2ESVE

Structure of the hla-e-vmaprtlil/kk50.4 tcr complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
240
structure length
240
Chain Sequence
GVTQFPSHSVIEKGQTVTLRCDPISGHDNLYWYRRVMGKEIKFLLHFVKESKQDESGMPNNRFLAERTGGTYSTLKVQPAELEDSGVYFCASSQDRDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for a major histocompatibility complex class Ib-restricted T cell response
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, alpha chain E
total genus 56
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2esvE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2esvE02
1F11A 4JREB 4XPGH 5DEGA 2DWEB 3VXUA 5JIKA 2EEAA 3BP7A 3OX8B 1JUFA 1MCFA 1UKQA 3HZKA 1A4KB 2VYRE 5C71A 3C60D 2YA1A 1SHMA 5J6GA 3KYAA 3UPCA 4JFOA 3QDMA 2Z92B 43CAB 4N8CH 4J3XA 2XOTA 1MREL 5A2LH 4L3EB 3KPRE 3WHXA 5HJ3B 5D2NE 2W0KA 3WDIA 3KNBA 4FTVE 4J1UB 4Q6IB 4KKAC 3LS4L 1P69B 4ODUA 1YECL 3P4OB 2WUCH 3VXUB 1CYGA 4Z7VB 4PJAE 4XCNA 3T3MF 4U0QB 4JZJA 4H8WC 4I3RH 1UCTA 2V5SA 4HJ0D 3PABA 3K46A 2G5BB 2DQEH 5ELIA 4DGVL 2P5EB 3CCHB 3WXVL 3WEXB 3HI5L 1IBGH 2WLYA 1CL7H 5DWUL 1MCDA 1RUPL 4P2QA 3WFHB 4AIZB 1S3KL 5FAAA 5HHNA 3AS0A 1OT1A 3OHXB 1OLZA 3U83A 4ODTL 3AROA 4MQXC 1ZT4B 1X7QA 1JHLL 3FB6B 3OG6B 2VR5A 4KY1L 2Q6WA 3FZUD 1NGQL 32C2A 3SKNB 1FLRH 3IFNL 5C8JA 5L2KE 5JUEL 1TVDA 3GI9H 5CZVH 5DR5L 1TTUA 3K2UL 3MRKB 3PDOA 5F9JB 4X6CE 4ZXBC 2R4SL 3DMMB 3F8UB 5F93C 1J88A 3AC0A 4PRAA 1N6QL 3TCXA 5FA3A 3QUYD 4G8GD 4L9LC 1EO5A 5KANG 5DC4B 1KTDB 4DGIH 5DJXA 1PKQA 2YPLA 4L8SC 3QRFM 2YD8A 1TPXC 2A9MH 1P84J 2D9QB 1U8IB 3QDGB 1MCJA 4C58B 3ULUE 5ILTH 5INDA 1FGVL 1QSFB 1VA9A 4ELMA 2NTFB 4JN1H 2D7TH 1P2CA 1JBJA 1G9NL 3S4SA 1KC5L 3OGOE 4JPIB 4KXZH 2DN7A 4P9HC 3THMH 5HXMA 4S0TD 5TE4H 2W0PA 4MMZC 4FFZH 3S34H 1NFDB 3SN6N 2WUBH 2P5WD 3NGBC 1FL5B 2AV1A 3S5LB 2DI8A 1F58H 3ZSTA 1OGTA 5DUBA 1MCPL 4OD2B 5D1QD 2J3SA 3BUYB 4XHJD 2SEBB 3HZMB 1JCKA 5FCUH 4WO4D 2ESVA 4P46D 3WCYA 4RMVA 1ZSDB 5ALCL 5I74C 