5CFAA

Crystal structures of bbp from staphylococcus aureus with peptide ligand
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
326
structure length
326
Chain Sequence
NNVNDLITVTKQMITEGIKDDGVIQAHDGEHIIYTSDFKIDNAVKAGDTMTVKYDKHTIPSDITDDFTPVDITDPSGEVIAKGTFDLNTKTITYKFTDYVDRYENVNAKLELNSYIDKKEVPNETNLNLTFATADKETSKNVKVEYQKPIVKDESNIQSIFSHLDTTKHEVEQTIYVNPLKLNAKNTNVTIKSGGVADNGDYYTGDGSTIIDSNTEIKVYKVASGQQLPQSNKIYDYSQYEDVTNSVTINKNYGTNMANINFGDIDSAYIVKVVSKYTPGAEDDLAVQQGVRMTTTNKYNYSSYAGYTNTILSTTDSGGGDGTVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/peptide
molecule keywords Bone sialoprotein-binding protein
publication title Crystal structures of Bbp from Staphylococcus aureus reveal the ligand binding mechanism with Fibrinogen alpha
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 87
structure length 326
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5cfaA01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5cfaA02
3IS1X 4LEEA 2Y7MA 4F24A 5CF3A 4Q6KA 2Y7OA 2YLHA 4LEBA 4JDZA 4B60A 4B5ZA 3IRPX 4MBOA 3IS0X 3V10A 4FJ6A 2F68X 4F27A 3ASWA 4MBRA 2VR3A 3AT0A 1R19A 5IHWA 2RALA 1N67A 4LE8A 4RMBA 4F1ZA 5CFAA 2Y7LA 1R17A 2Z1PA 3AU0A 4JDZB 2F6AA 3IRZA 4F20A 4JE0A 2Y7NA 4BBWA
chains in the Genus database with same CATH superfamily
3AAZB 1ESOA 4P4RA 1PG7W 1CFVL 5LGYA 5JORA 5JHBA 3BN9D 1AS7A 2FX9H 1P1VA 5IQNA 2QSCH 4FZ8H 4YH6A 3LZFH 5EUKB 4KRPC 4M8QB 4PJHA 4X8JB 5EU6E 3US9A 5LCVL 3F12B 4IEFA 5I24A 2BHZA 3BFOA 3H3BC 1RUML 5BVJA 5AKRA 5C3LD 2BNQB 3DV6A 1E40A 4KRNA 3TT1H 3QWNA 5DRXA 4CC0A 4BHUI 4CSPA 2YKLH 5MENA 1FNLA 4J7RA 3U0PA 4BM7A 1WZMA 2A83B 5IOKA 3REWB 1ZGLB 5FGSA 5HJBA 2YAQA 5TE6H 4Q0XL 2OMZB 3MUGA 1EEYA 2J6EL 5FYJU 1IAOA 1ZIBA 4Q14A 5JMRA 5E99H 5CMAB 1XF2B 1PSKL 1UZ6E 2I60L 4YJZL 2EEXA 2VLLB 5BVPH 5FYLD 3WY2A 3U4KA 2P52A 3VD5A 3UZQB 3FSVA 1UEMA 6FABH 5F6HJ 5D96B 4OF3A 5EU3B 3FOMA 3MRFB 3RIFF 4PJ8B 3LSOA 1XVSA 3ARRA 4UOQA 5AWNH 1FCGA 1BQHG 1GOFA 1MRDH 4GJTB 1IBGL 4GW4A 4L23A 3RHWK 4KVNL 4AIXA 2FIKB 4OUUA 2XWEA 5IUSA 2R2EB 4WCYL 3X1NA 2GJ6D 1HVXA 3LN9A 4GRWE 1Q9OB 2EABA 2FIRT 3ZE0E 1Z1WA 1QD0A 2E9BA 2XQBH 2NYZA 4LIQE 4RDQG 2IH1B 4XOEA 5C0RH 4JRXD 4MS8C 4XP1L 2LAGB 3LZPA 5EWIL 2EUXA 4QTHB 1A6UH 4YE4L 4CJ1A 3PV6B 2KPWA 4AJVA 4TNVK 4ZUTA 3MI6A 2WWMD 3DOHA 3E9TA 4ICWA 1ZLDA 4IRSA 4DW2L 1TXKA 3ABMB 5BQ7B 3BP6B 4HPHA 2ICEB 1RUPH 1WV7T 3IMBA 32C2A 2X9WA 5KVDE 4MXVE 3SBQA 2G3MA 3ZE1F 3FUKA 3GMNB 1HAUA 3ZUNC 4G7YH 5DVLA 3VXTB 2IQAA 2X53A 4KROB 3RPIB 2XX1A 1ITBB 1YVLA 4NO5A 2W9LA 3TO4A 3V4LA 1A0QL 1UB5A 5IJDC 3V79C 1U8MB 3NAAH 4G9FE 4WFGE 1L9NA 2NDFA 3BUYB 3MRMA 1AG6A 3WS3A 3EOTH 4JO4H 3BWAB 4X4YA 1EHXA 2APFA 4YPGA 1TITA 3GSXA 5L8LB 4WI9A 4A6YB 3TEXA 5LGHH 5C0FA 1SHWA 3FCTB 3UTPE 1FIEA 4GKZA 4JZOB 4FNUA 2BIIA 5JLZA 1I7TA 1KGCD 3EJZC 3SODB 1RI8A 4IRZH 2X1WL 1VGEH 2D7MA 2MMXA 1KYOJ 4POUB 4YDLC 4UT9H 4Z7IA 3CXDH 3DX9A 4WHTA 1MLBA 5EZLB 1GHFL 5AALA 2P5PA 1IGJA 1GY1A 4PJ7E 2X3AA 1JDCA 5FAAA 3VFTB 1KB9K 4ONGH 1QPXA 2GK2A 3F05A 4FQIH 4P5MB 3K5RA 2IAND 4P3CH 4PGCA 2R9HC 5JUEL 1WIOA 4BBWA 4BZ1H 3JVGA 3V6FB 3IJSB 5GS1A 2MIZA 5FECB 3IBOA 3I6SA 4UINL 1NMBL 1N5AA 3QUMH 4FE9A 3H42L 5I5JA 3VD2A 4JFUA 2XWXA 5KTEL 4A7GF 4JFTA 2ZWSA 3DX8B 4XAWH 4BK5A 1G43A 4IBQA 2F68X 4P48A 1NC2D 3LZLA 4KMTL 1ZV2A 1KLGA 3O3EA 3ZKSD 3GD1C 5D2LA 2Q87A 4EUPB 5LAXA 3TN0B 4HUXA 5E2TH 4AIOA 4ZYKB 4CGUB 4JZNB 3VI4A 3WFDL 4YHYC 1S9WB 2HVKB 2B5IB 4LBAA 4XP4L 3QXAA 4M43H 1L3NA 3OJVC 1KTDB 4G1MA 4NZFA 2AV7B 5F2FA 3EFOB 2GSMB 1X6NA 3IPBA 2W81C 3CK0L 1DQVA 2WJ5A 3ARWA 2VLRB 3TO2A 2IG2L 4TOYH 5I8KH 5CR1A 4W1TA 3NCXA 4O2EA 2MHAA 5EV7A 2A9MH 3SQOH 4OVUA 4PGDB 1ZVHA 3EH5B 3WHXA 4IBZA 2A74C 2P26A 1T21B 1WZ1L 2EDMA 5JPNA 4AV5A 3FN3A 3O6LH 2CR3A 2UYLB 1I1FB 4PJXB 4HD9A 4J3OH 4J3OG 4NZRL 5CGMA 4URTB 1KCRL 1QBML 2J8HA 3EDDA 3FMGL 5B39G 2KLTA 4AH2A 3CVHB 4FQJH 3RUGF 2AERT 2VJXA 4XWOC 3GSVA 3HI6L 3VFVA 1TCMA 3VXMB 4BEIA 4WEBH 4E9YA 1AANA 2V5MA 3WLWD 3CZLA 3JTSB 4JR9L 4NUJB 3H0TA 4MMXB 5TDPA 1CC3A 1UD2A 3O6MH 4XVSL 3KBHE 4F9LC 3GJFB 2DPKA 2V6HA 1YY8A 2WUBL 4DN3L 4S1QH 2GSGB 5D7JA 3RY6C 3L8QA 5IB3A 3BIKB 2QQNH 2AK4A 1SXSA 3S36L 3UTOA 2WD0A 3BZFA 4DESA 3ARZA 1XAKA 3L6FA 3ARBA 3RWHA 3L48A 5I17B 4MXWL 1NBQA 5FO7A 1N6UA 1FP5A 1OE2A 1XL6A 4G5AA 1G9HA 4R4FL 2BVPB 4AM0A 9CGTA 2NY5H 1A25A 1XZWA 3HUJF 1JGDA 1MAKA 4FI8A 3T3MB 4PCTA 1CL7L 4PB0L 2N01B 3D85A 3H2QA 4LSQH 4HFUH 1BJMA 1I8KA 4DO5A 3FUHA 4ZMQA 1IMHC 4GQRA 1E6JH 4HAKA 2MWCA 4U7MA 1KDJA 4OD3L 3NCWA 5B38A 4BJLA 2ADIB 3E6HB 5KAQF 3L5XH 4Q56A 2EC9T 2JLPA 4OZFB 1K8IA 5CP7A 1NKRA 4J5VA 1BZ9B 4WEMB 3JWOC 4PR5B 1X5LA 2Q7YA 3X3FH 1ZS8A 1X4ZA 5KS9B 1U36A 5CBEB 3Q6FA 2KZBA 4C55A 4GRMA 4YQXH 1NFDE 4CN6A 3T1FB 4IOSD 2PF6A 3DO4A 4YDLB 1BFTA 3UGUA 3C5ZD 5IJBC 1U21A 2ADGB 1IFGA 2JIXD 3HR5B 4D2NA 5HD8C 1LO2L 1ACZA 1VERA 3PL6D 5GGVH 1X3DA 2B20A 4DP6X 5KSBB 3HHRB 1U9KA 3T08A 3UO1H 1N19A 4LLUA 1MZZA 3PP3H 2E74C 3MV11 4UF7C 2V2TA 1NBZB 1CVSC 2G60H 2X10A 1TTBA 1TQBC 2H26A 1J48A 3LIUA 2YD8A 4YGVB 4RNRA 2LOEA 4L4VD 5GGSB 4G71B 3QQ3B 4U1SA 2XRAL 4NXKA 5ADPL 5L4MA 3BJ91 3UBXI 3BD5A 3ZRCC 3NZHH 2JB6B 3OKMA 4Z7VA 4L18A 