5CFAA

Crystal structures of bbp from staphylococcus aureus with peptide ligand
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
326
structure length
326
Chain Sequence
b'NNVNDLITVTKQMITEGIKDDGVIQAHDGEHIIYTSDFKIDNAVKAGDTMTVKYDKHTIPSDITDDFTPVDITDPSGEVIAKGTFDLNTKTITYKFTDYVDRYENVNAKLELNSYIDKKEVPNETNLNLTFATADKETSKNVKVEYQKPIVKDESNIQSIFSHLDTTKHEVEQTIYVNPLKLNAKNTNVTIKSGGVADNGDYYTGDGSTIIDSNTEIKVYKVASGQQLPQSNKIYDYSQYEDVTNSVTINKNYGTNMANINFGDIDSAYIVKVVSKYTPGAEDDLAVQQGVRMTTTNKYNYSSYAGYTNTILSTTDSGGGDGTVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone sialoprotein-binding protein
publication title Crystal structures of Bbp from Staphylococcus aureus reveal the ligand binding mechanism with Fibrinogen alpha
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding/peptide
total genus 87
structure length 326
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5cfaA01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5cfaA02
4JDZB 4F24A 3V10A 4B60A 4F27A 5CFAA 2RALA 4LEEA 4LEBA 2Z1PA 3IS1X 5CF3A 2Y7NA 2Y7OA 1R17A 2Y7LA 1N67A 3ASWA 2Y7MA 1R19A 3IRPX 4Q6KA 2F6AA 3IS0X 4MBRA 4BBWA 3AU0A 4FJ6A 4RMBA 5IHWA 4JE0A 3AT0A 2VR3A 4F20A 4LE8A 4B5ZA 4MBOA 2F68X 3IRZA 2YLHA 4F1ZA 4JDZA
chains in the Genus database with same CATH superfamily
2IOMA 4JGJA 1A4KB 5L7XL 4L18A 4UDTB 1BQKA 2PXYD 3R18A 2A6KA 5E99L 2J8UE 4RGNB 1E50A 1ZS8B 1CK0H 2QSTA 4KVCL 5FA4A 4OGQC 1LGVA 2CAKA 2A9NH 2ADJB 1MEXH 2VTFA 3QZPA 2J7LA 2JIXD 3S5YA 4AXWB 3KPSD 5DO2D 4ZUVB 1IGJA 3BC9A 3S3SA 2LU5A 6FABL 1XSIA 1U3NA 1B4JL 1WG3A 4TSBH 4U1MB 2DKMA 4EAEA 4HUVB 4PP1D 3CPLA 3RTQA 4Y4HD 1OO2A 2VLKD 1BIIA 5JIQA 2RA1A 2D7TH 2E3VA 4E0RB 2IWKA 1AXSA 3LVEA 5EPMA 1SDYA 4Z3TA 3JV4A 3EHBB 4TUOA 2VDPB 4W9GC 5JW4R 2G3NA 2OPCA 3HZVA 3ZHLA 2APFA 2R4SH 5KSUA 1QKZH 1JE6A 2J8UF 5CIPA 1LK3L 4Z76A 2C26A 2PF6A 3HC4H 1MRCH 1TZIB 2FGWL 3RWFB 4XBPA 5C0FB 1P7HL 2V0AA 4MNQE 1RUML 2DWDB 1KIPA 3X3FL 1WHOA 3RZCD 1M05B 3QRGL 1CZ8H 3WEXA 3A4EA 1SJMA 1XCTB 3NN8A 2BVQA 4HZAA 4NFDA 4NP4H 4JDZA 3S3DB 2VKWA 1I3UA 2Y9RT 4ZX5A 3P3UA 2WXIA 1D2PA 2VXQA 3L9RB 3G5XB 4K55A 3WNPA 1TYRA 4XN2A 4XPTH 2L0DA 4PRBB 2BVOA 4XXWC 2FQFA 1SDDB 4QCIB 5I1DB 3SYPA 2FEEI 1UXWB 2AJVH 4WFEE 2GQHA 3FCBA 1G7LA 2A74A 1B88A 2I07A 5DHYA 3GLAA 5CILL 2ADFH 1DVSA 5LJYH 4OCRL 2BERA 4K71B 4UM8A 3GMMB 3V10A 3IWUA 5E5MB 4AMKH 2CO3A 1ZT1A 2XHNA 1VEOA 1V3JA 43CAA 4WJKB 4JHZA 3PPSA 4J23A 4WCYH 5JHAA 3ZT5A 1T5XB 2PXYC 1T1ZA 3V6FA 4IGBD 2WUBL 3QA3B 1LEIB 4Z3GA 3TH3T 3UAFA 4KZ0A 3D09A 4LCUA 3GSOA 1CDCA 4GIOA 1A7OH 2OQJB 1G7JA 4ONOA 5DO2C 4Y19D 1F11A 1SN2A 4P2QA 2B9BA 2H0JA 2ZUQB 4JM4L 5K93A 3EBAA 1U8HA 2DICA 4KC3B 3FULA 3N9GL 4X7SH 2YD6A 1DVXA 4GP4B 4JRXB 3ZN6A 5E24E 1PZ5A 3CX2A 3EF4A 4Y4HC 5EU3A 4GKNB 4U4IA 4M1GH 5GS0L 2XWBA 5I15H 1SF5A 4ELME 4NKIL 1BIHA 4FQHA 3RX5A 1NCAL 3Q1SL 1KSRA 1EQWA 4NZRL 1EHKB 4ZFOL 4PJCF 3D39A 2QVKA 3LKQB 2ZKWA 2XIBA 1OALA 2Y0SA 5IROD 2VMEA 3KM1A 3P4OA 4P4RB 3DIDA 3SJVA 3E3QC 4XB3A 5F0MB 1WK0A 3O8XD 3PABB 2N01B 4XXCC 1MUJB 4HIIA 1PF3A 3L5XH 3RZCC 1WICA 1QATA 4BA8A 4TNVK 2CPCA 4OCLC 1J5DA 1OD7A 1NUDA 4NKDB 5IVZA 1T22B 1K2DB 4HU2A 4W9CC 2BY1A 2QFPA 4HS3B 4NUPA 1KN2L 4H88H 3ILPB 3REVA 4ELMF 3VB8A 1QQDA 3WIHL 1NBVH 2HT3D 2VDNB 4MMXB 4NJ9H 5BZZA 5IQ9B 2AEIT 1IIKA 1OAYH 4GEJA 3MREA 4BZ1H 3MRCA 2DJ4A 4XWGH 5AVZB 3PP3K 1OW0C 4RBPK 1CTMA 2RTTA 1G9NH 3ZE1E 2OP4L 4CBPA 4BFIB 3TBWB 3B9KA 4JQVC 2V7HA 3U1SL 4PLJD 5CS7A 1L9TA 2VLRE 1VPOH 4J3OF 1V55B 1C16B 5IJVB 4KKBC 5E6IB 5CKAA 2IOIA 5E99H 3S9DB 2BVEA 4RGOH 3SHSA 4KPHL 3AG4B 3WUWB 4JM2D 4IGBC 3QXDB 2ITCA 2XRAH 1TU2B 2W60B 2XWRA 1K5NB 3QUXC 6FABH 4YHIB 2IAMA 1OHZA 4TOYL 3QZBA 2G30A 3ZE1F 4J4PA 1QYGL 4L4VD 5ACZB 4P23D 1S78D 5AL0A 1YNLL 4TVPD 2GJ6A 4AL8H 1JGDA 1NICA 2J2ZA 3QARA 4OJFL 4RX4A 3SYCA 1VCBC 4KKNA 5IB1A 5JHDB 1TUPA 3FB7A 2EVJA 2Y7SA 3DKHA 4HCIA 1DL7H 1ORSA 4MD4B 3HC0B 1G9NC 3O6KH 4Y9CA 2YD1A 3LRSA 3DVGA 3UBXB 3MV9E 1UKSA 4PJFA 4LK4A 2ZUWA 3HRZA 1TQCB 1MREH 3TBSA 2QVFB 4UBDD 3GKWH 3TA3A 1I8KB 1DBAL 3L3DA 4ZSOB 2NY2D 1XR8B 1U92B 1E5AA 1DQVA 3PF2A 4ESKA 5IROC 3U0TA 3D0VB 3QG6A 3QRGH 5ICUA 1OZTG 2Z8VC 3OKMB 4WUKL 2Q76A 1HTYA 5DJ6A 5CEYB 2YGNA 5HBBA 1NPUA 4NQCA 3WS6A 5DZAA 4KRNA 1URIA 1QA9B 2WLIA 2Y7QA 2VERA 2H7WA 3KCPA 1KN4H 1ACXA 3D85A 4JEGB 5AB1A 5T3ZE 3D7PA 4N2IA 3VXUE 2JKWA 4YL9A 3PL6A 3VG0L 4AL8C 5GS0D 3IMTA 4TVPH 3UXFA 2ICWA 2XNAB 3MLWH 1Z3GH 4HJ0D 3O6FB 2IH3B 4HV8A 2GTZA 4FFZL 4HLZH 3ZYIA 2AABH 5HHOE 1N2RA 2YMOA 4NFBA 5DS2A 1E4XI 5I1AA 3HS9A 4ZMAT 2WTPA 3ATAA 3L3KB 1VLXA 3KPLB 2BSED 3GSXA 1L0XA 4IRZL 1AGCB 2C4FT 1GYCA 5DZPA 2VSKB 5F89A 2W07B 4XOBA 2NZ9D 1K6QH 2GIXA 3N6YA 3SBWC 1HOCB 1RKRA 1E4XL 5E2UH 1YYLH 2NNFA 2NXZB 2X53A 1MDAA 2JF1A 4ZW7A 4LCWE 3JVGC 4R8WL 2CXKA 1CDYA 2VR9A 2OI9B 2OMNA 4O58H 3X13A 4L1BA 4F15C 2I9LA 3HG1A 3N9GH 3FT2A 1S78C 2YKLL 5AZEH 1KOAA 3H0TB 4GPVA 4H8WL 3BP6B 4LKXA 5B7FA 4PLNC 1YUHA 4GXUN 2AJUL 4X0KA 3RIKA 1EXUB 2AK4B 4UIMA 3O2WH 3QIWA 2CGRH 3WFHB 3GTTA 3EZ8A 5PAZA 3OKEB 4TUJB 5C6WH 2AJSL 3HNTL 3K1DA 4KQ3L 4LDCA 4LARL 3W37A 3DO7B 2GI7A 1OP3H 1FVEA 2D73A 4LPUA 4YLBA 3GZPA 2NW2A 2OMTA 4HYTB 3VYOA 2NY4B 2ZXBA 