5CFAA

Crystal structures of bbp from staphylococcus aureus with peptide ligand
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
326
structure length
326
Chain Sequence
NNVNDLITVTKQMITEGIKDDGVIQAHDGEHIIYTSDFKIDNAVKAGDTMTVKYDKHTIPSDITDDFTPVDITDPSGEVIAKGTFDLNTKTITYKFTDYVDRYENVNAKLELNSYIDKKEVPNETNLNLTFATADKETSKNVKVEYQKPIVKDESNIQSIFSHLDTTKHEVEQTIYVNPLKLNAKNTNVTIKSGGVADNGDYYTGDGSTIIDSNTEIKVYKVASGQQLPQSNKIYDYSQYEDVTNSVTINKNYGTNMANINFGDIDSAYIVKVVSKYTPGAEDDLAVQQGVRMTTTNKYNYSSYAGYTNTILSTTDSGGGDGTVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Bbp from Staphylococcus aureus reveal the ligand binding mechanism with Fibrinogen alpha
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding/peptide
molecule keywords Bone sialoprotein-binding protein
total genus 87
structure length 326
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5cfaA01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5cfaA02
4F27A 2Y7OA 2F68X 4JDZB 4F1ZA 2YLHA 4MBRA 3AU0A 1R17A 4F24A 3IS1X 4LE8A 4BBWA 4F20A 4MBOA 2F6AA 4B60A 4Q6KA 2Z1PA 2Y7MA 4JDZA 4FJ6A 3AT0A 4LEEA 2Y7LA 5CF3A 5IHWA 1N67A 3IRPX 3IRZA 3IS0X 4LEBA 2Y7NA 5CFAA 4JE0A 4RMBA 1R19A 3ASWA 2RALA 2VR3A 3V10A 4B5ZA
chains in the Genus database with same CATH superfamily
1DSFL 4DO6A 1IBYA 2J88L 3DMMA 3L5HA 2G9KA 2XYCA 2HRPH 1TQBC 2L0DA 2A1WH 5E1GA 3AITA 5PAZA 4K07A 4LKCB 4WU5A 4EN2A 3MUGB 4EBQL 3ZIMA 2D31A 4TNVF 5EO1A 5KAQF 4H88L 3RWGB 1VADA 2N0MA 3DHMA 1E5CA 1LO5A 1P4LB 1MQ8A 5GZND 2DQHH 3V4PH 1VFOA 1K4DB 3MOAH 4OJYA 5D7KD 3AY2A 5D2LB 3OHXA 4NKMB 2P8MA 4FYQA 1AC6A 4YJZL 1EAOA 1J18A 5L2JB 5JIKA 3WKML 4WTQA 1CGYA 5I19L 3CFIC 4AK1A 3QUZB 1EJ6A 4B7LA 3Q7JA 4BKSC 4GLRI 4RZCB 3GI9L 4S1SL 1CFMA 4Q52A 1CXHA 1ZVSA 5EU6E 5CBAA 2EYRA 2DI7A 2PXYB 5SWQA 1PJWA 1A66A 3SQBA 4L9LA 1MF2H 3ZXAC 2O61A 4N90D 5D2LA 3ATBA 3HG2A 1XL6A 1IC4H 2YEZA 3GMRB 1HHGB 1KFAL 4YPGB 3GTNA 1MCEA 4YO0B 1QZNA 3CX5J 1O6TA 1JXDA 3GZOA 4M93C 4NBZB 1E9OB 2QADB 4QRUB 3VB8A 3HFML 3OXRB 4P9ML 3INOA 5HI4C 3BH9B 5E6ZA 4Z0XA 1JN6B 1FLTX 4HKJB 2R83A 4F57H 3CDZB 3S8FB 4O02A 4JFYA 1MFDL 4WFEE 2ZAIA 4O4YL 1MFMA 1QBML 1MHEB 4IRJB 2P80A 3GF8A 4IOSA 1AC0A 3EJSA 3HPLA 4D7PA 4MSWA 3MRJB 1S3KH 3K8MA 2DQ6A 5KYWA 2EDHA 2WXKA 4HD9A 4PJFB 5B7MA 4LRNL 3WY1A 9PCYA 4J27A 3SKNA 3T2NL 3U83A 4D8PB 1PY0A 2E27H 4HZ1A 4L29B 3QIUB 5JOFA 1XTLA 3MZGB 1SMAA 1V3LA 1YSOA 3MRQB 3UXFA 2ZAGA 3HUJA 1HDMB 3IDNA 1UKQA 4XMTA 1MJUL 3IFNL 4R4FH 5ANMA 3OL2A 2BWIA 3S5ZA 5EN3A 3QDGB 2Y2YA 5CGYD 3ZGIA 3C6LB 1UB5B 4PJBF 2I69A 5I0YA 2X2YA 4G5ZL 1KB9J 4GH7B 2EVJA 5E4AA 3TEWA 3UTTA 1XX9C 3H7BA 3P9LA 1AR2A 1MAMH 4UTAA 4KNSA 2X7LB 3ZTJH 3PYCA 5HHOA 4OZIB 4R4BB 2IV9A 2WP3O 3BP5A 2WGXA 2FATL 5FYJD 3D85D 3CFDB 3TS8A 1Q72L 1OGTB 2XTJD 4ZPVA 5E8EA 4DF9A 1BCIA 2NZ1A 4KTDH 4PREB 2YOCA 4NYLA 3D06A 3MCLL 4PVBA 1EHLL 4JN2B 4KK5D 4RVBA 4BQ9A 1S5HB 1DTUA 3BKML 1KELH 4IIQC 3E0GA 3KWUA 5DD5H 4YDVA 4Y7OC 3ULVE 2DMGA 2P1YA 1U8IB 2VLJA 3ARDC 1KGUA 2H32A 2X4NA 4P99A 5TH2A 1HWWA 5T1LD 4JE0A 4MQXC 1FZOA 3L9RA 1CL7L 5AL0A 3SDAD 5AB2A 1S9WB 2Q86A 4R8WL 1FZKB 2M26A 3L2NA 3PWLB 1T6BX 3E1ZA 2F54E 3K2UL 3WN6A 3OZ9L 5CZVL 2Y7SA 1UQSA 4ODTH 1E9QB 1N70A 3UBXB 5IM7B 5DHVA 5GRWA 3TT3H 5C2BH 3WTSA 1IVTA 1SLUA 4YHNB 5DK0A 1F4HA 3D8MA 4C57C 5J6GA 4JUSA 4P48A 3SDXB 1BVOA 2YD8A 4CW1A 1KJMB 3VFWA 1WFJA 3VMPA 3FQXB 5C6WH 4HKJA 1P2CB 4HXAL 3DROA 2VDPB 4LSVH 5SWSE 2UYLA 1DFBH 3OXRA 4TUJA 5MERB 2P46B 3IMTA 3V5KA 2DMCA 2RJMA 1AY1H 4HSQA 1AQDB 4YO0A 2UY6B 4K3JH 4YHIB 1VEOA 4NI3A 4X5PA 2UXGA 5FYLD 3ULUH 1G9NC 1NBZA 4W68A 1R3HA 1X9QA 1KJVB 4HUUA 2E27L 1U42A 5DUJA 3GK8L 2XKUA 3HE7B 4G6MH 5BMFH 2CR3A 3BPNC 3TBWA 3QNYB 2ESVE 2FIKB 5F7UA 3CCHA 3DJ9A 5GRYA 2JJSC 2C9RA 4OGYL 3ASNB 4P5RA 4ZTOH 3RIAK 3PXLA 1XB8A 3CZEA 3SD2A 4BSVB 1DUZA 4Y5YC 4MA7L 4ZMPA 1IC7H 4QRBA 1DL7L 5B39A 2E5EA 3KPSE 2CQVA 2PETA 6CGTA 4UNTA 2BS71 3NTCH 1DQML 4X5XB 2ISDA 3VI3E 5IGXH 4LKCA 1RJLA 2C3VA 3STLB 1W6WA 5EOTA 2H3KA 3HG1E 4X9IA 3KMDA 4LPVA 2R23A 3QI9A 2BVOA 2IQAB 4ZUWA 3K6DA 3ZT6A 4B53A 4RISH 2CLVB 2BIPA 4LCWE 1OB0A 2ADGA 2WBXA 4UIMB 5B7FA 3RYMA 5GS2H 1U41A 5I24A 3ARFA 4L8BA 1FHNA 4W9DC 4UM9B 4Z7UE 5DUPH 2K3HA 3RX8A 2IPKA 4YXLH 1N4XL 2M1KA 1D2PA 2IDUA 3O0RL 4W9CC 1EMTH 3CFDA 1C5DA 4LLDA 4WENB 1PZDA 3ARDB 2F54D 3FOLA 3S96B 3KYNA 5E2VL 4MVBD 1YN6A 2L7QA 3G5YA 4FEIA 4ZFOB 3HNSL 3WDJA 4ILDA 5I2IA 3FTWA 2LHAA 2X1WL 3HBZA 5ALBL 4ISVA 2EKSB 3JV6B 4JL1A 1AGEA 1I7ZB 2WNKA 2X4UB 3U9WA 1NJ9B 5GRUH 1ITCA 1A7RL 2LE9A 5TF1L 4ZXBA 3GBDA 3J07A 3LEYH 4RAHA 3ORJA 3LD8B 3MX0B 4PJFA 5I8KH 1Q9WA 2DM3A 3UDWA 2YSTA 2R1YA 2UZXB 1TCRA 3BSHA 4RAUB 4J4PC 4PWFA 3AM8A 2GY5A 4G72B 4WW2C 5HHQB 4HS3A 2WWOA 2I85A 1S8DA 4IRJA 3FCTB 5H35A 5JDSB 5I8OL 4F5CA 1EVTC 1EEZB 2ZWYA 4XVTH 5D6DA 4HWEH 3LSOB 4UQIM 3TFKC 3MRPA 5EO0A 1MDAA 1ZT4B 1NJ9A 3AGWA 1J1XL 4LSRH 2X4QB 2KMWA 4ZODA 5J13C 1TPXC 2HA1A 3PWPA 1X7TA 5DVOA 5MENE 3KNBB 1S9XA 5KWYC 1BBDL 2KZWA 3C5ZD 3LEYL 3GNML 2Z6FA 4GMSH 4B9IA 5HY9B 5LCVH 3GRWA 1H8LA 1IGTA 4E41B 3F7PC 4AM0A 1G9ML 2PO6C 3IS1X 4OCSL 4JO5A 3QDJD 4HH9A 3KCWA 2KUTA 3WFEH 2FR4B 3LQZB 3AU1B 1ZK9A 4JFPB 2K9FB 4M7ZC 2GC4C 5HHNB 