5CFAA

Crystal structures of bbp from staphylococcus aureus with peptide ligand
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
326
structure length
326
Chain Sequence
NNVNDLITVTKQMITEGIKDDGVIQAHDGEHIIYTSDFKIDNAVKAGDTMTVKYDKHTIPSDITDDFTPVDITDPSGEVIAKGTFDLNTKTITYKFTDYVDRYENVNAKLELNSYIDKKEVPNETNLNLTFATADKETSKNVKVEYQKPIVKDESNIQSIFSHLDTTKHEVEQTIYVNPLKLNAKNTNVTIKSGGVADNGDYYTGDGSTIIDSNTEIKVYKVASGQQLPQSNKIYDYSQYEDVTNSVTINKNYGTNMANINFGDIDSAYIVKVVSKYTPGAEDDLAVQQGVRMTTTNKYNYSSYAGYTNTILSTTDSGGGDGTVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone sialoprotein-binding protein
publication title Crystal structures of Bbp from Staphylococcus aureus reveal the ligand binding mechanism with Fibrinogen alpha
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding/peptide
total genus 87
structure length 326
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5cfaA01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5cfaA02
3IRPX 4MBOA 3IS1X 4BBWA 4LEBA 5IHWA 4F1ZA 3IRZA 4JDZB 2F68X 4JDZA 3V10A 4LE8A 4F20A 2Y7OA 2F6AA 2RALA 3ASWA 4RMBA 4MBRA 3AU0A 3IS0X 4B5ZA 2Y7NA 5CF3A 4LEEA 1N67A 1R19A 2Z1PA 2VR3A 2Y7LA 4JE0A 1R17A 4F27A 5CFAA 4FJ6A 4B60A 2Y7MA 3AT0A 2YLHA 4Q6KA 4F24A
chains in the Genus database with same CATH superfamily
1JSYA 5FGBC 2HUEA 3WY3A 1E28A 5DUMH 3RG1C 4HLEA 3DWTA 4GSDL 2IV9A 5I0VA 2VDKL 3SDXE 3SQBB 3MRGA 3NCJH 5D1QA 5F1IB 3V55A 5D5MB 4H8WC 1M56B 4HPYL 1U36A 3E3QE 5AVUB 2P8PA 4HKBA 4XNZB 4YR6B 4L8SB 3Q6GL 4BQ8A 3NBNA 5KSAB 1A7NL 5ICYA 3NSXA 3QCTL 3H55A 1JE6A 1QQDB 2CDGB 4G1EA 3TBCA 4GAJH 3TXAA 2CG9X 1GYVA 1FFOA 4AYDC 1G43A 4FD0A 1FV1A 3ESPA 4R84A 2DYPA 2MNUA 4GKSB 1QTSA 4K7PH 1YEDA 2C9AA 3GXMA 3V0VA 3HS9A 1V3KA 5DQDL 4ZBJA 1DSFL 2YMXH 3B9KA 2VKXA 1T4KA 3OAYK 1NM4A 5CSGA 1OV8A 1T83A 4HIHA 4BKTC 3C5SA 4ZUWA 4OVVA 2EXSA 1H6TA 3CIAA 4Z3TA 1I9JH 2A83A 2LLNA 3ZGHA 3M1BB 1D6VL 2W9EL 5HPOA 5IWLC 4LOEA 2CPUA 2FSEA 4WV1C 3MNZA 1O7DC 3SYCA 1DJHA 2CO6A 2EDYA 4C56E 4XCFL 4GRWH 1I3VA 4PV8A 2TRHA 5FV2A 4P9MH 2J44A 3W81A 5ACZA 5DJDB 3O0LA 2O61B 2C9PA 2C9QA 3LIZA 4JPVL 4K5LA 2FLRT 1UD6A 3UABA 3BAEH 3GMMB 2CR0A 4E41E 3O41B 3QRLA 3LNEA 1IKNC 2BP8A 1T1YA 1WBYB 4GXUN 4HKJA 2HMID 2WSKA 3IMWA 3MRJA 5DRXB 5EOTB 3TT1L 1IGYB 3IFOB 1GYWA 4W9DC 2ILLA 3MSPA 4NYLB 3QUXA 5GS1C 1G6RL 3BQUB 2AP2A 3Q3GA 3KJ4C 4PCYA 4P5MA 1TTFA 1L3WA 1X5LA 2Q7YB 3WLWC 5FK9A 4CMMA 1J9TA 1JPSH 2CLZA 3B2MA 4XN2A 3L3GB 1JGIA 4PW9A 1D9KB 1MWOA 3GSNL 5CN1A 4S1QL 1A7OL 1NEZG 4QXUH 5IMLB 2AQSA 3LKSB 2EXWC 2ZX5A 2EO7A 4Y19E 1ZDQA 2OK0H 3MUJA 5FX3A 4Y4HD 1FH2A 1KF9B 4P57B 4X0KB 1OP4A 4MCYB 1NCGA 1IEHA 4N5ED 5KVDH 1IB5A 4EIUA 1OSPL 3LVEA 1LJMA 4BH8B 1P6WA 4KKAC 5J7CC 1GJIA 1CGUA 1KENL 1SVBA 2B0SL 1YEHL 1HI6B 4HKXB 1AH1A 3VW3H 4FG0A 2ZUWA 5I1GH 3WFBL 2BIPA 5KW9H 2Y5EA 3JYBA 1ADWA 2VMDA 4X6BA 1YECL 1TTUA 1CLZH 3JTSA 4KJPD 1RK7A 4IHBA 4HUVA 1NSNL 3HEIB 1UOVA 3DECA 4Q0XL 4ORZC 1KJMA 4ACPA 2FLBT 1ZS8B 3MRRA 3UYPB 4JY6B 3ZU8A 4XXDB 3OKKA 4HWBL 5IVNA 5AYTA 3GKZA 1AGFA 1A9EA 1WHOA 5T3ZD 4X6EA 3OXRB 2DOCA 1RHHB 2I32A 3OGCA 5AOMA 4X6DA 3GHEH 5CLWA 4W4OA 3E1ZA 1ETJA 2UYLA 4XP1L 1I3GL 4M62L 2GTZA 1J7VR 1R3KA 3NTCH 4NC1C 5D2NB 3LNDA 4WFGD 4DQAA 4OGAD 3P30L 1AG6A 1LO2L 4IOFD 4KZ0A 4M7ZB 3N2JA 2MHAA 3V52H 4A68A 2DMCA 3T09A 4HHAA 2FEEL 2UX7A 4DP8X 3LH2H 3DX8A 4LLDB 3DOHA 3IGFA 2BP3A 4JO2L 4YEFA 1KYOK 5E6ZA 1UH2A 1AE6L 1NCJA 2WWKT 1A14H 3MLWL 1AJ7L 3O6FA 1WF5A 2P8LA 3QWQB 1SF5A 4LQ1A 5DZPA 4AIZA 1HL9A 2AXJA 4X8JA 4L5FH 2PXYC 4JDVA 2EDOA 3NCYP 1X9LA 4I2XA 4ABUA 2H1PL 1ZGLB 4Q6KA 3OKDB 1KIQB 1F56A 4TVPD 4XBEL 1QFWL 1J9CT 1ZLVH 2O6CA 4XO3A 5DD6B 5F3FA 5HSFA 3AGVA 3NAAL 3V0JA 32C2A 4N2BA 5L9DH 4K3DL 3X3FL 2W8CA 2H26B 3LKRA 3WY2A 1XAKA 4XMWA 4F37F 3T3MB 1BZ7A 1JHKL 3UROR 5E2WH 3P0YL 1FO0B 5I1AB 3FZUD 4JO4L 4P59L 5BV7C 5FEBA 2YRZA 1KELH 1XCTB 1BFOB 3QEHA 4FFYA 3SSGA 5BZWB 1YAZA 1AD9B 2XBTA 5CEXA 4K23H 1XZWA 4M43H 1KWGA 2OYMA 4G6KH 5JUEH 2RFXB 4XNMB 3QA3A 3HLKA 2NXYD 1T20A 3VXOB 2W65A 4IM8A 1U58B 1VIWA 2EC9U 1ODUA 2DKMA 2GPZA 3PGCB 3QPXL 4B5EA 4EMZA 1XF4A 4LDOB 3G9VA 2BFVL 3VFGH 5EU6D 4LHUG 3VCLA 4UT6L 3D34A 5EZPA 1FVEB 3D0AA 1J18A 3VU1A 1CYGA 4PY8J 2OP4H 4NQXA 4RRPM 1GSKA 3K6SA 1MH5A 3WELA 1INDH 3FQXA 4APXA 5EMYA 4TS6A 2WB1A 4XCNA 4H44C 5FGCE 3P4LA 4DCQA 1PLBA 2HVKA 3T1FB 1BD2A 1FG2B 3QJXA 2CJUL 2WZPA 3IDNB 3KCPB 4JHUA 4Q6IA 4XI5C 4HK3J 2DQHH 5G4OA 3FUJA 4PRBB 5E9DA 1UH3A 4I89A 5H94A 4KAQH 5AOJA 1RJLA 3NZHH 4G43A 5F0JB 3N5AA 4AZUA 3EH5B 4HIXH 5KVGL 4NPJA 4F7MB 3U4BL 5KSUA 2XPGB 5GRUH 3E9TA 2EZ0C 2GJZB 5DQ9B 2J57A 3ULVD 1UKSA 5CJQH 2BMKB 4OSUL 4F37K 5L2JA 2F19L 5CCKH 4LE8A 3KPSB 3PP4H 4M03A 1M1SA 2OYPA 4IMLB 2D7QA 1OCOB 2D03H 1WCQA 2P3YA 2HP4A 3OKMA 5FO7A 2XDHA 1CL7L 5FGRA 4AX3A 2DWYA 3LQZA 4F80A 1F1DA 4WDIA 3HAEG 3F3HA 4KKCD 4ODSL 2K1MA 1OARL 4ZFZB 3RUGB 5IQ7H 4ATWA 1AO7D 1MWAB 3AADB 2XQ0A 3MKGA 1EK3A 1MUJA 5IW6A 3ZRCC 2XRAL 3I50H 5L0QC 3CVHB 1KZQA 2ADIB 2D7TL 5HYEA 3DTDA 3QIWD 2VMFA 3UJIH 1LP9B 3UGEA 2V2TA 2Z31D 1MIMH 4L4TD 1VFOA 4IRZL 2RALA 1YNKH 1P1ZA 1CYWA 3K5SA 5A43C 2BS71 3IDYB 4TPRL 3N1MC 3E6FB 4F7PA 3GPEA 3GS0A 1ED3B 2FIKA 1OO2A 3RIKA 