2W9DH 3D4YA 1A6WL 5FW8A 1W72B 5I73B 2X70B 3P3SA 3QEUA 4TV3A 4I0PD 1IVLA 3K8LA 4X8GA 1KACB 4W9FC 2GSGB 2W5PA 3KPOB 3TJEH 1OSZB 4JFEA 1OARH 4OCYH 1F0LA 4X8XA 2P5PA 4K7PX 3LEYL 3T8MA 3ULSA 3MLXL 4KDVA 1JWMA 2GVYA 3N44F 4W9JC 4C4UA 5TPWH 4P2QE 3WIHH 3U0PB 3HZMA 4MCNA 3QDGB 2Q7AA 1QEWB 3T2LA 1YN7A 1NPNA 2V2WB 4MNHA 4N2LA 3IFPA 5GS0C 1B3IA 1OWWA 3L9EA 1YY9D 5D1ZB 4PD4J 4ZTOL 4NZ8A 1BMWA 4HJ0C 4I5BB 5D7LD 5B39B 4ZAKD 2MCAA 4PV1C 4LOFA 4BSWA 5F88A 2BNQE 3LX9A 3INOA 4DZ8A 3PWPD 1AD9B 1ITBB 4J2QA 2B77A 2QQKL 1OF2B 4BUGA 4EOWL 4XNMB 3BWAA 1T2XA 3EOTH 4I0CC 1NOAA 3QDJA 2NZ9C 4M6NL 2CLVA 4GW5B 1CE1L 2WXRA 3AUWB 2YS4A 3VFWA 4OF3A 4KPHH 4OLYH 4WIQA 4O51A 1S4IA 3UTSB 4AG4L 1RERA 4NQEE 2MOQA 3SQBB 4RFOH 2KZ1B 2WVUA 4N2EA 3GHBL 2W91A 1J10A 4Y2OA 1OT4A 4GG8B 2JNZA 3O41B 4GQQA 4XMXA 2PKDA 3UOAB 4F9LC 4GAGH 1TZHB 2WZ5A 5JDSA 4Y1AB 4X83A 4L8BA 2HFFA 1U41A 3QO0A 3QZWA 5K9QI 4E36A 4HJEA 2GJZA 4PGDB 3ZO9A 2VLJB 5CJOH 2PCPB 2P8PA 4ICXA 1QSEB 2D03L 1FO0L 4CJ0A 4OJEH 1BFVH 4ZUSB 5IW1B 4PB0L 2YD4A 2XA3A 3SN6N 2K6WA 1F13A 1MG3C 3ETSA 4HLZG 4JZOA 3M45A 1O5PA 2Z7UA 3GO1L 2F54A 4PJDA 4OUUA 4OZFB 5FA3A 2X6AA 4TVUA 1V5JA 3T1WA 1N18A 1JAEA 4JGUA 3O3DB 1GH7A 2WLLB 5FWQA 2ESVA 4IEFA 4I0PC 5ETUA 1XF1A 3BE1L 1F4HA 1MFCL 2VITB 4PRIB 5AZ2L 5HD8D 1NEUA 1IKFL 1TTBA 3LKOA 4WHCA 4D8PB 4AGPA 1O7DE 3NDYE 1PY4A 5JO5B 1SMAA 2WW8A 4HHAB 2D8KA 5F7FA 1T5WB 2X12A 2BZCA 4U1SB 2Y36L 2Z4TA 3BKYL 3MUGB 1B90A 1WT5A 3GMPA 3GSWA 1YY9C 4YPJA 5L2JB 1HX0A 1HI6B 2JQMA 4IRZH 1XGYL 3VWKB 2E9JA 4IRSA 1U58A 2P28B 3F6LA 5D4JA 2ZUTA 3LKNB 5BRQA 5TFSH 3DUSA 4NENA 2ZUUA 1IQWL 1NJ9A 3U4KA 3V79C 1H15A 2NY3B 4L3ED 5C08D 4UZGA 4KXDA 3SDCB 3ZW3A 2X7LB 3RVWD 5M95B 3FH8A 5KBKA 4LHUD 5EHFA 3OLEA 3TPKA 5D7SL 3ASWA 4PREA 4CRPA 1ZV2A 3A4AA 3AXIA 1FG9C 3WNNA 4J12A 4ANVA 3MRRB 2L7UA 5IMLB 3C8HA 2YKLH 2LAGB 1S7UA 2R56H 3B5GA 4H8WH 2GTWA 3RBGA 1N6VA 2OMYA 3AUVA 1WZ1L 2AJUH 3U7YL 1KCRL 5EMYA 3HG3A 1J5HA 5LBSA 4F9PC 3KYMB 3CJJA 3JYCA 3KGUA 3MCKA 3CFBB 5I8CA 4IBVA 2NTFA 3MV8D 4LEEA 4KQ3H 1RMFH 2EYSB 1WLHA 3QHFL 2A6DA 2ZCKL 3FAWA 4F7CB 2JCCE 5B3NA 1U8NB 4O2FA 4Q14A 5IHZA 2F7PA 2BOCB 4JL2A 4B0MM 3RGHA 1NL0H 2GBUA 3PAZA 4NN6B 5DRZB 4ERSL 3VD9A 4GQ9H 4FTDA 2ZCLL 3FUHA 2F68X 4EDWL 1YHPA 4GB9A 1IFRA 4H2AA 1QBLH 2O6EA 3LEYH 3SPCA 1IQDB 3GJFH 2C1PB 5HD8C 1DSWA 1ZT7A 1BEXA 4X7TB 5ISZA 1JPST 1JNLL 1DYZA 3SE8L 5AEAA 4CKVX 1USQA 4NRXA 4N25A 1DZ0A 4H8WC 3QUYB 4L3FA 5FFGA 1BVLB 2ZXGA 4QOKE 1RHHA 5CBEB 4OZIB 2JCCF 4ZTOH 2OMWB 2WXQA 1T0NB 4LP8A 1JF5A 2UXGA 1EJ6A 3H6JA 4I48A 3SE4C 4KHTL 1YYML 5SWSD 2CRZA 4L3AA 1GJUA 4ODXA 3RVXD 2QQKH 5K33A 5CCHE 3HNSL 5F7NC 3JYBA 5F7EH 1NAMA 1TZAA 4C56D 3MC0A 4P5TB 2IDCA 1NUFA 3FFCA 3OXRA 1MLCA 2NUTB 1QWUA 4P3WA 2X40A 4XC3H 1FCGA 4G7SB 1DLHB 4AG4H 4HC1A 3RVWC 5TDNA 3BPLC 4L4TA 3BW9A 1KXQA 4HBQA 4Z6AT 4EI0A 4JHBA 1KPUB 4L8DA 2DEXX 1QO3B 4R5VA 5SWZA 4U6XA 2P80A 3TVMC 3ELQA 3S98A 2ALWA 2O6CA 3CSYA 4BH8A 3UPCA 4ONHA 4PPTA 1KIUB 1MY5A 4KO9A 5F3HB 5L8JB 3K7UA 1ZHLB 1ZLWH 1FO0H 4UQIM 3BAKA 5MERA 1DQQB 2AJ3A 2GFBA 1WHPA 3ECBB 4PB0H 5EO1A 1KPVA 1QW9A 1TCRA 3M86A 1NFDF 1HINL 3PJSA 2ZWKA 1RP8A 5KBLA 1A9BB 3C60C 1WAAF 2ZT9C 2CKBL 4UNVA 4PEEA 5LBVA 4N0UA 4PW4A 3AB0C 1OAXL 4BJLA 3JV6A 5IKCB 5EBWA 1HKLH 1CWVA 5E9DB 2F8XC 2ATKA 2CLZB 2BFVL 1MFCH 4GUPA 4M4RA 4W6WB 3QWRD 5AZ2H 3V0WL 2UZYA 5DSCA 3KAAA 1YRKA 1M6OB 4GRWE 3G5VB 1F58L 3IJ8A 4ZO8A 4XXWA 4GKSB 1P7QD 4UAOC 4YSSA 3BSZA 3UGUA 2B4CL 5D9SB 2EEBA 2VIRB 1TITA 2ZWLT 4WWNA 3VUAA 4QO1B 5KSAC 1QFUL 1NQBA 1LLAA 1EFXA 2G3XA 3GDBA 1XF5B 2RHEA 4RDQG 2AERT 4P4KA 3WFCL 3I75B 1TZGL 2EDOA 5L4JA 4LEXL 4G42A 4FKKA 3K3QA 1JFHA 3W5NA 2ENPA 1QR4A 3SGJA 2Y22A 1PW3A 4DP9X 4L0ZA 4WI9A 1RUAH 4BFOA 4Z18A 3WHXB 5L9DL 1MQ8A 1S7TA 4U7MA 2F54E 4WO4B 1FFOA 2YD2A 2VAAA 3DVFA 4GRWF 2VDKB 2V17H 3PWNA 3OAZH 1EJOH 1TT6A 2N0MA 2CG9X 3BZ4B 1K5WA 4OGYH 2JIXA 3FO9A 3WDIA 4N2MA 1J8SA 4XCNB 3NIGB 3ESNA 3QEHA 3A47A 5IW3A 1Z66A 1G0YR 1SJEB 1VFOA 1QD0A 4LHUG 4Y4HA 2VLKA 1NEPA 5IVXA 4B0MB 3FT3A 5LKNA 3CFTA 2NTSP 2H1PL 1G0DA 2WB7A 2YMXL 4EIUA 3BFOA 3TT3L 3VO0A 5EEWA 1YAZA 4FMKA 4DKTA 4WU7B 1WA1X 3LHAA 5KVDL 3C8KA 4M3KB 2I25N 4D0BA 5FA4B 1JXGA 2ORBL 3NIDB 2MPAH 2EVIA 2ZCKH 1USZA 2ISDA 1IGJB 3BPCA 3TO4C 5E1QA 4PJHA 3K2UL 5CEZL 4HJTA 3RZCA 3CPLB 3RTQB 2HRPL 3STLA 1AHWC 2LLNA 4N24A 1J0HA 3OAUH 1BIIB 5T3XD 3TPUA 2A9DA 3UJIH 5EPMB 1AXSB 3RWIA 4MA7H 5J8OA 3QJHA 4HCGA 3JV4B 4TUOB 3QG7L 3ISWA 5DUBA 4MQSB 4NNPH 5DT1L 5D7KD 5JOFA 3OKNA 1RIVH 4NIYE 3HZVB 5F1SA 3S36L 4ODSH 5KSUB 5CIPB 3KEHA 3OZLA 4Z76B 1WE5A 3F85A 1VERA 4LLVA 3VFNB 1JWUA 4R0LC 4JGMA 1CMOA 4W9DC 4EIBA 1OW0A 4XBPB 3BAJA 1RH8A 5A7BA 1QFOA 1T20A 4MB1A 1JTTA 1ET8A 1KIPB 2NR6D 4KTDH 4P04A 3WEXB 2JWYA 1FLTX 4JJHA 4U3CA 3NN8B 1TQSA 2BVQB 2WWKO 5MI0C 4JDZB 4UOQA 4Y5VB 4HPOL 3UBHA 1IBHA 5F70A 5EDXA 4KNSA 1L9NA 4ODUA 3INUL 5K69A 2YRLA 4QTIL 5F7LB 3A6CH 2BVOB 5B1CA 4WTZG 3CHPA 5K9QG 4IGBA 5LAXB 4MJID 5T3XH 4HPYH 3VD5A 1DFBL 4M8UA 3OWEA 1G7LB 4EIGB 2A74B 5F7UA 4HU8A 4Y19A 1TSRA 2I07B 1DUZA 5DHYB 2GTQA 2ICEA 1H0DA 4PWEA 2L7EA 2YO3A 4UM8B 4BZ1A 1CLOH 3O0RL 1F97A 2R4RL 5EUKA 1ZPUA 3ZPDA 3CCHA 1ZT1B 3ET9F 2WZPD 