 5EU5B 5JIIA 2UZYB 1CWVA 3IDMA 5FUZL 3PIQA 1PW3A 3KPMA 3DV4A 4LLQB 1NDMB 3BP4B 4NOFA 3RIFF 4JVUA 3HKFA 3V5KA 5DJ6B 4KQ3H 1C16B 1UCBH 4GQ9L 2YD9A 3BEVA 4KKLC 4E0RB 5MEND 2EZ0C 3ARFB 5C7XH 5HVGB 4ZFZB 1AIFA 2YA2A 3T3MF 3CLFL 3STLB 3O3BB 4MQTB 2ZCKH 4KAQH 3L6FB 3ARYA 3NA4A 5F93C 1I1AC 4EDXB 1MEXL 4QKXB 3DLQR 3DRQA 2VLLA 1H3TA 4YH6A 2BNUB 3RI5K 1MFDH 1MREL 1E4JA 4XWGL 1CLOL 1JN6B 3SGDH 4TSBL 5DJ2B 5D7KE 1IARB 4JO4L 1JF1A 3I9GH 1GC1L 3DETC 4JKPH 1MHEA 1OHQA 2KH2B 4R90L 2J4WH 5ENWB 1XH3B 2LTQB 4RAUA 4JFED 2H2PC 1O7SA 2OL3B 1FN4A 3RBSA 4PJDA 1P7QB 2QTEA 1U8LA 2P4AB 4YZFE 2P48B 4LQFH 3DTXB 5HY9B 3QCUH 4LSDA 4LCUA 4FQPA 3OXRA 1RZKH 4JKMA 3CPLA 4XTRC 4L4VD 2ZUWA 3LEXA 1B4RA 5TDOA 1Q38A 3ULVD 2IFFH 3DSFH 3FB8A 4NO2B 4FQ1L 1KFAL 2AXFA 3CFDA 4IRZL 3Q6GH 2BOCA 4WI7A 1Z0MA 1N7MH 1H15A 4DKEH 2AK4D 5GSVA 5EWIH 2E7LA 5MENE 4JPKL 3WLWC 2Z31C 4WIQA 2APFA 2DQJH 3DX8B 4TSAL 3C5ZB 5KSAC 4M3KB 4ZOCA 4U1JA 4WUUA 1B9ZA 3BH8B 3A0OA 4HK3J 4P59H 2AS5M 3QXAB 4XXCA 1GGTA 4LDLB 4K9EC 1VFUA 4G43B 1A2YA 2PO6A 1P84K 3STZA 4L3ED 2GI7A 5DO2D 2IALA 2DQTH 2FJHA 5L0QB 1DEDA 3GKWH 1GOHA 4PLJD 4UQ2B 4GJTB 4KC3B 1BOYA 3BSZH 1IQWH 4BZ2H 1ZEAH 4ZFOA 5C07B 2OL3L 3HZVB 5ADOH 4KKAD 3ROLA 3ZE2E 1ADQA 3L3DA 4RBPH 4NP4L 2J6EA 5C0EB 2BVEA 2Q8AL 3FB7A 2Z4QA 3F12A 5CEYB 2YRPA 3ZDYE 5C9KA 1EGJL 4R8WL 1S9VB 2F15A 5ALCL 3P4OA 5J57B 3BPCA 3RDTA 4HS3B 3WJJC 4G6MH 1CE1L 4L4VE 3QPXL 3QO0B 4NZDA 1RK1B 2YKLL 4YZFF 2ATKB 3ULVE 2I60H 4LCCB 3UEZA 2DWDB 3P2TA 4OCRL 1MJJB 2R0ZH 3CDGA 2VL5A 1NGYB 4G8GA 4CDGC 4K94H 5CMAB 1NEUA 2AK4E 4XPBH 2NY4C 4HGWA 2J1KA 4NKMB 1E4XI 4LSTH 2BP3A 2CKBH 4AIOA 3B4NA 1BQLL 4NN6C 5KVDH 1RU9H 2CJUH 1P84J 2RIKA 1JYVA 3TIEB 3WIFA 1QFWI 1F90H 4NM4H 1QPXA 3GI9H 1R5WA 3FQRB 4RZCA 3LHPL 2CXGA 4QXGL 1D5MB 1B4JL 1SHMA 2BERA 2R23B 4AL8L 1HHHB 4L3EE 1S7RA 1F6LL 4ZFFB 4ZNEA 2B39A 2CIKA 1EJOL 5E8NA 4LKXB 4PJBA 2Y07L 4UB0H 2VQUA 5T5NF 1YEKL 3V4UH 2APWA 1L6XA 1S7TA 3QISA 2NYYC 1S7SA 5CLWA 3GMQB 1FNSH 1FL6B 3AM8C 4N8VB 3VFPB 1RPQA 2MMXA 1M05B 4Y4HC 4OSUL 1BQSA 1NGQL 4IOFC 4PJDE 5FB8A 5E2TH 5T1LB 3U7YL 1T66D 3CFEA 1P5VA 5JOFA 3GSNH 1V7NH 1BBDH 4PJIA 4UOW0 3C87A 1ED3A 4PTUA 4NT6B 3TNNA 5MEQB 4NKIL 3TCLB 3SGKA 5CIPB 2XTJD 2YPKB 1KJMA 3QUXB 4KH2A 5DT1L 4CDHA 2H45A 3ARDA 1JFQH 1QD0A 2V7NA 3X3GL 4P23A 1U93A 4WU7A 4OUUA 4HPYH 4G8GD 3ULVF 3IVKA 2BNRA 4KVCL 4XMKH 4CN6A 1ZTXH 4AYFA 3L9RA 3ROOB 4FQIH 4M61B 2PYEB 3O0RL 1I8IA 3KPRD 5T5FL 2BSED 3GO1H 3RGVA 1VPOH 2VDNH 4FFWC 3V7AE 1NGZB 2W38A 1U6AH 4HUUA 1R0AL 1FZOA 3RWFB 1LHZA 4U1LB 3N06B 4XP6H 2FSEA 1FFOA 4KUZH 2B5IC 3RY5A 