3GMLA 3AB0B 1N70A 4LSTH 1KGUA 4C54A 1UOKA 4YX2L 4LLYB 4X5LA 5KVFL 1OD9A 1P7BA 1X5ZA 2XTSA 3CDFA 4K73A 4Y2OA 1KFAH 2VLKD 1MCLA 1AOZA 4YGVA 3DURA 3J07A 2H3KA 4OJDH 5ITBL 1Q9KB 2CHXA 5ANHA 4DVRL 3D5OF 1UEYA 3BOVA 3C6SA 5F89A 1T04B 3O4LB 5D6CA 4F8OA 1SHSA 3A6BL 1UACH 2WKGA 4JPSA 5JW4R 3QUZB 5C0GA 1CDHA 1LWRA 1YY8A 3PNWA 4ICXA 4PJ8B 1MCPH 4S1SL 1JYWA 4JJHA 1CIUA 3S96B 5IB3B 5DJXB 1TYRA 3PE9A 4G8GB 1JI2A 3VA2C 2C4XA 5DK2B 4GFTB 1A02N 4XCCL 1D7FA 5I74C 5I0YA 2XPYA 2AK1H 4H0IA 1U8MA 4UTBA 5FGSA 4QRFA 2PETA 2D9CA 2FEDC 4J4PD 4AEEA 1UVQB 2OMZB 3A4EA 4L9LA 4X9FA 1P84K 2WWNA 6TAAA 4P5KB 3QIBB 4H0HB 1PG7H 3QJOA 4KGJA 4NHUB 3FSAA 1KV7A 4YBHA 3BEVB 4JM0A 3SE4A 4IU2A 1BXUA 1KLUB 2GUOA 3ZR5A 4B41A 4MQSB 4PRIB 5ERWB 4CJ0A 4E68A 5T3ZE 5KEZA 3RLSA 4UZSA 4NNXB 3QQDB 4OD3L 3IBEA 4GP5B 2IWFA 3ZKXC 4TVSa 3RY6C 1QG3A 3IJ8A 5D7HA 3ARXA 1XB8A 4GYBA 4WFGE 3N42B 1DE4A 3BUPA 3I02A 3PDOB 3ECWA 4Z95L 2VQ1A 1AACA 4KRPD 4HWNA 3W0WB 2IDCA 3SODB 1OQXA 4KRMB 1CDBA 3VFVA 2H4EA 4PLJC 3GXDA 4YDNA 2P5EB 1HILA 3A6CL 3UTZA 4L0PB 4N25A 5E95B 2JJSC 4IBQA 3QULA 2AJYL 4PD4J 3ZZSA 4OZGB 2A1WL 4HYTB 1HZHL 2P26A 3CJJA 2BVYA 1UXSA 5C9JB 4WHTB 3T0EC 3HA0A 1FZKB 4LVOB 1GTNA 2F53B 3P73A 5BOJA 2AQNA 4WWKA 1U91A 3RNKA 1XEUA 3AG4B 1SQMA 1PX3A 2X53A 1NC2A 2IPUK 15C8H 2L04A 2HTKC 3L45A 4N8VG 4JFPA 5DZ9A 4PYGA 1AQDA 2GFBB 1JZJA 3QIUC 5F1NB 5HDBB 3R06B 1ADQH 1ZV9A 1LDPH 3GMNB 2NCMA 43C9A 1DVFB 4L1TA 4Y2DB 3CDZB 3RBSA 2CHNA 1OB0A 3BE1L 4H1LH 1S9VA 4W9HC 3WXWH 3MNVA 4N1CA 3FU7A 3DO7B 1QI5A 3VFTB 4WHDA 1RAMA 2X70B 5BVPL 2CUHA 4G6JH 3ULSB 3PQYB 5BQ7A 2J72A 1U92A 5C0ND 1ZSHA 5E1GA 2ZWZA 1VFMA 2BY0A 1E27A 2EKSA 3I9AA 1F58H 4OZFG 4F8TA 2XWCA 4NFCA 5HHMD 2I7OA 1L0YA 3P4MB 5EU6E 4KOBA 2XN1A 2E8ZA 2VDQB 3CHXA 5EZOL 4Z0XA 3DYOA 3NPSB 3KLAB 4AEIH 1MY5A 2J2ZB 2DLTA 1T6BX 4DGYH 3R4DA 3U6XA 1OTSC 3AM8C 5E4EC 2XA8L 2OZ4A 3SDYH 3VI4A 1E3FA 4E2OA 3M6DA 4ZPVA 1QATA 5DUBA 4V33A 1A3LL 4TNVF 1R0AL 4X7EC 4GIOA 3A5VA 4PTTA 3NFPA 2EKJA 2EYSB 4PJCA 4YE0A 3B56A 2E3VA 4AYSA 1UD4A 5AENA 4XHJD 4XNZC 3NT0A 2V5SA 4FQCL 4L8SC 1CXKA 3SYAA 4YAQA 5KSAC 3OGOE 2R56L 3BRGC 2W95A 3RTQA 1JP5A 4X4ZA 3U1QA 1G7QB 1AZUA 4PGJA 5C0IA 2DYRB 5FKPA 4Y1AD 4W9EC 2XPZA 4OIIL 3SE3A 5GIRA 4HIIA 3ZL4H 5B3SB 1M7IB 1I1AA 3QDJD 5BXFA 5EFIA 3FCSB 2VSMB 3MC0A 5EOCL 2E7LC 4BZ1H 1VCBC 1AZCA 5LGJA 1JBJA 5F7NC 3HB3D 1IAIM 1BFSA 2NYKA 4Z7WB 3FF7A 1JWMB 3GDCA 3FQTA 1YN6A 3HG4A 3QQ9C 1S3RA 2GTQA 2WBWB 4NM4H 3ZN6A 3FAXA 2DQTL 4H20H 1TKWA 4P2YA 3TBYB 1H3TA 2FK9A 2PYFB 3PXLA 1VB9A 2JQZA 4K9JA 3QCUL 4QY8B 3QDAA 3KS0J 4CBZA 1FGVL 4KC3B 3D39B 4L4TE 1JMZA 2D9QB 5GRWA 3LHAA 4YSOA 4ELKA 3CMOL 3VM5A 4PRAB 5F9AC 3NFNA 4OZIE 4K2UL 2AK4B 1U8QA 4TSCL 1MJJA 3D52A 3ARFD 4FL4B 2XSKA 4H5SB 4HWZB 5EG6C 3II1A 2V7NA 4DEPC 2AJVH 5IEHA 2JB6A 2Z1PA 1IC7H 3BQUC 3F7QA 3WJLC 1WUZA 3GLDA 3W9DB 3H42L 4HH8A 3Q1SH 4JFFA 4TNVK 1N0XH 3EDKA 4ZFFB 5EOQH 1U9KA 1N5YH 1WWCA 1MCRA 5J11B 2ZG3A 3WEAA 3WS6A 1D9KC 4PP2B 4RCAA 1HFUA 4P46B 3FCUB 3GJFK 5G5DA 3KE0A 4JRXD 3MLXL 2XACC 1BM3L 2BY1A 4QAWA 1DBAH 4ZMLA 3FSOA 1NGZB 4LSVL 2ISDA 1T89A 3CUPA 5HYJD 3AS0A 1OLZA 4TF4A 5I0WA 1AGEB 3B9VA 3DMMD 1C1EH 1P0SE 2WYTA 2Z92A 4YBQC 5CR8A 4QOKD 5E1IA 4EOWH 4CMHB 3MLRH 4ALAC 4ZTOH 1I31A 1DDHB 1JZIA 4NO2A 3TJHD 1E2VA 1T7WA 2DJMA 2GBVA 3WIFB 4QHMB 2XTJE 4P5TD 1U93A 5MEQB 4FZ8L 4AWJC 1P7HL 5E70A 2O5XL 1WZ1L 1OEZW 4TVPH 2XHNA 1W0VB 4P3DA 3GM8A 3HE6B 2EE0A 4AUYA 3TBSB 2DQUL 3BZ4B 3QB7C 4WTWA 5C0AB 1DQQA 3EFDH 4MJ2A 4Z7OF 3VRIA 1O6SB 4KTDL 1TLKA 1I8MB 4CNIB 2HT2C 3MACL 4X99A 4S1DD 4RGNB 3SZ6A 5IW1A 4JBSA 1G1YA 1J86A 5C07D 4GRWB 5DC2A 1P6FA 5A40E 3IEAA 4XVUD 4HBQA 4UQ3A 5D2NC 4H1LG 1MSPA 2WZ0A 4BUGA 5JIIA 4HUUA 1TQTA 1MCOL 4KVPA 4LEOB 4M7ZC 3RVTD 2BCKA 5F6IB 5I8OH 2VDPL 4N0CD 1JZ3A 2DQIL 1KXHA 4IHOB 1YY9D 4HDIA 2YA1A 7PAZA 3S88H 5D8JH 1L0PA 1F3JA 1NMAL 3S2CA 2G3MA 1BIIB 3DBXA 4TUOA 3DVGA 2IAMD 2X2HA 4GT0A 3STLB 2OTUA 43CAB 4D3CH 4NZRH 1JGUL 1UH4A 4KI1A 4C4BA 3L7FB 2CDEA 1D6EA 3CFJA 1TZIA 3UTTB 4QHUA 2VM4A 4Q14A 3FT4B 1J0IA 1DBBH 4UT9L 2QGBA 1Z9PA 4PJGB 2YQGA 4YDVA 2WBJA 1NBVL 4MD5B 4FQXD 1KEML 3B9AA 1HL4A 4Z7VA 3S3DB 4MKTA 2P24A 4OUUB 4EN3B 3M17A 1QZ1A 4JEGB 4MS6A 3FO9B 3INOA 4P48A 4QXGL 3NZ8A 1R3JA 4R7VA 5HY9B 4XWOC 2BVQA 4YDKL 3QFJB 4MWFB 4XNAA 5I2IB 4BFGA 4WSGA 5KBNC 2CBQA 3FOLB 2HA1A 5FDYA 1XR9B 4LLQA 5C0BA 4AH2A 2O30A 1ETZB 5E8PB 2ICWB 3E6HB 4G8FB 3SKMA 1QSVA 3BXNB 5I17A 4XPAH 1ULVA 4KKRA 1QLEB 4KKQA 3ULVH 4MZ2A 4WO0A 1SXBA 3E8VA 1IV8A 3L5XH 4NQCB 3RZCD 1V7ML 2JKWA 4JZOB 1R19A 2AXGA 3QC6X 5C70A 2EE3A 4UM8A 3V5KB 1T0MA 4FG6D 3KLLA 4ANUA 2Z35A 4N0FB 1DBJH 4UOW1 2G3NA 2C4FT 4UUJA 3GSWB 2FH8A 1ACYH 3KYNA 3ARRA 2CJSA 3FT2B 4O02B 2EVHA 3WD5H 2BRRH 1HESA 5IMKA 2OTWB 2MKWA 2WXPA 5T1LD 3N1FC 5GGRA 1QD0A 5LJYH 2IDQA 1JDDA 4NQDE 1FQ9C 1XXDC 4NQQA 3T0DA 4WI9A 1U33A 4NZ8A 4W81A 4Y16A 3WDJA 4X0NA 1SJHB 1BV8A 2DQDH 1P5VA 5DVMA 3APFA 3PWVB 3UAJD 3UC0L 3MLUL 4PCSA 3UGUA 1BVNP 4MJIA 4MVBD 2WLJA 2CUAA 2D7PA 4NOBA 3OHXA 5F71A 3EO1A 1A3ZA 4Y1AE 5KYYA 2YAFA 1DL7L 2K0RA 4FFZH 3TBWB 2XCMC 3U7WH 5FFLA 3GLEA 1NKRA 1GC1L 2GSGA 2VDRH 3I9GH 3RL2B 5JW3L 3HE7D 3MRCA 3QH3B 5FO8A 3ZDZF 