3TBVB

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (a2g,v3p,y4a)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/agonist
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
total genus 15
structure length 99
sequence length 99
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbvB00
4XAWH 1OAUL 4LSRL 4HS8H 2EE6A 3FQWA 3IFLL 2BNRB 2Z4QB 3VWJD 1A4JA 5HYJB 4N0FA 1JWSA 4XMPL 3CD4A 2HP4A 4GG6B 2W92A 4UV4L 3DO7B 5D96B 3HNSH 3MV9E 2VC2L 1KBGL 3FJTA 5ANME 4RGNE 2FYYA 3K4AA 4FQXC 1CGSL 5F89B 2XQBH 2UUDK 4J4PC 5F8QC 1U8MA 3MBEB 5BW7A 3EGSA 4QTHA 1DQLL 4CL7A 3UTTE 2D7TH 4HK3N 3OHXA 4LSTH 1FG9C 5DWUL 4ZNEA 3I02A 1S9KC 1R3LB 2FX8L 1YJDH 3I75A 3L7FB 2R2HA 3MTRA 3MBXL 4NOBA 1OL0A 3HR5B 3F7VA 4UT6L 4RRPA 5J9PA 3RP1A 1B4JH 3BI9X 5SWSB 1KTLB 3SDXB 5D7KE 1BFTA 2NY4D 2WUCL 5CEZD 1E6JH 2JCCE 1BEYL 1RUMH 1OD9A 4G9FE 4Y1AA 3BE1H 3NA4A 4CADB 2ZNXA 3L9RA 3DI3B 4EN3A 1U36A 4WI7A 3IAGC 4PRDB 4DKFL 3WXWL 5ESVA 3MJ6A 3NGBB 2H2SD 4HGWA 1L4IA 4Z0BL 2ZCLL 3Q3GA 4MNQA 4PTUA 1K2DB 5T1DL 4OM1H 1A64A 1X5XA 3VJ6B 1YMHA 1J18A 3KXFD 2APTA 5KSBE 2EEDA 4WEBH 3HAEB 4H1LB 1IKFH 2ICES 5FO9A 4LLVA 3QUML 4HUUA 5DO2D 1LP9F 3HI5H 3OGCB 2ZUWA 4PJFE 2E9IA 2DQTH 3UC0L 4R7DA 1PLGH 2P45B 4QF1A 3LKRB 1KG0A 3ARFB 4YE4H 3OJDA 3UJTL 1FVEA 4GLRI 5E1AA 2GK0A 1K5NB 1P4IL 1I1YA 3WN5A 5I8KL 1KT2A 4NPYB 1NMAL 3P0GB 3QZWA 3V5HB 5F7HA 4J12A 2A0LC 3VXUD 1G7IB 4HV8B 3QISA 1KEGL 4P5TD 4HPYH 4NFCA 2GJ6B 3IFOA 5IFHL 1DQTA 5EULV 3UTZA 4WGWB 2IQAA 5CKGA 1KYOJ 1HSBB 1BWMA 3W11C 2GFBA 1NFIA 5BMFL 5DR5H 2PYED 4F7CA 1ZMYA 1A3RL 4G6AC 1D5BA 1HEZA 3WFBH 1XCTA 1MCWM 2A6JB 1P5UA 2ITCA 3LH2L 1RIUL 2QADB 3KYMB 1I9EA 3LD8B 1QSVA 5IVXB 4OFPA 4PP2B 1FNAA 5IFAH 3MLRH 2BVOB 3O8XC 2NY3D 1ZV5A 4TUOA 4XXDA 3V6OE 1A47A 4YXLH 4YC2C 4EIGB 3OR6B 3HZYB 1A9BA 4XB7A 2Z92A 4IMLB 4C56B 4MNHA 5F6IB 1RZJC 3D3VE 4LEOB 2HT4D 1FVCA 3V0WL 2W9LA 2A77H 3NIDE 4MDJB 3U0PA 4ODWA 4Y4KA 4C59B 4QEGA 4M62H 1F42A 3H8NA 1MI5A 3CFDB 5FB8B 1LE9B 1TZHA 2NY0D 3THMH 3F7YB 4KQ3H 4QRTB 2LAGB 5DDHB 1FYTD 3F58H 3ELAT 1ZANH 4RMVA 1M05A 1TQBB 5DJYA 3NABH 1N0XL 3RGHA 3NACL 3FQRB 4BH7B 4L4VB 5DJ2B 3Q6GL 2XPGB 3IDJB 3E3QE 1J7VR 1TXKA 4R0LA 5DVOA 3OMZA 3RWDA 2VDNH 1KIPB 2EKJA 3VI4F 1YPZF 4PJ7F 3OQ3B 2H8PB 2BXZA 1OAZL 2DI7A 3OG4B 4CJ1A 1YYLH 5C86A 3GSWB 5HYFA 4HKXA 1WFTA 5HYJA 2JJUA 5FAAA 5IW6A 3CU1A 3BKJL 4GG6A 2C26A 4WY7L 3DO7A 1K85A 2Z8RA 1PAMA 3ECBB 1NFDE 4HZLB 1VEPA 5JHDB 4RGOH 3TP4A 5F89A 3FN9A 3TEUA 4LRIA 3N0PB 3MBEA 2OTPA 4G6FB 4JJ5B 1IKNA 2APVA 4BQBA 1OSPL 2EDDA 1R3LA 1RUAL 1JP5A 1NLDL 2OSLA 5MEND 1OARH 4XVSL 3TNNB 3HR5A 3ZKND 4XCEB 1FL6B 3ZE2E 4U4BA 4GRLA 5I6XC 3MRPB 1ZT4B 1T66C 1U3HD 4RFNC 1KCUH 5TE4H 3SDXA 1JGLH 2VLJB 3HFML 3LV3B 3IETB 4NN5B 4I18A 2ZWLT 4OLVH 1J11A 2QQLH 3MLZH 4CVXA 5LXGL 1TJGL 3DECA 4X6CE 4Z7UF 4UUJA 4DVBB 4G6KH 1EUUA 4OB5H 4PRDA 1F4WH 3MJ9H 2DM2A 2H32H 2HH0L 4F9PC 1EHLL 4CDHA 1A0QH 2ADFL 4Z7WF 4JM2C 3B4NA 3VJ6A 2ARWA 5D2LF 4X8XA 5BRZB 4W6YB 4NCDA 4LCYB 5DJ0A 2V2TB 1LO4H 4KI5C 1QHPA 2DQDL 3ZYIA 3TH2T 4N90E 4F58H 3OGCA 2E6JA 3K4DA 3NCJL 4MA7H 4I0PD 4KMTH 3V52L 1INDL 1FCCA 1G1CA 1A14H 1DP0A 4Z7NE 3LKRA 3WFCH 5IB1B 1FJ1B 2OM5A 5F8RC 5HDOA 3RI5K 3FZUC 3NTCH 1K5NA 3AREB 4Z77B 4WO4B 4NPYA 4YDLB 4NZJA 4ZTOL 4HWBL 4Y19B 3UO1H 2F54E 5D9SA 3F6IA 5DQDH 4FG6C 2R9HD 4JFEB 2XZCL 3QDME 1S7QB 2CJUH 4NZTL 4DGIL 2EDEA 1C5BH 4RAUA 4XNXL 3NFNA 4JFQB 3TBSB 1ZVSB 1L9NA 2A6JA 3DSNA 1AGDB 2X4TB 5JOPD 5F6HI 3TGXA 5IVXA 4PP2A 5DVKA 1ZHLB 1YEEH 5I75B 1BF2A 2BVOA 4G8FB 5I16B 1OLZA 4MXVE 4JZOB 3QQ3A 2BVPA 2RJMA 3OKYA 2HAZA 2P8MB 2AXJA 3UBXB 3K2UH 3HZYA 5F1IA 2BNRD 4IMLA 3BXNB 4O02H 4P59L 2CDGB 4OD3H 2NYYD 3RPIB 1XF2A 3IDNB 5EIQA 4U7SA 4L4TB 4ZO8A 1DUZA 1NBZB 1QO3B 4P5KB 1OTUC 4C83B 2FGZA 1AIFB 1QSZA 3QXAB 5FB8A 5EO1B 4UINH 1LE9A 5HVWA 3TZVB 4QRTA 3LQAH 5DDHA 5IR1B 5IT2L 2CMRH 4L1DA 4YHZL 4D0BB 4GS7B 3FQRA 4BH7A 1NAML 3CFCL 4ZS7H 4L4VA 5DJ2A 4KTDL 1BAFH 3IDJA 4JO2L 5I18L 2Z8WC 3PQYB 3LKNA 5IUSA 5D7IF 1KIPA 5CSZB 1XF3B 3EHBC 1PY4A 3T4AB 1E6OL 1F8TH 2H8PA 5I30H 4KRNA 1JWMB 5EPMB 3VXRD 4JVPA 4TUJB 3CVHH 3GSWA 4G3YH 4JM4H 4M7LH 1CLZL 5DQ9A 4DZBA 2JELH 2VSDA 1NH6A 3DARA 4XTRD 3IXTB 1G7PB 4HWNA 1QG3A 4GQPH 4ISVB 3TH3T 1D5MB 3BUYB 4ONGH 3KPPB 1D9KC 3ECBA 4PBXA 4PJXE 4U6XB 4XBPB 3C5SB 4AL8H 1OY3B 2PUQT 1FZJB 4TSBL 2BHZA 1A6ZB 3SDCC 2P5WD 3IDMB 3KPQB 2A73B 4ZXBD 1CIDA 1KPVA 5EIIB 2E5EA 1UWGH 4OCSH 1KF9B 1SBSH 4P46D 1J8HB 4FRWA 1TVBA 5JUEH 1BX2B 4NQSB 1GGBH 1SJHB 1EBAA 2EYTA 2NX5E 3GSNB 1AR1D 2IMNA 4P4KC 3STLB 4FOMA 3N50A 5FECB 1X6LA 2H45A 4ZO9A 3FT2B 2VOTA 5GS1B 1FL6A 1OSZB 2XN9E 4YHMH 1UWXK 2NQCA 1T5WB 5FO7B 2K7QA 2G75B 5FEBA 2YEZB 4Q58C 2VLJA 2AW2A 3C60C 3QUYA 3LV3A 3IETA 5GS2D 4XP4H 2R1WB 3UMTA 1A5FL 4O9HH 2DAVA 3PABA 4WW1B 3MV9B 4LGRB 4IDJL 5ANMB 5F70A 3VGEA 4ZD3L 4RGNB 4DVBA 4WIQA 4Q9RL 1MQKL 4OAWB 3GHBH 4MQXC 4LARL 3TN0D 5T5FL 4PRPE 5JW4N 4FQHA 4ZOCA 4XCFL 3UTTB 5BRZA 1HQRB 4RMUA 3CUPB 1CFQB 2V2TA 3BQUC 2X70B 2ZPKH 3IXAB 5DFVD 1ITBB 4LCCB 3QR2A 4PFEA 1RAMA 1I85C 3MLVH 4Q0XH 4S2SA 5F9WC 3MRNB 3QUZC 5FK9B 5IB1A 