5ACZB 5EC1A 5GGTL 4ENED 4MA1C 1CFTB 1UC6A 4ZTPL 3TBWA 2G5BB 3D3VA 4KROD 2X4PB 3TYGH 4MCYA 3VXRA 1EK3A 1ACZA 4JO1L 2DF3A 3QNXB 1LDPH 2AJVH 4X99A 2RFXB 5GRJL 3LQZA 4YAQA 5DUML 2VQ1B 4JN2B 4U1GB 4HUXA 4BSWB 4PJDF 3AY4A 3HG1B 1NEZG 3GGWB 2KDGA 5HI3C 5BOPA 4OZ4A 4P3DB 1K8IB 5SWQB 3B9VA 4G6FD 4P4KD 4MD5B 3D48R 2DLTA 4PPTA 4JHZA 3BRFA 4G8GE 3VI3E 4WU5A 1Q9KB 1BFVH 1YC8A 5T3ZL 2F19H 3QFJB 4P23D 4CVZA 4R2GB 3BP5B 1CQYA 3DROB 4EXPX 2VIRA 1SJHA 3UPRA 2GTZB 1RIUH 1GZQB 3HE7A 1MAJA 5E1HB 5I75C 1B0GA 3NA9H 5FGBC 5D6CB 3HNTL 1KIQA 4LLDB 3N9GL 5EZJA 1AD0B 5CZXD 1NUFA 1XF5A 4YEEA 4NZRH 1R3IH 1Y6KR 2O5ZL 4JFQB 3RGVD 3V4PH 2VLJB 1HHJB 1YJDH 4ZSOB 4IIQC 4R4BA 4DEPB 2NY2D 2ZOLA 2JJUA 1F13A 4LVOB 5BVJA 4K71C 4PJBE 5I8CB 1ITBB 3L5XL 3OR7A 1FV1A 4ZPTB 3T04D 3N85L 3OKKB 4D0DA 1GIGH 2MCPH 2W9EL 1KN2H 3P0VL 5LGHH 1IGYA 2DICA 3GRWL 4ODSL 3D3VD 5F1IA 3D69A 1Q72L 4X5WB 2ZG1A 5CJQH 1YY9D 2V2WA 3GJFH 3MRGA 4LP4A 5HGAB 3A6BL 4L8SC 5D71H 32C2B 3LRSA 1L4IA 3HC4L 4PJIE 5K9OA 2GK0A 4YWGH 3KJ4B 3TBSA 4DZ8B 3LB6C 3MV9A 2K3TA 4PV9A 3RP1A 4Y8AA 5I1EL 4PJXA 4BH7A 3PABA 4QWWD 5TPWL 4R26H 4KDTC 2BNRE 1JHLL 1UWGH 3SDCB 4MNQA 4PGBA 4QHKI 3TN0A 3VI3F 3NFPB 3M8OL 5GGUB 1IGTB 5DI8B 4M8VA 5GRUL 5I6XC 3MLRL 2RAMA 2XKSA 1DQDL 3Q6FA 4ODTH 2NY0D 4G8IB 5FOBA 5IT2L 2VMFA 4MQXD 2YEZA 1MELA 4H26A 2H1PL 1OP9A 3P9MB 3U4BL 3REVA 3CC5A 1NBZA 1QVOA 3F7YA 4RBPK 3X3FH 3O2WH 4WUKH 4V1DB 1Q94A 4NSKA 1BJMA 3DV6A 3FFCA 1FRGL 1AQKH 5J12B 3D3VE 1GHFL 4LASH 4PJBF 4KDVA 5AD0B 4X5XA 1DCLA 4XXDA 3LKRA 1QHPA 3BW9A 3QG6A 2VITA 4TPRL 4LLMA 1QLEL 3LDBB 5E4EC 4H0IA 2Q20A 4JPIB 2A6JA 1LEKA 5JZ7D 3UZVB 4XCFH 4JDVA 1EHXA 4LCYA 5SWZD 1RJZA 3D1MC 2HMID 2KBGA 3HLAA 5A3ID 3MV9D 1XGRB 4OIIL 1ZWIB 4PJIF 4Z7OE 5C0FB 2CGRH 3K8MA 1MJ8L 2X4NB 1CU4H 2C1OA 4H1LG 1HQ4A 1BWMA 3DNKA 3MRPA 3QNZB 1T1YA 5D1QC 2AJYH 4MNQD 4LAQL 4JFXB 3TN0D 3VWJB 4JQXC 5MHSD 4QRUB 1M7DB 2NZ9D 1R3LA 1MWAA 1QFHA 1ZT7B 4WEBH 3ES6B 3K0WA 4WWKC 3ECBA 3BYYA 4G7VL 1CLYH 3FAXA 1ZLUK 1CVSC 4Z8FL 3ULUE 1NC4B 2XRAH 5BV7H 1OCWH 3PGFH 1T3FA 4EI5A 2ZCKL 4YDJA 2A0LD 1FORH 3ARBA 2GFBB 4J1UB 2QQLH 1SY6A 4F33A 3B9DA 1SJEA 3O4OB 5KW9L 4G8FA 3H3PL 5JW3H 4KTYA 5F9AC 2Q7YA 3FFCD 2EXYD 3Q0HA 3VWKA 3ETBF 1KIUA 5D72L 1ZHKA 4XNQB 3VG9C 5EULV 3QUYC 3OJVC 5IJVB 4NO3A 3MBEA 5DYOB 4S1DD 1KXQE 1P4IL 5BJTB 4BQ8A 1S8DA 2J4WL 5SWZE 1BOGB 5DK2A 3ZKNC 1N64H 2BY2A 1F4WL 1JRHH 4FOMA 5GJTH 1EDQA 3SQOL 1GGIL 2P8MB 5I76B 3UBXA 3S3PA 3MV9E 1AGDA 2R1XB 4WHTB 3LZFH 1TVBA 4OAWA 3O8XD 3C60A 5MENB 1IAII 4F3FB 2IPKB 4X7FC 4Z77B 2NW3B 2GAZB 1QPPA 3IJHB 4R4NC 4ELMA 2VDPL 4Y2DA 