4XNDA 2YEQA 2E7BA 2JVUA 1ETZB 43CAB 3RWCA 2ZG3A 3NGBB 2VN6A 3RL2A 1BF2A 2AQ1A 2BWIA 1T1ZB 2WQUA 2X28A 3DDGA 3V6FB 4HMCA 4D9QD 2ZF8A 4M1CD 3AY2A 3KHQA 3VQ2C 1NKOA 5C9JA 2NY0B 4M03A 3ARDD 3L7EA 2HPTA 5IROA 2XWJA 4LCUB 1HINH 1VDGA 2WXOA 3ARUA 3GSOB 1MOEA 5G5DA 4H1LH 5JIHA 2NT1A 4N2GA 3SKMA 1G7JB 1AGBA 1F11B 4AITA 1I85C 3O8XA 3H85A 1FH5L 1U8HB 2NT0A 4BZ2L 4D0CA 2CUAA 1PZ5B 2QMKA 2DM2A 2YUWA 5DTFA 5EU3B 3MOAL 2BFVH 4G7VL 4AQAA 1MJ7H 2XWBB 4I0KA 1VACA 2AEQL 5DEFA 3CC5B 4GT7A 4L4TE 3WMQA 3ESUF 1F58H 4FQHB 3PCYA 5T1KA 3PP4H 1KYFA 4MX7A 4Z1PA 3BSHA 3D39B 1KV7A 3ZIMA 2DLFL 3P4OB 1EZVY 3I74A 1KYOK 3SJVB 4KZEL 5C3TA 4PJEE 1TZGH 4HIIB 1Q0YH 2C3XA 4DUXA 5HXMA 2KPWA 5CZVL 2WXLA 2F1BA 1CLYH 1EBAA 1TENA 3FTVA 1HL5A 4BKSC 3LPFA 4B27A 2BK8A 4WO0A 3K74B 5IVZB 1EMTL 3V9CA 2ZP9A 5CEZD 4WUUB 5DJDA 3SBWA 3QDAA 1HZHL 3REVB 4ZTPL 1GZHC 1QQDB 1HEHC 4KK5C 4JM2A 4S2SA 3MREB 3T1FA 3MRCB 5I19L 1WH0A 5H8DA 1AJ7H 1D7CA 5CLTA 5AVUB 3RGVD 4NRZA 1P2CA 3VRJA 4JDEA 4L4VA 3B9KB 4P23A 4PJEF 2V7HB 1VZIA 1MRDL 2V3DA 5DMIH 5AVTB 4TQHA 2DQDH 5CLYA 4XP5H 1JCKA 4UF7C 3HC2A 2H1PH 5DR5L 4QJ4B 1BZOA 3IKKA 3CBJB 3V5HA 3N40P 1TQUA 3LZRA 4KHXH 2DQHL 3IBEA 5I0YA 2J5LC 4ZT1A 4DVRL 4XP1H 2ZE0A 2ITCB 4M1CC 2ORBH 1EAJA 1IL1B 5E6RB 4J2XA 4F1ZA 1NKGA 2IAMB 3KGSA 3K2UH 1M1XA 1NA8A 4MGXA 3IMUA 4JY4A 3S3JA 3UIZA 5CEZH 4K94H 2Y6SD 5F7KC 3SPJA 3T6WA 2X3BA 1OPOA 4YHPA 1TNMA 2GJ6B 1FNEA 1UQSA 1MCOH 1JGDB 1QSFD 2J2ZB 2ZJSL 3EOBA 4XCFL 1TJIL 3QI9D 4LP5A 3FB7B 5KS9A 1ORSB 1B6DA 3SDDD 3CU1A 4AK1A 5DT1H 3LRSB 3DVGB 3FONA 3U4BH 4PJFB 5E8DL 5GRJL 2AQTA 4JLRA 3HRZB 4JO4L 4N9OB 1JGEB 3TBSB 1RUKL 4J3WA 4X9IA 3TA3B 5AB9A 5EZPA 5FKAA 3L3DB 1B4LA 4ZUTA 2FIKA 3RLSA 1BFSA 1KPRA 3U0TB 3HE7C 1QHOA 4WEEA 1PKOA 1R33A 2AZAA 4YSPA 4ZFOA 1NCNA 3Q2LA 2Q76B 4OFPA 3U30B 4ZD3L 1SBSH 5DJ6B 1Q8MA 1Q0XL 5AD0B 2VDQH 4WKXA 1KCVL 12E8H 2BSEA 4NQCB 5F7HA 2IFGA 2ZWZA 4KTEL 3W39A 1NAKL 3RJQB 3MNWA 1NIDA 2WLIB 1YEHL 2Y7QB 5JOPD 3OJ2C 4LSSL 4K94C 3KCPB 4QTIH 5DMYA 1IIIA 2V5RA 3CVDA 1JFQH 3CZJA 5CLXA 5DD5L 4H1LG 2DL9A 2LVEA 3DUHA 3PL6B 1GSKA 1XHHA 2JB5H 4DKAA 3T3MB 1I8LC 1YMMD 3ZRFC 5JW3L 3OAZK 2CUHA 3DI2B 1HCVA 3HMXL 4P2RE 4HV8B 2FBRA 4FQ2H 2GTZB 4OGXH 3ARBD 3MRMA 2OYPA 3S96A 1SFDA 1VHPA 1NMBH 2ZKMX 4IOIA 3WIHA 5I1AB 3ZYJA 3RGVC 1IGTA 3BP7A 3GSXB 2R4RH 3WY3A 3SQOH 3MLRL 5I9QC 4YXKL 3NAAL 4U1GC 5F89B 4NC1C 4RMRA 1MCLA 1CFSA 1MXDA 2PTTA 2RCSL 4LIQL 4V1DE 2DM4A 1E4HA 2E46A 4GSQA 2FYYA 1SMDA 4CGTA 2CPUA 5T1LD 3RY6A 5ADOH 3CTTA 5FWRA 2XU9A 3UAEA 5F21B 3ZTEA 4P49A 1EEYA 2OBGA 3MUJA 3CLFH 5BV7H 1RPUA 3X13B 2MNJB 2P48B 1Z9OA 5L8KB 3HG1B 3D50A 2P7TA 3WG7B 4BZ2H 4H8VA 4ZMZA 5EZLA 4CC4A 4LKXB 1JG9A 3CFUA 4Z7UE 1SEBB 1ET5A 2GT9B 1BHGA 1YUHB 2OFQA 2EADA 3QI9C 4X0KB 5I8KL 2AEQH 3NK3A 4UIMB 1BVNT 2PPAA 3QIWB 4PRPE 1Q9KA 2WQSA 5IFAL 1UZ8A 1JK8A 1A21A 3X11A 1MZYA 1II4E 2OCFD 2A77L 4FQCH 4NM8L 3VGDA 2R23B 3WUZA 3TOPA 1NSNH 1FVEB 1YEKH 1EDYA 2NW2B 2OMTB 4ZQKA 1X5KA 3OAYH 3HC3H 4UB0H 3BWUF 3V6OC 3VX0A 2YUZA 3AZUA 3QEUB 2H3XC 3NZSA 4ZAKA 2EP6A 4KFMA 4M62L 4DP1X 4JFEB 3T6QC 3PWPA 4Z7UF 4PTTA 1I1YA 3QR1A 4GIPD 3UEQA 3BFWA 3LPOA 4UNTA 3UC0H 5BV7C 3ULSB 1N4XL 2L7JA 5IQOA 1HZHH 1DQDL 2EUWA 1JWMB 4NAJA 4JDTL 2LU4A 3J07A 4P3DA 3GMNA 4JR9H 3H3KA 1HT6A 3HZMB 2DI8A 1YN7B 1H3WM 4MNHB 4DVBA 3IFPB 5I19H 3JXAA 4N86A 2V8MA 4BRVA 1CBVL 1CC3A 4I77H 3ARBC 3ZDYB 2DM3A 4J39A 1OM3H 4L48A 4BSWB 5F88B 4GYBA 1DBJH 4DZ8B 3U82B 1T1YA 3FO0L 3U1QA 4FFZA 3MUY1 3BWAB 3MI6A 2UVEA 3QDJB 2CIIA 4ZFGH 3WN6A 1RAMA 2XY1A 2WV3A 3VFWB 4IRZA 4YXLH 2W9EL 4O51B 2DQHH 3NP4A 4PV8A 5DWPA 2AXGA 4GH7B 5HDWA 2F8IA 3PGDA 4Y2OB 2XG5A 5C0BD 2DN7A 3CZSA 5I1IH 4C4BA 1AKPA 5C92A 2X4TA 3P0GB 1UATA 1UACH 1Y7VA 2ZJSH 3A23A 2HFFB 4L8BB 4RWHA 3QO0B 3QZWB 1HVXA 2GJZB 3FRPG 5EWIL 2P8PB 5KTEH 4BSVA 4FTVB 2OXHA 3KE0A 5GRJH 3BUTA 1Z9LA 3PREA 1GY1A 3R1GL 4JO4H 1RUKH 4R7DA 1PJ9A 3SKNA 4M00A 4E9LA 4JZOB 3MJWA 4H0HB 3CZEA 2F54B 3OJDA 4OUUB 4PJDB 5T5NF 2IH1B 3NIFE 5FA3B 1G9MH 2XWZA 4HS8L 4F8QA 3CXHJ 4PLOB 4HEME 4OCWL 3UGXA 4RMQA 4G5ZL 2ESVB 4IEFB 4JX0A 5ETUB 2H45A 4Z78A 5I74C 3P77A 5JXEC 3T0XA 5JW4N 4M5ZL 3LKOB 3W81A 4PJGE 5F7BA 3PXHA 5C08A 3O6MH 3LZFL 4LZKA 2NX5E 4LHUA 1DANT 2EDHA 4GFTB 5J11B 2OLDA 3QCTH 3GJFA 3HMXH 1JN6A 1E40A 2QFRA 3NIFF 4NM4H 5D2LA 3RPIA 4GXVL 3GMPB 3GSWB 3F5WA 3RX8A 2IEPA 2X88A 4A04A 4GRLD 2XV2A 3QT2A 2F5AH 3G9AB 3U6XS 1AR1C 5E7BA 4IRSB 4UT9L 1U58B 2M83A 2JMRA 3R06A 4HFWB 5MEPA 1O5DT 2AS5M 1L6XA 3DUSB 1G9MC 2I7OA 2VO5A 1NJ9B 4WSGA 2RCSH 4LIQH 2XTSA 2DWEB 5HYQA 2VQ1A 2K8MA 2W92A 4FQ1L 4PJGF 2M2DA 4J3VA 5J6SA 5I1EL 2R0KH 3MV8A 3SCMD 1TDQA 3HB3D 4U6VH 4WHDA 3TCLA 4PYHA 1KTKE 3T2NL 2VDLH 1SOKA 4F80A 3C2AH 1BX2A 5I76A 1URLA 5FUCC 2LE9A 4FQJH 3T2OA 1E3XA 2DMBA 3N0AA 3MNDA 3H1ZA 1Q4NX 1S7UB 2VM3A 3MACH 5G55A 2GTWB 3UYRL 4PWIA 5CSGA 1E3FA 2OMYB 3M7FB 1A7RL 3N1GC 5I8KH 1DJYA 3GI8L 2D7PA 3MFFB 3S3BB 4HPHA 5J6HA 1L0YA 1TTFA 4AYMC 4YHML 4IMKA 2WTOA 4XNXL 1AO7E 4YVUA 1EA9C 3MCKB 1RPKA 3VNZA 5I8CB 2NTFB 3P2TA 1MFDL 3QJUB 1G6RL 3S88L 1SGKA 1RJCA 1QPPA 3RIFK 1E6OL 2O30A 4OQTL 2A6DB 1G4RA 3GRBA 4KUCF 4ZX3A 4O2FB 1FO0A 5IHZB 2VERN 3QW9A 5JA9A 1QSZA 2HJKB 