1RPQA 1FJ1A 4OD1L 5KS9F 1H3PH 4Y4FC 5I66A 3AREA 4CBPA 1F3JB 4WO4A 3X3FL 4FFYH 2IQ9H 5HI5C 4Z7QE 4G9FB 4LASL 1ZA3B 3BHBB 2X4PB 1YQ2A 4S1DC 2CPCA 3SCMB 4H88H 2FX9H 1KELH 1JE6A 4ZUVA 2DF3A 1YMME 2ICEB 5BJTB 3Q5OA 3QI9D 2XTJE 2I60H 1B88A 2DQGL 1OW0A 1DQQB 4MSWA 3CSYB 2WUBL 2A83B 1K6QH 5KSBB 4KKBD 1JNHB 4M6OL 1M71B 1ZVSA 3CCHB 2FH8A 3PUCA 4X6DE 2UWEA 5DGRA 3RWFB 3LZFH 1AGDA 3MRKB 1AGEB 2UV3A 1AE6L 1ZHLA 4GAYB 2NXZC 5I16A 4NC2B 5MP6H 4JZOA 5FV1L 1CFVL 3N85L 4PJ5D 5KVDL 2P8MA 3UBXA 5I1CL 2VLLA 1FFOB 4BFGA 3OJ2C 5T3XH 1NGPL 2CDGA 2Y6SD 4UOW0 1IGFH 1DBAL 1AY1H 3WCYA 3WSQL 3WDHA 2O61B 3IDNA 1HINH 1U0QA 5CP3A 4L4TA 4M61B 1YYMH 1NBZA 1QO3A 4P5KA 1JNLL 4JKPH 1E4KC 5EO1A 1EO8L 4EVNB 1ZWIB 2AGJL 5J11B 4ZAKB 5IR1A 4Z6AT 4XCYB 3CIQA 3GI8H 2AV1B 5ISZE 3QQ9C 4D0BA 2BY1A 4ZPTA 4M8QB 1A7OL 4HWZB 1UZ8B 4Q6IB 2AQ3A 2PKDA 4HDIA 2HT3C 1Z3GL 1AXTL 4LSPH 4PJCE 2I25N 5KSUB 2ID5A 4PRIB 3VCLA 2FEEL 1H5BB 3BWAA 5CSZA 3VGHA 1JGVH 4YDJB 1W72L 1U3ZA 3T4AA 1REIA 3B9KB 1JWMA 3SE9L 5EPMA 4ETYA 3RVVD 4TUJA 4PRAB 3BN9C 1YQVL 4KI5E 5EU6E 5BS0D 4R4FL 3SJVD 4HX1B 1KCSH 3BAEL 3IXTA 3CSBA 1G7PA 3DETC 4G8EB 4W70A 4ISVA 2OZ4A 1D5MA 1O5DT 1MFBL 3BUYA 3KPPA 4NQEB 4U6XA 2Q8AL 2EDWA 1ZGLM 4QNPE 4XBPA 2NY6D 2V2WB 4HUNB 3N1QC 3GJEB 3PDDA 5HHME 3SE4A 5E9DE 2W0PA 1A6ZA 3IDMA 4JFHD 3KPQA 3O6FA 1OLLA 2A73A 5E2TH 1NMBL 3DHMA 1MRCH 4TVPH 3LVEA 5L2JB 5EIIA 3QG7L 3WFEH 2IAMC 3ZTJH 5I1AB 4K3GA 4WWID 4NQSA 1SJHA 3STLA 4MQTB 5FHAL 1SJEA 5FECA 3TT3L 3FT2A 5GS1A 2Y5TB 1WZKA 2ICWI 1GOGA 4LPTA 1T5WA 3TV3L 5F9AC 1LK3L 5JDSB 2YEZA 2VDKL 12E8L 5GGSB 3O3UN 3C9NB 8FABB 4WWKD 5C0CB 1NC4A 4OZIF 2R1WA 3QWRA 5DUMH 5E8EB 3RL1B 1OGTB 3RTQB 5ANMA 3LS5L 2IALB 5C3TA 3ZE1F 1OP3H 5F1OB 3QIBD 5HHXL 3X3GH 3VE0B 1E4WH 3TJHD 3WO3B 1T6VN 4MS8D 5AYUL 3TLRA 3EO1B 3SDAB 3VGGA 5JXEC 5L6YL 1EFXD 1TETL 1HQRA 4GRWF 5T3XE 1BJ1J 1NLBH 2AKRB 2ZOKB 2X70A 3VFPA 3IXAA 4JPKH 4M43L 5GS0C 4I3SL 2R56L 5JZ7C 3DXAA 4YBLB 2ZSWA 1UM5L 3MCLL 4U1LB 5DXWA 2DLTA 4OT1L 3MRNA 4OKDA 3N1FC 3Q6FB 4K2UL 1JWUB 2VXUH 1EO5A 5FK9A 3V5KB 1CXIA 1QFHA 1F3JA 3BP4B 4KZDH 1MCFA 3QEUB 3B83A 3GO1L 4LDEB 3S4SG 1ZA3A 3QNYB 2DDQL 4ZTPH 5C0RH 2X4PA 4X6CB 5C0NC 1QLEH 1QFUL 4OFDA 1OB1B 4KGJA 1YNLH 1YNTA 2WBJA 1H3XA 1XZ0B 3TZVD 4YPJA 1DQQA 1QSFE 2VZVA 3CSYA 5DJ8B 2A83A 5KSBA 1IL1B 2A6DB 3STZB 1M71A 3GJFH 3CCHA 4KU1A 3RWFA 1ZE3C 2AJUH 2AXFA 3MRKA 1MJ7H 1AGEA 3O6LL 2AJYH 4PLKD 3QCTH 2AJXL 4GAYA 3REVB 4B7LA 3PQYD 4EUPH 1X4ZA 3NN8A 3OZ9L 5C2BH 5IQ7L 5E2VL 1A1OB 1EXUB 1X44A 1CI5A 1UEMA 5EORH 1KCKA 1FFOA 3P11H 3PP3K 4Y4HC 1WUNT 1WTLA 4TVPE 1Q9WB 4TULL 2F54B 5HHOE 3PWLB 4KKAD 3LHPH 4MJIA 4FABL 2O61A 5TQ2L 5CILH 4HQQH 4M61A 1RUQH 3BH9B 5KVFL 1PG7L 1QBLL 1L0YA 4J3VA 5JW5B 4LVOC 3WJJA 4GW4B 4EVNA 2VERN 1ZWIA 1HNGA 5H8DA 4ZAKA 3OKEB 5TDNB 3SE3C 4XCYA 2VZUA 5F44A 3GIZL 5HD8C 3U1SH 1MHPL 1OQOA 1BBJB 4HWZA 4O2EB 5CMAB 3QP3A 5IBTH 4WW2F 2FDBP 1J8HD 5KSUA 3ULVC 4FQXB 1KEML 4PRIA 2CGRH 5DHVA 1H5BA 1C1EH 2H3NB 2E27L 4YDJA 2O5XH 5BVJB 1JRHH 3V6OA 3B9KA 4MNGE 3DBXB 5IGXH 2EIZB 1RIVH 2VZTA 5I73B 3SDYH 1WF5A 4HMEA 5LQBL 5J89A 2PXYB 2XV6B 1OTSC 4TQEH 3INUH 4HPOL 1KFAL 4HX1A 2BFVH 1ZTXH 4G8EA 4NM8H 1VHPA 2BDNL 1I9JL 4NQEA 2YD1A 3D5OF 4MB3A 4ODSL 2X1XR 4XNYL 2V2WA 4Y7MA 1JFQH 2VL5B 3GJEA 2OL3H 4K07A 1YPZB 3KPMB 1DVFD 5I74C 4G42B 5KN5B 1DLHA 4PP1C 2Y23A 1LEGB 1QSEE 2BJML 1S7RB 4AQOA 1FG2B 1N64L 2OTUA 4IIQB 1MCNA 5T1KB 1E4JA 4MXQC 1MF2L 5ALBL 3G6JF 2HTLC 4XI5C 2Y5TA 2NXYB 3T0XA 3CSPA 2ED8A 4JFZH 1S9XA 4RBPK 4IRSC 2EC9U 3VD5A 1PSKL 3QG6B 4JJHA 5GGSA 8FABA 5JR1H 3C9NA 1XGYL 5C0CA 1EH9A 2PR4L 5KANI 4XMLH 4GMTH 5E8EA 3RL1A 2Q1EA 5F7YC 1OGTA 2H2PC 4PJXB 3RTQA 1JNNH 5E2UL 3BGAA 2IALA 1DBJL 1MCLA 1X9QA 4Y5VB 4DQOH 5FHBL 3VE0A 3JWDL 1H8NA 3EO1A 3NAAH 5DD5H 4JHWL 3A6CH 5GS0H 2ZOKA 3RJQB 4HXBL 1CGWA 3RAJH 4H8WC 4HWUA 1UACH 2WV3A 4GXUM 3CMGA 3HE7A 5IEHB 3W82A 4U1LA 5IMKB 2CK2A 3Q6FA 1JWUA 4Z7UB 2HJKA 4JPWL 5GRVL 2YN5A 1EEZB 2EIEA 1CU4L 2AEWA 2IJ0C 3T2NL 2FIKB 3L5XH 3QEUA 1MCWW 3HUJE 4Z7WB 1N3NB 1T89A 3QNYA 3W0WE 3O8XB 1WJ3A 4JZJC 2AK1H 2ZUSA 3OF6D 3O2DH 2BNUB 1LP9A 1M6OA 2Y9RT 1P84J 1J1XH 4XWGL 1FZOA 1U8JB 4PRPB 3NVQA 1BHGA 4NWTH 1XZ0A 5EZIL 4XP9L 4A2MA 5I1HH 5DJ8A 2Z35B 2VDML 1QRNE 2W9DH 5B3JF 4JR9L 2YPLE 3STZA 1N5AA 1V7MH 3FN0H 1MJUH 2VSCA 5FYLH 3AU1B 4LK4A 2R0KH 3REVA 2F15A 2DMCA 1G9MH 1JCKA 2JB5L 4KVNH 4NHUB 1A1OA 1EXUA 4LMQE 2WW8A 5F7DB 2VLKD 3KR3H 3D3VD 4N5EC 1WWCA 2QEJA 4D3CH 1ZGLP 4JQIH 5J1SC 2VDPL 3HG1D 4JDTH 4N1CA 3RBSA 3IB4A 4OQTH 4DUVA 3BH9A 1SY6H 3G6DL 3I6KB 4G6MH 4QYOB 2R2EB 4AENB 3KG5A 4HEME 4GW4A 4WU7B 1JZ4A 3W9DB 2XTJB 4X4MA 1MCJA 3CVHB 3OKEA 4L1HA 5TDNA 3RY6C 3CX5K 5GHWH 2VH5L 4X6DB 4OIAA 4O2EA 2EXYC 3WNMA 3QPQC 2RCSL 4R26L 1LVEA 4GSDH 4FNLH 4I77H 4BUGA 2H3NA 5C0GB 3MJ8B 3QIUD 2FO1A 1QKZL 3DBXA 3S3JA 3C5ZD 4HJ0C 4JFFB 4NO0D 3TBVB 2H9GA 2R29H 4HH9B 2OMNA 3MLXH 2PXYA 4J6RH 2E8ZA 3UTSD 3LRGA 3WIFB 1HIMH 2Q7NA 3BOVA 5I6XB 4XHJD 3H3KA 2EE3A 2NPLX 4YAQA 2VL5A 2B1HL 2DLHA 5D2NA 4IOFD 5D7IB 5BOZG 1YPZA 4PJ7A 3KPMA 4G42A 2DYPB 3IS1X 4LRNL 5KN5A 1SEQH 1YEHH 