1RZKL 4BFIA 4HEME 1CLZH 2W0PA 4LGRB 4Z7OF 1CZ8H 2IFFL 1IAOB 4BM7A 2F54A 4MNQE 4X7TA 1F4XH 4Q2ZB 4S0SD 5MHSE 3OKEA 5K9QI 3OAYK 2ZOKB 1N7ML 1JK8B 5DFTA 3IJSB 1ZGLP 1FC2D 1T04A 4HUWA 4NRXA 3X14A 1NJ9A 2IPTL 1BVLA 4HJ0C 5F1SA 2V5RA 4FQXA 3MJ7B 1WCBA 4JFEB 2DLHA 5C6PB 5ANMA 3TZVC 3CVHH 5ESQB 1KELH 2AERT 3ALWA 4TN9A 3WE6B 2QSVA 1YECH 1DL7H 3RJDA 1IEBB 1OPGH 3MRKB 4N5EC 3FFCE 3ULUF 5DJ8B 1INEL 1OGTA 1I9JH 2QQKL 1Q0YH 1VEPA 1HOCB 2ZSVB 1G9NC 3GMRB 1PG7W 4RNRA 4L4VB 4IOIA 4F7MB 3VWKD 3P4LA 1UJ3B 3MGTA 1U8MA 3PV6A 3KNBA 1JHTA 1F42A 1FNAA 3KPMB 2CDFA 1EEQA 2DKUA 3JUYA 4JCMA 1AQDA 3IDIA 2AK4B 2EDNA 5E8EB 4HV8B 3VXTB 4OZGA 1OTTD 3GHEH 2V9RA 2CD0A 5IQ9A 5KOVC 3V5KB 2Z8WC 4Q6IC 5D70H 4D0BA 3BEVB 2ZUVA 4OT1H 5DGQA 1MUJA 3L5IA 3C60D 3LD8B 3GB7A 4ZDHB 3GSOA 3BGMA 4QHNA 3UBXI 4X6EB 4YDKL 4PGDA 4QF1A 5HHXH 4Y2DD 4RMSA 5DTFB 4LLVA 4WFGE 4HWNA 1EO5A 4L3EB 3JWDL 3LY6A 2CDGB 1HH6B 4M5ZL 1ZKAA 2F54D 2VLLB 3DRQB 4XWOD 1J18A 4WENB 4YDLB 4LSTL 2OSLA 5CINH 5DR5H 1KXVC 4ZXBC 3LCYA 4YHKH 4MS8D 5JR1H 5DQJA 4AT6B 2RCSH 1N26A 1RHHA 1JZ7A 4FFVD 1WQVT 2HT2D 5JXAH 4TTGA 2I07A 1W0VA 4L5FH 3SDAC 1FN4B 5SWSA 5KJRL 1YYLH 4PJDB 3GJFK 5J06A 4EN3C 4LRNL 1JYXA 1E27B 3QXDA 1CYGA 1XR9A 3DVGA 1FO0L 5EFIA 3IFLH 4M1GL 1NAMA 2V5MA 3FO0H 3OXRB 5AYUH 4M4RA 3CCHA 3LV3A 35C8H 3LEXB 2X70B 4JY6B 1P4LB 5D5MB 2BOCB 3QEGL 2A83B 2NMSA 1I9RH 1H15B 1XGTB 4TNWK 1TETL 3MNWA 4NFDA 4ONFL 3KVQA 4WI8A 5GSVB 5E1AA 3EOYG 1S5HA 3RX7A 5DURD 1BFSA 4ELME 4U1JB 5DD5H 1UXSB 1FGVH 4OJFL 1YDPA 1FNHA 2UV3A 4NC1E 2P5WA 4RRPA 1JFQL 3IAPA 1ZHBB 3PJSB 3SE9H 2F54E 3RVVD 1G7PB 3HC0A 1L9NA 3S37H 3STZB 3U0PB 3GMPA 1KENL 4XMKL 5GS2H 5I0DA 2BCKA 3TT3H 1D9KC 1I8KA 1WIUA 4YHOL 3IFPA 4NQTA 4G5ZL 1LK2A 1S9XA 1JNNH 5ANME 2VWEC 1IEAB 1KC5H 2NXYD 1VPOL 4APQD 2ZWLT 3L3DB 1S7XA 5GQBA 1N4XH 5TE6H 2Z4QB 3F12B 1YEIL 1V7ML 1PAMA 5FUOL 1WEJL 3P4OB 3BPCB 3FFDA 1PBYA 5F1OB 2XTJB 1PDKA 1E4XL 4OF7A 2JKXA 4X0KA 1FLTX 3W9DA 1ZT4A 1T1ZA 2IAMA 3IS0X 5INCA 1RFDL 3U36A 5I15H 3CDGB 2VL5B 4G8GB 5CILH 4LLUA 1BQHA 3BP6A 4G6JH 4OQ1A 4XT1C 1IVLA 3LS4L 1YQVL 4EUPA 4OZGE 3B43A 4U6YA 1FCGA 2J2ZA 1X5LA 1UWXH 3KPRB 4XRCA 3WIFB 2HRLA 3LIZH 1EEYA 4BSJA 1R5WB 2P49B 4RZCB 1UG9A 1OLZA 5E0QA 4OM0L 1MJ7H 2C3XA 1ZA3B 1XIWA 2EIDA 5DJXA 1BFVL 4ELMF 1S7RB 4ZUSA 3MUHL 3HTLX 3VGFA 2QHLA 1KPVA 2KQMA 2OZ4H 4C57C 4JKKA 4FRWA 4PJBB 2X7LA 3PQYA 4UT7L 3GSQA 1OAUH 1RIUL 2V7HA 4YNYA 1LGVA 1S7SB 4ZFOL 2DLFH 1RUAH 1VEMA 2ICCA 3HMWH 4PLKD 4HW6A 1KLFA 1ADQL 4GAFB 5KS9A 3WV0A 4S1QH 5FB8B 5IV2A 1VGKA 3U46B 1JJUA 3V4PL 3BO8A 4WO4D 5KVFL 1R3KA 3CFEB 4FABH 1PJ9A 