1U6AL 2CJTA 2VISB 3F3HA 1MCPH 3NA9L 1AFVL 1NAKL 1U30A 3L1GA 4RFNB 4I88A 5CLWA 3HNSL 1WAAF 1U3HA 1QR1B 4M6NH 1UM5H 1R75A 5ADOL 1MJ7H 3HG1D 4RWYH 3Q3GA 3SSGA 1A3QA 3T4YA 1IJ9A 1FG2B 3K91A 5FGCB 3S37H 5FGRA 5DD0H 5HI4D 3D30A 3BVXA 4EKXA 5DCCA 1TETH 5I6XB 1C5DA 3A4EA 4Q6KA 4ZSOE 3EFFA 1KPVB 3Q2LA 2FO8A 3AQDA 4J3WA 1ZK5A 2COQA 4OLEA 3C87A 3B1TA 3WGUB 5DMIH 4KKPA 4ZJ9A 4DK3A 2O93L 3DV6B 1UD5A 1HC1A 3VG0H 1DQIA 1XO8A 2VQ4A 5AVUB 1T7WA 4L8BB 4GAAA 4PSRA 2HKHL 3IDNA 4Y19D 3L3HB 5DZNA 1J8HA 2CMRL 2GSIB 3ZXAC 1BJ1H 5E5MB 3O2VH 4MNGA 4YFLI 2WQ8A 2PO6D 3RTQC 4FQQA 3MUGB 1BQKA 2H6PA 5H2BA 1WZKA 1S9KC 2E0PA 5E8DH 4BXSV 1WE5A 5EU5B 3M17B 1J0YA 3EJRA 4I2XB 3FJTA 4GQPH 3MV8B 3RJQB 4ELKA 1AJ7H 3BCDA 3DIFB 5DQ9B 5EFIB 5GGVY 3GIVA 5AYUH 2WWKO 2P8LB 3UJJL 3KG5A 3TTSA 2D73A 1UFUA 3MV7B 1BQUA 2YD6A 4IDJL 3FOMB 1IAIL 4LARH 1I1CA 5CKGA 4HULB 4UQIM 1UKTA 2C7UA 4IM8A 4IRJD 4ODSL 5IMLB 4FQLL 3NSCA 5ACZA 2WWNA 1BPLB 5F97E 1DANT 1BVLA 4WFHE 4Y5VA 3WFBH 2F54D 2VDLL 3K2KA 1INEH 4G8GB 3UG4A 4FDWA 5I23A 1Q8MA 2BLFA 2EKJA 5ALBH 2UX7A 3BN3B 3QDMD 3FAXA 3TCLA 4N2HA 3WO4B 1CI3M 1H3GA 1OPOA 2YA1A 3HZKB 5BPPA 1MFMA 4TTDC 4OU3A 43C9A 1Z9SA 1W80A 2W88A 1XGYH 4KV5F 3K6DA 5T3XH 4PYHA 3UTSA 3CZUB 4UDTB 1RIUH 2EXYC 2DLHA 4RRPG 4G8IB 1FL6B 4A2DA 3QIBA 1IT9L 3O4LE 1H5BC 1DSWA 3O9WB 4PJBB 2FGWH 4N0UA 4CVZB 5EZOL 1U8QB 2BNRA 5IFAH 5E70A 3S34L 2H1PL 2QKSA 4PJGB 1IGMH 4MKTA 4E2OA 2NZ1A 4G11A 3ZPDA 5HVGB 3EO0B 2JJSA 2AXGB 1M6OB 4PJCB 5E9AA 5HJDA 4LOFA 1Q0YL 2ZQKA 3T04D 5JHDB 3FQ1A 3V0JA 1XTMA 2PW1B 2XV3A 4GY4A 4XN7A 3V10A 5C2BH 2QPSA 4WEEA 5JIQA 1OGAB 3TWYA 1L9QA 1NCHA 4AQAB 1OAKL 4KKNA 4ZXBA 3MMEB 2ZPKH 1PKQE 2XN9A 4HIXL 4YSOA 3QCUL 4QRBA 3AREB 3O8XB 3WFEL 1J9QA 3ARGC 3S9DB 4KZEL 5C08B 1TDQA 5IFHL 3U2SA 2OMBA 1TEFA 2ORBH 4U6TA 5FS5A 4IGBD 1CE1H 1L3WA 4NJAL 5AZ2H 2HG5A 4Q9QH 3DX9B 4RISH 1JRHI 1GCYA 2GW5A 3OXSB 4LCCA 4AGQA 5I16A 4Z77B 2FT8A 3QVAA 4OZGB 3VCLB 1XMWA 3HG4A 2YD1A 1UXSB 5JOFA 1MCWM 3LV3A 2OM5A 4MCNA 2DTMH 4HF5H 1TCRA 3ZY7A 4R83A 1TYJA 3HRZA 4DP9X 5F9OL 2N0KA 1TZOA 3EOBB 4WO0A 3X13A 2Z31D 4J8RB 4B6ZA 1ES0B 4P2OA 2H8PB 4WO4D 5DJXB 2LV4A 1K9TA 4JRYB 4W9LC 4A7UA 4Y2DC 4JHZA 4MQSB 3SGDI 4TVSa 4JDVB 3HNVL 1MHEA 3HKFA 4AVJA 5AD0B 1THCA 5FOBA 3OKLB 5FYLE 1KV7A 5MP6H 1LO3H 4PH8A 2OL3B 1QVOA 4KJQD 3O2DL 4A38A 1VFOA 2DQTL 1CK0L 1OHZA 4NWUH 1EZSA 5B1KA 1CBJA 5IM7A 4AT6A 3N9GL 2XG5A 2FB4L 4XX1G 3BHBB 4OV6F 4DKEL 2XU9A 1C7SA 2AABH 2XX0A 4JE0A 1E9PB 1QBLL 1S78D 4OV5B 4K5PA 4RGNC 1E27B 2ZCLL 4HKJA 5IREA 1DVYA 1DLFL 3WEBA 4K5LA 3HBZA 2VXTL 3LHAA 3ZK0A 4Y16C 1XGZA 1OLZA 5I1HL 4HIIA 5FO8B 4EXPX 4GYBA 4JRXE 3IXTA 4K8RL 3V6OE 4EN2A 4AQ1A 2A77H 1ZANH 2AJVL 4P5TD 1BXVA 1H0DB 2J20A 4JRLA 3VFRA 5IK3A 2ITDA 3C75A 2OSYA 1V05A 2K9UA 3SOBL 2FWSA 4NPYB 3VA6A 1ZA6A 1RJZB 3RGVB 3VRLF 3C6LC 1BBJB 3HE6A 4FQXB 2VDQB 3AS3A 4AGNA 5FK9A 4XR8C 4ZMWA 1G7IB 5GSVB 1JZ7A 1QBAA 1KLFA 4LL9A 5CEYB 2HFFA 5KVDL 1HHGB 2PCFB 1F3DJ 1HXMA 3F00A 1PL3A 4PP1D 1ACYH 2AK4B 3MGOA 1KOAA 2OXHA 1BWWA 4F8OA 5FDYA 5L0QC 2W9DL 3LQAC 5FO7B 4ZFQA 5FFOA 2ZKWA 3TBBA 5EF1A 2EEBA 1BM3L 5GRUH 1R3IL 4A6YH 4HD5A 5C6PB 1KGCE 3FONA 2CLZA 3C5XA 2OTWA 3NCYP 3VO0A 3DURB 1DQDL 5K9OB 4RIRA 3EDKA 1FO0A 3B5HA 3DOSA 3EJYC 1DP0A 4PRHA 1AKJD 5GRXG 4AL8H 3GHEH 3T6QC 4GMSH 2QQKH 2XZAH 4Z18A 4XHJC 2R4RL 1CZ8L 1M71B 5IJVA 3QYMA 5SV3A 2X1PA 3TBYA 2A6JA 1I7UA 2EXWC 5K9KB 3SE8H 1XF5A 5HDOA 4L1TA 1CICD 2TSBA 1DBMH 4RQQB 2IANE 1R46A 4PU2A 2NT0A 1WFJA 4HPYH 3TIEB 2CJSA 1YN6B 4YSUA 4P3DA 2Z93A 3QZWB 1T04B 4L9LB 3HC3H 5D8JH 4GRLA 4OGYH 3N43F 3QFJD 3BC9A 3MRDB 1YNTB 1R5VA 1G6RA 3FU9A 2FJHA 1FZJB 2Y2YA 1E8XA 2H3XC 2AQRA 4X99A 3BGMB 4Y9CA 3S3DB 4DPAX 5B1JC 1QATA 1KEMH 3KLSA 4GAYA 4EUPH 2VR3A 2XTLA 3QUZC 2B3RA 2LE9A 3QHFL 4LF3A 1Z9PA 3CDZA 5HDWA 3OXRB 1M4KA 3ROLB 1CFTB 2CRMA 4JFZL 1YQ2A 3PP4H 3KYKL 4V1DB 1YHPA 1S3KH 3SGEI 3VWKC 1IEBA 4EAEA 4NRZA 3HVNA 4QHKI 3X3GH 4FABH 1SLVA 1VFBA 3OAYH 4MQXD 1Z9LA 2X89A 1G4MA 4JFDD 2FQEA 3FT1A 2ZKHH 4AITA 2WVTA 3RWJA 1E90A 1ZSDB 2X4QA 3H4FA 3QXVA 2XWJA 1OQXA 3DDFA 1ZLSH 4FG6C 1XQ4A 5DRZA 5GS0C 4J2XA 2QHRL 2AP2A 5DS8B 3T0ED 5C0AB 1HXKA 3IB4A 3PWUA 2DIEA 3FOLB 1ZCRA 4RGOH 5IMMA 1PTZA 2PTUA 3EFFB 1UH4A 1CFQA 3ZE2E 2DQHH 2WNKA 4RAVA 3VXOA 1PLCA 1KBKA 1KBGL 1SXBA 2FATL 2EDYA 3CVHH 1BMGA 1ROCA 2YEZB 4HALA 3QGVA 2BSSB 4YFEA 1MW2A 3AROA 2VL4A 3KL3A 4R7DB 3G08B 3LH2L 4RGNB 4Z7UF 3HS8A 1XGUB 4B53A 4DPCX 2CAKA 2L04A 3DSFL 1IGCL 3LB6D 4Y1AB 4F57L 5HYEA 1PEWA 4QRTA 2BP3A 2NRDA 4AMWA 5DGRA 2R1WB 3CWGA 5KYXB 2WUCL 2FT7A 2X4TB 3VFUB 2G3ZA 3GJFH 3EHBD 5C0ND 3NBNA 3S8FB 2EYSA 2ZOKA 3MYZA 5DA4A 3FTGB 1YDPB 2WBWB 3V0WL 1Q38A 3V4VB 1H3XA 2VABB 1D5IH 4MJ4A 3CD4A 2BDNL 4N2OA 3ATFA 4X42A 3MJ9A 3KGUA 3STLB 2PCXA 3Q5OA 1NMAL 2LQRA 2IO5A 3RDTC 1FNHA 3QFDA 2B9AA 4FQCH 1RY7B 4LCWB 4PVBA 3BEVB 5IBTH 4LSPH 3OWRA 4KOCA 1UM4H 1FFPA 5DDHA 3HZMA 5D1QE 5E94B 4PWIA 1JL8A 5HY9A 5F89B 1T80A 2FR4B 2ARJA 3KPTA 2HJFA 3M1BA 2AEPH 2IPTL 4WW1A 1SGKA 4U4BA 2Y5TB 1AZVA 3KZ8A 4L4TA 1X6LA 3WUZA 2CUAA 4X7SL 3MFFA 1RCYA 4GSQA 4HUWB 2CHXA 5F1SA 2QVKA 1HSBA 1YA5A 4MZRA 5A2JH 4HEME 1SDDA 2AV1A 2YJQA 4OZFH 4OZFG 3WS6C 4K7PH 3CFEB 2WINA 