3FAWA 3GHBH 5TF1L 1PYWA 5GJSH 4NQCE 2MNUA 3M8OL 4HCRL 3DVNB 3TVMB 5HPMB 5J13C 4KXZI 5T1MB 5J8OA 4LP4A 3SGEI 4QGYA 1X44A 2IAMD 4PGCA 3RVWD 3P4MB 4XWOC 3IJYB 5H37H 5ILTL 4YHYB 3AREA 3W0WE 5SV3A 4NKOB 4FP8L 4N0FB 4N0UB 5FEBA 4NCC1 3WE6A 1N2RB 4HFUH 2EEDA 3WXWL 4MJ4A 1VACA 4RMQA 3FFCA 1FE8L 3CIQA 1J8HE 4KPHH 2YWYA 4P4KA 1LO3H 4JFHD 4CVZB 5JHDE 2DLEA 2YXMA 5CJXC 1EHLL 4XHJC 3MROB 2C1OB 4K3DH 1R5VB 2J8HA 5HYJB 2F53B 4MGXA 3S5LA 3MV01 3QFJA 5F1KC 1MHPH 2G9HB 4JPVL 2DKUA 1DDHB 2CDGA 4ODSL 2IFFH 4KU1A 1UM6L 2FGWL 2P8PA 1GGBL 3TWCL 1CTOA 1BQLL 1TZGL 2EYTB 4POZC 5DT1L 1KB5B 3ZKXC 5D7KD 3FN9A 5BW7C 2W65B 4JDVA 1QRND 2IADA 3L5HA 4KUCF 2FECI 4LSUH 1L7TL 2AJSL 1CL7I 3NAAH 1U8OA 1ZA3B 4Y5XB 4GG6F 4HKBB 3TZVC 1F4WH 1KFAL 1T1WA 4GBXD 2PN5A 1U58A 1WBYB 4DWHA 1K4DB 1UQSA 4G8IA 4WO4A 3PHQA 2RBLA 3DUSA 1KV3A 1L6XA 2H1PL 4WI2A 3WHE1 2R8SH 1X5XA 3DGGA 3K3QA 1FRGH 2EDRA 1G7PB 3EO0B 1XIWA 3GO1L 4IOIA 4GXUN 4JDTH 2DB8A 5IQ7L 2A83A 2G9HA 1CE6A 4M1DL 1Q9KB 3FZUC 3K1KC 1I4FB 5ICZB 3KXFA 4NN5C 1VGKB 5E6YA 4EZMA 3VE0B 5EZOH 3MJ7B 1PYWB 3UTSB 2OL3L 5EULV 3MQIA 5DJYB 4AEHL 3F7YA 1XCQA 3CDFA 2AJSH 1LVEA 4MB4A 3BAEH 5BW7A 1D9KD 2JCCF 4OCWH 5F9DC 1EMTH 2E9JA 3SPVA 1C08A 2HRPH 2VQ1B 4DVRL 4IDJL 4KK5D 3SE3C 3REWB 1J8KA 1PQZB 4G8GA 3KPQB 3IDXH 2VLJD 2HJLB 3F5WB 2DDQH 5ITBL 3TNMA 1NDGB 3NCYP 1BECA 5DQDH 1T0MA 3I50L 1J8HB 1FCCA 1QTYT 5DA4A 5T1DH 4RMSA 1UKTA 2EDEA 2L7UA 3DX8B 2Q87A 3GM0A 5EZJA 2GTWA 3BH8A 3BX7C 2NXYB 2H26B 1KPRA 3W0WB 1PDKA 4M1GH 3WMSA 1NCAH 1IAOB 3EJZD 4LCYB 2AJ3B 1J1XL 3QEQE 3QDJB 3KYNB 1GZQA 1S9YA 5C0JB 4YXHL 5I1GH 2KPNA 2WZPD 4X8XA 1KPUA 5SWSB 2BVOB 2X1OA 1T83A 3P77B 1C08B 3DLQR 3QXWA 3ARDB 1YMMB 1LE9B 1F3DJ 2GK0B 3A67L 4LPTA 1U95B 2VR4A 3V6ZB 2LABA 1IC7L 3RZCA 4H88H 5JW3L 4JRWA 3ZE0E 1AHWC 4MS8C 1C5DA 1VB9A 4PRNA 1S7XB 1UCBL 1MCKA 4RSVA 3LD8C 3RWEA 4OLVL 3O6FD 4MAYA 1ZLSL 5SWSA 1VADB 4RBPK 4I9WE 5CZXD 1T03L 4NPYA 2EO9A 1BJMA 1T7WA 1EGJA 3VA2C 5D1ZA 