4NSKA 4DZBB 4PBXA 3EXLA 4HALA 3BXNA 3KYAA 4O00A 1X44A 1BSIA 2HKFH 3MHZA 4X6DA 1DJWA 2DWEA 4BKLB 1FN4B 4UT6L 3RFZC 5J1TC 4WHDA 1VFUA 3A23A 3PDGA 4BSWA 3HC4H 1KN2H 3AVEA 1JF1A 3BIKA 2K4AA 5DWUH 2O1AA 3AUWB 3R7QA 4EI6B 3ZTEA 3E80A 2P42B 5F70A 1E8ZA 4JKPH 2OLDA 1GYUA 4HK3J 4I0PB 2X4PA 4I9WE 2VXVH 1DZBA 5F6IC 5HYJA 1MNUH 1PPIA 2FBJL 3D0AA 4KTEH 4QF1B 3IK2A 2DYSB 2H47C 2WLZA 2RQEA 2WLLA 3DMMB 2FJSA 3N1PC 3ZHFA 2GI0A 3GPEA 3NK4A 5JLZA 2WIMA 5KANG 2EDLA 4LLMB 1QSEB 4WJG3 2CHNA 3VFNA 3T1FA 2WBJA 5C0CD 4U0RB 3GLZA 4AYFA 3F7RA 1Y6MR 3FO0H 1JCKA 5IVXA 3LJ3A 3OKKA 1MH5B 5IHZB 3Q2CA 1I3GH 1GKEA 5C86A 2WHVA 2NXYD 4A2LA 1KBGL 3QZMA 1R3HB 3AS0A 1C08B 3KPSA 3D25B 4PD4K 2VXQA 2XN9D 4F7TB 5L7XL 4GG8B 4I3RH 5FYKH 3O3DA 3KCPA 3LTVA 2X87A 3TNNB 2FYYB 1XGZA 3NJIA 3W1ZA 4CC1A 5FFLA 4YLQT 4LBEA 5H94B 5J9PA 4IHOA 1QRNB 1RUQH 1NFIB 3K80A 4JFTA 4YHPA 2OXGB 3WMQA 2CO6B 4AQOA 4ELKB 4J2QA 1K4CB 4XCEA 5A40E 5CEZH 1FN4A 3C08H 1OW0C 3PF2A 4HJUA 2BLFA 4FCAA 1HNGA 1W8NA 3I3DA 2VCOA 2LABA 4LQ1A 1M4KA 2Y7NA 3OAZK 4ONFL 4CJ1A 5D7LD 3DX4A 2AV7A 2VXSH 4X7SH 3GIVA 2FJGA 1GHFH 1WA2X 4PJCE 5DQ9A 5TFSH 3HVNA 1KYAA 5ACMA 2OTUA 2B08A 3FAXA 2VQ1A 1ACYL 1HFUA 3LS5H 4PGEA 3TEYA 3QEQB 4MAZA 4XN4A 4KXCA 1J05B 3O6FD 5D1XD 4YAQA 1NFDA 1S9WA 4OCMC 2EYSB 3P1VA 3L2LA 5E4EC 5LXGH 2A73B 2IBBA 5D2NE 4BZ2L 4HHAB 2XPYA 1I8LC 5D1QC 5GZOD 5IB2B 1J0YA 1U8KB 5TH2B 5C0GA 1SHSA 1FJ1B 4QNPF 1T0OA 1KGIA 1BOGA 1YY8B 4ZQKA 5LG1A 4C56B 1KUMA 3W11D 4X50A 1U92A 5IBTH 3S3SA 4IOSD 4AOFA 2F54A 4BXVA 1K3IA 2MKLC 5ETUB 3FO1A 1EEYB 3NGBB 1L9SA 1RL1A 4NZTL 3TCTA 1ZVYA 1WUZA 2EE9A 3P3YA 5IJVA 1IC7L 3MNDA 1KT2A 2B15A 2DIAA 4JDVB 4OVVA 2VLKB 1IKOP 2DBJA 5KOMC 4NN7B 3NA9L 1VZIA 1P7KB 4X5LA 2B59A 4AG4H 3GHEL 3TF4A 2HJLB 1I31A 1MZZA 2VAAB 3Q43A 3L3IA 3D6GA 4E9LA 2ENQA 3L6FA 1BQHA 1WBZA 2C1OB 3L3OA 3CVHH 4L4JA 4LEXL 3FS9A 4LMQI 1A6TB 4X4MA 4AYSA 4HG4K 1KB5B 4FNTA 2PW1B 3X1NA 1YEDB 2JI3A 1S9YB 3HC0B 4JHZA 4DN4H 3M1OA 4Q6KA 1X5JA 2V3EA 4F91B 1FCGA 1IGJA 4NQCA 5DUPL 4CSTA 1B4TA 2XZCH 4JG9A 4AQAB 5AW9B 3C9NA 4K3HA 5HHXL 2NPLX 3T09A 3BSZL 2YPKB 3KPQB 3MMEA 3PJNA 5DFWH 5AVUB 1XF3B 3N43B 2ZKXA 1SFDA 3FUMA 2EVFA 3K1DA 3GRGA 2UWEE 2DH2A 4FFVC 5T1DH 2HX7A 1HWHB 4DP9X 3HZVB 4MWFB 5MI0C 1E8WA 2AGJL 4PJ8D 3RX5A 1LHZA 1ZGLA 4WO4C 4N2IA 4DOHB 4BHUA 1SJEA 1JXGA 1NC2D 4WNSA 3VE0B 5KSAC 2JKWA 1JHTA 3T4AB 4JFZL 2OM5A 2CCWA 3F84A 2CXGA 3IDXH 3MN8A 2QGCA 4OF0A 4XXDA 4Y2DB 5C6TL 3H9SD 4W81A 4R0LC 1B0GA 4LAJH 1N8OE 2EEFA 3QZPA 5A16A 3QZWG 2XTLA 4EVNB 2WN2A 2TSBA 4PJAB 2BP3A 3Q2WA 1NGXA 3G5VB 3IJEB 1GGBH 3BJLA 1ZV5A 3V6ZA 2QDVA 1F6AB 5JR1L 4DQOL 3QCTH 2VRAA 4JKNA 4P46C 4U1JA 3WFEL 2A9NH 4WFGE 4WY7L 2APTA 1VLXA 1NIAA 3SDAB 1D6EB 3ABZA 2DJ4A 1AD9B 2F74B 3QA3A 1H9VA 5I71B 3IF1B 1A3RL 3A6OA 5CIPA 3C87A 1B0IA 2OX5B 4PJAA 5ENWA 3KVQA 4V2BA 1A1MA 3ULAB 4P5MB 4BZ1A 4UBDD 4OFQA 4WWOA 5IVXE 2AJ3A 4PYGA 1KJ2A 4N5EC 2OL3A 3F7YB 1OD9A 1KJ3H 1J0JA 1XGUA 2QFRA 4QNPE 1I1CA 1MREH 3N6YA 4HF5H 1AIFB 3RWIA 1E8XA 5GS0H 4PJXA 3S7GA 4CVXB 4HUNB 3W39A 4G9FA 3G6AB 2QGDA 1YPZF 5GISH 4Q0XH 1NBQA 5HPOA 1U0QA 3RIKA 1IGFL 2CHWA 2K1MA 2JK5B 4NO0B 5KVFE 3MGOB 2ZCKL 1K5WA 5ILTL 3QORC 1DO5A 2CGYA 3MOQA 3EH2A 3KM1A 4Z3FA 4LPTA 4LVNB 4Z7OB 3VAEA 4R7XA 3GKWH 1QI5A 4OFYD 2WK2A 4BZ1H 1NC2B 4GG6A 4HIJA 5AVQB 2OW7A 5DO8A 3WL9B 5IBLC 3NJMA 3KPLA 3LRKA 3ZDYE 1NTDA 1S7TB 3MBEA 3NIFB 1HH9A 3MCKA 4FNQA 3SO3C 4KDVA 3X13A 3HN3A 2AAVA 1NBCA 4G7YH 1QBBA 4U0QB 2MSPA 4OFDA 5HHXH 4U1NB 3QCVL 4JM2D 1N7MH 3D52A 1KLFB 2GIXA 5E9DE 5C0IB 1FVEB 1HSBB 2AVGA 2H1XA 4LASL 2BJML 5F21B 1FZOB 1INQA 3LRMA 4IOIB 4P4KA 2JLLA 4MMYA 4BINA 2F5BL 2R2EB 3EHBD 1Q9KB 2QKIB 1LWJA 4JREC 2H0FA 1T0MB 1UYWH 2KLSA 2A6JB 4FQPA 1T89A 1DVZA 2EIJB 4HJJH 2C3WA 4L48A 4Y16A 5D4QA 4ZW5A 1Q94A 1S7UA 3F6JA 1NCWL 4U33A 4X6BA 3BUBA 5KVFH 4JNXA 4KTYA 1KENL 4FLQA 4JHUA 1WC7A 1Q1JH 5I26A 2G60H 2OSYA 1SFHA 3L3JB 4WLCA 1U8HA 5DC9B 4GSRA 1CGTA 1J5CA 3MRFB 3QDJA 1M3IA 1A14L 3DUHA 4H25B 4I1PA 5F1KC 4YSAA 5EIIB 4UUJA 1BG9A 2YPLB 4YEFA 1JZDC 1TVBA 3KGTA 2FHFA 3QXTA 5KSBE 3L95B 4LLYA 3QR0A 2XVKA 5D6DC 5KYUB 5IBTL 1VFBA 3EOYG 1BVZA 4U49A 5CWSA 3TLRA 5IW6A 1LM8V 2HN7B 3QI9C 1G7LB 3MRCA 3PDDA 1F6LL 1ZPUA 1FFNA 2VL5B 2R0KH 7FABL 1K5NA 3TH2T 3M1BA 3MV8D 1YCSA 4NQEE 4YAQB 2QGBA 2RGSA 5CCHE 1YMMA 1QSED 3K7UA 4N2DA 3CN2A 4GIPD 3UTZA 2ZSWA 3HMWL 1S7TA 4PWGA 3VDAA 3FU5A 1G5GA 4OGQC 2PWFA 1IZJA 4APXB 2FVNA 3ARVA 4P2YA 3O8XA 1BZQK 2R15A 4PJ9B 3D3VB 3HC3H 3VVVA 1MHEA 1LK2B 1Y6KR 4GAAA 5E9DA 1P53A 1SF5A 3VH8B 1RUPL 1NFDE 1ZJBA 3WY2A 5ABDE 3QARA 2KT6A 3FUFA 3FYIB 3HUJE 1S7SA 4L8CA 2HFGL 4ZSOA 2AXJA 3G5WA 5E6ID 2EO9A 1RZIA 1AGDB 4G8IB 4P0DA 1RURH 2V9RA 3IDJB 5J12B 2DQMA 2HZHA 4JFXB 1S2EA 3A4FA 1DLHB 3VG0L 2OZ4L 1JVOA 5E99L 3A6BH 4WUUD 1LNUB 1OAXL 3R06B 3A3YB 4AUUA 3M6DA 4OJDH 5AAPA 5FYKD 2FNBA 2IMNA 1KTKE 4LIQL 2FGWH 4LCWA 4MJ4A 4N5UA 3SIKA 5M95B 1LD9A 3M7FB 4XE0A 4LU5L 5FFGA 3HJ0A 3QIUD 1XSJA 5AW1B 2FBRA 2JELL 1OP3K 4DP4X 3O2WH 3QQXA 1QSZA 5DJYA 2OMTA 2YGOA 5HSFA 5DI8B 2V2TB 1ZLEA 2F19L 3LMJH 2DKUA 1L9OA 2WINA 4QCIA 4PRNA 4F7CB 4X7FC 1ZA3A 4Y88A 1AZNA 3O45A 5HHVH 2F61A 3MBED 4JG5A 4F15B 3S3PA 1JTOA 