3PP3K 1EHAA 3T6VA 2COVD 3DDGA 3O6LH 3RGVC 5IB4A 1WP6A 3TL5A 3RAJH 3K4AA 4BQ6A 5D7IF 1MKFA 2FUTA 3OXSB 4Q4IA 3SDXB 4NJ9L 5J6HA 1UD3A 4JMNA 4O2CA 2C3VB 4RIRB 4MYWB 1KCSL 1BDYA 4EXKA 3G08B 4AYEC 3APNA 1SHMA 1O5DT 3DGGB 2QR0A 3ULUC 3I75B 1KGCD 4O5LH 4JM2A 3WSQL 3HS8A 4HEME 4IS6B 4K9EH 3TNNB 3QZBA 3LNIA 2ZCZA 3MRBA 4JZNA 4KK5D 5AG8A 3IDYC 2Q20A 2N1KA 3P11H 1W72B 5D70L 3US9A 3ZTCC 3FQUB 5A6LA 5HGGS 3AB0C 3TT3L 4D9LH 4BKSC 2AGJL 4L8BB 1YRKA 4YZWA 1FN4B 4FQ2H 2XFXB 3AVEA 4JRXE 2IDTA 3G5VA 5D7KD 3B7TA 4EKXA 2PCPA 4WSKA 3EYVB 3ILDA 3RQ3A 5GS0L 12E8L 2Y69B 4GBXB 5KJ7E 3FB6A 4QWWC 5DMJB 1NFAA 2VR4A 1MREH 1DBMH 3U2JA 5I1HH 5JXED 3FAWA 4QOKE 2FR4B 3Q48A 3QUZC 5I8KL 4PJ8C 4PS4H 4E41B 3WO4B 1QMUA 3QI9A 3FW6A 3QVAA 4Q2ZA 4MX7B 3RY5A 3VXRA 4YFEA 3MHZA 3T04D 1E5BA 3QORB 3L5WB 3O8XB 2JELL 4OLXL 2NY3B 1PCSA 3CVIH 2BSDA 4LCVA 3MRPA 4UIMA 1XO8A 1NEZA 5C92A 3CDGB 1SY6A 5D1ZI 5CZKA 2CGYA 3QEQD 3FB5A 4Z8FH 5A2FA 3VWKC 5F7FA 3HZVB 3QIBC 2Z7WA 5HI5C 2OAAA 4PD4K 3S36X 3AITA 1E5YA 1UM5H 2ZOLA 1IGCH 1QWUA 2JFCA 3FU6A 5F9WB 4FFTA 3TEUA 1PS3A 3BWUC 2P52A 1BMWA 1IBFA 2RGSA 2XXFA 5HHOD 1LEGA 3C2AH 3O0RH 3JXAA 5C07E 2OYKA 1JL8A 2D73A 1IAKA 4N2KA 4LLMB 2R1YA 4LAQL 5DVPA 4WNQB 3SQRA 4JO3L 1PBYA 3QNYA 2BOBA 2FX9L 3DROA 3WO3B 4A7VA 1CGXA 2OJZH 3RWJA 2FL5A 5I0DA 3SGJA 2ZOTA 1BLNA 2HLAA 2IWEA 3AUVA 4DZ8A 4WI7A 5IBUG 2YQ3A 2FUQA 2WSPA 1SJEB 3CDCA 3P0GB 5ALBH 1GGBH 3BEWB 2BWQA 3GK8L 3MBWA 4JRWA 5GGQL 2EXTA 1USZA 2UX6A 4HIPA 1UGKA 5J1AA 3D9AH 3CK0L 4U1KB 2EIMB 4PB0H 4YPJA 3T4AB 2CIIA 5AZ2L 4DP5X 5I6MA 3KLHC 3N40F 4ZD3L 3TO2A 4D0DA 3NVQA 5CP3H 1E4JA 4P9HH 1DQDH 1J0ZA 4LVOC 3ABMB 4P23D 2AI0L 3MRGB 4JJOA 3QZWG 4JQXC 2GK0A 1Y6MR 2GT9A 4G7SB 2P8PB 3IJ9A 5E8EA 3EGXA 2O26U 1GGCH 2VXQL 8PAZA 1IM9D 4HPOH 4UMGA 4ZW8A 4U31A 2ITDA 3HG5A 3MOAL 5DQJB 3NN8A 4N28A 5FHBH 4FFVD 3L2NA 3LS4H 4H8VA 5IY5B 4OD1L 1DVFC 5FUCE 2IADB 2VC2B 1KPVA 3KW7A 3OX8A 4Y2DC 4N24A 1IE5A 1VCAA 4G7RB 1IMHC 3QWOB 3IU4L 1CU4H 2NSMA 2DIEA 1CTOA 1YDPA 4AVKA 3DDFA 4O9HL 5D6DC 4BA0A 5FA3B 4DP4X 3CSYA 1JPTL 1KCBA 3MNZB 1S46A 2IH1B 1GCFA 4HZLB 1EUTA 4M3HA 3ARYA 3OLDA 4LVHB 4PREA 2VL5A 1ORSA 3KWUA 3VYOA 5DJ6B 4WHCA 2G75B 1YQVH 1I8IA 3FO2A 3CBKB 1N5AA 1I7ZB 3NPSC 4CUCA 1NFDE 3ZKNC 4JFQB 1TZGH 4N90D 4I1RA 4O00A 1WPCA 5E94A 3QHFH 5D2LF 2BP8B 1AS7A 3R8QA 4MRBA 1CLCA 4FKEA 4I1NB 1DQTA 1GOFA 1P69B 1ERNA 1K5NB 3QUXB 2YAOA 4NIYE 2F8OA 1UHVA 2HRPL 2OMUB 3HLAA 4JB9H 1M4KA 1OE3A 4RMVA 3MODL 3WKQA 3TN0B 5B3JE 3ELAT 3AXHA 4P5MB 3AY2A 2KBGA 4IEFB 2R2BB 1A1MB 1IGML 2A77H 1CE6B 5IP4A 1RK1A 1KN4L 1YNTB 2HFEA 3LQAC 1KTRL 5IB2A 4G8IA 5L2KB 1G1OA 1MLBB 3O6MH 4PW4A 2J8UA 2QELA 2VGLM 5BW7C 3Q0HA 2PNDA 4K7PX 4NWTH 2VDML 1BVKA 4R4BA 4WRLA 1XSKA 5DJCB 5EZJA 3ZHFA 3T71A 2Y06L 3BWAA 3MLYH 4YIQA 1U8CA 1T1WB 4EQ3A 1T7XA 4KQ4H 4RZKA 5ISZA 3WKPA 2DDQH 1F3RB 4MA7H 2YN3A 2K7QA 3EBHA 3QG7H 1AC0A 3AWFA 5F9JA 5FUZH 4AYFB 4B60A 5FGCB 1A1NB 2XKSA 2VN4A 4X83A 4ZDHB 4YSQA 5I1DB 3DC0A 3Q9QA 4WLCA 1NFKA 2UUDH 1OSZA 1RD6A 1U8KA 3FO0L 1A9BA 4H13C 1ES0B 2DLEA 2IPTH 4N4YB 4TSAH 1FIGH 4GEIA 5CJXC 4TRPH 4MA3A 3ZHLA 4GO8A 1KCKA 3CCHB 2E7CA 1NPNA 3PPSA 4GG8B 2VDNL 5DUPH 1KLFA 4HXAH 2FYVA 4JFWA 3HR5B 3FUFA 3QJTB 2VDKH 5DK0A 1JDCA 2VR3A 2VXSL 2X40A 4BE5A 3QQ4A 4FL4C 3ZDYF 2I9TB 1EZSA 3H2QA 3G04B 4LL9A 3RNQB 1SYSA 2OL3B 3Q6GH 4HK0B 3VQ2C 1HXMA 4QMEA 3HAEA 3MJ7B 4K0OA 1WS7A 5EU5A 5SWZA 1EJ6A 1XHHA 1DQMH 4F92B 3NJGA 5J11C 1I1YB 4UV4L 4RMRA 1OHQA 1F11A 2Z34A 2XXGA 4FQJL 4NQEA 4P46C 4F9LA 2JKNA 5J06A 1F5WA 2WAQA 3S5LA 3V6OA 1TTAA 2WGNB 4KPHL 3TP4A 4L9DA 4FLHA 4AIZB 1EEUA 1SBSL 4WK0B 3P4OB 3VFWA 1YZZA 3ML8A 4X8JB 3RDTB 2EIZA 1D6VH 1UZ6E 2W9EH 4OIBA 5ANMA 4FCAA 3GRGA 3W1ZA 3DV4A 4LPXA 4NP4H 4CMHC 5TE7H 4Q9QH 3FTVA 4XCFH 3V5DB 4M4RB 4K5MA 4ONFL 5HDQH 3TBVB 2OMTA 5KBLA 2N0MA 3S5YA 1AYOA 2UWEF 3RX7A 3GZKA 3ZYIA 5AVYB 2X4UB 3KYMB 1S9WB 4JPVH 4PY8I 4BSJA 2L7QA 3HE6C 3WFDL 3QR2A 4F58L 5T5NG 5KAQG 3VFSA 3QPQD 1K8IB 3W9EA 5AAWA 3GNMH 5E5LA 4Y4HB 4EDXB 4NNPL 2YBRA 3MNWB 3QEHB 3IGKA 4HF5L 1GKOA 4JHWH 1SMOA 4IBUA 1QO3B 4N0YH 3VXMA 4RGNC 3IU3B 3P9WB 4HC1A 2BC4B 4JHVA 3CH1B 1WFTA 2CUIA 1NAKH 2BNRA 4W9CC 5LAXB 1HINL 3GSNH 3U9WA 2BY2A 5F8RC 4S1QH 3STZB 3CBRA 4X9GA 2W65B 3MRQA 4H8WL 2J8UE 5T1DH 3ISRA 1L6XA 1PD6A 1IEAB 4E42A 3RYMA 2WXIA 2RTTA 5DSCA 3GD1C 5F6IC 2EE6A 5GPRA 3LKPA 3DJ9A 4AK2A 2PR4L 5A6IA 3EYUL 3RVWD 1OSPH 4A2DA 5ISZE 3ARDD 2ODIA 3CFEA 3K0YA 3CBJB 3CTTA 5F6HJ 1KENH 4NNYA 2B0SH 1MG3C 2AANA 1CFBA 1CD8A 2C4FU 4XCNB 1G7JB 5A3IC 2OMXB 3F7RA 4AEHL 3KEHA 5C2BL 1E40A 1GZPB 2G9KA 4XVJH 1YECH 3VD1A 4WTQA 4RA3A 5KSBA 3CLFL 2IXQB 4X9HA 3WKML 2J1YA 4XCYA 4F7CB 1LEIB 4B6ZA 5H94B 2A6KB 2CKBH 1EEYA 4OLVH 4R8WL 1JRHH 4EN3C 3MRDA 1W16A 4Y5XB 1A8JH 1P4IH 2AJSH 1DN0A 3L4VA 4HWBH 1C08A 1K4CA 2WN3A 1NMBH 4OCNC 1FNSL 5L2JB 2D0FA 1TTGA 2GW5A 4JY5L 5CGYC 5JO5A 4HFWA 4WO4D 4XP1H 1I3GH 4NUPA 3LZPA 4G3YL 4YK4B 3BYYA 3IFLL 3TH4T 1EZUA 3EUUA 4N8VA 5GGTH 4G6ML 3A21A 2XY2A 2ROYA 2EYRA 1DVUA 2ZNWA 4AGOA 2BPBA 2WMPA 1WZMA 4YXKH 1AE6H 3MLWH 3FU5A 3IE4A 4N90E 3TCTA 4NRYB 1Q1JL 4Y9CA 4ODTH 3HG3A 3PJLA 3FL7A 2FSDA 2XICA 1FFPA 4QRRD 5KZCD 2LHAA 5JDSA 1PCXA 1QFWH 3U79A 