5CFAA

Crystal structures of bbp from staphylococcus aureus with peptide ligand
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
326
structure length
326
Chain Sequence
NNVNDLITVTKQMITEGIKDDGVIQAHDGEHIIYTSDFKIDNAVKAGDTMTVKYDKHTIPSDITDDFTPVDITDPSGEVIAKGTFDLNTKTITYKFTDYVDRYENVNAKLELNSYIDKKEVPNETNLNLTFATADKETSKNVKVEYQKPIVKDESNIQSIFSHLDTTKHEVEQTIYVNPLKLNAKNTNVTIKSGGVADNGDYYTGDGSTIIDSNTEIKVYKVASGQQLPQSNKIYDYSQYEDVTNSVTINKNYGTNMANINFGDIDSAYIVKVVSKYTPGAEDDLAVQQGVRMTTTNKYNYSSYAGYTNTILSTTDSGGGDGTVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Bbp from Staphylococcus aureus reveal the ligand binding mechanism with Fibrinogen alpha
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding/peptide
molecule keywords Bone sialoprotein-binding protein
total genus 87
structure length 326
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5cfaA01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5cfaA02
2F68X 5CFAA 2F6AA 2VR3A 1R17A 3IRZA 4JDZA 4B5ZA 4MBOA 4F20A 4JE0A 3IS0X 5CF3A 4LEBA 1R19A 4Q6KA 4JDZB 2Z1PA 3AT0A 1N67A 3ASWA 4BBWA 4B60A 2Y7OA 2Y7MA 4LEEA 4F1ZA 4F27A 4RMBA 2Y7LA 3IRPX 4LE8A 2Y7NA 5IHWA 2YLHA 3V10A 4F24A 2RALA 3IS1X 4MBRA 3AU0A 4FJ6A
chains in the Genus database with same CATH superfamily
3BC9A 3GMOA 3P2BA 5C0EB 4L8CA 3OAUL 1UOKA 2JVUA 4K5PA 3E7JA 3RNQB 2KZBA 4LLQA 1RFDL 3CZFB 3FQRA 2WMPB 3X1FA 3PJLA 4YGVB 3FTVA 1G6RB 3P3RA 2WWKO 2JLLA 4HS6B 2UY7A 3OAZH 3W9DB 5H37A 4HX1A 5HHXH 2JB5H 4YO0B 1OD9A 3L3OB 1W0WB 4QOKE 2H3KA 1Q9OA 2GT9B 3MJ7A 3B9KC 4YLQT 3MXWH 5L4IA 5HYQB 1AR1C 3TWCH 5KJRL 4NCC1 4Q0XL 1VZHA 3D18B 2W88A 2QQKH 3FU8A 3IETA 2DDQH 4XNMB 2ZUVA 5C09B 5SV4A 2ADJB 4MDJA 1RK1A 3NFSH 1WA0X 4QXTA 1LE9B 1E2WA 5DMGC 2B3IA 2FZ3B 1MRFL 4KKZA 4Z7VB 2P5WE 3RP1A 5I6PA 4I1RA 1NLDH 4QIRA 1BXAA 4WUUB 2WZPA 3GMOB 3FSVA 2YFOA 1B4JH 4L3EB 4O02A 4IM8A 4K5MA 3FTGB 4OCWH 4ZS6D 4ZFOL 2XFXA 3VVWA 1EHLH 1UASA 1CFTA 4XN1A 3MRBB 4I9WE 5FM4A 1OTUD 2XWJA 3RGBA 4Y5VB 1SXSA 2IQAB 5IOKA 1UKSA 1AZZC 1WFNA 1YYLL 4ATTA 4RCAA 5DEJA 1JTTA 1L9RA 5B1CA 2Q2EB 4PJGF 3LV3A 4WV1A 4J3SA 5B38G 3UABA 3CHOA 3DMMA 4CN4A 1A14L 1UB5A 5IR1A 1S7XA 3T8MA 4FXKB 3AWFA 3IMBA 3V4PL 3ZL4H 1FJ1B 1RJYA 1ZAGA 5I0VA 4IDJL 1ZRUA 1KB5B 4LARH 3L3IB 2XN2A 5DJ2B 3Q8FA 1W8OA 2DBLH 1ORSA 3GSRA 4IRJC 5FYKE 5GJSH 4G83A 3I3EA 3RKDC 3QR1A 3CHXA 1DL7L 4QHLA 4ESKA 5GGQH 3S88L 2ZKHH 4MZIA 3IMVA 5I16B 3IM1A 2VNCA 2B1AH 5K9OA 1MN4A 5IFHH 1KTDB 5IBLD 3WIIH 2F53D 2WXRA 3J8F7 5GRYA 2W0KA 1WT5C 2DLTA 5KVEL 5JPNA 3QHTC 5E8PB 2JJUA 3NCBB 3OQRA 2DQ6A 3WUWA 1IBGH 1YC8A 3MRJB 3Q6FB 4QOKD 5DJCA 4KK5C 2GTZA 3O6FC 4ZUUB 5BZZA 3V0VB 3RVUD 1U8JA 1Z3GH 5DJXA 5AW2B 2NY0C 5C0ND 1TUPA 3VGBA 4W70A 2JB5L 3DOIA 2AJUL 5E1QA 1ORQA 3QFDA 1EH9A 3QUHA 3VDBA 3HUJB 2VDRB 4G1EA 4WV1C 3RWIB 1N70A 1YRKA 3DBXB 1XR8A 2XTJE 3UZVB 3D85D 4WI7A 2VB5A 3JTTB 4Y8AA 3TWCL 3WHE0 2XICA 5KJRH 1N18A 3LH9A 3QWRA 1ODUA 4GT0A 1W16A 5CP3H 2EP6A 2LQRA 3TO2B 7FABL 3LKPA 4WW1A 5IFJB 3HMXL 5DD0H 2DN7A 4UNUA 5AALA 5D1XA 4WO0A 3VQLA 5CEZD 2X88A 5DJYA 1BFVL 1X5FA 3TH2T 5GGRA 2PP7A 1VACA 4ZG1A 3UL4A 4H26A 5IREA 3CPUA 3FUJA 1RZ8A 3P2TA 1NGWB 1U2CA 2QGCA 4N8UA 2LOEA 3AG1B 3DK0A 3U30B 1RJLB 3Q3GA 3UG5A 4AYFA 5D5ME 3H54A 4L2LA 3WJJA 3FB5A 3S5LB 1A3ZA 3N9GH 4JGMA 2ZUWA 4EZJA 1QABA 5EIVA 4R0LA 2CRMA 3CN1A 2J4WH 2OKMA 1NQBA 1XAUA 1K9TA 3B2UD 3K1DA 4WI0B 1DN2A 5CJ8A 2R1YA 2VDKH 1KIRB 2X1QA 5CZRA 5KVFE 2NRDA 3GXIA 1FH2A 4PJ9B 1KTBA 2Q9OA 2Y6TE 4JO2L 1A8JH 5INDA 1J87A 4DW2L 3D9AH 3V4PH 3ZL4L 3OMZA 1HZHL 2GIYA 3B7RL 4F9PC 4AH2A 4ZS6C 1T1YA 3ISYA 4POZD 4XC3L 4MMXB 3QEHB 5BQ7A 3HG1D 5C86A 4JN1H 4ISVA 2A99A 5ITFA 2IGLA 1CGSL 4YNYB 4AIEA 5GGQL 3S88H 5CEXB 4Z8FL 3EH5B 3NTCH 4F37K 1M9WA 3AQXA 5C0EA 1YPZA 3L4YA 4KUCF 4GMTL 4HV8A 5FCUL 1T4KB 5KVEH 2X1XR 5DJ0A 4D9RD 1GMEA 2YGQA 1Z9OA 4D0DB 1I1AC 2G5UA 4R7DB 3V10A 3US1A 3IB4A 3HN8A 3DUUB 3MRLB 1RVFH 3DXAD 4AIZB 1PTZA 3X1GA 5SWQB 1JGVL 4NWTL 3VFMA 4GUPB 4ALAL 4GSDH 1LYQA 2XTJD 3CMOH 3T4AC 3E6HB 1QWHA 1CTMA 4HWUA 3BSZL 4U7MA 3REVB 4CVUA 2NY5C 5IQNA 4RIRB 2EDWA 1EJFA 2XBTA 1QSVA 4FYQA 1OGAA 2DKMA 2RMNA 4IK7A 4QRAA 4F8PA 4A68A 5L8KB 3KYAA 3TWYA 2QPDB 4GO6B 1CE6A 3FYIB 2HVKB 1WPCA 1JGVH 4S1RL 4GSDL 1VFMA 4PUBL 4X9FA 4PJBB 1GIGH 3VSTA 3AUWB 2VDNB 5EU4A 4EEEA 2WTOA 3L7FB 3LRLA 3FFDB 4WTZG 1BIIB 5FUCC 3BGAA 2R2EA 4J6IA 1TVHA 5BRZD 1TJHL 4ES8A 5DA4A 5EZOH 3UTSD 4KGJA 3FRPA 2G3NA 2UXVA 4JFXA 5E2UL 1KCRH 5ALCL 43C9A 3ULVC 2YAMA 4Q56A 4OZFA 1IAKB 4PP2A 1ZLEA 4W6YB 3L8QA 5DYFA 3ZDXE 2ZNXA 1ES0B 1XGTB 3QEUB 4LRIA 1J1OL 5BZDA 3KPLB 5KSBF 3MLYH 2ZXBA 1JRHH 1R3HB 3NJMA 2X53A 2WLZA 1DBBH 1FYTA 3DMMB 1PQZA 4W6WB 4NLAA 4NO3A 1A7BA 5GZOD 2PW2B 1OP4A 4LPCA 1MCWM 1WZ1H 1TQUA 4UTCA 4ZSOE 2Y7MA 4ORGB 2QADB 1CPUA 3ABZA 4G9FE 4F1ZA 4DW2H 4PBXA 4ZAKC 2XWJB 3KR3L 5DHYA 3L3GA 2X89D 3NJLA 3AQZA 3QCUL 1G1CA 4ABUA 4KK6C 2XPGB 1OD7A 1INQB 1QW8A 2C7UA 3S3CB 5C6PB 1UGNA 3MREB 4H20H 4U1SB 3I6GB 1FPTH 4PJ7F 4HFWB 4Z7NF 4DPRA 3D2UA 3IAGC 2JELL 4DHLA 5DJZA 2AQ3A 4NZUL 4GRWH 4I0KA 3PWVB 4AQEB 4UOZA 1M2VA 1J9RA 2R2HA 3BPNB 4WHTA 2GK2A 2R69L 3MCLL 2NY4B 2YRZA 1D7FA 4EIUA 3S0PA 3QUYB 2GW5A 4RSVA 