4U0QB 2HFTA 3SDAD 1LEGA 1MFEL 1YY9C 1S7RA 3LEYL 1FG2A 2F5BL 4PJCB 3CX2A 4IIQA 3RRQA 5D8JH 5T1KA 3DMMC 3MJ9A 1SM3L 1MNUH 4JM2B 2QHLA 2FRGP 4R97C 1ACZA 4U7MA 3EYUL 3MV7E 5JLZA 3MJGX 5GRXG 1A6VH 3HTLX 5EU6B 4L4JA 3H3PH 3VRLF 2RQ8A 5FYLE 1T20B 4U0RC 2CH8A 3DGGB 3MR9B 2ENSA 1DEEA 2XZAL 4PJXA 1EK3A 3Q1SH 1MAML 5HHMB 4L9LC 4Y5VA 2RFXB 3D2UA 4KROC 1BPVA 2DQIH 5EA0L 1CYGA 5FUCE 3X14A 5ICXA 3RZCB 2D7OA 4R4BB 5HHNB 1QZ1A 5GGQL 1QYGH 4N90D 1MJJB 5IEHA 5IBUB 1F00I 4K7PH 2F5AL 3KPRD 4X80H 4Z7UA 1S8DB 4PGZA 8CGTA 1EEZA 5EUOE 4U31A 5BQ7B 2PO6C 4G9DB 4KHXH 4R96B 3KPTA 4CGTA 4Z7WA 1N3NA 3ULVE 1XGPB 2F54D 3QCVH 5JDJA 1AD0A 1GAFH 4KRLB 4OFYD 3L3IB 3QDMD 2BVUA 1I8IB 3MJ7B 1WFOA 4PS4L 1BJMA 4PRPA 1U8JA 1UQSB 3OKDB 4JEGB 1QEWB 5SX4I 2Z35A 5C71A 5HGBB 3GSNL 4N8CH 5MI0C 2FL5B 3AU1A 3K8LA 1U8IB 2R4SL 2Z31C 2HLAA 4LF3A 4UB0L 4U6HB 2C1OA 2BNQA 1FSKC 4NHUA 5ERWB 5F7DA 4J23A 1IGIL 1U2HA 4QRSA 3QQ4B 1ND0B 3I9GH 4WHTB 4W4NA 1E27A 3U9UA 3DVGB 2CDEB 3TT1H 1AQKH 2YZ1A 1OT1A 2G60L 4OBSA 1IMHC 3I6KA 5CUSH 4QYOA 3VD4A 2R2EA 5C0AD 4WU7A 3W9DA 5CJOL 1F97A 3CVHA 1ZLSH 1WWWX 4H0GA 4L3ED 4YZFF 4X6DA 2VXSH 5GRJL 4PGJA 1B2WL 1D9KB 1Q9KB 2QTEA 3DYOA 2DICA 5FUZH 1BD2B 4CU8A 3VG9C 1G7JB 3SDCB 1MCEA 5HXMA 5C0GA 4M8VA 4QRPB 1PG7W 4GAJL 1FO0L 3MJ8A 1U8LB 5CBEB 2B0SH 3GMLA 3AGVA 5DD3H 1PQZA 3TBVA 4JFFA 3QUXB 4HH9A 4P4KB 2OBGA 5HHOB 3UJJL 2YD4A 4OBRA 1CQYA 3C6LC 4D2NA 3WIFA 3TWCL 4NBZB 1JF1B 2FH6A 4IRJC 2E7HA 4ZOEA 3A6BL 5D1ZD 2VXTH 4LPWA 5E99L 4PJHF 5D7IA 2JJSA 5IROC 1RZKL 1EAPB 1U6AL 2YN3A 3CDGB 1I1FB 1NANI 2I07B 3PE9A 4KK6D 5DQJB 4Y2OA 5EOCJ 1NCDL 4Y16B 3LKQB 5SWZE 2ICCA 1OD7A 3QWOB 4OCYH 4U1JB 4UTAH 2NX5D 4JQXA 4NCC2 4QTIH 3W11D 3KVQA 4ESKA 1ZKAA 3JV4B 2J6EA 1H3GA 4MNGB 3ABZA 3S36X 4X4YB 2XN9D 1NGYB 2PTVA 4O51B 4G6AD 3VFSA 4DW2L 3BQUB 1EAJA 4FTVB 4TRPH 5C1MB 4YXKH 2YD9A 1FN4B 3MACH 3IKCB 4BK5A 3I2CH 2IG2L 3DGGA 3MR9A 5GRZA 1J0IA 1BFOA 3OKMB 1FFPB 3PGDB 2CQVA 3GSVB 3QBTB 5GGRA 3P0YL 3CLFL 1PEWA 3S4SA 1WZ1H 2RFXA 1ZLVH 3PHOA 4NJ9H 3VGFA 4HIEA 5CJ5A 1I8MB 4A6YH 5T1LB 3DURB 3BEWA 3RZCA 3S5LB 1QSEB 4R4BA 3ARBA 5J1AB 4WEMB 5E8OA 2WANA 3LOWA 1IZJA 1YA5A 1MJJA 4OZIB 3E6HB 2P5EE 4CMMB 4ZFFB 3MNWA 2KH2B 1S8DA 3GM8A 3QXVA 1DLFH 3C8DA 3GJFB 4G9DA 2YD2A 2KBGA 1IGMH 4R96A 4RMRA 1MFDH 1DFBH 3PGCA 1MREL 2ZJSH 4UIMB 3EJZC 1B4JL 4XPBH 4EUPB 3L3IA 1PBYA 3MFFA 5E6IB 3SGKA 3MJ7A 3RVTC 1YMMD 15C8L 2QLVB 3KYAA 2IPUG 2J2ZA 2Q87A 5D6DC 1BZQK 5FM8A 3OKDA 1E6JL 2DI9A 5BZDB 1RUML 1QEWA 1MEXH 4L8CB 1T83C 1LD9B 2J8UE 2LABA 1IC5L 3BE1L 3MOAH 3MLSH 5KS9A 1CF8L 2FL5A 1CVRA 3RWIB 3IJSB 1VEMA 2VQUA 1NUDA 1JYVA 2EDRA 1HWGB 5H94B 3UZEA 4U6HA 3KPSB 3BP6A 2LQRA 2VO5A 4OM1L 3MRMA 4EQ2A 3V7AE 4OFIA 2FBJH 2ESVB 5ERWA 2MCPH 1OP9A 3HR6A 3H9SE 3VW3H 4WEBL 1CG9B 5HDQH 1YDPB 3HC0A 1ND0A 1WCBB 4YWGH 3ARVA 3FQUB 1FRGL 5CP7B 5F71A 3QEGH 5DJCB 3W0WB 5ILTL 3TBTB 3DVGA 4HSQA 5SV4A 2CDEA 4V1DB 2DQTL 4OCRL 3L3OA 4N1EA 4D9LH 1NCTA 5I1LB 2B39A 4MJ6A 4JY6B 4YE4L 1T66D 5HHVL 4HWEH 3SO3C 4TVSa 3AB0B 5F7MC 3VRJB 4JG0L 2X10A 3TFKC 2AQ2A 5FKAB 1IT9H 1QRNB 2YPLB 4QXTB 5ISZD 2DYPD 3RNKA 4L8SA 4HPYL 1NJ9B 1D9KA 5BVPH 4AM0B 5H37H 3J8F7 1P7KB 3TF7C 1BD2A 2GJZB 1EUTA 3BGFC 1HHIA 4G80B 5DR5L 1DUYB 4JRWA 3SDCA 3KPLB 5IOPB 4MHHI 4X9GA 4ZYKA 4QRPA 1U8LA 2OL3B 5CBEA 2D03L 1PD6A 4MX7A 4M48H 3AUVA 2NY2C 3QUXA 4KI5D 5C07D 4Y4KD 1EVTC 4NQCE 5HHOA 5C09B 1J9CT 1MRDH 1EHXA 3RIFK 4MD5B 1WLHA 5HSFA 1JF1A 1BWWA 2W9EH 4R3SB 4BQ8A 3D39E 3QRGL 3GRWH 4XT1C 5FGBC 5D1QC 3R4DA 1PVHA 2B5IC 1S7XB 3MRFB 1AH1A 5D7JC 5EH1A 3HC3H 4X99A 3WJLC 5E9DD 5C9KA 3CDGA 2Y25A 1A7QH 4LLWB 3I3EA 2DB8A 2I07A 4YGVB 5DQJA 5IK3B 5E4IA 4NYLA 4FG6D 3Q5TA 4NRYB 4Y16A 3LKQA 4H20H 4P9HL 4JO1H 4LSUL 4OD2A 4P3DB 4U1JA 3QXUA 1TJIH 3JV4A 4KQ3L 2Z91B 4ONFL 4PJAF 5JA9A 1ZANL 3ZHLA 3LSOA 3D9AH 4MNGA 4W68A 3RWGA 3SKOA 2X05A 3PDOB 4X4YA 3NABL 1NGYA 1HZHL 5ACZB 4O51A 1L0XA 4RGMB 4BKLA 4OM0H 4FTVA 1FN4A 1JN6B 3IKCA 1RK0B 1X5KA 3FFCD 4FQIL 3B2UD 1VENA 3V95A 2HWZH 2VDNL 1F4AA 1VA9A 4Z7VF 3DTXB 5HBBA 3VD9A 3OKMA 4F2MB 4U3CA 1FFPA 3GSVA 4YDIH 5HJ3B 2NW2B 4Z18A 3WHE0 4OZ4B 1TZGH 1XGRB 3G6JB 2EDYA 1I8MA 4JY5H 5T1LA 3DURA 4PBWD 4R6UA 5DRXB 3S5LA 3ALPA 3D0LB 5LKNA 1QSEA 3RU8H 5J1AA 5DK3A 4ORZC 3U0WH 5K9OB 2Q3AA 1WBXB 4GRLD 1W0WB 4OZIA 4ZS6C 2EZ0C 4KJQD 3E6HA 3DRQB 1QACA 3MV7B 3IGAB 4LSRH 4CMMA 3DIFB 4ZFFA 1MHEB 2YD6A 5D1XC 3EO0B 3IFLH 1U58B 4FFVC 1TQCB 4HK0B 5IHUH 3GJFA 1CXKA 5A2FA 3S9DB 5FV2A 1T0MB 3LQZA 5IVNA 4XMPH 2JJTA 1OARL 5EBLB 4QWWD 1ORQB 4NUJB 4UIMA 5EOTA 4UV4H 4UMGA 5DT1L 5F6HJ 2JE8A 3EHBD 4EUPA 5E6IA 3SQOL 3QFDB 3F7PC 2YC1B 1UCBL 1ZHNB 3R8QA 4F7TB 1CGSH 4G8GD 3O9WA 2DLFH 4FQPA 4DTGH 1DQLH 1JK8B 1QSFD 4XCCL 1LD9A 3TC9A 3FAXA 3LRSB 3KS0J 1GJIA 3MLZL 1VFAB 3IJSA 3C2AL 2FX8H 4OCMC 2YA1A 3F12B 4OGAD 3MBXH 2DIJA 3KPSA 3MX0A 4UT6H 4TTDC 3V6FB 4K7PY 2ESVA 4F8QA 4HD9A 5TDOB 5EUOB 4PJIF 1CG9A 1YDPA 4X9HA 4KUCD 1IC7L 2WUCH 3EBAA 3FQUA 5CP7A 1BEYH 4F58L 5D93B 3TBTA 2KDGA 3MLTB 4KMTL 4FXGA 4V1DA 1C8PA 1H8SA 4NDMB 4X98B 2E7BA 3BPOB 2YBRB 5I1LA 5HI3D 4DKFH 3WXWH 4KDWA 5A3ID 2WWKO 