2ZCHL 2D7NA 2QADB 1YEEL 2XSKA 5SWSA 4HIPA 4G80A 2VDRL 2UZIL 4WHTA 3WCYA 2CU9A 3K5SA 1LE5A 3OV6A 3KJ4C 4G11A 1ZT7B 3DGGB 2EDMA 5ISZB 5D7IA 4JDTH 4KXZI 2P8MA 1CFMA 2FVNA 1IZKA 2VLMD 4WSJA 1NDGA 2Y7OA 4NRXB 4DP6X 5J0BA 2AV1B 2QTVA 2PWGA 1U8LA 2ZAGA 5E2VH 1S46A 3WHE1 4JN2A 4X6FA 2NXYC 5EBMA 5EO0B 1RHHB 1UCBH 5LXGL 1JPGB 4KXBA 4FG0A 3GSUA 4UDUA 3FSVA 4I48B 4BFNA 5GHWL 1IBYA 1JPSL 2EINB 4ODXB 1NCDL 1X9RA 2ZWSA 4Q9RL 3F7YA 3FUEA 4A6YL 3DJRA 1TO5A 1NAMB 3FFCB 3OXRB 2ZF9A 2AZUA 1IBBA 1FVCA 5ELIA 3BUDA 1TTGA 4GI6A 2VXVH 5TDNB 3SCMC 2EC9U 5I75C 3BW9B 1AG6A 3LV3A 2F6AA 3D07A 1P84J 4WSKA 4L8DB 1G84A 4ZMXA 2JKRM 3FYIB 2ZXQA 1RY7B 1AHWA 3HI6L 5JIIA 5SWZB 4U6XB 1J5CA 2XVBA 1XXFC 2EUXA 2FJFA 4O2EA 1C5BH 2IANE 4XH2A 2FUTA 5D5MA 3CSYB 4BH8B 2CSPA 5BRPA 4ONHB 2NNXA 3JZ7A 4FEMA 3QWRA 4QR7A 2VLLA 4FNRA 1GGIL 1P7QA 5MERB 3AW5A 3QPQD 1JMZA 2GFBB 4R0LA 4DTGL 5EO1B 1QNZL 1KPVB 1R0AH 4NDMA 1TCRB 1ED3A 2XBDA 2XYCA 3WTXA 3LCYA 1UT9A 1UZ6E 4NWUL 3PJSB 1FN4A 4TSCL 3CZUB 3UTZA 4N68A 3FFOA 4HS8H 2BX5A 3GT6A 2MH4A 4N0UB 1NCHA 3UMNA 2Z0BA 4G9FE 4HMEA 4EI5D 4NQVA 3SBRA 2PPFA 1J0JA 5EBWB 3X1NA 3UO1H 3UJTH 2ATKB 2XWCA 4RA0C 3EYOB 4JFFD 4M4RB 4AH2A 3BUYA 1GYAA 2UZYB 5DSCB 1L0PA 1OKEA 4M5ZH 1JIBA 4FFVD 5B1AB 5HGBB 1I8AA 1XF4A 2H5UA 2V9TA 5LN4A 3BLPX 3A4DA 4TYUA 4LSRL 4S0HA 3ZE2B 3LZQA 5I1CH 1UZ6F 2E75C 1UHVA 1EFXB 2E8ZA 3DOSA 4P4KB 1KCUH 1W8NA 2XJKA 4GXVH 5F71A 3VXOA 1OT1A 4G42B 5A6IA 3BVDB 4ABVA 1RZGA 1ETJA 2BIPA 1MI5D 4A2EA 1RURL 2A1WL 3FH7A 3LZLA 3KWWA 4UT9H 1S7TB 2GIMA 1XSOA 4DERA 4KRMB 1FFOB 2PXYB 4Z7VA 1MNNA 1F8TL 1DDTA 3KPQA 5IFHL 1CGWA 4IHOA 3QH3A 3PWNB 5I1EH 1URZA 3VSQA 1EIBA 3HRPA 2JIXB 2P24A 4V2BA 4PJBA 4K9JA 1FZOA 4X2UA 3GWJA 5I0WA 1I85A 2Y2YA 1F41A 3WEMA 5JTWA 1CE6A 2J1WA 3QEHB 3BVNA 4KXCA 3HHMA 2HKHH 5CD3B 4Y4HB 2VLKB 3AMLA 5IVXB 1EXGA 2HX8A 2YPVL 3FT3B 4GXFA 4NBYB 5BCAA 5IHHA 1G94A 3B7RL 1F4AA 3TJHD 3MLVH 5D72L 4TNGA 3GI8H 4JG1L 1IKOP 3DVIA 2UWEA 4PCTA 3C8KB 3VDBA 4D0BB 1FGNH 1JZGA 3IFOA 3S88H 3QPQC 1QRND 1R3IL 1WFIA 3UPAA 2V5SA 2VOTA 1XCWA 3BPCB 2FE0A 1XGPA 4PJHB 1W9XA 2IQ9H 2CXGA 1F4XL 1O6SB 3JQOB 3RZCB 4JFDD 2NR6A 5H35B 4WFFD 1Z2KA 4YFLF 1KTCA 2E9IA 2ZUYA 2V37A 4EI5C 3TPUB 3ARQA 3K4AA 2OKMA 3RAJL 2XOTA 2C9VA 3QJHB 2CKBA 2VN5A 5DUBB 3HR6A 3C9NA 4JW3A 3OKNB 5JOFB 1WFTA 4X98A 4HUXA 4NX0A 2TAAA 1JHKH 4A7TA 1Q0EA 1RZKH 5F96H 2CIKA 4FFVC 4A7SA 5C2BH 3TFKC 3B3BA 4LLVB 1MFAH 1JWUB 4HAGA 4JQXC 3SDAD 2WZAA 3VTTA 4AEHL 1U8KA 2XQ0A 3FUDA 4HHGA 1T20B 3F2LA 1M7IA 4MJIA 4XX1E 3QHZH 4AW4A 2XFXB 3BAEH 3MRGA 3TWCH 5LXGH 1CGSH 4QXGH 5DFWH 5DUML 4KXZH 3K1KC 4PG2C 5HPMA 4O4YH 4G1EA 1NANI 3MZGB 3VRLE 3W2DL 4OCXH 2WLMA 4U3HA 4ODUB 3OXSA 5ENWA 1JDDA 5D1QD 4OUOA 3VRIB 1IC4L 4IGBB 1OIOA 2GC7C 2OW7A 3ARDA 4OIFA 1CLVA 1ODUA 3FRUB 4GQPH 2CCVA 1QLEL 4PJAA 3S4SA 4BCZA 4UTBL 4R4BA 1Q9OB 1BGXH 4GSXA 4BSJA 3I6LD 2V5TA 4Y19B 1L7TL 1QSVA 4U1KA 2WUCH 1RZKC 3HI6H 5DFVC 3WU1A 1H0DB 2VDMB 3LRKA 4YUEH 5EUKB 1XGQB 2X6UA 4YFEA 5KVFL 3RIAK 3CCHB 3SKOA 2F7RA 3U0WH 4ZDHA 4JL1A 5JHBA 3QUHA 4WWKC 3RB7A 3TJHC 3RL2B 1J86A 1GGIH 1U0QA 4X9YA 3UFIA 4ZX4A 1U4EA 2L3BA 4WGKA 1TF4A 4WI5A 4KBPA 5DZJA 5DMGD 3VFMA 5C9JB 1QNZH 2GEEA 4FQLL 4IW4C 3ZGHA 3L7EB 4HWNA 2XWJB 3SBPA 2G75A 5G5DB 3EFFA 1XCXA 4TSCH 3SKMB 3VFTA 1QFPA 1AGBB 1HILA 1AD0A 2DF3A 4LDEB 4AGOA 4DKFL 1UGNA 3O8XB 3AWEA 1AQDA 2DYSB 2EEFA 4WFHE 5KJRL 2E27L 4LPWA 4D0CB 2WLZA 3BEWA 4JFXA 5DTFB 4H8HA 5HDQL 4AQAB 5DQDL 3UAJD 2WXFA 1GCYA 2H9GA 3LIZL 1VACB 2YKKA 5DEFB 1OPGL 1TKWA 1MCHA 3H9ZA 2WYZA 3OTTA 4LDLB 5DRXA 4B9CA 1WD8A 3M07A 3O4OB 3CZGA 3CX5J 1BWMA 2JJSC 1EGJL 3RNQA 3RDTC 1CFQA 3D2UA 2MPVA 1BZ9A 1M3IA 3RGVA 2N3JA 3LXCA 5H37H 2AQRA 5EOQH 1CFTA 1NFKA 1BZ7A 4BCYA 2KLRA 3FN0L 3ARFA 4G6KL 1RURH 5DJAA 5H4YA 2Z31D 4HKZA 5DJDB 4M6ML 2WO4A 3RU8L 1WZKA 3S7GA 4EN3D 1D6EA 1OEZW 1TLKA 4ZQTA 2DQUL 2JLPA 2OTWA 3TTSA 2A9CA 2L8AA 4X9BA 5IFHH 1RZFL 4QXTA 1S7VA 5FGCB 1GL4B 1IBGH 1QFWI 2HVBA 4JM2B 4PCKA 2H0PA 3L1EA 3T1FB 5AVRB 2KYIA 1DEDA 2P47B 4TQEH 3O11A 2P43B 3UYOD 4J6RH 4L1SA 4LFHD 4WHYH 1QRKA 3P1VA 4NRZB 1D5IL 1P2CB 3VRJB 1G7QA 3QCUL 4L4VB 4P23B 5FYLD 1CGVA 1PBYA 3FDWA 3D3VD 1QSFA 3OSVA 1A6VL 1ACYL 5CLWA 3QI9A 1YMHA 2MOGA 3SDDA 1IJNA 3SGKC 3F05A 4QHKJ 4OZGB 3V5HB 4YDIL 4MVBD 9CGTA 2VT0A 2D0HA 4NKOA 3KVQA 2NY2B 1R3IH 4FCAA 5D6DA 4KJPC 4R2GD 3PDOB 3V6OA 1M1XB 2F19L 4JY4B 4UMGA 3GXUB 3F01A 3RWEB 2V7NA 2ZPKL 4XP4L 5AW9B 3S37L 4YHPB 4AVKA 4RAVB 2ZOUA 1FNEB 1UQSB 3EOBB 2Y2WA 3HI5H 2VNCA 4XMWA 5KS9B 1I75A 2Z93A 3CZLA 3RNKA 1KB5H 1NBYA 2KHAA 3FONB 5HI3C 1A14H 4JLRB 4BZ2A 2BWDA 3F7QA 3BUPA 2B1HL 1EVTC 5FKAB 3BPNC 3LEVL 4LE8A 1X6LA 2Z8WC 4N8VG 4ZUTB 5HYSA 1PZ2A 5DWUH 2FIKB 5FYLH 2H4EA 3WKMH 2F8VA 1KPRB 3CVHL 3HG0A 1MAJA 4MMYA 1ZLSL 3ARBA 3IJYB 4N8UA 4ZFOB 4DN3H 5F3BA 3PNWA 2OV0A 4QPEA 2UWEE 3PHQA 4C54A 5IESH 1G9HA 3NJXA 2NYZA 2NZ1A 4HIXH 3MNWB 2FWLB 3ATFA 2Z31C 15C8L 3P4NA 2AKRA 2WQVA 4OZ4A 5C0RL 4EN3C 5T1LA 3JTTA 4LCIL 1SDAB 2BS8A 4WW2F 3T0EE 4ADIA 5GS2H 3MLYL 1ZVYA 4PJ9D 4JE4B 4LCYA 4B7LA 4FYTA 4ZJ9A 4EZLA 4UTBH 2OMZA 2EIZA 3MRMB 3O4LE 4H26A 3S96B 2X09A 4IOIB 4LRIA 2E4TA 3FXIC 2VWEC 2I24N 1MY7A 3QEQD 3BP7B 2BSBA 4PJ8D 