4X98B 3VX0A 3LS5H 3BT2H 4POZC 1RVFL 1I1FA 2P8LA 3RE0A 3SDXF 2WXPA 3ZKMD 2F74A 4JZJC 4K2UH 4O9HL 3HC0B 2AEOA 4H25B 5JA9A 4NIYE 4BKLA 1CBVL 3RX7A 4H0IA 1DANU 2DMHA 2OMXB 3KPRA 4M48H 3BAIA 5F7DB 5J11B 1HCZA 2XJKA 4GP5B 2P43B 3KWVA 1PKQA 2P9RA 1Z0NA 2JJSA 3F65A 4WK2B 4CC1A 2E9WA 2APVA 2DYPD 4IBWA 3S6CA 4PPTA 5KN5B 1P53A 4Y0GA 2JV6A 2N4IA 2HG5B 4A38A 1HEZA 2R7EA 1PX4A 5IB3A 3HI1B 1IBGL 4HLZG 1GAFL 1C5CL 1GL4B 1L9PA 3LOWA 2C4FT 3IMSA 4C4KO 4HKJA 3BKJH 5I28A 1YEEL 3FCSB 1L3WA 2VDNH 3TBYA 5KYWA 5LXGL 5CN2A 2XWBA 4P2CG 1MAKA 1XH3A 3IGUA 3WSQH 3PG2A 1CDYA 5SV3A 4PB9L 5E6IA 3HZMA 4V2BA 2HKHL 3HE7B 1DQQA 2GI0A 4RMSA 4AMKL 1AANA 4NO0A 3ILQD 2OZ4A 4GKNA 5GISH 5ISZE 2KZ1B 4RA3A 2DWYA 1V55B 3D4CA 3IDXH 4KJWD 3T0WA 4JFFA 4N0YH 3ASOB 1MHHA 3ECBB 4JKKA 4PJ7E 2VDNL 1XF3A 3V0FA 1RERA 3V4UH 4EVNB 5LXGH 2GK0B 3EADA 1U3NA 4RQQA 4XXWA 5I1HH 3N85L 4UYPA 2NLJB 2QL1A 3UJIL 5BQDA 4XO5A 2JCCA 2E56A 3N04A 1UATA 3NYKA 4LDEB 2VQTA 4X4ME 3D3VD 1BBJA 4HFUL 4YE0A 4YHPA 1AZNA 1PX8A 2VDKB 4UQEA 3DOSA 2J73A 3KPQB 3WBDA 2Z1PA 1B0RB 5ERWA 4RWYH 3TOPA 4R26L 3LSOA 2QLYA 3A6CL 4NQCA 4NUPA 3T71A 5K69A 5FXCH 4ZUSA 1O9VA 3O8XD 4QHLB 1C1EH 1IQWH 1I1AB 1JPSL 3CD4A 3TYFB 4GBXB 3T3PF 2A9ML 1BEYL 1BAFH 2A9AA 4ADJA 4DN4L 3BRDA 1B0GA 4YSUA 2Z35B 1NWOA 2A77L 1U8CB 2EE3A 4P2RD 5KSAA 5AZ2H 3T3PE 3L95B 5FGBA 5G4NA 3GGWB 5DUJA 2HFTA 4NOBA 5ABZA 4AK2A 3OKEB 4JN1L 4WNQB 3O9WD 3SO5A 2DQDL 3ZDZB 5GPRA 4APXB 1G7JB 4P49A 2B08A 3PAUA 5CFHA 2XKUA 3CQPA 4LL9A 1X5YA 4LSQL 3LH8A 1U8PB 3K8LA 4G1EB 3P54A 2VJXA 1IMHC 2NX5A 3H8NA 3MRGB 4PM1A 1QHPA 2WLMA 3HS9A 3NABL 3FFCA 2YGOA 3PIQA 4QPEA 1UUSA 3EDEA 4X7TA 3RY5A 1QFHA 3HE6A 5B38B 2MHAA 5LQBL 1MCPH 1QTPA 1G94A 3NJKA 4L4VB 2DIEA 5AL8A 1V5JA 1A6TA 3N0PB 4XB3A 4A7VA 5DLMH 2ADGB 1C5CH 3SKOA 2LGNA 2L8AA 1E67A 2J20A 4GRLC 4GSRA 4TNWK 5JQHC 2NY1D 2NSXA 5C92A 2VZVA 2CKBL 3QQ4B 1DQVA 1ZA3A 2YZ1A 3VSVA 2QADD 5IBTL 5CEZH 1XGQB 4TRPH 2OMYA 1E9PA 5F7UA 3BJLA 5E6RB 2OQJB 2OYKA 3S5ZA 5LG1A 3DPBA 5ISZB 3WFDL 1QSFA 3HLAA 5G4MA 1S7SB 1I8MB 4R5VA 1KJVB 5EOCJ 1A7NH 3F84A 1YNLL 1ML0A 3W9DA 1SDAB 4P5TC 1IM9D 2CNZA 4PJFA 1KN4L 1M1XB 4WFED 4M8QA 4FADA 3ZSSA 5DD1L 5IMMA 1JZ2A 2WGNB 5TK4A 2C7FA 3L6FA 4TQIA 5D7LD 1AGEB 4YR6B 1QKZL 4TUKL 5DRNB 5F2FA 5FKPA 3BKYL 1UOWA 1YEWA 3OBAA 3ARBA 4OCXL 1PY9A 3EYSL 1J8HB 3TA4D 1VGEH 1IGYA 3KS0H 4Y7OC 3QFJA 5B1JC 1YLBB 1V3JA 2ZCHL 4DZBA 3FNKA 4H2AA 2XTJB 1BJ8A 1XB6A 3BXNA 3FB7A 4G6JH 4G8GB 2IBBA 3AMLA 5EC1B 8CGTA 4N1CA 5EUOA 3D33A 3SBWA 2F5BL 3HNSL 4FQXB 2V7HA 4HUCA 5FYKH 2BNRA 5AOLA 4JJ5B 2KPNA 4RFNC 1VZIA 3NA4A 2DQCH 5CMAB 3QJOA 2FJFB 2R0KH 2XQBL 1R5IA 4NO3B 4PJXF 3F62A 5J4MA 2WWMC 4F8TA 4O2FB 2G75A 1RUAH 5BMFH 3DX7A 2PPFA 5C09A 2DYPA 4QCIB 2DQUL 4M29A 2GAZA 4F57H 5TFSL 2H3NB 2CA4A 1NMCB 1NKGA 3HNSH 4KMQA 5AENA 2N7BA 4M7LH 2IGFH 4J3BA 3VD0A 3NCCB 3TZVC 1Q4NX 2YXMA 4XOBA 1KCLA 5F71A 1M56B 1Q9KA 4LNVA 3C2SA 3EIFA 3CLEL 4LSQH 3T2OA 4APQC 4M1CD 2ADYA 3GLDA 4B9CA 1RUAL 1E9QB 1M7IB 3V0WL 4Y19A 3JWOC 2K9UA 3IJHA 5H35A 3SBRA 1OIOA 4TSCH 5TF0A 1ZWIA 4WW2C 3RX8A 1QSFB 3F04A 4FULA 5E0QA 4CBPA 3VD5A 3RVXD 1XSJA 1MHEA 3SN6N 3MLUH 4J27A 2R4SH 4ZX3A 4M62L 4U1HB 4X2UA 1MCKA 4WFHE 3LX9A 4GRWE 5EDXA 2VXSH 3QEGH 2GY5A 5CEXA 3Q2LA 5LWYL 3ZVVA 3F5WA 3AXIA 1YEGL 4JFFD 4R7VA 3UO1L 5FIEA 4XNUH 2PCFB 2X6BA 2VXQH 1VFAA 4JM0A 5A6IA 4XNQB 2C9RA 4PS4L 3BVWA 3CDZB 3OKNB 2VN6A 4UBDC 4G8IA 2ZUTA 3SKMA 4MVBC 2LFGA 3LNHA 4B95C 4N2HA 1ZT1A 1O0VA 3FK3A 4N0RA 3VFSB 2V2XA 1FZMB 4HWZA 1G9ML 2UXTA 5SWQA 1L7IL 4W9CC 2VXSL 2CM6A 2OMVB 3QEGL 4LCIH 1GJWA 2DTMH 4PGZA 4PW9A 5H37G 5DO2D 2YAOA 7PAZA 2BOCB 2B1HL 1YQVH 2WY3B 5CLYA 2ZWLT 4NKOB 4KXDA 1B9ZA 3FF8A 4JRLA 4LDLB 4HIXH 4M7KH 1AR1B 1ECYA 2HRPH 3PL6C 1XV8A 2EDOA 3QHZH 2Y2TA 2UWEF 2HWZH 3QIUA 5TE4H 4LLQB 1PZDA 4AM0Q 3WO3B 1AKJA 1JTPA 3CFBA 5I8OH 3CSTA 3NOIA 5E9DE 1WFOA 1ESOA 3L81A 4NQCB 2A6IA 3CTTA 5FGCE 4KFZC 3M6DA 2ZZUT 2CHNA 2EEFA 5F3HA 4ZO7A 3WFEH 4XMPH 3ZIYA 5JW4N 3ML9A 1NCOA 4OT1L 5HJGA 5TDPB 4Z7OF 4MNQD 4HEPA 4MHHG 3VFNB 2ENJA 3WLWD 5L4MA 1HHHA 3O9WA 3T0EA 3VI3E 2JCCB 2W65B 3MGOB 4ZZFA 4P9HC 4QRRA 3E8VA 1GYUA 1H5BB 3INUH 4DF9A 2YAQA 5A40E 3L5IA 1TVBB 2ZYSA 3B43A 1MFVA 3K46A 1E4XL 5AYTA 1MFBL 4BIKA 1G84A 3BYYA 3MGAA 3RWCB 3U4KA 1T5XB 3TBCA 2Y5TA 5KUMA 3EDFA 1AZUA 3W39B 2TRYA 3OZLA 1ZEAH 2BW5A 4G43B 3KPLA 4QT5B 1ZCRA 3INOA 3GBNH 3RB5A 2EDTA 1G7LB 1NUGA 3APMA 1X3DA 4OVUA 3VG0H 5DZOA 4OCRH 4NUQA 3HG1B 1M4KA 3BSHA 4J3OC 4NQDE 2B39A 4G7YH 2QELA 4FA8A 2FTAA 1SBSH 1XGZA 5HYSG 4GAYB 3MLZH 5LKNA 2ATKA 3RZCC 4OJYA 4KPHL 3SPIA 1LO4H 4RAUB 2VJ0A 3JV4B 2BZ7A 4MCZA 4JFFE 1BP3B 1JZFA 1UT9A 2I69A 4UZSA 1ZEAL 3ZRSA 2R8SH 1CTNA 5BS0D 4GAJL 1A3LL 1X9RA 1H3UA 4C4UA 2VIRA 3DYMA 2VDLB 1VF5C 4HK0B 3TO4D 5GGVH 3V0IA 4OCRL 3DJTA 1BQRA 3FFCE 3FU5A 3TBYB 3F3HA 2WXQA 5JIPA 1AGEA 4N0UE 4XOEA 5FKPB 4YR6A 4QRTA 4DOHB 3VWKB 2J5LC 1UXSA 2DMGA 5F7NC 1WYJA 3HHMA 5DT1H 5C3LD 4JS7A 3EOTL 4A55A 4JG9A 2EYRA 3K6FA 4H2CA 2XWDA 5E2WL 5JZ7D 2YQ2A 4J1UA 3NP4A 5AW6B 5HYJE 5ANME 3CFCL 1O7VA 2WIMA 1QNZL 3C60D 4WEMB 3RIFK 5HI5C 1R47A 1CLOL 1DQKA 3HRZC 3L45A 2BIPA 2R0LH 2RHEA 2FBJH 4BV1A 5JHDB 3T0EB 4KH2A 2PWFA 1XCTB 