3AWFA 4RSYA 4J1UB 5DRNA 2PCYA 2C26A 1F18A 1J05B 1O0VA 3QDGA 1T7XA 1DDTA 1LHZA 3QDHA 5C7XL 2WBJD 2Y72A 3LKOA 3L13A 8FABB 2ESVA 2B59B 2V0AA 4MSWA 2AXWA 5DFAA 1TU2A 1TNMA 5HDRA 4Y4KD 4M00A 1BG1A 1U0QA 3CFKB 4X6FA 1T1XB 1OW0C 3G6JE 4KKLC 3CPLA 5JW5A 1H9VA 5C0IB 3OJMB 3IMRA 1S7SB 3I75B 4L4VE 2E6JA 3C6SA 3VFMA 5CEZE 4PRPD 1RK0B 2CBTA 1JWUA 1E5BA 3RWEB 3HG1E 3PDOA 4H8WC 3SCMB 2TRHA 2HT3D 3TT3L 2HWZL 1LO5A 2F53B 5ILTH 4PJEE 2XTJB 4ZUWA 5CD5D 4PRID 2GY7B 3BLBA 1UWGH 3W0WD 4KNQA 2D3JA 3NCCB 2NY1D 4G7SB 4KI5D 4NOFA 4N9GB 3BO8B 5ACMA 1MLCA 1CGSL 2D0FA 2W0KA 1ZD6A 1FL3B 2VLKB 5D5MA 2OI9B 3NCMA 3MV9B 4G8AC 5KN5A 3TYFB 5KVFH 4D0BB 3EJPA 1VPOH 1DUYA 2NSMA 4LSDA 1TTUA 2VO5A 4RH4A 1A02N 3QQNA 2XVGA 4D8OA 2PP9A 4K7PY 4Y19E 5L8KB 3SDYH 1ID2A 4HQQL 1RIVL 4XB8A 1BWMA 1NCWH 1TQCC 3QYCA 1CDCA 2I07B 5CUSH 5JXAL 2JELH 1OM3L 1A1OB 3L5JA 1G7JB 1K4DA 1NLDH 4TULH 4IS6B 2MFNA 4KUCD 4QXVA 3RZWA 3IFOB 2WLLA 4LLDB 2AAVA 3KL0A 3WJJC 3ZSTA 5DO2C 5B21A 2YIHA 5JHLH 2WY3B 3QQDB 5CJQH 4Y4HD 3THML 3VWJD 1KTBA 5CJXC 3T0BA 5EPMB 4S0HA 2OA9A 1DQTA 3FYEB 3DUSA 4FJYA 4XB7A 3CU7A 2XV2A 1NGWB 2R0LH 5DJ0B 1UWXK 3DYOA 4EEEA 5GGSY 3NRPA 2JKTM 1KV3A 4NHCH 4PGEB 8CGTA 5IR1A 2X6AA 4C4KT 2F54E 3HCVB 5IB2A 1KGYE 1KJ3L 3IDMB 4RMUA 4CC1A 1XR8A 2I9LA 3GBNH 3DETC 4AXWB 1YY9C 2VR9A 2YA0A 2OV0A 2IDFA 4YDVA 3SYCA 1WWBX 2JFCA 2O5NA 2BOBA 2EE9A 2JB5H 2AEQH 3QEUA 4EKJA 3KPRD 4PREB 1PPIA 5FHAH 3SPGA 5L4JA 5EO1B 5A2AA 2NX5B 2GABA 5L9DL 2K6ZA 4G1EB 2X4PB 4A04A 3HS0A 3ISYA 4FLHA 4PJXF 3O11A 3IN2A 3AACA 1AHMA 5TE7H 1I85C 1BX2A 4OF8A 4K23L 4F8LA 3KXFD 2Y22A 3IDGA 5DZVA 1C16A 3UADA 4URKA 1WGVA 1E2VA 3EBIA 5I1CH 2BP0B 1S7TA 3JWOH 3LTVA 1SPDA 3DX4A 2FHCA 3L4XA 4AOFA 1I3GL 5ISZD 4A7QA 1SHSA 5CGBA 3WXWH 2OJZH 3KBFA 4BZ2A 3DHPA 3APNA 3W2DH 1CYGA 1YEKL 2O5XL 1LD9A 1R3LA 1ZV9A 2VXUH 4P23B 5GGUB 3VJ6A 3U1QA 3MA9H 3ZDYE 3UCQA 2XCMC 2DQFA 3P11L 1ZIAA 1WH0A 4GAJL 2QVMA 1HQRB 2FLMA 3TJPA 3LHPH 3VDBA 4AWJC 1W0VB 1A8ZA 1NCIA 4XBPB 1UYWL 4N1EA 2NY6C 2ICWA 5KSVA 2UUDH 2H3NB 2APXA 3C8KA 3TBYB 3FT4A 4F2EA 2KL6A 1A6WL 4Q89A 3FN0H 2YD7A 4X80L 3B4NA 5T5NF 4LAQL 1SJVA 3FUFA 2J57A 5F1KC 4LB8A 2Z4QB 4MZIA 3V0AC 5DEFA 1JWSA 1ZGLM 2Z93B 5D6CB 4U1LB 4FTVB 4PY8I 1IARB 5D1ZA 2X0UA 5F6IC 3D69A 3KJ6H 4HEPA 5IHBA 3WKYA 1R5VB 4GI6A 12E8H 4ALAL 4L8DA 4N28A 5ICZA 4P9HC 3V5DB 3H9SD 5TGBB 2MJWA 5DU7A 4ODHH 2BINA 4GUCA 3WKML 5LGJA 3EYOA 1DQMH 4PJIE 4B95C 1MIEH 2XWTA 2EIZA 4YAQA 2LLGA 3QI9C 2NW2B 3PHQA 2MQ3A 2JCCB 1M2VB 2OL3H 3V52L 1Q94B 4B9PA 2OMVA 2O5ZH 3UPCA 1PW3A 5T1MB 5KUKA 4M7LL 1W91A 1E5YA 4UZSA 4BSJA 1RJYA 2ZG2A 3CUPB 5JZ7D 4NRZB 4CKVX 3TVMC 1YEGH 4AW4A 4OGXH 4NQQA 1NBYB 2KZ1B 4G8FA 4W4OC 1REIA 3TBTB 5KSBF 4G8EB 1E5UI 2QPFA 4OZIE 3I50H 5DXWA 5IFJA 1Q0XL 3K0YA 3FHQA 1SEBA 3C09C 2FNBA 1OVZA 4FNLL 4W9FC 3RWDB 1AY1H 1FYTE 3E8UH 4R0LA 3CFDB 1CFNB 5CCHE 2QGEA 1EJFA 1VZHA 3DX2A 3CFNA 4D9QE 1MCWW 2QQLL 3MREA 3OF6A 4PB9L 2HCZX 3TBVB 4DP4X 2WAQA 1YN7B 2HLFC 3GNMH 2YOCA 4TF4A 5GRJH 2RALA 1NIEA 1P5UA 3MLSL 1QSFB 2EIJB 3JSSA 2ZXQA 4UNUA 3QNFA 1NZRA 5F96L 2CIIB 2IH3A 4DK6A 2IGFL 2V2XA 3CSPA 4UV4H 4MKMA 4WUUB 1QA9A 2FBOJ 2VDQH 4YUEH 1ZLUK 5A43C 2WANA 4DOHB 3SJVA 5GPRA 5EF0A 3HLKA 2DBJA 1WBZA 4JFPB 4NKDB 2DL9A 1AZRA 2X4SA 3VRJB 4X5PA 4EI5B 3ES6B 4Z0XA 4Z7QB 4ZS6C 1GPOL 1MEXH 5JIDA 3CHSA 2WTPA 4D0DA 3F6JA 1I7ZB 3QJFB 1KLUB 4NM8H 1CD1B 2DMHA 2V5YA 2HH0L 3HKZA 4RMRA 1JPTH 4LU5L 3TZVB 3WN6A 4C56D 5AZEL 1FFPB 4CUCA 3UPRB 1B4JL 4JZJA 2OMYA 2QZQA 3S35H 4AKOA 2H7WA 5BRZB 1LP9E 3W57A 3JUZA 3X1EA 1HFUA 3HBQA 1RQ5A 2P7TA 4JFFA 5DHXB 4GIOA 4F33A 25C8L 5I76A 3IVKA 3UOAB 4S0TD 1EDHA 2G3NA 1H8NA 1ID5I 2E27L 5JO5B 2PXYC 3LEVH 1EFXA 1NC4D 3QDAA 2BW4A 3QEQA 3SDAC 2WPGA 2WINB 1MFEH 4Y9FA 2QJDA 1ZWIB 3WAKA 2QL1A 1JSYA 3QZWG 1DL7L 4MYPA 5AAWA 4ZPVA 5DK2B 4Z6AT 4W68A 2Y4SA 5KVGE 5JW3L 3HNTL 1W8NA 2VC2B 1KCBA 5I30H 1MCOL 1VFMA 3RJDA 1AHKA 2C9UA 1UQSA 3NFPA 1AXTH 5JDJA 3I6GA 4X6FB 4HWZA 1JMZA 1WO2A 1QO3A 4FMFA 1NCBL 1GYVA 1KCUH 1U92B 4U33A 2CGYA 2DM7A 2NY0C 3DUHA 4GSRA 4X6DE 4KKCC 1J87A 1HXYA 3LS5L 5LAPA 2F6AA 4PJGF 4JLRB 3OKNA 1CLZL 3WIFA 1KYUA 4U7SA 4PJCF 4N22A 1XGTB 4PUBL 3E3QE 4KGLA 3Q5TA 4M6AA 1JV2A 3V0IA 5IVXA 1WAPA 4NUGL 5DJZB 4LHUA 4D8PA 1V10A 1ZK9A 4BQ8A 4OZ4A 3H55A 3SE9L 4B9CA 3IJHA 5AAPA 3E6FA 3QWQB 3BLKA 3H53A 4GW1B 4ZAKA 1PX4A 4OIBA 5D5MB 2VB5A 2X42A 2AK1H 1D9KC 4YHKL 2L4OA 3AXLA 3HZVB 2YSSA 5KJ7E 3VB8A 2QMJA 2YQGA 5CZKA 3H4HA 3HB3B 2DQGH 1L7TH 3BH8B 2DYPA 4NQEE 3WN5A 2H3KA 3ZDZF 5GZOD 5FWRA 2A2QT 2C1PA 4OZGF 5C9KA 4KKAD 3PXJA 3ZHLA 1JFQL 3FO0H 4IBTA 3VYPA 1I3UA 4N0RA 3QULB 5EA0H 3T1WA 4YLBA 3UGEA 3V4VH 2IOIA 4ADGA 4MMYA 3MOAL 2WLLB 1RMFL 2Q9OA 2UY6A 2XIDA 3O3AA 2V9RA 5F3HB 1MRCH 4X83A 5HGHA 2K8MA 2D2CC 4M7ZC 5SWZB 1IFHH 4J3OD 4GO9A 2NR6A 4BH8A 4EF3A 4XMPL 3ZT6A 3OQRA 3NIDB 3KH3A 3PWJB 2GUOA 4QOKD 4LVOC 3OVUB 3WFCL 15C8H 4QHNB 5I1JL 1YJDH 4QPEA 4ODBD 3WEAA 3QIUA 3E2HB 1SF3A 1FA4A 4ES8A 5D7SH 1KIRA 3MJ7B 4O2FA 1T4KA 1CLYL 4QRUA 3D34A 4AEHL 5BCAA 3DECA 4HJSA 4OFPA 2W59A 4GPVA 5EU7C 3H9ZA 3UAJA 1U8PA 2DWDA 2ZKXA 4JY6B 4LAJH 3OAZK 4OQTL 4MAYD 4GQQA 4YDIH 3EAKA 5TDNA 1IEHA 3P77B 1D7FA 4PG2C 5AW8B 2C3VA 