4Z0BH 2ZCLH 4TOYL 2ZG2A 4LCIL 3VRJA 3NMEA 5FKAA 2Q7YB 2FLRT 3C60D 5AD0B 3GBLA 1F2QA 3UO1L 2YPLA 4QXTA 4K7FB 5DHYB 4BQCA 5DQDL 1NJ9A 3P9MA 1DN0B 4AM0A 3X11B 1IJ9A 3QUMH 2GJZA 5ALCL 3MOBL 3PL6C 1EPFA 1OF2B 1DUYA 1RVFL 4YEFA 3UC0H 1NC2D 1LDPL 3KPLA 5I74B 5IOPA 4NQVA 4MXWH 4BM7A 2GITA 3DI2B 5DJ6B 5E7FA 1RFDH 3UJTH 5FO8A 1P4IH 5I8KH 3BQUD 1NMAH 2ATPA 5C09A 4LGSB 1QFWI 4MD5A 1KEGH 2JJVA 4R3SA 5IFHH 3U4BH 4WW2A 1ONQB 3RGVC 3QUZD 1RZJL 1UB6A 5ESQA 4IRSB 4OFVA 5DURB 1S7XA 3MRFA 5BMFH 1KIQB 1HH9B 4Y4FD 1ADQA 2XZZA 3V6ZB 1KNOB 4I3RL 3Q0HA 3K8KA 3P30L 1A3RH 3OAZH 4OD3L 4LLWA 4GKOA 4YGVA 5TH2B 3AY4C 5IK3A 2DWEB 4JO3L 1PJ9A 4S1DD 3ARGC 3NFPB 4DKDC 1KPUB 4UINL 4BH8B 3RWJB 2N4IA 1KN2L 2Z91A 4DVRL 2CMRL 3PDOA 1JHKL 4ZDHB 3OKOB 4JKKA 4WJ5A 3ARWA 5ACZA 1NGZB 5DGQA 4DK6A 4ZOBA 2OI9B 4KK5C 4DEPB 4YHYB 4ACPA 1JN6A 3MUY1 1RK0A 2Z93B 3CFKB 2HFEB 2VKWA 4FQLL 4UBDC 5IWLA 1K8DA 4KAQL 2NXZD 1F8TL 3DTXA 4F2MA 4NNYB 4Z7OE 4HUXB 1JPGB 4G3YL 3NBNA 4OZ4A 3MV8E 3G6JA 4OLUH 2MCG1 4XH2B 1V5JA 3U4EB 5DRXA 1OAXH 2BVTA 3D0LA 4C55A 3NACH 4CVZA 2WNGA 4X5XB 2HVKB 3EIFA 1CFTA 3Q6GH 2R23B 3QH3B 4ONGL 5FA4B 4PLNC 5JIIA 5K9OA 1FAIL 1WBXA 5AWNL 3O2DA 5LAXB 2BSTA 5HHQB 4XPFL 3T04D 3DRQA 2R0ZL 3IGAA 5FOBA 3DIFA 2UZIL 1MHEA 4Z5RB 3EO0A 3QQ9D 4NT6B 1U58A 3TA3B 2YPKB 3MRIB 4HK0A 1S7WA 4MB4A 1SBSL 5JPMB 2ARJQ 3NA9L 5EB9A 1T2XA 5D4QA 2EC9T 4ZFOL 4NUJA 3W0WD 4WY7H 2E9WA 4GMSH 3ARZA 4I2XE 4NQDE 2H2SC 1ZHNA 1KJ3L 3JWOC 3NIGF 3VI3F 4RX4A 3A67H 3BN9D 1OCWL 5CIPH 4LU5H 1T0NB 4BJLA 2D4DA 4YO0B 2FSEB 4K3JL 2AXHA 3DETD 3U2SB 1WV7T 3LRSA 2AEPL 1VFAA 2KL6A 5DO2C 2IPUK 1N6QH 1S5HB 2AK4E 4OQTA 1NLDH 2HFFB 3GHBL 5A1AA 4PY7B 1SY6A 4XVSH 2CUIA 4UI2A 5E4EC 3IDYC 4EI5C 3EAKA 3V6FA 2FR4B 5TDOA 5EUOA 3SKUD 2VR9A 5AZEL 4XC1L 1XEDA 1HQ4B 2IAMD 4OLWH 1MY7A 2X1OA 3F7RA 3HFMH 3WXVL 4P5TC 5C7XH 4IJ3C 4I9WE 3MLVL 5LXGH 1TJGH 4PJ8B 4HUVB 3U0TB 4NDMA 4HCRL 4X98A 2YBRA 1BJ1H 2Z0BA 4LLUB 3VXMA 2JTDA 4LKCB 2BHYA 4XPTL 3GNMH 1H3PL 4PJGF 1EHLH 2ADFH 2IQ9L 2Q7YA 2IPTL 3EZ8A 5AD0A 1QA9B 2J8UB 2EDJA 3C08H 5A43C 4GXUN 5FGCE 1TNMA 4K7FA 3BSZL 5DHYA 3ZTNL 2G5RA 3PWPA 4QHLA 3GIVB 1NPUA 1DN0A 3X11A 4H88L 4UOJA 3SDDC 1KELL 1FE8H 3MXVL 4OZFG 1OF2A 3V52H 2I60L 1INDH 2CO6B 2KKQA 2NY5L 3H9SB 2IBGA 5JXED 2XFXB 6CGTA 3LZFL 4YX2L 3RUGE 3G5YB 2HT4C 3QO0B 4HWBH 4A2LA 3BJLA 2Y72A 4J3SA 1S9YA 3BGMB 4FA8A 5JZ7D 3FOLB 4LLYA 1I1AC 1JVKA 2VXQH 5EFIB 4ALAH 4F33B 4NZTH 2NY0C 5E94B 3RVWC 3RFZC 2AEIT 2D31B 4S1QL 2ICWJ 1KIQA 2APXA 1HH9A 1MCKA 4ODBD 2DWDA 4EQ3A 3V6ZA 4LP4A 1KNOA 1DQDH 4XNXH 1KYOK 4U0RB 3SE8L 3VMNA 4KJWD 5GGTA 5TH2A 4LOUD 3ZKQD 4BFIB 1RURL 2DWEA 1MLCB 3WEXB 2GI7A 2EEBA 5DJZB 5C0ND 2EE2A 7FABH 4JKPL 4L9LB 2V7HB 1UZ6E 4KROB 3RWJA 1FZMB 5T3ZE 1UCTA 3UPAA 3HCVB 3EOYG 4ZDHA 3OKOA 5DRWB 1RHHB 3O4OB 3GSUB 4PJHB 3R06A 4NQCB 3QDGB 4R4ND 4I5BB 4NCC1 2GJJA 2FO4B 2Z93A 3DYMA 4NKDA 2HFEA 2Q76B 2DOCA 5FYLD 3D39B 5IF0B 3O3EB 3SO5A 4NNYA 1TZIA 4HUXA 1JPGA 4OUOA 5GGVY 5IT2H 4JKLA 4Y4HD 1GGTA 4XH2A 4QGTA 3AS0A 1QQDA 1JZ8A 1DTUA 4Z76B 4YHZH 2D7MA 3U4EA 3HC4H 3GSRB 4X5XA 1NAMH 2HVKA 2VQTA 4KTDH 2R23A 5FA4A 3GB7B 5EU3B 5LAXA 4HG4K 3ZKNC 5C0IB 5CWSB 5HHQA 1HYRC 4KI1A 1E6OH 1RULL 1ZLVK 1U3HC 5E2TL 4Z5RA 5CEZH 4NT6A 3TA3A 1P53A 4JZNA 4APQA 5I76A 3WFEL 1CLZH 1NC4D 3HKFA 4RCAA 5JPMA 3O2VL 2Z31B 1ZS8B 4P2QE 3BKYL 1B6UA 2R0WL 2BOCB 1IAKA 4AJ0A 3ULVD 3FO1B 4PD4K 4U33A 1Q1JL 1MH5B 1Y18B 3LDBB 4RMQA 2C3HA 3E0GA 4MAUH 4QOKE 4JFXA 4TSBH 2VXVH 1T0NA 4YO0A 1OTSD 3TH4T 3WLBB 4V2BA 5F7UA 3TJEL 3IJHB 3BPNC 2EDHA 3DXAD 3BW9B 2R4RL 3CDFA 3LKPA 4JG1L 2VDLL 2HLFD 3B6SB 5C0BB 3MV01 2HFFA 4IMKA 4PY7A 4JPVL 3CVIL 5ICZB 3RY6A 3X3GL 4OIIL 1QUNA 1E4WL 2FR4A 1K4DA 3QO1B 1NLBL 2F58L 2ZUXA 4LDOB 4TN9A 4WNQA 3ZHDA 4ODHL 1HQ4A 1OGAB 3WKMH 4JPKL 1KV3A 4P48A 5DZNA 1A5FH 5DEZA 5TE6H 2CKBL 4XI5D 2ATKB 4PJ8A 4IDJH 4HUVA 3U0TA 4JB9L 4LLUA 1CGVA 1OOAA 4LKCA 1MQKH 5IMLB 2Y5EA 1FIEA 1Q0YL 2VLRE 3MCG1 1QA9A 1S3KL 4YIQB 1H3WM 4IRJB 3RKPA 5C0RL 3GIVA 3Q48A 1QLEL 2H2PD 3NPZB 5TJWK 3S7GA 1RY7B 4PRHE 3MV11 4M1CD 4POZD 3ZKXC 5D5ME 3U7YL 4D0DB 2DKSA 1OWRM 2AXGB 3MO1B 1EZVX 4JGJA 5TF1H 2XFXA 4P23B 4XVUC 1CFSB 2DI8A 4MJID 1MWAL 5GGUB 3X3FH 3X12B 5IHBA 3BT2L 5CD5D 1U92B 4LASH 3BGMA 2VN4A 1BIHA 5K9JH 5T1MB 4F33A 3VGDA 5IB5B 5E94A 2CRIA 4UIKH 5EORL 4HFWB 5CEZE 2DQGH 3JV5A 2WP3T 1H15B 1P4LB 3T0EA 2AJZB 4M6OH 3TIDB 4AYFA 2QKIB 1MLCA 5DJZA 1T03H 5SWZD 4L9LA 3VXOB 2V7HA 1MLBB 1FZMA 5GS3A 3QDJB 5CZKA 1KTRL 1URLA 3KXFE 1P4BL 3DO3A 3N85H 4QT5B 5KVDH 5DRWA 5EZJB 5I1CH 4PJHA 3BZFB 5IBTL 3P77B 3QDGA 1NGPH 4I5BA 4XTRC 1DBAH 4LHUG 3WSQH 2Q76A 2CGRL 3D39A 1C1EL 4R7NB 1NQBA 1JRHL 1X7QB 3O3EA 1JNLH 4B53A 4WFEE 1RIVL 1EO8H 1M7IB 4EZMA 2AGJH 1U2CA 3DUHA 1CD1A 4O4YL 4MCZB 4N5ED 3VXUE 1EO7A 1MFAH 4NM8L 1WVZA 3GMOB 4HHAA 5HVHC 1Z3GH 2AJVL 3GB7A 1AXTH 2AVGA 5JW4Q 5EU3A 4KV5E 1JFQL 3GBNH 5C0IA 1IAII 2G2RB 4WI6A 2OL3L 4NN7B 3QNZB 1W72H 4Z7VB 3BDYL 2P5ED 2YWYA 3SE9H 1VCAA 3G08B 3QFJE 2HMID 4Y8AA 1ZS8A 5LGHL 4R4FH 4NRXB 1MHHB 2BOCA 3PGFL 3FO1A 5D7LD 1T04B 5CINH 2HJLB 2RR3A 1VACB 2A74B 1A8JH 1MFBH 