2PPEA 3GLZA 3CIQA 1OP5H 3CG8A 3W81A 5E5UB 1T6VN 1IGML 1FDLH 3GJFH 4WWID 4KK9D 2ESVA 2G30A 2Y6SC 3PXJA 4RGNE 5CJOH 1IGTA 1RUMH 2ENQA 3AMKA 1CLYH 2Y5QA 4IKNA 1U8LA 2EDQA 5IB2B 3RWDB 4PV8B 4OGZA 5ICZB 3E0GA 3QDGB 3SDAC 1KPRA 1RU9H 5EOQL 3V5HA 5C09D 2A9NL 4NXSA 4P9ML 5HHPA 2FBJL 5IQLA 1N4XH 3EFDH 2BNRB 1XXDC 2DI8A 5ECGA 5DSCB 5G55A 1R17A 4PRPD 1MFCL 2BIHA 4NAQA 2ZX7A 4NN5B 4WKZB 2EIKB 5EOTB 3O3BB 2R83A 5I1DB 4EQ3A 1IGYB 2Z8SA 3SHSA 1TJIH 4PFEA 1SVBA 2EIEA 3EYQC 5AVUB 4HJJH 4WO4D 4DKFL 4BCZA 3ZTDC 1VGEL 2L7UA 1CU4H 5F1OB 1AO7D 3NMEA 5MEND 5C6WH 1HAWA 1S78D 3A47A 5KVGL 2RCSL 3HG0A 3ECBA 1DEEB 1J48A 2ID5A 4EVNA 5KOMC 5I1KL 2B9AA 1I8AA 2J7LA 2XFGB 5IWLC 3UG3A 4LT7A 2QDVA 2V17L 3MV9D 2F8OA 3OXRB 4NWUL 1CYWA 5C0CE 1J9QA 4DPBX 1RPKA 3P0VH 2YD5A 4MD5A 4UQ3B 4UIMB 5EDSA 4OH2A 1IFHH 4LCYA 1UXSB 3UC2A 2DDQL 3QARA 3W57A 2KQMA 3NGBC 2DI9A 5EWIL 4NOFA 2VDRL 4WNJA 2GKIA 2ITCA 5KBPA 1JE6A 1LO4L 3TBBA 1MHEB 2IEPA 4YH6A 5D2LA 4L1LA 2I07A 2HLFC 4OLWH 4U7SA 3VYNA 4JO1H 3V7AG 4YDVB 4KOBA 4CRPA 3OL2A 3ZO0A 1OP5K 3FT0A 3LHPH 4Q6IA 4Y4FA 3CNKA 3SCMC 1F4AA 1EJOL 3C08L 5I6MA 4QJ4B 4ZNEE 3FDWA 1BMGA 2EVHA 4D0CB 1ZA6B 1ZANH 3ARDB 3D39B 1BFOB 1AD9B 2DAVA 4IEFB 2HB0A 4L3FA 2LTQC 3WIFA 1RPQA 2B8OT 1AKJD 2CQVA 1LNUA 3BO8A 3J2PA 4PLKD 3CH8A 1T80A 4IJ3B 2XZAL 4JO1L 4Q2ZB 15C8H 1CLOH 3G6AB 3RKPA 4IRZA 3VB9A 4YHLH 2RJMA 3NAAH 2WBJB 3WN5C 4RAVA 4JQXA 3O4LA 1J8RA 5DFVD 2OMWA 1EO8L 5IVZB 4JFYB 4NPKA 3ULUH 2OMNA 1NGYB 3C08H 1HHKA 2QSQA 1PPIA 3SKMB 1MAJA 4OGAC 4DK3A 5KYNA 2EC9U 1OF2B 3DX8A 4PJ5E 1L6PA 1BVLA 2EEXA 1A4KB 1SOXA 4LOUD 5IIEB 3MRNB 5AUMB 3OGOE 5HHME 5B39A 4FG6C 4K94L 2OSWA 2HH0L 3EO0A 5E56A 1G9MH 3WOVA 3X3GH 5HSFA 3CU7A 1BM3H 1U33A 4OVVA 3EFDL 2B1HH 3PV6A 2CMRL 3VGDA 2OMXA 4HJ0C 4OV6F 3UBXB 1MWAH 2CAKA 4LCYB 1MHPH 1I7RB 1H19A 4QGYA 2IXQB 1U8IA 2UUDH 5HHOB 4HPOL 1RZJL 3H9YA 3KZ8A 3MOBL 2D7NA 4NQED 3RY4A 4HOWA 1S7SA 4HJTA 1I8MA 2B4CL 2X2JA 4M5ZH 4B3VA 2XOTA 5EC2A 5TGBB 3RWGB 4R4BB 4JQVA 3B5TA 1YN7B 4LDOB 2IMMA 4OD1L 2BMKB 3ARED 3D3VB 2V33A 4RRPG 1PNCA 2ATAA 5DJDA 4P04A 2AMGA 4AE1A 5IHBA 4JKPL 2NNFA 4Z3GA 1PZSA 2BY3A 2NT1A 3O0LA 1QA9B 1FGVL 1PBYA 5CJXC 5AAMC 3U4AA 1VHPA 4M5SA 4HZ1A 2C1OB 3NZHH 1TQBB 3S5LG 4OLXH 4PJBF 4Y5XB 3PWPD 1BYNA 4XCFH 4LEEA 5CCHE 2H6UA 1EHXA 1CF1A 2J1KA 1DBBL 1K3ZA 2MTAA 5GGRB 3G6JF 1OQOA 4ZX5A 4YHKH 4PRDA 2ZX5A 4G8GE 5HYIA 3S8FB 5ID0B 3JV0A 1BX2B 3WJLA 3IN0A 2C4FU 3DV4B 2BDNL 3L1GA 5HHVL 3WI9A 4UT9H 2BY1A 4TL5A 4L0PB 1ZT1B 3L95A 1IAKA 4N8VG 5ICUA 4OUUB 4HCRA 3S4SA 4QXGH 3VDCA 5AOIA 3UCRA 2ZX8A 3QORB 2YGNA 3IDGA 3IRCA 1W72H 2ETWA 5FW7A 1RHHA 3KLKA 4X4XB 3RY6C 3SGEI 4NCC2 3GSVB 32C2B 5BV7C 5KTEL 3HUJA 1HYRC 1DQML 4L1BA 4U0RC 4RWHA 3WFBH 5GS0C 4LAJH 4FS0A 5D7KE 2YLHA 1WA1X 2P52A 1JWUA 4YK4C 5L0QB 1REIA 3ZE0E 3E80A 4B3EA 2CKBA 1WICA 2X9ZA 4X8CA 4DCQB 4ZSOB 2IH3A 3TNMA 1LO3H 4U3CA 4QXGL 3C8KA 5E00A 3L4UA 3ATFA 3KYOA 4ERSH 1CXHA 12E8L 4AEFA 2ZAGA 5KTEH 3IMUA 4TLKA 4FHJA 2ZOUA 3SY6A 2NY6D 3ULUD 2C7UB 3FUDA 4FQCH 4K5OA 2W0PA 4WSGA 3RIKA 5ILTH 1AHKA 1A7RH 3CC5B 2HVJB 4NQDA 2VLJB 3RQ3A 3BLKA 1HIMH 2XKNB 3EJZC 1ZE3H 4YX2H 2BRQA 2YMOA 3CSYA 1OGSA 3M86A 4TTDD 3VU1A 5A43C 2H4EA 4RZCB 1E4JA 2UXFA 1H15A 3S5YA 3BD4A 2FUTA 2K8QA 3NSXA 5A2IH 2QPUA 4PJ8D 4P5MA 4FF9A 4DZ8B 1MCIA 1GGTA 4HPYH 4XCCL 3DUHA 4FJYA 2Y1VA 4F8LA 1LLAA 4ZOAA 3LV3B 4WV1B 2VH5H 3ZTJG 5CLWA 5CJBA 2ZD0A 1VADB 4Y1TA 3D0LA 5BZWB 4PRBB 1UXLA 1OVZA 2QVMA 3QYCA 4V11A 1N6QH 4ELMB 3CHRA 3QCVH 4A6YH 4AQAA 1I7UB 4WFGE 3LJ3A 2W59A 1PZ2A 2G5BA 3CN2A 5TPWH 5FKAB 3VFPA 4KAQH 4NM8L 3I02A 2NR6C 3TBTA 3LPGA 4QRSB 1MCOL 5L0QC 1AE6L 4YK4B 2MPVA 2CRZA 2OXHB 4HG4K 3BFOA 3AREC 1PEZA 3NN8A 1OP9A 4GQ9H 4BZYA 3DK2A 4U6HB 2WLJA 2V37A 2YPLA 3ZDYF 5DVMA 4LGPB 5EZOL 3TV8A 4JGJA 4OD2A 1CGWA 2GJRA 3S7GA 5IUCA 4FQLH 5KANG 2NCEA 3KPRD 1IGCL 1WGOA 3X11B 3EDKA 4HLJA 2ADFL 3MV11 2CIKB 1PKQE 3DGGB 4XVTL 3QB7C 3GRGA 3BP6A 5HHOE 4F2ME 2R29L 3PJSA 3FQNA 4F2EA 5LNDA 5TDNA 2WM0A 3IDUA 2NPLX 3RZCA 4DOHE 3A67H 2HJKA 5C9JB 4K3HA 4KDTC 2XC8A 1YN6A 4KV5E 1A7QL 1F56A 1IAOB 1U8NB 1UZ6F 4O2EB 4HIQA 4AQZA 1S9VB 4U1LA 2GY7B 3WUWG 4EUPA 5D7JA 1LXMA 1DLHB 5B1JA 2ITDB 3WELA 3CFKA 2QPEB 4P2QE 1OE3A 3LZQA 4U4IA 3L4VA 4L8SB 5IQMA 2DRUA 3LKRA 1CI3M 1D3CA 2EDMA 1PGRB 1F02I 5JW4M 4HS3A 5I1GH 1MJ7H 5FUZL 4F37F 3OQ3B 3U6RA 4FOMA 2H47C 5DC0A 3ARFA 4MA7L 2Z8WC 4XO8A 3WJMA 4DVRH 5F7HA 3B9KD 4PV9B 3GO1H 3TA3B 2ED9A 5C7ZA 3IEAA 1X9LA 3P30L 3RNKA 3RVVC 1PLCA 1SJMA 3NCFB 1P5UB 3DPDA 4GAAA 2FT7A 4RDQF 2R27A 4P4KD 3PDOA 4NHCL 5GRXG 3LNFA 4ZZKA 1MLCB 2F74B 3X3GL 1F6AA 2NUTB 4J12A 3IFNL 5C0BD 1JDDA 1LHZA 2K3HA 5I1GL 1YAZA 2A38A 5DMGD 3TX4A 1P4LA 1MHPL 2EADA 4OLEA 3TCTA 4LMQE 2H9GA 2FHBA 2GEEA 4ODWB 2LR4A 3KLSA 5J1TC 4ABVA 1AKJB 3CFBB 4JFVA 2CJUH 5GGSB 1Y0LA 4XNZB 1QI4A 3R8QA 2HT3D 2YOCA 4RMQA 1UA6L 1RULL 1D5BB 3IBOA 4QXUL 3ZMEA 4LK4A 4DKTA 3FTZA 1C08A 4G5ZL 1RJZA 3GEFA 5F3HB 4P2OD 1INQA 3EFOA 2SEBB 3VMOA 5IZ7A 3OAYK 1I3GL 1G7IA 2DS4A 1F4WH 1RQ5A 4RX4A 1G7QA 3BKCH 5IF0A 1IO4C 2PR9A 3WFHB 1J11A 4URKA 2R1WB 2FLBT 2XXGA 4WFEE 2E5EA 3LS4L 2FNBA 1TKWB 3WS3B 4ELME 3GRWA 3OXSB 1D5XB 3ULSB 2ZSVA 4YAQA 3L1OL 1LP9A 