5CFAA

Crystal structures of bbp from staphylococcus aureus with peptide ligand
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
326
structure length
326
Chain Sequence
NNVNDLITVTKQMITEGIKDDGVIQAHDGEHIIYTSDFKIDNAVKAGDTMTVKYDKHTIPSDITDDFTPVDITDPSGEVIAKGTFDLNTKTITYKFTDYVDRYENVNAKLELNSYIDKKEVPNETNLNLTFATADKETSKNVKVEYQKPIVKDESNIQSIFSHLDTTKHEVEQTIYVNPLKLNAKNTNVTIKSGGVADNGDYYTGDGSTIIDSNTEIKVYKVASGQQLPQSNKIYDYSQYEDVTNSVTINKNYGTNMANINFGDIDSAYIVKVVSKYTPGAEDDLAVQQGVRMTTTNKYNYSSYAGYTNTILSTTDSGGGDGTVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone sialoprotein-binding protein
publication title Crystal structures of Bbp from Staphylococcus aureus reveal the ligand binding mechanism with Fibrinogen alpha
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding/peptide
total genus 87
structure length 326
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5cfaA01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5cfaA02
4MBOA 2VR3A 2Z1PA 2YLHA 4LE8A 1R17A 1N67A 1R19A 2RALA 3IRZA 4LEEA 3AT0A 3ASWA 4Q6KA 5IHWA 4F1ZA 2Y7NA 2F68X 4LEBA 4B5ZA 4BBWA 4MBRA 4FJ6A 4B60A 5CFAA 3V10A 2Y7MA 3IRPX 4F20A 4F24A 4JDZB 4F27A 5CF3A 4JDZA 3IS1X 2Y7OA 4JE0A 2F6AA 4RMBA 3AU0A 2Y7LA 3IS0X
chains in the Genus database with same CATH superfamily
1RUQL 2QMKA 3BZEB 4QO1B 1G7LA 4EXKA 5LG6A 3LS4H 2FBOJ 3NK3A 2HG5A 1Z0NA 5FFOA 3BD5A 1RZKL 1H3TA 3UTPD 1KG0A 3FUJA 4ZX6A 3DXAA 1MY7A 4KRNA 4QOKD 5DTFB 4AEHH 2ZXEB 3WIFA 5DD6A 3FT4B 3MRFB 1T5WB 1RZ8A 2X7LA 1MRDH 2A7BA 3F5WA 3GSQA 3NZ8B 2E9GA 2HXAA 2UYLB 4WWID 5CBAB 3P3YA 2D31A 4O02A 4K8RL 1XF5A 3D0AA 4JJOA 4L3EA 3EBIA 5EIIB 5AYTA 2WK2A 3BIBX 3MV7E 2WAHA 4UQ3A 1KJMA 4CKVX 1EBAA 2PP7A 1N3NB 3U2SB 1ACZA 5FO2A 3D69A 5HDWA 4V2BA 3RTQD 1JG9A 3EYUH 3EJQA 3RX8A 2YMOA 2WTRA 1CD8A 1DDTA 5EU7C 5IEHA 5D7LD 5FGBC 4FFWD 3R8BB 5F89B 1L5GA 3F00A 3Q2WA 1D7BA 3CSPA 4JPQA 4ZAKD 4N0UA 2G75B 2ATAA 4KKNA 3PHQA 5E9NA 5AKVA 4LCWB 3GPEA 1XIWD 3ZTEA 1TEYA 3G5WA 3IJ8A 4XPBH 3SDAB 3UG5A 5JDSB 3MBED 2NY5C 1TLMA 4M7JH 4AMKH 1DCLA 4Q4IA 1DJSA 1P7QD 4HUWA 4NN6C 3C12A 4WDIA 2JV6A 4IBWA 1TMCB 1UM4L 4Z7IA 4HPOH 4W9FC 1BWWA 1CZ8L 2PXYD 4W81A 1ZLWH 3O6LH 2CDEB 1XBRA 1JV2A 4ABQA 3RTQC 1MPAL 2AQNA 2GPZA 4CBPA 5ALBL 1OALA 4Y4FB 6CGTA 1RV6X 5ISZE 1CLYH 1ZEAH 1EJFA 4N2LA 3U1PA 3QQXA 2FH6A 4MMXA 2BCKB 3O9WB 4FFWC 2E6PA 1Q9LA 2R2CA 4OZIB 4ZAKC 5C0AE 4O5LL 2C8NA 3F7LA 4JM0A 4TVPL 1RPKA 5G4MA 1P7KA 4NP9A 1XIWC 3TL5A 4ZODA 4Z18A 2X12A 3MBEC 4F2ME 4AXWA 3DPBB 4MWFA 2F9BT 1NCDL 3CFKA 3DLQR 5DO2D 4E5XG 3HRZB 1TZAA 4Q6IA 1QFWM 2FD6L 4PWEA 4DN3L 4FMFA 1KDIA 2XJLA 1TTRA 1I9IL 1OLLA 4X7TA 3VVWA 2Q7NA 5TDPB 2BSEA 5F0JB 4P57B 1Q9WB 2SODB 4WJG3 5B3SB 4ZFOL 5KBNC 4E68A 4CC4C 2VM9A 3ARFA 4JFOA 3IETB 3TWCL 2GEQA 1DANU 2XWRA 3MLRL 1LEGB 2VE6B 3JSSA 3F64A 1V8HA 3MOAL 4XAKD 2Z8WC 5GISH 1HE8A 2G9HB 3OZ9H 4PD4J 1CFNB 1A3LL 3HLAA 5TK4A 3U9UA 2ZWZA 2OR7A 2BINA 2BRRL 4HEMA 4BFRA 3GWJA 3MRLA 1JDCA 1KENL 4RETB 1SQMA 4IBQA 1F4XL 4HIEA 5DMKB 4I0PB 4UOJA 4AEIH 5DO2C 2DLGA 3W9DA 1WPCA 1LO0H 3C08H 1F6LL 4QRRE 4FMKA 5IVZA 2ADIA 2DD8H 2AQTA 4UAOB 3H3PL 1YUHA 1DQLL 1GW6A 3S7GA 1UZ6E 4GY4A 1HHKB 4N0RA 4QXGH 3GDBA 4DEPC 5JW4N 1VFMA 2WXRA 4WLCA 3H9SA 1MI5D 2WVUA 3BC9A 2DMCA 2JQAA 5GHWH 4NT6B 2NY1D 3FDWA 5JUEL 3A6BH 4FQXB 1H0DB 1EDQA 1RXLA 3GMNA 3L4TA 3QR2A 5IBUG 1T6VN 5KZCD 3DRTA 1A6PA 2HMID 4U7KA 1ZHNA 5BW7A 5D71L 3ZKXB 1PJ9A 5C3LD 4ZFQA 1M71B 1AXTL 3LMJL 1KTLA 2GCYB 5T3ZL 3IDYC 3M8OL 3UZEC 1NFDA 3C6LD 4PJAB 1Q94A 3QUML 2DIEA 4HS8L 2F8XC 1KJVA 4X50A 3S8GB 2H1LM 1V7NL 2I7OA 4L3AA 3RUGF 3MLZH 4O58L 1SXBA 5M94B 3VXRB 4JKWA 4ZOCA 3PHOB 4YSPA 2CCLA 3ZO9A 4ZW8A 2FHCA 5KVGL 5DI8A 4ODXA 4BKTC 2H1PL 3VE0A 2H32B 2VR7A 3VYNA 2ZCKH 2VDLH 1KBKA 2FUQA 4AUYA 2QQLH 2HMIC 2GTZA 4HS3B 4JG1H 3WEMA 4EOWH 3EH2A 3CVIH 4D0DB 1ZPUA 3MR9B 4OD2A 1I3VA 1F0LA 2E76C 4TSAH 4BUHA 4PGCB 1F58H 5EZIH 3V5HB 1GZPB 5B8CA 1WBZB 3FOMB 2IANA 3PABA 2EEBA 3FH7A 2WC7A 3C6LC 1M57B 5EZPA 4P4RB 1OWRM 1QFPA 2APXA 4QHUB 3ZR6A 4HKZB 2XG4B 5IIEA 2AFNA 5EEXA 3BPNC 3ZQXA 2VITB 3BUYA 1GOGA 3FBQA 3QAZC 1L7TL 3HNSH 4ONGH 3UC0L 3BKCH 2N7AA 5ICYB 4J3BA 4BH7A 3ZYOA 4TMPA 3K2IA 4N6QA 4CMMA 1IAIL 1IGJB 3MJ8B 1USQA 2PPCA 3U79A 3CQQA 2VDOB 1FWXA 3D0VB 4X5PA 3MACL 4ENED 1ITCA 3CVHL 4NQVA 3QDMB 3V4VA 1GTNA 1QQDB 3D4GA 1FG9C 2F74B 2P46B 2PYFA 3PWUA 4RRPM 3UTTB 1YNTB 4FFZL 4CMHB 4L9LB 3IF1B 1Z9SA 2LVCA 2Z31D 3D09A 2B8OT 2Z8SA 3K6FA 3MRPA 4MGXA 2R2HB 4TKWA 2VLJA 1AG0A 1KYAA 1J1OH 1MJUH 3CLEH 4DVRL 5J6HA 3AFLA 1KEGL 4YSEA 3R18A 4OUUA 4U6YA 5DEFB 4R5TA 1RUKL 4HJJH 4CW1A 5LXVA 5EU7E 3V0FA 2EKSB 4FQCL 4BGLA 3HPLA 2CKBH 4KZDL 3MYJA 4AEEA 3EO9H 4CGTA 3UTZB 3RWHA 2CA4A 3UTPE 2AK4A 3WN5C 2DDQL 2D7TH 4RSVA 5IMOB 3JWNG 4E41A 4ENEC 2IXQB 3LKOB 5DRNA 4JM2F 3QUYD 1I7UA 1M7DB 4HZLB 4HPYH 1XGRB 2NYKA 1JGLL 4APXA 2GQHA 1SJHB 1S9WA 4PRPA 2Z31C 3FCSA 2YAOA 2BNQB 4N0CD 3RWCB 3VWKA 5FOBB 3OQ3B 5IKCB 5IW1B 1U6AH 2FLRT 3N55A 1KV7A 1YG9A 1S2EA 5F96H 1GY2A 2FJHB 2WSPA 5D7LE 1OP4A 5CLZA 1JV5B 1FVDB 2NR6D 3RNQA 4MD5A 3MAWA 1R6VA 1HVXA 4UQ9A 2ZONA 3KPRB 4PJ9D 4KUZL 2XN9B 4OM1H 4Q52A 3TZVB 3UABA 2QGBA 3QULA 3CN0A 2DQ6A 2WP3T 