5JOFB 2VDRH 2VDQH 4GAGL 4PJIB 1VFAA 2EC9U 4H8WL 5HDLA 1NAKH 4G6FB 4P4KB 4C58B 2JF1A 3TNNB 3UDWC 3VFSB 2NY7L 3INUL 1KJMB 2NR6C 5E2VL 3NABL 3KLAA 4DN4L 1EHLH 2I25N 3P30L 2IAMD 5DD6B 4P23B 3OKMB 1IC7L 3RL1A 4POZD 4JRXA 3L9RB 5CS7A 2AABL 1AFVL 3HZMB 4I0CC 1D6VH 4YJZL 1N5YL 1I3RB 1U8JA 1MLBA 1RI8A 4AQ1B 3AREC 4OZGF 2HT4C 3IU3B 3C5SA 1FNGB 1SVCP 3RGVB 1AXTH 1UM4H 1MPAH 1F5WA 2P5WE 2H9GA 3HI5H 1K4CA 2NY2B 3GMNB 3IGAA 2AXGA 1I1AA 1FZOB 4J6RL 5MP6L 2FSEB 4R26L 1FFOB 4Y19A 4XPGL 4WTZG 3GIZL 4P9HL 5DWUL 2YN3A 3PQYD 4PR5A 4LSVH 4FTVA 3U82B 5LBSH 3D3VB 3NZ8B 3SKMA 4GAJH 3O6ML 4MCYB 1P4BL 2ZG2A 2XY1A 3C8KA 3GM8A 4G3YL 5GIRA 1A02N 3L3OA 3G5VB 1AO7A 3GSXB 3MOAL 4K7FB 5FHAH 2W60A 3VGGA 2J88H 1G7IA 2H32A 1CGTA 3EDKA 4HUXB 1A4KA 1FVCA 1KJVA 5HYIA 2RBLA 1W2KT 1QRNA 2V9QA 3EGSB 4OD3H 4OZ4B 5B4MC 4ODXA 4HFUL 2HG5B 1MCFA 3HUJA 1TJGH 1UVQA 2XIDA 2BVYA 1ZVHA 2F5AL 3RI5F 1KSRA 1P1ZA 1AGEB 4CVZB 5H37G 4LRIC 2DQHH 3LKQA 2QQNH 4YBQD 5KANI 4JRXD 2NY0B 3EZ8A 3ZKSD 1QBLH 1J5OH 1B0GB 2Z31A 5DD0L 3VG0H 4MWFB 1KIQB 5HYEA 3CX5J 5EZJB 5KSAA 1F00I 5L6YL 3FN3A 4NJAL 4XBPA 2VDML 5L8JB 3KPNB 2OXGA 5C0NC 2EZ0D 2B4CH 1OL0A 2CGRL 2E6QA 3QFDA 4OQTA 4KK5C 1JZ3A 3QRFM 5JXEC 2X1OA 3PF2A 5E6IC 1I1AD 3PQYE 4KK9C 1ZHLA 4QGYA 2XXCB 1FV1B 4EOWH 5J4MA 4Y19D 4D0DB 5I71C 3P0GB 4CBPA 1IGYB 1RULH 1WBXB 3BESR 1W0WA 4FTVD 1JPST 4M9OA 3U1SH 5KS9E 3DETD 4S1RH 1R5VA 5CKGA 1MVFA 1Z9SA 2V17H 3AAZB 4LVHB 3LRHA 2N7AA 5SWZB 2Q8BH 3MRGB 5HDOA 5JHLH 1I7RA 4D9RD 2FYYA 3LRSB 5K9OB 5KVGH 4KTEH 3WJJA 1HSBB 1FORL 1KTRL 3TBSB 3MV9B 2D7TH 1IILE 1HXMA 4PV9B 1DUZA 3DO3A 4L8DA 1QRND 5KSUB 2G75B 4BH7B 3UP1A 3PABB 4JZNB 4XTRD 4HF5H 3BQUC 1CDBA 3DPBA 2AJUH 3MLZH 3KYKH 4OZFG 2DMKA 3O3AA 3V5HA 4P48A 4JRXE 4MNQB 4HXAL 4JHAH 4PGBB 3TN0B 4OFVA 4WW2B 4U6TA 5LCVH 5GJTL 4LBEA 4JLRA 2A77L 3Q6FB 1KEGH 3EHBD 5FOBB 5AZEL 1F3DH 2YEZB 1T03H 5KSAD 5D2NC 3CC5B 3F65A 5I1JH 3WD5L 1QSEA 1QVOB 3F7YB 3ULUL 5L88L 2DOCA 2HT3D 3I50H 1AY1H 1Q94B 1XZ0A 2ZJSH 5I74B 2VJXA 4Y19E 3DV6B 5E95B 1LO5A 3GK8H 3FFCB 2EDQA 4F37K 4M6MH 4O4YL 4X7CC 4FTVE 1J8HA 4HKBB 5B39A 3TBYA 3AM8A 4XXDB 3MR9A 4N90D 3LKRB 3W2DH 3BW9B 4I77H 4BH8B 3RWHA 2SEBB 1AO7E 1UKQA 4Y4HA 3ZE0E 2VITB 4LLMB 1RHFA 2FJGB 3U83A 4D9RE 1FH5H 4PP1C 4JDVB 5KS9F 4UUJA 5HHPA 2EC8A 1RJZB 1S7WA 1MCDA 4KXZH 3O8XB 3A6CL 2A9MH 1QRNE 1UWXK 3HLAB 4N1CA 1PGRB 1IC5H 1PZ5A 2EEBA 3HUJE 4I3SL 4XNYH 4CN4A 1ONQB 3F7VA 2UY6A 2C1OB 4HC1L 5DUPL 4ZPVB 3BE1H 4Z0XA 3QRGL 3JWOH 1HQ4B 2YUZA 1I9EA 5F72S 3RL2A 5F3HA 2VUOA 1UZ8A 2YHGA 3DVNB 5LWYL 3OR6B 3MRPB 3RWGA 1OGAA 3UTOA 3U79A 5JPMB 