4P3WA 3CC5B 5I6MA 1WZLA 1XMWA 2ZD0A 3NRPA 5HD8D 1BPLB 4KKQA 2XACC 1MI5A 4X7SL 4JO1H 1ZGLB 3CDCA 1Y7VA 4ZOCA 1MFAL 3HB3C 4W9EC 1EUUA 3TONA 4AY0A 3ARGB 1G1CA 3LEVL 2R1XB 2J8OA 1UC6A 3GHBH 3LZLA 4KRLB 5TGBA 3Q05A 1KCSH 4J6IA 4YR6A 1V7NH 5F7EL 4HCRL 3V5DA 4ZAKC 1XF4B 5ICYB 4P46A 5T1KA 1ZLWK 2WD0A 3ZE0F 4I8DA 3LKNB 4HFUH 5ERWB 2QVKA 4NQVB 5CSZB 3G9AB 4BBWA 4QHNB 1CGSH 1EA9C 2ITCA 2O5YH 1S7WA 3CZLA 1MJUH 3IFNH 1MSPA 3QQ3A 4R4FL 1OAYL 5E2WL 4PLJD 4XWOC 3LNHA 4AQ8A 5SX4I 4JFDB 4JO4L 2BO0A 4IIZA 4RWYH 1NFKA 1SBSL 1A9BB 5KSAD 4LPYA 1EAJA 1M53A 5EA0L 3L9EA 3DMMD 4ZW6A 2VAAA 3NZUA 4MDRA 5CU5A 5AW2B 5BO1L 1OAYH 3AM8C 5E2WH 3CDGA 3VW3H 2DQFB 2QQQA 1L3WA 3IE4A 3PGCA 4J4PD 4AV4A 2WXMA 2EYTA 1P4BL 4YZFF 3KPRB 1B9ZA 2YQ2A 1BDYA 1X5LA 3EJUA 4UTBA 1NGWB 2I9TA 3ISYA 2CDFA 5GRZA 1JGLL 3T77B 4H0GA 4JREB 4XODA 3VD4A 1A6WL 2BFVH 4UQ3A 3RL1B 1XSKA 2BP0A 4BSJA 1I1AC 3T0AA 1VCBC 4IU3A 2H6UA 5L6YL 1MIMH 2ZE0A 5EC1A 2PWHA 1IAIH 1YC8A 5LNEA 4JE4B 5HJDA 1QSFB 3F7VA 1I4FA 4ZNEA 2BNQE 2EDMA 4GO6B 2DQFA 3Q9PA 4XPHL 5ABAA 2GAZB 4A6YL 1KSRA 1I7ZA 1T0NA 1Z9LA 4HBQA 3ZR6A 4PJEB 1A5FH 4KQ0A 1HXMA 3N41F 5LQBH 5HGGS 1BVKB 4PJBE 5HHVL 4DPBX 1PLBA 1DE4B 5EORL 3OKMA 1RHFA 4WUUA 4OI8A 4PWHA 1A6UH 4WGWB 1WICA 4XMVA 2B2XL 1BW8A 3QHZH 2VZ1A 4QJ3B 4U6TA 3MNVB 4TSAL 3SZKC 3WNMA 5HVGB 5DD1L 2VLRE 4UT9H 3GBNL 4GXUM 4OUUB 3IDXL 4OD2B 4PH8A 4HDIA 3UTTD 5IK3B 5TDNB 2O5XH 3T0VA 3DYOA 3I9AA 3QEUB 4GUPA 2NDGA 1ILSA 3L3KB 5CXPA 5DRWA 2NNFA 4GEJA 2ZCZA 4JK0D 2BWDA 3UAJC 2WSDA 4IBTA 4IRSA 4W9IC 5CN1A 1R75A 4K8RC 4MXWH 4ZMTA 1UZ8B 4X5XA 2MH4A 4OCRH 5IF0A 1OAKH 4DGWC 3V8CA 4PJ5A 3SE4C 1MAKA 4XMKH 1OT4A 3QDMD 3RZCD 4LPCA 3TGXA 5HGDB 3ES6B 4PP1D 2XG4A 1NCNA 2D7MA 4R0LA 1QVOA 1TG8A 5JHLH 3QFJE 4Z95H 3CCHB 2FIKA 4OZFG 5HVWA 4J6RH 4P9HC 5EWIL 5DS8B 4ZW7A 3H8NA 3CBRA 4PJ5B 5HYJB 4M6AA 2FB4H 4JRLA 3RGVC 1RERA 2NNCA 5IF0B 4KFZC 4M43L 4M4PA 1QW8A 4Y4FB 1PIGA 2MIZA 3QRGL 4E5XA 3B6SB 3GMQB 5GGSY 5EBGA 3KS0J 4ODXB 5E6IA 5FA4A 1DLHA 3N55A 3HRZC 5DO2C 1PG7H 4WRLA 3VFTB 1BAGA 2R4SL 5C1MB 2J57A 3QNFA 1SEQL 1N4XH 1XO8A 1ZLDA 1U8LA 2AXGB 2VMFA 4QRPD 2V3DA 2FJFA 4OF3A 1AS7A 5AVRB 4HLZG 1DFBL 2ZP0T 1XCTA 3AS3A 5INDB 5F96L 4L5FE 3LKPA 4OCLC 2QVMA 1IB5A 5AALA 1PLGL 5DJ8A 1NCJA 4ZSOE 1RCYA 3U2SB 3K2KA 3SPHA 3VFTA 5CR8A 2WWKO 4RH4A 1ZIAA 4HUXB 5AUMB 1OF0A 4J6RL 5IM7A 4LVHB 4ODXA 4AM0Q 2E4TA 3LKRB 4AM0B 1RJYA 4NUQA 5I71C 4Z8FH 4Y2DD 2VN5A 2GJ6D 3BLKA 4XBGA 5ES4B 3TO4A 5EF3A 1NGQH 5FB8B 1NOFA 1G0XA 1GHFL 3F58H 3MLVL 1MCLA 2GAZA 4C4KO 2IANE 4N2AA 4YDIL 4OGYH 4FXLA 1FPTL 3GDCA 5CJQL 1KPUA 3WEMA 3B5TA 2XLLA 1E3XA 1XHHA 3RJQB 5EC1B 4I18B 5IB3B 5IVZA 3X11B 4JB9H 1CYXA 2HLEB 5E1AA 5KSBA 5MENA 3RHWF 4TNFA 2L3BA 5FYLH 4G6FB 1PDKB 5SX5K 3D30A 4OBSA 4GRLC 1DVFA 3OC5A 3EJZD 3DX3A 1SQMA 1RFDH 3IU4H 3ROOA 1OPGL 2XTJE 5FHBH 3P3SA 3ATFA 5B38G 3NESA 2QVFB 3O6FC 4NLAA 4XPGL 1QFPA 2X4SA 4L4VA 3O0LA 4GSXA 3DVIA 1N5AB 4GRWH 4PG9B 1ZHNB 2ADJA 4KRPB 1JPSL 1JPGB 1NGPH 3D34A 3DC0A 3MUZ1 3QDHA 4MAYB 3BW9A 5HHOE 4XN1A 4EDXB 5D1XE 4ZFOA 3SKMB 5DJCB 2I07A 2WSPA 4KWUA 4R7NA 4ETYA 4D8OA 2BW4A 1KC5H 5GSRA 4Z5RA 3TT3L 3NG5A 4HIEB 4GINA 5B3SB 5I1LB 1F1AA 2A74B 2NR6A 3KGSA 1R5WB 3GQFA 4NP4L 1I1AD 1U3HD 1MW3A 2NNRA 3MRJA 2ZTBA 4MSWB 4RFOH 1NLBL 5FDWB 5C9KA 1T03H 2WKOA 2YSSB 4W9LC 5EO9B 5F3FA 2CDGA 3OR6B 3C5SB 3MV9B 2VXTL 3APNA 2N1TE 2R1XA 4JQIH 4LOVA 1ZS2A 2DTMH 2BFVL 3KLAA 5H2BA 1OCOB 3IJHA 2FWLB 1MFVA 1OAUH 1IO4C 3F7VB 2BW5A 1I8AA 3L8QA 2VXQL 1JN6A 2F7QA 5FUOH 3LY6A 3DIFA 4PY8I 4LPUA 4TTDD 1OCZB 5T3ZL 3TJEH 1TJMA 3AROA 1NSNH 3P4NB 2Z31A 1CD9B 4ODBD 4I2XA 1YMMD 5DS2A 2UV3A 5GGRB 1ODUA 1SXZA 2ICEC 4X0KB 1CDIA 1W72A 3R4RA 4P2OA 2R7EB 4H4NA 4XP5H 4Z23A 1IGML 4NWTH 3D48R 5TK2A 3H9HB 3D39B 2DYPD 1J87A 3CZFB 3NQIA 1XB6A 1NCCL 2DJUA 3T1WA 2EDTA 4UM8A 3B2UD 4B9CA 3IMVA 4N9GB 5HGAA 4LCWD 3GUFA 2QPUA 3QUZA 1ORSB 3HE7A 3RX7A 5ACLA 1MFEL 4W9ZA 2XZZA 5JXEC 5C8JB 1PG7X 2EILB 3NZHH 4G42B 2X6CA 1JNHA 1ZE3C 3P02A 3JT2A 3SE6A 2PR9A 2P5EA 3AWGA 3IXAB 4AMKH 3MREA 4YHIA 2MHAA 4Y2DA 2R0WL 3RWGA 2ZX5A 2ZYHA 1U8JA 2CUIA 5CFHA 3UTOA 5FECB 1KCLA 3T8VA 2E6JA 3QXAB 4HOZA 1FL3B 3PCYA 1YNTB 4QXGH 3C5ZA 1CDUA 3IN0A 3CTTA 1DR9A 3OR7B 3CAFA 4FI6A 4GQQA 4EEEA 2VMCA 2XY1A 2EE3A 4JFVA 3DX2A 2NY2C 5LGJA 5DJ2B 3SGDI 4AJWA 1A3LH 3QUXB 4POZD 2HMIC 3PWLA 1P9MC 1F00I 1UG9A 2PNDA 2BOCA 4LOUD 5SWZE 4WTZG 2UUDH 1HCVA 1UM6H 2XTSA 4B9YA 3DX6A 3HJEA 2ZUUA 5EIIG 4FRWA 2TRYA 3GFUA 4NQQA 5AW4B 5D1ZI 3C8DA 3TT1L 5I82A 3VI3F 3U4BH 1G4MA 1QLFA 2DM4A 4GI6A 2H0EA 3KPOA 4H20L 4WV1C 4H25A 1E5UI 3GEFA 3MU3A 3BN3B 5DJ0A 4CN4A 1RUAL 1DJXA 3ZMNA 4RMBA 3K8KA 3KJ6L 4JR9L 3BSZA 3U4EB 2F7OA 4PJDB 4OZIA 1SZNA 4OZHB 4NIKB 3MI6A 3DTDA 4ZXBD 1RZKL 2HFEB 3KLKA 4MMXA 3QUKB 2YD5A 3OMIB 1ODAA 2Q7YB 3VH8G 4J23A 4O2CA 2VR8A 3CSGA 1OCWL 3BAKA 1IL1A 3MUJA 1A5FL 5BVJA 1ED3B 1DSFH 5C08A 3ZJAA 2AK4B 3V7AG 4JDEA 4FXGA 2IPUK 5HHMD 3B3IB 4LLWB 4NUJA 4P4KB 3WIIL 5MEND 3PL6D 3PJLA 2CBMA 4NC1C 3W0WA 1JGUL 3DSFH 3AG1B 4X98B 1JAEA 3FDWA 4A37A 4GIOA 3QBTB 3LPFA 3VFOA 1P5UC 3HOGA 3TV3H 4NENA 5F89B 3DXAD 5T5FA 1GTFA 4Z9KB 1MRFH 5BNXD 1AD0B 4JRWA 1YNKH 3G5ZB 3RQ3A 4U1MA 2V5MA 1RK1A 