3QDJD 2WWKT 4MJ6B 2IEPA 2OW7A 1X5HA 2E4TA 2Q6WA 1F8TL 3VH8G 3Q44A 1A3QA 5EO0A 3QR0A 1S5HA 4OLZH 4AYID 1N8ZB 1NIFA 4N0CC 4Q89A 3OF6A 5ANMB 3WELA 1TIUA 3FFCD 1G9HA 3RA7H 3FQ2A 2CM5A 4HH8A 4TVSa 4D3CH 5F9OH 2VW4A 2LQRA 3BZFA 3AZUA 1RZFL 1H8OA 1SEBA 3I9GL 1FO0A 5DHVB 4FX5A 3VD1A 1XGYL 2CMRH 2NW3B 2XCMC 3LD8B 4PJ9C 1WAAE 2C4FT 3KCWA 3KJ4C 5D96C 2GJ6B 3RVWD 3GRGA 3QUGA 3IDGB 1NGYB 1AQDA 1L4IA 4EDXA 1H3VA 3QBTB 1P5UA 2GSMB 2EIBA 4NDMA 3LEVL 1FV1A 1II4E 2DEXX 4FHKA 3DVGB 4TV3A 5F7DB 1BLNB 1UWYA 2X1XR 1KPUA 3PWPA 3DX8B 4J8RB 3VXMB 5JPNB 2DKSA 2VR4A 2V6HA 4FLQA 1EHLL 3GEFA 2AS5M 3MJWA 2CDFB 1KULA 3MA7B 4GXFA 3O3DA 4Y1AE 3WTSA 2ZCLL 3L3HA 3FL7A 5EBLB 3D9AL 3G5YB 4JFYA 1GCFA 3MLVL 5DJ0B 5KSBA 4OLUH 4BD4A 2J88L 7CGTA 1WBYA 2DWYA 4AM0Q 5BS0B 2DWXA 3RVWC 4FTVD 3VXSD 1X5JA 3DX7B 2EICA 2Z0BA 3FB5B 4YPGB 1DVQA 1CFSB 2D3NA 1HXYB 3VFPA 2LV4A 4H2AA 1BQHG 1D5MB 3I85A 4WJ5A 3E8UL 4WEEA 3VFSB 3LRGA 4WTZG 1IZKA 4PSRA 2BFVL 1UGKA 5IMKA 3VGEA 4YUEL 3BUTA 4OZIF 2OKMA 1IGML 3UROR 3NCYS 2FGZA 2ZAHA 2X4OB 3KWWA 3MRRB 4PQXA 5GZOD 2FR4A 2ZSWB 2DBLH 2HT4D 1CD1B 5AVZB 4JCMA 4N26A 3TBBA 5FHAL 3QJOA 1KXVA 3PG2A 3L3JA 2BNRE 4JE0A 1FHNA 2PO6C 3QWRD 1UYWL 4J3OH 4R2GD 4UTBH 2R51A 4YDKL 2Z4TA 3QE5A 3X2QB 1ZHBA 3VRLE 3O0RH 2UZYA 1JL8A 4PGZA 3VD4A 3GIZH 3FPYA 1GKEA 1Q0YL 3F8UB 4IGBB 4M9PA 3AG2B 3BXNB 3FONB 3GHPA 1J1XH 1E43A 4TTDD 2I9LB 4I5BB 3CE1A 4ZUVA 4G42B 3HJEA 5DHEA 5T1MA 1KIQA 1WTGT 3L9YA 1OAZL 1QEWA 5BRPA 3D25B 5DJAA 4ZTPL 3R06B 3RWDB 5GZOC 2HT4C 1OSZA 3SSGA 1YSOA 2ICEC 3VFGL 4IDLA 2XN9A 5JMOC 4YO0B 2HUEA 4IJTA 5C7XL 3W82A 4FQLH 4QHPA 1ES0A 1XR9B 4R2GC 4F7CB 3V4PH 3SKMA 1W72A 4K3DH 4QKTA 3IE4A 4JHWH 1ACYL 3MROA 1GXEA 3DGDA 3O4LD 2DZEA 4DO5A 7FABH 4Y1SA 2OMBA 4FFYA 1JRHI 3PS6A 4NRXA 1Q9OA 4TUUA 5C97A 2XBDA 1M9WA 1AZCA 2F53A 3CJJA 1LGVA 2OS7A 3QRGH 4WV1B 4TTDC 5JOFA 3ROLA 1YMMA 3SOTA 4DGWC 5J11C 5JO5B 1GS6X 1HU8A 3SE3A 3LZQA 5J56B 1AS7A 1CWVA 3SE8H 4ENZA 4M8RA 2GUYA 2XTLA 5HHXL 1UJTA 3H6AA 1WD8A 3D4YA 3TIDB 2PP9A 4PJAF 2B2XL 4E0RB 4QY8B 3U7YH 2W91A 1S46A 3ILEA 5DJ8B 5C07A 5DQJA 3I3DA 3O6KL 4IS6B 4QRBA 3ZTCC 1FNGA 4DZBA 4FQQA 1R5WB 1ZA6B 2QPFA 4JCWA 4FHBD 4M9OA 2P1YA 3EBGA 2HWZH 3VFOB 4L29A 1DANT 2KMWA 2N3JA 4QRPA 1W91A 1MVUA 1TZ8A 4FE9A 3VXNB 4A66A 4Q8BA 2RA1A 4H5SB 1BFOB 3G5VB 2Y07L 1A1MA 2UZIH 3E2HC 3LEXA 1JHTB 1BZQK 4L18A 3EOTH 3NFNA 4FNUA 4G6MH 1IUZA 2DLHA 4JGMA 3IJ9A 2APBA 4LSPH 4DNLA 5JIDA 4NYLB 3ZE2B 5EIIG 1I82A 4QRQA 1ROWA 4PJ5B 3B2PA 4JO5A 4YXHH 2G2RB 1X5AA 1KN2H 1MFBL 2VISA 1HEZA 1EFXB 1N4XH 1A6TB 5FX3A 1G7MB 2OJZH 4HHAB 1GS8A 3GK8H 3H55A 4NO3A 4Y9CA 3BUDA 3SPGA 3SE4A 3ILPA 1ZT1B 4L8SC 1TJGL 1E7VA 4RFEA 1YNTF 1UXSA 3AVEA 4FS0A 4AYFB 1KUMA 3E6HA 5I19L 5BUGA 1MCOH 3QDJE 1DDHA 5JHMA 1ZD6A 3CFMA 3QNFA 4IOFD 1NMCB 2JVUA 5GGRA 3KXFB 4JDZB 3TBWA 3NFSL 4R97B 4PYHA 3T77B 5IMMB 2PCFA 3IN2A 2QPUA 2V3FA 2AI0H 5BOPA 4HWZA 3FFCE 1AXIB 3Q9PA 2A77H 4JDEA 4KJPD 2YSSA 4XE0A 4CVWA 4HKXA 4NNXA 5ID1B 3BO8A 1A65A 3TN0A 1J88A 1J5DA 3I6KB 3ULVH 4PJXA 2EDXA 4PHXA 4ZDHB 2HRPL 4UYQA 3MCYA 4HCRH 2WQXA 4FAAB 5C0GA 3ULSA 3BPCB 3GEWB 3U9PH 3GMLA 35C8H 4W9CC 3RDTD 4XP1H 4J3OD 3SQBA 3WEAA 5DJDA 1QFUL 2R4RH 2AJ3B 2YOCA 5GRXG 1NBQA 3FJTA 4YDJB 4Z3IA 2ENSA 1PSKH 5INCB 4OGQC 4IOFC 4WI0B 4C4KO 5I6KA 5CEZL 1IJNA 3T0AA 2KS0A 5LBVA 2EIZA 1FC2D 5AUMA 2Y5QA 2GHZA 1GCYA 1LILA 4RCAA 2J6WA 3GSRB 3P3RA 1Y6MR 3QIWA 4ZPVA 2KLTA 4GS7C 4KJPC 3HC3L 1BLIA 1UB6B 5C08B 1KTKE 1KT2B 5E2VL 3BN9D 4FMVA 1AHKA 5E2TH 5AVRB 4EUPA 2FO1A 3KPLA 3ETBJ 2YA1A 3AWEA 2GIMA 3CMGA 3P9LB 3RDTC 3RPIB 1HZHL 4J3OC 3H7LA 3I3BA 4MMZC 1L9NA 1Z9NA 3CVCA 4AIEA 2AEWA 2NY0B 3P11L 2EE6A 1NCAH 1GGCH 1RIHL 4HMDA 3SYQA 3VXSE 1T0MB 2N1KA 3BAEH 2J6EL 2JJSC 4NM4L 4ZS7H 2BVYA 4JY5L 5DD5H 4UMGA 3BFOA 4R83A 3A6OA 3SPCA 2I9TA 3ZE0E 1JSYA 1NC2B 1WE5A 2C5DC 3EGDB 2Z3FA 2GSGA 2XN0A 4H4NA 2PYEA 5GSRB 1TQBC 2VLKB 1BVKB 3FSWA 3ILQD 2ENJA 2AV1B 2BSBA 2X4QB 1RLWA 4QHKI 3BN9C 1JPTL 5IHZB 1MEXH 5JYMA 2YWZA 4HALA 1UH3A 1EERB 2HKFL 1PZ2A 4JKPH 3KLHD 4GAFB 3LZNA 3VGAB 1JPGA 2I60L 1CE1L 3F58L 3NA9L 5F7WC 2ITDA 1IT9L 4NWUH 3TA3A 1RJYB 3CN4A 4EIBA 2OMUB 2RJMA 4AE0A 1YJDH 3IXTA 2XXMB 4KDTA 2FQGA 1EV2E 1AR1C 1KPRA 3US0A 2K1MA 4G2AA 1BM7A 1UA6L 1SHSA 3G9AB 1G6RH 2YQ2A 3MMEA 3PWNB 3ZSTA 2BERA 1CQYA 3ILQC 1GS7A 3DUUA 1E3XA 1TG8A 1KV3A 4HJTA 1HDMA 4MSWB 2GC4C 3W39B 4HWUA 2O5NA 4IRSD 43CAB 5DJCA 4L0YA 2JNZA 3KLHC 3FQRB 4UQAA 4KXCA 4BINA 5GGSY 5SX5K 1O75A 5JMRA 4Z7UE 5IFHL 3EF4A 1AZRA 5T1KA 2R29A 3VSVA 2ZG1A 3S36L 3MO1A 1WA0X 25C8L 1OEZW 2QQKL 3GSNL 3ULUL 3UGEA 1E6OL 1RI8A 4NQCD 1EQWA 4TLTA 3GBMH 4DW2H 3W11D 5I6XC 5JORA 1RK1B 1JNNH 3NJKA 5D5ME 1DL7L 1FZOA 1MW1A 2VXQH 2L7EA 1TZGH 4WI2A 1DE4B 1SNRA 3CZFA 4AQOA 4ZMAT 4JO2H 2WO3B 3DROA 4R9HA 3QZWA 1MAMH 4U1IA 2OK0L 4FI8A 4HHGA 3CHOA 2EDNA 5JW3H 3ZK0A 1N6QH 4IRSC 1CBVH 3GMRB 1KGCE 4Y2DD 3TCXA 2R2EB 2VIRB 3V4LA 1U93B 4E2OA 1F56A 1W15A 1N2RA 2DTSA 5F7EH 4LGSB 5JXED 2FO8A 4JPKL 4K7PL 5K93A 5HGBA 4GXVL 3WAKA 1D2PA 2NT1A 3STZA 4GQPH 1CICB 5HD8D 3GDCA 4X4YB 3ULVD 4FADA 2Y36L 1THCA 2QZQA 4HH9B 4XVSL 1MG2C 3SE9L 3ZDYB 4TL4A 1VEPA 3X1FA 4OLWL 3W11C 2NY6B 1U8IA 1TFPA 3I3EA 3MNWB 