1NBZA 2I25N 4OM0L 4PJBB 5F72S 1W0WB 5CEZE 1NAKH 2CDEA 1A7OH 1OTSD 5A40E 5J6HB 4KHXL 2VL5A 1L7IL 2K7PA 4EN3B 1NJ9B 2OL3A 5HHVL 5CBEA 4LPCA 4TPRH 4K3HA 5ADOH 3OX8A 4JFPA 1AQKL 1FO0A 2ICWB 2R2HA 2Y36L 5HYSG 5GS0L 2UY6A 4PJHF 3BQUC 3GB7A 3UTOA 3GZKA 3ES6A 4LLWA 2HKHL 3SQOL 1YPZA 3HC4L 2A77L 3WUZA 5C08B 4P3CL 3HG1A 3SDYH 4BA8A 1MHEA 5IF0B 1BQHA 3MOAL 1CLCA 4QRUB 4O58H 3CFKB 3HUJF 3HMXL 1YEHL 4HHAB 4BELD 3V95A 4F37F 5J56B 3MLRH 3IDIA 4P9ML 1PW3A 4CAGA 1S9VA 3PGFH 1G7HA 3MRMA 2V5MA 3P4LA 2GSIA 3SDAB 1YQVH 1N5AA 3OKNB 3SJVA 2C7UB 4ZTOH 5GJTH 3STLA 1A2YB 3NVQA 1Q9LA 3KPSA 5C0DA 4JM2B 2C26A 4N5UA 3ZLQC 4XNQB 4GAGH 1UXWA 2NY6B 4OZ4B 2PTUA 4NNYB 2N4IA 1GGUA 4MA3B 4IOSD 1A9BA 5IEHB 4PJXF 5HI3D 5HSFA 3V5KB 5BCAA 4KDVA 3PQYE 3QUKA 2WWKO 4JKKA 3MV8D 2H6PA 3KR3L 2GITB 4NNXA 2X4NA 4HKBA 3RL1A 4KGJA 3RWFA 2W1NA 3B43A 2BOBA 3ZTNL 1GPOH 5I1CL 2EIDA 3Q6GH 1QLFB 5GRJH 2X4TA 1QBMH 3HRZA 3WUWB 4N8VG 5C2BH 2RAMA 1ONQA 3Q5YA 1FNEB 3N85H 4KFZC 3CVHB 5FKAB 3GHBL 4G9FE 1MAML 4LPXA 4OB5H 4PLKD 3BVNB 1VCAA 3BZFA 5I73C 5GRZA 2X10A 3QUKB 1JHLH 4KY1H 4BFBD 2OL3B 4L4TE 3VGAB 1XGTA 2YUVA 5SX4H 2JB5H 2Q1EA 4PBWD 1JI2A 1KJMA 2VZ1A 1INDH 1JTPA 2QHRH 2R4RH 3UO1H 3R8QA 4S1RH 4YXKL 3V4UH 1ZTXH 4H1LB 4WTZA 4WEUD 4GKNA 5IM7A 3BRGC 2AJXH 4CJ1A 3C6LA 4BK4A 4U1IA 2QQNH 2BNRA 3TZVB 5DD0L 5I71C 1PQZA 2VL4A 3FTGA 3RJQB 4MNQD 1T2JA 4D94A 1MEXL 1CBVL 1RAMA 3KJ6H 5E8EB 1BIIA 5IBLC 1GHFH 1M6OB 2A77H 3P9MB 3QI9B 3TA3B 3GSNB 4E41E 5ID0B 3QUMA 1I75A 1A14H 3P40A 1JZ8A 4F7PB 1QFUL 3RWIA 1FVDB 4QXUH 1YN7A 3X14B 3VG0H 3EO9H 3K2UH 4OZFH 4LK4A 4BFIB 3QXDB 4OZGF 2Z9TA 3DSFH 1Z9LA 2QQKH 3LKPB 3MJ9A 4TSBL 2YHGA 1A6VH 5KVDH 1XH3A 4LVOC 5C0BA 5D7KE 4X7FC 2P7TB 2KH2B 1QRNA 5GJSL 3GM8A 1BVKB 5E5MA 2EZ0C 4J4PD 5IVOA 1KGCD 5HGDA 4PJ5E 1ADQL 1FAIH 3B9KB 1QNZH 3ULVC 4GRLB 2JJTC 1IILE 1K4CB 1ZHKA 1YMMA 1LE9A 1LDPL 1U8KB 3MJ6A 3B3IB 1GGBH 4P3CH 3OJVC 4OSUH 4DK3A 2AEPL 1EZVX 2ARJB 1KN4H 4TNVK 4YDKL 3S88H 