1TZHB 1CR9L 3QJHA 4KFMA 3U36B 4DKEH 3NAAH 5AD0B 4WTZG 1SJXA 1MNUH 2UY7A 4BEIA 5BS0D 2CIKB 1A4JA 2R29L 4OZFA 2XNAB 4M6OL 3A0OA 4PHXA 1NCAL 1X4XA 1PAZA 2NXYB 3EYFA 4OF3A 3W11C 3L3DA 3FBQA 5B4MD 1JHKH 4U3XA 5T8IA 3B2PA 3P0YH 4HFUL 2Q3XA 1WYJA 4W9IC 1IVTA 5G4MA 4B95C 3X1BA 1X4ZA 4PGCB 1G9EA 1RZGA 1KDIA 3C6SB 2R69A 5DGQA 5EU6B 5CSBA 3VXME 4DP0X 2Y9RT 1XDTT 4KKNA 4NZTL 2VZTA 1WFIA 2BNRE 3L3OA 2KHAA 4BFNA 1Y0LA 2H0FA 3I3EA 1N67A 2R15A 4ZQKA 3L4ZA 5HYQA 3FU3A 3GS7A 5FYJL 3MCG1 4Y5YB 5ABAA 2GIXA 4U1MA 5C0EB 4CC0A 5HHVL 2PPAA 2YPLD 5GGSB 3JV6B 1FBIH 1TITA 4DN3L 3HJEA 2A38A 1NAML 4M5YH 4IIQA 4ZAKA 5E0QA 3E3QC 1QBBA 5E6ID 3WN5B 3DX4A 2Y1ZA 1HH9B 3BRFA 2ENPA 1GW6A 2DLIA 3X11B 5AVZB 4HWEH 3QJZA 5DD3H 2WY3B 1U2CA 1URIA 1IM3D 1PZAA 5ADPL 4G7YH 2ZKWA 3D1MC 3RJDA 1GYAA 4PRDB 4XXWA 4JL1A 3BDYL 5EUOA 3U46A 2IO5A 5AVVB 1T7VA 4P3CH 1OE1A 4A7TA 1XF2B 1MCSA 2NQDA 3F58L 2ZXEB 3O2DL 2NUTA 5EZIL 4U1IA 1SDAB 1RZPA 2ARJA 2PCFA 1GGIH 4NM8L 3WEMA 2Y2WA 3WGUB 4LLVA 3GO1H 4GBXC 1BVZA 1WFNA 2F54A 1L3NA 2WNGA 1HVXA 2X7LA 3QIWB 3QULB 2DM3A 4IDJH 2Z31B 5CXPA 5BV7L 4L4TB 1H9VA 3WYRA 4MQXD 1QR1B 4CRPA 5HI4D 3X13A 5DO2C 5IM7B 4E5XG 4UZUA 3WO4C 2WYHA 4L3CB 4LLWB 4V1DD 4WWKB 4Q7DA 1U8NA 5E8OB 4D0CB 4OZIB 4XE5B 1KT2B 3QORC 3O8XC 3IKKA 2DWXA 2EILB 5DYOB 2NY3C 4AMXA 3WTWA 4BFEA 5CILL 5JIDA 1D3CA 2UZYA 3G6AA 4KWUA 2OCJA 3MA9H 4GG6B 1HH6A 1D5BA 2Y6TE 1AQDB 4EO5A 1PLGL 1PG7X 2VLKB 1INEL 2I5YH 3CX5J 1IC0A 4PI0A 5KN5B 1XEDA 2Z3FA 3B5GA 3AAZA 4IRZH 2VDRB 3GIVA 3EW3B 3OZ9H 4UU9A 5DJ2A 4TPRH 2PF6A 3CMGA 1KG0A 4LB8A 5F9WC 4R5VA 1BQHA 2G9HA 4PCKA 1YG9A 3AUWB 2Y6SC 3CV5A 3MRLA 2ZWNA 5BQ7B 2H2PC 5BVJA 5C09D 3GPSA 5DR5L 2EKSB 3TM6A 2OJEA 2BHFA 5FYKU 4XOCA 1MCBA 3KPPA 4NSKA 4DVRH 4KK8C 2XVLA 5D1ZD 1NEUA 2YD0A 4HOMA 2K8QA 2XTJB 1BIHA 2ICES 3GSVA 3FB8B 1A25A 5IKCA 1HCZA 3MJ9H 4S1SH 4A63A 3HMXA 1I1FB 1HEZA 3P40A 1NIEA 3OAUH 3UBFA 4QHNA 1WFMA 1TXKA 5LN4A 3T4AC 3IFNL 3U9UA 2FCBA 5L88L 3HNVH 2VAAA 3RWHA 3QJFA 2X0VA 5I30H 3PGFH 4AL8H 3H0TA 1LNUA 4U49A 1BX2B 3WHXA 4Y1TA 4H1LA 3S3BB 3SE8L 4JRFA 3MXWL 5DK3A 3BP5B 3X12A 2BH0A 2QV2A 3BVDB 5I75B 4GQZA 1S7SA 4J3UA 1LD9B 1IZKA 1OAKL 4OU3A 4UI2A 1J8HA 2V2XA 4KRPB 3L3IA 1MRCH 4CSTA 1IL1A 3QS2A 5CO1A 1BQLH 3IGLA 3KR3H 1FFTB 4XX1G 5E03A 5C0JA 4XNUL 3SPVB 4FNLL 3L13A 4ENEC 1OANA 2YUWA 1JFQL 2FJFB 4RMSA 4WKXA 1BJ8A 2AXFB 3L95A 3OHMB 5BXFB 3VFMA 2VERA 2IALB 2E4TA 5EEUA 1KPUA 3BAXA 5CBAB 3KH4A 1ETB1 2Y2TA 4HUNB 2ZP0T 2FO4B 2NY6B 5D7JD 4P3WA 3FQTB 1W8EA 3LZNA 3INUL 4XP5L 3O3AA 2A6JA 1LO4H 3QNFA 1KB5B 1BAGA 1JXJA 1EBAA 2G2NA 4LVHC 4EI6A 1OOWA 2YJQA 4PMFA 4Z18A 3V0FA 2F54E 3W39B 5ESVA 2P45B 4LCUA 2K3TA 1RFDL 3GMPA 3B8YA 5ESQA 5EU3A 4J5VA 3HKZA 2OA9A 4IOSA 2QKIC 3IN2A 1AQKL 3D2TA 1HZHH 3MOBL 3ZE2F 1G7HB 3BKML 1ZLEA 3CN2A 1PFCA 2XWBA 2CH8A 5IVXA 5IVZB 3AU0A 2H0PA 4N2AA 5E1AB 2VLRA 5INDB 2H9GA 1AMXA 5BS0E 5E4AA 3OQ3B 3MLZL 5IEHB 2JB6B 2BVUA 1S7RA 4UMSA 4YUEL 5EU4A 3TN0C 1QLRB 4PJIF 4G9FD 1UFUA 2VW4A 3IPFA 4KUCF 4I0CC 5CMAA 4XR8C 4XMLL 4C8XA 1WC7A 3F83A 4Z77A 4AYMC 5HHMB 4JN1L 4X5XB 4GSRA 3VSQA 1RUAL 2NY7H 1AP2B 1CDJA 3LZFL 5DD5H 1XL6A 1TJXA 2Z8SA 3BKCL 4R96A 3CFTA 5BVPH 1QZNA 2OCCB 4NO3A 4IGBD 5KYXB 1HCFX 2VW7A 2YPLE 1NMCB 1WZAA 3I9IA 2MQ3A 3N40P 2KLTA 5BNXD 2ZJSH 5JLZB 3O11A 4NQDB 1PZ5A 4PJHF 3TIEA 2AXHA 3VG0H 3MFFA 1FCCA 4FA7B 1ZA6B 4NS0A 3KPRD 1QACA 4ZSOA 1J9RA 2XA8H 4N9OB 5JDJA 3PWUA 5KVMC 1EGJL 3U1SH 3FTGB 2R8SL 4L8CA 1E3XA 1SDDB 1K8DA 3U48A 1HNGA 4Y1AB 2NX5D 1R0AH 4XAKE 1AKJA 4NUQA 2BLFA 4JX0A 4KVNL 4R2GD 4Y5VA 5IR1A 3IDJA 3WE1A 3FQ2A 4IOIA 4X98B 4YVNA 1EFQA 3H6JA 4X6CA 1A1OA 4I48A 1VACA 5F7MC 2HRHA 3HB3B 5JIHA 3T9WA 3V9CA 2QJDA 3QEUB 3QXAA 3MLSH 3GSXA 1UT2A 2Q86B 1JV5A 2H3NA 1BG1A 1P9MC 3IPBA 2VQ4A 2Z7YA 3BVNB 4N1HB 1VZIA 1H8NA 1P7QA 2WXHA 4QRTA 1RZKH 2WP3O 1WITA 3K4DA 1YEGL 4BWTA 3WLBB 2B4CC 4TUOB 4HXBL 3DVGB 2YXVA 3OJ2C 1S7UB 4GSXA 5E2UL 4PRNB 3G5ZB 4FA6A 5E7BA 1R3IL 2A0LD 3KXFA 4V1DE 3TFBA 4AVHA 4JHBA 3RDTC 2HMIC 1NGXA 3ARFB 4UQIM 4IBVA 6CGTA 3HZKB 3WV0A 4QYOB 5DFVD 1FZJA 1DCLA 25C8H 2DQTH 3GZOA 3NMEA 5JMRA 4FA8A 1Z5LA 5I16B 2YD6A 1J5OL 4AE1A 4G42A 4I13B 4S11A 5I8EB 5EBMA 3MR9A 1RZJH 2X4PB 4KDTA 2Z8WC 1IAOB 1MPAH 4PRHA 1S6NA 1P7KB 1EMTH 2AJ3B 1JHTA 2PTUA 2Y25A 5AOKA 5IVXE 2J6WA 2WKOF 4DPRA 4JRXB 2VLRE 4LAJH 4TSCH 3BAKA 3MBXL 2HT4D 3N85H 4OFIA 2ZWSA 4X80L 4Y4HC 4DGVH 5BRZA 4LLQB 1BWWA 4L1SA 5HYJB 4UTBL 2LLGA 4N5EC 4H25A 4RQQA 4DK5A 3DMMB 3AW5A 3KL0A 5LGHH 3MUGA 1VGKA 3H85A 3DV6B 1KB9J 4QOKB 3TIDA 3QCVL 1KGIA 3P3YA 3POHA 1KACB 2AXGB 4P5TB 4ERSL 1JUFA 4M5TA 3C60A 4G71B 1LL1A 4TULH 4KJPC 4LSVH 1EHKB 3M86A 5F44A 1CLOL 1ZDSA 4LARL 3FB7A 5BJTB 5IMOB 4YNYB 1CI3M 1AZRA 1NFIA 1XIWA 5HGBB 2CRMA 2R7EA 2QSVA 2E7HA 3N3EA 1KJ2H 1XGRB 1C5DA 3ABKB 5HGDA 1IQDA 1FNFA 1UWFA 4WUUA 2DN7A 3UAFA 5CJOL 4APQD 2X1QA 4LRNL 1MEXL 2P7TA 2WTOA 2X4QB 4I18B 4OCMC 5C07B 4UQAA 4XMZA 2BHZA 1XMWA 2APFA 2Z7UA 4OGAC 2BP5M 4X50A 2NR6D 4IOFC 5E8DL 3FFDA 4YHOL 4Y5XC 1HHIB 2R0KL 3DX3A 4GUPA 2WSDA 1AXTL 4UTAL 4F3FA 4DK3A 4EIBA 5KBPA 1AGDB 1QSFD 2I60L 5MERB 1INQB 2IAMB 2XOTA 3HG1A 4L3ED 3D4ZA 1A6TB 2R1XA 3QZWA 4XH2B 5AW9B 4PGEB 1AHMA 1ZVSA 