5EU3B 1RJCA 3KYKH 3WIHL 4BCZA 3R4DA 3L5JA 1LGVA 1F18A 3DARA 4JPKL 5C09B 4HGKC 3G5XA 5B21A 3CDZA 4XNXH 4OCRL 3VM5A 3TL5A 2BNRD 2EQDA 3CVHA 2EH8L 4GNKB 4PRBA 4AXWB 4TQEH 2Q2LA 5C0EB 5C0NC 2HRGA 2V5TA 1T5WB 3L4CA 3REVB 4G9FB 4B96A 2FBOJ 3MLYH 3L95A 4PJXE 3S2AA 3MV7B 3D7PA 2W0FA 3EHBB 1ADWA 2AEIT 4P4RB 4WCYL 1FNSH 1TMQA 4GBXA 1V3KA 1SGKA 2LR4A 4P9HH 2XV2A 4YSDA 5DVNA 4N0RA 3EJYD 4G43A 5I8CB 1MCWM 4JKMA 3VFGL 1G7HB 4OSUH 1UM6L 3HNVL 3BWSA 4DH2A 1BF5A 3SGKA 3C6EA 1KCWA 4ZT1A 2X6BA 4YZWA 4FLRA 4DIXA 5AENA 1ZXKA 2KC0A 3MLRH 2ZOUA 3BT2L 3C6SB 5CP7B 2LLNA 4MD5B 2HT4D 4R96B 4AYEC 4QYOB 1IC5L 3BQUB 4R8WH 4ONHA 5C08E 1LEKA 1WPCA 1QLFB 3FK3A 2VOTA 1TZIA 4PJGA 1VJSA 3IJEA 1T04A 1CQYA 3DX1A 4E9QA 3EO1B 3BKCL 3ENEA 2VR5A 2W9EH 2Y6TE 4J3OH 5GS1B 1YEFL 1T89C 2ZXAA 3RB5A 3T0XA 3MRIA 2J44A 3EYFA 1FVEA 1HSBA 1Q9LB 1JJUA 5E95B 4N2FA 2P26A 1HESA 1N59A 1B3IA 2I25N 3WFHB 4ODUB 4JO2L 1N2RA 4F7EB 4MJ5B 4DETA 3NP3A 3SCMA 5DSCB 1YYLL 2FZ3A 2WXQA 3A4AA 3FTZA 3PNWA 5DFAA 4EJ1C 5LGJB 1IAKA 3BH8A 2PYED 3ISRA 1RP9A 1X5ZA 1A7PL 1MVUB 3STZA 4X6DF 1TO5A 3VGAB 1B88A 1FZJB 4B41A 4JVWA 2XQYK 4XP6H 1XGQA 1ZHBB 3ILPA 1R3JB 1HI6A 1B2WL 1ZANL 3G6AA 2IDQA 3BXNB 3SDAC 1OL0A 3QPXL 5F7DA 1EHNA 1ID5I 3S35X 2FQDA 3PQYA 1KG0B 1SY6H 3TO2B 1XR8A 3SGJC 5GS0L 1AANA 4YHOL 1UUSA 4I0PD 3VXTB 1R5IB 1I8KB 4XBMA 5EV7A 4M6ML 5I6XC 2C9AA 3QDMB 3BD3A 4IMLA 2X09A 2H3XC 5C07A 4APQA 5D7LA 5L2KD 1E5YA 1D5MA 2OMUB 4LLVB 2OYPA 1R3JA 4KO5A 4G42A 1HNYA 5IG7A 2X0UA 3MTRA 2E7HA 5E8DL 3F01A 4X6FB 5GGVY 5SX4H 5C70A 4YGAB 4G8FA 2B59B 3VXPA 2EDQA 4PS4L 2LGNA 1TF4A 2X2JA 4Y4FD 1FA4A 3IMUA 4BH8B 3HZMA 1CE6B 1QACA 3DVNB 1NGXB 2VIRB 4P2CG 5CCKL 4K7PX 3CBJB 3RAJH 3NCEB 4R4NC 3CPLB 2YD9A 5I0XA 2DPKA 1F4YH 4F8PA 2E9BA 3AAZA 4QT5B 2NX5D 3T0ED 4QRPB 1A4AA 2MCAA 2E86A 3ARBB 4EZKA 3HG4A 3BZ4B 1DVFD 4HEPA 3O6FA 2JELH 1OK8A 4XP4H 3ZE1B 1CFNA 5I73B 1JZ6A 2VW7A 3CUPA 3IJHB 2BXYA 4DEPC 3GBEA 2ZOLA 5AWNL 3C6SA 4WNQA 1OY3B 4UILL 2NY5C 3H56A 4I48B 2OZ4A 1U58B 3ZHLA 1KIPB 2DBLH 2JTYA 2E59A 4QRRE 1PL3A 2K4WA 3L4TA 4M61B 5AOLA 4NPYA 1UEYA 1IAII 2WTPA 1T1ZA 2FJUB 3IEAA 1MHCA 4YNYA 1IBGL 1H19A 2FQEA 4K55A 1IFHH 4YSCA 3V4VB 4LVNC 2EDYA 4ZMVA 2B4CL 5E8PB 4F9LC 2GJ6B 4Z7AA 3P0YH 3DDFA 2BSSA 4BQ6A 1DCEA 1TQCC 2FL5B 4XCCL 2R2HB 4XCEB 2AITA 1TMCB 4I85A 4B9GA 1WZAA 3L3IB 2IAMC 4KO9A 4NKDB 3MV11 2X4RB 2ZCLL 2WWMD 1J5OL 4WZ9A 1QRNA 3D9AH 3DX7B 4UQ2B 3H2PA 5D2LF 4AKQA 1NDGA 4LCIH 4MMXC 4JG0L 1G7JA 1SF3A 2FYYA 4JKWA 4CBPA 2X5PA 1MEXH 1CGVA 2YPVA 4NZUH 3CGTA 1KGCD 2WNWA 3LB6D 5IB5A 5ETUA 3H9ZA 4KMTH 3I9GL 1JV5A 2BSEA 3NSDA 4X5WA 3NRQA 1CF8H 5H8DA 4GG6F 3G04B 3PWUA 2H41A 3QEHA 2MJWA 4QGYA 3QK0A 4RZKA 4YBLC 2BVUA 1BJMA 4F24A 2V0AA 5L4MA 3KXFD 1VB9A 5JIDA 4FULA 2KI6A 4AEHH 1SN2A 1CLCA 3L2MA 3MRMB 1H5BB 3WNKA 2CE6A 4J8RA 4BZ2A 3DOSA 1F4YL 2B3RA 3DOIA 1SEBA 4RETB 2NY1D 4Q9QL 5JPMB 4UTAH 1QG3A 1RZJH 5EU4A 1PS3A 4G7QB 3GBLA 3ARUA 3UGXA 2ZICA 4P8QA 3NIDF 2H0JA 2IFFH 4DWHA 4RMRA 2N01B 1JOIA 2AEQH 4F8LA 5MERA 3SPJA 2ESVD 5BXFB 4PRIB 3X12A 3FRPB 3T6ZA 3PG2A 1XQ4A 5KG9A 3C60D 2AXFA 4DK6A 1HYSC 2P3YA 4F37K 1JV2B 1ZSHA 1AZZC 2BY1A 5DRNA 4KI5D 1HILB 4HKBA 4LRIC 5DHVB 4CVZB 5AFAA 5LGKA 1Z5LB 1F58L 2XDHA 3LDBB 4AQ1B 2X4TA 4WEBH 3DRQB 3D25A 2G2NA 1A02N 4LL4A 3NAAL 4IKNA 1MWAH 4QHMB 5H37A 3ZT7A 4AH2B 1UA7A 2GQHA 2P7TB 4F7MA 3KYKL 1S9XB 3CXHJ 5I1JH 1CXFA 4KVCL 1ZHKA 3HG1B 3VXOB 3FSOA 1I3GL 2CD0A 3EAKA 1PNDA 4OJFL 4M6OL 5DJ6B 2BH0A 2QSCH 3GMPA 3TV3L 3MVSA 3BCDA 5AVXB 2ZXCA 3U4KA 2YN5A 4DZ8B 4IRJC 5JA9A 1AGBB 3F04A 3CZJA 3K91A 5IW3A 3OHXC 1N0XH 5FKPA 3S36X 1IEBB 2BNRA 2DMKA 5GQBA 25C8H 1MJJA 5C07D 4JRYE 3WIIH 2JSFA 2R1YB 3DBSA 1RZ8B 1OGTA 3BYTA 3F6IA 3HC4L 4U1LB 2F5AH 1KIUA 1ORQB 4ZMOA 3BAYA 3L3OC 2DMHA 3U0TB 5DFVD 3F05A 2A9ML 2IAMD 2WVVA 5FO7B 4FFYL 2WZPA 5HP5A 1P6FA 2J6EL 3DXAA 4IRZA 4HW6A 2CRMA 5JHMA 2ZXDA 1G7JB 3V0JA 2O6FA 1XMEB 2VR9A 4XX1G 4PJ7E 2JB6B 4HWZB 4I5BB 4NM4H 3ZTDC 3NIFF 4Q6IA 3AXIA 1NLBH 3D51A 1T03L 1E3ZA 2P8LA 1L9MA 3H6AA 4MXQC 4H44C 1B6UA 2BSDA 5DC2A 5E4EB 3O2DH 1UWYA 1LEGA 1LVEA 4X80L 5IVXF 4JFFB 2HKAA 2R2BB 3FTYA 3C2SA 3APDA 3SJVA 2K9UA 2IH9A 3QWQB 4L3EE 3MROB 4ABWA 4NZTH 5DJDB 2XPGA 3D85B 1H0DB 3GSXB 3LQZA 4M8RA 4OZ4B 1UD8A 3DPDA 1QWHA 2DD8H 1FLRL 3TCLB 4JPIB 2Q6WB 2EAEA 8CGTA 1WWWX 4XP6L 3H53A 4CDHA 1JDDA 1U4FA 1DE4A 2I7OA 4JRXE 3RVTD 3WOVA 2Y22A 4GKZA 1F8TH 1IGTB 3PHQB 4PVNA 5DK2A 4L8BB 4N90E 2HVKB 3MLTB 1ZLSL 3V0DA 1UD4A 4I48A 4JFQA 1I3RB 2WLNA 2RFXB 4QI3A 4OLUL 1UA3A 1EEUA 1AXTH 2OL3L 2IXQB 4XMWA 1HH6A 1KGJA 1GY2A 1LDSA 3R7RA 2BOBA 4YQXL 4Z0XB 4JPIA 2Q6WA 2QQKL 5JW4R 3S0PA 5GS0D 1ADQH 3ETBF 4TSCH 4ES8A 3ARBA 1NFDF 5KVMC 1Z5HA 3VI3A 4HIEA 3QIWA 4WUUE 1JYXA 1SXCA 1TEFA 5HHOD 3EFOA 5LGHH 1CGUA 4N2CA 5FKAB 4DGIH 2HAZA 5JW5A 4B95C 3X17A 1RLWA 1URIA 2P52A 2VT0A 2BDNL 3PQYD 4KZ0A 5I8KL 1M2VB 4N8VG 3PHAA 1JPGA 2EYTB 4BH8A 2HT2D 1G0DA 1PZBA 4Q6IB 1WSST 4JHVA 4RZCA 2JJTA 4CDGC 2VN3A 3JTTA 1NLDL 3O6KL 3X1EA 1A0QH 4JUTA 2EP6A 2FGZA 4NXKA 3RWEB 3NH7L 4ZBJA 4Y5XB 2WXPA 2XX1A 3P0YL 3PABB 3EOBB 4JBSA 2X70B 1JZHA 2VR7A 1OW0A 2X9ZA 4U1LA 2W60A 3QDMA 5C07B 3VXMA 1MUJB 1T6WA 3X1BA 5IROD 4DERA 4X9FA 