2Q8AH 4I8DA 1RMFL 4LQFL 1XR8B 1MH5A 1Y18A 3U30C 3MV8B 5LGJB 3T65A 3V5DB 4LGPB 4HJ0D 4DFHA 3UX9B 2ZUQC 4G7VL 2COQA 3WLBA 1NMBH 3EYOA 4HC1H 4XMLL 1TCRA 4GMTL 1ZK9A 3QG7H 3IJHA 1QD0A 4GBXA 3ESUF 3HE7D 3MROB 2Y4SA 1WAAF 3BW9A 1EBPA 1IILE 3B6SA 3WNPA 5C0BA 5FHAH 2J4WL 2W1NA 2JJWA 4NNPH 5ICZA 3QHTC 5HYQA 3AXLB 1OM3H 1FNGB 3SOBH 3TO4C 1WICA 1BP3B 3QO1A 5TFSL 3G5VB 4GG6F 3TV3H 1LK3H 3A6CL 5JNYA 1RZ7L 1OGAA 1YY9D 3GI9H 1UACL 5AG9A 4WI3A 5F1NB 3DRTB 3QUMB 3DMMD 2LU7A 2X09A 1FNLA 1X5LA 1DDHB 4I2XB 1GOHA 2ATKA 3O3AB 5IV2B 4KMQA 2UUDH 4KPHH 2NY2B 1YEFL 3CC5B 1CE1L 3ILPB 5AYUH 2W0LA 5L6YH 3QCUL 1FP5A 4PJIB 1LMKA 3U46A 4WFGE 1SHMA 2B5IB 4M43H 4I3SH 5D7JB 5HDBE 2R56H 1DZBA 1UM5H 2WAHA 5F1SA 4NWTL 4U6TA 4URTB 3ZL4L 3E2HB 4K2UH 5I1HL 4D0DA 2W9DL 2AXGA 3RWCB 1V7ML 3FN0L 1MJUL 4P23A 1CFSA 5FYLL 3G9VA 5GISL 2VISB 5GGUA 3GO1H 3X12A 3ARDC 1LWRA 1JZ3A 1U92A 5MENE 4CW1A 3BMVA 1U8QB 2DDQH 1QVOA 2MOVA 4KWUA 4EOWL 3EKCA 5T1MA 1QFUH 3PDGA 1GIGH 3GGWB 5IB5A 3IJYB 4YDKH 3SPVB 2HRPL 4YHNA 1ULVA 2PO6D 5D6CB 1H15A 5AUMB 5FGCB 2P43B 2HRLA 2YZ8A 3TIDA 3SGJA 2QKIA 3MRJB 4JDTL 5C08E 2NTFB 2AV7B 4HS3B 3O6LH 2VZ3A 3DUUB 3RL2B 2AJXH 2R69H 1MLBA 2C1PB 3DROB 1I9IH 3QDJA 4PGDB 4TUKL 3OZ9H 1P9MA 4QT5A 5EZJA 3A6OA 1T2JA 3OAZK 3ULVL 3ME0A 3BZFA 1X5ZA 3P77A 3QA3B 1CS6A 1V3MA 5DFTA 3FB5B 4FNLL 4TULH 4I77L 4FABH 5TQ2H 4R7NA 2LV4A 3STBA 5D1XB 1M7DB 1X7QA 2ILLA 3FTGB 4XX1G 3OB8A 2NY6C 1PG7H 3QSKB 5DJXB 1XGUB 4PJAA 3PP4L 2YXFA 3MLXL 4E41E 2FIRT 4MCZA 5IVXF 3GIZH 4XNQA 2J5LB 1XIWC 1NGWB 1UXWB 3GMOA 1EGJL 3KJ6L 32C2B 4W6XB 1KEMH 2G2RA 3ARTA 2E27H 4Z7VA 4X0KB 2WBKA 1I3RB 1SEQL 5CIPB 3VH8B 1EDQA 5GS2H 5JOPE 5LQBH 1MOEA 1PG7X 4UQ2A 4NRXA 4HPOH 1MHHA 5JMOC 1KFAH 1T04A 3EDKA 4GKNB 3VD3A 5IB2B 4JKWA 2BDNH 2A9MH 1VACA 2GY7B 2A74A 3ULUF 2XQYK 2WINB 1P1ZA 1XR8A 4ODSH 5EOCH 4XNYH 3MCKB 1RQ5A 3MV8A 3QIBC 4XWOC 4FS0A 5I15L 3P0VL 3MYJB 3TJHC 4MDIB 1KLFA 1FYHB 3C6LD 3QXTA 5B8CB 4IRJD 1IZKA 3MROA 1MVUB 1N64H 3S3PA 4V2CB 1Z2KA 1U41A 3N06B 1MF2H 4GW5B 3BZDA 4RAHA 4NWUH 2WMPA 3BVNB 2XG5A 4H8WL 4JANB 1AGCB 1QBML 3PHQB 4P2QB 5DVNA 1VDGA 1DSFL 1DANU 1QR1A 3PL6B 1QYGL 3HMXH 5F1NA 4LVEA 4RMSA 2P4AB 1RZFH 3QUMA 4YQXH 1MFNA 4TSCL 4K7PL 2QHRH 1DDHA 3QHZL 3O3AA 5IV2A 3VXRE 5E2UH 3T0AA 1DBJH 4XP5L 3WNLA 5F21B 2P8LB 3FO0L 1WWBX 2R1YA 4U1KB 4R8WH 4NHCH 1LQSR 4JHWH 1SBBA 4PJIA 3QCVL 5EU7C 4OCXH 4HXBH 4OQ1A 1J5OH 2X1PA 3RGVB 5EC1B 2BNQD 4PGBB 3KYKL 4JHAL 4PLKC 3RI5F 2P24B 3PV6A 1NGXB 3VDAA 2I9LB 4XRCA 3OB0H 3LN5B 4JPWH 1EIBA 3QEQA 4NBXB 1CU4H 4PJ9C 5EC2B 3I6LD 1T1WB 1Y0LB 1TTUA 4CVWA 1U8QA 1NBYA 1YEIH 1TVHB 3ZDYF 4FXLA 1A1NA 3VWJB 5JO5B 3GGWA 4RNRB 5I1KL 4XWGH 3SPVA 5EZIH 4Z78B 3I9GL 4MZ2A 5AUMA 1RIHH 2VDMH 1AQKL 3MRJA 3FL7A 2XT1B 2AV7A 2DJUA 2RB8A 3FO2B 1S9WA 4HS3A 3KDMB 3RL2A 5JPNB 5F9JB 2C1PA 4IOSD 3C5JB 3DROA 3T0DA 4YEEA 1IRAY 4Z8FL 5D5MB 1ZLSL 4LVNC 2JB5H 2X2YA 1TPXC 3QXDA 2PCPB 4M6ML 2BRQA 4M1DL 3QA3A 5FUZL 1NAMB 3FB5A 5ESAB 1YUHB 3MRHA 1QFPA 2D0FA 2VDPH 1JIBA 2VL4A 3CU7A 4M03A 1M7DA 2H1PL 5CZVH 3G6DH 2CXKA 4N9OB 4U1IB 5FYKU 2NY4B 1RK1B 5DTFA 1GH7A 5HGDB 1RZGA 3DWTA 5DJXA 3WBDA 4AZ8A 1T2QL 5CBAA 4JKMA 1NDGB 1SEBB 1X5AA 1NGWA 1UXWA 2YOCA 1KLUB 3U6RB 2RCSH 4XBGA 3S88L 4R26H 3DHJA 3HAEG 4H1LG 1SQ2N 1T1XA 3VMOA 1KENH 2D0HA 4ELME 2C3VA 2ZUVA 4QHMB 3L3DB 1N7MH 1MAJA 3KXFB 4X0KA 3TFKD 1AGFB 1I3RA 3MSPA 5CIPA 3AM8A 3NIFF 4GW1B 2GY5A 1D6EA 1QKZH 35C8L 4B0MM 2OQJB 2PNDA 2P42B 1IAIM 1TITA 4UTAL 3RA7L 2FATL 5E4EB 5T33H 1LGVA 5IIEB 2DBJA 2BSRB 2C7UB 1WZLA 4NQDD 3KLSA 3EUUA 2M2DA 1G7QB 1GL4B 3VXUB 3MACL 1UT9A 4MDIA 3W2DL 4LRNH 4P5TB 2CR3A 4IJ3B 3I2CL 1UJ3C 1RJYB 5B8CA 1XH3B 1OP5K 1MFEH 3LEYH 1MVUA 4FZEH 3WS6C 1M7XA 1I1CA 3BO8B 3KLHC 5D1QD 2PYEB 5IVZB 2AK4D 4P2YA 3NPSC 2FZ3B 1WZ1L 4GW5A 1R0AL 5D7JD 2MQ0A 1GC1C 4HBCH 4NJ9L 3BPLB 3EYUH 4A6YL 3BVNA 3BX7C 4JANA 3O4LE 1AGCA 2F8XC 1B0GB 1J1PL 3VXSE 3PHQA 2VB5A 4EDWH 5MHSE 4M7ZC 3PL6A 3GSXB 2IANE 2NY3B 2XZAH 4I9WD 3G9AB 5B38G 3KHQA 1A6PA 4Y2DA 1DLFL 3S98A 5MEOB 5BS0E 5I9QB 4UOW1 3EO9H 5D70H 2IADB 3U7WL 2XWBA 1DFBL 2P8LA 4LAQL 4XVJL 4HWBA 2ZJSL 4U1NA 2DN7A 1BVZA 5IJKA 2FJHB 1IQDB 4POUB 4LCWA 2NY0B 3JSSA 4PGBA 4ZPVB 5ACLA 1FYTB 2JKXA 2P24A 4N0UE 4U3HA 3T8XB 2I9LA 1UWXH 2F5AH 1ZHBB 3LIZL 1CGYA 4PR5B 3LN5A 1P2CB 3AY4A 4KJPC 1ZLUH 3MLSL 1L9MA 5F7WC 1Y0LA 5H2BA 3BDBA 1DN2A 5C92A 4ZS6D 1MJ8L 3TVMA 5I19H 1A4KB 4P0DA 3GSQA 3VWJA 2MCPL 5JO5A 4FXKB 3RVUC 5ICYB 3KS0H 4RNRA 1JYWA 4FFVD 4PS4H 4PJDE 4LHUA 1NFKA 43C9B 4Z78A 2YA2A 3QEGL 5ITBL 4M3KB 2ZNWA 1II4E 1P84K 4YHKH 1JGEB 5HI4D 4D9LL 2R4SH 4UTBH 1P6AB 1HNFA 3KDMA 1NCCL 4HWEL 4UB0H 5JPNA 5F9JA 2E9BA 2JCCF 1ZOXA 5T3ZD 4WTXA 1IT9L 3JBG7 1TNNA 1LO5B 2PCPA 4ENEC 2D7QA 5DC9B 1IGIH 2ERJC 2NZ9D 3LB6C 1NAMA 5MENB 5ESAA 2DS4A 1U3HB 3KNBB 5KSBF 1W72B 4PJBE 3M8OL 3ISWA 3MNZB 5HHPB 5LCVH 1G9NC 4IOFC 5FFLA 1RK1A 5HGDA 4X4ZA 4K8RD 2DQHH 5CJOH 1G7HB 4QRRA 1G7MB 2J88H 4PJFF 1W2KT 3PNWB 4WV1C 3U48A 1SEBA 4ZUUB 1CR9L 2W9EL 1KLUA 3U6RA 4X7DC 3VMPA 3P9WB 3GRWL 1C5DA 2ADIA 1IAOB 1RD6A 5GGVL 3RHWK 2QQKL 3L3DA 2F9BT 4GAJH 1NGQH 