1TJMA 5EA0L 5F88B 4HUXB 3UACA 3OKMB 5CLTA 5HHOD 3D07A 4RFOL 1GXEA 4PIRF 3WFZA 1LNUB 2NR6D 3DX6A 3LNGA 3GI9L 4J4PC 4X80L 4Z77B 3LEXA 3V4VB 3UTPD 1XZWA 3PWLA 5CEYB 1JDCA 1EEZA 3HNVH 3CXHK 2K7PA 4RMTA 4KZCA 3STLB 3QNZA 3KYKH 4R90H 2KYIA 3FB8B 1RZIA 2ORBH 5I71C 2HVJA 3O11B 5K9QI 3LD8B 5D1QE 3FUHA 4L29A 1CDBA 1S9YA 3WKMH 5C0CB 3WUWB 3PDDA 4M61B 1RHFA 3HI1A 4GKSB 4YHNA 4JO3H 3AU1B 3GSWB 4M56A 4XBGA 3NGBB 5IB5B 3GKWL 1G6RL 1LO0H 4G7VH 1BZDA 1N10A 3GZPA 4MA1C 5DD6B 3ZQWA 1FNGB 3A6BL 3O4LB 3Q6GL 5IV2A 4FHBD 5J89A 4W9ZA 1JWUB 1DVUA 1T1ZB 2OA9A 1A3RL 3FUNA 4TVSa 5H35B 5AKSA 4Z7WF 4Y9CA 4ZMYA 1U4FA 1H15B 1AD9A 1MCEA 4LO9A 4POYA 4QHUB 4QRPB 2CGZA 1A1MA 1ES0A 1XGTA 3QEUA 1Y1UA 4LEXL 2R4RL 4KRPC 1KGYE 3GS4A 12E8H 4I13B 1F4YL 1IAIL 1QG3A 5A2JH 2VYRE 2PYEA 5HGGS 4AV0A 3DTXB 5K9JH 1V27A 3IBEA 2P8MA 1AHWB 3B83A 3MLXL 4KI5E 1E9OA 2I85A 1QFUH 4YXLH 5I74B 2VDPH 3GHBH 3EUUA 2GBAA 4WJG3 4JE0A 2B3RA 1I7UA 5ICXA 2A4CA 4XE0A 5E0FA 3VFRB 4DEPC 1OAZH 1KGJA 4Y2DB 5C07D 5CUSH 4GUCA 2FSDA 2X4UA 5KWYC 3DYPA 1C16B 2A9CA 5LGJA 3CDCA 4BD4A 5ADPH 1SQMA 4WI9A 2VUKA 3ME0B 3QUZD 3ZN6A 2FGWL 2JKIS 5E6YA 3QEQA 1ACZA 1CT8A 4UT7H 4JRFA 4XOAA 3RTLA 4G80A 2ZICA 2E59A 1GC1C 5JXAH 1BVOA 4MD4B 3QPQC 1JNHB 2B7DT 4JKLA 4DP8X 2VW6A 4BFEA 5JUEH 3CIAA 4AENB 1JZHA 1JAEA 1RZKC 3IETB 5KOVC 2GC4C 4Z3FA 3ZGHA 5IY5B 3BLBA 2CKNA 1OAQL 1CMOA 1J8KA 1USQA 2VLKA 4XN4A 2FGWH 3LDBC 3PWUB 3KE0A 1F18A 2Y23A 5F1KC 5C2UB 1UD2A 1S3KL 3NG5A 3NDZE 4AEEA 1K8IA 4PJHA 1J1PL 3CZLA 5F0MB 2QDWA 2AKRB 3P3SA 2VO8A 5DUMH 2CO2A 5DZNA 4NNPH 1NJ9B 1F6LL 1XCWA 5C3IA 2ZXEB 2BK8A 2HN7A 5JOFA 2F58H 4NT6A 5FYKL 3X14A 3QIWC 4FTDA 1TMCB 2NX5E 3WEBA 1VDGA 3EYOA 5LDUA 1NBYB 3C5SA 1YUKB 4RIRA 3D50A 4XXWC 3FTSA 4C54A 2JCWA 4XTRD 4KPHH 5TE7L 3UTQA 1U3HC 1Q9LB 1ZLVK 3UOAB 4DH2A 2W07A 2BVTA 1YECL 4FQ2H 1U8QA 1QSEB 3B37A 3VMPA 4JFUA 2L04A 3MRBA 2XWRA 4YFLI 5I24A 1AKPA 2CUAA 3RTQA 1IT9L 1IE5A 3V5KB 1PJ9A 2OS7A 3KPSD 4J3OF 2CBPA 5E9DB 3EOBB 3ME0A 2EYSA 5PAZA 4YQXL 5ACZA 3FT3B 3JT0A 3DLQR 5BS0E 3F7LA 3MLXH 3CC5A 4NQDB 3O6FD 3FSZA 1P4LB 3LKQB 1AQDA 2DF3A 1N64L 2NY0D 3PGCA 3RWFA 1AOZA 3OWRA 4Y2OA 1CJYA 3VD2A 1GW6A 2Q5BA 4DEUA 2B2XL 3LRGA 2RTTA 3FQYA 3KJ6H 5EZJB 5FM8A 2YA1A 1LDSA 4U6YA 5K9OB 1YHPA 4JM4H 5LCVH 3MBEC 2YK1H 4WCYH 3VRJA 3LPWA 4P4KB 3IT8D 2YBRA 3RX5A 3B8YA 1I1RA 4UAHA 3UZVA 4HD5A 1FORH 1OP3H 2V2WB 4QD2E 3HB3B 5EG6C 1L7IH 4GSXA 2X0UA 4K9EC 4AYFB 1NFDB 1KIPB 1QBAA 3BWAB 4GKLA 2XVGA 4OIBA 3BAJA 4TNFA 5F7BA 4YDIL 3VQMA 4D9LH 3QXVA 1Q9WB 2E6JA 4P5TA 4P2QA 1J05B 1AZRA 2OCJA 3K4AA 4OZGB 4BFGA 1NBZA 4XMWA 2C3VB 2H6PA 4BSVA 2HVBA 1VRSA 2X5PA 4G5AA 1GZHC 2HKFL 1ZSDB 4H13C 3VVVA 2WIIA 1U3ZA 2Y2YA 1V3KA 5B1AB 2QV4A 1E5ZA 2E3VA 3ESVF 4IIQA 5E8DL 4QHNA 1N5YL 2EAEA 5A2FA 4JPKH 3KWWB 3BVTA 4Z0BL 4U49A 4GIPD 3I6LE 3P77B 3DGGA 3AS1A 3MGTA 1J5OL 2P45B 3EOBA 5IHUH 3ASWA 1X5IA 3IXTB 3GXDA 2WXJA 4MJ6A 1KIUA 4O58H 4XNYL 2EC9T 3DX0A 3IJ9A 3KYMA 1AIZA 2PYED 2HKFH 5FYJL 3S37L 5HYSB 1ZV9A 3BAKA 4IKIA 2G3ZA 3O41A 4JZNB 3WGUB 3TA3C 4JM2A 1ZPUA 1PFOA 4OFVA 1QLRA 1KBBA 3CSFA 3HPLB 4WHTB 5EF0A 5KBLA 2B9BA 4M9PA 4NZTL 4B0MB 4NI3A 1KC5H 3MRCA 3OHXB 4ZYKB 4HVBA 3S96A 3FT9A 2F5AL 2VC2H 4I48A 3GC3A 2XT1B 2ESVD 4NZRH 5IFAL 3HMXA 3OZ9H 4MX7A 4Q6YA 4AUUA 4ATWA 5GZND 3MLPA 3ZDXF 2F7RA 4UNIA 3GSQB 2YAFA 5FLUA 1JCKA 5FYJH 2BRRH 2QVIA 3FRUB 2ERJB 1IBFA 4MMYA 2E27H 1B0WA 4OQ1A 5D1XD 4FYTA 5HGBB 3QUZA 2MRYA 4L23A 3RPBA 4YLCA 1ZVNA 4CUCA 5I75C 2OL3A 1A22B 2EDLA 4N1HB 3VWJD 5FUOH 1F11B 4IGBD 4OZIE 3JVGC 2XTJC 3MNVB 4NRYA 1NUNB 3RDJA 1QEXA 1NFDA 4XAWL 3ARUA 2VN3A 3O2DL 4TYUA 1JNLH 1KYUA 4ELKA 4N6RB 3A4FA 3I6SA 4P8QA 5GGVL 4Y5XC 4M6NH 3KJ6L 2JKSA 4ZFQA 3ARYA 1KB3A 1SUJA 1LWJA 4ZUWB 1F6AB 5ANMB 1UZGA 3SD5A 3H53A 5MENA 3OG4B 2OMUB 3WIAA 1JDAA 3ATBA 4P4RA 5FYKU 1A7OH 1XH2A 2XKNA 4FCHA 4AQ1A 4JM2B 2K45A 2B16A 4MA8L 1KGCD 2Q8AH 3PWJA 3WEMA 2WOBA 4UV4H 1OAZL 4XP1L 3WGVB 4YSOA 1NAKL 4ZOBA 1C08B 2BM3A 1JNNL 3KM2A 5BZDB 4JZJB 3V55A 4YDIH 3FFDA 3HG2A 3KD4A 3CU1A 1A2YA 4FABL 4ZNCD 2J1WA 5EF1A 1RZ8B 1A6VH 5HGBA 1G9EA 4E41A 3GK8L 4Y1AE 3PL6A 1UT2A 1CF8H 2V5YA 3I6LD 2Q8AL 4ALAC 3DOSB 4OD3H 3DETC 4NQXA 4QKXB 1A4KA 2PP9A 4UV4L 3TV3L 1Z6JT 4RMVA 4F2MB 4XZUA 1C8PA 5CN1A 1GHFL 2DD8H 1Z3RA 4Y4FD 5I18H 5F3BA 1IZJA 4ETQA 4Z3EA 1XEDA 1LK3H 3GMQA 2PYEE 3FO1A 5E51A 2XIIA 3SGKC 1HSAB 3JUZA 2ZT9C 2IAMA 1BZ9B 3C6EA 3DXAA 1WDAA 4QUOA 3K2UH 3JZYA 3STLA 4ZAKD 2Z1KA 1E5UI 3G5ZA 2QKSA 3MRGA 2JSFA 4GS7C 5K39A 2Y36H 2JF1A 4YGVA 4E5XB 1YYCA 5JOFB 2APSA 1L9TA 5F89A 4OZHA 2FBRA 4N0UA 2FO8A 1TG8A 4JCLA 4UF7C 3FN0H 2WNKA 3H0TA 4R8WL 1R0AL 1MCBA 4LCWB 3TBWA 3V9FA 2EE9A 1AGFB 4W9FC 4HH9A 2UXGA 1TXKA 4LL1A 2XZQL 2IALA 1IAIM 4PY7A 5EU3A 5A16B 5F7MC 3REWB 2P5PA 1I82A 5F7EL 1YYML 1NM4A 4JG1L 1B6UA 3RWFB 4LEOA 1SN0A 2UVEA 1TQCB 1MEXL 4HSQA 1M05A 1OSZB 2HT4C 4ODHL 2YD3A 3FT4B 1HCYA 4JZJA 4LQ1A 4NQEA 4OJEH 4OZHF 4IBTA 4M8QB 4L1SA 4FCAA 1TJGH 2GEQA 3SPGA 4P46C 1KB9J 1FGNH 4CN1A 4Z7WB 1WJ3A 2XWTB 1MFMA 4K7PH 2E74C 3SD2A 1O9ZA 5I0WA 1UB5B 5IR1B 4TS6A 1ZT4A 4DP7X 2JJSC 1S7UB 1BJ1J 4Z1PA 3IU4L 1R34A 3EYUL 3TZVA 1F2QA 1KPVA 3WUZA 3MBWA 2Q3XA 3UTOA 1UCBL 4DN3L 1Q0XL 