3TA3D 5F96L 1R3LB 1MWAB 5DRNA 4H88L 1X4YA 2J5LB 3ECBB 2NCMA 1CK0H 3O41A 4AY0A 5HHOA 4AG4H 3P0YH 1A6UL 1T3FB 2G60H 2WWMC 4YDJB 5DSCA 5IB2A 3WFDH 3ULSA 1GXEA 2DTMH 1R6VA 4JEGB 4F33B 1JZ4A 1CG9A 2Q7YB 3WLBA 5T3XH 3VWKB 3TCXA 4YIQA 5I1GL 4JRWA 4Q9RH 4JN1L 3RZCA 3D6GA 1CN4A 1MI5A 2ZKHL 3G5XA 4WJ5A 1WT5C 1IAIL 4NO3B 3QR2A 4NIKB 1WZKA 2BNQA 4LQ1A 5EUKA 4YGVA 1T2XA 5DK2B 4JY5L 2Z8RA 5B8CC 3UO1H 2HRPH 3ZE0F 1TNMA 3VGAC 4HH9A 3ILQC 1RURL 4GW1A 4GSDL 3C60B 3EOBA 5E2UL 1T6VN 1DSFH 3FO0L 4ELMB 2LU3A 3T2PA 4EKXA 4Y2DB 3LS5L 4F2MB 1JPSL 4OTXL 3HUJF 4NZUL 2F54B 4X7TB 3MLVH 4FXGA 4HUMB 3LQAH 5M95B 3OKEB 3BXNA 3WIHH 5IESL 2X41A 1MWAL 5FGBA 1OGAD 4KVNL 4MJIA 5C0CD 1T04B 5HGBB 4NRXB 1BVLB 4MDIA 4NN7C 2F58L 2IG2H 1WCBB 1AI1H 4W4OC 2GJJA 4PJ8D 5ANMB 5C0AD 1KN4L 4IIQA 4YHIB 4CGTA 1GL4B 5MEOA 1A1NB 4Z76B 4HKJB 3SE9L 4NC2B 4R4FL 5D6DC 2FGWH 1J8HE 1OGTB 3E1F1 4MVBC 1I9IL 3FQXA 3T0XA 3MLWH 3MGTB 1MFBL 3PV6B 3KNBB 3RZCD 3G6AA 1JHTB 1OAZH 2CDFB 4OLXH 4XB7A 1X6NA 4R96B 2CO7B 4L8SA 1AQDB 3FTGA 1MQKL 3IDIB 3VXUD 4E5XB 5IQ7H 4QXUL 1N4XL 3RY4A 4KKCD 4PUBH 5HHVH 5TE6L 1DQMH 3TVMC 1IEHA 5GS1C 3WHE0 4D0BB 5CUSL 4QRSB 3IDXL 3MA7B 5DURB 1VESA 3UTZA 5DUBA 5I73B 5LGJA 4O5LL 1Q9WA 1TJHL 5CEZH 4P5TC 5CZVH 5TFSL 4OGAC 4OD2A 4MJ2A 3GB7B 4K3GA 3GSOB 3BGMB 2EEDA 2CQVA 4NQCD 4PGDB 4QF1B 3DO7A 1A7PL 1VERA 3K4ZA 1T1XB 5J3HC 3G9VA 3G6DL 4MNGA 5FM5O 2VH5H 1OGAE 4PRDB 4ZUVB 4FZ8L 2IQ9H 2Z92A 4LEXH 2Z35A 5LQBH 1FYHB 1Q8MA 1OTUD 5C0AE 2NY5C 5GGVY 2NXYB 4JG1L 4QEGA 4APQB 1RHHB 4Z18A 1U8HA 1ACYH 3BJLA 4ZMAT 2I07B 5F3BB 1MCBA 1W0VB 2FL5B 4I18B 3QA3A 5IOPA 3QP3A 3QXDB 4NM8H 1XR9B 4RGMB 1NGPH 2UYLA 1IM9A 1K2DA 1NAMB 1S78C 4ODUA 4LSQH 1JWMA 3VJ6B 2VAAB 2OTUB 3MRRA 3T1WA 2Y25A 2CSPA 1VACB 3NIFE 4J3OC 3VXUE 3CXDH 2R1YA 1AE6L 5TH2A 1KCVL 1F58H 4LPWA 2LVCA 5DF0A 1H5BA 2NY1C 3GJFA 5IGXL 1HIML 3MNWB 4U1IA 5FCUH 4DW2H 5HPOA 4G42B 4LGSB 3EFFA 4GRWH 3AB0C 1A5FH 4NQCE 1JGEA 4CJ0A 1I1YB 1F11A 1YDPB 1WFTA 4UV7H 3WFZA 4EXKA 1OSPL 2AV7A 1MCQA 5D1QA 5F88B 3GMPB 3QXVA 3OKDA 2IF7A 4JQXA 3H7BB 4XVUD 3B2UC 4LCWD 4WGWB 4DCQB 1IGJA 2QADD 2E7MA 2X44D 1I8KB 3IFPB 3O3DB 4WWKA 1FFNB 1LK2B 3T4YB 5A16B 3UTPE 3MUJA 4WO4B 3RKDC 1DTUA 3HI5L 2H6PA 5CWSB 5JTWA 2P45B 1IZJA 2NX5A 4R97C 4W70A 5J1TC 1X6LA 4Z95L 4Y4FA 5D1ZC 4HIXH 4XP9H 3BRDA 5DJYB 3FFDB 3QWQB 4KJYA 1CFVH 2W65B 4P4RB 1CTNA 4X0KB 3W9DB 1ZT4B 2PYFA 1T1ZB 3QUYA 5TGBA 2IAMB 3HS0A 4XVSL 5INCB 1F3DJ 3U36B 4QHUA 4OZFB 3EO0B 3BH9A 4LLUB 5CSZA 1H9VA 5JORA 2X1XR 3MRDB 3S3SA 3NIFF 4Y16A 4U6YB 2J88L 4ZTOH 1EMTH 2ICEA 2CPCA 2R4SH 1A7RH 2M1KA 3ARRA 4XRCB 