2ATPA 3FO2B 4HLJA 4LIQH 2NXZC 4I0PB 1I3RA 1NDMA 4TTDD 2DIAA 2NY2C 4LCWB 4LCYA 3QRGL 1V7NL 4ZPVA 2CIIA 1U42A 1FE8H 1D5BB 4MD0A 1V8HA 4MJ6A 4R7NB 1QBML 3FCTB 4RMRA 4NZTH 3QCUH 5EU4A 1IQWH 4Y4HC 5GHWH 4X6FB 4MAYC 5EB9A 1T04B 1BVKA 4WO4C 5C7XH 5JZ7D 2CK0L 3P73A 3VFWA 3P4NA 5EC1B 1ZAGA 4P99A 4FXKB 1NC2D 4POZD 1VACB 2EIBA 4LFHD 3RWDB 1UYWH 4K9EL 1MQKL 1BQLH 4PG9B 4F3FA 4GW4A 3EFFB 2DLIA 1QFWH 2LU3A 2DQCL 5E1AB 2IPKA 3CXHK 4HFWA 3I6GB 4FG6C 5JOPE 1UG9A 1HKLL 3RUGB 5IWLC 4Y4HD 4K07A 1RURL 1K2DB 1NDGA 3P9LA 3EYQD 5C2BL 3U2SB 5HY9A 1B0GA 4Q9BA 2O5YL 5BMFH 4ZUSB 3RWCB 5JIHA 1Z5LA 3CC5B 4LHJB 1CXLA 3GGWB 5L7XH 2QTEA 3IJYA 3CPLA 4TSCH 1RZJH 1R3LA 4N90E 2LTQC 4W4OA 1ACZA 4F8QA 3N50A 3T0EA 3UTSE 1Q9WA 3SEPA 4ZXBA 3MXVL 5FGCE 5FO8B 1BP3B 4P46C 2FD6L 4ZG1A 5TQ2L 1INEL 4XAKE 3JV6A 3QHFL 5DJCB 2NW2A 1CFTA 2X44D 3WLBA 3OKMB 4FQXA 4PRBB 3NN8A 1NCBL 4OF8A 3T1FB 2EYTA 4QRQA 2XZCL 1T20A 1MCWM 2VDML 3U2SA 4KK9C 4HKZB 3T8XB 5F7LB 3ROLA 2X4PA 4OD1L 5F7MC 4JFFD 1IBGL 3R4DA 4LBEA 4AEHH 3CX5J 3F12B 5EORH 3RVUC 1T04A 3LKSA 4WJ5A 2KBGA 2V2TB 2ICWI 5ERWB 4JGJA 2ITDB 2DYPA 3HZMA 5EUOE 1U8PB 4ZPTA 1OD7A 5ICYB 1A7RL 2VO5A 3SBWA 2CDEB 5GS2H 4LIQL 5E8DH 4IHOB 3O9WA 4Z76B 2ED7A 1P6AB 2DRUA 4NYLA 3MREA 2NNAB 2PCPB 2HAZA 4ZOEA 2BVPB 2WBKA 4KROB 1LO0H 3QIUA 2QLVB 1G7LA 5IG7B 4GAYB 4XNYL 5I71B 1HKFA 5DJ2B 2BCKB 2BXZA 4HUXA 4TSAL 2JJVA 3MV9E 3L9RA 4JPKL 3WIIL 1AD0B 3MV7B 4XHQA 3B8YA 3P77A 1NKRA 3S96B 3HC0B 4C55A 2Y5TB 3C2SA 3NABL 3BQUA 4H26A 5KSBF 3CXDL 2W9EL 3OXRA 4PV9B 1G7MA 2Q8AL 5C0EB 3SGKC 5GRXG 4LPWA 1IL1A 4POUB 4UILL 1FZKA 1XZ0B 3FQNA 4XBEH 1GGCL 4YGAB 2CLZA 2EDQA 2IGFL 4UAOC 1T0NB 2YK1H 4HXBH 2OSLA 4TQEH 4L29B 3EDKA 3X13B 5I8KL 1O0VA 5DK0B 2XY2A 5EBLA 5EN2B 2D7TL 5E5MB 1IFHH 4XPFL 1QVOB 2ZUWA 4XBPA 2WBJD 1E4XH 4FQLL 2VDPL 4OUOA 1SQ2N 4PJIE 2ZCLH 1KPUB 2UVFA 1JPSH 2PTTA 3K8KA 1YEDA 5DD3L 5LGJB 3U79A 4BSVB 3EJYD 1EEYA 1X7QB 1BAFH 1FNFA 4LOUC 1YC8A 5KN5B 3KHQA 5LVEA 