4JMXA 1G7IA 1JNJA 2UWEF 1H3VA 2WXHA 1A7PH 5JW4Q 3LKRA 2ILLA 1CIDA 2BRQA 4JK0D 3D8MA 4L2LA 2J12B 1CFSB 3GMLA 1UT2A 4H8UA 4TM9A 2D0GA 3Q9QA 2FYYB 3ZDZF 4F8TA 3SDXE 2I5YL 5G4OA 3T5WA 2JE8A 1J1XL 2Z91B 3L45A 3OPZH 4MVBC 1BQLH 5IMMA 5I5MA 3L3GA 1CLZH 3GFUA 5H37G 1EEYB 2OAAA 3V4VL 4R2GC 5ADPH 1OE1A 1EO8H 3C6SA 3BZEA 4LU5H 5JHLH 5EZLB 1DQKA 4PJ5D 4KTYA 5EU6E 4A38A 3TO2A 3VXSE 2HWZL 1WP6A 4XVSH 2X9WA 1WBXA 5CSZA 1OPGH 4JKKA 1Q9KB 2EEXA 4PJAE 1UZ8B 5BZDA 1JK8B 3K80A 3X11B 4N0FA 1LM8V 1VSCA 2QV2A 1MFEH 2EVGA 3ZZ1A 1E27A 1TQWA 3SDXF 1EGJH 4JPKH 4WHYG 3SOBH 1WD9A 3W0WA 1W15A 3MYZA 5ALCH 4ZQKB 4YHLH 4XN5A 1ZK5A 9PCYA 1M2VB 2Y5EA 3E8VA 2AQSA 1GAFL 4XNZC 4ZAKB 2BSTA 4OBRA 5JIPA 1DBBL 1OL0A 5FUZH 2Q7YA 3PWPB 1G1KA 3T0VA 4PTTB 1I1YB 4OT1H 2FUQA 4M6MH 5TQ0L 3WL9A 4ZXBA 4R5TA 5DZ9A 5GIRA 5KVGH 3RU8H 3TT1H 5DJYA 2DQUH 4PJAF 4P3DB 3GMNB 2WTRA 1LO4H 3GBLA 2YSSB 1WTGT 2DJMA 3AG2B 4NN5B 4OJDH 3UH8A 4DVBB 3DIFA 2LV4A 1DJZA 1T0OA 1J7VR 5BOPA 4PJ9C 4A2DA 3L9YA 1SPDA 5ALBL 1D5IH 5AW2B 2Q3XA 3BESR 3W57A 2AQ2A 2CM6A 5SWQA 1QFWH 3HMXA 1T83C 4N9GA 1A3RL 1HH6A 3DDFA 4PJ8C 3GM8A 1FPTH 5EZIL 1QPKA 4Y7OC 3RQ3A 2CIIB 2R0LH 1V27A 4MZ2A 3K6OA 2G60L 4Y1SA 3RI5K 4AQ8A 2JB6B 4PV8B 1SM3L 5D4HA 4BUHA 2AXGB 2WOBA 3PGDB 5AB0A 1L7IL 3GSNL 2LOEA 2XG5B 1BBDL 2J20A 4A7UA 4RRPA 3BAIA 2WO3B 3BMWA 1OP9A 2GJRA 2X4TB 2ZPKH 4F5CE 1CGUA 3GXNA 3VXMD 4Z7OE 1A25A 1GPOH 1HL8A 1JSYA 2F0CA 4Q97A 4FNTA 1GJWA 5CZXD 1MW3A 4J3BA 4BSVB 2OXHB 4W9ZA 1DVFC 3T0DA 3SKNB 4R7DB 2B1HH 3T3MF 5AW1B 4R84A 1TQTA 2DIAA 2Y3AA 5FHBL 3KLKA 4H8QA 1UOKA 2Q10A 4P99A 1ICTA 2RFXA 3KJ6L 1ZLSH 3UTTD 2WKOF 4GRLA 3KNBA 2C3VB 3OVUB 4TLKA 4XMPL 1A5FL 1JZIA 3P77B 3ROOB 1MW1A 4S1QH 2UY7A 1ZIBA 15C8H 1BAFH 4OD2A 3R4DA 4ZPVA 4L3EB 3SEPA 5C08B 3GIVA 1RIUH 4R5XA 5C0RH 2WBJD 1KC5H 3OKOA 4GG6E 3C12A 4LHUB 3OF6D 4CSZA 4UT6H 3GJFB 5MENE 1JN6B 1JD7A 3OMAB 5D2LB 3RPIB 1U2HA 4DPCX 3F5WB 4RISL 5AW3B 5GZND 3N0PB 2OSLA 3AGVA 1X5ZA 4A2MA 3ASNB 3LZNA 1QHQA 2UV3A 5C3IA 2BY3A 2E56A 1XSKA 4U0QB 3MLZL 3EFDH 4ACTA 2KH2B 3R06B 5MEPB 4CAGA 2AEPL 2BSSB 2H32H 3ARED 1BQHA 2ZZUT 3KHOA 3LH2L 5BW7C 4DGVL 5JUEL 3B1TA 4JPQA 1E4WL 5HYQB 2VQ1B 1VGEH 1MELA 3AJ7A 4AKOA 1UOWA 3SY0A 1KXVA 2I5YH 3MV8B 3TCLB 2XWEA 4PVBA 1VENA 4GG6F 3Q8FA 1X5FA 4HEPA 2EDTA 2P44B 3FTXA 3AB0B 1AQMA 1BX2B 1TPXB 1X5IA 4NIKB 3GUTA 1CURA 4XP9L 4QRTB 2VW7A 4YNYA 1PZDA 3OSKA 1AOHA 4JCMA 3WIFA 4DW2H 4UAOB 5J6HB 3KL5A 3VA6A 5CZXC 1ASQA 3KWUA 3VI4A 2VUKA 3JWNE 2LVCA 3ZLQC 1NCWH 2E9GA 4EXPX 1OSYA 3PHAA 2Z1KA 4B9IA 3N85H 4FOMA 3VQ1C 3TM6A 1FO0B 1X5YA 2X6MA 3ZDYF 4XVJH 4PCYA 3STZA 2AJXL 4KU1A 5K1NA 1GAFH 4PM1A 4OJAA 3NMEA 3V0DA 1AGEA 4OLZH 5SWSB 2N4IA 2FJSA 4L2YA 4R26H 4AYBA 1AZCA 3CVBA 4G80B 4MAUL 4NQDD 2EILB 1YO4A 4WHTB 4XVTL 5KVEE 5B1KA 3FO1B 4FZEL 1H8LA 1WF5A 1LE5B 4C4KO 2ZOWA 4C56B 1WGOA 3MPCA 1E4KA 5D7IB 3W11D 1T1WB 2P8MB 4MJ4A 3OD3A 4DZBA 2DJSA 4NN7B 1NDGB 4BWTA 4XZUA 1PSKH 3UBXI 4IIZA 1U8LB 3NG5A 1XBRA 4JN2B 3LVTA 4X6FB 1V8HA 1MCBA 5EBMB 5HVFB 3GD1C 2YD0A 4ZZFA 2W0LA 2XTJD 2X4SA 3VXPA 1MH5A 1BMGA 1H3GA 4NI3A 4UDUB 1T5KA 2OYMA 4TUKH 4F58L 5GZNC 5IK3A 4AGQA 4R83A 4U6YA 2EICA 2QHRL 3V7MA 2YD5A 2P5ED 5AALA 1RPQA 4QWWC 5F44A 3W0WE 1XQ4A 3AACA 2WNGA 3C6EA 3FQ2A 3AREC 3LPGA 3WAJA 4FULA 4O02L 1F2QA 3P0YH 1QVOA 1SHXA 3BWSA 4UT9A 5JORB 4RGNC 3WGUB 4MXWH 4XAKD 1YEJH 3GSNH 5EOCL 1UEMA 3LV3B 2AGJL 3FZUD 5I18L 3MHZA 1AHWB 1FYTD 1YJDH 2FJFB 2XICA 4O2EB 4XH2B 3DXAD 5LWYH 2ZXEB 5D5MB 4JRXD 4NT6A 3ISYA 2YGVA 4JFFA 3QFJD 2OS7A 1X44A 4L5FH 3A6OA 2J72A 2VLLB 8FABA 2ATPA 3EJYD 1KDJA 2BHZA 4PS7A 1NEZG 1P7QB 1SNRA 1EXHA 1A7QL 4JQXA 2X4PB 4GP5B 4R0LB 2XXCB 1VZGA 4G8GE 1UYWH 4UZUA 4NDMB 3UERA 1ED3B 4F37F 3ZYOA 4ZOBA 4AYID 1FN4B 2YOCA 3IKCA 3UTZB 2E0PA 3MXWL 4FQXD 3Q01A 5BO1L 2Y69B 5CR1A 1WVZA 3PJLA 4XBMA 4Y5YA 3PLYA 3DV4A 3PV6A 4WK0B 5MI0B 1G6RA 1FAKT 4NQVB 4B5ZA 3I9GL 1ASPA 4ETYA 3VYNA 2GUYA 4OQTA 4FADA 3FSAA 1MI5A 5IEKA 1A5FH 1Q38A 4AH2B 5D93C 2Y72A 7CGTA 2DQEH 1D3CA 4FFTA 1CR9H 5CSBA 2OSWA 4DGWC 3DYMA 1SOXA 1XF4B 1QBBA 5TF0A 1T04A 3V52H 3W11C 5HDOA 5C71A 4L1HA 2VUOA 4CC1A 3OJMB 4HOMA 2A9BA 2YXVA 3D52A 5E8NA 1U8CA 1XGTA 3VXOB 4PVMA 1BZQK 4FFWC 3VMOA 1NM9A 3CHSA 2XTJC 4X5QA 1RZGB 1SQ2N 4XTRD 1S5HA 1TTAA 5AUMA 3KWWB 1ZPLA 2AEPH 2I7SA 4HCRL 3AM8C 4K71C 4I4WB 4UQAA 4Z7VB 4PS4H 1BPLB 4YSUA 4U1HA 4XPHL 3KPQB 4ZX6A 3RVUD 1KTLA 4IHOB 1IAII 5GSVA 4U7KA 2JELH 5I6KA 3ZL4L 4XC1H 2PP8A 1NZRA 1QRNA 4GRMB 2P24B 1H9VA 4A6YA 4PJBB 1F4YH 1FZOB 5D2NE 2ADYA 1KLUA 1NIEA 5IQ7L 1CE6B 4XNYH 2EYTA 1C5DA 4HXAH 4JFDA 3BVNB 2PLTA 1J1PL 2ZICA 1IAIL 4S1SH 1L5GB 4GJTB 4HGMA 3GKZA 2H2SC 4X6CE 5F8RC 1I7UA 2ZUQC 3CZNA 4NO3A 5F1IA 3DOHA 2VDNH 3MLTA 5GISH 3BVWA 3NJVA 3O3BA 4RAUA 2GPZA 4N2AA 2N7BA 3LZOA 1UWEL 3EJYC 2JJSA 3UZEC 3IFOB 2O5YL 3HI1A 3LNHA 5B4MD 3SDAA 4KVNL 4X6DE 5FKPB 1RULL 3VCLA 4QXUL 3UZQA 1XGPB 5DRNA 1KT2A 1BQSA 4ZUWA 5DLMH 4K5NA 4FQXC 2EXYC 1MJJA 3NH7L 1EVUA 2BSDA 2WAHA 4GMSL 5GJTL 4NNXA 3H9SE 4G3YL 3EYUL 3P4MA 1AYOA 4X6CF 2A4ZA 2CKBB 3DSNA 4XVTH 3MV7D 3C9NB 4FZEH 2WC7A 4X98B 5D1QA 3CZKA 4HUXB 4M7LH 2CIKB 5AL8A 4E41D 4XOAA 3OGOE 1KBGH 1NDTA 1GGYA 4X9GA 5DS1A 1WUNT 2EE6A 