1AGFA 1FO0H 1Z0MA 2C3WA 3QEHB 5J13C 4GW1A 5E08H 1CXEA 1U8KB 3BPNB 4LPXA 3T3PE 5EU7E 1ODAA 2OQJA 5KZCD 4M6NH 3UJJH 5E6YA 4I0PB 3NZ8B 4YHOL 3MFGB 3TWCH 1HWHB 1GGIL 1A7BA 5IIEA 2ARJB 3A6BH 3D9AL 3JVGA 2C7UA 3QIWC 3IDUA 1CICC 1KB5L 1BVKB 3WNOA 1RZKH 1U6AH 4QOKD 1LK2B 3UXFA 1G7QA 4D9RD 3VXUA 5DD1H 5DJDA 1RJYA 1XH3A 2DLIA 3FB6B 1NCDH 2DLGA 3MUGB 4HLZH 3IDXL 3BO8A 2PYEA 5IVZA 3Q2CA 4JVUA 4XZUB 4Y5YC 1ZLWH 1C12B 2FZ3A 3L6FA 1CDHA 4NOFA 3NIDF 3GEWB 3CGTA 3LEXB 2FD6L 4FQ1H 2GSGA 3WNNA 3ARGD 1S7TA 4U7KA 3UBXG 4IEFB 1AR2A 2D7NA 1NMCC 5KSAC 3GSXA 4RFEB 2IG2H 4NKMB 4LNRB 5FYKD 3ZKXB 4POYA 4K3HA 3UYRH 3O9WD 4OI7A 3MMEB 5KTEH 4BZYA 3P0YH 3NCCB 5IHUL 3CLFH 3DX9A 3NCFB 3P3YA 4KK5D 2VLRD 2CLRB 2VABB 3S96B 5BXFA 1DCLA 5IVOA 2QV2A 4UBDD 2MKWA 2E9JA 2UZYB 1H8OA 1IQDA 4KKCC 5CKAA 1U8NB 3ZZ1A 4LPUA 4ZPVA 5I1GH 3O41B 4PRHD 1FYTA 1KB9J 3T8XA 1PY9A 4ETQB 3QJHB 5BZWA 2DLFL 1ZHBA 2VIRB 4AQ1B 4DTGL 4YHLL 1GHFL 1U8HB 4PR5A 5HDLA 1P2CA 2VQ1B 1WT5C 3ZDZF 1NFDF 4U1GC 1YY8B 5FIEA 1Q38A 2PW1B 3QAZB 1KGCE 4UU9B 1MREH 1VERA 3RWHB 3GKZA 5DMGD 3P73B 1A4KA 3VGBA 3VXRB 4ZFZA 1F2XK 3FMGH 4S1SL 1F45A 5DK0B 4U6VL 3F8UB 2MTPA 1ZA6B 4X9BA 1PFCA 15C8H 2OLDA 4JO4L 5JIHA 43C9A 4FFWC 1S5IH 4LLAA 2X89A 3ZE2F 2OR7A 1IC5H 4HAFA 5F96L 1CF8H 1FH5L 1NUNB 3ET9F 1KLGA 1JGEA 2A38A 4PJEE 4HFUH 4H25A 4ODXA 4CKVX 3F6LA 2BP3A 2P5WB 3LRHA 2VR4A 2DQFB 4FQJL 4YH6A 2GTZB 4ZXBB 4P2OD 2F53E 4QGYA 5C6PB 1KJMB 1LO5A 4P46B 4KVCL 4X6CF 2A1WH 1IAIL 2CLZA 4DN4H 5C0FB 1FRGH 5DYOB 4TPRL 3VXTB 5KVEL 5ILTH 3BN3B 3VFMB 3QDAA 4OCRH 4HEPG 2X5PA 4MXWL 5D1ZC 1G9NH 2PTTB 4EI5D 1I7UB 4MAYD 5A16A 1KXVC 1W72A 5L2KE 3MNZA 1RFDL 4WFED 5HHVH 5HHPA 5JORB 1E28B 2FWOB 1G7HA 4JG0H 1G7MA 2YSSA 5E8NB 3QULA 4ZQKB 3PNWA 1HXYB 1R24B 2Q3ZA 1KN4H 4ZUUA 4KK6C 1MRFL 3RVXC 4Z7NF 3MA9L 3GHEH 3U4BL 2DIBA 1IAOA 3PJSA 4S1RL 1ETZB 3TN0B 4D8PB 2OK0L 2X41A 3PXJA 4YDVB 3LEVL 1JF5A 3W5MA 4K3DH 2D03H 1U8KA 3PP3H 5EZLB 2IH3B 3S35L 2EDQA 3SQBA 3LN9A 3QFJD 2WSKA 3VFTB 4HS6A 3SDDD 4I0PA 2FNBA 1ZSDB 1OAKH 3L3GB 1KJVB 1Z9SA 2HYMA 3QRGH 1KSRA 4LLDB 5K9KB 2VLKE 3H0TB 5BW7C 3T4YB 1BVKA 4FQCL 3VXPB 1LK2A 1A21A 5F7LB 5DVLA 3ROLB 1A9EB 1N2RB 3MUHL 4CJ0A 5J3HD 3HG1E 3D85A 2DL9A 5GSVA 5B38B 5KVMC 4MXVF 1I1AD 5IB3B 3MUGA 4P9HH 4LSUH 3QI9B 5B4MD 4YR6A 4ODUA 5DMYA 3RVWD 4ELMB 3FT3A 3ALWA 4QO1A 4YFLF 1FFQA 4ONFH 4OLUL 2G9HA 3H6JA 1HZHH 1OAXL 1T21B 4HG4J 5C8JB 4KRPD 3D48R 3HHRB 5E95B 1GPOL 3EDFA 4KTEH 5BOPA 4B7IA 1I9RL 4FQIH 4P2RD 1F4YH 3B2VL 4RFEA 4NKMA 1JPFB 3FB7B 4PJ5B 4BYHA 2L4OA 1WAAA 2BNRA 5EN2B 2Z4QA 3MMEA 2D3VA 4AIZB 1WZMA 4PD4J 3UTSE 2CLRA 4OJFH 2VABA 1ROWA 3V4VH 4GMSL 4IM8A 2ZKHL 3B8YA 1JYXA 1YEGL 4NGHL 1U8NA 4W4OA 4WFGD 2N1KA 5T3ZL 3VG0L 3O41A 1Q0XH 3A67L 4ETQA 3QJHA 4LU5L 5EZOL 3EFDL 3H9ZA 3NIGE 4KK9D 3WN5C 4RBPH 4JY4B 1U8HA 3D6GA 3O4LB 1NCAH 4M7KL 2HVJB 2VQ1A 1T1YB 1D5IH 4NQTA 4PJXF 1VB9A 4W6WB 3CH1B 1CDYA 4JRXD 1YY8A 1N6QL 2PW1A 2IANB 3L7FA 5J6GB 3RWHA 4IHOB 4X7CC 5DT1H 3OXSB 3PWVB 3P73A 4Z0XB 1FIGL 4K8RL 5DK0A 5SWSA 4JFDD 4JFOB 3SQOH 3S37L 1UCBH 1CZ8L 1ZA6A 3OB0K 5BS0B 1KTLA 5GRVK 3SJVB 4OLWL 4F15C 3PWPD 5I8EB 5B39B 4XCCH 5C7XL 2V9TA 4UT7L 5C08D 4CADA 4Y5XB 5K59E 2NY6B 3C2AH 1SJVA 1X5YA 1ZGLB 1YEKL 4JHBA 3WHXB 3GNML 2P5WA 2YR3A 2F74B 2DQFA 4FQQB 1K2DA 2GTZA 2DQJL 4D0CB 4ZXBA 4AH2B 4LSVL 3C08L 1KJMA 1G1YA 1GRWA 4P46A 5K33A 3VFGL 3HAEA 4H1LA 5C9JB 4EEEA 5I2IB 4Y4KC 4GFTB 4KHTL 4YK4B 1IC7H 2CRYA 1FE8L 1JL8A 5DYOA 3WFDL 3VXTA 4PGEB 4JGMA 4N0RA 4DGVL 5BV7C 3VFMA 1AFVL 5E03A 2BVQB 3KPRE 4HULB 4K71C 5HTSA 4K9EL 2PTTA 1I7UA 1XT5A 5J12B 3ARFA 4CDGC 2PTUA 1NL0L 5I17B 5JORA 1T22B 4L3AA 1E28A 4TOYH 4WWKB 4LCIH 4AEEA 3ZO0A 1F6AB 3V5HA 4WHDA 2N7BA 1D3CA 4RFOH 4ZQKA 4E41D 2QSQA 1A7NL 3NH7L 1HXYA 4KQ4L 4R0LC 2MJWA 1G7IA 4HV8A 4QLRA 3SGEI 1A2YB 2GJ6A 4ERSH 4OGXL 2VXQL 4ALAL 1JMXA 3Q5YA 4NC0B 1HSBA 5ALCH 3TN0A 3QIBB 4D8PA 3MOBH 5I1EH 1HHHB 1RVFH 4Z7QF 1I8LA 1LDPH 3PIQB 1UM6H 4N8PA 5GZNC 1DQDL 1EFXB 2VDOL 2B4CC 4OCNC 4LSDA 3NCBB 4OZGB 5EZLA 2NY5C 1YEJL 5FYKL 1AKJD 3KYMA 2OR9L 4U05A 7FABL 3VFTA 1DL7L 1R3KB 5HYSG 2IGFH 3B2UC 2LFGA 4X7SL 3WIHL 4WUUD 2B1AL 4OF0A 1KJVA 2HFGH 3MLUH 4PJBB 4LLDA 5JXAL 5K9KA 1RZJH 3H0TA 4J3XA 3MBEC 4MA8L 4X6DF 3T4YA 4JN1L 3OR6A 1DBKL 1IKNC 4XVUD 3QHFL 4C56A 3MLPA 3VXPA 2MPAL 4LEOA 3TCLB 3T1WA 4I3RH 4NSKB 5E8DL 4HLJA 3ROLA 1A9EA 1N2RA 3P30H 4W81A 4MDJA 3KJ4B 2EYRB 2LAAA 5B38A 2XI9A 4JO3H 1UWEH 4ZSOE 5IB3A 4DCQB 4GRLC 3VWKD 1UXSB 3CFDA 5C0AE 3QI9A 2A9NH 3O81A 5A2IH 4ELMA 4LSSH 3K8MA 4KJQC 3F7YA 1KN2H 1S9VB 5HPMB 4DVRH 1BZ9B 4APQD 5ACMA 4L3EE 1JHKH 1X4YA 1C16B 1IGJB 1T21A 3HC4L 3D25B 5C8JA 2HTKC 1RJLB 5E1HB 2XPGA 4I18C 2Y36L 1SYVB 4LFHD 2OMBA 4QWWC 3A0OA 2E6QA 4ZFGH 5J0BA 1JPFA 3FB7A 4FQLH 2YPVL 4KAQH 4PJ5A 1N4XL 2V5MA 4FP8L 5CEZL 5EN2A 2ZUYA 4AIZA 4PJCF 2R2BB 3RZWA 2DKMA 4GRMB 2AI0H 4BSWB 4JM2F 4HKJB 4AEIH 5IW3A 2FX7L 3JWOL 1KACB 4HZLA 5DS8B 1FAIH 4Q74A 4OGAC 5AWNH 1BJ8A 4KI5F 5JHDA 4MAUL 4XP6L 4GUPB 2VXVL 4XMKL 4XPFH 1OAQH 2R0ZH 1MY5A 4JJ5A 1IM9D 2UZIH 4LKXB 1E4XI 1T1YA 5I1IH 2P49B 4M93B 2OX5A 4QNPF 3CH1A 