1U91B 4E9WA 3PCYA 4O4YH 1QASA 2QPEB 3BQUB 3GB7A 4DIXA 2MKLC 1MI5A 3L95A 1QWUA 4NO0A 2PYED 2CUHA 4OJDH 3HJEA 2N1TE 4PS4L 2VZTA 4U1HB 1JUFA 4FYSA 1YPZE 4I9WD 1I8AA 4IIZA 1KSRA 4ELDA 4HWBA 3D1MC 1MREL 5IBLC 4APQC 2CA3A 1F6FB 3SE4C 4XNYL 3QUXC 1DQLH 3BPOC 2YXVA 3AM8A 3C60A 4UBDD 5F3BA 4JK0D 4PRPE 3FB8A 3ARDA 2QVIA 1FLRL 2ALAA 4QXGH 3NJGA 2Q86A 2SODB 1MQKH 2H32B 3TFKD 5DZOA 1PEZA 4XO4A 4XNMB 1CGWA 1XB3A 3X12B 5CEZL 5T1DH 3DHMA 1ZSHA 1T4WA 4DUVA 3O3DB 4KK5C 4PRIE 3EYVA 5J6GB 3CFCH 3W0WE 3U36B 3V0VA 1YC7A 1Z3GL 4FFZH 2PCPB 4KI5E 4P46B 4LSTL 2B0SH 5EF2A 2OQJA 2N3JA 1I9RH 4UM9D 2Q8AH 5JQIB 1BXXA 3DXAA 5CBAB 4X5XA 4YEEA 4YDKH 5IEHB 3RY4A 3BH4A 2OTUB 4I89A 2PUQT 3JT0A 1UA6H 1I1AC 3DPBB 3LKPB 2HRHA 4CW1A 2FO1A 4K5MA 1EHLH 5DUPL 4EE2A 2F74B 4ONFL 3PF2A 1X7QA 5ICZB 2IAMC 5I75B 4U6XB 4TSCH 3BZ4A 4KUZH 1OAJA 2NXZC 4OH2A 2PYFB 1QWNA 4M62L 4GG6A 5I8EB 3UAEA 3GGWA 2DKMA 3MUZ1 4NCC1 4RMSA 1I3RB 1G6RL 2FJFA 3V6BR 1OF2B 5DJ8A 1MXGA 2CPCA 3MNVA 3T0WA 1NEZB 5HPOA 1A2YB 5GZND 1HHHB 1T0OA 1WD9A 4MA3B 1HWHB 1PMYA 5HDLA 1BVKA 3MLVL 5C1MB 2EEFA 4JY4B 4HU2A 4JO5A 2WLIA 4X9FA 5FCUL 1WS7A 4B9YA 4AC2A 1EH9A 2JNZA 3E0GA 3ESOA 4EMZA 4PV8B 1FBIH 3PGDB 3TEYA 4JDZB 1PG7X 4QKXB 4ZFGL 2VXSL 4QRRB 5D7IE 2Q20A 4Z7VF 3X2QB 2XPGA 5IROC 4XN2A 4CC4C 3KPRE 1GIGH 3ZMNA 4OCRL 3AWGA 5FXCH 3IPFA 1CF8L 4IQHA 1S5HB 4K8RC 4JPSA 4N2BA 2CK0H 1IQWH 3L3OA 4MD4A 2K0RA 2FE0A 2FEDD 5C09B 1SEQH 5G2NA 3KXFE 3L5IA 3QPXH 3SDDD 4MA7L 3NJNA 4E0RA 1FH2A 1JGVH 5JNYA 1RUAL 1IL1A 4A63A 5J12B 2XA3A 2MTAA 2Y07L 3OQ3B 4FXKA 3VXRA 2HTKD 4L37B 4Z0XB 3ZKNC 1TG8A 5J11B 3IF1A 4G80B 3K4DA 4LMQI 4ZUVA 3HIZA 3QIWC 1EBAA 5FF6A 5ISZE 4MRBA 2Y7MA 3BP5A 4R5TA 4WK4B 5DSCA 4JFQA 4MVBC 5I28A 4WW2A 1XF4A 4O58L 1DFBH 2CO3A 3RFZA 1QZ1A 5E6ID 4PJ5D 4N0YL 3TWCL 3QH3A 4H26B 1DLHA 1OSZA 2OYLA 2E8YA 3TX4A 1BVNP 3QDJD 1RFDL 3L3DA 2VDML 3O45B 4WWKD 3BSGA 5HYJA 3MJ9L 1A7OH 3ISWA 5C0DA 2W80C 4MCYA 4NIKB 4X8CA 4P57B 2AQQA 5I76B 4FFYA 4LLWB 4EZKA 3IVKB 4LSVH 1BFOB 1I9IH 2R51A 3L3GB 2WOBA 1AZCA 3HBGA 4HC1H 2FWOA 4P2QA 1GZPB 5FKPB 5HBBA 1EFXB 3MGTB 1JK8A 2KERA 3MRHA 2YRLA 1Q9WB 3NZ8A 1FZMB 1BD2D 4MMZA 4S1SH 3IMTA 2O6PA 1U8LA 4NYLA 3QHZH 5HDBE 4RFOH 4J3TA 3TA3C 3O6FC 1YNLH 3VFPB 2HTLC 3AMKA 1YMHB 4X6CB 1P7KA 5IJCC 3H9SE 3GTTA 1RULL 1QR4A 4NNXB 3VXUB 5LJYH 4J6IA 1UACH 1PNDA 1F6AA 1MHHA 4A2HA 1ZOXA 3WEXA 1D5BA 4TM9A 1ET7A 1R4XA 4LQFH 4GKNA 5LCVH 3GSRA 5BW7A 1RUMH 1A6VL 3NSJA 2AI0H 4DP8X 1AOZA 1G7HA 4UQBA 3S8WA 1EHNA 2Q3ZA 2CDFA 5EU6B 5GRZA 3CFUA 1AHWA 1G87A 1MCIA 2FRGP 1ZGLP 4XBGB 4JFOB 3IYLW 5DURD 5GRYA 5D72L 4L8CA 1QNZH 5H8DA 2EVFA 2D9QB 4JEGB 1NDTA 4OIIL 4P3WA 2R2BA 4Z7NF 2IQ9L 5FGBA 4XPFH 3TYGL 3U0TB 1OTSD 4Z8FL 3CX5J 1PSKH 3IGKA 2I60H 2V2WA 3S96B 1INDL 2JXMA 3E6FB 5DR5H 4XNBA 1XGPB 1XIWA 5AOIA 1GGTA 2NNXA 4YHOL 5BMFH 3QXUA 4J3BA 4HS6A 3WNLA 5EDXA 1N0LA 2AEOA 2W9EL 4YSPA 3TNMA 2A99A 5IHWA 2BS71 2WM0A 4HSQA 4UNTA 1Z6JT 4EDWL 1P7QA 2J1ZA 1M7IB 3F7VB 1GXEA 3KLKA 4PV9B 4UTBA 4J4PD 4BSWB 4LKCA 3FTVA 5B3SB 5LDUA 2VN3A 2P5WD 1HWGB 4IKKA 2NNCA 4WCYH 3LPPA 1IM9B 1XR9B 4NNPL 4ZMPA 4I0PA 4PJ8D 3ARVA 4TLTA 2X0WA 5EUOE 4UIMA 4ZMAT 4O51A 4WFFD 3NRFA 4GRWB 2E9GA 3ZE0B 2VM4A 1R5IB 2QTEA 1YEJL 4OZHE 3MRGA 4X9YA 2G75A 4C56E 2IWFA 3DRQA 1T89A 3RNKA 5KJRH 4HGWA 3N6YA 2ED7A 5F1IA 1A7PL 2OPCA 3B9KA 3MBEB 4RX4A 4AEEA 1CT8A 2AJXH 1RZIA 4MNQD 5F7EL 3ETBF 1FWXA 3DBSA 4HJGB 1I3VA 3ZO0A 2JQAA 5E2WL 4U05A 2CKBB 4FX5A 4H7VA 4FQ2L 2HKFL 4LCIL 3EF7A 4FD0A 3X1FA 5C07A 5DK0B 5HHNA 4YXHL 1Y6NR 4F7KA 5EOCJ 1FNAA 4ODXA 1KIRB 2WIIB 3FQWB 4L5FH 4CU6A 1A22B 4JM2D 2HRLA 5HGBB 2HRGA 2D7QA 2XV0A 4G9FB 2L7JA 1MCDA 4JVPA 1OALA 5IVNA 3KYOB 3TOPA 4N2EA 1J1XL 1W72A 5HVHB 5IMOB 1DE4A 5TJWK 3D87B 2E7DA 4FXLA 4Z0BL 1INQA 4X0NA 5F9WB 4NP4L 1HQ4B 5J06A 4R3SB 2VC2H 4M7JL 5D7KD 2ZG3A 4B60A 4DUWA 1F4AA 4Y9BA 5D55A 2XJLA 4P04A 1M57B 3BUPA 1XDTT 2P5ED 4TXVB 1JV5A 4YWGL 1K2DA 5G5DA 3DX7A 1U8HB 1IZKA 3TA4D 4PJ7B 4XH2B 4Y5XB 4W70A 3WIAA 2DWEB 5DF0A 4YDJB 4IRSC 4ZTPL 3LS4H 5F3BB 3TBWB 1T22A 3H42H 4IU3A 2WO4A 3ARDB 3KS0H 3RWIA 5JW4R 5KTEH 2NNAA 1KBBA 3BKJL 2XPYA 3ZHDA 4H1LG 2IEPA 1P9MA 2F19L 4LRIA 5DMGC 1L6PA 3TO4C 4QDGA 4B9IA 5DVMA 4BZ2L 4FTDA 3PHAA 3STBA 3V0VB 4M61B 2OMNA 1TJHL 3KNBA 1FE8L 4XP4H 3T77A 1NDGA 4XO5A 2YAPA 5FYKD 4G7RB 3NABH 4U1NA 4UTAA 5E2VH 3FUEA 3LZQA 5SWSD 3WJMA 5FB8B 2G4GA 3L5WB 1MY7A 2V7NA 2X7LA 4PJ9A 5FKAB 1XCTB 4QHUB 4EOWL 3K80A 1OTTD 4HHGA 4GW5B 3QG7H 3X1GA 1WWCA 1AC6A 1ZHBB 4LVEA 3RIAF 4K7FA 2VLRD 4G6FD 4KHTH 4BFKA 5B7FA 3UTZA 1NCTA 3PAVA 5GQBA 1QEWA 2DQUL 4NC0B 4S1RH 1G0YR 2H41A 3E1F1 1QOKA 3UTQA 2GJ6A 4NZRH 1N26A 1WBYA 3EJJX 3H54A 3JZ7A 4E42A 3II1A 1OCZB 2PR4H 3TH2T 3FPYA 4MJIA 3CH1A 2ENYA 2FT6A 4N8VG 3GSUB 3CE1A 3FMGH 1T1ZA 1QPPA 3JVGC 1XBRA 5E1QA 3ML8A 3MLTB 3UAFA 1BQ5A 4M7KH 1E2ZA 1IGTA 1T6WA 4PJDE 4QRPE 5CO1A 1UWEL 5F7LB 2IF7A 4XXWA 3TNNB 5DYOA 3D52A 1A4KA 1T20A 2N7AA 2WB1A 4AZ8A 2FSEB 4LBEB 4NPKA 5ICYB 1SNRA 4XVSH 4ZUSA 5ETUB 3BSZH 4YK4C 1U8NB 3LNEA 1WISA 3NK4A 1IB5A 1PZSA 4LKXA 1E43A 3L1OH 1CFSB 4KKZA 2J5LC 2VXVL 1UT2A 3OLEA 2Z7UA 4N2NA 4DN3H 2R69A 2DKUA 4F15B 4K94L 3U6XS 1ND0B 4P2CG 3AU1A 1IIIA 3BH9A 