1MVFA 4PY8J 5E4EC 2EIZB 2CUIA 3AM8A 2R9HD 3VMNA 5IVXA 4K3GA 5BO1H 1UJTA 1OL0A 3HPJA 4OD1H 5EG6C 2UWEB 1QQDA 2VLKE 2J8UA 3BGFC 5GGTL 1T80A 1MRCL 3LHPH 3CFCL 3C9NB 2BDNH 3WL9A 3U0TA 4LSUL 3C08L 3KLDA 3GSOA 4RQQB 3ZE0F 2P5EE 3D0VB 2ITDA 5EO0A 3O2DL 4J12A 4JRXA 4QHUA 3JWOL 1SJXA 2BFVL 1LP9B 2PYEB 4KQ3L 3IDJB 4PJAB 2BNQA 1X5JA 3ARRA 3IB4A 3VXUE 2ZCHH 3E2HC 5ICZA 4XAWH 2IADB 1CLYH 4GRWB 5E1HB 3DXAE 1FCGA 4WWKD 3V4PL 4RFOL 5MEQB 3ECBA 4MNGE 1ZT7B 5CGTA 1JNHB 4KRLB 4BFEA 3JTSA 1HQ4A 1OAUH 3RP1A 4ZFZB 1WIUA 3HE7C 5CZXC 4EI5D 1RMFH 2DMCA 5IW6A 3GHEH 3WO4B 4AY0A 1S7QB 4V1DA 1NAMH 3ALPA 1OD9A 4UIKH 2B4CH 3RA7L 4YHIA 3EOTH 3UTTE 2VE6A 3BXNB 2R0LL 3GK8L 3C87A 2HVKA 3RGHA 4X9FA 2O5XH 1AHWA 1H8OA 3X12B 1B4RA 3SJVB 3FOLB 2EDNA 3LKRB 4P4RB 1S9XA 4YO0B 1JHTB 5C0DB 4O2CB 1ZVHA 1IZJA 1MLCB 2XN9B 5BRZB 5C7XL 2OR7A 1TZHA 1SEQL 1OARH 2OR8A 4J3VA 2F8VA 4UDTB 4ODXB 4KZEL 4RZCB 5C0CD 2CMRH 2FJFB 1FNSH 3WJJA 1MCQA 4APQB 4JLRA 3CZFA 2MQ0A 4X4ME 4YHKH 3ESUF 1QHOA 5DJAA 2JIXB 5D7IF 1S5HB 2NLJA 4KKNA 4H0IA 2X89A 4HF5H 1IM9D 1T7XA 2DBJA 1OSPL 3MOQA 5D1XA 3IAGC 3CFEB 3SE4C 5HI5C 4JFYA 2IALB 1HIMH 3P4NB 5EC1A 1YPZB 5HHXL 2JCCB 3H7BB 3OKKB 2PYEA 1BD2B 1VPOH 2GHWB 4JHBA 4LHUB 1QYGL 3PP4L 3A6BL 4DZBB 2OTPA 1J05A 2ZUQC 4HX1B 3NTCL 5AWNH 5DWUH 1KSRA 1D6VH 1LEIB 1Y18B 1LDPH 3S37L 4DQOL 4Z7UE 5L8KB 4EIZC 1LD9B 2IMMA 5EUOB 4UMGA 4N0UA 1I3GH 1A6VL 5KVDL 3F7PC 4PFEA 3LB6D 3VXMD 4OCYL 4WHTB 2DQFB 1XR9A 5IIEB 4LHUG 1CIDA 1P4IL 3ZDYF 2P5WE 4Z7OF 3O4LE 3S9DB 4Z7QE 4GQ9L 1T2QH 4JFDE 1A1MB 4CVXA 4Z7UB 1LP9F 5D71H 3UZVB 5ACZA 4WHYH 3FMGH 4AMKL 2FB4L 5C0AA 4M8QB 2SEBA 1MFNA 3JWNC 3RKPA 5I66A 3RIAK 3PNWA 3CMOL 5ICXB 2YWZA 3BKJL 4OZFA 1J1PL 4KRPC 2OYPA 1QBBA 2Y72A 1M05B 4MNQE 1RHFA 4YXHH 4X7SH 2HKFL 2VH5L 3X3FH 4LEOA 2X40A 2AEQL 5C0BB 2WSKA 1NGPH 3RTQA 2AK4E 5LXGL 4MDJA 4RCAA 3I6KB 3RWJB 3HNVL 3WKMH 3OB8A 1KCVH 3H9ZA 4ONGH 3VGBA 4U6HB 1MIEL 3QDHA 1AJ7L 2JTDA 1MUJA 2A9NL 4WW1A 