4HX1A 1FFQA 4JPSA 5KVFH 1VGKA 2J20A 1EJOH 3AAZA 5CCKH 3ZHDA 4OIFA 4FABL 3Q9QA 2NY4D 2CM6A 2ED8A 3INUL 1CGSH 4KKQA 4LEXH 2ITCA 4KJYA 4RISH 1U8QB 2EDLA 1DVFD 2XRAL 4BQBA 1UXMA 1GJWA 3G04A 4ES9A 2E0PA 1PLCA 3Q1EA 5AOIA 1KCRL 2G60H 4Y2DC 1K4CB 2Y2TA 1HINH 4J4PA 1YECL 4GSQA 3GBLA 4S1QH 2AJSL 2XBZA 3E9UA 1QBML 2DLFL 3ZIMA 4DTGL 4F8TA 2J1YA 1Q1JL 3DURA 4AT6A 1KNOA 5HD8C 4PJ6A 3ULVC 2ODIA 4BM7A 2YAEA 1TO4A 2CO2A 4KXZI 4U1NA 1R3HA 5IJVA 4TQEH 1QLEL 1WFMA 1OARL 4NUPA 5DD1L 5G55A 5DEGA 3H9HA 2UXVA 3CG8A 1FL3A 4RZCB 2JK5A 2A99A 2B16A 1J5OL 5E8PB 2H1XA 1MKFA 3UH8A 2NY4C 1W0WA 4RGMB 4GW4A 3TT3L 1BXVA 3WFHA 3IS1X 4FZEH 4P23D 4AJVA 3CH1A 2I5YL 2RGSA 4QAWA 1DVFC 4JO8A 4PJHE 4F9LA 4LSRH 1J7VR 1TJHL 5J12B 3WKMH 1REIA 2V2XA 2PR4L 1N5AA 1U4FA 5I1AB 1SXCA 2X89D 3HR6A 4BFNA 4EBQH 1F4WH 2IC2A 3DTXB 3UPCA 5T1LB 4BV1A 3S96B 2KUTA 1ZAGA 4F37K 1JFQH 1YYLL 1OAYH 2ROXA 3FYIB 4QMEA 4CC1A 5G2NA 1ETJA 4I3GA 4KX8A 1LLAA 5SWZB 1J8HB 2WW8A 1V3KA 4M8QA 5EPMB 3QA3A 4R0LC 2P26A 3DRQA 3ZKND 4HAGA 5D9SB 4KRPD 1BECA 1R3JA 1IFRA 1X5MA 3MNVB 4P23C 5F8QC 3ZE2F 3VWJD 2FATH 2XN2A 4EIGB 4DOHE 5EDSA 1AC6A 1GA2A 4BBWA 1XB3A 1NGWB 1OT2A 3DO7B 4P5TD 2H7WA 3WTWA 4HEME 2H8PA 4XZ4A 5DDHB 1X4XA 4A6YA 1JF1B 3S8WA 1LEKA 4F24A 4YDIL 2IOMA 2XZQH 4PJ7B 4BFEA 5HYSG 1J0KA 1HIMH 4PJ8D 4YS4A 3D18B 1K8DB 2IBGA 1HHIA 1B9KA 3QG7L 4JN2A 3ZKNC 3H9SE 4KRPC 1J0HA 4PFEA 3EDEA 1EHKB 3EIFA 5IVOA 5TQ2L 2IAMD 4M5YL 2OJEB 3S37L 1YJDC 3HG0A 4OIBA 4YHLL 4LEOB 5FDWB 3F7QA 4HUMB 5IVXA 1XAKA 4P5TC 2AGJL 3UTOA 3FXIC 1T7YA 1TCRA 4X80L 2ZOWA 2HG0A 3MU3A 2YMXH 4K71B 4HIXL 5T33L 1AHWA 3VNZA 1GGIH 2VC2B 2XU9A 2B3IA 3ZMNA 1FNLA 3DVIA 5I1LB 4KNQA 2W0FA 4ZFOB 4TQIA 1U91B 4F58H 4PJ8C 4IU3B 3B2DC 2ILLA 2FCBA 4RAUB 5CJXA 4LSSL 3TJPA 1E4XI 4Y5XA 3N50A 4Q9RL 1X5IA 3AMLA 4M4RB 3SBWC 2X53A 3MXWL 3FF8A 2IAMC 4IIZA 1SN2A 4N8VG 1S3KL 1L0YA 1D7DA 1YEHL 4QHMB 3SDCA 3IDXL 5HHOA 3FU7A 3BVNA 1S7UA 2X70A 2VDNH 1I1YA 3NIGB 4MLIA 3CDGB 3L5WA 4WFGD 4HIIA 4I3RH 3BZDA 4JZNB 2IANE 1JZ8A 3DX6A 3NT0A 4P06A 4JQVC 5A40E 1YY9D 4RBPH 4RWYL 3V4UL 1AGEA 3IJSA 5IHBA 3BAXA 2OA9A 3EZ8A 1WZ1H 5E8NA 5E94B 5ICUA 3LV3A 2CJUL 2TRHA 4G8GA 2CLVB 2RACA 4FG6D 5F3FA 1A14L 3GSXB 2GSIB 3TT1H 2Y1AA 2A9NH 4NERA 2R2BA 4KHTL 4XPHL 4OCYH 4JO3H 3VG9B 4NPJA 3WFBH 3B7UX 1BPLB 5ALCH 4XOEA 3WTVA 1H5BB 4Q9QH 3GBNH 1E30A 3PNWB 1PKQA 3OBAA 3CHXA 4N2AA 1NCHA 1XCQA 4FN0A 5FM8A 3GKZA 1MHCB 2P47B 3VG0L 2EO7A 1EX0A 1RZGA 3U82B 1AD9B 1VF5C 2D7OA 3IMRA 4U1LA 1YY9C 2A74A 2EH7H 4Z1PA 3CLFH 2FGWH 2Q0ZX 4GKLA 5CLXA 1T3FA 4O2FB 3BISA 1ZHKB 5EN2A 4DVBB 1I9JH 2JE8A 3GXPA 4FXKA 1ZLVK 1DVUA 2R69L 3CZNA 1HK6A 3AQYA 2RTTA 3RVVD 2ZSVB 1ZV9A 2IH3A 3AB0B 3Q6GL 2DYPA 4Z3HA 4HLEA 4I77H 1OSPH 3GF8A 2HVJB 4FG6C 4LGPB 4LLDB 1BFVH 5CMAB 2BMKA 4YXKH 4G6KL 5AALA 2R1YA 3B8YA 3GRWL 3N9GH 4F9PA 4KY2A 2ICWI 3K6OA 1BW8A 3ULVE 5T5FL 1IE4A 5FYKH 4E41E 3I6LE 1L9PA 5L2KD 3PGFH 3H56A 3AGVA 3FRPA 1LO4H 2ZUYA 3CFNA 4OKDA 2K78A 2P9RA 3ZHNA 1NOAA 5CEXA 3Q06A 2ODHA 3DETD 5INDB 2X4NB 3I9IA 5EZOL 1IGFH 4OCWL 3HE7B 1OM3L 2IPKB 4NKIH 4WO4B 2JH2A 2EXWD 4MHHI 2E5EA 2R0WH 2R56H 4WI3A 4HU8A 4PJEA 3U4EA 2X6VA 2GITA 3OKKA 1E5AA 3V5DB 5JXAH 3CVHB 3RVVC 1LE9B 2R7EA 5DK0A 4PV8A 5E9DB 1M05A 1QNIA 5EUKA 3BRGC 4JVUA 1VADA 4PG9B 2VRKA 2AABH 4JFWA 3AJ7A 2P8LB 5H8DA 1L6ZA 5TDOB 4KAQL 5TGBB 4TS6A 3QEQA 4Z78B 4RAHA 1EK3A 2UZXA 1I85A 5LUMA 4QRTA 2BY3A 3DETC 4MAUL 4RMUA 2BS8A 2H47C 2UWEA 1BJ8A 5EWIL 4H2CA 3K7UA 1XXFC 4X8CA 2O5ZH 3QZNA 1QZNA 5MENB 2EXWC 3JTBA 2DMGA 2DQEH 4KUCD 5DUMH 4ZUUB 4QT5B 1LQSR 3NMEA 3E8VA 2P4AB 3P3TA 5IM7B 1OSEA 1WA2X 1WF5A 4MA8L 5DD3L 3ETTA 1TVHB 3QZMA 2LE9A 3ZDYF 1RUAH 1I8KA 3MLUL 2Y69B 3GSUB 3TGXA 1C5BH 2OTWA 2JTYA 4RIRA 2HN7A 2AEIT 1MFEH 3M45A 1JK9B 1HILA 1A4JA 2CPCA 5AVXB 1SDAB 1HOCA 2F7IA 4WHTB 2X88A 5KJ4A 1IKNA 4TULL 2IFGA 5C09A 3PWPE 3CXDH 4Z8FL 5FO7B 3EYVA 4AQAA 1J9RA 3ARGB 4JR9L 4YZFF 2EYSB 1FFNA 1X4ZA 6FABH 3N3EA 1D9KD 1JERA 1B9ZA 1P1ZB 3ZGHA 5ABZA 3GJFK 1XV8A 5L2JA 3K6SA 2N4IA 3OKEB 4GQ9L 4CN6A 4OJFL 4Y19B 5KSBE 4R8WH 1UVQA 2Z35B 1MHPH 1BX2A 2EYTB 2RH0A 2G2PA 4LLUB 3S88L 5D7KE 3F7VB 3QUMA 2CO7A 4XP9H 2CHZA 4CNIB 3WXVH 5GS0L 5DWUL 5B4MD 4IIQA 3P30H 4MD0A 3A4DA 4W9HC 2AJXL 2ARWA 3KJ6L 1OF0A 4UIMB 4ELKA 4R3SB 2XZAL 5EB9A 1A6ZB 1FNSL 2CJTA 1DJWA 1G7HB 2DMHA 4GI6A 5C0BA 4L8CB 1WT5A 4OLYH 5DMYA 3TO4A 3REVA 1JXKA 3VQMA 5LWYL 5FFLA 1D9KC 4XBPA 1E9QA 3OAYK 3WI9A 4FA8A 2KDGA 3QP3A 1MWAA 3MJ9H 3NSDA 5JPMC 3AROA 2BY1A 5K9JH 3V7AG 1OAQL 4PN6A 4YSRA 3T65A 1CFQB 4FQ1L 2Q8BH 3WMPA 1QLFB 4V1DA 4OFVA 2Z6FA 4OIAA 4UOQA 1L0PA 5B4MC 4ZX4A 1M3IA 4H8WL 2WV3A 4YFLF 3HI5L 4P2QA 4WWNA 1WH0A 5AOLA 1YQ2A 3VRJA 1ZCRA 8FABA 2JKSA 5GS1B 1TQTA 3FU0A 5AAMC 3PDGA 1E4JA 3T6WA 1ZIAA 1MHEB 5AL8A 2XA8H 1ET8A 3HUJA 3CZEA 3QIBB 4G1EB 3VTAA 4PJCE 2MCPL 1AKPA 5FYKD 1E4KC 3IXAB 1SVCP 1BFSA 4RGOH 3F05A 4H25B 1A7PL 2H26A 4TSBL 1N0XL 4LASL 4FFZA 1LXMA 4PJ7F 2XX1A 4EEEA 3BP5B 3DIDA 5FIEA 4WFGE 2BXYA 4WI4A 1ZT7A 3L3GA 4MA3B 5FKAB 3GNML 1ED3A 3H4HA 3Q5OA 2CHNA 3MNZB 5AYQA 3SQRA 2JIXD 1UD3A 2AANA 1JWMB 4Y16A 1B2YA 4H20H 1QUNA 1EAQA 2UX7A 4J27A 5AVSB 1BYPA 1SBSL 1ZK5A 1XF2B 1AGDA 3P77A 4MJ5A 1MFAL 3SCMD 