2JB5L 4FKHA 4RFEA 1OP3K 1AO7A 3FTWA 4YK4C 3KM2A 4AV5A 3BLKA 1G5GA 3PL6D 3CQPA 3EYOA 1FE8L 1MCOH 4P07A 3F7VA 3T4YB 4Q9RL 1OAXL 3V5HA 2VDPH 2GI7A 3SEPA 3QDGD 3MNMA 4FQXB 5KS9F 4Y4KA 5AOLA 1NC4D 1F4HA 3KYKL 1MOEA 4YHIA 4XP9L 1CC3A 2WIIA 1F4XL 2IANA 4A7GA 1TTRA 4XMVA 3GQFA 1IARB 1D5ZA 2Q76A 5DCCA 5SX4H 1IGFL 3FC8A 4LBAA 2RHEA 2YEZB 3OB0H 4N2MA 4JFZL 5MP6L 5DRWB 4XMXA 2KZKA 1OKEA 2IH3B 4FFZA 2RB8A 4KUZL 2Z65C 4R7NA 3V4UL 1PF3A 1V5JA 1EHXA 2BSSB 4G9FE 3L5JA 4QXWA 2AEIT 3SDCD 4B53A 3OV6A 4PRHE 1FZMB 4F2EA 1PX8A 2B7DT 3N41F 4GRMB 5DRNA 5DD1L 2NOYA 2NXYC 3RZCB 2L4OA 5KYWB 3VD2A 1DVXA 4YDKH 2CDFA 5CZVH 3QUMH 4JJ5A 5BRZE 1WS8A 4TQ8A 3FB6B 4YSSA 4NO5B 2E59A 4MCZA 3ROOA 4U1JB 4M48H 2YRLA 4XPFH 3GXPA 4ZXBD 1NFDB 5K1JA 4ELMA 1UWGH 3K7UA 4A37A 2YD7A 2APVA 3QRBA 4TTDD 1SDYA 5ENWA 4J4PA 2PLTA 5T1LB 3QFDA 1IC4L 3EO0A 1ZT4B 4HJTA 4Y5YC 4X6FA 4PJFF 5EA0L 1C5CH 1QA9A 5FHAL 2B9AA 2AQ2A 1N6VA 3BFWA 3HZ3A 1PYWA 2GY5A 3CC5A 4WGWB 5BPPA 3ARED 2FQGA 2XBDA 3DK0A 3JWOC 3WN5C 1E4XI 5JR1L 2NX5E 1YPZF 2IMMA 4F2FA 4JY4B 1H0DB 3QJSB 1TSHA 4PJBB 1G0YR 4CN1A 3ZE0B 2BSED 4WUKH 4F57H 5E08L 3G5XB 1QLFA 3WNKA 2G3XA 4WUUE 1UCBL 2Q2LA 2VXVL 3BW9A 3D48R 4H0GA 1LEGB 3ULVC 1P5UB 4ZFOA 4KK6D 3HE7B 1M7XA 4X7TB 1T22A 4HS6B 3Q8BA 1XSOA 2ZCHH 4TOYL 3R0MA 1JZ2A 3PV7A 3FXIC 2VO5A 1CDYA 3TA3A 3ECQA 5IBTH 1MHCA 3RWJB 4G1MA 3CX5K 3I6GB 5A1AA 2O93L 2R9HC 1FAIH 4IU3A 1PMYA 2YRPA 2CO4A 3SOTA 1NGWA 1ND0A 4XGZB 4GPVA 1E4KA 2IGFL 3O9WA 2YPVL 3IJYB 4PN6A 4Q8BA 3QIWC 1FO0L 3HI1A 1LM8V 1FHNA 1U8HA 2Z31C 1BJ1H 3HG2A 3TO2B 4D0DB 1UQSB 1UB5A 3LMJH 4O58L 3SN6N 1FJ1B 5FA4B 1OXYA 2L3BA 3T1WA 4LSQL 4WWKC 2GT9B 5HBBA 4EDWH 2CM6A 1SXNA 1RI8A 3DRQB 4I3GA 1CK0L 1IRAY 5TE4H 3OKEB 4EIGB 4XZUB 3ILQD 2FB4L 2V5YA 3BYTA 1KCSH 2ITDB 1H8OA 1RZIB 2IWKA 3QEGL 4UM9D 4ZPTA 2YSSA 4BFJA 3GB7A 3T6QC 2VR6A 4S0HA 3BRDA 1UD8A 3TPUA 4ILDA 1CN4A 1JZ6A 4KKAD 3T6ZA 3WSQH 4AENA 1KPVB 4J7RA 5CEYB 4Z0BH 1QEWA 3MA7A 2BIOA 4NKMB 2GAZB 5GGVL 1T7ZA 3FOMA 3TT3H 4NKDB 3L6FA 3WEOA 5ICZB 5K9OB 4GH7B 1SFDA 1GHFH 3E8UL 3MRIB 1GY1A 4R7DB 2ZOUA 4XC3L 1E5AA 5EBLB 1OCCB 1XF5B 5CP3A 4LFHG 1A47A 2AJZA 3BWZA 2VN5A 4NQTA 4WEUD 3QG6A 3IMRA 1Q9LB 3SJVA 1Q9WB 1S7VB 2OS7A 2XTJC 1J8RA 5C0DA 4Q4EA 1FVDB 2FECI 5TQ2H 2JCWA 1UB6A 3ARBA 4RH4A 3WIIL 1BMZA 4K9EC 3X14A 4F2MA 1QSED 1E6OL 5LVEA 3TBTA 2ESVA 3OVUB 3WNMA 4Z7OE 1PTZA 1AR2A 5DEFA 3TO4A 1GZQA 4PS7A 1TETH 3SKJH 1PIFA 5HHOB 3QYCA 4NCDA 1YC8A 4OZHF 2MFNA 4MXVF 2OYLA 2UZPA 4AQEA 2X28A 5BOZG 2CNYA 4F93B 2GJ6A 3G6DL 1MCJA 5TDOB 5I75C 3MUUA 4HS8H 5IFHH 3NCBB 4KTGA 5IB2B 4KQ3L 1DP0A 4NO0D 4DUXA 4CW1A 3ATDA 1L7TH 4LHUB 4AI7A 3GI9L 3H4HA 1U3HA 4KRPC 2J8UB 1MWAL 1AAJA 3HMWH 5HP5A 2Z4QA 5B21A 5E24E 5EZJB 2DEWX 4KKLD 1BBJB 1CD9B 3CVHL 4Q56A 4L3EE 2HJFA 4A2HA 3QO0B 4FYSA 1DO5A 1NGQH 5ISZB 1EJOL 2YAEA 4KJWC 4J8RA 4P06A 2ADFL 1MW2A 8CGTA 2FX9H 2IH9A 4MJ6B 4UQBA 2NY6C 2HJKA 5E1QA 2OQJA 3P9MA 1JZ7A 1MFBH 1IEBA 5KJRH 1IM9B 1G6VK 5FV1L 2P5WA 3FSZA 4UDUA 3SGEI 4U1LB 4Z7IA 3CK0H 5HXMA 5J1SC 1IQWH 3AXLA 1KLFB 1OLLA 2CBOA 3KGUA 1N12A 2DQJH 4HLJA 3TS8A 3MCKA 4AM0B 1BZ9A 3F84A 1K3ZA 1W15A 3L1OL 1AS8A 2FD6L 1RPKA 4DT2A 1J48A 1DFXA 2ZCKH 2GSIA 3QNZA 1A6WL 4URTB 5C97A 1RURL 2VXQH 4LU5H 4FQ1H 4MSWA 1SBBA 3L54A 1EEZA 2CZNA 5T3XD 5J57B 1OK0A 1ZHKA 3M07A 4XAWH 1BQKA 1CGVA 3EO9L 2ZKYA 5C0NC 2D8KA 3GRWL 4WI6A 2PCXA 3T65B 4D9RD 4TSBL 3JWNE 4OFYA 2OX5B 4BDVB 3H9HA 2QHLA 3QUKA 4HD5A 5IJKA 2DD8L 1OAQL 4OZ4B 4JKPL 3KDMA 2W80C 1KYDA 5E2VH 3ES6B 5CHNA 1CQKA 2Q9OA 2ZG1A 1NGYA 1JNJA 1HSAB 2DQEL 4JO1H 1IILE 3IU4H 5IJVA 1AHWB 5C2UB 2X6BA 3VFNA 4WENB 4O9HH 2AHIA 1F2QA 2Z91B 3L5HA 4LF3B 5BO1L 1HIML 1NBQA 3PHQA 5IHUL 2WLZA 2BSTA 3F05A 4XP4H 4KHTL 2E7MA 1J5CA 1FNLA 4RNRB 1N19A 1EX0A 1OF2B 3LSOB 1KOAA 1UXLA 4ZMPA 1CTMA 1NMCC 4AMWA 2I26N 3HNTL 2JKJA 3B3IB 4QXTA 1F6AA 1KCRL 5E2JA 3UBXI 3V4PH 3FQ1A 3PV6B 1LXMA 2EP6A 2E86A 1WISA 4YXHL 4HOXA 1RZFL 2JXMA 4FI8A 5EC1A 4F2ME 4XHJC 4YXLL 3IDIB 5AFAA 4BQCA 5F6HI 4AV4A 3QWNA 3VJ6B 1KYFA 2W0FA 2PUQT 3CLWA 1MHPL 1TG8A 3GKWL 3MRFB 1BHGA 1S9YB 3CPUA 3CQFA 3D4GA 2RBLA 4KTEL 4M8QB 4YDIH 1LO0H 3ZX1A 3KVQA 4HCRH 3KAAA 4POYA 3LN4B 4P49A 2YFNA 2OR9L 3O6KL 4WW2A 1KEGL 3MODH 2QFRA 2Y36H 1WFJA 1NGPH 1M6OA 2F5BL 3ZDZE 1KN4H 4JGJA 1L5GA 3HB3C 1IKOP 4F7KA 3LNGA 5D7IE 4OGXH 2YAMA 3F12B 2X2UA 3LPPA 4ZW3A 5I1KL 2PYED 5E4OA 2CE6A 7CGTA 1JK9A 5JQ6H 2C9XA 1E5UI 3FDWA 1ZXQA 4ZMVA 1YEEH 3P77A 5FYLL 1ZD6A 3PWLB 1MJ8L 2JTYA 2ATAA 4DSYA 2WINB 5E9AA 1TJHH 4K94C 3LRHA 1EO8H 2EJ1A 5SV3A 4ZW7A 1ZK5A 4N8UA 1ZMYA 2NYYC 2F1BA 1KIPB 2IQ9H 4ZRGA 1TNMA 3ARFC 4F20A 3KD4A 2BNUB 2G3ZA 1UWEH 3FO0H 1G6RA 1L9SA 2OMWA 2ICEB 4R3SA 2R4RH 3RWIB 3VXTA 1IE4A 4G9DA 5L8KB 2W9DH 2BSRB 3GFUA 2JCCA 3NJMA 1GS6X 3GSNA 2DL2A 1AANA 1FI8C 2CNZA 2KKQA 4OBRA 4HVBA 3B2XA 5JHDA 1T2JA 1VFAB 3A4AA 1C08B 3E9UA 5AB1A 1S7WA 2B08A 1MELA 1SXCA 1SYVB 5AQ0A 4AG4H 2EC8A 5I5JA 4BYHA 4E5XA 3GWJA 1DVSA 1JG9A 3SE9L 4P2QD 1GIGH 2NDFA 1ZWIB 5C08D 1R9FA 3ASWA 3DMMC 2ZUVA 1B4JL 2VLJA 4GS7B 1HCVA 2XIBA 4LKCB 2VNCA 3WXVL 4WK4B 2FJGB 4AM0Q 3IGUA 1XZ0A 5FB8A 4P5TC 4HHWA 4GW5B 4C55A 5GZOD 2CRIA 4I85A 4ABQA 2E27L 1QSEE 1JGDA 3HS0A 3LEXB 5HGAB 