3T9WA 4PRPD 3MUGA 3DGDA 5JORB 2GTWB 3IU3A 5IFJB 5ALCH 4JFHE 1BFOA 3HB3B 5C0CA 5HYFA 4B60A 4FOMA 1THAA 4K5MA 1K9TA 4JY4B 5ITBL 1WEJH 1X9LA 4PS7A 2FEDD 3SCMC 4BQ8A 5T5FH 1ZWIB 4B27A 3SDXA 2ARJQ 1KCRL 5FUZL 4TF4A 3STZB 4MYPA 4U1IA 4E2OA 5JHDB 5JXED 5IFHL 4U1HB 2ATPB 4L05A 2R8SH 1KDJA 3RTLA 3V0VA 2QKSA 3QXUA 4ZW8A 1F2QA 4QR7A 4HUXA 3VXRA 4TRPL 1JYWA 1FVCA 3JV0A 3KAAA 3UZVA 1WD8A 5DMIH 5F7KC 1W0WB 4K7PH 5I0ZA 3C2AH 2IMMA 5JOEA 2G5RA 3EO0A 5IMMA 1VCAA 4ABVA 3VXME 2ALAA 5E5MB 1HOCA 3NH7H 1LQBC 4NFDA 4NP4H 5FF6B 2A3TA 2CIIB 2WMPA 2R59A 2XNAA 3RL2B 5HGHB 2P5WB 3V6BR 3ZKXB 5C0JA 1QFWH 2BIQA 5F7FA 1II4E 3DV4B 3FUKA 4KUZL 3HW7A 1UURA 3ARBC 2DM2A 3EJYC 3CLEL 4L23A 2BSBA 1FFOA 4Y0GA 3TBWB 2NY2D 5IREA 5BRZE 5FGCE 2VDQH 5F0JB 4GJTB 3ARPA 3WNIA 4U4IA 2Z9TA 3MJ6A 5HXMA 3DNKA 5CILL 1TJIH 5DQDL 2H6OA 3AWEA 4ESKA 4NXSA 1NC4A 1SXBA 2I24N 2R29A 2XCMC 3CPUA 2WQXA 2Y7QB 3D69A 2CO2A 4JGJA 4TXVB 1IM9D 4YUEL 2KZKA 4QOKE 4IK7A 5DRZA 3S4SG 1KMGA 3ULUL 3HBPA 5D7SH 3W9DB 1EZLA 4PB0L 4P07A 4F15C 3O3EB 5F0PB 2XHNA 4JY6B 1DVUA 2O5ZL 3UTTE 5I1KH 2DQUH 2UYLB 3HS0A 5K5YA 4WSKA 2UY7B 1TEYA 2G4EA 5FGRA 1QUNA 4PLNC 1BEXA 5F7YC 4AXWA 1WA1X 2X0VA 3CN1A 1A6UL 1PMYA 3FCSB 3QQDB 3G5XB 4X6CB 5IQ9A 3WS6A 1G9EA 3O4OB 3ISWA 1KYUA 4PY8J 3US0A 2EVHA 4IJTA 4FX5A 4YHNA 3Q1SL 1PGRB 3D0VA 4W1TA 3RIFK 4AITA 4F2MA 4MXQD 3D3VA 4ANXA 1UQSB 3O8XB 5KSVA 4NENB 5F89A 1FL5A 2V7HB 3JTBA 2X1XR 5KBPA 5EEXA 4GRLB 1YUHB 5TE6L 2Q76B 3MNZB 3B2XA 4UQCA 5TFSL 2ED6A 3HR5B 4F2ME 1F58H 3FCSA 4HKXB 2Y4SA 1CIDA 1QUNB 1H3XA 4TQIA 3BVNB 2FD6H 3CVIH 5TDNA 4BM7A 1H3GA 4P9MH 4ZXBC 1KZQA 2DQCH 3PWPD 4Z7QE 4GSUA 2X40A 4KNQA 4G1MA 2E46A 1Q9OA 1E6OH 2B5IB 3BWAB 3C6LC 1KACB 1MCCA 1PLGH 1RSFA 4GP5B 3LXUX 1UWXK 4P23B 4NEHB 3VQ1C 1I1AA 4J2XA 4PREA 2D0FA 2VR6A 4M7KL 1S7QA 4CJ0A 4E9RA 4HS6B 1RZ7H 3VWJA 2K7QA 2PPCA 1HN1A 1UT2A 4EKXA 2ODIA 4PJBA 5JZ7D 1TZGL 2XFXA 3GNMH 4UU9A 2I27N 4L9LB 1Z3GH 2O61B 1HQ4B 4DGYL 2CBPA 5CP3H 1BJ8A 4KJYB 1E8YA 1PY9A 5GRJL 5KBMA 4WNQB 4OIIH 4LSRL 2LAAA 5IB4B 2WVSA 1Q94B 1S4IA 3MTXA 1NM9A 3FCUB 4FNPA 2EDFA 3QFJD 1ZA6A 3H4FA 4DKEH 4OJFH 1WHOA 4OU3A 4XPGH 2J71A 3VGEA 1JK8B 4BKTC 3BUYB 4RIRB 3DYMA 3HG1D 1RI8A 5BS0E 4J5VA 3PWNA 1IT9L 2V2WB 4RFNB 2NT1A 2BPBA 3FBKA 3L1OH 5KZCB 2AKRB 4FQJL 1MW1A 2NXZC 3VFRA 5LBVA 1EZVY 3WIHH 5K39A 1AR1B 1H3TA 3V55A 3EH4B 1FVCB 5BVPH 4YFLI 3JWNH 5JW3H 5IQNA 2ADYA 5D7SL 3TPUB 1RK0B 2VISB 4Q89A 3BKCH 5ADOH 1YEHH 3PWJB 4XMZA 4JGUA 4LSQH 4MJ2A 1J1OL 5DYOA 5AOMA 3SEPA 3K4ZA 3GC3A 3PGCB 4NPKA 4HAKA 4Y2OA 5LBSA 2HLFC 3KHOA 1RULH 2A6DA 2XV0A 3D2UB 2WYHA 3OKOB 3QG6B 3VXNA 1LILA 4RFOL 4GRLD 4YHML 1I1YA 1WTLA 5C9JB 5DMKA 3RG1C 4JZNB 2GABA 3SKOB 4Z3JA 4LLVA 3T2QA 1DJGA 1KOAA 3FO2B 1AIFA 1T1XA 3VXMD 4WTZA 2D4FA 4R5TA 2YAEA 3T4YA 4CC4A 1P69B 1AR1C 4KO7A 1JBJA 1E9OA 1U3NA 4XWGL 4QRUA 3HRZB 2HG5A 1GMIA 4FTVD 3BP7A 1DQLH 4M5YL 2VDKL 3ASOB 3IJYA 5DRXB 3TA3D 3SJVD 2YPVH 2VO8A 4K3EL 4R90H 4F1SA 3D1MC 4Z7VA 4OLXH 3HI1B 3UJTH 1HL9A 2C7UB 1VA9A 4TUOB 5CIPB 1B0RA 3WN5B 3B9KA 3GT6A 2GJPA 1WFNA 3MO1A 4A39A 1IM3B 5T3ZD 1FZJA 4LCVA 3MA9H 2GIMA 5GGSA 1A2YA 3RDJA 4GAGH 4LO9A 4XTRD 3QIBB 1J10A 4MCZA 4DESA 3DGCR 4XWGH 2ODHA 1N6QL 4JFEB 4X9HA 1OGPA 5A2KH 2OZ4H 5I9QC 2WV3A 2FSEA 4P2OB 4TNWK 3GSQA 1U95B 4HXBL 1CFVH 1NPNA 3Q01A 3VGHA 2VKWA 4PRNB 5G4NA 5E03A 4YBHA 2D31B 5EZIL 1H3WM 1GVIA 4YXHL 1HHKB 2HFGH 2XWTB 3GBML 3MRBB 1GXEA 1RUML 4PLKC 4WU7B 4N0YH 3SGKC 3HIZA 3Q6FA 1FVDB 2DN7A 4Y16D 4K5LA 4ZK8A 5TDOB 4A2HA 3LRGA 5DVPA 3IJ7A 1N8ZA 2ZUXA 5GJSL 3ZDXE 1UUNA 3IMWA 4N8CH 4JFQB 4YE4L 1BREA 1M71B 2R69L 4UDUB 4OQTL 3CK0L 2YAQA 4K9EL 4FQJH 1P84K 4K5PA 1JGVL 1G7HA 5I9QB 3A6CL 1JGDA 2NY7L 1A7NH 1F90H 2Z7WA 1V05A 2X44D 5E00A 1A6ZA 4LLQB 1T1WB 1AGFB 2W81C 2ZZUT 3RNKB 5KVDE 2WJ7A 4NM8L 2HFFB 2WYTA 5DZNA 5GSVB 5LAXA 4OJEH 3LYRA 2UXVA 5BW7C 4MRBA 2VLRA 4BFGA 1NUDA 3I50H 3LXBA 4UILH 4MAYD 4NHCL 3KW7A 1Z1WA 3DO3A 4RRPA 2CKBA 3IB4A 3MJ8B 4GRWB 3SGEI 2OS7A 2V33A 4PJAF 4Y1AB 2LLLA 1U2CA 2XETA 4WI4A 3OJMB 4TLKA 1YNTF 3MJWA 2GHWB 3ARRA 2WVVB 5AAWC 4ANVA 4XP5L 1YMME 5E7FA 2IIJA 4B6ZA 5ADPH 2FJHA 2NX5B 3TWCH 3G7TA 2DJMA 4B97A 1QNIA 4X4YB 3M1BB 5ESQB 4PR5A 2F54B 3DYPA 4KRPD 2QPSA 2QGEA 1ERNA 3W0WB 2NDFA 1U8PA 5GJTL 3TA3B 5MENB 2OW6A 3NFSL 1PAZA 2O30A 3OAUL 2YEVB 3FPXA 2QQNL 5KVDH 2WIIB 2DZEA 4GI8A 1ND0B 4XNBA 5KYUA 2H6PB 3CHRA 4MD0B 2H8PA 1JUFA 4FNRA 3JVGA 5CZRA 3QRBA 4LGSB 3FU7B 3IKKA 1OLLA 3VXOA 2BS9A 1WQVT 3QUKA 4WI6A 5HJ3A 3W2DL 3PHOA 3VFVB 2UZIL 2R0WH 4H5SA 4QHMA 4P2QD 2MQ0A 4GKOA 1J48A 4U31A 1NC4B 3E3QC 3F5WA 3HE7D 1N64L 2VZ3A 5CINH 2ICEB 4BFEA 1TNNA 3H3PH 1XGRA 2R0LH 3TO4C 2JFCA 1OIOA 4X6BB 1HJCA 4A1RA 1E4WH 5AB1A 1AXIB 1UJ3B 3OKNB 2X4OA 1A1NA 2WKOF 1XCQB 2EC8A 1A9EB 1AFVL 1E28A 2DYPA 5T1MA 4UT9L 5HGHA 3CG8A 1MJ7H 5INDA 1IUZA 4EPSA 4BUQA 5JW4Q 5D4HA 1T5XB 5JQ6L 1FFQA 2JJWA 1EUTA 5DC0A 5F44A 2WBJC 5GHWH 5KYYA 1G1OA 1Y0LA 3EADA 4PWKA 4JEGB 1OP4A 3DPBB 3GD1C 1KLFA 2QSCL 5B1CA 3L5WB 5ACZA 4RBPK 5EORH 4TQEL 4U1GC 2WZ6A 2NXYC 3VSQA 2NT0A 1SYVA 1MCPL 3OGCA 4JANA 1RZKC 2OI9B 4Y5VA 3RGVA 5J6HB 5LQBL 3B9KC 4H0IA 5EUOB 1C08A 3KPSB 4U1HA 1RPUA 4WHYG 2Z4TA 1YNKL 5E56A 4XPHH 