4Y7OC 1YMME 4Z7WA 2VL5A 4BHUI 1EEYA 1WAPA 2HX8A 4X6DA 1ZS8A 2ZWNA 2AQ1A 2WANA 4PS4H 3WY4A 4XOCA 4AG4H 1XH0A 3QUXA 5FCUH 3VH8A 4AH2B 4G1MB 1IAMA 5F1NB 3HMXA 2WYZA 1LO3L 3EYSH 4NBYB 2VUOA 1RQ5A 1QHOA 5IR1B 1IFHL 4RNRA 2RIKA 2ZXCA 2ZXDA 1LD9A 2DM7A 3FTWA 2DH3A 3BH8B 3GJFA 4YK4B 3U36B 4PJDE 4HLZH 4XMVA 1KN4L 2VRQA 4HQQH 5E00A 1DLFL 2DBJA 5B22A 2WWNA 3RG1C 3P2BA 4UQBA 3ZY7A 3MLWH 3ZGIA 4ZMWA 2DQHH 2XDHA 1UZ8A 3HCVA 3A67H 1JBJA 1TZHB 1K2DA 3CX2A 4GRLA 2Z92B 3QG6B 3PP3H 3AXLB 3SCMC 5IQLA 2ADGA 3NIGF 3UMNA 1IFGA 5DHYA 5FUZL 4IOSA 1U3HB 3F83A 1JF6A 4KTEL 5IK3A 1DUYB 3IFOB 1C16A 2ZAGA 4P9HH 2DTML 5CSZA 1UACL 4RQQA 1S7XA 4XB7A 2VDMB 1FAIL 4PRID 3NIFB 1IARB 2WBWB 3AREB 3L1OH 2DN7A 2L0DA 4L1TA 1ICTA 4WUUD 4NQEA 4MDRA 2BOLA 1JGVL 4Q2ZB 5L88L 5H94A 4S1SL 3EDJA 4NHUB 1IGCL 1KJ3H 3P02A 3RGVA 1WC7B 3QUZB 2Z1KA 3QJHA 4HGMA 4X4MA 2V9UA 2A73B 2DM4A 3LNHA 1DYZA 3L2LA 5F9WB 4W9EC 5FWRA 5JHAA 4J3VA 1NLBL 2ZKYA 2YPVH 5BZZA 3L8QA 1CCZA 1F5WA 2FB4H 1KXHA 4BK5A 3MLSH 2YOAA 1G9ML 4PRNA 4D9QD 3ZKQD 2V2TA 2MHAA 3O4OC 1HHHB 3NZHL 1RFDL 5TDNB 3RNKA 1QNZL 4YC2C 2QVMA 2P5EB 3US9A 2KC0A 4IRJA 4D8OA 2AXGB 3U0WL 3C87A 4JN1H 4DGVL 4BE6A 2K4WA 2UV3A 3IWVA 1S7QB 4L4VA 4DAGH 4UQIM 3UBGA 4FKEA 1TDQA 2ZUVA 4PB9L 3RAJH 1XVSA 3GMOA 4M6OL 2A9CA 4DP7X 1EXUB 2I24N 2IDCA 4GKOA 1QI3A 2J12B 3KLQA 3NJMA 4ZMTA 4QRUA 4GAGL 4B50A 3FOLA 4FQHA 3KS0H 4L1LA 4QOKB 4WKZA 3TONA 1OAJA 3KL3A 5H37A 4DQAA 2GK0A 4K07A 1MRFL 2DWDA 2UZPA 1U92B 2XZCL 3O6FD 4C56B 3EGXB 3MCG1 3MREB 2OXHA 3L9BA 1NBZB 1U95A 3ISRA 2D03H 2LTQB 2DJMA 1RIUH 4LQFH 5ENWA 1AZBA 1PBYA 3I9PA 3C09B 2EIDA 1UD4A 4JUTA 1RJCA 5D6DC 2HJLB 2HSIA 2P80A 2NXYD 3W2DH 4JRYA 1OAKH 1OPGH 1U8MB 5MI0C 5AENA 4XAWH 4NFDA 1P69B 3QFJA 1TQWA 1PY4A 3VI3A 4PGDA 4GG6A 4YR6B 2CO6B 3LIZH 3D2UD 4YX2L 2E9JA 4RMVA 1GPOH 5F7HA 4LAQH 1LP9E 2XY1A 1NUNB 3O6FC 4P46B 4WENB 4HETA 1IM3B 4X7FC 5J9PA 2BSDA 3KLAB 4GEJA 1HTYA 1NMBH 3DMMA 5E6RB 5E8EA 1BYNA 5CEYB 4ADGA 3FUKA 2PXYB 4YHIB 4HF5H 4Y0GA 3B9KB 5KSAB 1IO4C 2VW6A 3D87B 3FHQA 3N41B 2OMWB 5LCVL 2PYEE 3N1PC 5I30L 1UOLA 3LQZB 1TYRA 2QHRL 2ADYA 3KPQB 3G5ZB 4LKCB 3T6XA 2ZNWA 2NXYC 1WCBB 5K59F 3RWJA 5DZAA 3A4FA 4G83A 2A9MH 4FQJL 2RCSL 3KYNA 4JKKA 4YE4L 3RX9A 1VHPA 2B59A 3DX9A 1FL5A 2LHAA 1EZUA 4H13C 5FC9A 3WE1A 2F7RA 1BWMA 2E46A 2YA2A 2YAMA 5CLTA 5E1HB 1O7VA 5DJZA 3JV6A 4PEEA 1NIDA 1QWUA 4FXGA 5D93C 1R24A 5L4MA 3F65A 1MHHA 4DEPB 2OMVA 4AKPA 1Y18A 2GBUA 4GAJH 2QKIA 2QFPA 3D3VD 4FC3E 3P4MA 3IFPA 4MYWB 2NX5A 1C1EL 2F68X 3HZMA 4X4XB 4XBEL 4XGZA 3WKPA 2WY3B 2ZX8A 5FYKE 1F6AB 1I7TB 5HY9A 3BSZH 1KGWA 4R96A 4N0YL 4UV4L 3RP1A 4U31A 1DO5A 2ZXGA 4U05A 4FA6A 5FM5O 2D8KA 5KS9B 3B3IB 5BQDA 3AXIA 3IDYB 4JFQA 1C9SA 5LBGA 2K6YA 3OWRA 2F54A 5CIPH 2EIJB 2A6JA 2V2WA 1MLCB 4JFDA 1QSEB 3LKRA 1CL7H 4N2GA 4OLXL 2BW5A 5HGDA 5TDNA 3RU8H 3WUZA 5JQ6H 4QR7A 4QUOA 2BJMH 4X9IA 4YHOL 2ZJSH 3QISA 4FJYA 1EO7A 4YLBA 5L0QC 1MI5B 4PJIB 1J9TA 2CGRL 3WNKA 2IQ9L 5EEVA 2NY1B 4HWBL 4Y1TA 4U6HA 2BY0A 2HCZX 3HG1A 2NUTA 1CUOA 2KPNA 2GVYA 1YYMH 2AJYL 3PQYB 4P9HC 3JZYA 1WUNT 3UZVA 3AMKA 4NB7A 3DK2A 2GB2A 3TJHD 4ZUTB 3CPLA 4PSPA 1WCQA 3HNVH 3PU7A 4LRIA 5D1ZB 2MQ3A 1FYTA 1P5VB 2LAAA 2VGLM 1I8AA 3V8CA 3II2A 3WXWH 5JOPD 5KAQF 1T80A 2IV8A 3PFQA 1SY6H 5F7BA 2B4CL 3D30A 3PJNA 3TFKD 5I6MA 4YSQA 2NPLX 1B4LA 1OKEA 1Z1WA 2YO3A 4CSPA 1SXAA 3C5XA 3TTSA 4TNVK 3FMGH 1H15B 6TAAA 5JHDA 1WSST 3MOQA 1KLGB 1HNFA 1S9VA 4Y5VA 2VLRD 1BBDL 4LCCC 4Q7DA 1XCTB 1XR8B 4PV9B 1UKSA 2YUVA 3ZZ1A 4Z7AA 1QTYT 1BCIA 3WMSA 5BXFA 3FQNA 4ZNCD 4LEEA 3UIZA 3F85A 3TJHC 5HYQA 1X9UA 1AO7A 2FJFA 4YSDA 4Z77A 4GKSB 2LLGA 5AWNL 1KJ2L 3ARBD 2CUIA 4OZGB 2HUHA 1KLUA 4PRIE 4YWGH 2BIMA 5ADOH 2FDBP 4ZRGA 4WUUE 3U0PA 3FQWA 1QLRA 4KVNL 1ILUA 1F90H 3GHBL 3S9DB 3TFKC 5TTRA 1QBBA 2V37A 4XP4H 4FP8L 4QD2E 5CILL 4CVXB 4URKA 4G6JL 3DKHA 3VFWA 4NCDA 1AP2A 2O5YL 4OKVB 1WZKA 5F0LB 3T4AB 3TBYB 4CUCA 1GYUA 1SM3H 1YEJL 3IJEA 5KVDH 2XJKA 1MFCH 3BAKA 3UL4A 5C0DB 1FNEB 3D39B 1L6XA 3G3LA 3RILA 4JZJB 4WI8A 5AVQB 1MFNA 2ZTBA 3D08A 4Z3TA 1DBKL 2YN3A 3CSTA 4A2LA 1IGYB 4BZ1A 1FSKC 1OCWL 2FAUA 2P49B 3ARBC 4LRNL 1KCVH 4OLEA 4WKXA 5FUOH 1JUFA 1U30A 2ZCHL 2G5RA 1OGAE 4NPYA 5LGYA 5I0ZA 5D7SL 1IQDA 5E51A 5HP5A 2CRZA 2C9QA 2HFEA 2YWYA 4LLVB 3ZTJG 4LCYB 1A2YB 4B97A 4NQXA 3ZL4L 4HOMA 1INQB 4H26B 4NWTH 5ES4B 5EBWA 1BXAA 3QJFB 5E8DL 4WFEE 2FX7L 3RWFA 3LN5B 1UJ3A 2GBVA 2JCCA 4EJ1C 1EO8H 2AITA 3VU1A 4W4OC 4CU6A 3SGJC 4AW7A 1A5FL 2H9GB 1J87A 2VXUL 4HD9A 4XCCH 4GW5B 5DRWB 5GGRY 1CPUA 1ZOXA 3CXHK 4I1RA 4KZ0A 3OGCB 1E4XL 1RZIA 3NIFF 3R0NA 4OZFB 2X4UA 3QUYB 5I15L 2J6EA 1WFNA 3VXUA 5IQ9B 3TVMA 1MIMH 3NRQA 3HJ0A 4QCIA 4HJSA 4HUCA 2Z93A 1SPDA 1QLEB 4TTGA 3B2XA 4XC3L 4MNGB 4O02H 5HJ3B 5ERWA 4S11A 5JDJA 4ELMF 2ZKHH 1KIPB 3T0DA 1HEJC 2Y0SA 4AVJA 5I71C 3QRBA 2IJ0C 4BK8A 1WGVA 1NGPL 5HYJB 1MJ7H 2EAEA 3QWNA 3P9WB 4PAZA 3HVDA 4UCFA 4M7ZB 4PWIA 5DVOA 4ISVA 1RSYA 2VJ8A 3KPOB 3TPUA 3NEXA 5LVEA 5TQ0L 2APVA 2BOBB 4XNQB 3HE6D 3KH4A 2AXFA 5I8EB 3QVAA 1DFBH 1DBML 3KJ4B 3BZ5A 2QJDA 2J44A 3BKYH 4LPUA 3ABLB 2FJUB 3K3QA 2YGPA 1C5CL 2IGFL 3E6FB 4M3JA 3ATDA 3T3ME 2FVNA 1QFWH 2ATKB 3D85A 3T9WA 3UAAA 4ZPTB 3JV5A 2W59A 5IVXE 