4FLOA 5I0DA 3SDYL 1MWAL 1U8KB 4MJIB 4Q6IC 4X6DF 3K2KA 1M7IB 4ODVH 4LLAA 5HTSA 1BWWA 4JY5H 3O6FD 4TSAH 2CDGA 4BEIA 1V7NH 4ZO6A 1N59A 5HHXL 4ALAH 1ILUA 1OQXA 1XB6A 4I1PA 3VI4E 4G1EB 1I8IA 4CA4A 4PH8A 1L6ZA 4XRCA 1U8IA 3B8SA 2RBLA 2GJJA 5ENWB 2X4QA 3CDGA 5AOMA 3JZYA 2ADGA 4KROD 4PJ7A 4RWYH 1EDHA 5JIMA 2R83A 1TVBB 2J5LB 3IMRA 1NKRA 5E6IC 3ESOA 3B9DA 2CJ3A 3ARDB 2WMPA 2QSQA 5DGRA 1AGDA 2ZYHA 5AKRA 3S4SB 4R4BB 4D2NA 1YEDA 4AYGA 3MSPA 3TS8A 3JWDL 3C5JA 4U1KB 1PEWA 3K6IA 1WTLA 3OL2A 4FHJA 2D3VA 5IGXH 3KPPA 3QXAA 1U3HD 2DBLL 5BS0E 4MQ7A 4P48A 4FD0A 3SKOB 1F1DA 5A3ID 2VQ4A 3N5AA 1AY1L 5DD6A 4ZDHB 3UAJA 2WINA 4B9KC 4CDHA 4CNIA 3ECQA 5FDWA 1C7TA 3FQWA 2I9TA 5IUSA 1HE8A 3FU6A 4BQ6A 3VGAB 4ALAC 5MHSE 3ALXA 1IARB 1PLGH 3VFMB 4F2EA 2YPVA 4NO2A 5T1MA 5I23A 3X1GA 2G75B 5B4MC 4AY0A 3CG8A 3EFFB 4Z7QB 2RD0A 4FDWA 3VFTB 3APFA 1HILB 1AD0B 4MMZA 5BO1H 1T0PB 1AQDB 4DGYH 1KTBA 5EH1A 2BH0A 2XIDA 3BEWB 1VESA 3MJ9L 4JFXB 3LSOA 5T1DH 5C6TH 4EQ3A 4NUGL 2WPGA 2HYMA 2H9GB 2Z31A 4JO1L 4XPGH 5FX3A 1TKWB 5AOKA 2CJUL 2DQ6A 3DX8A 5DRXB 3S6CA 3GK8H 3V4PL 3FF8A 1JDAA 3QQDA 4EN3A 2C5DC 2D3NA 1IAOA 1C5CL 1S9YA 5A40E 4JB9H 4AJVA 5KAQF 1FBIL 3AQZA 3RNQB 4ZRGA 1RU9H 1WS8A 2LFEA 2W0KA 1CFQB 4QRRD 3KWTA 4MCYA 4UQ2A 4M4PA 1BZ9B 3RGVB 3AS1A 1CFTB 4L05A 3O6FC 1NCCL 5I9QB 2BRRL 2VXSH 3D3VA 4U1GB 4YLQT 1N19A 5DJAB 2X10A 3VD3A 4ANWA 2CH8A 4HKZB 4MS8D 1PG7H 5AW6B 2H6OA 4K3HA 2R29L 3BRDA 1D6EB 4FJ6A 1Y6KR 2OTWB 3BP4A 3FHQA 2J6EL 2VDQB 4KROC 4HJGA 4QXTB 5LXVA 1S7VB 2EDEA 4Z7OB 4JRYD 1E8XA 1W72H 4L3CA 1EJFA 3L1FA 3O11B 2NXZC 5DEJA 2GY5A 2CO4A 3BUQA 3HAEA 4ZK8A 1SJXA 4OKDA 3HFMH 5TE6L 5IQ7H 2DQIL 2APVA 3P3YA 2HKFL 3ARXA 2RACA 3HPJA 3MODH 4FJZA 4GAYB 1UM4L 3GXMA 5DS8A 5C07D 4R4NC 2HT4C 2OI9C 4N2NA 1QSFB 2J6WA 1BCIA 4YO0A 2JJVA 1XIWD 3QI9B 1U3HC 1YMHB 2PYED 4UTBA 1ZANH 1N6QH 4GSUA 4H25A 3SDDB 2WKGA 4DKEH 3QJZA 1VKXA 1OAJA 1P5UA 4RMBA 4NHCH 4ODHL 2B15A 5B1BB 3RFRA 3TP4A 4ZFFA 5I71C 1KWGA 1UWXH 2OL3L 1UWEH 1P5VB 3L5HA 4S0SD 1INEL 4NKOB 3FCGA 3LQAL 2CD0A 4FGMA 1CU4H 5E56A 3CFKA 2J71A 4BQ8A 5JQHC 3PYCA 4I87A 3QJSB 1WYJA 1YNKL 3UBXG 2V7NB 2C9UA 3NH7H 2NY4C 4HA1A 1YECL 4GMSH 5AVWB 2A0LD 3HBPA 4JFZH 4Z5RA 3ZDXE 2Z93B 3QUGA 4JHWL 4JQIL 3RNKB 2PWDA 4DUWA 1B4TA 2I27N 1OCRB 5BQ7A 3VGBA 4PRID 5BMFH 3V2AR 1INDL 2PTUA 4J3XA 2YHGA 2BMKA 3QS2A 4MB4A 2AJZA 3CSGA 5HYSB 5TE4L 1KFAH 4KQ0A 2AITA 3EO9L 1XL6A 1YMMB 3HS8A 3LIZA 4LRNL 4PJ9A 4MMYB 3P9MA 1TQVA 1I9RL 3FN9A 3ARBB 1JNNL 2MIZA 1RFDL 5F3BB 1EGJA 1KB9J 3H6AA 3PNWB 4XNBA 5D1ZC 2OR9H 3PHQB 5DC2A 3QEQA 2EE3A 5DC0A 4LVOB 4F8NA 4PJ8A 4GP8B 3OZ9L 1KBKA 1ZDQA 3ZDXF 5HYFA 1FHGA 1LWRA 3MCG1 3CDFA 3P4NB 4GKLA 4MS8C 1OTUD 1T89C 1F1GA 4QAWA 2AKRB 4OZ4B 1N6UA 4OZFH 4OSUH 4DK5A 1DQML 3AS0A 5T1LB 1IO4C 3JTTB 4HGWB 4ZNCD 5A2IH 1PLBA 4LCYB 1UJTA 2OMZB 2EIZB 3K6SA 1CI3M 4H26B 3MRBA 2CO2A 4Y2DA 4N0YL 3CFCH 2WVTA 4RLDA 4YWGL 4JNXA 1E2WA 3N3EA 1CF8L 4XOEA 5D1QE 2W65A 2DEYX 5TE7H 3R8BB 5K9OA 1G7IB 5CZKA 4LXFA 1T7YA 4GKZA 4M6OH 1U93A 4PJ5A 4BFKA 3IJHA 3WLBA 3KGRA 4M3HA 4BBWA 3LKRB 5IQLA 1AY1H 1NDMA 4MNQD 3OR6A 1XIWC 1BA9A 4LHJB 4F57L 3GMLB 2DH3A 3QYNA 2ROYA 3CU7A 3PGFL 2NDFA 5BNXD 4U0RC 4B9PA 1MVUA 5J3HC 1JMXA 2X1QA 2KLTA 5IMMB 3L3GB 2APTA 5LGHL 3BWZA 1DSFL 1QWHA 2JCWA 4NCDA 1A1NA 4ENED 3BZ5A 3GBMH 2C9SA 3OHXA 3D08A 3C6SB 3FOLA 1N0XH 1PFCA 3BZEB 4NYLA 3DYOA 1J0IA 4MNGE 5I74B 1FCCA 3VACA 3FBKA 4PJIA 2R15A 3EDEA 1FNAA 4WFED 1LL1A 4JO1H 5CSZB 1WBXB 5DDHA 3L4YA 3IPEA 2G4GA 1DBML 1Z0MA 3ABZA 3OBAA 4R96A 4F7MA 2QPSA 5BZDB 2YN3A 4N0FB 3LOWA 3QQ3B 1E27B 4M8RA 5B7MA 2Y07L 1U3YA 3IXTA 4NJAH 1X5MA 1SYSA 3H7BA 1HIMH 4PB9H 3LZPA 3MDJA 5HVHC 3TIDA 4G6MH 5E08H 4WI3A 2BSTB 2DY2A 4JDVA 2O61A 2BWQA 2XWTA 3CVHA 1LP9E 4LF3A 2Q7YB 4AZUA 3KH4A 1G7HA 4JE0A 2OR8A 3WL9B 3CWGA 1MJUL 4LOVA 5GIRB 1JJUA 4OZGF 2R29H 3VWKC 1Q72L 1AXIB 4NWTH 5B39G 2J6EH 2WTRB 1OTUC 4X5PA 3KLHD 1O9WA 4G7QB 1NCOA 5T3ZL 3S35H 2VR7A 5F9JA 5J7CC 4Y4KA 1PPIA 1X9QA 1SHSA 1J8KA 2OTPA 3Q1EA 4Z0XA 1RZ7L 2WXGA 3DIFB 4CADA 3ZHNA 2ROXA 2XC8A 5C0BB 3I50L 5DI8B 2L7QA 2ZAHA 1UWYA 1ZLEA 2DQIH 4AM0A 2OXGA 1NEZA 2IO5A 3V5KA 3AQYA 5SWQB 1OGSA 4A2FA 1XFPA 1ZLVK 3VXMA 4N9GB 1HH6B 4QDGA 3EO1A 3EBGA 3CZFA 1LP9F 4CW1A 3FT4A 3SD5A 3OX8A 4R97C 3UG5A 1B2WL 1IEBB 1NH6A 1I7RA 1WITA 2EDJA 3WFBL 2QVTA 4J3OD 1AI1H 3AQDA 1Q9WA 5CEXA 3NZ8A 3UJJL 1M2OA 4WFGE 3I3DA 1BVZA 3UTTA 1UUSA 5JYLA 1ZLUH 4ENEC 1SYVA 4HLEA 5T5FL 4HXBL 3P11L 4KDTC 4BUQA 3GHPA 1YEIH 4ZOEA 5AOIA 2UZPA 4NN6C 5JXAL 3V4VA 3BO8A 4OZFG 2ZNWA 4X6EA 1NFIA 2C9AA 1INDH 5GGTL 3JT2A 4B97A 3FT0A 2YA2A 4C57C 1SXNA 2OTUA 1J12A 2WBJA 3LB6D 2VLRD 5ANME 4AUUA 4GSRA 3QJTB 2VH5H 5EUOE 2H0EA 4EE2A 4M7KH 1RZJL 1YQ2A 2RFXB 4PRAA 3P0VH 4UV4L 3VXTA 1UENA 2F58L 5DC9B 3AMKA 1PL3A 1XBDA 3NCFB 5GZNA 3HE6D 2DTMH 4X7EC 4GRLB 3KNBB 1QZNA 1JZ2A 4OV5A 2FL5A 1N0LA 4J3OH 3FL7A 5AKSA 1KGIA 4Z95L 2A73A 5FLVA 3AREA 1S3KH 3CXHK 3WTSA 4OD2B 2DWSA 4ZPVB 2IVFC 3MA7A 3CH8A 3ZY7A 3GIVB 3O2VH 1DQMH 3OKOB 3SCMB 2MHAA 3HB3B 3KYKH 4P5TC 3KLHC 3RJOA 1L9RA 1LO2H 4OLXL 2XT1B 2PWHA 1KJMA 1NCJA 5CZRA 2CWRA 4N85A 5EUOF 3HJ0A 3FTSA 3HLAA 4F2ME 2EDBA 3MV9D 3NSCA 5DK3A 3LS4L 2OSLB 4YWGH 