4F57L 1CICC 4A2DA 3ILQC 4DQOH 4LRNH 5D70H 2CLZA 1N12A 2AI0H 5D6CA 3QJRB 4B9PA 3W2DH 5IVXB 5KYXA 1N10A 4URKA 2NY0B 1CT8B 3FTGA 4LLUA 4EIUA 1QWUA 3RWDB 3PGDB 4RGMB 2W65B 1VGEL 2EICA 3C5JA 3O9WD 1Y6NR 4LGRB 5IW1A 2OJEB 4ADIA 4PJCF 1YNLH 5J57B 1P7QA 4NDMA 1BMGA 1SYSB 4NKOB 4S2SA 1UT9A 3V4VH 4FFWC 2NY4D 2AEQL 5J13B 3EBHA 2X4PB 4RNRA 3HZKA 4YDMA 4U4BA 2F8IA 5ENWB 4YDJB 1LMKA 3KBEA 2YMXH 3KDMA 3AU0A 4HIHB 2NYYC 4AUYA 4JO3L 3IE9A 2NUTB 3Q8CA 3VWJD 3RVXD 1CR9L 3RTQD 5CS7A 3L4ZA 4AEHL 2YPVL 3CVDA 4FTVB 4TVPL 1J8HB 3VCLA 1KN4H 1QLEL 1W72B 3RX9A 4HUWA 3RWHA 3GJEA 4L9DA 3V7MA 2GIYA 2YUWA 3B7YA 3T2NH 4L4TE 4R26L 3MPCA 3M07A 1UA6H 2C34A 1L9TA 4XZUB 3X1FA 4Q9RH 4TSBL 2IJ0C 3TX4A 4KJQD 2DWSA 2J20A 2Y06H 1GOHA 3KLAB 2MNJB 5H2BB 2H2SC 1QYGL 1MHHA 1FAIH 2EEDA 1DBBH 5C08D 4P4KD 3ZIYA 1FG9C 5A7EA 1E0OB 3V9FA 2DLFH 3NN8A 4WWKB 3TEXA 1UA6L 1GMEA 3PFUA 2ZX6A 3EYOA 3KLDA 4JFEE 4MFHA 2VR3A 2NNXA 1B4JH 5FCUL 2VZVA 3MLWL 32C2A 2YD4A 3K74B 4E0RB 3FQYA 2FWOA 1OTTD 4UQBA 5GSRB 3QO1A 4NN6B 1ACCA 3FTUA 5K93A 3BDXA 1RH8A 1WCBB 3VG9B 1HHJB 1YDPB 3MX0A 4L1TA 3P73A 4YDKH 1R24B 3WNJA 2VSDA 3FQUB 3TPKA 1VERA 1CVRA 1T6VN 5J4MA 3L6FB 1UVQB 4ODSL 4ELDA 5B7EA 4ZX6A 2HJLA 2NZ9C 2WTOA 2QHRH 2NUTA 4BH7B 3QHTC 1BXAA 5B3JF 1NBVH 3UPRA 3OKDB 4P57B 3KPRE 1UCBH 3O2VL 4DEPB 3ZE1F 5C09E 1JNLH 3QULB 1A9BA 5IKCB 4H8UA 5T8IA 2ZYIA 1R24A 3IDGA 3CQPA 4ZMNA 3TTSA 1EEYA 3I6SA 4V1DE 1CE1L 3SYQA 5KBNC 3ARYA 1JTTA 5E70A 3VRIB 3UGEA 1Q1JL 1J8HD 2BNRB 4GSQA 4NWTL 1D5BA 2ZPKH 3QEGH 4XGZB 3A6CH 3SYCA 1RULL 2XICA 1KPVB 5FGBC 2ATKA 2H7WA 4OD3L 4OF5A 1MRCH 1FGNH 1FHGA 1JK9A 2IPKB 3PDOA 2NYYD 3RU8H 4DOHE 1Z0NA 4LP5A 4MDIB 5T3ZH 1T7WA 3F00A 3VXQB 4PJIF 4D7BA 5TF0A 1NFDB 4GS7C 4YIQA 1K6QH 3IFPB 4TULL 5DU7A 1MVUA 1MLCA 3AS2A 3NACH 1UOKA 4MB4A 2P4AB 1IAIL 4RSYA 1SNRA 2GCYB 4FFYA 1CICA 2KDGA 5DEFB 4W6XB 5M7QA 1XXDC 2BXZA 3AREC 4Q58C 5AUMA 4Y8DC 3WFHA 3US1A 3KL5A 4Y2DC 4NN5B 3GK8H 4PRDA 3MBXH 4U2YA 2CM5A 3RFRA 3NVQA 2WPGA 3B2PA 2OR9H 5IQLA 4R3SB 1GGUA 2FJFB 1DLFH 4OIAA 1MFEH 1RY7B 4J3BA 3QQ9D 4L1LA 4AVJA 2VN4A 3ZDZB 3LN5B 1A14H 3U6RB 1K8IA 2YA1A 2W80C 5DJYB 1DBAH 1AIZA 1A6AB 3FO9B 4R96A 35C8H 4LOFA 4M6NH 5TDPA 5L4FA 4W9FC 1NKOA 5CBEA 1OAQL 4GW5A 4PJAE 2IPTL 4N9OB 4BDVA 3KLQA 3ELAT 5AAMC 4JO4H 3K6OA 2V2XB 3WXVH 4H40A 1MWAB 5CNHA 4NOBA 5J1SC 2X6VA 4JZJC 2B39A 4PV9A 4UT7H 1E2WA 4F27A 2OAAA 3NCYP 4XMPL 1R33A 3UC0H 1KCUL 1R3KA 2YXFA 2QEJA 3CLEH 4J3OC 4LEOA 4MJIE 4OCXL 3TBYB 2E6QA 1DDHA 3FF8A 4M5ZL 2EE2A 3FO9A 4HFUL 5ECJE 4AUJA 1CBVH 3R18A 5TE6H 1QTSA 2DQEH 1XGTA 2VDOB 4M29A 3PGDA 1SDDB 3FU8A 1ZOXA 5KAQG 2K78A 2Z93A 3CFNA 3WJJC 3NSCA 3FQXA 5EZLA 5A3ID 4EN3A 3G6DH 5TPWL 1MJ8L 1O7DE 4NWUH 1EXUB 3BRGC 3JUYA 5C2UB 4N68A 1IKFL 4A7QA 1N3NA 2QT6A 4GB9A 1HWGB 4X5QA 4HCGA 4YSPA 5DTFA 4ZUTB 3IMSA 1EAPB 1V7ML 3OSKA 1KCBA 3KPNA 4ATTA 2O5ZH 2VM4A 4FQ1H 4NAMA 4XMPH 3UC0L 1EGJA 3BYYA 3U0PA 5DRWB 1P4IH 3VTMA 4OZGA 2N4IA 4XMLH 3EJZC 3LEXA 3PV6B 3B2VH 1OAQH 3FT4A 1JK9B 3ULSA 3KVDD 2HJFA 3HNTH 3HHSA 1KPVA 4YH6A 3ZZLA 2IGFH 4JN2A 1XF2B 4HUVA 4KQ4H 3WFBH 3D9AL 4NN7C 5E8EB 1MHCB 4YNYB 2ICEA 5GGTL 5JA8B 5D1QD 2AVFA 5D96C 5GZOC 5J5EA 3MUHL 4P06A 4X7DC 4RDQG 4ZYKA 1P5UB 1YA5A 1YEKL 5HY9A 4BZYA 5LKNA 1BFTA 1TOXA 1XEUA 2VDMB 3NEOA 1R3IH 1JF5A 4M1GL 5DJ0B 2CIKB 3RA7L 4M3KB 4IS6A 2X05A 4FYRA 3ATDA 1A7QH 2EXTA 1NINA 3CVIL 5HI5D 4Z3GA 3D18B 2AJUL 4Q4EA 4F7PB 2R9HD 4H8PA 3OJ2C 4LHQB 1PG7W 3MLPA 1YYCA 1JPTL 3O6FB 4PJDE 4G7VL 1JZFA 1EEQA 2FX7L 4IKJA 4L0PB 5DUBB 5E5UB 3NT0A 3OPUA 2E0PA 2K70A 4PGZA 2B1HH 4AV0A 3DJRA 2OK0H 2NY6B 4W6YB 1C12B 1FO0B 2D0HA 3CNKA 4YLBA 3BP6B 1WZ1H 3KM2A 2ZOWA 1HEJC 4I18C 4OLWH 5IBUB 3QUMH 3Q8FA 2WO2B 2WQ8A 2QVIA 3S48A 4ZFFA 4Z1PA 4HIJB 4NRXA 5D2NA 2B7DT 2YHGA 1YN7A 1G43A 4WWKA 4EQ3A 3V5HB 2XWJA 3WNLA 4NQEB 1A9VA 2CKBB 4GEIA 5CGBA 1I8MB 5ISZA 4D0DA 4OLXL 4NFBA 2KQNA 2YA0A 3UTPE 1KB5L 2C1PB 4XO9A 3HI5L 4XP9L 1MCHA 1DVYA 4F2FA 3OB0K 4PU2A 1CBJA 1CU4H 2G75A 4IDJH 1U3HA 2BY0A 3OKLA 4KAQH 2V6HA 1JHKH 2AMUA 1S7WB 1I8KA 4KK9D 3WHE0 3IS0X 3F7YA 1KXQE 3FB6A 3ZE0E 3DHUA 1CFQB 1IGCL 5GS1C 4GY4A 5AVZB 1I1RA 1U6AH 3QQ4A 3V0WL 4NRZA 2PPFA 4FHBD 4HPYL 4WHTA 3MUY1 3IWUA 2YWYA 3SKOA 4HV8B 1HTYA 1YAIA 4OTXH 5LBGA 8PAZA 1E30A 4PJ8A 4LFHD 1NAML 4K9EH 5AVYB 1CJYA 5ICXB 5FLVA 4PTUB 3GRBA 1A0QL 4KJWC 3F6LA 1EGJH 3BH8B 1FVDA 4UM8B 4XNYH 2NY5L 3NCJH 4ALAC 2VR4A 1KEML 4K2UL 4Z0BL 5C97A 1MVYA 4YQXH 6FABH 3QUYB 1BM3H 1I7RB 4JJHA 4OLVH 4LVHC 2R7EA 2VZTA 2RHEA 1FC2D 1EXHA 2RA1A 2PO6A 1HC1A 1KJ2H 3MLVH 1UH3A 4M4RB 1PD1A 2DQGH 3I9PA 3TN0C 3ZSTA 1JHTB 1XF1A 4HWEL 4AJVA 3EO1A 1Q8MA 1MOEA 1BJ1H 2KZBA 2JB5L 4PJGB 1S9VB 5IEKB 3QNYA 1GC1C 1X4ZA 3FB8B 3T04D 3BN9D 3T3PF 1XBDA 3FU9A 3LS5L 4PRAA 2APSA 1OCCB 4ORGA 4KGJA 3RPBA 2CBTA 1MNUL 3PHSA 1XF3A 4N6QA 2CHZA 4HGMA 5FDWA 4IGBD 2D2CC 5EG6C 3PXHA 4PRPA 4HS6A 3LQAH 5AVSB 3IJYB 4YWGL 2PWGA 3G6DL 2I32A 4GXVL 1CFQA 2CK2A 2NY6D 3M8OH 4YS4A 5L88H 4I0CC 3TFKD 2EXWD 2VLMD 4FI7A 2GK0B 5ELIA 3EO9L 1MN4A 3INUH 2CHXA 1RPKA 1Y18A 4HU2A 1RIVH 2CSPA 5CHNB 4L4VD 1FI8C 4NUGL 1XD0A 1WBZB 2H9GA 2Y6SC 5D1XA 1YYML 3QFDB 2HUHA 3BD5A 4PGBB 4PTTB 3VXUB 4N2OA 1XDTT 5FYKL 4NQEA 