4HIHB 3RIKA 4POYA 3CAFA 5C0JA 1TVBA 4BRVA 5GXBB 4UNIA 5IZ7A 1M6OA 1DZBA 3HNTH 4LHJB 3WYRA 5AZEL 1R3IL 3APCA 1JMZA 1HXMA 1YNLL 1HQ4B 1ML0A 2W81C 5E2UL 5FA3B 3CC5A 1IGIL 3UCQA 3GSOA 4KTDH 5GPRA 2DLTA 3GHEL 4KKRA 3MRCB 5IVNA 4OFIA 3RZCD 2CUMA 5ILTH 4L0PB 1XGUB 3FPXA 2F58L 1KDJA 4BELD 1AE6L 1FFPA 4YEEA 4Y2LA 3GI9L 1QA9A 2V3EA 5F0PB 3GSNA 5C0RL 3I02B 3QQ3A 5FFGA 3SYOA 2DQIH 5HHOE 1A1NA 4N2FA 2RQ8A 4JGJA 3SY6A 1J9QA 5KAQG 5BJTA 4OI8A 3PAYA 3D3VE 5DZVA 4ZTOH 1UOVA 4YSTA 2VDLB 1XGZA 3VFUB 3N40P 5AKTA 2E7LA 4BCXA 3L3KA 3Q2NA 5FKPB 4AL8H 3PNRB 2IDTA 2YQ3A 3QEHA 5D4JA 3U1SL 1TO5A 4DKFH 1B4JH 1S7RA 1INEH 4TSCL 4G6AD 1DTUA 3RZCC 4O2CB 5F21B 1VFUA 4P2RA 4N25A 5JIQA 5MEOA 2AEQL 1K8IA 5KYWA 4G8GE 4O2EA 5I8OH 3AU1B 1N70A 5EU3B 1VDGA 4FTVB 3SQOH 4UOW0 5KG9B 3JWNC 4DSYA 2DYSB 4BZ2H 4CN1A 3ORJA 4IMKA 5BVJA 2YFOA 2XQBH 2YD0A 3DSFL 3N41F 1OP9A 2OL3L 4IKLA 4LDLB 4WU5B 1DQDH 5BZDB 5AW6B 3W9EB 5DJYB 2Y23A 4MS6A 1TU2B 3SKJH 4GG8A 2V33A 2ZE0A 4X6CE 3Q6FB 4B3EA 1QHQA 4G6AC 2VM4A 4M61A 2N0MA 3BIAX 5DUBB 2VZTA 3IN0A 5CR8A 4JFSA 5F3HB 3SN6N 1YZZA 3T0EE 3L5HA 1DN0B 1OK0A 4MAYD 3GKWL 3JYCA 5DFWH 5IW6A 1IL1B 4Y4KA 2F8VA 4BDVB 1D6VH 5GRUL 5D2LB 3ELQA 4ODUA 4JKLA 1QUPA 1T20A 2WCSA 2NW2B 4ZQTA 3CFTA 5EH1A 5EOTA 5D1QE 2CKBB 4ICXA 1BJ1J 3MJ7B 5T8IA 4YFEA 1NGXA 4G82A 3ZIYA 3NAAH 3MCKA 1AKJA 3FFDA 3UOAB 1AFVL 4EI5D 1TQCC 5D8JH 2VLRE 4HKJB 4X6BA 5I2IA 2J7LA 3T1FB 2MQ0A 3BVWA 1KCSH 4XPAH 3BT2L 4UINH 5KS9F 5CINH 3DXAD 5D1XD 5HYEA 1CF8H 4JREB 4N85A 4NQSB 4FNRA 3MRNB 1FC1A 4UT9H 3CVBA 4L3FA 3ARUA 2ZUQB 4MAYC 4PY7B 2ZUTA 1CURA 4UZSA 1ZE3C 3W56A 4Y4HB 1AIFB 1GZHA 4IOIB 3AG1B 2FH8A 2XV6B 5IV2B 2HLAB 2WVVA 3FUDA 5HYSA 1ITBB 1W0YT 2XPGA 4LB8A 3PL6B 4PJIF 4OZHE 2X09A 3SGEH 1BVOA 2GYSA 3WFDH 2OSXA 3QEQE 4FD0A 2P8PA 5AYUH 1KXQA 4F57L 4LF3A 4ODBD 3QH3B 2M1KA 3UCRA 4H1LA 5DUPH 4EI5C 4TNVF 2NY5L 3HMWH 4WW2C 2UWEE 4XMUA 2HA1A 3MXVL 4AYDC 5D1XC 3CFEB 3SDDA 2YD8A 4EXPX 5HPOA 2OX5A 4ANWA 3LHPH 5CSGA 4ONFL 5AZUA 5LDSA 1KGYE 5I0YA 5I75C 3WIIL 1IC4H 2XFXB 4GKNB 4P59H 2C9RA 4QTIL 4KQ3L 4MMYA 3WFCL 1CXHA 4Z0BL 1LO5A 2ISDA 4XMWA 3WE6A 3EFDH 1OT4A 4XR8C 2YLKA 2VOTA 4YSCA 3SBPA 1ZHLA 4LMQI 4DP2X 5BV7L 2J5LC 2DQCL 1NDGA 5DVKA 2FSDA 2KZKA 2VMFA 1LWHA 4KTGA 1A7RL 2KLSA 1MZYA 3LS5H 3JV4A 3IEAA 2Q7YA 1HKLH 4N8VA 4OU3A 1GHFL 3I2CL 1NMAH 4OZGF 5GS2H 2PWDA 2A9DA 3O3UN 2HH0H 4WK0B 3B1UA 2BVQA 2WXGA 3FC8A 1SBBA 3FQ1A 3Q8AA 3QI9A 4HUUA 4J7RA 1PLGL 2OMZA 4X8JB 5F1IB 2XZZA 5JW5A 1KWGA 4AW4A 3IFNH 5C0FB 4H8VA 1X7QA 4DCQA 3U4BH 4JM2D 1DQQB 2BSED 1MF2L 2N1TE 3L3OC 5BO1L 1NUDA 1T1ZB 2X9XA 3UG4A 4HIQA 4UDTB 3LPWA 3AWGA 4XO5A 2YIHA 3IGAA 4U33A 1QSFA 2NMSA 2CRYA 3D33A 4V33A 1V54B 3HFMH 4YGAB 1Y6NR 1PZCA 2AJVL 4PB0L 3O8XA 3MJ6A 2FJSA 2XQYK 5C0BE 3OHXC 3QSKB 1YPZB 2HTKD 1VKXA 4JDVB 3LNGA 5KSVB 1WYJA 4GBXB 2D7NA 3NJVA 1A1OA 4KZEL 4XP5L 1ZTXH 1V3LA 2NLJB 3C5ZA 2YXMA 4XNUL 1HCYA 2C9UA 3GRBA 4YAQA 5HHPA 3SDXA 1PG7H 1N8OE 4XWGL 1J8RA 1EGJL 2V9RA 2XV3A 3B2UD 1UT2A 1J0JA 1P4IL 1U58B 4GMTL 2CJ3A 4JM2C 4IRZH 4LGRB 4NN7B 1G5GA 4XMPL 5BZWB 4AL8C 5EF2A 4Y9FA 2WBKA 3CC1A 2FL5A 2D7QA 2XWZA 5IHUH 4AQEA 1E6JL 1NC4D 1U9KA 4YHKH 2ALWA 4F8PA 4P2QE 5HHVL 2GY5A 2XTJC 2XACC 3O3EA 2GJZA 4WFFD 3KL5A 1T04A 2ZG3A 4U0RC 1D5BB 3IJ7A 4OCNC 3RI5F 5IT2H 1YAIA 1HH6A 1GC1H 3BVUA 3HUJE 1BIIA 4HS6B 2NNAB 1Q9KB 1LEIA 2H32H 3ZTNL 2JJTA 3OXRB 3JWNE 1NAMA 3QJSB 4OW6A 2FBJH 2QMJA 5IUSA 1I3GL 3QORA 3S5YA 3I84A 4GPVA 3L4ZA 3WLWD 3QO0B 3BEVB 2NT0A 1P4BL 1YEWA 1JNJA 2DB8A 4Z7VB 3B2UC 5DS2A 3EFOA 1SF3A 1LO2L 1MFDH 2JXMA 4I18A 4OVUA 4NP4H 1BP3B 2VZ1A 4G8IB 4U6VH 3COOA 5J6GA 1HL5A 4PJGB 5MEPB 4RLDA 1H3XA 1GOFA 2PCPB 2EE3A 5DD0H 1E5UI 1UQSA 4Z7WE 4DK6A 3QIUB 2XXGA 1XT5A 4G43B 3SDAD 4N24A 2DEWX 3GRWA 1AH1A 5E6YA 5T5FA 1ZIBA 2A9BA 2QDWA 2VDOH 5DVNA 1WD9A 2K6ZA 3MBXL 1NFKA 3FTGB 1UWEL 3WLWC 4ZUWB 5J0BA 4P3CH 2FIKB 5E99H 1OT1A 2IO5A 2WO4A 4EQ3A 5C71A 3VACA 4AEHL 1OSYA 4JFEA 3KLKA 5KVDE 1ET7A 2FQEA 1LMIA 5I1JH 1MRDL 4D8PA 4PP2A 1FRGH 2K7QA 4QPEA 5GGTH 2QV4A 4R7XA 4QHNB 3WEOA 3BZ4B 3LH2H 1DHKA 1ONQA 4OQ1A 3ZDXB 3MX0B 5KYUB 3GO1H 4R4FH 3DJ9A 1AGBA 3LJ3A 3SDAC 1FFRA 3EYUL 4H88H 4XCFH 4HPHA 2AC0A 1JGUH 3P73A 2NY7H 1I9RL 2XQYA 2AEPL 1NBVL 2H5UA 3EGSB 3RL1B 2PTTA 3W81A 1VGEH 4BKLA 4JQIL 4KK6D 4B95C 4XNXH 1E9PB 1WP6A 4KXBA 1P84K 2GHWB 5EDXA 4H7VA 2WMPA 5IY5B 1IAKA 4M7JL 4HJ0D 5F97E 3ARDB 4JHVA 4NQEE 3B7RL 4OM0L 3RUGE 2DQTH 4GQQA 2YHGA 1JK8A 3F7YA 5GS2D 3GJEA 1EAJA 2G0LA 4MNHA 1BZ9B 3LN4B 4Y4FC 5D1XE 5BQ7B 1MW3A 4KMTH 3ETSA 3BSGA 3PJSA 5BO0D 3RWEB 3OZLA 4KI1A 3TNNB 1QO3A 2JELL 3UTSB 4P2OA 1C7TA 1CIDA 3HC0A 5IJDC 4M8UA 2J4WH 1IM9A 2Q2EB 1H8SA 4KX9A 4PRPD 3U7WH 4I0PD 4MNQA 3B6SA 3HPJB 1ZEAL 4EN3A 4CADB 1J5IA 3HRZC 2D4DA 4KK6C 4OIIL 4GQRA 5DUJA 4AIZB 4GUPA 4LL9A 4HJGA 1A4KA 4I48B 4HJUA 4CSZA 2OQJB 2ETWA 2ARJQ 5B1JC 4HJ0C 2RMNA 3OAUH 4FFYH 5DZPA 5I5MA 2LOEA 4GINA 2W60B 1M1SA 5ESQA 3SYCA 4HBCL 5EZJB 5CWSA 2NQ3A 4XODA 1UEYA 4FQXD 3HKZA 1HYRC 3EH4B 1U42A 3E80A 4QNPF 5D2LF 4K5OA 4AJYV 2JLLA 1IBGH 1OQXA 2WB7A 2XBTA 4QRFA 5DHVH 2R0ZH 1T03H 4JZOB 4PI0A 2Y2WA 2GT9A 2DQDL 4I0PC 5L4IA 4JFFA 2O4EA 4YSAA 3OF6D 5GISL 2BZ7A 2YD7A 1S5IH 5IB5B 