3IGAA 1N7MH 5AUMA 3U0PB 1JF5A 3WY1A 3MV9A 2BJML 5JORA 5MEPA 3OR6B 3WIHL 4EXPX 1SZNA 3QJHB 4HWBA 4YHPA 1RIUH 3MO1B 3TEWA 4FZEH 2DJ4A 2BO0A 1Q72L 4L8DB 5GGUA 3BPCA 1HHHA 1XH2A 3BP4B 5TK2A 3TZVA 1D5XB 4I18C 4LCCB 4MJJA 2L7UA 2HWZL 5CGTA 1LEKA 5HVHC 4PWKA 3PP3H 2YS4A 3WL9B 3HC3H 2BS8A 4XVUC 1VFUA 1WD9A 4F58H 1OGAD 2DICA 2Q7NA 4U1NA 3JUYA 3ZO0A 4NNPH 3GMOA 3RVTC 4KNQA 4N0CC 1YO4A 5KTEL 4U1HA 2JK5A 3II2A 2O6FA 1TQBB 3FONA 4FQLH 4X5PA 2G5BB 2MPVA 3K8LA 4G11A 5TD4A 4LNRB 4RBPK 4R83A 1KBPA 1QI3A 3ARDB 1DBKL 1TF4A 3GSOB 4TNFA 3JWNH 1G4RA 3LH9A 3EOBB 3L3OB 4ZS6D 4K3GA 4D2NA 2IAMC 3DO4A 2HTKD 4AGNA 1HINH 2JKIS 4LCWA 5TJWK 1I8KB 1VF5C 4WY7H 4H8WH 5LCVH 3GXUB 4U1MB 4PVLA 1U95A 2WUBH 5E8NB 4HETA 2VABB 2YLHA 2BZCA 2FT6A 2HFFA 2DAVA 1BEXA 3GRBA 3LN5B 5JIKA 5TE6L 4BUQA 1F90L 4M1DL 4FXTA 4HV8B 4FQXC 1M71B 4OI8A 1GZHC 3OWRA 1JXFA 1WTGT 2F7RA 3A47A 3D87B 1C16A 4QRSA 1PZ3A 4ETQB 2F0CA 5FXCH 5C2BH 1RUML 1GKEA 2FZ3B 2OXGB 2X2IA 1OW0C 4BZYA 3H9SA 3NCJL 5T3XE 4WO4B 3WKMH 1JF1A 1PSKL 5D4JA 4BSVA 4FNUA 5HTSA 1NINA 4P2OD 3SD5A 3H7BA 3UZQA 4KXAA 1X6NA 4DESA 3BIBX 4MD0A 2YUXA 1SLUA 2MCPH 3DUSA 3UTQA 4ODBD 3C6LA 3RZCC 3FQRB 1DEDA 3MREA 4GAJL 4HIEA 5IEKA 2ODHA 2ARJB 2PPEA 3WFHB 4FG6C 4KXDA 3VAEA 1EJFA 2DQGL 1MQKH 2EVGA 1FNSH 1KJ2B 2D31B 3WE6A 1G94A 3VFOA 4MDIB 4C83B 4HEPG 2F54B 5E4IA 1ZCRA 2X7LB 4PTUB 4WI2A 3V2AR 2WXKA 2BERA 1YYLL 1ZA3B 3C08H 3MTXA 3SCMA 2X4OB 2G60L 4UT7H 3STBA 4ZMAT 1Z1WA 1VDGA 1WJ3A 4TN9A 3WHE1 3LKOB 1I9JL 1XH3B 2ICCA 3OAZH 3QEQA 2WC7A 3ZDWA 4NRXB 3HPLB 3MVSA 3UDWC 2EDQA 3QNXA 4ZYKB 5BS0B 5J8OA 1H8SA 1UA7A 2AF2A 5CGBA 3VWJA 3AY4A 5EEZA 1AXIB 1D5BB 1HYRC 2COQA 2CQVA 4P9ML 3SO5A 3UAJC 1SVCP 4AK1A 4BK5A 4A55A 1RIHH 3MYJA 4X6DF 5FW8A 1E6JH 4MVBC 2CO7A 1Q9OA 3BO8B 4R5XA 3VO0A 5E6YA 3DX1A 3CHSA 3BAEL 3RTLA 2ROXA 4YHMH 3WU1A 4NFBA 4QT5B 2NW2A 4LNVA 1WFOA 1ICTA 2G5RA 3BIKA 3SDAD 1FPTH 1V27A 4EZMA 1GS7A 4YSAA 3NP3A 3QQ9D 2X2JA 3LZLA 4WCYL 2R29H 2OSWA 3TVMA 1P5UC 4M6OH 2NLJA 1DLHA 3HE7C 1B9ZA 3BZEA 1NCAH 3RDJA 4QTHB 3ML9A 1JPSL 5DXWA 2YPLB 1I7TB 3KLDA 2PYEE 3TWCL 3JT2A 4GXVH 1EQWA 4QXUL 4JRYD 4R7LA 1WIUA 3C6EA 2X5PA 3HC0A 4I8DA 4X5QA 2R0LL 4ZJ9A 1CVRA 1SLVA 3DPBB 5E6IB 2OK0L 1NWOA 4OAWA 5L8JB 2ZXWB 3MNDA 3RB5A 3D18A 4P23A 3SBWA 3KPOA 2BHYA 4LCWE 3BQUD 3OJDA 1RY7B 4WW1B 4HX1B 2APXA 5KVDL 2V5TA 2UXVA 5FYJH 3RWHB 1IBYA 1IM3B 4IRZA 1JNNH 3QDMA 3T77B 2VH5L 4DN3H 4PRPD 3UZVB 4KK5C 3FSWA 4FNTA 3VW3L 2PCYA 5I1GL 1NAMH 5KW9L 5IGXL 1Z6JT 1CLZL 1MFAL 4N20A 3QDHA 2EDBA 3L3IB 1JHLH 5ICXB 2B9BA 4N0UE 5ESAB 2VDLB 5B1JC 4XO8A 1PD0A 1II4E 4JPIB 4OFPA 2ZKHL 4WFFE 4KK9D 5ADPH 4P2QE 3VFMB 3TTSA 3NDZE 1A6AB 1KPUB 4NUGH 4PJDA 3BP7A 1KNOB 1FYTD 3LH8A 4E36A 4FNPA 3OC5A 5IOPB 5JXEC 3EZJB 4O02L 3SPCA 3GHEL 2ORBL 4PWHA 4TVUA 2LOEA 4JDEA 3GHBH 5INCA 4QLRA 2JIXD 4HW6A 4V1DB 2LT9A 1NUFA 4K5PA 4BFIB 2CRZA 5I71B 1XX9C 4YHKH 3FNKA 4HJSA 1W0WA 1JERA 4NKOA 1BXAA 2UWEE 3KHOA 5DA4A 3V52L 4M6ML 2GI0A 4M93B 3LH2L 4XZ4A 1TCMA 5ESQB 2BVTA 2W07A 3KS0H 2R39A 4KGLA 3BUYA 3WKNA 4S2SA 1A14L 1RJYB 2G2RA 5I76B 3U2SB 4XNQB 3GS4A 3TESA 5A2JH 3TCLB 4YDZA 2AKRB 2WLLB 4L5FL 3V0GA 1KPRB 1ZY9A 3RJOA 4YHNB 2CGRH 4Z3FA 2Q3AA 4LVEA 5EBGA 1HJBC 1M3IA 5TDNB 5F96L 3J7HA 1ROWA 2KPNA 5JW4N 4M6NH 5L9DL 1PLGH 3BD3A 2EACA 2FLMA 1L6PA 1OGAE 1OZUA 5C09B 2JJUA 1I8LC 5CMAB 1EZVX 2FGZA 3MGTA 2ZSVB 5KVGE 4GNKB 5D1ZB 5T3XH 1DJIA 2JQAA 1EANA 5E2WL 1N10A 2K8MA 4L4VA 1QEXA 1X5IA 3FSVA 4HJIA 3EYQD 1ITBB 1KELL 2ATKA 1WWAX 4UAOB 1UJ3B 5T5FL 2FJHA 1HU8A 2DYSB 2HKAA 5J9PB 4PJ7A 1NCUA 5H2BA 4K23L 4Y7OC 4MMYA 4M43L 4G6KL 4HJJL 1JN6A 5JUEL 4ZOBA 1XB6A 1QAWA 2VB5A 4MQ7A 4WNJA 2V33A 4JQVA 1W72L 3AXIA 1VAHA 1UOLA 2ID5A 1R5WA 4FX5A 3CN1A 4N2LA 3TIEB 3GLAA 2QV4A 2X38A 3IMSA 3QSKB 5AKRA 5I1IL 4KMTH 4IK6A 4AZ8A 3VFGL 5DHDA 2YK1L 3K8MA 2H0JA 4NQVA 3OAWA 4D9QE 3DOSB 1ONQA 4FFVC 3IFNH 4ODWB 3VVVA 3PWPE 5IHZB 2OP4L 1N59A 1WCBA 1L9NA 3V4VH 1INDL 1XCQA 3DRTB 4YDMA 3MQIA 3RWGA 5CFAA 2UY6B 4TNGA 5F3HB 4WKZB 4HH9B 3SE8H 4UINH 3GTVA 1TYJA 5I1JL 2GCYA 3S35H 3K1KC 3PYCA 5AW1B 3FQNA 3FRPB 4GKNB 5D7JB 1OIOA 4CVWA 3HC2A 3JSSA 3QQ3B 4TLUA 4BD4A 3PIQA 2DQHL 2J3SA 4KAQL 5IQ9A 2A74B 1NCDH 4HP5A 4XNUH 4FNLH 4HIXL 5FIEA 4O51A 4P2CG 4PJDE 3REWA 1MFVA 2WJ5A 3W82A 4F8LA 5K69A 3W38A 2OJ1A 1R24B 4MB5A 5CJQL 1AHWC 3CFMA 4AL8C 5IG7A 1FFNB 1NIAA 4YHYB 3PP4L 2FWOB 1S8DA 2K6ZA 2X0UA 5BZXA 3VUAA 4A7UA 4Z5RB 4GAYB 1NBZB 1NGXB 2DF3A 5B8CB 5KSVB 4LEXL 3WTYA 4PJEA 4ZUTB 3KWVA 4PJ9A 5IQ7L 4GI6A 5I18H 4G9FB 2HPOA 4PRHB 3M45A 2EDTA 4KUCD 4OLZH 4MNGA 1V8HA 3UJIL 1H19A 1WGOA 4MNHB 4ZX5A 4KKZA 1YCSA 4HJ1A 4W9LC 1MIML 3LIUA 1AIFB 4FULA 1BZOA 1QFHA 1YEJL 3I2CH 3HVDA 3NIGF 2FQDA 1YNKL 3AMLA 4NIKB 3UJJH 4AQAA 1VFBB 2H6OA 2Y3AA 4CADA 4H25B 3P4NB 4ZNEA 1AR1D 1EO7A 5ETUB 1VGKB 3K5RA 4PP1D 4IGBB 4AYID 4I1PA 4LSTL 3MBED 2W92A 3S8GB 4XXCC 2NY1D 4PGBB 4YHLH 1ZSDA 2V9UA 4FXGB 5GHWL 3VXUA 4JRYE 3EOTL 1OM9A 1KFAL 5GZNA 1TO5A 5I1CH 2DWDA 3ULUD 1UUNA 1W0YT 1BOGA 4FE9A 5E9NA 2W88A 2Y2YA 2EDRA 4K71B 4M7KH 3C60B 4YSCA 6FABL 3IE9A 5F2FA 4KNTA 3LZFH 3GJFB 3NJVA 4B9KC 3IVKA 5FYKD 2VQUA 3CPLB 4O2EA 5BZDA 3R7QA 1TQSA 5H35A 2CKNA 3PGDB 3EF7A 1L9OA 