1HH6A 1UWEL 2P3YA 1KDJA 3P11H 4ODHH 4FQQB 3V0AC 3QNYA 1S5IH 2JNZA 1P7BA 1TJGL 3IDYC 2NXYC 2AHIA 4Y1AD 4CMMB 1USZA 4WU7A 3CK0H 5BUAA 4G8FA 4MJIE 4BSWB 4YL4A 2YK1L 2Z65C 3ZJAA 3HZMB 4G6AC 3ZTCC 2P8PB 1NGYA 4BZ2L 4BBWA 2H9GB 2IH3B 2WLYA 3COOA 3F58H 3OD3A 3FL7A 2OK0H 4MSWA 4B6ZA 1EVTC 5E8NB 1FFNB 1AC6A 1M6OB 4XMKH 3ARFC 4LCWD 2O5XH 1NC4B 3T8VA 3F7VB 4DGVH 4WI5A 1CGUA 3ZHNA 4LBEB 2NDFA 1BVNT 3UFIA 5GJSL 3QAQA 3ZRFC 2AK4D 4JRWA 4MS6A 3IJEB 3QI9B 3LXBA 4KKQA 3U4BH 4PIBA 2NLJA 1IILE 1MCHA 4NNYA 3T3MB 3WIIL 5DQDL 2CR0A 4FKEA 2OR8A 2XU9A 3ESNA 1WZLA 3WS3A 1N59A 3WE6A 2ICEA 2EDKA 4JKWA 3K2IA 4NP4H 3ZY7A 2R23B 2DYPB 5T1JA 1E6JL 1O6SB 1UA3A 2BS9A 5DQ9B 2CGRL 1IBDA 5IK3A 3GNML 2IPTH 4AW7A 4AVHA 3ARGD 1U8OB 2X70B 1NFDF 2OV0A 4LP5A 5DS1A 2HLAA 1HEHC 1JVKA 4EI5B 1I3VA 3BE1L 2FO1A 1OW0A 3I3DA 4L8CB 1DN0B 3HR5A 1QEWA 4AV5A 2NY4D 3QIBD 3JWNH 4LASL 1INEH 1U8MA 4GKSA 1WEJL 1XGYH 5E6ID 4YHNB 3EKCA 1DLFH 3ZE2F 2CGRH 1F1GA 1A9VA 3TESA 3LRSA 3D06A 2DM2A 3VXTA 4WK0B 5BOPA 5ES4B 3S48A 4N2CA 1MH5A 1YEJL 3SGEH 3UZQA 5DEGA 43CAA 4PB0L 4XB8A 3HBQA 4KX9A 4BJLA 4JM2F 4Z7NE 3H85A 4PY8I 2NX5B 5FF6A 3AAZA 3CFJB 1W91A 1A6WL 4J6RL 1OB1B 1FNEA 2C9QA 2ZOLB 2JB6A 3RZWA 2PTTA 2YD7A 4NN7B 3HLAB 1NC4A 1SXBA 5CCGE 2LE9A 4N87A 2PWEA 1S7QB 3CLWA 5AWNL 4LLAA 2Q87A 3HFMH 4XPAL 3QQDB 1ZA3B 3JWDL 2VDKL 4NKMB 4LCWE 3NCJH 4V1DD 2OFQA 3PGCB 3ARZA 2UVFA 2EO7A 2VW7A 4IHOA 5FYJE 4FNTA 2F15A 4AYDC 1HESA 1HU8A 2CBOA 4KNQA 1HS6A 4XBPB 4H7VA 5I1EH 3PE9A 3AC0A 4KMLB 3VX1A 5L2JA 1QRNE 4P23C 4GQZA 3WHXA 3K6DA 1JWMA 2HFGL 3AB0C 5GGSY 3LZNA 4H25A 5E6ZA 3DRQA 2G4GA 1HI6B 3EH2A 4JB9H 4K23H 1ND0A 5JQIB 1T0MB 2AJXH 4ZXBC 1BOYA 4XMZA 3MLVH 1P5VA 2WTPA 4A6YB 1MCFA 3NEEA 4N2DA 3SYOA 3VTTA 2XQYG 1RP9A 5JYMA 4ZOCA 5FECB 2E6PA 2X3BA 3EOYG 3O4OC 1R3JB 4B97A 3D51A 1UA6H 1MREH 1YO4A 5FB8A 2QMKA 4OUUA 1QBLL 3S4SB 3GZOA 4WJ5A 4LVOB 4KROD 4EQ2A 6PAZA 3QQ9D 3HC2A 2YD2A 1T2XA 4QEGA 3DI3B 4JB9L 4K23L 3EFOB 2H1XA 4DKDC 4BZ1A 1WD8A 3GNMH 2AV1A 3DJRA 4TUJA 3MLVL 5LAPA 5E4IA 3EH1A 5EU3B 4BSVB 4E68A 1SOSA 4U6VH 3MJ9A 1A8ZA 5I74C 1MW0A 3GKZA 4WAFA 4ZO8A 4L3CA 4FYRA 2OTUA 4ZPVB 3GWJA 4OZHB 3TBSB 2E4FA 4XAKE 3IXAB 3WAJA 2PNDA 1K6QH 3MO1A 1XIWD 3H3BC 3PLYA 1KSRA 4BRJA 4D3CH 4CC4A 2YKLL 2AGJL 2NY5H 3OJDA 3K7UA 4PBVC 4R8WH 3S34H 3PPEA 3Q0HA 4DUVA 5KZCB 1VEMA 4U6HA 2KDGA 1QRKA 4P99A 3UTPE 4JFXB 3BFQG 1IAII 1KPVB 1QHQA 3QDMD 4J6RH 4GRMA 4MQ7A 4U3SB 4OB5H 5I0XA 4RFEA 4OFDA 3PXHA 3ARBD 4K3JH 5D1QD 5J12C 2FEDD 3VFOB 4XVTH 1OAJA 5EU5B 2IANE 3TIDA 2R29H 3QFJD 2D3VA 2W0FB 4I3RH 5K33A 5AWNH 2ZCLL 1ACYL 1THAA 2AQPA 2P24B 4X6BB 4BA0A 6FABH 1QTSA 1VFUA 4MVBD 4JFSA 4AEIH 1NBVH 3EW3B 3EXLA 4PJCE 3O2WH 4OF7A 1RMFH 1P1VA 1BZ8A 2NY2D 3L3DA 2XJLA 3RVWC 3U4EB 4GQQA 4PJHF 5ITBH 4JLRA 1ZHNA 4X6FB 4TNGA 3H9HA 4G7RB 1UJTA 2A0LC 1NOAA 1Q72H 3GQFA 1DBJL 1E43A 3MTXA 4DN3H 3HE6C 4AUJA 6FABL 1Q38A 2QVKA 4W4NA 1C9SA 4ZJ9A 5KANI 2PO6A 5T1DH 2X10A 2HXAA 3LNIA 3T6QC 5ETUB 3FQXA 2N7AA 5LGKA 3DIFA 4JMXA 1S9XB 4KI5D 4AGPA 3BPLB 5K39B 1GGBH 3QPXL 1TNMA 4UILL 3ULVD 1OSEA 3LMJH 3AFLA 4MNQB 5HGDA 1JMZA 1XL6A 4Y19D 5D7JB 5IEHA 1KLFB 1NIDA 1HN1A 4XMTA 4P23D 3BZDA 4HGKC 4PWHA 3OMNB 2ZONA 3UTSA 4U6TA 3QQ4A 1FAIH 5AKVA 4ZMLA 4AL8C 1QMUA 1JPEA 1OGAE 4KUZL 4MGXA 4YIQA 4M1GL 1PD1A 4KO5A 2IQ9L 3DGDA 5JUEL 4F91B 2HTLC 2ZIDA 4HAKA 4H1LA 2WUCL 4A2FA 1XF2B 2EQDA 2WCSA 3P9MA 4AM0A 4LU5H 2BWIA 2XG4A 3KVQA 3QXDB 4OFPA 2E9IA 3DBSA 5INCB 1MFUA 3ZKSD 2OMTB 4MNGE 4NJAL 1MW1A 5SWSB 3SZKC 1KXQE 4KROC 1EJ6A 3BKCL 4JFTA 4LKXA 5H94B 5LBGA 4TOYL 4JY5H 5I8CB 3ZYJA 1YEEH 5H8DA 1HILA 2X7LA 4FI8A 5J5EA 4L3EE 4Z7WA 3KCPB 2ODHA 1FO0H 5FF6B 3NSJA 4LB8A 4DP1X 2Z4TA 4PY8J 4ZFFB 4BUGA 4ZMTA 2DM7A 3OXSA 3WNKA 1JZ7A 3WNMA 4PN6A 2C1PB 4HUUB 1YA5A 4IOIB 1RZ7L 1UACL 1VFBB 4L8DB 4QRPE 4JFFB 3GI9H 4OZFH 4X80H 3HG4A 4UWQB 5DK2A 3V52L 4U33A 3FOLA 2V0AA 3OSKA 2MQ3A 1QPPA 1F00I 3REWA 1ZHBB 1X5ZA 2QPFA 5T1KD 1I8LC 3MACH 4FQ1H 1W0YT 3UJIH 5FOBA 2H32H 3QC5X 4YFDB 3VXRA 3ZU8A 4JFEE 3FMGH 1SHSA 1P2CA 2X9XA 4AXWA 2FBOJ 5I17A 2EDFA 5JHMA 2X4OA 4HSAC 2BNUA 5EORL 5I66B 2BCKB 4ANUA 4DZ8A 4ADIA 4BEIA 2PTUA 1MI5D 4MNGA 4PAZA 5IGXH 1ORQB 2Q7AA 2FIKB 1DVZA 3MZGB 3VXSA 2IADB 2CXGA 1VJSA 2X4SA 3H7BA 3MRRB 4M5YH 5H94A 1LP9F 4EIBA 4AV4A 1ZLVH 1W8EA 1KDIA 2C4XA 4JO4H 2JCCE 4BQ9A 3B9AA 5EFIB 5AEAA 4P23B 1JFQL 2J5LB 1E5BA 2V3DA 5HI4C 4YJZL 2AFNA 5IMKA 3EDJA 2QSCL 4XP4L 4UILH 1MY7A 3GHEH 3ZT7A 3L4CA 1EXUB 4DWHA 2YMXL 4NO2B 5LJYH 5JNYA 5SWSE 1BGXH 1XIWA 1UVQA 1I31A 3SDCA 3BUBA 1RZIB 3C09B 1A0QL 2OR7A 2VZ3A 3P9WB 2V4LA 3FPXA 3GMNB 3HG1E 2K6YA 1F58H 1QA9A 3KW7A 2YC1A 3OKKB 5AQ0A 2E7BA 4HIIB 4Z6AT 1FZOA 2HG5A 2VZTA 3HG3A 2A4EA 4K94C 3TJHD 5I9QC 5D2NA 3EYFA 3AADB 3G6DL 1X5MA 3IFOB 3KHQA 3PNWB 5BO1H 1L5GA 4LLUA 1Y7VA 5D1QA 3E6HA 3II2A 2TRHA 3ELQA 4CSSA 3SQBB 5J6HB 3LRMA 1GZQA 4PWJA 4IKKA 1BX2A 4YSPA 3VAEA 4CNIA 1FO0B 4NIKB 3ARVA 5AZEL 3R7RA 3U48A 1DCLA 1JZ3A 1EHKB 1PF3A 3GRWH 4EBQL 1Q0YH 1ONQA 4MCYA 1A1NA 5FW8A 4Z0BH 1UWFA 1MOEA 2ZAIA 3G04B 4B0MM 1JGUH 1QFWL 2LLNA 2J1YA 2OX5B 1H3PH 5DRZA 1T7ZA 1MNUH 5C08A 5IW3A 1XCQA 4PBDA 3HZYA 5J12B 3SCMD 1RZGA 3ML8A 1JNJA 4JFED 4MJIB 1DE4A 