1FAKT 3OKLB 1SHXA 1V3JA 3BD4A 4UAOC 3VXRD 4N2NA 4WCYH 1QR1A 2BCMA 2ICES 1P53A 4L1DA 5E5RB 3O2VH 3FSOA 4NXSA 5EOCH 4AEIL 1U8HA 1HL4A 2FK9A 3C60A 4XCEA 2JQZA 2X4SA 3IJHA 3HBQA 5CD3B 4FQXC 4I9XA 1CXEA 1YEEL 3MRIB 3PXLA 5TFSH 4OZFG 4H0LC 3QFDB 4JRYE 4G70B 4ZO9A 3L1FA 4OTXH 4UU9B 2Q8AL 5AAWA 1JGDA 3ZKXC 4AGNA 4JRXA 5DS8A 1V5JA 3RGBA 3HIZA 5E6IB 2VTFA 4ODTH 1NSNH 3REWB 3VI3E 4GG6E 1QYGL 3VXPA 4GOSA 1A66A 2YEQA 4A2FA 3X13B 4AYBA 4N2EA 3T6VA 4HUNB 1G7PA 3UG3A 4C57C 4JY6A 3AG3B 3CFDB 3DUHA 4R5VA 3U6RA 1CLOL 1VSCA 2AV7B 4Z9KB 2XTJE 2Y7NA 1FNHA 2G9KA 2B9AA 4TLSA 32C2B 1S7TA 3SOBL 4EE2A 1NDTA 1GC1C 2P3YA 2H6PA 3H8NA 1WWCA 3BGMB 2R23B 4YHZH 3WIHH 3WL9B 1O9ZA 1U8CB 2MPVA 2UXFA 4M62H 3WNJA 5I76A 4KNSA 4BFGA 4YHNB 3KPNB 1BQKA 5SX4H 1PDKA 3CDZA 2WWMD 3V0HA 2CG9X 1JNHB 3C6EA 3CFBB 2X6AA 1HH9B 3EOYG 3QDMD 3J8F7 3VD7A 1OZUA 1QASA 3UTTD 5E4IA 1U8PB 1XFPA 1Z0MA 2WTOA 3OX8B 5KYXA 1UM6H 3TBVB 4F33B 4HXAH 1BVNT 3FU3A 4KY1L 4N86A 3UPAA 5FYLH 2Y1ZA 1OVZA 1MCNA 3GXIA 4HFWA 4R7VA 5C9JA 1LWRA 1OAXL 4OCSH 4RZKA 1KY6A 1T66D 3POHA 4JG1L 4EOWL 3DVNB 3UFIA 1IAOA 4NQDA 2QDVA 2VMEA 1DUZA 4HW6A 4TSAL 2WXHA 5EZIL 1J9SA 2YXWA 4W9JC 4P3WA 4WWKB 5IVZB 4A04A 4L3CA 2NX5E 3ABKB 1BMWA 1Y0LA 2J21A 4R6UA 4HEPG 3VWJB 1MJ8H 3IDJB 3OKOA 2YBGA 1ND0A 2WWMC 2Y7SA 4U3CA 2G0KA 4X8XA 5TE6H 4YZWA 3GUTB 2PW2A 4CMHC 4P5TB 1BD2A 2ZAIA 3HNSL 3OJDB 3PP4H 4L9LC 1G6RB 1ZWIA 3BKCL 3QHTC 3AUVA 3MRMA 1XBDA 3EOBA 4A7TA 2BNQD 3NESA 3CDCA 1YEIL 2UXGA 4JFDE 3MRGA 3LPOA 2PPEA 2F5AL 3WNOA 3FUEA 5D7JA 3LRSB 2WZPA 2BSSA 1T66C 1YPZF 3KBEA 4NO0B 5JIKA 5DEZA 4K9JA 1NIEA 3LXCA 4ZOAA 3TO2A 1PLBA 3G6AB 4MJIB 5TE4L 3W5NA 3ZTDC 1MJUL 3CLEL 3NGBB 2FIRT 2VZSA 1VB9A 2NUPB 4LCWE 2RQEA 1D5RA 1Z7JA 2WXKA 4EUPH 1AXSB 3KPRD 2XN9D 3TZVD 4M7LT 4HJJL 1DBAH 2BNUA 1RUPH 4RSYA 4A63A 4W1TA 5HGGS 2VDKB 3U48A 1A9BA 2A4CA 2Q3AA 3FB6B 3BESR 2R0LL 2V3DA 3NFPA 4NCC1 3EO9L 2BDNH 1N64L 2EDHA 5AVUB 4LLAA 3AY4C 4G9FA 3VGHA 1JPFB 5EU6B 3JVFC 4PJFB 3FO1B 4O9HH 4DZ8B 3CK0H 2D7TL 5K9KB 4OCXH 3H6JA 1HX0A 3FZUC 1T22A 4N9GA 4KZCA 1MUJA 3W0WA 3BYYA 2EDRA 4X4KA 2X4PA 4RX4A 5A43C 1JVOA 1QRKA 4OZIE 4NJAL 3MTXA 5IBTH 3MUUA 1N5YH 4J8QA 3X3GL 3I6GA 2X9YA 1BQ5A 1EZVX 4F80A 3TZVC 1CXIA 4B9GA 3VQ2C 5F96L 2GJ6D 3MV9A 5C07D 2P5WA 3BRFA 1KYDA 5CP3H 1AGFB 4Z7VF 3RFZC 2F19H 3VX0A 2UXTA 2JCWA 1BYOA 4Z5RB 3ES6A 3NJIA 4WAFA 1ORQB 1IBBA 5DSCB 4WSJA 5HDQH 3S5ZA 4QHLA 3ILDA 4PJGF 4OM1L 4YL9A 2Q10A 5FK9A 1S9XB 2YKKA 3CBKB 4QJ5B 5B3NA 1C08B 4QRPD 3VI4A 1SDDA 3GB7A 1T1WA 4M93B 2YGQA 5I26A 3PGCB 1U8JB 2CNZA 4LLQA 4AVHA 4L5FE 5B7FA 3QYNA 2AQQA 2FWOB 4OLZL 3KPSB 2P5PA 3UYRL 3VYPA 4ZMQA 15C8L 3VFNB 3QNYA 3RA7L 1MJJB 3ARRA 3VXOB 3LD8C 5F9OL 2FEEI 4QIRA 3RHWF 5I17A 1BGXH 1BZ7B 5BS0D 2MKLC 2WINB 4PIBA 4TRPH 3EXJA 1E9OB 4XHJD 5EUOA 2J73A 4FI7A 4D9LH 4I2XB 1CF1A 2ZUXA 5HJBA 2GK2A 1CFTA 3QPXL 5H35B 2XG5A 4LPCA 1FP5A 5JPNC 3VFRA 4BH8A 3ZYJA 5ICXB 4HBQA 4WY7L 4KO7A 3MV8B 2IPUG 5JNYA 4BE5A 3WS3B 1AGCA 5HGAA 3ZDXF 4FLSA 1A4CA 3NBNA 4HGWA 3IKKA 1Z5LB 3U83A 4G7RB 5IFJA 2ESVB 4PRHA 1L9SA 4A7SA 4LSVL 4APQA 5I18H 5EBGA 2JCCE 4R4ND 4DGYL 5CGMA 1BG1A 3G08B 1N19A 3IFLL 4JFPB 2FYYB 4U1HA 5FYLD 4NNYB 1G7QB 1MVYA 4NGHH 3UXFA 4FQ2H 3P4OB 3ZOAA 5C0IA 2X1WL 1NCBH 4AE1A 1NWPA 5L2KB 1KPVA 2O5XH 5DR5L 5ACMA 5M95B 1MH5A 3QJQB 2DJUA 3CFCH 3L5IA 4M1CD 1A6AA 2BRQA 1AS6A 4IGBD 3VXRE 4X5WB 5ESAB 4OLUL 3K81A 3THMH 5J1SC 3L5JA 3RFZB 2AF2A 3X1GA 2QLVB 3V6OA 2YD2A 2XWTB 3JTTA 4LVHB 3MCLH 5LCVA 1U0QA 3SE4C 2PP8A 2XWBB 4C4UA 2YEZA 2ZF8A 3D50A 3RIFK 5EF0A 2B1HH 3Q5TA 2WLJA 2I27N 1RULL 3GS4A 4R4NC 5JHLH 1D6EA 1QTSA 2ZX7A 4XXDB 5IF0A 5I1EH 1BEYH 4Q6KA 4KQ4H 1EVUA 1JWSA 4NLHA 4UANA 3VCLA 3JWOL 1EEQA 1CT8A 5LAXA 4O51B 3V6ZB 1DQML 3ZMEA 3Q3GA 4LHUA 2NCEA 3RJDA 4ETYA 4HT1H 2DBLL 3P9MA 1BVNP 2NQDA 1MCJA 4NKOA 4PLNC 1BVZA 1U8KA 5F44A 1G9EA 3HC4L 4M1CC 4IGBC 5DXWA 4FQIH 2BPBA 1E4HA 1JPSH 2C3WA 5A7BA 2CK0H 4UTBL 1WA1X 3MGTB 4X42A 2B1AH 4R26H 4K23L 1WVZA 4S2SA 5E5MA 1YN6A 3GIZL 4H0HB 4OB5H 4PD4K 1Q90A 4EI6A 1N59A 1NICA 1FZMB 1CR9H 3K4ZA 4FEIA 3UTTE 3OV6A 2WSKA 3LKNB 1UT1A 5T5NF 2QSCL 5FLUA 5GJTH 2WNWA 2WXLA 3L2MA 1HHGA 2DM3A 4D2NA 3OMAB 1L7IH 2HX7A 2ZYHA 2EDJA 1NAKL 1MQKH 2GEEA 2Z4QB 1O9WA 1AJ7H 1JDAA 1FJ1B 2YMTA 3BVXA 1VEOA 3PV6B 1P4UA 4WV1C 4UTAH 2RHEA 2WUBH 4FQLL 5SX5H 1MCBA 4TUOB 5C0AB 1OB1A 1Q4NX 3CU7A 4HWBA 4ZD3H 4MJ2A 3IDNA 5C9KA 3W38A 3QDGB 2NNRA 1B0GB 4JHWL 1HSAA 2BP0A 1XB6A 4AGQA 5CD5D 7FABL 4F2MB 1XL6A 5BRZA 4YQXH 3QQ4A 5DQ9B 1YNKH 1OAUL 1UWGH 3HZVB 3M7OA 4W9GC 3VRIA 2V5SA 2J1KA 4QYOA 3BYTA 4Y9GA 4RMWA 1QP1A 3DO4A 4F7MA 2BNQE 1HT6A 2V8LA 5M7QA 3VA6A 4WFHD 2FT8A 1WEJL 1PLAA 5IWLA 1EFXD 1I31A 4JDTL 2OZ4H 6PAZA 3CH8A 3UYPB 1G1YA 4ELDA 2PMZA 4HKBA 4HP5A 1OW0C 2BOCB 4ODVH 3RWGB 4EZMA 4LLYB 4MBRA 2EZ0D 4N9OB 3V5KB 1E28B 3HOGA 1ZDSA 3RWIB 5E2WH 1NFIA 2H6UA 5CD5C 3ATFA 3MBWB 4Q56A 2H3NA 1PZSA 2CO3A 3GXMA 4L48A 5EC1B 3P4NB 1EO5A 5T1KD 2Z7YA 1QI4A 1AY1H 3C8KA 2W0LA 2E9IA 5L8KB 3KXFD 2B0SH 5FYJH 3TYGL 1LHZA 5EA0L 2EUWA 1KJ2A 1YO4A 1JN6A 3FT9A 5ANME 4P5KA 1S8DB 1N7MH 3EOTL 2W07A 3NJXA 4KOBA 3BQUA 2D2CC 4U4IA 3OR7B 1CFVH 2YQGA 2QTVA 2ZUWA 4P3DA 2EXYD 1GJUA 2VLLA 