4PWJA 2XPGB 4D9RD 2WQRA 4Q58C 1P4IL 4R2GB 2RTTA 3CHXA 2YUXA 5EBLB 3SKNA 1F4XH 2EILB 3L4ZA 4MS8D 3EADA 4NZUH 2CBPA 4H25A 4LNVA 4R4FH 4LP5A 5AW6B 4PRNB 2N1KA 2Z92A 4ONHA 1ITCA 4PRBA 3CSYA 4AJYV 1WITA 3JWDC 5JPNC 3L4UA 1BZ8A 2ZOOA 1MPAL 5DJ6B 1RIHL 2NUTA 3D0LA 2WP3O 1BZ7B 4LT7A 2X70B 4QXUL 2DQJL 3G5ZB 4OD3H 1S7VB 2WZ5A 1JS4A 4DGWC 5CCJA 5FF6B 3FK3A 4I9WE 4NBZB 2R56L 1A4JA 2P47B 3UACA 2H1XA 4PCSA 1NKGA 1UJ3A 2HX9A 2UWEA 4TRPH 5AW2B 3H9HB 1KXTA 4FZEL 1JNHA 3MA7B 5JW4M 1JVOA 2PP8A 3H85A 3QZLA 3G9VA 1V3JA 4N8PA 1MUJA 4UNIA 4Z7QF 1KACB 2CR6A 2R2HA 3MOBL 3QH3B 3NJIA 3AMLA 1HI6A 5MHSD 1NFDB 2H32H 4P9MH 5DK3A 4UQ3A 1NOLA 5I5RA 4A7VA 4PBVC 1NC2A 1LO2H 5D7JC 1WFTA 3T8XA 3UYRL 4WRLA 5DJCA 4PCKA 4UV7L 3APDA 4KZCA 3MLRL 1O6TA 3T3PE 1EVTC 3R06A 1GGUA 3ARBC 2IGLA 1EV2E 3QB7C 5GGRB 4XCNB 3FTUA 3GSNB 1FJ1B 3H3KA 1IRAY 4QF1B 3QNYA 3DTXA 4NKOB 3V4PA 4HVBA 1V7ML 5T1KB 3B8SA 2VW7A 1GS6X 2VMCA 1CO1A 2WWKT 2BX5A 2HT4C 5C0JB 1QRNE 4WI4A 2PN5A 4WDIB 1E4JA 3MLWL 1PAMA 2CLRB 3HA0A 3HNSH 5IJKA 3S4SB 3L9RB 3QJSB 5ADOH 2VDRL 1RJLB 4N6QA 2VNCA 1XXFC 2DMBA 3WYRA 4KU1A 2ATKB 4ALAC 2OKMA 4MDJA 3WEXB 4UYPA 4OCXH 1Q9KA 2XFXA 5HDQL 2QSQA 1TTFA 2E5EA 2OYPA 4G3YH 2E86A 3R8QA 3GSRB 3X1BA 1M7UA 4BV1A 1GYUA 4X4ZA 4N2FA 4ZSOB 2AJYL 4GFXA 4LCYA 1U8JA 4ODWB 1QSEA 3QXWA 2MRYA 3HMXA 4ZFOA 1TQTA 2W1NA 4L8CB 1EEUA 4JGJA 1S9VB 2WIMA 3N42B 5DLLA 3WNJA 4AJ0A 2LU3A 1P6WA 1GC1L 3SE6A 4HK0B 4OGQC 3P0YL 3VTAA 2BIQA 1HCZA 5L2KD 3V4UL 2YPVA 1X5GA 4L3CB 3MLUL 2W60B 4KC3B 1QTSA 2CCVA 5J6HA 2YRBA 3ARFA 4ZUUB 1BZQK 2ENJA 1WG3A 3FFOA 3UJJH 3VTMA 2WGXA 4AK1A 4LSRL 4N3TA 4LSSH 3TNMB 5JOEA 5AW0B 2ZX8A 3VH8G 4IDJH 2Z65C 3PWPD 4XWOD 5CN1A 5AW3B 3SYQA 3ZDXE 5I73B 5FHBL 5A3IC 4OJYA 2GBUA 4ODSH 1U3HC 3SQBA 3HE7A 3UYPA 3A67L 4P99A 3D8MA 5J3HC 2QGCA 5D5MF 2DOCA 3N55A 1UUNA 3G5VB 1F11A 3CZNA 3QP3A 5E9DA 1MVUA 2R1XB 5DRWB 3DO7A 3ZKXC 1Z5LB 4MD5A 4Z7WA 5ACLA 3QEHA 1BAFL 5EIIA 4JKPL 2DMCA 3AQXA 4G83A 4G8GD 3DYPA 2IWKA 4BK8A 5K39A 4PJ5E 1AGBB 3GEWB 3T6ZA 3B37A 4AYID 4Q74A 2R0KL 1F00I 4XNQA 1NKOA 1X5IA 3QDJE 3V0FA 1EAPB 3DJSA 1SJEA 1OF0A 2AQ1A 3OKKB 4IOSA 1DJHA 3O4LB 3S2AA 3VG9B 4QEGA 5LQBH 1GJIA 3FFCE 4QYOA 2I85A 5IVZA 1E6OL 4XOBA 2VR8A 2JI2A 2OYMA 5TQ0L 1LEKA 4DGUA 2YXWA 1RPUA 4N2CA 4ELMA 4IBSA 1FFTB 1TZGH 3O9WD 1NGZA 5I18H 4E41D 3GK8L 5GS2D 5KWYC 2Y6SC 4GSXA 3VQLA 3L5HA 3G6JA 4TSAL 2QKIB 1P7HL 4A2MA 1EDYA 1OAKH 2F7OA 5EO9A 1BD2E 2X1XR 4JO8A 1BJ8A 4HIXH 1X5MA 1WUNT 3D51A 4U6YB 3VFOA 1GGYA 2GITB 3WFEH 1PKQB 4DKAA 3H2WA 1QLFA 4ZODA 2APWA 4OSUL 2ZCKH 1CDGA 5E7BA 5E0FA 2HRPH 5I74B 2KHAA 3BWZA 1OAZL 3WUWG 2DI7A 3A22A 2XKNA 2RA1A 3PYCA 5L4FA 4LEBA 3ZTNH 4G9DB 1KJ2A 4NRYB 1MAML 3LDBB 1HDMA 4ZFZB 1JF1A 5BZZA 1N8OE 2D7OA 3QIBC 2WQSA 1WT5A 2HVJA 4Y5YB 5DD5L 4ZG1A 4HKBA 2NY4C 4Z78A 1MCQA 2GI0A 2F1EA 4J6RH 3RWGB 2PW2B 5DC4B 3KYMB 3EGXB 3RPBA 3CLEL 4F91B 4C8XA 1BLNB 1UZ8A 2AW2A 1R17A 2WBXA 5D2NE 1JHTA 5DVPA 4JFSA 2CRZA 2PO6A 1OAQL 2A9AA 2GJZA 2JJSC 2XWZA 3FN9A 5ID1B 3POCA 4PRAA 3WENA 4OI8A 5EZIL 3HVDA 1TENA 4H2CA 3OGOE 3R7RA 4LGRB 4ZXBC 4JRYD 3ULVD 1CK0H 3IGFA 5C0BA 7PAZA 2CK2A 2OZ4A 3GSWB 3NCYS 3VDCA 4L0ZA 2W07A 4YZFF 3CZFB 3R0NA 4AJWA 3RP1A 1JZ6A 2FB4H 2KI6A 2OMUB 3EOAB 3JV6A 4DKEH 2P5WE 3K71A 3CFQA 1MFAH 1PJ9A 2L7QA 1FVEB 1L0YA 2ZCLH 2JJWA 1CXHA 1MCLA 1DLFH 3UTZB 3UBGA 2I26N 1CFBA 2VUYA 2YPLD 4LCCC 2CUIA 3P4MA 4I13B 4WFFE 4H20L 3RI5F 1G7QA 4G2AA 4KZDL 1RU9L 3QDMA 2GG1A 3LN5B 3DNKA 3BE1L 1G1KA 4NQXA 1KIPA 2MQCA 2AJVH 3NCJL 4YFDB 4OR1A 5FUZH 2QLYA 4JRXB 3HRZC 5CEXB 1OSPL 3SOBH 1F1GA 3DVGB 3BWUF 1TVBA 1U8CA 3HAEA 2JTDA 4M4RA 4MNQE 4P2OC 3C08L 3D2UD 4JPIA 1AACA 1TTCA 1I82A 3VI3E 2FYVA 4K5OA 1IIKA 5T3ZD 5E08L 2CKBH 3UC2A 3W9DA 3GI8L 1MJJA 4PLKC 2GJRA 1BHGA 1OB1A 2H45A 4HGMA 5KVDH 4XOCA 3KLAB 4F7PB 3FQXB 4U0RC 1CF1A 1TVHB 3BPCA 4M3JA 3Q05A 3CN4A 1N18A 4PJ6A 4PJAE 1EEZA 1EQWA 4FL4B 4YC2C 1QLEL 3DVIA 5E8OB 3TJEL 2W9DH 4TTDD 1QQDA 3GIZL 2AXFB 3NT0A 2C8NA 1BFVL 1TLMA 1AR2A 4N9OB 1R3IH 1XSIA 3HPLA 2EXYD 4NNYA 1EDQA 1NPNA 5CJ8A 2P4AB 1C5BL 5GHWL 1HSAA 2VXQH 1AGCB 1T2QL 5D7KE 4AV4A 5AVWB 1NCAL 3MSPA 3I9IA 2R4RH 4EI6A 4IGBA 2P5EE 1UFGA 1BECA 5E6SB 2BZ7A 3W56A 4AQ1C 1PIFA 2ENPA 1R3KB 2A6IA 2HN7B 5DHYA 2IMMA 1DQQB 1U41A 6TAAA 5LUMA 1JZFA 3HHSA 1A9BA 4K2UL 5KBLA 3L7EB 5BV7L 1QUNB 4NQDA 3TP4A 2IANB 2VITB 3HE6C 2EDKA 1UA7A 1W0YT 4OGAC 5E2UH 4U1MA 3UTTE 2IPKB 3O4OB 3U79A 3ATAA 3ARGD 2NT1A 3QORC 5IGXL 3ESUF 4U1KB 4BDVA 1CLOL 5DHDA 2X4UB 1Y6KR 2RMNA 3J07A 3R1GL 4JM4H 3C9NA 4JHAH 5T1LD 3V5HA 3QHFH 4C59B 2DQEL 3EO9L 2BVOB 3BAYA 4JFZH 5FYKE 3L1EA 2HMIC 4OF7A 2NSQA 2R1YA 3WNMA 1Y1UA 4PPTA 1RK1B 5SWSE 3FL7A 4QWWC 5J57B 3BVTA 2Q2LA 4PV1C 4NN7C 1NOFA 4PHXA 4O9HH 4KK8C 5DD6A 2BY0A 4LPWA 5I0YA 1FIGL 3CZEA 3OKDA 4L4JA 5CIPB 4HIHA 3LH8A 3F65A 5DJAB 3FB5B 4FFYL 4NQCD 3AS0A 3WOVA 1Z0NA 2FX7L 5F9JB 5IHUL 3BDYL 1QX1A 5C0CD 4KKRA 3LCYA 4E36A 1CDBA 3BXNA 2FLRT 2QHRH 1BF2A 4W93A 3QJOA 2QEJA 4Y2DD 2XFXB 4EXKA 2GIMA 3HTLX 5B4MC 4P59H 4PSPA 3WTVA 3GBML 3GMQB 3W38A 1L9OA 2FATH 2R0ZL 3EG9A 3GMLA 4JG9A 3R19A 4PQXA 4X6CF 3GMRB 3ZE2B 1SN5A 4GRLC 4LSUH 1LEIA 3IKCB 3F7PC 2FECL 2HJKA 3LH2H 3NJXA 3FCBA 3MV01 5BZDA 