1HSAB 3NA9H 2GQHA 5J6GA 3TNNA 2C3GA 4XCEA 1DANT 3OXSA 3PWVA 3WFHB 4Z0XA 1FGVH 2DBLL 1CBVL 5CS7A 4TSAH 3MRPA 5HI3C 1ZT4A 2A6IB 4JFOA 4KTYA 5A3IC 3FO9B 3FONB 4JDVB 1KJ3H 5BS0A 1BQHG 1ZLUK 1OCWH 3SJVA 5SV3A 2Q6WB 5EBMB 3WKML 4DJMA 1A7RL 2PW2B 5B39A 4JVWA 3CK0H 2K9UA 4K3JH 4MLIA 5TE6L 1UJTA 4KDTA 1GGCH 4F57H 2AEPH 2D7PA 4Y5XA 4Y88A 5JA8B 4MMZC 2ZG3A 1ZGLA 5E24E 2ORBL 4RQQB 1WIPA 1DVFB 2F74A 2C5DC 4ZNEE 1EERB 4JN2B 5F6IC 4AH2A 4K3EL 1FL5B 3LY6A 2F8VA 4LCYA 4DAGL 3M1BB 1IGCL 4XC1H 5AZEH 3V0VB 4X9IA 1KC5L 5I2IA 2IH1B 4XC3H 5CJBA 4KZEL 5BV7H 4U3XA 2SEBB 4ZOAA 3MZTA 3WXVH 4PGEA 2ZUTA 1CLYH 2BVQA 4NNXB 5C0JB 1L0QA 3L1OL 4HCRH 1NAKL 3TO4D 3ULUC 1FO0B 1SVCP 5TF1L 1T22A 2WWMD 1INQB 4XPTH 4Y1AE 3T0ED 4WWKA 1Q9OB 3ZDXE 4Z77A 1F6AA 1P7QD 2JCCB 2IPTH 1ZEAH 4Y19A 1N5YL 1LDSA 3VFUB 3BSZH 3ZTNH 1A2YA 2VDRL 4N0YL 4F3FB 3RDTD 4PJEB 5K9JL 4JFEA 2Y07L 4MNQE 1S7QA 3CXDH 3MXVH 3VFNB 4UIKL 2B4CH 3PIQA 1EFXA 4JFQA 3IFPB 2NY5H 1AD9B 4KY1L 3TBSA 4F9LA 4OZGA 4ELKB 5JMRA 5M94B 4I4WB 4YX2H 1T03L 4MD4B 1J0ZA 2X4TA 1R3KA 4XXCA 3IU4L 4PJFB 4L8BB 2GT9B 4QXGL 3O6MH 3O3DB 5CHNB 4G8FA 1CD8A 1WCQA 4PJBA 5L2KB 2BX5A 1Z6JT 1LO0H 1S7UB 4OSUH 1ORSB 4S1QH 3DX6B 4ZNCD 5JOFB 3VFOB 5J56B 1UFUA 3BXNA 5C70A 1FORH 3TCLA 3OKLB 4NSKA 3ARDD 3T77B 3SE8H 1IFHH 3RPIA 1OTTC 3ROOB 5KANG 1BVLB 1RURH 4HJGB 2OP4L 4EJ1C 4MZ3A 4QHKI 4C83A 3BIKB 4KUCF 4PY8I 1AIFA 3QXAA 4WI4A 3OX8B 3M45A 4NQUA 5KOMC 3TZVA 1S9VA 3OPZL 4NRZB 5KW9L 4M1GL 2KQNA 4GAFB 2GAZB 4CMHC 1A6WH 3RPKA 1MFAL 5KAQF 1IGJA 2JIXD 4NZUH 3QUYC 3D25A 3O4LD 4NN5C 4JCMA 1J0HA 3VXSD 1JYNA 2BCKB 3MRCB 3P4NB 5MHSD 1SYVA 4XP1H 2QQNH 3PQYA 1U8PB 4RWYL 3GBNL 2IAND 1Y6NR 1XF3A 5MEQB 2BK8A 1ZLWK 1UH3A 2VLKB 2A6KB 3IT8D 2NR6C 3PWJB 4JFPB 2MHAB 3NFSL 2R15A 4E9LA 1L7TL 3D3VB 5C07E 1ES0B 4GBXD 3UDWA 3HG1B 2DJ4A 1MI5E 5CINL 1CXFA 4HKJA 3TIEB 4LIQH 3NCYS 4E42B 5SX4H 1AHWB 3C5SA 3L3KB 2XKUA 1FZJA 4GUPA 1N8ZB 1RHFA 3IDIB 3AREC 1RULH 1BF8A 1HKLL 1K8IB 3HRPA 4YDLC 2F8OA 4HC1L 1XIWD 1R3IH 4OGYL 1FLRL 1C7SA 1J8HA 3O2VH 1HSAA 1A3LH 1BX2A 3BKYH 3GSNA 2R0WH 1GXEA 3UJIL 1PYWB 3SKNB 2J3SA 4NNPL 3QIUB 2OR8A 1OSZA 1OM3L 2FJGB 1Q1JH 3SOBL 4DN3L 5DA0B 5FO7A 4GG8B 1OPGL 3C5ZB 5D71L 3FO9A 4NO0B 2WQRA 2G75A 3FONA 5DA4A 1F6FB 3GI9L 5EBMA 3FFCE 2Q6WA 2V9RA 3MYZA 2PW2A 3UTSB 1FFNB 3RNQB 1N59B 1NEZB 3TJEH 4BSJA 4WW1A 3MV9A 1UKTA 1F6LL 1NFDB 4LP5A 2R8SH 2R4RH 2W0FB 4JG1H 2VDLH 3DVIA 4OAWA 3ZYOA 3W5NA 1CGTA 4KPHL 1DVFA 4JPVH 3CVIH 4XWOD 4OIIH 1LHZA 4WV1B 5LBSL 3UTTA 1I75A 3GSOB 1FL5A 3M1BA 2F58H 3CUPA 1CFQA 3V0VA 2AAVA 2IFFL 4ODHH 2IH1A 1JTTA 5DI8B 4LCCA 4LHJB 1U93B 4TNWK 3I84A 3EYSL 5JHLH 2CKBH 1V8HA 3MODL 4NNXA 5C0JA 3SDXE 5J13B 4JB9H 3P4MB 5FF6B 4YBHA 1KIUA 2KQMA 1FO0A 1INQA 5HYSB 4PG2C 4GS7C 3SGDI 3OXRB 4S11A 3UPRB 1Q9OA 4ODVH 2JCCA 4G9FA 2XICA 1Q0YH 1AO7D 3U82B 3VFUA 3AAZB 4KJWC 3LS4L 1S3KH 2IF7A 3BHBA 4LOUC 2ICWB 3QIWB 3SCMA 1RV6X 1GIGL 1CICB 3QNXB 1KCLA 3RX7A 2ICEA 2XWJB 5BJTA 3IU3B 4G8GE 2VUYA 1NANH 4YDKL 4WTZA 3HUJF 1Q9LB 4NP4L 3TCXA 1WBYB 3U7YH 5IBUG 3CXHJ 2E3VA 3IFPA 1AQDB 3RIFF 3EJJX 1JNHA 5CGYD 5HGAB 4ELKA 5L9DL 1TTGA 3FRPG 1MWAH 2HKFH 4I4WA 3MOQA 4R4NC 3WS6A 1XGQB 3BT2H 2XY1A 4PJFA 4RAVB 4PREB 3D69B 4Y5YB 2R69L 2GT9A 3KPRB 3O3DA 4LIQE 2VR5A 1I9IL 3SE4C 3BUTA 2XXCB 5K9QI 1FC1A 3O6FC 1ORSA 1EA9C 2GKIA 3DX6A 1MCHA 1FGNL 4OUUB 4PJ9D 4HXAH 3RQ3A 1NMCB 4PB9L 4LPCA 3T77A 3AVEA 1IEAB 1CLOL 4OZHE 5TDPB 3OF6A 4HGKC 3ROOA 1CD9B 3ORJA 3QDMB 4LNVA 3KGRA 4R9HA 3I3DA 5GS1C 4HJGA 1EFQA 4PG9B 2AJ3B 4JRYD 2F19L 3OX8A 4NRZA 3ZKMC 3QPXL 2AV1A 4UQ3B 4R2GD 1P4BH 5IB4B 4MYWB 4M8QA 1A3QA 4FFZL 1UZ8A 4I48B 4Q6IA 1BM3L 1R3HB 1R5WB 3P4NA 3N1PC 3HNTL 4X4XB 5MEQA 2VUOA 2X40A 3IAPA 3SN6N 3VXQB 2A6KA 3PWJA 1LO2L 1PEZA 4G6JH 3GMPB 2MHAA 3S36L 1TJHH 5FUOL 4PRAA 1C08B 3D3VA 1QTYT 1S7VB 1T7YA 4O4YH 4B5EA 2WIIB 1ES0A 2P46B 3UZQA 2UY6A 1DE4B 1UB5B 1QNZL 4ZSOB 2A9ML 3TIEA 1CLCA 2WK2A 1BQHB 1BBDH 2BSED 2HLFC 1XGTB 1RUKH 2AJVH 5C0AB 3MRRB 5EOCL 1AHWA 3GM0A 3L3KA 2LVCA 1N8ZA 2GYSA 3IDIA 4L3EB 3BDYH 1K8IA 1EEQA 3DX7B 3DSFH 5L2JA 3FB8B 1BQLL 5I1AA 5LGHH 1A1MB 1Z0NA 3PGFH 1F90H 1K3ZA 1KGCD 2DD8L 1PYWA 1RZ8B 4NC1C 3ZTJG 2CK0L 2H32B 3F5WB 2WQ8A 2KUTA 3QIUA 1XCQB 2B8OT 4MQSB 4NWUL 5KAQG 2FJGA 2WBJC 1RMFH 4LQFH 1IARB 4GG8A 1I7RB 3C5ZA 4NO0A 1BQUA 1J1OL 5JDSA 3DVFA 1QPPA 5I8CB 4F37K 1KCRL 4G7VH 3HMXL 1FFNA 3RX8A 3RNQA 1RZFL 4YQXL 1N59A 1NEZA 2QHRL 5D1ZB 1NFDA 1BLNB 4G5ZL 4WU5B 4M1CC 2J4WH 1KTDB 4YXHH 4POZC 3QEQD 1JZ2A 4KKLD 3CFJB 2F53D 5CCKL 3SDAA 3GSOA 4R8WL 4ZUSB 2MQCA 2VTFA 4NHCL 1JI2A 4U6YB 3IFNL 5TFSH 2AKRA 4HKBB 4QKXB 4OCXL 1J5OL 4P9ML 1RZ7H 5TE7L 2GIYA 2EICA 2NX5B 2E7LA 5CD5C 5DI8A 2BY3A 3KLHD 1U93A 3O3BB 5FA3B 5I1DB 3VXNB 2R1XB 2XN9B 3CDYA 5J11C 4N0FB 2VLJE 3P4MA 5FF6A 3V5KA 1TIUA 5L2KD 5HYSA 2HJFB 4RISL 3UPRA 1YEFH 4PB0L 1CE1H 3BP4A 5DZLA 3AAZA 2LE9A 1PX4A 3QCUH 1YEIL 3AC0A 4Q6YA 1TFHA 4X6CA 5EOQL 1H5BC 3S5LG 4NM4L 4JQVA 4YC2B 2M1KA 1OB1A 3EGSB 2VNCA 3QNXA 3MRDB 5EUOF 3B9KC 3V6OC 4FMKA 3IU3A 5BRZE 3OKKB 1S78C 4DZ8B 1Q9LA 4HW6A 1MCBA 3VU2A 3ZL4H 1RIHL 1AQDA 4XB8A 1IL1A 