2J8UB 3MPCA 5CBEA 3FN9A 4KXAA 3PWLA 3GMQA 1B2WH 5HGHA 4F7EA 4HAFA 4OLVH 2A2QT 3TCLB 3MRJA 4UILL 3U0TB 4OCMC 2CHDA 2WKOF 3SB3A 3WNLA 1TSRA 4P4KB 1N4XL 3V4VL 2OJZL 4PLJC 1NMCC 2C3GA 1T89A 2OCFD 4OGXH 3MV7A 5A16B 1JYWA 4R97C 2OR9L 3LTVA 3ZDZE 5C0CA 5SWQB 4MJ4A 1AG6A 3VXME 5IB2A 1FG2A 4YDLB 1MCOL 4POUB 2V5MA 1FN4A 3BRDA 1EVTC 5C08D 3JWDL 2XYBA 4XMLH 2XXFA 4UM9A 1BOGB 2EXYC 4MZIA 2E27H 4HMCA 2Y5EA 1T2XA 2AI0L 1RUQH 2A77L 3G6JA 1NCUA 5J1AB 4DJMA 3D07A 4UAHA 4KO9A 2UVFA 3K71B 3ULVL 4ZSOA 1P4LB 4XH2B 1RZKH 1HCFX 1WBXB 4PJFF 3CXHJ 3QJZA 1EAPA 1NEZB 1NLDL 1TTBA 2A6KB 4P04A 1PD1A 4HCRL 4YBLB 3OAWA 4M5ZL 3NIDB 3C5JB 1DVSA 4MXWH 4IBYA 4XPFL 3VSTA 4POZD 5FECA 1NCWH 3VXQB 2BHFA 4K8RH 1PSKL 4LXFA 4JFZL 2VLKD 3K72A 4YNYA 1ZY9A 3EYOA 5ISZA 2CCWA 2J57A 4V2CB 1PMYA 4GH7B 4L4TB 3KAAA 5AW5B 1LWJA 5F9JA 3U30B 2P28B 4WO0A 4CL7A 2JKNA 3H0TA 3S34L 4L8BA 3PREA 5E2TL 2K8QA 4KGJA 2FWUA 4OBRA 3ECBA 2VSMB 3ROOA 5D7IA 4PBVC 4POZC 4B0MM 1BBJA 1UM4H 1MCHA 5ITBL 1NCAL 1GGCL 5DJXB 5SWSB 4JPIB 1R17A 1FZKB 2UY7B 2B14A 4AGPA 1XH1A 4M1GL 2B5IB 4IHOA 4ZS7L 3S2CA 3N85L 4MCYB 1MPAH 5KUKA 1FO0L 3KW7A 4NKMB 5B7MA 4DO6A 3DHPA 1RPQA 1XCWA 3DX3A 3VGAC 1UOWA 4XMKL 1D5ZB 5ITFA 1E3FA 1RKRA 5IB4A 3EG9B 1ZK9A 2Z8VC 4ZZFA 1GGUA 1K5NB 2RD0A 1MEXL 4U6XA 4Z95L 1I7ZA 4WTXA 2A6IA 4QRRA 1A4AA 4XO3A 2C7UB 4HUKB 1NCDH 2C9AA 3B5TA 3BPLC 5E7FA 1LK2B 3SDXE 2KLRA 4L8DB 4MDJB 1L9MA 2ICWA 1YEDB 1ZLEA 3F6LA 4ZOBA 1NEUA 3EO0B 1FA4A 1G7IB 4DN3H 3A23A 4A7GF 1I9IH 3WDIA 1WJ3A 5L7XH 4B27A 4U3HA 4E9WA 2HT2D 3L2NA 3TWCH 3OKMA 3UPRB 5FYJD 3MLRH 4G80A 1SEQL 3NSYA 5F3BA 4JPVH 3MOAH 5GSVB 1T4WA 2X2UA 4ODSL 1PNCA 3O11B 4PTUB 2IDQA 1A3LH 4AMWA 3SPVB 5MP6L 1I1FA 1W6WA 2QR0A 4X2UA 5KYYA 3JT2A 1U3YA 2OMTA 3QR1A 1KENH 2IVFC 2KQNA 1OWWA 2FZ3B 1S7VA 3FBKA 3LSOB 4UWQB 2NY6D 3R19A 2CIIA 1MCPL 2OL3A 5AQ0A 1K4DB 5DZNA 2QSVA 4JPWL 1EA9C 1LVEA 2JKIS 3GT6A 1TZIB 2KBGA 4DW2L 4ZNEA 3EDDA 3G5XB 3WJJC 2HT2C 2I07B 3U4KA 2DI7A 5HI5D 1JAEA 3T2NL 2ZOLB 2W65A 3U7AA 1CG9B 2VXQL 5JUEH 4PVBA 3SDCD 5TH2B 2AAAA 4HV8A 4G8FA 3TV3L 4JO2L 4PJ5E 4WEUD 1OGSA 2VAAA 2YPLA 3BDXA 3V6FB 4GNKB 3S48A 3LMJH 4YHYB 2G3MA 4X98A 1J05B 1N6QL 1ZLVH 3SJVA 4ZG1A 2X1PA 3QUMH 4HS8H 2NY6C 1M2VB 1W16A 5C2BL 4WRLA 1O6VA 3MUGB 4JJ5A 4Y1AB 2CNYA 1V7NH 4N8CH 4ELMA 1CI3M 4J1UB 3UZQA 2MCMA 1QRNB 5B3JF 4O58H 4Y5XC 3FT3B 3H1ZA 2BO0A 4AQ1B 5D72H 3GI8L 5KVGH 1DLHB 3QZLA 4Z7QE 4WW1B 3SKOB 2H1PH 3ZKSD 5HI5C 3L3IB 4KFZC 2XOTA 1QTPA 3FU6A 3KXFE 4G5ZH 4K7PY 5H2BA 3SDCC 3EOAA 4JG5A 2P24A 4K8RD 1CGSL 4U7MA 2C1OB 3PIQA 3CFJB 4NENB 5AW9B 5T1LD 5FF6A 1W72L 4KTYA 1Z9OA 2WUCL 5K9OB 2BVOB 2MCG1 2MKWA 1R5VB 5CJQL 2G60L 4BXVA 5FGBA 1CL7I 3GSWA 1BV8A 1FNFA 1YY8B 2BH0A 2ZXWB 5SWZD 4E9QA 5FO9B 3QNXB 1JWUA 4NN5B 3FB7B 2GFBB 2MCAA 3JV0A 4S1QL 5B7EA 5ID0B 1PD6A 1IZJA 4MZRA 1D5XB 4RGMC 1WG3A 5CZVL 2R0KL 2ITEA 4PS7A 4U1KA 1L7TH 3UC0H 4TQEL 1TNNA 1S7WA 5J12C 1MCKA 5GGSB 1NDMB 4BFIB 4Y5YB 3QEGL 3UDWC 4YDNA 3ESOA 1R47A 1U3NA 4JL1A 3MACH 2P8MA 4F15B 3CVHH 4K8RC 5EC2A 4AYMC 3VFVA 4FZEL 5AD0A 4FFZH 2AMUA 3DBXA 3HHRB 4NO2A 3RTQA 3B7TA 3VW3L 1WS8A 2WBJB 1Q38A 3WKML 4G7YL 4DVRH 2EEFA 5D7LA 4OQTA 4MCZA 4L2YA 1KEGH 4ZAKA 2CD0A 4XCNA 1RUKH 1F4WL 1AMYA 1KB5A 3PWVB 1XIWA 3FQUB 2PCXA 4XNAA 4UUJB 3MBEA 1JFQL 5MHSE 1OAYL 1BREA 1KLFB 2ZXBA 3KWUA 3G9VA 4HJIA 3DC0A 1PY9A 1P7QA 5D2NB 4KZDH 4I89A 2VDQB 2WXJA 4F93B 1NPNA 2GTWB 12E8L 3O41A 5AZ2L 2O6CA 4AM0A 1BMZA 1ZA3A 2DDQH 2WLIA 3UBXB 3BWSA 3V7AE 5KEZA 1WIPA 4NFCA 5HHME 1RIVL 4CC4A 5B39A 5LGJB 3HAEB 1JGLH 1WHOA 5HVHB 3T2OA 5A2LH 3BCDA 2J8UF 5JR1L 3R4DA 2IALA 5FO8B 3RKDD 1FL6B 4Z0XB 1URLA 3GJFH 3OLEA 2VQTA 5K39B 3WTXA 3LRMA 4CKQA 3A24A 4DP5X 3DUSA 9CGTA 3CUPA 2CGYA 2D3LA 1WAAA 4DPAX 3BW9B 3JXAA 1KYOK 4UI2A 1QVOB 3WN6A 1QFOA 2VXTL 2VZOA 3KGRA 5HDBB 3WEXA 1HWWA 4OGZA 2WYIA 4BHUA 3CWGA 1FORH 4P49A 3SYPA 1Z2KA 4K71C 1EGJA 3PGDB 1KZQA 3HFFA 3K2MC 2R1WB 4GI8A 1F8TH 1UWXK 2QGEA 4L37A 5A6LA 3NP3A 1ZSHA 2OTUB 3OAYH 4UQ2B 5GRJH 3RKDC 3UJIL 4P9ML 3WTTA 1YEGH 1I8MB 2P44B 4KV5E 3S35L 4WU7B 4GIPD 2VKWA 3FSAA 4JHBA 1RZFH 1C5DB 1XF3B 3I9GH 3UZEA 3NIDF 5C0EA 3ECUA 4P5MB 3NZUA 3IAPA 3BEWB 5IJKC 1XGYH 1BQSA 4HK0A 1ASOA 1WTLA 5LBSH 2Q2LA 3BVTA 3HS0B 3V0VA 3FO2B 1UUNA 3OKNB 1C8PA 3ZW3A 3GZOA 4PW3A 4TUKL 3L3DB 3S4SB 3ZL2A 4DP0X 1A7OH 2X4TB 3LEVH 4KK5D 3V52L 2OMXB 3QXDB 2RB8A 4IU2A 4BCYA 3BUQA 1XAUA 3WY1A 4FNLH 2D3VA 3JQOB 4ORGA 1PS3A 3SY0B 5EO9B 2WVTA 1UWFA 5FYJE 3L7FB 2APTA 1EHLH 2EE9A 2Y9RT 1MLBA 1O5PA 4MA7H 1M3JA 1ILSA 2BNRA 4B9IA 3LB6D 2ZCLH 3LXBA 4HDIB 4NRZA 3C6LA 4ORZC 1GZQA 3D9AH 4F91B 3VG9C 4YOKA 2CR3A 2WYTA 1XF4B 3MLVH 2VCOA 4V1DD 2J88H 1WZ1L 1SOSA 1HL8A 2HKHH 1H5BC 3GGWA 3W3BA 1KBGL 2A83B 1FE8L 3IE9A 4IIQC 4GAAA 1QFWI 1NCCL 3DYOA 2Y72A 3C8HA 4OY9A 2VQ1A 3OG4B 4KK5C 3V0WL 3TT1L 3C5SB 4X7EC 4OCYL 4JO3L 3E8UH 3HE7D 3WFBL 3KBHE 4JGNA 2BFVH 4UV7L 5ALCL 1UFUA 4IBTA 1Q8MA 3MFGB 3GIVB 1JPEA 1IGMH 1TITA 3KM2A 1WRFA 3NACH 3NYKA 4N5UA 3S3BB 3HE6B 3AB0C 3KYOB 3LB6C 2FJGB 3KR3H 2JB6A 2EH7L 5I66A 1RK0A 3MRKA 5ABAA 5FHAH 2WXNA 1VFBB 4JQIA 3C2AL 1S7SB 4M7KH 2V17L 4YDKH 2AKRA 2PPFA 3QZPA 3E3QE 1IEBB 1OSPL 1P84J 1PZDA 1N67A 2EXSA 3P0VH 