1RJZB 4MX7B 3WHXB 2ICWJ 4BSVA 1DUZB 4JO2L 5A16A 3PDGA 4JFZL 4PJ7A 1CICD 1JUFB 1IGMH 1A1OB 1ZT1A 3QUXC 1KIPB 3HG1D 5BS0D 2KL6A 3H9HA 2FIKA 3AAZA 4MZ2A 1H3GA 4A2LA 1YYLH 4NQUA 3MBXH 5TQ2H 1SM3L 4HC1L 2R15A 4XNXH 3FT3A 3RAJH 5EFIB 4Y19A 3BMWA 4KMTL 3BPNB 1QBLH 3UTPE 5BZWA 2VXTH 1QFOA 4EDWL 1AGEB 3DMMC 5E8OA 3WEXA 2MQCA 4N68A 2K7QA 4D2NA 1V3KA 1CXHA 2PTVA 4LGRB 2IH1B 3SGDI 4HAFA 2Z4QB 5GS0H 2IPUK 1JGDA 3PJSB 2YZ8A 5GSVB 2ZG3A 4LVHC 1X3DA 1V7MH 4ODSH 5DDHA 1D6VL 4WW2C 4QHMB 3IDMB 3V7AE 1R0AL 1EEZB 3VWKB 1J86A 1HOCA 3RVVD 2VLJA 4NQEE 1YEKH 1AP2A 4KJYA 1RK0A 2FO4A 3RHWK 1CF8L 4G8GE 5CSZB 4U1NB 4XCCL 1TVHA 5E9DA 5E70A 1LEGA 2ZUUA 2JB6A 1N8ZB 2CH8A 1UENA 1BFOB 3ILPB 2E8YA 4GLRI 3ULUD 2W0LA 1UA6H 5GGQH 2X4UA 4I2XE 1I1FA 3VCLA 5I2IB 5DC9B 2VISB 3DX9B 5KSBB 3BP6A 1HHJA 1IC4H 1MH5A 2EECA 5HHOA 3U36A 3QIWA 2VXUH 4MCYA 1RJZA 4MX7A 1DDHA 4UQ2B 2D4FA 1RULH 3QI9C 4JKMA 1EEUA 3JWDC 1ZGLA 3MRCA 4HH8A 1A6AB 4MJIE 2ENYA 3H3BC 2VITA 3IKKA 1CFTB 4GMTH 3JV6B 1C16A 2R2EA 3MXWL 1SVCP 1M05A 5IGXL 5GRUL 1UXWB 2EKJA 5CP7B 1W72A 3O2WH 3MFFB 1ZHLB 3GNML 2X4RA 4G80B 3DVNA 3EGSA 5CHNA 2CQVA 5H94A 3CSYA 1LO2H 1T5XB 1MAKA 2Y06H 4MWFB 4E41D 4H0HB 2PR4H 2CIKA 4UQ3A 1CT8A 3ARWA 2RFXA 1MAJA 4XI5D 5CJBA 5I0DA 4U05A 4U3HA 2F5AL 1KOAA 4PJ7B 1OW0C 2DM4A 4XPTL 2HFFA 5F7DB 5ISZA 1EIBA 4BK5A 3MFFA 3IF1B 4XPBH 2RB8A 4OZGE 5FUZH 3D39A 3PF2A 5F7NC 3THML 5TH2B 5CBAA 3QEGH 1LEIA 1KULA 3EOAA 1JL8A 2X6MA 5FUOL 5T3XL 3VXMB 3MOBL 1PX3A 1U8NB 5IR1B 4FXKA 1G84A 3LRHA 4MJID 4OFIA 3D5OF 1C7TA 5GGSY 3JUZA 5EZIH 2Y06L 4KDTA 5TFSH 3VFGH 2XKUA 3IU4L 4CNIB 3NZHH 1YEDB 1BBDH 4PB9H 4EI6A 4HIIB 2EC8A 4KWUA 3GRWL 1ZWIB 2PYFB 3ARBC 4ZPVB 3C09B 4WFFD 4MXVE 1U8HA 5CD3B 3ZT7A 4F7EB 5TDNB 2FZ3B 1BFTA 2ARJA 2Y07L 3HE7A 2E6PA 3C8DA 2XZQH 1KCLA 3PWPB 2EE3A 4P5MA 4TVPH 1TVHB 4R2GB 4APQD 4ZS7L 3X13A 3L3GB 1JHTA 4HV8B 3CPLB 4WWID 4RAVB 1BZ7B 4MD5B 3OHXA 1XH3B 2VKXA 4PGCB 3ULVE 4XP1L 1DQQA 5KSBA 4MXWL 2HJLA 