5GZOA 4LF3A 1PBYA 2F7PA 5DHDA 4CSPA 2AJYH 3E6FB 4C8XA 3TURA 3S88H 1NCBL 2IOIA 2BCKA 4OCWH 2HPOA 5AZ2L 1WF5A 3V4UL 3U2IA 3PWJA 4APXA 3VFMA 3ROLB 4U1SB 3SGDH 5I1AB 5HJBA 3WFDH 1FZKA 4QXWA 1VZHA 1ZTMA 3LZQA 1TNMA 4AC2A 4PJEE 5E1AB 1SOKA 4EKJA 2GG1A 5KSBB 3HG3A 3Q3GA 4JKKA 4RGOL 4OT1H 3FSZA 2OR9L 2FH8A 1NCOA 4Y5XC 3MOBH 3A47A 4YDVB 1UCTA 2LAGB 5LCVA 2L8AA 1IJ9A 1OTUD 1X7QB 4L8SA 4PAZA 3V7AE 3BPCB 3IFLL 2BVEA 2NNAB 4KQ3H 2X10A 4PR5B 2VB5A 4PIBA 1ASQA 4PBVC 2Y7QA 3D69B 1S7VA 3SY0B 5B8CB 8FABB 5JYMA 3RY4A 3RLSA 1MW0A 5DEJA 3M1CA 5BUAA 5ESAA 1K6QL 1WC7B 4LCCA 1CXKA 5A3IC 2VDQB 4XCYB 5E2JA 4P23A 3T6QC 3UTTB 4LHUG 1Q9OB 5DLLA 1T20A 3BFOA 3F83A 2X12A 3N1QC 4D9QE 4Y5YB 4D0CA 2HB0A 2XNAB 3HFMH 4ZMZA 2NY4C 2PR4H 2XPZA 4G3YH 1OTTC 3AQDA 2X9WA 2J6EA 4IRZL 3KYMB 1PEZA 2N56A 4ELKA 5GSVA 4MS8C 3I2CL 4U1NA 3TWYA 2WO3B 1FDLH 3HE6D 1IBGH 1QFWL 3IGAB 1I9JH 1DVSA 4YXKH 4M8UA 2CDEB 4I1NB 3D3VE 5D71L 3UEZA 4Z7UA 1ITBB 2UZYA 4FLOA 2ATPA 4CVWA 1X6LA 1JGDB 1NC2A 25C8L 3NPSC 4FXKC 4RLDA 4Q9QH 1CICD 1I85C 3KYOA 4F33A 4UQDA 5DJXA 4EOWH 3A67L 2Y2WA 4GAYA 5BV7C 3QUZC 5E6SB 4OQTA 4XNAA 2J72A 2VC2L 4IGBC 4PJDF 3FULA 4YPJA 2WBJB 3II1A 3FMGH 4KHXL 2JI1A 1NBYA 1XGTB 4N8VA 1QLEB 3HS0B 5BS0B 1GSKA 2YXMA 3RGBA 3FQTB 2DAVA 4UTCA 1KLUA 5E24E 2J73A 2VUOA 1HQRA 2A1WL 2FLMA 3JV5A 4LCYB 4WEBL 1J5OH 1G7IB 2FSEB 4BWWA 4BA8A 3EGXA 2OX5A 1XH2A 1UZ8A 2UXTA 4JLRB 3WO3B 4CC4C 5CBEB 1I8IA 2GJZA 2Y36L 1D6EA 1NC4D 4O9HH 3BP4B 2Z8SA 4RDQF 4PTUA 3FFOA 3T5WA 5JHDD 4TSBH 4NNYA 3HA0A 1GGYA 4IIQA 2VDLL 4FF9A 4LL9A 1A1OA 5E94B 5C0JB 1U6AL 1KBKA 3QUXD 5CEZL 4UQAA 3IGFA 4U05A 2F0CA 5BZWA 2DQDH 4XPFL 3VD1A 4HJJL 5IK3A 3NCWA 1RUQL 2PO6D 2YD3A 2F5BH 1GYVA 1MI5D 4PRDB 4ZPTB 1IE5A 1RZJL 1JZ7A 5D8JH 4P2QB 2VDLH 3VJ6B 5EU5A 3U2JA 4XP9H 1AHWB 1PSKH 5SWSA 3L7FA 5C0DB 2YRZA 2IG2H 4U3SB 5K9OA 3LDBC 4OFVA 3WS3B 2NQ3A 2WVTA 5I75B 2XRAH 4OI9A 2WLIB 4AYBA 4JO3H 1LO0L 4IMKC 5DMKB 1JFQL 4ZO9A 2RFXA 4NP9A 4YIQB 1HXMB 1H3VA 3VXNB 4YHYC 3KNBA 4L3AA 4NN5C 3MLTA 4HVBA 4U6XB 5C0CE 5I76A 5IZ7A 1XGYH 2MFNA 2HVBA 4JL2A 4KMTL 3C8KA 3CLWA 4Y19D 4ODTL 3O6ML 4P3DA 1X5XA 5GGQL 5T33L 1EIBA 5EBLB 2APXA 1L3NA 3BP6A 3L5IA 1N67A 3O2WL 2A9AA 3BOVA 2FX7H 1OP3H 3U7YL 1UADC 3D3VD 4XAWL 2YGQA 3TIDB 3T3ME 1EK3A 2YAOA 2XG5A 3RKPA 3DHPA 3A67H 1P84J 2FH6A 4ZXBB 3RWFA 5DWUL 3O41A 3O4LB 1G7PA 1BQHB 2PYFA 2JWYA 1VFAB 3ZN6A 5B4MC 2H3NA 3B9DA 3LOWA 4OAWA 4FC3E 3COOA 4ERSL 2QV4A 3CMOH 3P4MB 4U1KA 3NYKA 5IB4A 5A6IA 3TJPA 3BO8A 4JMNA 1R5VA 1JWSB 4HK3N 3DXAB 2NSXA 4PJ9C 1BX2A 4NUMA 3N1FC 4K23L 5IQ7L 1T7VA 3P9MA 2G4GA 2WKLA 3QI9D 4FZEL 3TIDA 4IBZA 3L7EB 2WLJA 3QO1B 4LQFH 2IH3A 5EF2A 1INDH 1JPSH 3QIWC 2BSED 3MACH 4FDWA 4LLDB 5CMAA 3MLYL 1X5GA 2D0GA 4R6UA 3ZRSA 1J5DA 4PMFA 3WGVB 7TAAA 3EGDB 3HHSB 4K5OA 5HI4D 5T3XD 1J8KA 5MP6L 1Z32X 4M6OH 2D9QB 1BPVA 3GMMB 1PYWA 3FT4B 4RQQB 2EINB 4TTGA 2GPZA 3L5XL 1R46A 2Z3FA 1ZANH 3M45A 3O6MH 3BC9A 3GSRB 5CEYB 1L9PA 4DEWA 4YDZA 6PCYA 2A73A 3RNQA 3RTQB 3CZSA 4HEMA 4HKXA 4XAKE 4B9ZA 4Q74A 3TO4B 4G7SB 1U30A 2Z64C 3IBOA 4Q56A 5CGTA 4GKZB 1OT2A 5AG9A 1USZA 1F8TL 1UWFA 4G9FE 1MI5E 3GDBA 4HKBB 2C9QA 2CJ3A 3WJMA 5GS3A 3VI4B 4OCWL 4XPAL 5KSUA 4ZPTA 3TIEA 4AQEB 2YD2A 4TL4A 3SJVE 4L3FA 5D5MB 3VD9A 2WNGA 1AMXA 4FTVA 3OAYK 4XMXA 4HOMA 4LVOC 4KX7A 4AW4A 3BGMA 4NIYE 4PJ6A 1VKXB 5ISZD 2VZOA 4GUOA 4OV5B 5EF0A 2D4DA 5KSAA 4X4XB 5ALBH 1KCSL 1OGAA 4PJ8C 2ZPKL 2P24B 4GUCA 4O58H 3V0HA 5K9QG 5CCGE 5D2LE 4LCWB 3ESOA 5KN5A 4Y4FA 3QT2A 1T0PB 1MWAA 2OMZA 3FFCE 3L3HB 4X4ZA 4Q2ZB 3TEUA 4C59B 2FO4B 3D12B 5GGUA 3TM6A 4XVUC 4J3OD 2GB2A 2WXHA 4IRSC 3UABA 4B3VA 4N85A 4KKCD 2BVPB 5C0FA 3GSUB 4WK0B 2F58H 3FN0H 3DUSB 5I6OA 3HAEA 2WCPA 4KDTC 4N2LA 5C6PB 3LIZH 3IGLA 3MFFB 5L8JB 5H4YA 3NMEA 1NAKL 3LN5A 3TYGL 5FF6A 4NM8H 2MKWA 3PXJA 3H85A 1BXXA 5HGDA 4ZSOB 2L4OA 3FUJA 4JFSA 5FYJL 3CC1A 5JHLA 5KS9F 1CIUA 2J1YA 3ARFD 3H2WA 3MRNA 4UINL 4AH2A 2YA2A 4XOBA 2VC2H 3AQXA 3KHQA 2DW5A 3QH3A 3QE5A 3ZE2E 4ECNA 4Q0XL 4LMQE 4RGMC 4X6DE 4ZMYA 4JW3A 4OD1H 1JCVA 5BOZG 1CG9A 4HS8L 4BFNA 5MP6H 1MLCB 4Y1TA 5CJXC 4POYA 3S36H 3ZDXF 4KKAD 5HHPA 5IVNA 1L9NA 5D71H 3WJLC 2XJLA 5IHBA 3B5GA 2DQDL 3KYMA 4PBDA 4XPFH 4IYKA 3PP3H 5GIRB 2XV3A 1H3PL 3NIDB 3AG4B 3MNWA 5D7JA 1MCFA 2H32B 2X4NB 3GMMA 1BD2B 1N18A 3MXWL 5T3XH 3V0IA 2WQVA 2EIDA 1MFCL 5T5NG 2LQRA 3GUTA 1A9EA 2A4CA 2VLRD 1IFHL 2JJSA 1PZ5A 4O9HL 1BGXH 2A9DA 5J3HD 5AYUH 2AQNA 2PTVA 4QHLB 2CO4A 1DQIA 3MRFA 3QDJB 4HC1L 4QRFA 4ZPVB 2Z92A 3KWXA 4LCCB 4M03A 1AS6A 3OKMB 1ZLUK 4CSZA 5EZJB 2JIXB 2YARA 3EFFA 3U9UB 3TH3T 1RKRA 4N86A 4EI5B 4OGAC 4F93B 2N7AA 1AKJB 3PAVA 2W0PA 1BX2B 4E41E 1CDHA 1NM4A 5MI0B 2X7LA 5FR3A 1E7VA 3BO8B 5E6YA 4ANKA 4UYPA 5CJ5A 2QTVA 1OTSC 2HRLA 3J27A 1UB6B 2DOCA 4IW4C 1I4FB 2GHZA 3QO0B 1T0MA 4WK2B 4XC3H 5T1LB 3DIDA 2Q2EB 2ZWSA 3AT0A 3P54A 3BZ4A 3MLUL 3O41B 1SQ2N 3DURB 4CRPA 5JO5B 3JZ7A 4LVEA 2A0LD 1W6LA 2WCSA 5JW5B 1WP6A 1F13A 1QR1A 3L4UA 5T3XE 4EOWL 2JKIS 2ZG2A 3HI5H 5ESQA 1JE6A 5DWPA 1NEPA 2ZWNA 4L4TB 5CCKH 2CUMA 5I1DA 2HRHA 3DHJA 5FXCH 5EZOH 2R56L 1WZKA 5J56B 4K3DH 4DAGL 2KQMA 2Q7AA 1ROCA 3IBEA 5I6KA 5HDBB 1AE6L 1NIEA 2N7SA 1D7BA 1BVNT 4HZLA 3JV6A 1DVFC 3EDDA 