3CSYA 3BKMH 1EEYB 3PWNA 3M1BA 3MLYL 1JPTH 3ARZA 1WGOA 3HPJA 2AQ3A 4UTBL 5C8JA 2XZQL 1D5XA 3L7EA 4FQCH 1A6WL 2EH7H 5C6WH 4ZUSB 1KBGH 1G6RL 2P8LB 4LIQE 1KPVB 3IDNA 4RA3A 4LCWE 2UVFA 3WBDA 3PQYB 2XA3A 3MROA 2WNGA 1AXSA 1RUPL 2W0KA 2DWEB 2PNDA 2V7HB 5T1KA 3TP4A 2BDNH 2DI9A 4A6YA 2Y72A 3IXTA 3FRPA 1JTPA 1W72B 5KS9B 2DBJA 2GSGB 1N6QH 1KB5H 1YY8B 2B4CL 1MRFL 2ENYA 2FZ3A 4HIEA 1RZJL 1VGKB 3VXNA 1WLHA 2VXTL 4I0PA 4L9DA 4O58H 5TDNA 3MYZA 4NOBA 1NUDA 2V5TA 2AEIT 4G9DA 4QGTA 3UJTH 3OAUH 3V0WH 1EVUA 4Y4FD 2DLGA 3FL7A 2MTPA 3OHXA 5K9JL 4POYA 1A7OH 3QUYD 3HR6A 1XGUB 3TH4T 3QJHA 4DTGL 1RMFH 2A6KA 2JIXD 3RL1B 1JWUA 1M7XA 1TCRB 3RU8H 3ZKND 3BI9X 3MRNB 4JRXB 1XGQB 4U6XB 4Q6IA 4NPYB 4DVRH 3T65B 1T2QH 5EB9A 4Y16D 2BSRA 4NNYA 1U8JB 1MLBB 1IC4H 1FBIH 1DQLH 2D4FA 2DYPA 3MA9L 1UM5H 2LTQC 3HNVH 2H9GB 1K4CB 3CFBA 3MV8A 1NBVL 1I1AB 1SM3L 1HKFA 5L2KA 1K6QH 1S7VA 4Y19B 1ZLSL 2X4RB 4QOKD 2X9WA 4RWYL 5DMGD 4X4XA 4PR5B 5ERWA 5HDBE 4FTVB 4HWBH 1L7TL 4ZXBA 3SKMB 1UACH 3BD5A 1JHKL 4XAWH 3L3OB 3SDAA 4OCWL 3HE6D 3ZTNL 4HX1A 5BW7C 3F58H 4EN3A 3P77A 4M7LH 3CVHA 2W60B 3I50L 1G7IB 2H32B 3RA7H 4I0PD 1A4KB 2CMRH 1U91B 1QRNB 4M6ML 5EO0A 5F8RC 2MWCA 1QFWM 1TDQA 3C5ZC 3HUJB 1UVQB 1X5XA 2YD4A 5DZLA 2FHFA 2MQ0A 4QTIH 1VENA 5DRWA 2RHEA 4OUOA 1PSKH 4Z7QE 4PJ7A 4KRNA 5L0QC 2RQ8A 1D7FA 1AR1C 5F9JA 5KSAB 3LPWA 4XBPB 1BGXL 2ENSA 4DGIL 4ZAKC 1IC5L 4ODBD 2MPAH 4UU9A 3QFDB 2JJWA 1B88A 3U9PL 3S8WA 1WCQA 5JQ6H 3BE1L 3MV8D 4PP2B 1MCPH 3V6OC 3JWOL 4QOKE 5IHUH 2V2XA 4O2EB 5L2KD 1ZHLB 1RSFA 1OAYH 5IR1B 4C4KO 5FYJL 1V3JA 3MZTA 4GMTL 1W0WB 5L9DH 1WWAX 3JV4A 4ZXBD 5ITBH 5GHWL 3ZTJH 1P53A 1R5VB 2ORBH 3BFOA 2D2OA 5HDBF 5ALBH 5IK3A 2DQDL 3SDAD 4U1NA 1R3HA 1H3WM 1DJSA 1NCUA 5HYJD 1I7RB 4AG4L 2FYYB 2E6JA 4BFBD 1TENA 5FECA 1AD9A 2DTML 1A1OB 1DUZB 4L8DB 4G6AD 5DZOA 3LEYH 1D6EA 1JCKA 2FX8H 5KG9A 1MJUH 2Q3ZA 3SN6N 1OP5H 4LSRH 3V5HB 3M17B 4HG4K 3UZQA 3PDOA 1ZV5A 1CIDA 1UM6L 4UTAH 3TA3B 4LBEB 2R29L 3FZUC 4HKZA 4HWEL 2X10A 4PRHA 2EICA 3UAJD 2AJZA 5F9OH 4Z7QF 3TYFB 1UJTA 3N1MC 4OQTL 2AI0L 5EIIA 1BECA 4K9EL 1INDH 3MV8E 3MRBB 1VGEL 5K93A 5L2KE 1LP9B 1XZ0B 4L8CA 2OJZL 4KJQC 4PY8I 4WY7H 1LO5B 1BWWA 1HH9A 4DUWA 1CD9B 1ZANL 4M03A 1QKZL 3LQAL 4OFPA 2Z93A 1YZZA 3S34H 3SBWC 5C3LD 2AEWA 1W8OA 3IKCB 4Z7NE 1PLGH 2XA8L 4OCXL 2MQCA 3TBYB 5C0DA 3QUXC 4GLRH 3C6SA 2CLRA 5DVNA 3AU1A 4J3VA 3CUPA 4Z7UA 4I1NB 1WBYB 2BVQA 3F62A 2YC1B 3PP4L 4IMLA 1JV5A 4UUJB 5DHXB 5HHPB 3SCMD 5J1SC 2HN7A 3SGEH 1CXIA 2ID5A 1FZMB 1S9WB 2QLVB 1L6ZA 4HG4J 3UDWA 3RVWD 5E99H 4S1SL 1UH4A 4FQJH 1PZ5B 1N5AA 4P5KA 4XI5D 3O2DH 2XWJA 5BZWB 