5TQ2L 5FFOA 2Y23A 1MFVA 3DJ9A 1CICD 3KS0H 4DOHE 3VW3L 2Z35A 3WFEL 1ADQH 1B9ZA 1BQHB 2DQMA 4IDLA 2BOBA 1GOFA 4CMHB 1W6LA 1S8DA 2XN0A 4HKJA 4WEBL 4A2LA 1KZYA 2R9HD 3PGFH 1LYQA 1PDKA 3SY0B 1MSPA 2VQTA 4IRJD 1B0WA 4ZYKA 1BXXA 5HJ3A 2JJTC 4J3OC 2PETA 2GITA 1R46A 2PPEA 3UEZA 2VMFA 1M9WA 4XCCL 3IS0X 3AAZA 5T3ZD 1OV8A 3V6BR 2HVKB 3GUTB 3VXUD 2B5IB 3V0FA 3GSNA 1RXLA 2VDKH 4YNYB 3WIFB 3PU7A 5HHOD 4Q89A 4NP9A 3VI4B 3CXDH 3O2DH 5BQDA 1I7TA 1JGVL 5JOEA 2FX8L 3KR3L 2J1XA 3DHJA 4OF8A 2IBZY 3LB6C 4X7FC 2DYRB 3GTVA 4R7NA 3X12A 3CSTA 4TS6A 1OQOA 1UA6H 1CI5A 4M7JH 3STZB 4PGZA 4LLMA 2VAJA 2XKNA 1Q90A 3VX1A 1AGEB 3EJJX 4LSPL 1P4LA 2F7QA 4LCWD 4WTXA 5C86A 3ESVF 2HLFC 2P5EA 1QW8A 4HHWA 3LH8A 4X99B 5TJWK 4K7FA 2BS9A 1KCBA 2EDDA 1BDYA 1Q72H 3OB8A 3BCDA 3OLIA 3N50A 4ONFH 4DZBB 1I4FA 3UMTA 4PW3A 4JVUA 4XZUB 1SEQH 2YUXA 5DHMC 3NSFA 1T1XA 2N7AA 4FXGC 3GB7B 3P30L 4TLUA 3EDDA 1RZ7H 4PGJA 5F1OB 1YEWA 2YAEA 2EIMB 3MRNA 4WENB 3BH4A 2BS71 1JZHA 3VXPB 1N68A 3CVIL 1MH5B 5D71H 2OCCB 5DA4A 2ZXDA 4DETA 1M71A 3GHEL 2R1XA 1FYTA 3NTCL 5FGBC 3MJGX 3EUDA 3O6LH 3IJEA 5IK3B 2H3KA 3DXAA 2W80C 1ET7A 4JHAH 4U1NA 5CIPH 3EOAA 3RJDA 2HJFA 4MQTB 1UC6A 3QFJA 2CJSA 1LHZA 3FSZA 3N2JA 4JN1H 3P9LA 2J55A 3TH2T 3V8CA 1B2WH 3P9WB 3UZEA 2EH8H 3T8XA 1E8YA 1H8SA 1QVOB 3IDMA 3UTPE 4N2KA 5DGQA 1DBKL 3GXTA 1YEFL 5ESQA 4GMTL 2E6QA 1PMYA 1H3PL 1WZAA 1RJYA 1KEML 3H9HA 3K2IA 4FQXA 3S5ZA 3U4EB 1EV2E 4Y9GA 5CP3A 5D8JH 2ICWI 4RSYA 4W9IC 2VXQH 4P2QD 4J3OG 4XN8A 4EI5B 3HA0A 4XVUD 5FLUA 1JRHI 4L8SA 4UQEA 1IE4A 2RB8A 4OY9A 3G9VA 3UBFA 5B38A 4NT6B 4PWFA 3RA7L 1HFUA 3RTQC 2OA9A 4JFFB 4TXVB 3T65A 3PXJA 5JXAH 4NUQA 4AE0A 3ZKND 8FABB 2C9PA 5GRUL 2ATPB 1P84K 3J7HA 3ZYZA 1RJLA 2KPNA 2OJZL 2A2QT 3V0IA 2PYFA 2BNQD 1JRHL 4GLRI 1AZBA 4PHXA 1Q1JH 4HGKC 4GO6B 4NGHL 1IILE 3IKCB 2K78A 1RZJH 2XKUA 5IVOA 4EN2A 1B4RA 1FNGA 4Y5YB 3D6GA 2NY6D 3DV4B 1TSHA 1G6RB 3EH3B 3PV6B 4LSVH 1W8OA 3GZKA 4FLQA 4NQED 1MI5B 4JFOA 4KAQH 4U49A 5FR3A 5CFAA 1MHEB 5IEKB 4P9ML 1QUNA 1R24A 5I1GL 4CSTA 1O75A 1KJ3L 2CR3A 4HFUH 2WYHA 2E74C 1N3NA 1VZHA 4NB7A 4P5SA 2XQBL 1T04B 1WIUA 2XZAH 1FL3B 1MIEH 2VDRB 4MXQC 4B6ZA 3R8QA 4FS0A 4OLXH 3WFZA 1PX4A 1UKQA 5E8NB 1W2KT 1U8CB 1XGTB 4DEUA 4PI0A 1NOFA 1SLXA 4HF5H 3WKNA 3BIBX 4QRPE 5CGYD 4AOFA 2JKXA 5A2FA 1J05B 2A74C 5AVSB 1S5HB 4AJ0A 4XR8C 5AUMB 4K3DL 3IU3A 4HOXA 1EHLL 2DQJL 1F1AA 1C08A 1RZJC 2RH0A 32C2A 1ILSA 2BIQA 3KG5A 4PRHE 3OKLB 3M88A 4UIKL 4U1HB 4WEBH 1KTLB 1FNSL 5GSVB 5FYJH 2G4EA 5DHVA 5K9JL 1QRNB 2JXMA 4I18A 5FYKH 1UG9A 3QULA 4LBAA 2EXWC 1KLUB 3D2TA 4XCCH 4O02A 2EYTB 4JFDB 3SKUD 2PW1A 3VSUA 2O6DA 5I1KH 1GJIA 2R8SL 4XVUC 1I7UB 4NO3B 4RX4D 4KX9A 3O9WD 3I2CL 1D5MA 3MLTB 2XVLA 5I8EA 3MV7A 1MCQA 3O3BB 3DOIA 4RAUB 3VM7A 4ATTA 5D1XD 5DCCA 1ZS2A 1U8OA 5MEOA 2COQA 3NSDA 4E41A 1BYOA 3HI1B 1PIFA 5F3FA 2A9AA 4MLSA 4N3UA 3SDAB 2J73A 4HSQA 3BKML 5KANG 3VCLB 2IDTA 1P9MA 1ROCA 3UZQB 4DPRA 5I0VA 1F90L 3QWQB 5DRNB 3C5ZD 1KT2B 4MCZA 3VH8A 4ZUWB 2UXFA 4FZ8H 5FGRA 3FTGA 1OK8A 1MJJB 1JHTA 3CMOH 4KVPA 3IGFA 4WJ5A 2NY6C 4NNXB 2WWMC 1FDLH 1GS7A 4LLYA 4YZWA 1XO8A 5GS1A 3NRPA 3TEUA 5G2NA 3TEXA 3IDNA 3MNMA 3DSNB 3UP6A 4L29A 3MA9H 5ILTL 5D1QB 5A2AA 5EF1A 4QKTA 4AQ1C 2HZHA 4OW6A 4HD5A 1IFHL 3BH9A 3D85D 4P07A 4TNFA 3CN2A 2CDFA 4OFYD 3P30H 1T2QH 4HDIA 1XWVA 1H8NA 5I82A 3DROA 3EAKA 3PHSA 1RHFA 2CDGB 2FCBA 4P2OD 1C1EH 1UJ3C 1N59B 1EZSA 2AJYL 3BKJL 3GHEH 3RUGA 2YA0A 4K7PL 1FUNA 1I8IB 1U3HA 2CKNA 5CGYC 3LYRA 2QLVB 3UIYA 4XRCB 5J6GA 1U8IB 1BECA 4UM9D 2WM0A 3G6AB 5JQ6L 3CDGB 3F8UB 5DUPL 2ADGB 4LOUC 4PJ7B 1S9XA 2Q6WA 2WWOA 5EIIA 1IX2A 1MWOA 4JFHE 3DX6A 4DNLA 1DBKH 5A7EA 5F1KC 2WMPB 4HCRA 5GGUA 1YEFH 3I85A 3L4UA 1AGDB 1H3PH 3WLWC 1KEMH 1YEDB 3BD3A 3FKUS 4ADJA 1BFTA 3C5JB 4S1DC 5FO8A 4ANUA 1CTOA 3KPPB 2EXSA 4OQ1A 5CKGA 3QXAB 2J88L 4J4PC 4MQ7B 4X80L 5GJSL 3RPKA 3NOIA 4G70B 4X4MA 3QORA 2EVFA 4QOKD 4WVRA 4TRPL 2WINB 5DD6B 4CNIB 3UTQA 3DO4A 3FQWB 5DZOA 5GRUH 2I9TB 1WBYA 2G2RB 3BPNB 3GSQB 1VCAA 5DVKA 3ZT7A 2AF2A 4N0RA 4NO2B 5T1MB 1ZXQA 2EZ0C 3CIAA 1JRHH 2ZX6A 5JNYA 3TA3C 1GGTA 4QRRA 1KLGA 4MMZB 4Z23A 4LPTA 3QVAA 5IT2L 2IG2H 5IEHA 1XR9A 1XX9C 3NCCB 2HN7A 5CWSA 4XMLH 3QDHA 4GLRH 2WO2B 3LSOB 4OVVA 2BDNL 2Z31B 4P9MH 4PJXE 3V7AG 1H3UA 1A6UH 2K8QA 3DX8B 4OCNC 1QFWM 5I1GH 1KENL 3B3IB 3WS6C 5F7AA 3QQDB 4KKRA 4M7ZC 3IFLL 3CBKB 4G2AA 1IAOB 1S9YB 1PTZA 4Y0GA 4EN3B 4IBZA 3U9PL 3P02A 4I2XE 2DLHA 3L9BA 1KB5B 3ML9A 2R0ZL 3GPEA 4UINH 3KXFE 4KMTL 3HUJB 1SXAA 4MCYB 3UABA 3SO3B 3X3GL 1MW2A 4FFYL 3WTYA 1ZHBA 3CX5K 5C07A 3VDAA 3F3HA 1A6PA 2XYBA 3D3VB 1MWAA 4HIQA 4QRAA 4UTAL 4K3DH 1NPJA 3TBTA 2PYEA 4ZFQA 4B53A 3QCVL 3L7FA 1CYGA 4PJXF 3OQ3B 2BHYA 4UIKH 2K4AA 3MGAA 1UOVA 3BP4B 4CSSA 1FNSH 4G6JL 4HJGB 2KLSA 3MX0A 1WC7B 5CINH 4PU2A 2AQ3A 4FQQA 4L3CB 3WNOA 2FATL 2DQTH 4OLUL 4YAQA 4ZI8A 3WMPA 3MNZA 4R2GB 5HI5D 4LCCC 4D7PA 1Y07A 3HAEB 1E9OA 3GF8A 2DDQL 1SMOA 4JAMA 4EO5A 5CBAA 5C0GA 3I3BA 1MLBB 1OAZL 3QRFM 5DS8B 3AWFA 3RDJA 3GRWL 4OH2A 5SV3A 1IGCL 3T9WA 4H25B 2QGBA 4P5KA 3LHPH 4CC0A 5HP5A 1DEEA 2EAEA 1VKXB 2FHBA 1P5UB 2GI0A 4RDBA 4ZFFB 2ED6A 3U7AA 3WXVH 2WLJA 2XWXA 3OLDA 2AW2A 2O4EA 1F45A 1FG2A 2EDQA 3TYGH 3CFKB 3W38A 1F90H 