2NX5B 2XU9A 5FFGA 5JA8B 1KJVB 4R2GB 4JGNA 4LP4A 1ZXKA 3FTSA 2DLHA 3LN9A 1B6DA 3ME0A 4WJ5A 1MRFH 3Q8CA 4F7EB 1KXQA 2L7JA 4ZZFA 5LQBH 2AK1L 4U6YB 4G72B 2ICEC 3ZGIA 1AVAA 1B0GA 2PP9A 3JWDH 2B3IA 4JE0A 1UD5A 4P05A 1MCCA 5IROA 3VFPA 1HAWA 1PG7L 5F9OL 5DJZA 1AOHA 2CR6A 3UC2A 1OGPA 4WU5A 3NGBB 1FYTE 4P4KB 3W5NA 5HDLA 2GG1A 1EV2E 1MLCA 4KJYA 2V2WA 4LOVA 4A6YH 2R1XB 2V8LA 3S34L 3SBQA 1BFVL 5DHXB 4PJXA 5DZJA 1PNDA 4LDEB 3U7YH 5LBSH 3FN0L 2A9NL 1KTJA 2XQBH 5SX5K 3OB8A 3IETA 5L7XL 2FO1A 4LQFH 1JGVH 2PW2B 3VI4F 3FQ4A 5TDPA 5DS8A 4ANVA 1MCHA 4NAQA 1IIKA 4F15B 3RWFA 3NJNA 4K7FB 1UCTA 4PRID 3C9NA 4QRRA 1JYNA 5DHYB 4YPGB 4I0KA 1ACXA 3RPBA 3VD7A 1DDTA 1S7QB 4HXBH 4PJCF 4MZIA 4IMKA 1YMMD 1Z0NA 2O5ZH 4GLRH 4JNXA 2PW1B 3RPIB 2IMNA 1JWUA 3GSRB 3K80A 3W2DL 3FTYA 4S0SD 3Q2LA 1NANI 1AQHA 4H4NA 2AZAA 2IFGA 4JFXB 4PJEE 1J5OH 5A16A 3A4DA 5TTRA 4MHHI 1XGQB 3IJSA 3QXVA 4NXKA 1QOKA 3KBFA 3N44F 2C26A 2QQLH 2FYYA 3V6ZB 2Z93A 15C8L 3BSGA 5TGBA 4QRPA 4LCCC 1UZ8A 5DRNB 2XWRA 4FLRA 4PWFA 2DQFA 3KEDA 2HAZA 4W6XB 1ADQL 3EOAA 5IIEA 1XTMA 2ADGB 1LDPL 5JQIB 5JHBA 5KUMA 3UO8B 5FUOH 1JGEA 3QUYD 2F53D 3F8UB 3N9GL 4JZJB 3RWEA 4P99A 1TQBC 1QBLL 5GS3A 3NZUA 3N1PC 3RVWC 2DMGA 1X5JA 3ARDC 4M5ZH 5F1SA 3WXWL 5CEZD 4AKQA 3L3OC 1TJMA 3BD4A 1KLGB 4WFHD 4YEEA 5D1XA 1I7UA 1YC7A 4XRCA 4G6JL 3TYFB 4PS8A 4RAUA 4Z7OB 5HVWA 1S5HA 4HAKA 1N8ZA 3PUUA 1RZJC 2DMKA 4UT9A 1ZVHA 5EUKA 5HHQA 5K9QG 2OL3L 2VDOB 4WI0A 4ZW5A 5DWPA 3WCYA 3CC5B 4J3SA 5ALCH 5AVTB 3UGXA 1CLOH 1M7DB 2V3DA 2P80D 4LARH 3DI2B 4HD9A 1NEPA 3DJRA 1IO4C 2X89D 4KX9A 2D3VA 4DGYL 5ILTH 3MRMB 5F7DB 3M1CA 1PL3A 4MZ3A 3SDYL 4ZX6A 1UFGA 2YEVB 1I9IH 2A3TA 1QLFB 3F2LA 5D72L 2CHZA 2Q6WB 5CD5D 3ESUF 2WWKO 4JFDD 2ZT9C 3L3HB 5FC9A 2B4CL 5DZNA 3QUMA 5CJOH 4LRNH 1MEXH 5F7HA 3D0VA 4L3EB 3DUUA 5B38B 1T22B 1DQJB 4ZMXA 6PCYA 1FZOB 4WO4C 3B2DC 1J0YA 3WENA 4DVBA 3HNSH 4PGDA 3FFCD 2VSDA 3PL6B 4KHXL 2ZXQA 3MMEA 3D2UD 3DPDA 4J3OF 4Y0GA 4UANA 2R0KH 2HVJA 3QDGB 4IU3B 3NA4A 1O7SA 4Y4FA 3K72A 1NC4B 1ND0B 3LDBB 5LGKA 2IFFH 3ZL4L 3NJHA 2R2HA 4KI5D 2CU9A 5LNDA 3RWCA 3ZE2E 4PJXE 3ZHDA 3QXUA 3WUWA 4BZ1L 2JB5H 3MROB 2VE6B 3QQXA 3UMNA 1UB5B 5DTFB 3FU0A 4QRQB 1FE8H 2CO1A 2M83A 1GGTA 4Q9RH 1CFQB 2OW7A 2DMBA 2JKLA 4GUCA 4IRJA 2N59A 4QTIL 3H2PA 4NM4L 1AHKA 4OJFH 1F8TL 3SDCB 3D3VE 3TNMB 4PJIE 1SEBA 2XETA 3EG9B 4MDRA 2HKHH 3KYKH 4I0PD 3A67L 3ECBA 4QGYA 3HPJA 5DI8A 3SO3B 3UL4A 5F1KC 3VH8G 1DJXA 1MW3A 2XY1A 3DIVA 3WFCH 5B4MC 1MZZA 1B3IA 4MQTB 2E6QA 1FNGB 2QEJA 4JFZH 5D4QA 5MP6H 2H32H 3ZO9A 3QXDA 3TWYA 4WWOA 3AQZA 4KUZH 4OCWL 3BUIA 4ANWA 4M8RA 1QVOB 4DP7X 2E46A 3O2VH 2WNKA 2AJVL 4ALAH 1KBWA 1IC7L 2J1XA 2ATPB 4EF3A 3ATAA 3Q1SL 3QQNA 1ILUA 1N0XL 5T3ZL 5EOQL 2JNZA 3D39D 1N5YL 2QMKA 3ZMNA 5FLUA 1CFTA 4PJHE 4RISH 1MHEA 4M5SA 4LL1A 3LKNA 1SOKA 1K2DB 3N91A 4GINA 4U0QB 1ZRUA 3T6WA 3AREB 3X14B 5E6IC 5GRXG 3ARBB 5CLXA 4F2MB 2WCGA 3THMH 3TBTB 1M1XA 4ZW6A 1M2VA 2XWXA 4XTRD 5GRVL 2UZXA 4YDJA 3W57A 5I6LA 4Z7VF 2V9QA 1MFNA 2K9FB 3BIAX 1XT5A 4EOWL 1A2YB 1C8QA 3MLRL 5EA0H 2ZUTA 1DQIA 4ZTOL 3CZFB 1I1RA 2WHVA 3OLEA 4C57C 3D85D 2AJXH 4GQQA 1PDKA 2EDMA 2WXJA 4G5ZL 4HS3B 4CKQA 2NW3B 1EXUA 5K93A 4CC4A 2LVEA 3ZDZB 4YC2B 4AT6B 4TVPL 4F5CE 3PJNA 2XN9A 3C5ZA 4KH2A 1BVNT 1OT4A 5D7IB 2YEQA 2KS0A 3DHUA 2WLIB 3B1UA 1XGPB 4AY0A 1UCBH 2GTWB 1ILSA 2VXVH 3H53A 3EJRA 5GGRY 4K8RD 5AALA 1KCUL 4GRLA 4L4JA 3IMTA 1FVCA 4XN8A 3IF1A 3IXAA 4QO1B 1AS6A 1BXXA 2VWEC 4IRSD 3VXNB 4J8RB 5FKAA 3FCTA 4MQXC 4X4XA 5HI4C 3BHBA 3WS3A 1KCWA 5IHBA 4JR9H 4MJ4A 3REVB 1H5BA 3HE6D 2E7DA 3VRJB 2J1KA 3HRPA 1IC1A 5AYQA 5I71C 3EH2A 4I4WB 5I8OL 3N0AA 3QC5X 3V7AG 4NCC2 4JKMA 4M93C 3S88L 1WH0A 5D8JL 2G30A 4XBGB 1ASOA 3CZGA 3CXFA 3U4EB 1FO0H 5EEWA 3VQ1C 3VYPA 1BVLA 3IK2A 5T1KD 3VI3A 1UTDA 4D3CL 1IGJB 4NZRL 4KITB 3BISA 5ACLA 2Z9TA 1WA2X 5I73B 1E8YA 4LSQH 1N6QH 1FL3B 1QBAA 3FH8A 1DBBL 1HHGA 2O6PA 2XJKA 4F27A 3IJ7A 5C71A 5G55A 4YMPA 3QEGH 2WXFA 4P2RA 3ZMEA 5IMMB 4MAUH 1C8PA 2EUXA 3S3PA 3RU8H 2NUPB 3D6GA 2LU3A 1XSJA 4AEFA 1ID2A 2N3JA 1A7RH 5TH2B 4HCIA 1SMAA 3QUKB 1QTYT 3ERXA 1JZFA 1ZLUH 4ZO7A 4GUQA 2FATH 5D1ZC 2EO9A 5CHNB 4XB3A 3T2QA 2BHUA 1QW8A 2IPKB 1JIBA 3JWOL 1ZTXE 3BT2H 3UTTD 1WBXA 4UOJA 3KGSA 5CEZE 3CVCA 4UAOC 1X5YA 1QSEB 4TUJA 1UJ3C 2ZUUA 4XC3H 5KBDA 3F62A 4PR5B 4XPAL 2JJVA 4FTVD 5ID0B 3ULVL 4YSDA 4WI3A 2FWLB 1WA0X 4EN3D 3KL3A 3L5XL 5A7BA 4FLQA 2CO2A 2Z7ZA 4JM2F 1W8OA 1WE5A 1OP5H 3GJEA 2GABA 2H6PA 3HRZA 2JE8A 3GMQA 5M95B 2JJTC 2VXQA 1J8SA 1K4DB 1CBVH 4NO0B 1DBJL 3MRNA 4AC4A 5FOBB 3ZTJH 1PY9A 4YL4A 3BH8A 1JZDC 1FYHB 2CBTA 3CFBA 4ACTA 1ACYL 4JFDE 4M7LT 1CYXA 1G9MC 4YQXH 5E0FA 5DD0H 5JPMA 1FNEB 2BRRL 3DX6B 4FXKB 5E6RB 3DTXA 1RJZB 5AAMC 3HBPA 3MV8D 4AYGA 2YC1A 1VKXA 1M6OB 2HN7A 1XTLA 3FFCE 3VGFA 2OV0A 1B9KA 3LV3B 1E9OB 2DQDL 5JPNA 4KQ3H 1AGCA 5D7JC 3ZIMA 3F04A 5DRZB 4EQ2A 4F33B 4JPWL 1JPFB 4UTCA 2CK0H 4JFYA 5C0CD 3LZQA 2XV2A 1MWAH 2A74C 5AW2B 4UQ2A 2C9VA 2WGXA 5I19H 1T1XB 5KUKA 3CVHH 2F7IA 4NT6B 4I9WD 1QW9A 2X4TB 3COOA 3V4PA 1N6UA 4FFZL 2LVCA 4M1GH 3EGSA 3ULUH 1ZV5A 5CLYA 1B0RA 2EEXA 1EJOH 1NQBA 3U7WL 3SDDA 1TOXA 4OQTL 1TCRA 1NPUA 2VDRL 3I9GL 4X4ME 4R0LB 2OMVA 2DQ6A 4EAEA 2YA0A 1U41A 