1TVBB 5HDLA 3KG5A 1T1YA 3V5HB 2DQDL 1UJ3B 1JGEA 4MJIB 4XVUD 3L5XH 3HE6D 4L3EA 2OMBA 1D5XB 2VQ1A 3MLXH 5I8CA 2JIXA 4PGZA 1HKLH 2R0WL 2OJEA 15C8H 4X99B 3TO4A 2JJUA 3RVUD 3CK0L 2BVEA 2YUWA 4QT5A 1ZT7A 1KXQE 4YHZL 5HYJE 5MEPA 3DV6B 5L9DH 1N0XH 5LGKA 4DW2L 2JE8A 3MJ9H 2JCCE 2A0LD 2OTUB 4Y1AE 1JN6B 2D7QA 5AUMA 3MRBA 5J12B 2XZCH 1IC1A 3O3EB 5DK2B 2XN9E 2X41A 5GXBB 1JWUB 4CBPA 1A0QH 5E5UB 3HAEG 1X9QA 2YPKA 1WWAX 4NQXA 5ICYA 3OJDA 5F1SA 1P5UA 4RQQA 5C0NC 1XGYH 3HPLA 4ZYKA 1G6RH 3WHE0 5ACLA 4PRAB 3LQAH 5J12C 2GK2A 3ARXA 3TYGL 1WCQA 5FYKH 3ARFD 4IIQA 1VESA 1MFCH 3KPOA 4X8JB 2GSGB 2FZ3A 1AY1L 4PRHA 3FRPG 3UTZB 2PXYC 3D69B 5BVPL 3PWNB 3SY0A 3KLHD 5L7XL 4YH6A 3EFDL 4ACPA 3BPCB 1BLNA 3QYCA 3PNWB 3V6OC 4O02H 1ZVYA 2KZWA 3C5ZB 4FFVD 5F89A 3U46A 1CE1L 2DYPD 1CDJA 5IMMB 3L3HB 5T3XD 4PJCB 5HYQA 4TUJB 5C9JB 4LCIL 1NUGA 4XNQA 3LIZH 1AD9B 2ZNXA 4NNPL 2V6HA 2ADIA 2HFTA 1NANH 1QRNE 4NYLB 1EZVY 3VG9B 1E27A 3H7LA 4C83B 1XCTA 4RGOL 4ZFFA 4P46A 1E4JA 4WW2B 3BHBB 4M7KL 3SDDA 5IFHL 3T0AA 5GGUA 5GPRA 3X12A 3S7GA 3HAEA 4NNXB 3VH8B 3K80A 4TYUA 1CK0H 4XMPH 4LLYA 4LRNH 4P23B 5FM8A 1S78C 1ZA6A 5HGAA 1RIUL 4HKXA 1JWSA 2H2SC 1NEZA 3GJFH 3VFGL 2XTJD 1FYTA 5DHVA 2MOVA 4OLUL 3W82A 1U8QB 4FZ8H 5D2LB 4DGVH 1RUKH 1S9VB 2NY3D 1FG2B 2YMXH 4LP5A 3VWJB 4CW1B 4NKIL 1YPZF 4HIHB 2FECL 2RFXB 4QRUA 4JO1L 3RWGB 3Q6FA 2JK5B 1EJOL 1X5HA 2NXZD 3HAEB 4PJ5B 3MBEB 4HMDA 1RZKL 1YJDH 4S1RL 4X4XA 3V4UL 3ARDC 1AGCA 1ZS8B 4U3CA 3QB7C 1PZUB 4JM2C 4XMKH 4KI5E 5DR5H 4ZS7H 5CBEB 2LAAA 1LHZA 1TNMA 4NT6A 4Z7VE 1FG2A 4JM4L 4IEFB 3I50H 1A7OL 3U6RB 1QVOA 5T5NG 5DVNA 1JNLH 2AJZB 3EDFA 4YE4H 4DOHE 1JFQL 2VZUA 3U0PA 1CDBA 5D2NB 1OT2A 4E0RA 3SKUD 4PS4H 5IW6B 4QRPB 3HG1B 2NXYC 3T2NL 2XI9A 5JHDD 1HEZB 5GRVK 3L5XL 2YN3A 4RISH 5LBSH 5KSVA 4CDGC 4WCYL 1JYXA 1AGBB 4JANA 4KROD 5D9SB 3SO3C 2IAMA 4UBDD 1NGYB 5EO1B 5DLML 5D1ZD 4JE4B 5IEKB 2OZ4L 1K8DB 2APXA 4R6UA 2IPUG 4F7CB 5ANMB 5FKPA 2PYFA 2EC9T 2W60B 4OCRL 2AQ2A 