4LDOB 2ZF9A 3LYRA 1IGCH 1IZJA 4I18B 4I77H 5LN4A 4L1BA 1TJGL 3U7WH 2C9AA 4PP2B 3W5NA 5BXFB 5DC0A 3FT9A 4N85A 1FGNL 4RGND 2H9GA 4KTEH 1D5ZA 2PPDA 1MWAB 3ASWA 4JAMB 1AQ8A 1X9LA 2C4FT 4Y1AD 5EHFA 3DMMB 2MSPA 1RZGA 3UL4A 5HTSA 4Y16D 4D9RE 3ME0B 4OD2A 2CGRL 2VERN 1NMAH 4XO9A 2VAAB 2L7UA 4GG8A 3MRNA 3UBXA 4XP9L 3NDYE 2CO6B 4J3XA 5INCB 3K4ZA 5I15L 4I1PA 2CXKA 1GKEA 5E00A 1K6QH 4QYAA 3FNKA 3RA7H 1HIMH 1HL5A 3K72B 1BW8A 2IPTH 4POYA 2HLEB 5D1QB 1JNJA 3C6LD 4LOEA 4PWHA 1KENH 1A7QL 3IT8D 1OB0A 4AYBA 5IT2L 4X7SH 3LKRA 1LP9A 4P2RD 4D3CH 4X6BA 3PIQB 4Z3EA 1KXQE 1H3WM 1DYZA 2CA4A 3WXVL 1G1OA 3MRQB 2XACC 1QAWA 3F58L 1Y7VA 3IDIA 4JQIA 4UTBL 3L81A 1YQVL 5I8CB 4MXQC 3HI1B 1SXNA 4UZUA 2FQGA 5F0MB 1GGIL 3QQ4A 1ORSA 4ATWA 2IBGA 4ODTL 5C7XH 5MHSE 1QKZH 4U3CA 4L05A 1BDYA 2X28A 3QFJA 4HUVA 2O61B 4GRWF 4UT6A 4WI8A 4Y4FB 3TPUA 3ZE0F 3BVVA 1AP2A 1HZLA 3C5ZB 1RZJL 3EJCA 3EH2A 2JIXB 3S2CA 3RQ3A 1KYAA 1KWGA 3EJYD 3QWRA 1HZHH 3V9FA 3HFFA 4OCYL 1OP3H 1JZ3A 3PL6B 1KGWA 3P4LA 4L48A 4XHJD 4BH7A 4PY7A 4XN1A 4P4KA 2XQYG 1AQDB 1SUHA 4MCMA 4WU7A 4AG4L 3JV0A 2IDTA 4N24A 4AVKA 3GSNH 4H88L 3H1ZA 4B3EA 2DI8A 3HPJA 3JUYA 3SDCA 1O9WA 5DVNA 4JDTL 4PW3A 4JN2B 4M8RA 2P8MA 4L4VB 3GS0A 5J1AB 1QLFB 3FO1A 2BWIA 2CG9X 3D08A 4D0CB 7TAAA 3ULAB 4JFDA 3S4SG 4AIZB 1NM9A 4H0HB 3U82B 4RA0C 1AD9B 3HG1B 5I1GL 2X41A 4M3HA 1A7NL 2XKNB 3KWXA 4HS8L 4YOKA 3QUZD 4HJUA 1QYGH 3B2PA 4PJEB 4QHLB 3TBSB 3U1SL 4A2GA 2FL5B 1PZ5B 3T0EA 4UQ2B 1KNOA 1QFOA 5EBWB 3WIIH 2V7HB 4LDLB 4LP4A 4NFCA 1LTXA 1YEEL 5TE4L 3RGHA 2BY3A 2R27A 1PG7L 3VWKD 2KLSA 2O5YL 5DMKB 4QTIL 4OCSL 1RIVH 3SPHA 1OHQA 2F5BL 1AD0A 5JXAH 1M3IA 3NA4A 4RWHA 4Y19B 1E30A 1VCBC 4HKZA 4BA8A 4PJ7F 5L2KE 3QUYA 3L54A 3RVVD 4IJTA 4FG6D 4ESKA 1TJXA 2UVFA 3SKOA 5TH2B 4FC3E 4X9BA 2NTFB 1SVZA 3GHBH 3MJ6A 4TNFA 4GBXC 5AUMB 3KD4A 1L5GB 3BP4B 4HJ0D 4CMMA 5I6OA 3PWPE 3PGCA 3GSOA 1R34A 5GGRY 4HJIA 3IN0A 3OKEB 4NEHB 4CBZA 3H7BB 1AH1A 3JT2A 4YR6A 3PDGA 4DKFH 4PBWD 4IRJB 5MERA 4RAUB 3AWEA 1VIWA 3B2VL 1PNCA 3VGEA 4LVNC 3NIFF 4UTAL 4OFVA 4FS0A 2F54B 1VKXB 1KG0A 3QFGA 2VLJD 4WSJA 4AENB 4ZX4A 4CILA 3FB7A 1AGEA 5E1AA 6PAZA 4F2ME 4YBLC 3LXBA 5MEQB 1PY4A 2EAEA 1OO2A 5ESAA 1F3JA 3LRSA 4OFDA 2FEEL 3RDTD 1OP5K 1IC7L 1XD0A 3RL2A 3FT2B 4KX9A 3B5TA 1YNKL 3CSTA 4WU5B 4CJ0A 2P8PB 1FVCA 1F5WA 3CVIH 3VFWB 4K23H 2FBJH 1BIHA 4L8SA 4M6ML 1DUZB 2ZCHL 3W9DB 5HYFA 4ZFFB 5BUGA 5HGDA 3ZYOA 3NEXA 4HDIB 4E41E 1HHKB 2Z35A 1PLGL 5F0LB 1J0ZA 4YSSA 3X11B 1PQZA 2IDQA 1O9ZA 1JD9A 4JJ5A 4FI6A 2MCMA 1RLBA 3MXVL 1PU0A 3IS0X 5I1IL 1NAMB 3NACH 1T0PB 3ILDA 1IBDA 1SY6H 4XHQA 1SF5A 2R69L 4GAJH 5IEKA 5D1XA 2VDMB 4DGIL 3ZL4H 3MN8A 3BCFA 3ZDYB 1UYWH 2H2SC 5AYTA 2XI9A 1SFDA 1JBJA 5LB1A 4AQEA 4EI6B 2ZUQB 1JZ2A 2W5PA 1HCFX 1DBAL 3KJ4C 3O3BB 1WBXA 4LESA 2HJLB 4JB9H 1RZ8A 4PVMA 4NJ9L 4KKLD 1SXZA 4O02A 1YECL 3HS0C 4M7LT 3K8MA 2IFGA 3NDZE 4JPVH 3ILPA 2APBA 3MACH 2QDVA 1JGLL 5IIEB 3C5JB 1KF9B 4OF5A 4BCXA 4KPHH 2Z31B 5K33A 5IESL 4IHOA 4YL4A 4DKTA 2E8ZA 4FTVD 4B9ZA 4WO4B 4BELD 1A9EA 2O1AA 3TPKA 3FU3A 2JK5B 2AMUA 2CDEB 2XKSA 5F44A 1JGEA 4NGHL 4HXBH 4M5SA 5I1LA 3GM8A 4PJIB 3ULVE 5IVOA 1N8ZA 3ULUL 5FYLH 4M1GL 1P2CB 4Z3GA 3C8DA 4MYWB 3GRWH 4WY7L 4G6JL 4YHPA 5DEGA 4MA1C 2EDXA 4HJJL 3BVNA 5IKCB 5JQ6L 5IG7A 1IILE 4LHJB 2QTVA 1TUPA 1T0MA 1I53A 1WK0A 3QG6A 3H3PL 2YPLE 4OBSA 1CE6A 3G5XB 4ZK8A 3INOA 4JFED 4JQVA 4MNHA 3W81A 4OZIB 3SYOA 2KDYA 3V4PL 2A0LC 4NLHA 2JF1A 4AYDC 2CHWA 2XZCL 2W91A 4G72B 1MFBL 4EN3A 1YYLL 2QQLH 2YD0A 4KOBA 1FYTB 1NSNL 2YMTA 3EG9B 4HZLA 4Q6IC 1S2EA 5D1ZC 1VF5C 2EDEA 3DTUB 4N2LA 4P5TB 5IW1B 4DNLA 4NI3A 1XEDA 4ZX6A 4PM1A 3MO1B 2IGFH 1F8TL 4QXTB 4OLUL 3KDMB 5EC2B 2WCGA 2IOMA 3IKKA 5T3ZE 2JKSA 3B6SB 5HHOD 2YBRA 3DWTA 3TF7C 3OLIA 4JANB 1IGFL 5BOPA 4Y2OA 3TTYA 3GMOA 5EH1A 3P4OA 1Z5HA 3ALWA 3DI3B 1X5JA 1DDHB 1D3CA 2OSLB 3DETD 1EXGA 4OD2B 2GK0A 5GJTH 1VFAB 1FFNA 3RWFA 1DCLA 3UBXB 2GHZA 3AT0A 4LU5H 2QLVB 2R8SL 3GM0A 3UXFA 4A7GA 4FP8L 2F8XC 5CGYC 3I9GL 5I0WA 5GSRB 3BPLB 3MOQA 3D6GA 2A9NL 2JSFA 4KHXH 5L8JB 3BAIA 3UC0H 2F5AL 4Y1SA 1M53A 1TZIA 3QEGL 4LASL 4N8UA 3TZVD 5FDWB 2R0WH 1RZPA 2DS4A 3RL1B 3DUUA 1LP9B 1AKJB 3A6CH 4R0LC 5FO9A 4FXTA 4A7SA 1UM6H 3CFBB 5CD3B 1NWOA 3HMWH 2BHYA 3LY6A 3W39A 4MJHA 2G9HB 1P5UC 1EVUA 2MQ0A 1RK7A 4LLVB 1CICB 5D7LA 1KWKA 3LMJH 3FRPA 2X2JA 2PNDA 4HBCL 1KUMA 1HL9A 1F2XK 1TTAA 4PI0A 4WZ9A 1DL7H 4TQIA 4ORGA 1OE3A 1S3RA 1UVQB 3FF8A 2PTVA 4TNWF 5F7DA 2VE6A 3NCFB 4Z5RA 1ZT1A 4R8WL 4HP5A 5IQ7H 1P4UA 5IB5A 3LXAA 3UBHA 1ADQH 3G3LA 3Q6GH 1DVSA 1WIPA 1AP2B 4KJWC 1MVYA 3HC2A 2VIRA 2IDUA 4MQ7B 3T65B 4N5ED 1GAFL 3U4EB 2NY6D 4PY7B 3IFLL 3MVSA 1EEQA 1QNIA 5E8NA 1LE9A 1D7BA 3D4CA 3RUGA 1XGRA 2WNGA 3GDBA 4L3EA 5J56B 1LO0L 2HLAA 1H8OA 2F08A 4UILH 1UWYA 4X6DB 4WJ5B 4JZJC 1N2RA 3VYOA 3GBLA 2PMZA 4ZNEA 2EZ0C 4NQCE 3BZEB 4QTFA 4OKDA 2AJ3A 5C0CE 5I1EH 3KGSA 4TVPE 3T4AA 1FSKC 3MRLA 5E03A 5EBMB 2ZUWA 1ZE3C 2DM3A 2FYYB 1IFRA 1NCCH 4K4KA 5LKNA 4TVUA 1BF5A 2WZ0A 3WHE1 4WNQA 2AEIT 2GTWB 5ANMA 1DEDA 2QADB 3QI9D 5B1BB 5I71B 4B9KC 1LWHA 4WKXA 3CFJB 3BMVA 4U3SB 3U4BH 5E0QA 3RX7A 5TFSL 1PLAA 5EOCL 4KMQA 3HUJA 1KCSH 3IFNH 3SY0B 4OLVL 1G1YA 3TVMD 1OARL 2Z7ZA 3WIHH 2QSVA 