4F27A 4N8CL 2IDQA 4YDLC 3JSSA 4XNZB 2J8UA 1KJVB 3QB7C 1R5WB 2FX9H 5IM7A 2BNRE 2E76C 4Z5RB 1M53A 1OGPA 2Y06H 3DMMA 3SOTA 1D9KA 1A7NL 5IW6A 3OKDA 2EH7H 5BQ7B 3HR5A 2VDOL 4UAHA 4MYWB 3NCJL 2O5XL 1LMIA 4OB5H 1MHHA 2IPUG 4Y9EA 2BMKB 4KJYA 2AJZB 4GRWH 3MJ9A 3HOGA 4U6HA 1IFHH 3WXWL 2V33A 4P9HH 4WU5A 3FOMA 5IBTH 2AI0L 4G1MA 3QC6X 4RIRA 4ANKA 4ZMWA 1MPAH 1R5VA 4PJ9B 5HHPA 3V4PA 4EKJA 1FIGL 5KW9L 3P9MB 2J8HA 3T3PB 4KKLC 2YRPA 2B39A 1ACZA 3MV7E 4JFPA 3EG9B 5E2TL 2AJYH 2WBXA 1W91A 3D0AA 5J56B 1KYUA 3QEQB 2BXZA 3PDGA 2R7EA 4PJ8B 5I6MA 5F6IC 3T4YA 5DJ0B 1HOEA 3KM2A 4N0CD 4MNQA 4PJ6A 1R75A 3DJTA 4W6YB 3V0HA 1LO0L 1TMQA 1H6TA 2Y1VA 2GBVA 3NA4A 3SD2A 5FF6A 5TH2B 3HNVL 1FL5A 3B2PA 5CJQL 3F83A 3FQXA 3EXLA 5D55A 2Y5TA 2R29A 3K6SB 3C5SA 3MRBB 2AHIA 2J6EA 3NQKA 4KV5E 4KKQA 1IGFH 2Y7LA 3FFDA 2XN9E 4JUTA 5HJDA 5K9OB 2W65B 3QYCA 1LDPL 2RR3A 3K6FA 4P9HC 4PJ5B 3N43B 4GKZB 2DWTA 1U93B 4X80H 3WLBB 2CZNA 4OVUA 5EDSA 1NDMB 5TK4A 3KLQA 3OR6B 4JO8A 5IP4A 1WCQA 3TTYA 1RI8A 4FN0A 4YBQD 3ZT6A 3MR9A 5HGDA 2BJMH 1CDBA 1MVUB 3QUZD 4LDOB 3MXVH 5AENA 2R0WH 1UB6A 1U33A 2HRLA 5JZ7D 3U6XA 4TTDD 1JYVA 3RIFF 5HHME 1KCKA 2OL3A 1KCSH 1ZTXH 3OHXB 4AZ8A 3FOLB 1DJXA 4KV5F 4PJCA 4NYLB 4XP6L 4PJIB 4XNUL 4CVXA 5GSRB 3CBRA 2G9HA 1CD1A 5DDHB 2YAHA 4JPVL 1KTDA 4B9FA 3GS4A 4R96B 1KENH 1L9QA 4YSOA 4F7MB 4EUPH 1M9SA 4JZNA 3IFLH 4X5WB 2XIIA 4AKQA 1AQ8A 4N90E 5L88L 3U9PH 3SODB 4JQIA 4YE4L 3SZ6A 5KN5A 1BZ8A 1JGLL 2AQNA 3IXTB 2GYSA 3L5IA 5CUSH 1P7KA 1MIML 1R17A 1SYSB 3H7BB 5DD0L 5FB8A 1VFBA 5INCA 4ELMA 2CBPA 4GY4A 4MDRA 5J11C 1TETL 4JG0L 4KITB 4LO9A 1FI8C 4JDVB 4AEIL 2XWTB 3CE1A 1WT5C 5LBSH 4HZLA 2VW6A 3CVHB 4U4BA 5EA0L 1G7HB 1H6EA 4KRPD 3HKFA 3QCVH 2X2UA 2FQDA 1I3GH 2XI9A 4HUUA 4JKPL 1JPFA 1VFAA 3FCUB 2X41A 4LLUA 5E7FA 4G6JH 5HDBB 4YDVA 1YA5A 5F9JB 3VB9A 2O5ZL 4X8JA 1MJ8H 2FATH 3DVNA 3MBWA 3L08A 5LQBH 3QEGH 5HDLA 2Y2TA 4H0IA 1PY0A 2ZP8A 3LD8C 4L4TD 5EEVA 1DLFH 4P2CG 5GGRA 3BRFA 4JFWA 2OXGB 4U2YA 1OAZH 2CR0A 4I1NB 4UU9B 5KSBE 1NEZB 3N41F 5IZ7A 3V5KB 4FQPA 1CDGA 1FE8L 2Q2LA 3VXMB 2AQQA 3EO1B 1A47A 4WI0B 4CW1B 1ETB1 3GS0A 3L48A 3WFDL 1PZUB 1PAMA 1YPZB 5AW0B 4CMMB 2RJMA 1I7RB 4AIZA 2MRYA 2F53E 1CXLA 3L81A 4PUBL 3BXNA 4YBQC 2W8CA 1Q9WB 4ICWA 2H32B 4Y16B 2VLRA 3HPLB 3NABH 3QNXA 3IFNL 3QUZC 4X9FA 5IR1A 3QZWG 1INQA 3SE9L 3F6JA 2H8PA 2FBJL 4JPWL 5JZ7C 4R6UA 2R2BA 4TTDC 3UTTB 1SYVB 4FQIL 2QQNH 3TNNA 4Q0XL 4QT5A 3HE6A 1T03L 1FORH 3ES6A 5KSBF 1NAMH 2GHZA 5DA0B 4BXSV 5IREA 3B9VA 1A1OA 2FEDD 2VC2L 1LWHA 1A7NH 3V4VB 4UYPA 2QADC 2KQNA 4X6EB 5DJ2A 1NFIB 2Q1EA 5B1JA 2B1AL 3Q06A 2OTUB 5C0AA 2DD8L 5L0QC 2WBJB 5ITBL 4FXGA 2AAAA 4X9HA 1NCBL 1W0VA 1JZ8A 4HKBA 35C8H 4OF6A 3VXTB 3GUFA 5KW9H 3G6JE 4GNKB 3VE0A 4F8PA 4EBQL 3RL1A 3WTVA 2ATAA 1I3RA 2WD0A 3V0JA 1GR7A 3ETTA 1OSEA 1E43A 1SRDA 5CLZA 1FC1A 4I3SL 2I60L 4OV5B 2FL5B 1CICA 1ND0A 2A73B 4YSRA 5EN2A 3AREB 3CFEA 2CGZA 4E5XA 1X7SA 4LPVA 5C09E 2J4WH 3G04A 4C55A 2MHAB 5GRZA 5CJQH 4IRJA 3BAWA 1Q94A 5FO7A 2EDXA 1KJMB 1FNFA 3RP1A 3WN5C 2NSXA 3HLAB 3G6DL 2H0FA 2V9UA 5I30H 4F7PA 4PS3A 3G6JF 1GA2A 4HQQL 3AROA 1YEGL 4XPFH 3VXUA 4OFKA 4H13C 3W5MA 4RQQA 3Q0HA 3BSZH 2Z35B 3DSFH 4EUPG 1N8ZA 2IV8A 1CB4A 2G5BA 2BOBB 1S8DB 1IC5L 5HHOA 1UD5A 2Y1ZA 4HKJB 2AXFA 5FUOL 1I1CA 1PDKB 5DD3H 5J12B 3VWJD 1G4MA 2IGFH 4WQOA 1F3DH 1OAUH 2GBAA 2B8OT 5HJ3B 3DX2A 2OK0L 5FUCE 5AVQB 2GITB 3S5LG 1WFMA 4BH7B 5I8OL 5IJBC 2ZNXA 3DPDA 1NINA 2QKIA 1JBJA 3AAZB 1JD9A 2MQGA 4ADGA 1AQKL 3IDXL 4R4FH 3U6RA 3GZQA 2MQCA 1MN4A 1OF0A 4G59C 1GSMA 3GSNB 3QWOA 4LCWA 1A4BA 5D93B 3HBGA 5AOZA 3DWTA 4P2RD 4NQDB 4ETQA 5K9KB 1P4UA 1TJGH 1A22B 2FEDC 4JPVH 3I9PA 3J8F7 4XBEL 2D7MA 3AY4C 1J8HE 5T5FA 1I7TB 2K70A 5IWLA 4ZMQA 4QRSA 2XUWA 1GMEA 2F1EA 3IM1A 5L88H 2FJHA 4Q2ZA 3NK4A 3PJNA 5C7XL 4R7NB 3X12B 3LAFA 5DD0H 4V1DD 5GGTA 2N7SA 2OJEB 2XTJB 3WS3A 3H42L 4LLMB 2JK5A 1U6AL 4M1DL 2XKNB 2XQYG 2CDEA 1L9SA 2NCMA 3Q2VA 4LMQE 4AEIH 4F91B 4P4KC 1P4LB 5CJXC 3T4AC 1ZK9A 1J9TA 5EA0H 3S0PA 2A83A 4UILH 1N64L 1HS6A 1EEUA 2P5EB 4XHJC 4MRCA 3SGJC 5AYTA 1TEYA 2D0FA 2GSMB 2IPTL 2CO6A 1I4FB 1AS8A 4YHKH 3GZOA 4R90L 3PAYA 4PJCE 1T1XB 5DUJA 4UZSA 4FNPA 5AWNH 4LHQB 1NOLA 5DD1H 4LPXA 3MRNB 4OZHE 4PRPD 5BRZA 1AFVH 2HH0L 3U7WH 2ZOTA 4AYFA 1M71B 1MQKH 2R1XB 3BOVA 3P54A 2WQWA 1FYTB 1DN2A 1I9EA 2CGYA 2KL6A 3AQXA 3IJEB 3DXAB 1KDIA 4PP1C 4U1NB 2WQRA 3EOAB 5C0ND 2HJFB 1FGVL 1A3LL 3QFJB 4AE1A 3EH1A 3RIAF 4N2DA 2VKXA 2Z7ZA 3P9LB 3L3HA 2EDYA 3MN8A 3NACL 4MD0A 1BVKA 1K3ZA 1MZZA 1UD2A 2K3TA 2PMZA 3HTLX 3ML8A 4XCYA 5IUCA 4F37K 5E2JA 2BNQA 1CFVH 3CQFA 3CVCA 2FB4H 1R3LA 5ESQB 1QI3A 4RFEA 3U83A 2QR0A 4O5LL 1K4CA 1RJYB 3H9HB 4FQXB 3WGVB 2Q5BA 4WV1A 3ZTNL 4OZHF 1KELL 3DBXA 4Z0BH 1FV1B 4L8SB 2APSA 4NQEA 2BO0A 5J5EA 1NGQH 4IKNA 4ECNA 4M5YH 3T65B 3VSVA 1R9FA 4OTXH 4RAVA 2D4DA 2IDFA 1A2YA 5E0FA 4AQ1A 1W80A 1C12A 1RJLB 2FHCA 1OSPH 2NQCA 2YK1L 4DAGH 3H2QA 2PYFB 3MRJA 5T1KD 1YQVH 4D9LH 4Q6IB 2VZVA 2ZKHL 4N2CA 4TNEA 2C9QA 2VDMH 1HHGA 4O9HL 4TTGA 1JXJA 4I3RL 2BIMA 3BP5A 5BVJA 1UJ3A 1FNGB 2YQGA 4C58B 4ORZC 3MRFA 2EECA 1NMAL 1ZLDA 1DQLL 1BLNB 3BGAA 4AIEA 3V95A 1QBML 25C8L 1DE4A 1F00I 4HWBL 2B0SL 4JFOB 2I60H 4R7XA 2WYTA 4JBSA