5JOEA 4HLJA 2ESVA 4N8CL 4HZLA 2PCPA 1A6TA 4KHXH 4Z0XB 1IM3A 4LNRA 3RL2B 1OAZL 2VLRA 4OLXL 5F3HB 2Y5TA 2L0DA 3RWDB 4N0YL 4PJ7E 5FYKH 5I8EA 1OGAB 3S5LG 4LMQI 1ZVSA 4GOSA 5C0CB 3ZSTA 4PUBL 3MACL 3AREA 4UOW1 4DKDC 2CKBB 2IADB 2X09A 2UZXB 5FHBL 4LHUD 5DRNB 1WC7A 4PJ8B 5C0AB 4I9WD 2JB6A 4YEFA 3ISWA 3NTCH 1IZKA 4M43L 2FATH 4FXLA 3D25A 3RNKA 1M1SA 5IB2B 1NC2D 1OD9A 3R0MA 4EVNB 3ULSB 4MA1B 2HH0H 3LN4B 5DS8A 4U1GC 1KPRB 4PRAA 2BFVH 4J23A 4JZJB 4ALAH 4YIQB 4TVSa 5FOJA 2VWEE 5SV3A 3RZCB 4WJ5B 3G5XB 4GW5A 4Z7NF 5EUKB 1BAFH 3MFFB 3CD4A 1FFQA 4YGVB 3TT1L 4JFYA 2Q76A 4RGNC 2AQ2A 4MA3A 3VXUB 3ZSSA 3L5WA 4PFEA 4LVNB 5HGHA 3S35H 3EOTH 1HILB 4F57L 1KCUL 1P2CB 2EXWC 2CLZA 4XGZA 2D03L 1IGCH 1NGPL 2ZPKH 2UVEA 3GSNB 1OAXL 3H8NA 1N2RA 4JZOA 5E94A 2O26U 2DJUA 3VXOA 3T77A 1IKNC 4NQCB 4LMQE 2NR6D 1YNTA 2HKHH 1A3LH 3LKSB 1J1PH 5IUSA 3OKNB 4D0CA 2ESVD 4LRIA 3QCTH 4DEPC 2DQFA 2YPLA 2ZNXA 1WWCA 4OFYD 3IETB 2FBJH 2VLRD 3OL2A 5IMOA 2E9BA 4HT1L 4LSUH 4I9WE 5FCUL 4PS4H 3D2UA 4MDIB 3CDYA 4PJ7F 5E7FA 2VAJA 4O9HH 4OIBA 5AUMA 1WV7T 1OW0C 4HUVA 2KUTA 5B38G 3KPSA 3GSRA 4M7LT 2YN5A 4P49A 5JXEA 1OAQH 3GI8L 5FO8A 5E6IA 4MXQD 5MEOB 1A7QL 4NJ9H 3PWLA 4OLUL 3ZKQD 3C2AL 4WI6A 3KJ4C 1LVEA 2D7MA 4PRPA 5E2WL 3FQXB 4ZS6D 1OTSC 4WW1B 1Y18A 5GRZA 2D0HA 1HE7A 2D4DA 4GQPH 4XVJL 4HGKC 5I1DB 3NMEA 4PJGE 3VGBA 3ESVF 3S9DB 1BJ1H 4KGJA 1NMCB 4TVPH 3S88H 3T2NH 3CAFA 4HIXL 5DUBB 5CP3A 5LGJB 1BMGA 1Q9WB 2V5SA 3QEQD 3LOWA 2WK2A 3K1DA 2ESVE 3BQUA 5JIHA 5KSVA 3ZL4L 2VLRE 5EZLA 1NCDH 3NFSL 5HI4C 2YPLD 4ONHB 4YHZL 4LCWB 2QADB 3P11H 3CK0L 4OI7A 1S3KH 5J12C 1G7JA 4I3RL 3UTQA 5B39G 2VXUH 1Q0XH 3REWB 3MGAA 1IBGL 3ZT6A 4LHUG 3MLXH 5D2NA 3BKML 5I1CH 4OM1H 3OXSA 2FX7L 4N0CD 2IGFH 3LDBC 3FQWA 4HXBH 4TRPH 1AGBB 4O51B 2R2CA 3BWAA 1IGIL 4XMLH 5IOPB 5E6ID 1KBGL 2YMXH 5E8DH 2UYLB 1J0JA 3WNKA 4KK9D 3NACL 3IFOB 12E8H 1IAIM 4PRPD 1JWMB 4YDIL 3IDJA 3CMOL 4Y1AD 1DBBH 3BZFB 3MRRB 4G6KL 4Z9KB 1H8NA 5F7HA 2R1YB 3FO1A 1N6QL 3HAEA 4QRTA 3U4EA 1RZGA 5TH2B 1CGXA 2E8YA 2OTWA 1H5BB 4Z7UF 3TM6A 3GJFB 1A4JA 5DFWH 2HFEA 3EYSL 3LEVH 1XF4A 3QEQE 4U1IB 3UJTL 5ITFA 3SHSA 5DMIL 4PJGF 3EFFB 2PF6A 4QXTA 2W9DL 1J0YA 4C83B 4XPFH 5DZNA 1YEHH 3WDHA 4WGVB 6CGTA 1F11B 4WCYH 5HVWA 1A14L 4MQSB 1DN2A 4LVEA 3T08A 4F37F 3BQUD 4S0TD 2AV7B 2YPLE 2W0FB 2FJFA 3BKJH 2C4XA 5AAWA 5FUCE 1NCAL 1XF3B 3OKDB 2P42B 3QUML 3O4OC 4JM2D 4CVXB 4X4ZA 2PR4L 2MOVA 3BPLC 3RWIA 4QHLB 3BWUC 5GJSL 3IDUA 4QCIA 1P9MA 1DQLL 5CZKA 2OCFD 3KPLA 3MCKA 3OZ9L 1AGFB 2YZ8A 3H6JA 4HH8A 3L3IB 1F6AA 3JBG7 3CIQA 2H6PB 4M6OH 1TPXB 2YD6A 5GSRA 5DJAB 4Y4FB 3SKJH 