3V0EA 3TLRA 5I66B 5DWPA 4NQEB 4NKMB 4G5ZL 1AGDA 5IUCA 1H3VA 1QHOA 3EHBB 4HT1L 5E51A 4N68A 4NAMA 1E28B 1MWAH 3FU6A 1BQHA 4Q6IB 1GC1C 3JV5A 1A4AA 5ELIA 3MXWH 3PHOB 1CXLA 2BFVL 3BUQA 4HJ1A 1U8KB 2HP4A 2HLFD 3K0WA 4QGYA 3P0GB 3OKOA 5ID0A 5F7YC 5I19L 1FAKT 1MAJA 4OD1H 2BY2A 4JJOA 2FEJA 5D7EA 3HS9A 5BZWA 3DRTA 1E5ZA 1EUUA 5SWZD 2D31A 1LLAA 4DERA 2RD0A 4XN9A 4Z7AA 2HZHA 1ZTXE 5HJ3A 4P2RE 2AJSH 4TQEH 2Q76A 3P9MA 3BSHA 3ABZA 5KZCD 2OZ4L 2CBQA 1BIIA 4ZAKC 1K4CA 4NN5B 5C97A 3BLPX 2MNUA 4AEHH 4V2BA 4WHYG 4CDGC 1S7QB 3DROA 5J13B 5ENWA 1V7NH 4HV8B 4UI2A 3FUMA 4OQTH 3WN5C 1WYJA 1WAAA 3SBWA 3S37X 4JO1L 4GS7B 1AIFA 3NOIA 3MTRA 4G59C 2WBJB 4JM0A 2WB7A 3PJSB 3ZOAA 5INDB 5BS0A 1VA9A 1KN4L 4XMKL 2AITA 4OT1L 4Y4KB 1UOLA 1AR1C 2YA2A 3OPZH 2QFPA 3ZZSA 1I75A 4M5ZL 1CQYA 4PS4H 1HILB 1YMME 4IRZA 3W5MA 2W65A 2NR6C 1NICA 4OFKA 1OV8A 1T7ZA 2OW6A 4EBQL 4UT9A 1YPZB 4M56A 3SDAD 1RUKH 1NWPA 4FNSA 4JFXA 2Y7QB 2ZJSL 2JI3A 3BGFC 3BAEH 1FLRH 2TSAA 3WHE0 3QNXA 4I7ZC 1C12A 5CU5A 4PRPB 5IBUB 5CEZH 2Y3AA 3QIUC 2J55A 4BZ1A 2K70A 1V54B 4KWUA 3SE3A 3F7LA 1J0IA 4PBXA 5A2BA 3QUMA 2ATPA 4AMKL 2WXJA 2XYCA 3CIQA 5K1NA 1NTDA 4PRIB 2WYHA 3W0WB 1A6ZB 3FT3A 4NO2A 4PIRF 1P53A 1RHHB 2NY1B 1QW8A 4JRWA 4FFWC 2DEWX 2K7PA 4HS3A 2JVUA 1GZHA 1UT1A 3VVWA 4KKCD 5K1VA 35C8H 3EDEA 1LNUA 2L0DA 3HC0B 1A1MB 3OHXA 2GT9B 3MLZH 5LN8A 4ONFH 3NJLA 1BOGA 3LNHA 5GZOA 2VDRB 4R7NB 2DBLL 2V8LA 2JJVA 5IOPB 3VXSE 4X50A 3FQ4A 2WQUA 2UWEF 2AC0A 1B9KA 2ADYA 1LK3L 1JPFA 3B7RL 4JHUA 1V27A 5ABDE 2RFXA 5DWUH 3RYMA 3PNWB 1B2WL 3ULUF 3EGDB 1M7DA 5H94B 5IF0A 1ECYA 5CINL 3TH3T 3KCPB 4HKXB 1H15B 4P2AA 2AZUA 3AM8C 1XF3A 3DGGA 4IIQA 4Y4HB 2AJZA 1D9KD 3VWJB 4JL1A 1IBFA 1UHVA 3VVVA 2COVD 1DBJL 2H2PC 1TYEB 1O7DC 3MLVH 4QOKA 4RGMC 4OAWA 5FCUH 1R3JB 5MI0C 1AS8A 3MBWA 2NXYC 3Q8FA 1MNUL 3UIYA 5I1KL 5EF3A 1AQKH 4ZOCA 3SOTA 3UPAA 4LO9A 1Z9NA 2VLJE 4N5UA 2IALA 4X0KA 4GQZA 1IM3B 3C8HA 4BQ9A 5D70H 4XNXH 5EO0B 1XV8A 2VH5H 2FNWA 1SMAA 2OR8A 4XCYA 3RZCA 3N06B 4OCRH 5D7IB 3KPRB 1AG0A 3KGTA 5SWQA 3BW9B 3AG2B 1LK2B 1RZKL 1RZQA 4I3RL 4ZI8A 4KKBC 1M1SA 1KIQA 4Y7MA 1U42A 5FA4A 1ZHNA 3S5YA 5I1AB 3D7PA 4MA7H 1DZBA 5CILL 3OV6A 4ZO9A 5AOZA 3M07A 3OJDB 2ZP0T 1JAEA 2Y07H 2BSTA 3KXFB 2C1OA 4P49A 3ZE2F 3HG2A 1MDTA 2CR0A 4TNWK 1QLRB 2PYEA 4P2YA 1A4BA 2EYRA 1DVTA 2X4RB 4YHZH 4MAZA 3HZYB 5ISZB 2OXGA 5KYYA 4S10A 1CU4H 4XGZB 3QNZA 4HHAB 2ZSWA 2WNXA 3IXAB 1KELL 2YXMA 4OJCA 3TWCH 1NAMH 3Q8CA 4XBMA 3D25B 1RFDH 2VDMH 1PZBA 3M8OL 4WV1B 2X4NB 5KSAA 3WBDA 2EKSA 2RJMA 3D3VA 4XMWA 3QO0A 4GP4B 4GXVL 4N0FA 3A4AA 4WKZA 5FO9B 2OSXA 5HXMA 2FJGB 1ILSA 2BCKA 4OM0H 3D12B 1VHPA 2DRUA 2KQMA 5C0EA 1G9NL 5FM8A 5ESQB 2F18A 3L3OC 4UAOC 2WVVB 2VZ3A 4IK7A 4XN4A 3EGSA 3IDYB 1QFHA 2NY3C 5IBLD 5BV7C 3QXTA 2VDPB 2OMXB 3FTWA 1ONQB 4Z7WF 5HDBB 2Y3NA 5H4ZA 1C08A 4FTVE 4FXKC 3NSXA 1O6SB 3IM1A 2FX8L 3PQYD 2VIRB 4AKQA 2C4FU 2V17L 3DVFA 3FB6B 3H9SB 3OM3B 4XWGL 4F3FA 3GXTA 4XVTH 3MNWB 3EXJA 3DHUA 5F0PB 2GC4C 5E56A 1T66C 3BKYL 1TPXB 4WW2C 4XPTL 1XGRB 3RFZC 3KPSA 1MCHA 3G6DL 3WNNA 4M8UA 4UT6L 5I5MA 1ZJAA 1E9OA 4BIKA 7CGTA 4PWFA 4F5CE 4PJFE 4BRJA 2BZDA 4Z7OF 1I1AD 4X7CC 1OEZW 5CCKL 3V6ZB 4P5KB 1XSOA 1MJUL 1NJ9B 4LL4A 4RETB 4IKIA 2WLZA 4JFEE 1BEYL 3T2PA 1ZT4B 4KJPC 3G6JF 2IQ9H 4NZJA 1RL1A 2IAMD 4Z8FH 3CU1A 2WLNA 4RBPH 3UX9B 1CDIA 1AYOA 5DHMC 1P4LA 3MROA 2NXZD 1F2QA 3PABA 3CXFA 4MDIA 3VU1A 1J10A 4HUUA 1W6LA 4ECNA 4J8QA 1BVOA 3K6SB 5KYUA 3FQNA 2OR9L 1EXUB 1R1CA 4QNPE 2VAJA 3FUNA 5HGAB 5KSUA 3REVB 2RAMA 4DO4A 1CPUA 4ODUB 1K5WA 2NXYB 2ZOLB 3APCA 4FXGA 1GS7A 2XXCB 1NL0H 1FC2D 3MCKB 2VL5B 4PJEF 4DCQA 5HHOE 2AGJL 5DEJA 5HPMB 2R7EB 2D0HA 3KPLA 4U1IA 1ORQB 4J12A 4RAHA 4GMTH 3EJSA 3V8CA 1BQHB 4M93B 5BW7C 3GO1H 5E2JA 1KDIA 5CF3A 3MUHL 1I1YB 5EUOB 1QWHA 4DEPC 2W94A 1YEJH 5CAYB 1AHWC 1J8SA 3DK2A 4DP0X 3UZEA 3S88H 5FUOL 5G4MA 4YMPA 3PWLB 2NNRA 4OZHB 3RGBA 1A7PH 3QJHB 4C56B 4K8RD 1KJVA 2B4CL 1CGXA 3WFHA 1L7IH 3BPNB 1U93A 3GC3A 4PMFA 5FGBC 3LEXB 5AB0A 1IGIL 3ARYA 3EUUA 3LD8C 4FQ2H 4MB3A 2HKFH 4LCIH 5FA3A 2FBRA 4RRPA 4YXHH 1F4YL 1GY2A 1XIWC 5TDOB 3ZKND 6PCYA 1RD6A 1ZT7B 1AO7A 1MG2C 4XPHL 4ZDHA 2ERJC 5C6TH 5M95B 1JHLL 3RU8H 2ICCA 3QIWD 3PPSA 3BT2L 2CM6A 3VXPA 5A7BA 1NC4B 4G43B 1MSPA 4MVBD 3S7GA 4XPGL 3QHTC 1JRHL 4NQSB 4LDEB 1CWVA 5HHQB 1J1XH 4HH9A 4YVNA 1H3PH 3FYIB 4NP4H 4I0PC 3GF8A 4AEIL 2ZNWA 1MCKA 1UOWA 1WA2X 1IBYA 2NQDA 4WAFA 1BSIA 2NYYD 3L3JB 3OPUA 5I6NA 1RZJC 1MJ8L 1E5AA 3FTYA 1F90L 1M2OA 4UIKL 1T89C 3AAZA 4G7QB 1ZPLA 1G84A 4JX0A 3B9KC 5K9QG 3P2TA 4X4XB 5AW5B 5I82A 2YPKA 3QRGL 4UQEA 1IAKB 1PKOA 5EUKA 1H19A 1MCEA 1S7UB 4M8QA 1KY7A 4X8JA 3F12A 3TA3D 4CSTA 3AU0A 3BKJH 3CZKA 3O6FD 1JZ8A 4YNYB 3BI9X 2HTLD 5F93C 2F19H 2BNQA 2W38A 1VDGA 2AMGA 4BZ2H 3OAWA 1IC4L 5LG6A 1FE8H 4TVPL 1TNNA 5KVEL 1T1YB 3N44B 4V2CB 3UIZA 3FT3B 2A83A 2V33A 3REWA 4ODVL 1ZGLA 2OMZA 5AFAA 5KG9B 3U1PA 1S7RB 1F3DH 2X6MA 2J12B 4ZMOA 1A66A 5CMAA 1XF2A 3CQQA 1TKWB 3NESA 4KJYB 2VLLA 4F7CB 3RIKA 4UB0H 4H4NA 4J4PA 5HYSB 5TF1H 4TUKL 3UZQA 2VYRE 2QBWA 3S8GB 4WI6A 3ZQXA 2Z8VC 4Z5RB 1L9SA 4O02L 4K71C 5EU3A 4K7PX 3WFZA 3KM1A 3MRFA 4TLKA 4NC1E 5A16B 4PJ8A 4JGNA 2YMOA 3U6RB 3HBPA 4KK9C 4TYUA 2BSCA 