4UQ3A 2BERA 4PRID 1R6VA 2F8VA 1K8IB 4DUWA 1K5NB 2PN5A 3GJFB 3N0AA 3LY6A 5JHBA 2YBGA 3W3BA 3EBHA 3MXVL 2CO3A 3DHJA 5MEOB 1S4IA 2UZXB 3K1KC 4GW4A 5LLIC 1N26A 5FHBH 1SY6L 4BELD 4PRPA 3SJVA 1YMMA 3TO2A 2VISB 3C8DA 4R3SA 3EJZD 4UOW0 4HYTB 5KYUB 4MZ3A 2NDGA 1XF3B 4EXPX 2WANA 1G7LA 1WIOA 4GRLD 4Z7WE 1H0DB 5I1CH 3TVMD 3MXWL 2E27L 4XWOD 4C56E 3WNNA 4JDEA 4JREB 1U91A 1RZKH 4F7MB 1PKOA 1CICB 3GINA 3NCEB 3CPLB 2G75B 2R0KL 2XQBH 4UQDA 2RR3A 4WEBL 5DDHA 3KPNA 2Q0ZX 4X9IA 3KLDA 1A7PH 3MUUA 5D1XE 1CFBA 4JFZH 5BJTB 1LO2H 3I75B 3BVXA 3FCTB 3QIUC 5EUKB 1TEFA 1ULVA 1S8DB 2K6WA 2QSCH 3FONB 3M17B 4OSUH 4QO1A 4RSYA 5GGRY 4IS6B 4JFHD 4YQXH 4E9YA 4AL8H 2AEQL 4W9IC 1A66A 3C5SB 5ABAA 5C70A 1KJMB 1OB0A 2YMXH 1NLDL 3QH3A 4L48A 4N2MA 1Q8MA 4OF0A 2P80D 2IG2H 1RZFL 1I9JH 3B2VL 2A6DB 3EBIA 3KXFA 1FL5B 3LQMA 5D1ZB 5IB4B 2BSDA 3F6JA 3QG6B 4ODBD 4EI6B 4UTBL 1NJ9A 2EO1A 5L4JA 1QLFB 5GRUL 4M9OA 4X7TB 2WQWA 2MQGA 4J2QA 4M5TA 4YHML 2VDQH 3S3DB 2R4SL 1UUNA 2UY6B 2R9HC 1J5IA 5HGAB 2AJYL 4PVLA 4C4KT 1XCTA 1ZLDA 4EN3D 3P73B 1OTTD 1KLUB 2QPSA 4HS8H 1RJCA 3B2VH 5IHZA 1MVUB 1N3NB 5FM5M 1HFUA 4PJ9A 3W37A 5E95B 4ZFGH 2BJMH 5FOBB 1BFSA 1TZGH 1GKEA 1TNNA 5A7EA 2DQJH 1YDPB 5FM5O 1QNIA 3W9EB 4NZDA 3DUUA 3VXRD 4M6AA 5E8EA 3JZ7A 5ELIA 5I1LA 1BAGA 4XX5A 4KZ0A 5IJVA 5AD0B 2O6EA 1HTYA 4MD0B 4ENZA 4LESA 3HNTH 2A3TA 4R2GC 5FA3A 2FLMA 1A2YB 2VMDA 4BH8A 3WCYA 4F2FA 5KBDA 3BIKB 4Z0XB 3ZHLA 1MF2L 3QIUB 1OL0A 3FO2A 5F7LB 2Y36L 2VTFA 4LSTL 4Q0XH 1IBYA 4LDCA 4LVHC 1KB5A 2A4ZA 4OAWB 2HWZL 2ZE0A 1AGDB 1T1YB 1NDMA 3NCYP 5FHBL 3HUJF 1T5XA 3QRLA 4I9XA 1SLWA 1AJ7L 1CG9B 5I8OL 1DEEA 1UG9A 4G42B 4Y7MA 4A7SA 4UT6L 2MPAL 2I9LA 2X2UA 1Z9SA 3N55A 8FABB 5AAWA 1UJ3C 2PYEB 2GJPA 4O58L 4YWGL 4N5UA 1MXGA 4HETA 5DA0B 4OT1H 3S37H 1MIEH 2YD8A 1EAPA 4P4KC 2X2YA 1SEBA 1WS8A 3U6RB 4I89A 2DLFH 4IJTA 4HOMA 4FQ1L 2HAZA 2AF2A 4FQJH 3DX7B 3HMXH 2ZUQC 3G6JA 1GGCH 4NKIH 3AREB 1GZPB 3POCA 3JBG7 2XVBA 1U8JB 3L48A 5DJXB 2XQYK 5EORH 4ZUSB 4PJBA 5DVKA 5IEHB 1L9NA 2KQNA 2NXZC 3ZKXC 4Z3TA 4JJ5A 2XWBB 5DHDA 3V9CA 3L08A 1E28B 2HT3C 5D96C 5IOPB 1S7VB 3H42H 2Y9RT 4G6FB 3L17A 3VI4E 1G7HA 2FJHA 1UADC 2IG2L 3D05A 3CLFL 1AYRA 1BF2A 3ZZQA 2IPKB 1GGCL 2Q1EA 2WCPA 4BKSC 3BGMB 1LP9B 5HJBA 5A2BA 3FSAA 3IKKA 1G0YR 1UA7A 2XA3A 4R5XA 4PJIB 1T3FB 1TEGA 3ILPB 1CDJA 4Q2ZA 5I0DA 3QIUD 5HDBF 1GGYA 4Z7OE 1NBYA 4TSAL 3SKUD 4E0RA 3V8OA 2ZKWA 5AYUH 1U8PA 3DVIA 3WLWC 2L4OA 4Q9RL 1XGRA 1X5HA 2H7WA 5DEFA 4H8WH 3KPOB 3MFFA 4AW4A 1NDGB 3RGVB 2A6KB 3CX5K 3KLHD 3RL1A 2QBWA 2BFGA 4JCWA 2B77A 5F88A 4DGVL 1XEUA 5DR5H 1TFPA 5CGMA 3HE7D 5B1BB 5ALBH 2FSEA 5A2KH 4JPWL 5INCA 3WNOA 4OQTA 5EZIL 2NXYB 2I26N 2Q7YB 3P02A 3VNYA 3VXSE 3I9GL 1FN4B 4HKBA 4IHBA 3NEXA 4G8FB 2VDMB 4MAYC 4B7IA 3HNTL 2R0LL 4BSWA 3DO7A 3AGVA 1B4RA 1D2PA 4ZX4A 2WTRB 2YD0A 5EPMA 1CZ8L 1CXLA 1LTXA 3D5OF 2JI3A 2XN9E 3RIAK 2VL4A 3OAUH 3WE6B 5FDWA 1G4RA 2Z7WA 3JYBA 3VGHA 1GHFH 2FECL 4ILDA 1KYFA 2OR9L 1RFDH 4XT1C 2OULB 5CIPA 3VA6A 4N9GA 5ID1A 4WZ9A 1DL7H 4R4BA 2XDHA 4ZK8A 1DJXA 3BKML 4MXWL 2P8LB 4M7JH 3V4LA 4HIEB 1J5DA 1T89C 2YQ3A 3M8OL 5D1ZC 5IV2B 3PHOA 3HJ0A 5C8JB 3P4NA 4GW1A 2E7DA 4LASH 4HA1A 3V0EA 3L4WA 2WXGA 2O61B 3GJEA 2EKSB 4BA8A 4V2CB 2P5ED 3VFRA 2EVFA 5KYYB 3WJMB 3DARA 3D2TA 4XH2A 1QBMH 5FLVA 1AH1A 4K3GA 3FQWB 4FLQA 3EG9B 1E5YA 5D2LF 4DEPB 1DVTA 3TEWA 4BFRA 1JF1B 3CVHB 3QNXB 4H4NA 5K1VA 3N44B 4LCWA 3KYNA 4Q6KA 4URTB 2JKLA 3TBWB 1KBKA 4JHUA 3DJZA 4Z5RB 5AVQB 3IWUA 1ASOA 4JG1H 4GS7B 1SXZA 5HI5D 4M7ZC 3X12A 2AK4A 2IOMA 1OM3H 1E8WA 4IMLB 3HAEG 4GI6A 3QUZC 5AW8B 5FO9A 1INDH 1MEXH 1IC0A 1OPGH 3V6ZB 1BBJB 2KUTA 4ZMQA 3QDHA 4XVJH 1HZHH 1I4FA 4OF3A 1QRNA 1Q0EA 3FULA 1IEAA 3KHOA 3HKZA 1DVFA 3NQKA 3BP5A 1CFNA 5JOPD 3KPMA 3AS3A 3B4NA 3SO3C 1T2JA 3GDBA 3UZQB 3FAXA 2DWSA 4OIIH 4OI9A 4BWUA 3K5RA 4XXDB 5EPMB 3KXFB 4X5XB 5D1ZA 3BDYH 1S9WB 5H2BB 1CD8A 5FGRA 1B3JA 1JXFA 2VSMB 2E8YA 4Z3HA 2A9BA 4DGYH 1CURA 3CFTA 3KYOB 1DQTA 3DSFL 4FXGB 2V7NA 4GSUA 1D6VL 1P1ZA 1ZHLA 4ANXA 3AITA 5I6XC 3QS3A 2NY2B 5JNYB 4H20L 1GGIH 5BRZA 3BYTA 3T04D 2CLRB 5CBAA 5GGTL 5IVNA 1R3IL 4PGBA 2EH7L 1R19A 3QUMA 4MNHB 2V8LA 3FUMA 1QSZA 4ODXA 3UP1A 3EO1A 3ULUL 3DO3A 1MJJB 4WFHD 2P5WD 2KZWA 4FMVA 3KLHC 4LSRL 5GS0H 4M4RB 1A02N 3EJYD 4HGMA 3DMMC 1WWBX 5DFWH 4GEIA 2VQ1A 4R3SB 2BMKA 1Z9SB 4PJEB 4NP9A 2R2BB 4QRQB 2NY3D 3RA7H 1R3IH 3IJEA 1A1OA 2Z6FA 3VXUE 1UH3A 2DPKA 3GJFA 1NGZA 2FO4B 3BGFC 4N2GA 4ONGL 4OD2B 4YUEL 1G43A 4IMLA 4V33A 1AFVH 4R2GB 1MQKL 1SRDA 4I3SL 3V4PA 1F3DJ 1NM9A 3NSDA 3QIWB 4OJAA 1JGDA 5F9WB 1DO5A 3QXDA 2PPDA 4PGCA 3E6FB 5GGTA 1DZBA 3WFCL 4NERA 3QDGA 2D3NA 5DRZB 4XBGB 1NAMA 4YNYA 3MYJA 4O51B 5CU5A 1A6ZB 1E8XA 5C0JB 5B7EA 3S9DB 3FT1A 2HKHH 2UWEE 3O11A 4IRSC 5JQ6L 2KHAA 3U1SL 1RD6A 4AQ1B 3T0BA 2V9QA 4EZKA 4FFVD 1RKRA 1KBGL 3D85B 4XNBA 1ZLUK 4D9QD 4HWEH 3LQZA 1F2XK 4LHJB 1TCMA 5JLZA 3KNBA 1FQ9C 5SX4H 4KDTA 3TTSA 5GS1B 1XSIA 4JKMA 3R7QA 1A4AA 1I1FB 4GW5A 2EE2A 3OAYH 3UH8A 4AQ8A 3LPFA 4F33B 3AG2B 5I5RA 4XCNB 5DUBA 4IOFC 2BC4A 2J72A 1CI5A 3BEVB 1R24A 4M1DL 1WC7A 4NUGH 2JTYA 4HJ0D 2APBA 3G7TA 3WEXA 3CXHJ 5F0JB 4ZW3A 2QSVA 1WFUA 4DP4X 4GG6B 2X6CA 2IFGA 5CP7A 3VCLB 2QV2A 5AOMA 2WXNA 5JDSA 