5FYKH 2FBJH 4YHYC 4N3TA 3QJVB 2IDUA 4OGZA 1YEIL 3VXSA 4ODHL 2K45A 3LS5L 2E0PA 5B8CC 2GK2A 1BW8A 3RAJL 4HCRA 4Y2LA 2OMWB 3P2TA 4J27A 5BRPA 35C8H 1O9WA 3DXAA 5CP7A 3KPMA 2WWOA 1CT8B 1OQOA 3VXTB 5AB2A 2OMYA 4ELDA 2QFPA 4KDTC 4CVXA 3VI3E 5IF0B 2DBLH 5LG1A 2DLGA 3GBNH 3ARGA 5C3IA 4HEPA 5D7LA 3EJJX 1RK0A 1KBKA 2D2CC 1T5XB 1S7WB 2DQCH 1AD0B 4O5LL 2EXYC 5HHPB 1BGXH 2C7UA 1FDLH 2FD6H 4K9EL 4NQSA 1HQ4A 3OPZL 2ETWA 2GKIA 2PPFA 2X09A 1A6WH 4MAYD 4Q9BA 1F4AA 3FHEA 4P2RE 5F7YC 3L17A 2PP8A 4RAHA 3P11L 5D2LB 3DX9B 5HD8D 5LXGH 4IGBC 3GRWH 1E67A 1YSOA 4D9LL 3L81A 4TSBH 1U8OA 3MLTB 4EZLA 3GMRB 4PJFE 4FXGC 4B7LA 2XQYG 2DD8H 1OAQH 4Z7UA 4FQ2L 1FLRL 5SWSA 1ORQA 3C87A 4K71C 1K85A 3HZYA 1JGDB 5FO2A 1WBZA 3EDDA 4PV9B 4L37B 3C5JA 3JUZA 3HC4H 2JI3A 1H6FA 5B39B 4APQA 5I1HL 2EC9T 4KHTH 5MEPB 1JV2B 3L9RA 3E2HB 4NLHA 4GI8A 4R2GC 2JMRA 5KOMC 1KCRH 1R5IB 2OXHA 5KYUA 1U8PB 3WMQA 3CVIL 1MVYA 2CHWA 2NQCA 5HPMA 5IV2A 1U8IA 3GINA 4XNYH 4C56D 4DP9X 2YBGA 3SKOA 1B4LA 3JV4A 5LDUA 1CFNB 1QSFA 3GKWH 4LLAA 4HUWA 2QKSA 2PYEB 1I9RL 5I0XA 1UM5L 1UZ6F 1KEGH 3Q5OA 3FHQA 2WTRB 1I4FA 3QORD 4I9XA 3NGBC 4TUKH 5I15H 2EICA 4K7PY 4MBRA 4P4KC 1ZT7B 4QHLB 4UV7L 3ILPB 2F5BH 2IJ0C 3D0LB 5DMKB 4NKQB 4UDTA 1B2WH 3K71B 1DZ0A 1EAQA 2A0LC 5DMIH 3UP6A 4P2AA 1BSIA 4EI5A 2A5UA 3TLRA 5DFVC 1MCNA 3ZDYB 5DJYB 5I1LA 1GJWA 4F15C 2EH7H 4JE4B 3BKYH 3QO1A 4Y19D 2F1EA 3WIAA 5HGHA 1O6VA 4G8AC 1IAIL 3MX0B 1GGBL 3C2SA 2XKUA 2XWJB 1MJ8H 4Q58C 1UA3A 3SIKA 3D9AL 2H2PD 2ZYRA 4N0UB 4PB0L 1ZJBA 3VXSE 5I23A 4FI6A 1H3UA 2GB2A 5FO9B 1QWNA 1DQDL 1ZEAH 4E0RB 3VFUA 1W91A 3CFQA 4P2QB 4U05A 1H6EA 5EDSA 1NJ9B 4BSVB 5FGBA 3MJ8B 3UZQB 4N8CH 4V11A 4NLAA 3EGDA 1GGCL 3P54A 1I82A 4HPOL 2M1KA 2VR7A 3PHSA 4ZUUA 1HQRA 2BVOA 3C6LB 2YGPA 4E9SA 5AB0A 3O45A 5FHBL 4MDJA 2VDQH 1QNZL 2V5MA 5TFSH 4AE0A 3LS4L 4NENA 1BAWA 1HT6A 2G4EA 2UWEB 3VXQA 1AI1H 5CJ8A 2D7MA 4JZJC 3SE9H 1NLDH 3IJHA 5D1QD 1SUJA 2QPUA 3UZEC 4AUUA 4EE2A 2XXCB 3SCMB 4CSPA 1CU4L 1UWXK 1B4JH 4TTGA 4P5RA 2WCSA 4KY2A 1KIRB 4MA1B 3O3EA 5C6PB 4GAGH 1YMHB 3OMZA 1TSRA 2MNJB 3CXHK 5SWSE 4OZHE 2P8MB 3T0WA 3ZYJA 3QNXB 2C1OA 3BGAA 4LCYB 5EO9B 5FW6A 2ZAHA 4DTGH 2LFGA 4UNUA 3FO1B 3NCMA 2DYPD 3FKUS 3LQAH 2UVEA 3CDYA 4Q52A 1P84J 5F7EH 1HOCB 3Q5YA 5J6SA 4DKAA 1YQVL 5IWLA 4WV1A 3B9KD 2F08A 4ANKA 1OGAB 1Z9OA 2A6DB 2CHDA 3NK3A 4MGXA 3QT2A 3UTPE 2BJMH 4B9YA 1D2PA 3KWXA 4LGRB 2NR6C 3WIHH 2RAMA 4BK4A 2XXMB 4M29A 2C9SA 4X7SH 2EH8H 2OFQA 1BCIA 1DJWA 3VE0A 1YJDH 5AWNL 5JHLL 4K94L 4JB9L 4OT1H 1IKNA 5E00B 3TJEH 1I7RB 1SEQH 2WJ7A 3B7YA 3CFKA 1HHJA 3IMVA 2A77L 5GS1A 3MUHL 3P02A 3PL6C 5B1KA 4WF7A 3BGMA 4EZKA 1QRNA 4WZ9A 3RIFF 3HC0B 4XVOA 2YHGA 3MOQA 3MRHA 4NWTL 5DJ0A 1WUNT 2VZVA 4KXZH 5JIQA 3QUXD 3RIAF 3LDBC 4AQ1B 2NTFA 3MLYL 2K78A 1IGTA 3L3JB 5FF6B 4HUXB 4ORGA 2DWEA 1L9TA 5I1EL 1IC5L 4KQ4L 1DEEB 2YZ1A 3PWPB 2DDQL 3B7UX 4KMLB 3BUQA 1XFPA 3EJPA 4N6RA 4OB5H 4MA7L 4HIJB 3QG7L 1LE5B 5FUZL 5E2TH 5DEGB 1J87A 1F90H 2R29A 4OLUH 4P2OB 2JKRM 1Z9SB 3SDCC 2ZPKH 3BDBA 2X4RA 2WO2B 3KYOA 3K6FA 3SO3C 2IPTL 4AQ8C 2PO6B 2VUYA 4TSAL 4AW4A 3PABB 3MV7A 3DX7B 2VISB 4TRPL 2HVBA 4D8PB 3LRGA 4BXSV 3CHQA 3ARQA 1M6UA 3DIFB 5DUPL 1VADB 5EV7A 1N8OE 1RUMH 2DJUA 3JWNC 4HXAL 3BZFA 4CVZB 2BP0A 2WBKA 4KX8A 1GTFA 1NCWH 5ADOH 3U0TB 1N2RA 2CLVB 3IXTB 3FRUB 1PSKH 4ZXBC 4NPYA 2MH4A 2JH2A 4TTDC 3TF7C 2O6DA 5DVKA 3IKCB 1JNHB 1N3NA 1DQML 4JLRB 4M3KB 5L4JA 4L3AA 1OVZA 3KPLA 4F7TA 4BUHA 3OR7A 4NKOB 5KANI 1HHKB 2DQGH 4RDQG 5JNYB 4AXWB 1NAMA 2WK2A 1BPLB 4GQPH 2ED8A 3U6RA 2TSAA 3L7EA 2NNCA 3BUYB 1YYLH 2HRGA 3AREC 1S3KL 1S7XA 1MFDH 4C4KO 5KSBF 2G60H 4M8UA 2NZ9D 3RIFK 1E3ZA 3V10A 1E9QB 1UATA 1O75A 3SDAB 2GITA 3RIAK 3J27A 3P9LA 5HHNA 5CR1A 3ET9F 4NP4L 4QRUB 5TE7L 3I6KB 1EAJA 4Q9QL 2ZOKA 2BIHA 4KK6C 5HDQL 2YD8A 2PXYA 5FWQA 4LK4A 1PW3A 1JNLH 3IAGC 3ZT7A 1TNNA 4YC2C 3V0WH 4ADGA 3EFFB 4B9CA 2CM5A 4J1UB 5LDSA 4L29A 3NA9H 4HBCH 4JRYB 1CBJA 4UIKH 4DN4L 2QGCA 3O2DA 3QXWA 3RDTD 3GNML 4WCYH 2HG5A 4JHWL 1CDIA 1TMQA 2CSPA 2VW6A 4N0YL 4OF5A 1XV8A 1JN6B 4QRBA 1PIGA 1NAKL 1N64H 3G5YB 4H26A 3TWCH 2QVMA 4HGKC 3PDGA 4PRPB 1ZLVK 3FN3A 1CFSA 2I07B 4MJ5A 3LEYH 5T1DL 3C8KB 3HI6L 4BCZA 2R0LH 1ZT1B 2L7EA 4D0BB 5I66A 4X4YB 3ILQC 2YGNA 2H32B 2YD5A 4JAMA 3F6IA 4N2CA 3HCVB 4CDGC 3T0XA 1MVUA 2N01B 3FMGL 5EC2A 4Z7NF 1A7QH 1TPXB 5HJ3A 2UVFA 3UCRA 3DARA 4K3HA 2VH5H 1U3YA 1AXSB 4QI3A 4U1SA 1JZ4A 2B39A 1G7PA 4LBEA 4P5SA 1K3IA 1FORH 5I73C 2AV7A 2XKNA 2I9LA 3K6NA 1FYTB 4XVJL 4EUPG 4RLDA 5IGXH 1Y6KR 1QLEH 2NXZD 5EPMA 1R5VA 1GH7A 1TVBB 1MFAH 4M61B 5TQ0H 2W1NA 5KYNA 3CFDB 3L3KA 8FABA 2JIXB 3ZSSA 4IBWA 2CKBL 4OLVL 1EFXA 1JRHL 1NDTA 1EEQA 3OQRA 4BSWB 2ZKHH 5B22A 2AV1B 4HKZA 5IB5B 5TF1H 1EPFA 2AJSL 1P4IL 5D1QE 2KDYA 1CS6A 2R23A 3REWB 4JFVA 3RFRA 1LE9A 1NMBL 1R3HB 2L8AA 1MCIA 2LR4A 4O02H 1CXEA 2ORBH 4JFEA 2AQTA 2WZPD 1I8AA 4G7VH 5E9DD 1T1ZA 3TYGH 2WOYA 1BYOA 3V4VA 3SPIA 5GGTL 4X5WA 5CIPB 3E1F1 2IGTA 4MA8H 4M6MH 3RURA 1FH5H 1ZPLA 1EO5A 4K55A 4ODUB 4UNTA 4WI5A 2NPLX 5F88B 3UAEA 3Q6FB 4HJGB 2YXWA 5EUOF 3ETTA 4ODTL 4MXQD 5DJAB 4U6HB 5A2CA 4RFOH 1A6ZA 2XG4B 4J3WA 5H4ZA 3LYRA 4FXKC 4FS0A 4KKLC 3GSQB 2HFGL 1LK2B 3S35X 5F96H 4DKEL 1RZ8A 3O3DA 1A0Q<