3BZ4B 1QO3B 5KOMC 5ELIA 3PG2A 4PRPE 1OARH 3VDCA 3I02B 2FO1A 3AFLA 3VG9B 1Q9OA 3QUYB 1IQDA 1FIGH 1WT5A 3HS0B 4MAUH 2JIXB 1CFBA 2BY1A 4QHUB 1KXTB 5DEGB 1UGNA 2A73A 2K1MA 5CSZB 2VB5A 5JORB 5B8CA 1XAUA 4XP5H 7CGTA 4Y16B 4XX1E 2ICEB 1HZHL 4TUKL 3MPCA 1KPUA 4UT9H 3M1BB 5DD3H 1SYSA 4MJ6A 5GGVL 3WMSA 4G80A 2AK1H 4X6DA 2MHAA 3HPJB 4RA0C 3GMLB 1YEGH 5C8JB 4OCMC 4F7CB 1A6VH 2CK0H 2COQA 1M6OA 3I6KB 4QOKB 2EDTA 1DE4A 4FMKA 1FVEB 2OQJB 4DUVA 4A6YB 5D2NE 1BLNA 1UJ3C 2EDHA 3ULVC 3HE6B 4OCYH 4F80A 5FGCE 1RVFH 3QHFL 5GS0H 1IFHL 2FZ3B 1BQUA 3VXNB 5ICYA 5I16A 5D1XC 4I0PB 4W6XB 5TDNB 4JFPA 5D6DA 1HI6A 5CKAA 4DKFL 5BV7B 4G9DB 4HJGA 2A1WL 4ODHH 3Q1SL 1NCWL 3LD8C 5EA0L 5JDSB 3V79C 4O2CA 4Q9QH 5ITBL 1BD2A 3QJHB 2ORBL 4WHYH 3D0LA 1JWUB 4GKSA 1WFNA 1J12A 5DO2C 3NOIA 1NMBH 3TVMA 3EKCA 2BRQA 1UXWB 4Q6IB 4KI1A 4PLJC 3BEWA 4YDLC 2BSRB 4NNYB 3ILQD 4P5TA 1BBJA 1JGLH 5I19H 4UNTA 4D9QD 3VRLE 3V6FA 1VCAA 4TSCL 4KKAC 1NDGA 2X4UA 4YXKH 2N1KA 5DRXB 3MTRA 3CFBB 3MV8B 1XEDA 1T7YA 5L2KB 1NSNL 4MMXC 5EORH 2HFGL 3UMTA 5GGRY 4X4XB 4A6YL 4UTAL 3QDMA 3WIHA 2Q86A 4OKVA 4GW4B 1QEWA 3BJ91 2A9NL 5KTEH 3MRLA 2QSCL 4NKQB 1ZS8A 3FT2A 4JPWL 3SDAB 5HYJB 3RNQA 4YO0A 4K8RH 3CVHB 2Z9TA 4GMSL 1SEQH 1BEYH 4KK6C 2KZ1B 2YUVA 1G9NL 4OKDA 5FM8A 3QXUA 1TZGH 2BVOA 1CI5A 5EO0B 1YN7B 1NMAH 2R69L 2G5RA 5DRZA 4LKCB 3NH7H 2VNCA 4NHUA 3BVNB 1U8NA 1Z9LA 5T3XD 4JRYA 1X5IA 1B2WH 4XXCC 5IHBA 3SY0A 5DRWB 4YXHL 3WDJA 1J87A 1K5NB 4UDUA 3OF6D 4WDIA 4D9QE 4U6VL 3TVMD 1AGCA 5GGRA 4ZO8A 3NCFB 1FNEB 1RIHL 3C9NA 1ND0B 5B38B 3E6HA 2DM4A 1G0YR 2GJ6D 4U0RB 4KU1A 4PJEA 1NKOA 4HS8L 3VRLF 1N0LA 4R3SA 2VKWA 3ARQA 4U1SB 5CBAB 2VZ3A 3HB3D 2BRRH 2V2XB 4IJ3B 5J3HD 2B0SH 3MRHB 1BJ1J 4H1LH 1SBSL 3ZHKA 2XTJC 3QDMD 3RUGA 4HQQL 1QLFA 2ICWA 1KULA 3DX9A 5GZOD 1NCNA 1DR9A 2WWKO 5ICZA 1MCLA 2VDLL 1ERNA 5E4IA 5IK3B 4TUOA 2VXVH 4KRMB 3SCMB 4XC3H 1WJ3A 5EO1B 1A3QA 1HK6A 1BIIA 2FATL 5D1ZA 4P3WA 5LXGL 5FECB 4RMVA 4M6AA 2J8UA 2XNAB 5E8OA 5EBGA 5T3XE 4L9LB 3MLSL 1MFAH 3EW3B 3H0TA 5KG9B 3OSKA 5J6GA 1XGPB 1BD2E 3W0WA 2VQTA 3TBTB 4JRYD 3VFGL 4FNLH 3VFTA 4PRID 4LF3A 2AV1B 4P9MH 3R06B 1X5ZA 2ADFL 4ENEC 3WXWH 1G7LB 1NH6A 3D18A 4NQSA 4YHPB 1HNGA 4U7SA 3QQ9D 2CK2A 1XGYH 1T2JA 2OMBA 4HKZB 4TTDD 4LHUB 4UV4L 2HJKA 1OSZA 1KJ2H 2XQBH 1QFUH 2AJZB 3RFZC 2C4FT 2GJ6E 3U0WL 4BUHA 4CU6A 4FQ2H 5CEZD 2HKHL 1A3LL 4L1HA 2R0LL 3A67L 4L8CB 1NCCH 1NC2B 2IH1B 4G8EA 4X6DF 1HH9B 4IS6A 4CUCA 3R1GH 3UROR 3ME0A 3QDME 4P4KC 4OLZH 3NCBB 1EUUA 4ZQKA 1HSAB 4YR6A 1BM3H 1HHKA 3C6SB 2OP4H 5IIEA 2FGZA 2CLRB 2GCYB 3AU1B 4TYUA 1OY3B 4O9HL 3CUPB 1MH5A 4LLQA 1HQRB