2ICWB 4FQXC 4TPRL 4Y2DC 1OGTB 5F97E 1QYGH 3BGFB 3LS5L 4AQ8C 4D9RE 1QOKA 1C5DA 4Z8FH 3FRPG 3CFMA 4P46A 1OCOB 1ECZA 4LPXA 2V3EA 1MVUA 1N3NA 2EJ1A 2WUBL 2EH7H 2QLVB 2UWEA 3U7WH 4XO9A 5DC4B 3B7TA 3O0RL 1JK8B 2VLJE 5JORA 3IJHB 4YHPB 4G2AA 1FFOB 1IARB 4TULL 3NFNA 3MV8B 1A4CA 3PPSA 2WBJD 2P28B 4PJBE 5FK9A 2HFGH 3VXUD 1GAFH 1UGKA 1VEOA 3TA3D 2YPKA 3GLAA 5J6SA 4WI8A 5SX5H 3ETTA 4LLMB 5C0RH 3CAFA 2GK0A 3L3HA 4RQQB 1FNFA 1MH5B 2AJVL 1BW8A 2XG5A 4UINH 1G7QB 4KU1A 1NCWH 1XZ0A 2MKWA 1LDPH 1JNHA 1PFCA 4ANWA 1R5WB 1C5BH 5IW1A 2GC7C 3DGCR 3MYZA 4N2EA 3HPJA 1B6DA 1Y07A 2IDFA 3M1BA 5IKCA 2ZKXA 3MUZ1 3BT2L 3DX1A 1KIQA 4LOEA 1SZNA 2VM4A 2AJVH 2FK9A 1NKOA 3LD8C 3MI6A 5DZAA 3CVHA 1GIGL 1OV8A 2LAAA 5A7BA 1FIGL 2BOLA 5DURB 1JPFB 2VH5L 1GS6X 3OPZL 1D6EA 1NIEA 1E4XI 1JN6A 3C6SA 3GBMH 1KCUH 1XSOA 1S9WA 2DWDB 3BT0A 4Y16C 3VDAA 1UKQA 5C09E 4F20A 4S0TD 5E2UH 4P9HL 2C1PA 2K4WA 4EUPH 4HKXB 1SYSA 4OCLC 3MV9B 2FECI 2ZOTA 5E1HB 2M2DA 1OSPH 2FQFA 2CBQA 4X4YA 4U6YB 5DK3A 2CJ3A 1IQWL 4JZOA 4OTXH 3IDNA 3QR0A 4YC2C 3EYVB 3LYRA 1SVCP 1SM3H 3B7YA 1T1ZA 3ZRCC 2UWEB 1BAFL 4RMRA 4X0KB 2DQTL 4E41B 1UEYA 3LKQA 3T1FA 4PJXA 3OF6D 1EUUA 4A2DA 4FNSA 4K9JA 3SE4C 1IAOA 1U8NA 3B1UA 4HMCA 1OAKH 4KY1H 1DDHA 5C0CD 5EUOF 5MHSD 4PJ8C 4QXTB 1LE9A 3HA0A 4TPRH 5C0IA 2YJLA 1KJ3L 5HVWA 32C2A 5EEYA 3KW8A 4DP2X 1OTUC 5F9OL 5ANHA 4MZRA 5JXEC 1LEIA 2EIZA 4UDTA 4NQQA 2GJ6D 1FFPB 1MI5E 1SY6A 4OIIL 4KXBA 4YSRA 4B9ZA 1PKQB 5INDB 1KACB 1N59B 1R3KA 1U4EA 3ARGB 4HT1L 4NYLA 2NY6B 1P0SE 2ATKB 3LHAA 3PY9A 5DD5H 4X7SL 1CDUA 1XMWA 2NY1B 4KMTH 5BRZE 1CE6B 1OTSC 2EDRA 4PGEB 5KSBB 3EGDB 4PJFF 5IG7B 5BVJA 3GMLA 1F0LA 3B3BA 2OW6A 5ENWA 2VC2B 4UANA 3AACA 2UY6A 4UNTA 4Y4HC 1LP9E 3O3AB 1RIHL 3VRIB 5DS8A 2ENPA 2FB4H 1BZQK 1A0QH 3DUSA 4PSPA 4P5RA 3BAEL 3CCHB 2VT0A 5D71H 5EBWB 3IK2A 3K80A 4C83B 5E1AA 1MUJA 1TTBA 1LDPL 5KVDH 3QG6A 4KXZH 6PCYA 1RUPL 3MA9L 4JR9L 4XHJC 4ZQKB 3X2QB 4OLZH 2ROYA 4IDLA 1OLZA 2IAMC 5I76B 5AUMA 3FB7B 4HEMA 4LVOC 5I1LB 4XXCC 3VFOA 1PL3A 4LPYA 1WD9A 4KTGA 1UFGA 2F7OA 4HXBH 5EU4B 2H2SD 1SN2A 1E4WL 4M43L 3CMOL 4ZI8A 3MU3A 1VADA 2OMWB 5C0NC 1D5ZA 4YS4A 1HL4A 1U42A 4XODA 1P7QD 2GUOB 3NCMA 5HHMD 1XTMA 2AXJA 1A6UH 1OB1A 4X5QA 3UBFA 5HXMA 1ETB1 2CHDA 1E27A 1JGUL 1QFWH 2QFPA 4JMNA 3N43F 2WINB 5HHNB 1F6FB 2WXOA 3EGDA 3EAKA 4PS7A 5BVJB 4MFHA 4KZDL 5LBSL 1XVSA 3BW9A 4N0YL 5CD3A 2BNQB 4JY5L 4RBPK 4DQOH 2B5IB 1OSPL 2JFCA 1I3RA 4U1NA 5EEUA 4CC4C 3ZL1A 4FG4A 4MS8D 2OMUA 4NQEE 3LIZH 4IBUA 2CR3A 2B14A 1EO5A 4UTBA 1S2EA 4UDUA 3T3ME 3U1SH 1DZ0A 1JK8A 3S35H 5JORB 3PWPB 4KOCA 3FF7A 2F8IA 4NPYA 4ZTPL 4AC4A 3VCLA 4Z7OB 1SQ2N 4NT6B 4DERA 2WYTA 3MNZB 2JMRA 4L4VA 1AGBA 2J6EA 4L8DA 3P1VA 4Y5XA 2H26B 2R69A 4XCEA 4ZW5A 2APFA 1JF1A 2EYSB 3ARFD 3RI5K 1X5JA 3SGJC 1UJ3A 4XPGH 3EO9L 4PJ5B 2CJSA 1RI8A 2BP3A 3VFVA 3MCYA 2JCCF 4XNMA 5IEKB 1VKXA 5D6CA 1YY8A 4AX3A 3ESUF 5F9DC 3WKML 4ZO6A 4AI7A 4R7XA 4KX7A 5CXPA 1G1YA 4DKAA 3KDMA 3GMQB 3GS0A 1T04B 1AD0A 1UWGH 1CDIA 3T8XB 2DQDH 4G7YL 1X5XA 5FGSA 2M26A 3MLZL 1T7YA 4ORZC 3GSXB 4CVZB 2MCPH 4HV8B 4GINA 3EDDA 4UYQA 2VXQL 4GPVA 1A5FH 4KVCH 1DBKH 1KTLA 5KSUA 3WKYA 4C47A 4AIOA 3R06A 2BP0A 3BZ4B 1ORSB 4X8GA 5ITFB 4IGBA 4LSPH 2MEJB 2A73A 2LAGB 3FH8A 4OGYL 1XGUB 1NEZA 3MYJB 1PD6A 2Z3FA 4KKCC 4ACTA 1A1OB 4GAGL 4U05A 3CFDB 2MCMA 2CKBH 3NTCL 2UYLA 3DROB 4MA3B 2VERA 2Y1YA 5KBMA 1BJ1H 1A9EA 2BSRA 2G0KA 5AVRB 3FW6A 3TVMA 4NRXB 1ZSHA 3NH7H 3BWAA 4PGDA 2CO6B 3V4VH 3L3KA 3I85A 3LRSB 3SDXA 3T2NH 1ICTA 4LSVL 2Y5EA 2UUDK 1DJZA 1G7PB 1UM6L 2VSKB 1CR9H 5I19H 5IROD 1A9BB 4HBCL 1U6AH 2D0GA 4P3WA 4LSTH 2VLJA 3QO0A 3QWOA 1RSFA 3LIZL 5JXAL 4BGDA 2WQUA 1RUML 3FRPB 1PY4A 4NYLB 3CBJB 4PJ7A 5I73C 4MKTA 5BS0A 3MV7B 3UTZB 4GBXC 1WAPA 3MRNA 3IGAB 4QLRA 3VD1A 2VJ8A 2G3XA 4OFIA 4LCIL 2HZHA 4XN9A 1G5GA 1WHOA 1B4LA 4MTMA 1JHLL 4LLWB 3IJYB 2FWLB 1G0XA 1VSCA 3HMWL 4HJSA 4JY6A 4PUBH 4TUUA 5E70A 3S36H 4EZMA 2ZJSH 1NDTA 2X87A 4NCDA 4R7NB 5F1NA 3ARSA 1KWGA 1O6VA 2OZ4L 2JKXA 3WS6C 2WYIA 1IL1A 3O41B 3QEQE 4JZNA 2OI9B 4W4OA 1I8LA 4G7QB 4HJJL 1GH7A 4F3FA 3LKSA 3VYPA 4DETA 4U7KA 1CYXA 1QI5A 3TBVA 4F9LC 3MFGB 1MFEL 1T03L 1FFOA 1I4FB 5KVGH 4GIAA 2CO6A 5KSBA 4BQBA 4K4KA 3EHBD 5DGRA 1JZ8A 1R3LA 3O45A 3MRIA 3SPHA 3IGLA 3BRFA 3GSOA 3BP4B 3QWRD 1UHVA 1ZIBA 1LE5B 2LU4A 1BF8A 3D2UB 2VGLM 2K8MA 3I3BA 3KAAA 3HC3L 5GS2H 5ID0A 4U1KB 5ACMA 5B8CC 1MFBH 1RIVL 3ETSA 4TSCL 2AJ3A 3SE9H 4B9KC 1RURH 2OSLA 2X6MA 3VWJB 1T2QL 4XPFL 1VFBA 2NYKA 3FXIC 2DLHA 1LWHA 4PQXA 2JQZA 1XCQB 4JHAH 2XZCL 3BZEB 3GBNL 3LB6D 2DICA 3FTWA 2FZ3A 4A04A 4KDVA 1NCDH 3DUSB 2GJZA 2EIDA 1NCJA 1K4CB 3ROLA 1DVXA 2WD0A 4DNLA 2ZUUA 4JDEB 3KCPA 3FTUA 1AI1L 5L2KD 1S7XB 3WKPA 4XPHL 2R2CA 4FGMA 2BY0A 1FFTB 3MLRL 4WI6A 5J11C 3GSUA 5KBKA 3VXME 2BLFA 1YNTB 1TVBA 4X7CC 5AW7B 1YJDC 2EIJB 3CSPA 3R8BB 4HJEA 1CFQA 4JO8A 2APTA 1JHKH 1KJ2B 2IOIA 2VLRA 2EZ0C 4Y5VA 1DQJB 1DDTA 2ZNWA 1AYOA 3A21A 3L9RB 3VXTB 1BCIA 1BG9A 1U36A 2NY4C 2VWEC 2QQQA 4Z7QF 4YPJA 1VFOA 1UT1A 2Z93B 3IYLW 5E4OA 4CN6A 3HTLX 1QO3A 4OM1H 4KK9C 1FZJA 3NJGA 3RDTC 4MJHA 4TUOA 1YPZF 2XWXA 1QSEE 2CLVB 4OZFG 5FDWB 2PCPA 4ODWA 3TNMB 1JGDB 1BQHG 1A65A 4A2HA 2OSLB 5AFAA 2HH0H 3JT2A 3LSOB 