4IRZH 2YBRA 4X7TA 3N9GL 2ZCLH 4M1GH 3RA7H 4JN1L 3OKEA 4ES9A 3HMXL 2B5IC 2C9UA 2BSSB 1CXIA 3NJFA 4I87A 3TYFB 1ET8A 5TQ0L 3UYRH 4XZUA 2GJ6A 3JWNC 1FGVH 1MLBB 3IFOB 4LSPH 2BWQA 4ODVH 1KV3A 1G6RA 1Z5YD 3FB5B 2DLGA 1JZ3A 4RFNC 4UV4H 5SV3A 4G80B 1CPUA 5CSBA 1WLHA 4PJGF 3W3BA 3QUGA 3D39E 5I74C 5A6MA 1WYJA 3CX2A 4GKNA 4UM9A 3IKCA 3CH8A 1O75A 4WHYH 3R19A 3RZCA 4IIQB 2ZX8A 1G9MH 1ZLVH 1EAQA 5TQ2H 4HKZA 4M1DH 4J3XA 3ZE2F 3GHPA 4FL4C 5ANHA 1E4WL 4M8QA 4A7SA 4H8WL 1XB3A 3EH1A 3NJXA 2P8MB 4OLYH 3LVEA 1U3JA 1FUNA 3HE6A 1TEGA 5E8OA 3BGFC 4QT5A 1AQKH 4W9HC 3MRHB 2C3XA 5K9KB 1XFPA 3APCA 2VDNH 3WEXB 3FQRA 5F1IA 2Q10A 2OJEA 5DEGA 4NKIL 5I6PA 2EDJA 3U6XS 1BF8A 5CJQH 4BFBD 3EIFA 3N0PB 4HGWA 4HWUA 1SN0A 1IC5H 2IV8A 3RWDA 2IF7A 4ZS6C 4MA8H 1F4AA 1HZHH 4HKZB 1M9SA 2YQBA 3JV4A 1YMHA 3U46B 2XIDA 4PRID 3NCYS 4K15A 3VQ2C 3WU1A 1R6VA 3EG9A 3K72A 3GSWB 5JPNB 4NUGH 2H5UA 1B0RB 1DEEB 4KDWA 3BKJH 3IDUA 3QIUC 1IM9A 1D5MB 3L4YA 1P7QD 2FO4A 5GGUB 4Y1SA 3ZRCC 1SM3L 2EDXA 2NZ9D 4PY7B 3ZDYB 1IGJB 3QQ9C 3L1FA 4Y9CA 4AVHA 3T4YB 2YKLH 4YHYB 3R8BB 3UBXI 2G75B 2YAFA 1V3MA 4PYHA 3V0AC 3WN5C 1T7ZA 4ENZA 1HU8A 3EKCA 4LHJB 3F64A 4ZDHB 2ZX7A 1YC7A 4S1QL 1ZV9A 4G2AA 1AMYA 1SHXA 5JXEA 4C47A 2C9SA 3VFWB 1MRDH 2BCMA 3OX8B 1ZS8A 4NT6B 5D96B 3N40F 3LZFH 2B9BA 3KPRD 4RA3A 4AZ8B 2X4OB 3H3BC 3IRPX 1RK1B 5GZNA 2PF6A 1XGRB 2JKSA 3HI6H 3RKDC 3TIEB 4AQEA 3EJCA 4MTMA 4ZFFB 4F92B 4ADJA 5KSUB 4NBXB 1D2OA 5DSCA 1TFPA 3SCMB 3RY6A 1KTDB 3T65A 1VF5C 5D1ZA 4TM9A 4MNHB 4PS3A 2Q86B 3WFCH 4XBPA 2XWBB 4DP8X 4KJQC 3MRIB 2XZCL 1CTMA 4JM4L 3TZVB 2Z31C 2G2PA 5DLML 1AZUA 1QTPA 4CGUB 3OVUB 4ZQKB 1JUFB 4EE2A 3BZFB 3JWOC 4LLYB 1ED3A 2OR7A 1FJ1A 4LEXH 4OD3H 1U8NB 2YAPA 4I3SH 4R7LA 3V4LA 5AZ2H 1BYNA 2V37A 2IADB 3UROR 1WK0A 3KDPB 4Q14A 3K46A 4WAFA 5F6HI 4Z7NB 1DN0B 2CPCA 5E23A 5FW8A 1JWMA 3OD3A 5CN2A 4UU9B 4N2GA 3QQNA 3VXSB 1NAMB 1R3IL 3PWVA 2Z7UA 3GI8H 1ETJA 4ZUSB 3KPPB 1CI3M 2JNZA 4E9XA 2KS0A 1NAKH 1SXSA 4UAOC 3P9MB 4EZMA 4WWID 4DO5A 4Q8BA 3X14B 2OKMA 4MB3A 2OXHA 5ITBH 2OZNA 4GG6E 4PV8A 3CFUA 3GI9H 3KBHE 5J11B 3NIDE 4A2MA 4Z18A 4KZDH 3D07A 5A2BA 3APMA 1J1PH 3CZKA 1D5RA 3HBGA 5IJKC 4JRYD 1AKPA 3T3MF 1T5WA 5JIQA 1ZRUA 4M02A 2P9RA 3FUHA 1I8LA 5D1QA 2X1PA 4YDKL 3RVWD 2HVJB 2DQIL 2CO6A 4LSVL 5E8PA 5B8CC 2BNUB 1CXEA 2OXHB 1AGFA 4XMUA 2GKIA 2E8YA 1F1DA 3U4BL 3AB0B 4ZUTA 3SD5A 1UYWL 1ZGLP 3BJ91 2FEEI 1MWOA 1NGZA 4XVTL 1X6NA 4JJ5A 2FDBP 3S3JA 3FU3A 1L0YA 4IU2A 5DZOA 4GRWE 3WUZA 1ET7A 2P45B 5B1KA 4X8XA 3MC0A 2B9AA 3O4LD 2FO1A 2XX0A 3GS7A 3V9CA 2RH0A 3NFNA 5D7HA 2Q8AH 4ZUUB 4PJXB 4CVXA 4PVMA 4WDIB 5L4IA 3QXAA 4O2CB 3PUCA 2WLLB 3S36L 5I6XB 1CFTA 1QHPA 2GUOA 2LU5A 4JRXD 4X2UA 4MMXB 1IEAA 5D7JC 3GMOA 5LBSH 4NZJA 4PLKD 4YFDB 2CJSA 4JHBA 4IOFC 4OLYL 1I7RA 4WI0A 1R47A 3L4VA 3T6WA 3T65B 1MCBA 4N5ED 2WKGA 1S78D 1AY1L 2KYIA 4L37A 3ARQA 3AABA 2VMJA 3SDAA 1QKZH 1A2YB 2WYZA 3OLEA 4U1JB 4YDNA 2UZPA 2E9GA 4GP8B 4NT6A 3ZO9A 4P5TB 3SDDC 3UO1L 1K8IB 1AHMA 4Y4KA 3LVTA 3GXDA 4HIIA 4PWEA 5CUSH 3IJ9A 1QEWB 3KL3A 1QO3A 1JD7A 3RILA 4XTRC 5IROC 5EC2B 2OMWB 3P11L 3QAZB 1AP2B 4WHTB 5DZLA 43CAA 4BGLA 2W94A 1YY9C 5FHAL 4OR1A 1IAMA 1A3RH 3EYVA 4WI0B 2BSTA 5ABZA 4ZJ9A 3HRZA 3VXTA 3SN6N 1X7SA 1G7IA 3VE0A 3HVDA 4NUPA 3QG7L 5EIQA 1DBML 3QWNA 4X80H 5IIEA 2NSMA 5DEFA 3ZKXC 5D7IA 4EUPG 2XQYA 1A4KA 3QZWB 4JN1H 2NMSA 2ORBH 5E1IA 1ZY9A 2DTML 2C1PA 3OKEB 2WXLA 3VFPB 1CL7H 3LH8A 1AVAA 1DQMH 4AQ1C 4R2GB 4X7TB 3OLDA 4D0DB 5ISZB 2K3TA 5C92A 2ERJB 2Y7MA 4GBXD 3RUGA 2BSRB 3VMNA 4HHWA 1MNNA 4N4YB 3VA6A 1FBIL 1ID2A 4LLAA 3MRPB 5DYOB 1DSYA 4DAGH 2E7CA 3H54A 3QEQE 3ZDXB 2OTPA 5H35B 4AIZB 3ZUNC 1EXGA 2ENJA 2RIKA 1JXKA 1E4KA 1D9KD 1BQRA 3DUUB 1JPEA 2GITB 2I60H 4OM1L 2HG0A 3WKQA 2VERN 4PJIB 2PTTA 3MREB 1FP5A 1ZIBA 3IXAA 4WK4B 3EGSB 2F19H 3LMJL 3MRGB 2R1WB 4NS0A 5HVHC 5LDUA 2X38A 3G6JA 4PJGE 1F3DJ 1T04B 4XC3L 1DBMH 1EJOL 4HWNA 4MAYA 1R1CA 3RWEA 3OBAA 1CLVA 2HJKA 2IPUG 1X9RA 4G5ZH 1RIHH 3W9EB 3GEWB 3SBWC 5JNYA 2XN1A 1WBXA 4FI8A 1OPGH 2CUHA 4RGNC 4XI5D 5F9WC 2R0LL 4PV8B 1BFVL 3IGKA 4CADB 5I73C 1P7HL 3H9HA 2FRGP 4FQIL 5DA0B 3VYOA 3G5YB 4XR8C 4Z7WB 2WSKA 3FO1B 3B2VL 3HMXH 2O93L 4QXUL 1BECA 1X5MA 4Z3TA 3VMOA 2DQCL 3MDJA 3OZLA 1BAFL 1AHKA 1DN0A 3ECVA 5DS1A 5F1OB 1M7UA 2COVD 2GJ6E 4XB3A 4B7IA 4DVBA 8FABA 2VH5H 1E50A 3SB3A 1M7DA 3KPMB 1BD2A 4G71B 5I0DA 1CDGA 3QC6X 1R0AH 2NUPA 2R51A 4TS6A 5CZVH 4ZD3L 3RJOA 4FTDA 5TQ0H 4C54A 3CVHB 5TE7L 3AY4A 3U0PB 2ADGB 1QW9A 3Q3GB 4PV1C 2AZUA 3TJHC 1BV8A 2IQAA 1I8UA 2IWFA 2WLIA 1THCA 1XF5A 3FU0A 4R2GD 3PJSB 4FS0A 4PUBH 3QNXA 2VQ1B 3WS3A 3STLA 2X9YA 1Z9OA 2ED9A 5DQ9B 3WEAA 1RZFL 1U91A 2VDRH 5ID0B 1Q1PA 1YQVH 5KEZA 1JSYA 1SBBA 1RZGA 2CA4A 4Q9RL 2DIEA 2WANA 4ZO7A 5KVGE 4X6CA 3CMGA 3CE1A 2AABH 5EZLB 5K1NA 5EZPA 2VABA 1KCUH 4MLIA 3VQMA 1JNLL 3CQQA 2AJVL 3ET9F 1WAAA 1KTCA 3NFPA 3D50A 2WNXA 3CH1A 4PB0H 4UNUA 1KN4L 3DUSA 2RCSH 4YHPB 1OSPL 5EA0H 1N5AA 1EFQA 3MLSL 4G9DA 4NO2A 4P5KA 5EU6A 3UYOD 1SRDA 4KZEH 2X4SB 4L4VB 1RJZA 3UAEA 5H37G 3REWB 4AIXA 5AYQA 4PV9B 5HYJE 1AKJA 3BKYH 1T80A 2J2ZB 5JW4N 2V2XA 5I8EA 1B2YA 2JIXA 5IMKA 4IKIA 2X2UA 4A66A 2DQJL 3QHFH 3EBAA 1XCWA 4PRPB 5BZZA 4Z77A 3CK0H 5EIVA 4KTGA