2FIKA 4MA8L 2A6DB 3BAKA 2R2EA 3FU0A 3U9UB 5EEUA 5D4HA 4N6RB 5IHZB 3VAEA 1PJWA 4QLRA 5IV2B 1Q9OA 3IWUA 4PJDB 1N6QL 4QRPB 4NWTH 1U3YA 1DBKL 2IH1A 2OMTB 5F9DC 1RPKA 1P9MC 5B39B 2AF2A 3B9VA 4QTHA 3VM5A 1VFUA 3PV6A 2WCPA 3IU3B 3BFWA 2YUZA 5E8PA 4JO2L 3ZTJH 4K94H 3ARXA 4ZT1A 1JYNA 2Y9RT 5BQ7A 2PABA 1NGXB 3BP6A 4X0KB 2YK1L 4DZ8B 5AVTB 5D4IA 3STZB 5DFVC 4MWFB 1P4IH 4ZNCD 1J8KA 2GAZB 4NHUB 3GMNA 4PJ9C 3VXNB 1MCRA 4YSCA 2UV3A 3VXTA 4BWUA 2WJ7A 1N64L 3RPIA 1VEMA 3E9UA 3FH8A 4FHBD 2IVFC 5MEND 1U8MA 3U83A 4LEOB 4F8NA 5EORH 4RLDA 4MAYB 3SBRA 3BUYA 3RBGA 2UXFA 3BWAA 4IMLB 1JDDA 1JZHA 1RIHH 1YYML 2HFGL 3SGDH 1F3RB 2ERJB 2P1YA 3CX5K 1OP5H 2Q8BL 2D7NA 2BSTB 4A6YA 5E95B 3FCTA 4H8QA 4JZOA 4I48B 1CS6A 2LVEA 4XO3A 1JXJA 2J73A 2VSMB 3NTCH 4DZBB 3QUKB 2NQCA 2HVBA 4XXWC 3IJYB 2ADJB 4D9LH 1HK6A 4YX2L 5EZLA 2Q6WB 4JHWH 5JA9A 3D2TA 1ZVNA 4OLXL 4B3VA 1T5WB 3I3EA 1M6UA 2DH3A 4P5MA 3UG5A 5JR1L 1TQSA 3RVTC 4R4BB 1ZLEA 2AQ2A 5HHMD 3V6FA 4UV7H 2XVKA 5FECA 3MLRH 3VGHA 5IY5B 4AYFB 4OLWL 3DX8A 3T3PB 43CAB 3P30L 1FGVL 1GA2A 1M42A 4UM9B 3US0A 3UGXA 2BS8A 1FAIL 1V7MH 2D7TL 2EO1A 3FQRB 4Y88A 4EUPA 2WXFA 3TN0A 2AHIA 3DSNB 3PDDA 4ZYKA 4XOAA 4JZNA 4EZMA 1S9WA 2HVKA 3HLAB 2F15A 4IRSD 1LP9F 1OP4A 3CC5B 1IC5L 1KTDA 4KY1L 5IB1B 1A7RL 1ZE3H 1QRNB 2HX7A 4OLZL 2AV7A 1NCUA 2FD6L 3EFOA 2DQDH 2VDRH 2DMKA 4B41A 2ADFH 2VLRA 1I8IB 1QACA 4MJ5B 4N20A 5CJOL 3KWUA 2WCSA 4PGDA 4GAGH 4MLSA 1T21A 1UJ3C 2VR5A 3B1UA 4YFLF 5GS0L 1S9XB 3ROOB 5DZJA 2UYLA 5T33L 1I1FA 3FO2B 4PJXA 1IU1A 3VU2A 1E9OB 3ULUC 3L3KB 5DVOA 4KK6C 4YDNA 4N2GA 2Y1VA 2AQPA 1YEWA 2BK8A 1HH9B 4UT7L 5J89A 1O7VA 2P44B 4KXDA 3CVHA 4Z7UE 4M03A 4NB7A 4QHMB 5DLML 3RDJA 1OCCB 3VXMA 4CMHB 2VTFA 1ED3B 1R19A 5DS2A 4E5XB 4X6DF 4PWEA 1PCSA 4JFWA 3JTSA 4NUJA 4MMXA 2QSCL 3SO5A 1G0XA 3OZKA 1FZKB 1ZXQA 2BHFA 5C7ZA 3GJFA 5EBGA 5HP5A 5BO1H 3SZ6A 3B43A 1F02I 2J1KA 4PIBA 2Y1YA 5F6HI 2RR3A 2B08A 2EDNA 1ZHKB 4LHUG 2GSGA 4MX7B 3BIKA 3S3JA 1KGUA 1MWOA 3FSOA 4BUHA 4PWKA 2YKLL 3ZDXB 1N4XH 3AGVA 5I17A 4XI5C 1A3RL 2VUKA 4JVUA 1ML0A 3V7MA 3DARA 3HW7A 2R39A 2EH8H 3ELAT 5DQDL 1JN6B 4NN6B 3SDDB 1BREA 5K59F 3RY5A 2BVPA 1ZVSB 1KXHA 3ILQC 5E99L 2CALA 4G7VL 2CIKB 2VDNB 3ASNB 5BVPL 1JOIA 1WZAA 4XMTA 2A73B 3CLFH 3EYFB 5E24E 1LXMA 2RCSH 2BW5A 5EU7E 6FABL 1NMCC 2L7EA 2ADIA 2P24B 3E6HA 5E6IB 4PJ5B 2XC8A 5AWNL 4OZFA 1MRDL 1LE5B 1BZ9A 4PR5A 2BNUB 3ZU8A 1OXYA 3QDJB 4QKTA 4WWKB 5KS9A 3QISA 1E6OH 5CBEA 5TQ0H 4OGZA 3FFCB 2Z4TA 2ZAIA 2K3HA 4XCEA 3T1FA 3ARFC 1NGYB 3GK8H 4AE1A 4B0MB 2XQBL 4TSAH 1VENA 2ADGA 3HR5A 1ZHLB 3S6CA 5C0RL 3QRFM 4FQHB 2G2PA 4BGDA 1FFOB 4I9XA 3SDXE 1A6UL 5KSBA 1BD2B 3HE7C 2VDKB 3VQ1C 1XF1A 5KJ4A 2VDPH 2NY2C 1FH5L 1OQOA 3AQYA 1HN1A 3IAPA 1AXIB 1NBZA 3AABA 3PQYE 4LRNH 1N10A 3D39E 3A0OA 4CU7A 1JF5A 5I6LA 4ZW6A 5T8IA 4AGOA 4C4UA 4YGVA 5GGSA 3QQ3A 4AZUA 5B8CB 1TJIL 4UYQA 2H0EA 4Z3FA 5D7JD 3UP6A 4AKPA 1A5FH 1OANA 2C3XA 2EE6A 2JB6A 4AM0Q 3VGAC 4NDMB 3TH4T 1FPTH 2VISA 1TFPA 5E6YA 3ARBD 4YHIB 3NAAL 4YPJA 3INUL 2VR6A 3HN3A 1QR1A 1RH8A 2IPUG 3VSQA 2Z91B 1MAMH 1I31A 4CU8A 1EJOL 3WTYA 1FG2A 3U7AA 5J1TC 5DD5H 3N04A 4JHVA 3MRBB 2YPKB 4IOFC 1FRGH 2HT4D 4H8UA 1KPVA 4EVNB 5LGHL 4EDXB 5DURB 2CBMA 3MFGB 3D85D 3U2IA 3K1DA 3EBAA 3BZ5A 4ACTA 4IRZL 1OAQH 1VGEL 3VM7A 4JDEB 3R8BB 2VOTA 5TK2A 1M9SA 3QCTH 4GEIA 5D2NB 5IQMA 1YPZF 4L8BA 2WWOA 2EEAA 3CXDL 4J3UA 2XETA 5H37H 5H37G 3TEUA 4LOVA 3L3HA 3GKWH 3T8MA 2GSIA 5E5MA 3W3BA 5HYIA 1ZDSA 4I4WB 5EMYA 4ONGL 3AXIA 4O00A 4FQIL 4DQAA 2ODHA 3S35X 2XWBB 3QUHA 4OCLC 4P3CL 1FF5A 3Q1EA 2JKWA 3RB5A 2VWEC 3F01A 1VGKB 1Z9OA 1CTNA 2ZYSA 3M17A 4I2XA 4WFED 5EU5A 3PWPA 1F58L 3MV8A 5FX3A 3TEZA 5EEYA 2BVQB 3DIFA 5DQ9A 3OMNB 5JHLA 1E5CA 4FNQA 5EFIA 1B0GB 2BOLA 1WSST 4I1RA 4HFWB 4QRQB 2P8LA 2P5WB 4XAWL 4KI5F 4PTTB 3MV7A 4BYHA 1D2PA 5E2TL 3WTTA 1JHKL 1GH7A 5IMLA 4C57C 1MRFH 3BE1H 1OY3B 3NCJH 1NDMB 3OG6B 4WI0B 1QMUA 4TN9A 1WT5C 1CGUA 4FJZA 4GB9A 4G8GA 4TOYL 3CSBA 5AB9A 5I8KL 4F27A 3HJ0A 3SQOL 5H35B 3C08H 3HZKA 3RPKA 1MXDA 4KUCF 4DH2A 4NC2B 2O6FA 1ZS2A 5A3ID 4AQ8A 2PO6C 1U3HD 1BAWA 4MNQB 4BKLB 4MZ3A 5CHNB 2G2RB 3OR6B 1MKFA 1XEUA 4UDTA 3PHSA 4ABQA 3VI3B 1DVFB 4K9EH 5J3HD 1Z66A 2D2OA 3IU4H 3O6LL 3BVDB 5E8PB 4G8IA 1FL6A 5F88B 3FHAA 2CDGB 2X1OA 3O9WA 1PCXA 4PJBA 3TJEH 4CVZA 1U8QA 1CD9B 5DUMH 4JM2B 4PJAB 4PJGA 4R4ND 5FW8A 4AVHA 4FQJL 4B9FA 2I27N 3EO0A 4PJCA 2AXGA 1M6OA 2V8MA 3PWNA 4JO3L 2XLLA 3TV3H 3KPOB 5JHDA 3LN4B 1J1PL 1DN0B 4WEBL 5GHWH 1J8HD 2PW1A 2XZZA 3NJMA 4YVUA 9PCYA 1OGAA 1T2QH 2F7PA 4I5BB 4POZC 4AQAA 1FYHB 3O6ML 1NCAH 3IMSA 3MMEA 1FNFA 1UG9A 3PY9A 1IBBA 1KB5L 2J1WA 4JREC 5D7IF 4N90E 5FM4A 3AREA 1G9MH 1ERNA 4JPQA 2WZPA 4PS8A 1A14L 3O8XA 4S1QL 2HFTA 2LTQC 2P5EB 3P69A 2QQNL 3G6AB 3O81A 1KY6A 4YO0B 2JJTA 5C08A 1KPRB 1IE5A 2Y6SD 3GZQA 3QR0A 1P5VA 5DD1L 1A3ZA 3BT0A 4R90H 3FU7B 3WNOA 3OXSA 2LLNA 1NGPH 3B3BA 3SD5A 4Z77A 4OZGA 3VCLA 3VUAA 1WC7B 3B56A 2IIJA 4HUCA 1UXSA 3FZUC 1BVZA 1DSFH 3ETBJ 1CLOH 4MHHG 2ZWLT 3UTTB 4HFUL 3ARSA 4X5WB 3OX8B 4Q9RH 5BZXA 3UJIL 1E6JL 2FLBT 1ILUA 1IGYA 3EOBA 4P9HL 4KTDH 4AC4A 1N12A 1QBBA 4J8RA 2H5UA 4LZKA 3DJZA 3MRPB 5LBSL 3S3PA 4FGMA 1ES0A 2H8PA 5DJXA 3WKPA 3PREA 2FGZA 4JRYA 4LLMB