2A6DA 3I75B 3RJDA 4IBLT 5GISH 1YJDC 2EC8A 5J9PB 1JPSL 2NCMA 3D1MC 1XGQA 4PREA 3D69A 4Y5YA 4EOWH 2CDFB 5INCB 3WS3B 4KJPD 2KZWA 4EUPG 5I0DA 4OUUA 1RI8A 2HRPH 3LAFA 3C8KB 4OIBA 3L9RB 5J6HB 1Q9WA 3FAWA 1WITA 2F54A 5L7XL 3L3JB 1IEAA 3PWLA 5TDPA 4HGWB 1DEDA 1CT8B 3T3ME 1VFBB 3QDMA 3UAJC 5CZVL 1YMHB 1YMMB 4HT1L 5TPWL 4IOIB 3UCRA 1B4RA 5JW5A 1B6DA 4KK8C 2DM3A 3RVUD 2AJ3A 4P99A 3MLYH 4TUKH 4OCWH 2D0GA 2UWEE 5FO9B 4LLVB 1Z5LB 4UQ3A 2Y06L 4PYHA 4S10A 1BBJA 3ULVH 2HMIC 4I48A 5CMAA 1R3HA 1R5WA 4QF1B 3RTQC 1WEJH 4FQXA 1KENL 3OJDB 3U4AA 4J4PA 5JQHC 1W8NA 4X4XA 2DQCL 2EDOA 1N7ML 5BVJA 3QZWB 3VXQA 3GMPA 3MREB 2A2QT 1WT5A 2X9XA 2EIZA 1WTGT 4IDLA 3ZYZA 1C08A 3F65A 4ENED 1S7VA 3IFOB 5T5NF 3AMLA 3PP4H 4F7EB 4L4TE 3LB6D 2IQAB 4GT7A 1HILB 2DKUA 5T33L 3HE7C 1UB5A 1EGJH 4ZFOB 1BQHA 4WDIB 5BO1L 1XGTA 4RFNB 5C0AA 3MRRA 2HA1A 3KJ6H 1XCTB 4MMXC 4L3EA 5ISZB 2XZQL 3CH8A 5ADOL 1E0OB 3DX7A 4P2CG 1O7SA 1HN1A 3FB8A 1EEUA 1T89C 1AXSB 4FZEL 5L8JB 5JOEA 4NO3B 1RZ8A 2H32A 4HBCL 3F5WA 1MIML 4Y2DD 1XCQA 2E6PA 1FVCB 2VLME 1J87A 1I7RA 5C07B 4ODWB 4Y4KB 4EDWL 5I15H 3QG6A 1U3JA 1GVIA 2QSVA 3P0VH 5I8CA 1MFCL 2RBLA 4NO5B 5BV7B 4LCWD 5D1ZA 3MLWH 2RHEA 1BLNA 3QIWD 4WU5A 3WUWG 1KTDA 5E9DB 1CICD 1JGDB 1X4XA 4OCLC 1I7ZB 3EO9L 5D70L 3CFJA 4DKAA 1WGOA 4H8WH 4ZUSA 5F7EH 4U6YA 1QBMH 4HKBA 3CZFB 1DSFH 2NX5A 3K1DA 5FM5O 3ARYA 4TNVK 3TVMD 4MA1C 3O3BA 4TSCH 4QRQB 5FA3A 1WC7B 5IMKA 5I1DA 3VXNA 2R1XA 2XN9A 4HKXB 4MHHG 3P40A 5DD0H 3QHZH 2Y1VA 2UY7A 3CMOL 4LHUD 5IW6B 1QFWH 5DLML 2HJFA 4D9QE 3FFCB 4XP5H 5EIVA 2FIKA 4HF5L 5FYJE 3CSGA 5DHVH 3FO0H 5KSAD 3ILQD 4DGYH 3O8XA 2Y7QB 2G5BB 5I19L 2CKNA 2EXWD 1X5GA 2BNUA 3KYKH 4JHAH 1JHLL 3MRDA 4KXZI 2ZP0T 3OKKA 4WEUD 4DZ8A 2R2CA 5I73C 4LLMB 5L8LB 2PXYC 3NZHL 4K7PX 2OSLB 3ES6B 4YHKL 4PTTB 4X5WB 4YHPB 3DXAE 5JW4R 4GRLB 4UTBL 4KKCD 3HMWL 3ZE0E 4X7FC 3I50L 3BKCL 1FQ9C 5D2NC 4OLYL 3JV0A 2CDFA 5INCA 2J8UF 4QRRD 4X6EB 4FQ2H 3WS3A 5I1KH 4I18B 3GK8L 4CVXB 3C8KA 1CL7I 5J6HA 4UUJB 3L3JA 5KOVC 1JPST 5C6TH 4IIQC 4NC1E 1CT8A 3AFLA 1VFBA 2QBWA 2NXYC 1YMMA 4IOIA 5LCVL 1FPTH 1T80A 2MQ3A 4G8GB 4AENA 4I13B 3G04B 5DJ0B 2DQHL 5KVGL 2J88L 4Z8FH 2VAAB 1QSFB 4OLZL 4WENB 1Z5LA 3VFRB 5C0DB 1ZT1B 3EFFB 4FFWD 2YD8A 3P9LB 4M6MH 4M1DH 3KPOB 1CTNA 4O5LL 1IC1A 1E4XL 4Y5VC 1NGQL 3HE6D 2H1PH 5E08L 3MREA 2V9QA 5D9SB 4UDTB 4MJIE 4M7JL 2QSCL 4F7EA 4M6NL 1T2QH 2P7TB 1BOYA 3K3QA 4OZHB 2V6HA 5EU5B 3L5HA 3U79A 1HILA 1AJ7H 3T09A 4ZFOA 5J4MA 3S88H 4RAUB 4WDIA 3NFNB 3O0RL 1GCFA 4GJTB 1MCPL 3C60B 3C6SB 4M6AA 4U1HB 5DD1L 2DYPA 5ISZA 4YPGB 3OWEA 4PRIE 3U9PH 35C8H 3RVXD 1Y6MR 1EVUA 4KRMB 5CD3B 1INEL 1AXSA 4PJCA 1GC1L 2X6MA 1NC2B 2BVPB 3QQ3B 2FATH 4NO3A 3RA7H 4F9PA 3PF2A 5F1IB 1KJ2L 1MAKA 2MNUA 4JM2A 4F7PB 1OAYL 1YECH 4OLXL 1C5CH 4FQ1L 1XF2B 5C07A 5EU6A 1P7HL 1BMGA 4JAMB 1DUZB 1GSMA 2DIAA 4NQEE 3W2DH 4NO5A 43CAB 1T20A 3P4LA 3LQMA 5F9WB 5DHXB 1HHKB 3QUZB 5IMMB 5IEKB 2CKBB 3UYRL 5KTEL 3LQAC 4Y4FB 3G6AB 2EH8H 3B5HA 4HCRA 4UT9L 5E9DA 4XAKE 5T5NG 1MCIA 1EJOL 1JGDA 5TGBB 1R0AH 1I7ZA 5I71C 3LKNB 3WE6B 1J1PH 3CZFA 5HHNA 5I1GL 3WD5L 1IEBB 5DQ9B 4QRQA 1WC7A 2Z8VC 4DZBB 2J12B 2XTJC 3FRPA 1B0RB 5C0CE 4Y1AD 2X89D 5BQ7A 3FFCA 2EH7H 3U7WH 3ZDZE 3BIAX 1MWAB 1WSST 5FXCH 1XGPA 5D7LE 4LAQH 4XVJH 4EN3D 4MA3B 2NXZB 2Y7QA 4FHBD 2J7LA 2G5BA 2EDNA 3FMGL 3LPFA 4MNQD 1MCCA 1KPVB 1I8IA 3W81A 3MGTB 1UQSA 3ZYJA 1TVBB 3LIZH 3MNVB 4J3TA 4LLMA 1S5IL 2EYTB 1Y6KR 5HGBA 3ES6A 4PTTA 4X5WA 4JPIB 4YHPA 3BKML 3EOTH 1U8IA 2DQEL 4HFUL 1T3FB 4L29B 1MJ8H 2ADJB 5BCAA 4CMHB 2JJSC 3MRQB 3QUYB 2V5SA 4X6EA 2FECI 1RU9L 3QRFM 2AJSL 3PABB 2A1WL 3ZLQC 4DUXA 2Z9TA 3CLEH 3ETBF 3QQ4A 3HUJB 5E6ZA 4DN4L 5D72L 4WHTA 5ITBH 5I0ZA 3FFDB 1LP9E 2FB4H 4JQXC 1J86A 4J3OC 1G9NL 1F5WA 1YZZA 4FQHB 1D5ZB 4G8GA 2GSIB 1N26A 1NCCH 3BD5A 3G04A 3BFOA 2VAAA 1QSFA 3UBXI 2P8PB 5C0DA 3VFRA 1ZT1A 3EFFA 1KN4L 4YBQD 3P9LA 2NTSP 1Q9KA 3GHEL 4S2SB 3KPOA 1J10A 5K93A 1G7JA 9CGTA 1HYSC 4NFDA 1A6UL 2D9QB 4M5YH 4OF5A 5I66B 1H0DB 4XPAL 4K3DL 4BQ6A 2MMXA 3M8OH 2IAMB 4UDTA 3RZCC 1CVSC 2UVEA 3D85D 3ARBC 4P4KA 2DTMH 2P7TA 4N5UA 4OZHA 4XPGL 5EU5A 4ZUVB 2I5YL 1MI5D 1CR9H 4AIOA 1H9VA 1OAKL 1FDLL 2UYLB 1WIOA 4X4ME 4MSWB 4WUKH 5GGVH 3K7UA 3UTPE 4L5FL 2QQKH 5LWYL 4ZG1A 3C60A 4MJ2A 2UWEB 1EAPA 4P4RB 4YGAB 1G6RL 2AP2A 3C6SA 3KYNB 4U1HA 1I1FA 4YPGA 3V7AG 3O6KL 2IFGA 3WUWB 1I8KB 5FGRA 1H3VA 1NSNH 5CD3A 3OSKA 1BFSA 2W65B 5D7SL 3QWOA 1P5VA 3NCEB 1NC2A 2WWKT 4XNUL 4YHOH 3SGKC 2CUHA 1GGIH 3JUZA 2VLLB 5ETUB 4WI8A 4F7PA 5GZND 4Z9KB 4M5ZL 4MQ7B 5HYJD 5F9OL 1KB5H 3BQUA 1MCDA 4KTEL 4B41A 5E2JA 2RAMA 4JAMA 1F4YL 1I85A 43CAA 2KPNA 5D2NE 3PHSA 1HHKA 3QUZA 5DEGB 5IEKA 5IMMA 2CKBA 1YPZE 1Z9MA 4PJ7E 3VI4E 3PGDA 3IDXH 1JBJA 3MBED 3G6AA 4Y4FA 5TGBA 4ZPTB 2I9TB 1CDUA 5MERB 4HDIB 3HA0A 1UA6L 4OJFL 3EOAB 1SYSB 3V4VL 3VCLB 3WE6A 2FD6H 3BWAB 4Z7OF 1VKXB 4I3GA 1IEBA 5SWSD 1Q0XL 4HJJL 4Z95L 5DD6B 4RMWA 4X6FB 1B0RA 1NCAL 1D5IL 1G7LB 2VE6B 4K23L 4L8SC 2HTKD 6FABL 1ED3B 1MWAA 1V3JA 3GKWL 2P48B 4MA3A 2YKLH 3LKSB 5HI4C 3O6FB 2C4FU 2DRUA 4Y4HB 4EBQL 3MGTA 4FZ8L 3MNVA 5BZDA 3QUXC 4YHLH 1GHFH 4L8CA