1CU4L 5C0BE 4N0UB 4GUOA 3MAWA 5EC1A 3UERA 1R75A 4ODVH 5ADOL 3Q1SL 1X5AA 4GSQA 3UPCA 2W60B 4YDZA 3HS8A 1KN4H 1NIAA 4KHTL 4Q9QH 3MRMA 3FQ1A 1EHNA 2VOTA 2XWCA 2WXKA 3ARBB 3OSVA 2DYRB 2VABB 4FXKC 2NQ3A 1IKFL 4Y16A 4WI3A 5DD0L 2PYFA 1KYOK 4OZGE 4EKXA 2VLME 2DB8A 1MFEH 2Z4QA 1TTCA 2MPAH 4ODVL 2ZF9A 4FD0A 4N8PA 3A4EA 5KSAD 2AABL 2EDNA 3X14B 1RJZB 4KI5C 4F33A 5DRXB 2XCMC 4Y88A 3Q7JA 4QTIL 3RURA 1QR1A 4M8UA 4JANA 2H45A 1R5IB 3R4DA 3CVDA 3N42F 4QYOB 3A3YB 5CP3A 1U3YA 3GIZL 5TK2A 1XSKA 2QQKL 2N1KA 4OUOA 2X4RB 2G4EA 3NPSB 2DJUA 4XVJL 5DI8B 1BFTA 5LAXB 4BQCA 1DVQA 3ERXA 1KLGB 2KH2B 4HCGA 1ZANL 2X6VA 2ZPKL 1UXMA 4OI8A 2G2RA 4E41E 1OCWL 5J1AB 3HBZA 5D7SH 2ADGA 3SKOB 5GZOC 3ABKB 5CZXC 1NEUA 1BLNB 1WUNT 4GBXA 1RZGB 5IFAH 3BP6B 3LDBB 3FH7A 3GI8H 3QNZB 4PRBA 2CK2A 5CKGA 2O72A 1FZJB 2QTEA 3TZVB 1V05A 2D7QA 5B4MD 5T1MA 3TIEA 2EIBA 1GMIA 3PWJB 3ABMB 4PGEA 3OKDB 2KBGA 5EZLA 3QPKA 1QSFD 3ZXAC 5T5FL 4J3VA 4TSAH 1FYTD 3AJ7A 5FAAA 3CFCH 3B3IB 1YC7A 5AYUL 3K6NA 4MB1A 2ZYRA 3K5SA 1B0IA 1A47A 2CDFA 4JRXA 4N5ED 3AZUA 1NPNA 1PAMA 3F8UB 3TCXA 1ZHBA 2V9RA 2CMRH 2YARA 1E6OL 3SDYH 1CD1B 3PQYE 4XNUL 1GYAA 2PTVA 4L3EA 1CBJA 4O02B 2X89A 4M3JA 5FDYA 1A7OL 1J8HA 1EFXA 4X6DE 3UTTB 5JO5B 3GD1C 2UZYB 5EH1A 5T5FH 5FPIA 1YQ2A 3EUDA 5E2VL 3X13A 3N50A 3R0NA 3O45B 4YBHA 4Q4EA 2HLAB 3WDHA 3B5HA 2VAAB 4Q58C 1ZGLP 5DEFB 2OTWB 4BZ2A 2GSMB 5CEZL 1VZGA 1WA2X 4PJ9C 1X5GA 4GMSL 2OR9H 4A2GA 5EF2A 1W8NA 4UM9A 5GZNA 4IGBC 4M6MH 4PJGA 4W1TA 2NY3B 4PJ6A 3V0VA 4Y1AB 2DD8L 1P7KA 3QAZC 4OLXL 4XCFL 4NGHH 2NY2C 5CS7A 4L9LC 4AE0A 4KX8A 1TT6A 2CBTA 3LPOA 2VERN 1ITCA 2MKLC 1IU1A 2ZCZA 1JPFA 1PEWA 3PRZA 4FZEH 4MA1B 1TVHB 4UT9A 4JRYA 2DLGA 5ALCH 1DYZA 4NUJB 3C5ZB 5JHLA 3FO9B 3U0PB 1YUHB 1CK0H 4ZMPA 5HDLA 1QUNA 4UQBA 4M5ZL 4LIQE 1QFWM 1YCSA 3QIBB 2NQDA 1EDQA 3L4ZA 1MWAB 4MQXC 2W95A 2X09A 4GLRH 2K3TA 3MLWH 2VLKB 5I26A 2NUTA 2GITB 5TQ0L 4I77L 3FU7A 4EPSA 4BHUI 5AB0A 5ETUA 3RUGE 4GAYA 4WRLA 2OBGA 2O5ZL 1FE8H 2ED7A 3BQUA 4M6OH 5IESL 1YJDH 3DX3A 2DEYX 3W56A 2BSED 3BPCB 2NW3B 2C9SA 1XF5B 4NN5C 1A9EB 1U8CA 1I7ZA 1YMHA 3B2PA 3TEZA 3WIHH 1RIVH 4QCIA 2F53E 3BAWA 2D7TH 1OW0C 4JPIA 4YHYC 2FYVA 4N0FA 4ERSL 4NHUA 2XHNA 1UB6A 2FHFA 2IDSA 1NC2A 4QRRE 2JELH 2JKJA 3T65B 3WU1A 1FE8L 1ETJA 1OQXA 1OZUA 3FT2B 5F70A 3TEUA 1T6BX 2VLRE 4IMKC 1NL0H 4JK0D 2J3SA 3P9MB 4AM0B 3SDDD 3DSFH 4EE2A 1E65A 1CXKA 3MRQA 1WBXA 2IV9A 1D6VH 3NIGE 5CHNA 3W38A 4XP9H 4MXQD 4W93A 3QEHA 3CZGA 4UBDD 4NFBA 5BQ7B 2FRGP 2NY6C 4JG0L 4Q8BA 5DK2B 4OLYL 5H37H 4AJWA 5KZCD 3ULUC 4P59H 1VPOH 2AC0A 4Q7DA 5AW3B 2JK5B 3HR6A 1I53A 3B9VA 3SQRA 4KQ4L 2AAVA 1H3WM 4X42A 1WAAE 2PABA 4MJ5A 1P6AB 5CNHA 3PV7A 2DQHL 3CK0L 5JHAA 4P4RB 1Q9LA 3AB0B 4QYOA 5JPMB 2Z91B 2ZG2A 3T0ED 4PVBA 1XF1A 3GO1L 3TVMC 1FDLL 3BUIA 1NGPL 1L9SA 5HHQA 3RIAF 2YRPA 1SXCA 3F58L 1MWAA 2OMVA 4MQTB 4HOZA 2Q76A 5BRQA 5HVFB 2FWOA 2YEZB 4QHKI 1FNHA 4XRCB 2YLKA 1JOIA 3MJGX 3L5XL 1IFRA 4TN9A 4H5SB 1BZ9A 2HCZX 4QF1A 2EDBA 4UCFA 4WJKB 4JDZB 1J12A 1IC5H 5HI3C 4CADA 4GKZB 3RZCB 4AKOA 5J6GA 4F8QA 4NNXB 3DV6B 3AM8C 2WSDA 1NKRA 4NN7C 1KLGA 5AG8A 4WSJA 4XVOA 3WTVA 4RAUA 4ZXBA 2JIXB 4TNVK 4UUJA 4DKFH 5AVTB 5I6OA 5EU6B 2HJLB 5BRPA 2DWEA 2NW2A 5I8KL 3MV7D 4FFYA 3H6AA 1R3LB 2YZ8A 1KWKA 3CDYA 1EAJA 1EXUA 2XA8H 3RDTA 1NPUA 2NXYD 3M7OA 3JWNE 3MRRA 5CJXA 3HZ3A 5JIIA 3V6OA 2R9HD 3NFPA 4J2XA 3P4OA 1MCNA 1X7TA 1IC7H 3CFJA 4RGNC 1JBJA 3FAWA 3BUTA 2LFEA 3RWCA 5CIPB 5D5MB 1BD2A 4CU8A 3FQ4A 4OZFB 4WHDA 2JXMA 1QUPA 3ZZSA 2X4UB 1ASPA 1AE6H 1WISA 3AW5A 3BX7C 5C0BA 2VIRB 4TQPA 1JRHL 3ZKXB 1W72L 2SEBA 4YDVA 4JFDE 3RL2B 2QHRH 2ZKMX 3QAZB 1N7ML 4G1MB 4TSBL 3UG4A 3DURB 4B5ZA 2ORBL 4JNXA 3BVUA 1K72A 4EDWH 1V8HA 2OLDA 2FWUA 1JV5B 2G3MA 4FLSA 3LHPL 1HHKB 1ZDSA 3FKUS 3QJRB 2BVQA 2GJ6E 3D7PA 2XSKA 4TNWF 4JFOB 4V1DB 5AW1B 4APQD 1BQKA 3NSCA 4LQFH 2P4AB 3MPCA 4XP9L 3EG9A 3HW7A 4PJAB 4RX4D 3TC9A 2TSBA 2DOCA 5T5FA 4FFWD 2B1AL 1U3HB 4EDWL 4PD4K 1AP2A 3Q5TA 4KXAA 4JO2H 1U8KA 2BP8B 4M3KB 3O0RH 1EWHA 1I9RL 3PFQA 2V5MA 3HAEB 4KTEH 5E1AB 3WEXB 3RVTD 3QDAA 5EBLA 4UIKH 43C9B 2R69H 3MCLH 2RD0A 4ZFFA 3RPKA 3D4YA 1QQDB 1UM4L 4PJDB 1MW2A 2XG4B 4X5LA 1MCDA 4RMBA 5HDBB 3X11A 1F1AA 4ONHB 5C0RL 5DMIH 5C2BL 1QAWA 4HXBL 1W0VB 4XI5C 3LZFL 3QR2A 1XGUA 5EO1A 1HXYB 4MASA 4LHQB 1ZK9A 3UTSE 5K9JL 4I1PA 5D93C 4S11A 3WTXA 1E28A 1DE4B 2IFFL 3BZFB 3KGSA 4G6MH 1ZK5A 2EACA 4PHXA 2P8PA 2ZOOA 4AYMC 1XT5A 2E0PA 1IM3A 1IGMH 3MV7E 4OY9A 5GS1C 3G6JB 3GSNA 3MNWB 1I8IB 1A7NL 4JUTA 4NBYB 5JDSB 3KH4A 4MMXA 2ADJA 4MDJB 4NWTH 4PJAF 5LBSH 2X6UA 3KBEA 3W5MA 3BSZH 3G3LA 2O5YL 1UM5L 1F45A 1DANT 2KMWA 1RAMA 5DJDB 2HX7A 3MRHA 1SHXA 2VQUA 3ZTJH 2W1NA 2DQEH 2WSPA 1NSNL 4F15C 3RIFF 4G9FB 4XN7A 1NC4D 4RDBA 4C55A 4R7DA 1N67A 3IGFA 4M8VA 3SOBL 1WVZA 4RFNB 4MYPA 4Z76A 1Z9LA 3MX0B 4JO3L 5A2LH 5C1MB 1WZKA 3C9NA 3BEWB 2Q6WA 1T1XB 4FNQA 3RWEB 5LGJB 5K9KA 1UTDA 3VRJB 2J4WL 2X4TA 4GH7B 3VGGA 2N01B 4TSBH 4D7BA 2WP3O 4YHKL 3SCMA 4LHUA 3S3PA 1KNOB 5BXFA 1KCRL 4U1KA 4OFYA 4FFYH 3D9AL 1CGTA 1OAKL 2VMCA 4KY1L 4ZD3L 1ETZA 1LQSR 3C8KB 2OMZA 3E6FA 4JDTL 4R97B 3KLLA 4AYEC 5JW4R 4OBSA 4NSKB 2G2PA 1KJ3H 2D7TL 1S7QA 3TFBA 5IQOA 2EXYC 2P24A 1T0OA 4X6BA 5F9OH