4DK5A 4R7DA 2GG1A 1PQZB 3WN5A 4ILDA 4TVUA 1CI5A 4X5XB 1RD6A 5MEND 3HE7C 5FYKL 5KSUA 1I3RB 4WO4C 3UBFA 3NCYP 2I7SA 2XSKA 4P5SA 1BEXA 43C9B 3VD5A 4JJHA 1JZJA 3DNKA 3TNMA 2ICCA 3E1ZA 4Y2OB 4N90D 2Z31A 3FRUA 1XL4A 4N8UA 1SFDA 2PWFA 1UASA 2R29L 4NKIL 1V7MH 3MRHB 3ZE0B 3QJVB 1CDUA 2R56L 4ZXBB 5C7XH 4W6WB 4PY8I 1F11B 2ENPA 1P2CA 1T4KA 4W9LC 3V0DA 4PRDB 3A6CL 2WLHA 2EIKB 1J8HE 3HZYA 4WNQA 4C8XA 1AS8A 3H3KA 1T1YB 1T7ZA 2E47A 3LKPB 5GIRB 3IB4A 3GM8A 3IDIA 4P0DA 5FM5M 4DN4H 3AY2A 4N2CA 2ZX5A 1IEHA 2VDMH 4OAWA 4LO9A 5EZLB 5JLZB 2J2ZA 3BAWA 4G7VL 3ARGD 2AABL 3KPPA 1GAFH 5G4NA 5D70L 3M1BB 1F4HA 2ED7A 4XNMA 3NN8A 4XBGA 5FB8A 1HN1A 3QJUB 4LLWA 1F02I 2FO4A 1CDYA 2OMYB 2X4RA 2UX6A 1E27B 3QXAA 2CLRA 1AOHA 3LKSA 4PCSA 5HHXH 4Y19D 3C8DA 2B2XH 3F12B 5DUML 1P6FA 5EUOE 4QRAA 2D2OA 1OGTB 3GQFA 4X7CC 3VQLA 3W5MA 1FFOA 4KO6A 5EFIB 5E4OA 4GI9A 1TEGA 5AFAA 4FLHA 3RGVD 3OM3B 4MD4B 4OZ4B 4PJ9A 2DWTA 3ARGC 5ETUB 1F3DH 1NGZA 1ZV5A 3DTDA 3P40A 3IMWA 3QDJA 2A0LD 4ODWB 4Z7UB 2ZNXA 3EJCA 3O6ML 5E8OB 5TJWK 1NEZG 4GAYB 3IJYA 4JO4L 3TYFB 4KKPA 3D4ZA 4QRSA 5CAYB 1PZUB 5F88B 3BLKA 4JHAL 3QQDB 1XF1A 1BVLA 3FFCA 3KDMA 3MOBH 2C1PB 1R3KA 5IESH 2P7TA 3C6SB 1AQKL 5I6NA 4QF1A 1WFOA 3SGEI 1T5XB 1JCKA 4HAKA 3FT2A 1G7LB 3RGVC 2NNXA 5FW8A 2HG5B 3ARXA 4MX7A 3VRLF 3EADA 3QIBD 4HEPA 3GMPA 1N26A 2G5BA 1KG0B 3R7QA 1W0VA 3DXAB 2F15A 2A0LC 2G5UA 3LVTA 3CSYA 4LQ1A 1TJGH 3WIFB 5DD6B 2EC9U 4N2OA 2XVBA 1RZ8B 1XCXA 1IBZA 2X7LB 2YXFA 2FLMA 3F5WB 3GSQB 1UCBL 3L4XA 3NIGE 3NUKA 4HJ1A 5I19H 4OLYL 2XY2A 1OANA 2D31B 2I26N 4O02B 4AJ0A 1XF5B 4JFUA 4L3EB 1R46A 4GUOA 1RJLA 4UQ3B 1KJMB 4L9DA 5ACZA 3NFSH 4NM8H 3D69B 3K74B 4ABUA 4FG4A 4BIKA 3DV4A 5K9JL 1A9EA 2XKSA 2WTRB 1EHNA 2J5LB 3B4NA 5IEHB 4OCRH 3W57A 2Q8BL 5GS1C 2DQUL 1L5GB 2YUWA 3HS9A 3L9RA 4JFTA 4N0UB 4U1JA 5A7EA 3WKNA 1ID5I 1VRSA 1G87A 2PO6A 3L4VA 1YUKB 1ETA1 3PHQB 3QIBC 3TF7C 1HCZA 3QFJD 1MSPA 3VXSA 4A2MA 3BHBA 4RDQF 3PRZA 4HUWB 3SZKC 4XRCA 2PABA 4OF8A 2C3HA 4WDIB 3BGFB 4AQ8C 5CP7A 3CZSA 5GRYA 5LQBH 3H7BA 2LLNA 4K73A 3RBSA 5CEZH 2OFQA 3B9VA 2PLTA 3X11A 3WKYA 1G0DA 5HHQA 3UGXA 1JV2B 4JK0D 5IG7A 1OCCB 3ENEA 3QARA 3UYOD 5GZOA 3C9NA 1V55B 2ICEA 4MMXB 1UT9A 1XH3A 3Q2VA 4LDEB 1Q9LB 4G5AA 1LL1A 3HG4A 5HDBF 2WYHA 3QWRA 1P7KB 3UADA 1PFOA 2CCVA 4KKZA 2VN5A 1U3HD 2F6AA 3NP4A 4H20L 4P5RA 4AXWB 3EJYD 3QDHA 4MWFB 5BRZE 1HZHH 2BHUA 3CFKB 2LFGA 1FCCA 3NDZE 1Q72L 4EVNA 2C7FA 3AWFA 3P11H 1RIHH 4Q6IB 4EKJA 4GMSL 2ZYRA 1TCMA 2J6EH 4X7TB 5KBKA 5IOPA 1DO6A 3ARED 1DVTA 3A4AA 4JY5H 1IKFL 3U46A 4YK4C 2V0AA 3L95A 4PS4L 4JFOB 3ARFB 5FCUL 2WQUA 2WXIA 1Q0XL 4PVMA 3K5SA 3AM8C 3RVUC 5GRVL 3NRPA 1IBFA 3QUZD 3EYSL 3ETBF 3K91A 5EIQA 4DOHB 1JPTH 1RHHA 2EDTA 3HLAB 3U9UB 5MERA 1X44A 1EZLA 5E9DE 2L7QA 2WLLA 3MRLB 1U3HC 3ASOB 1TTAA 3EJYC 4HIEB 3MLWL 2F54D 2DQHL 2I60H 3O4LA 4C58B 1CE1H 1X5ZA 3PPEA 4IYKA 5K1JA 4WK2B 3W9DB 3L08A 3NA9H 4JQXC 1F2XK 1IT9H 4GIOA 3JVGC 4FZ8L 4M6AA 1HOEA 2FLBT 3H2QA 4NZRH 2ADIB 2P5ED 4FXGC 2PTVA 4M7LL 4Q14A 5D5MA 1LNUA 3VJ6A 4B60A 1YUHB 4CBZA 3QUKA 3WDHA 3AREC 4UB0L 3DGCR 1PJWA 3O81A 3H9SB 2QKIC 3HZKA 3KHOA 1Y1DA 3WO3B 1XGPA 4P9HL 2X2YA 3N2JA 1Z32X 3BVDB 1K5WA 3EZJB 3GMNB 3T08A 3QUZC 3CZKA 4FG2A 5HDOA 3DRTB 4I0CC 5F9WC 1ZHNB 4JM4H 4EDWL 1GGTA 4HLZG 4NSKA 5K59E 1KTLB 1AYRA 1FYTD 1NFDB 4J23A 1ULVA 1KJ3L 1U8NA 2DQFA 2WXQA 1Q94B 5KVMC 4XOBA 1KJVB 3R8QA 2CO1A 4C56D 5JIHA 2IBBA 2Y6TE 2QQKH 3ULUH 1WFIA 4NUGL 4ZYKA 1DJGA 2ITFA 5C0CE 2EABA 4L8SA 1K6QL 5DI8B 3S3DB 4PH8A 2N7BA 4ODXB 4BEIA 1G84A 3VE0B 2WXFA 5TK2A 5FGCB 3EO1A 1F3RB 3WUWA 2BSTA 4ZO7A 1KEMH 1GIGL 4CILA 2VH5H 3IDMA 4BYHA 2WZAA 3QQ9D 2GTZB 2BFGA 3KYKL 3QHFH 3IVKA 1DJHA 2H6OA 3LAFA 3G6JE 4OD2B 4LP4A 5G4OA 3EH5B 1HAWA 4PRBA 3X14A 1TTUA 3TPKA 1QABA 3WHXA 3D51A 4ZMZA 3LZLA 1PEZA 4ZSOE 5B8CB 2Y25A 2IANB 3PABB 4JFHE 1JHLL 1H3GA 4P46D 4JPKH 3RURA 4JFXA 2C9PA 4N1CA 1IM3D 3U6XS 1WLHA 3TBTA 4OJDH 3BE1L 4U3SA 5C6TL 5BRQA 4Y2NA 5B1KA 5IIEB 2MSPA 4OJYA 4XVSH 3BKMH 2LTQC 2LU4A 5I1GL 4OLWH 3BUYB 3B9KD 5KSAD 4KH2A 3VA2C 3BLBA 1L9TA 4BH7B 3QS2A 3C09C 5DLML 4Y5VC 4PJHA 4CMMB 2XICA 3IU4H 5HYFA 4XMXA 2YFNA 1R0AL 1VERA 3ZE0F 4NQVB 1RU9H 5DMIH 3RY6C 3UBXG 3V4VB 3QQ9C 3PWUB 2PYFB 4NO5A 5CEZD 4UBDD 5MEQA 1U36A 1Z9SB 3AGWA 3MRPB 4RDQG 1NCGA 5E4EB 4DGIH 5J6HB 1RUML 4LPVA 2IPTL 2VLJB 3HAEG 3FYEB 1YECH 5BZXA 4P46C 2AJSH 4OUUB 1AD0A 2DLFH 2RALA 4N2BA 4OBSA 1OAKL 4U6YB 4OZFH 4IJ3B 4CW1B 1KZYA 1TLKA 4XAWL 4K2UH 3DX2A 3O2WL 5D7IE 4Z7OB 3NEEA 1PYWA 3HPLB 2PXYC 3RDTA 3MYJB 3LIZL 1M1XA 4IMLA 1QLEH 4G7QB 1OARH 3B9KC 4MMZA 5DD1H 3SO3B 4UTBA 4RMSA 3RWHB 5KSAC 1FGVL 3JBG7 1BQLH 2AK4B 1RPUA 2YRZA 4R90L 3CIAA 1MCRA 3QK0A 2PPAA 1YAZA 1UD2A 4NAQA 5FV2A 5AEAA 1QX1A 4E41B 2DQMA 5D7HA 2I5YH 5DRNB 3ARWA 3OVUB 1I7UB 2F0CA 4UBDC 1TJHH 1WQVT 4APXB 4HUVA 1S9WB 2OW6A 1I8IA 1XTMA 4PRPB 2BVUA 3FCSB 3RTLA 1NANH 3RRQA 2WHVA 3RZWA 3VWKB 4E9XA 1QSED 4LLMA 2BHZA 2A9ML 2OP4H 3HHSA 1YYLH 1GSMA 3K0WA 4Z7UF 1B0IA 2TRYA 2VN7A 4B41A 1CYGA 2E7BA 3RNQB 3V4PA 5AW4B 5ACLA 4MD5B 4ZS6D 5C8JA 5B38A 3WENA 2ZCZA 3PQYD 2AK1L 4H1LH 4JANA 4C4KT 3EUUA 2P42B 3QULB 4AC2A 4HMEA 5AAPA 1VAHA 5FGRA 2Q6WB 3DBSA 5KW9H 5D1ZD 4ALAH 5EO0B 4U4B<