3FB6A 2Q6WB 2EXWD 3VD3A 5HYIA 1WF5A 1N4XL 2BVTA 1KIQB 4FQIH 3A67H 4OZHE 4W4NA 1V7NH 4KDTC 4P49A 4PJXE 1RJYA 4XTRD 1A2YA 2VWEE 5KVFL 1NANI 4Y5XC 2FCBA 1M71B 4JFFB 4PTUB 3TIEB 4J3WA 2HT3D 1QACA 3RFZC 3WS6A 2GIYA 5KSUA 4HIXL 5CMAB 5I1EL 1AC6A 5C07A 4DGYL 5D1XD 4XPAL 5F96H 2ADJA 4W4OC 5GS1B 1PSKL 4JRXD 4KZEH 2MCPL 5ITFA 1ZHBA 1NC4D 3M1BB 3MRPA 4JR9L 1A3LH 3QUMB 2BXYA 3MUHL 4M7JH 5HI4D 2N56A 4K71C 1U8PA 2F19H 4R4NC 4JO4L 1ORSB 4U4BA 3D18B 2EDKA 2HN7A 4WFEE 3GSUA 1CK0L 4XMPL 2KZ1B 3HB3D 1WWBX 1NEZG 3T4YB 2F58L 3G5ZA 2ZP0T 1ETZB 3QUYA 1T0MB 4CMHC 4PLKC 2CXKA 5D7IE 5EDXA 1A1OA 4RFOH 5BV7H 1BMGA 4WW2F 5C0GA 3UJIL 3T2PA 4OZIF 1CLOH 3HTLX 4LSPL 1OTUC 1W72L 4NQCD 3OAYH 4JRYD 1X5IA 1CCZA 1ORSA 2NY4C 4UV7H 5DRNB 2YEZB 1WFNA 4FZEL 4WHCA 2NCMA 2P45B 4PJ9A 2X2YA 2DQJH 5EPMB 2QR0A 4DKDC 5IP4A 4M9OA 1JPGB 4PREB 2JIXD 1CS6A 4Z7UF 3QCTL 3VRIB 4BQ8A 2VDOH 5CJOL 1MWAH 2KUTA 1ZTXL 1TXKA 1OSZA 2O5YH 4GKOA 5D7LD 5A2JH 5E8DL 1VGKA 3DECA 4MXQC 2P1YA 2H1PH 4U1JA 2RHEA 5GSRB 5C0CB 5JOFB 2A74B 2E7HA 2EYRB 3MRDA 4WGWB 4E5XA 4PRNB 3DIFA 5TDOB 4JPVH 5EU3A 1KIQA 4UTBL 3QQ9D 4GO6B 1YZZA 1NC2B 1OGAE 1TLKA 3O3AB 4P2OD 4N0YH 1FV1A 4K7PH 4FOMA 4K3EL 3I02B 3F65A 2A6DA 4MDIA 3WLWC 5TDNA 2VLRB 3CX5K 3LN9A 3P0YL 4HW6A 3SDDD 3ZKMC 5L2KB 5JDSB 1BX2A 5IT2H 3BE1L 4MXQD 1VKXB 3OZ9H 1SBBA 5D72L 2MTPA 1NGPL 4GKNB 1F8TH 1LE5B 3NA9L 5BS0E 1P53A 1MJ7L 2KQMA 3OKNA 5D6CB 2AK1H 4WWKC 4WFHE 3F6IA 2J4WH 3SKJH 4GG6B 1VEMA 4UOW0 1A3RL 4CDHA 3DVGA 1A64A 5E6IB 1AXIB 1F6LL 2H26A 3MROA 2D4DA 2FEDD 1IGCL 2X4OB 3MBEC 2DTSA 3B2UD 2XKNB 4HGWA 4JFYB 3NIFE 2Z31C 3AVEA 1JNJA 2EICA 3ULVL 2FHCA 1NGWB 4P59H 3UC0H 1WZ1H 2DICA 1IJ9A 1NC4B 1ZLWK 1OB1A 2E7CA 3MZTA 2AEPH 5KAQF 4KVCH 3O6ML 3D2UB 2I9TA 5FV2A 3RTQD 2PYED 3V6BR 3DUUA 3QZWA 1KPVA 1Y0LA 4ZAKD 1L0QA 3Q6FB 4YBHA 1DVFC 4NQDA 2B7DT 1CR9L 1QG3A 5DA0B 4ONGL 4JLRB 3D48R 3S3SA 3VXRE 1CT8B 1ZT1B 5DZLA 4OF0A 3D1MC 4GLRH 3U4BL 5DQJB 3T1WA 4NJAL 5ID1A 1IEBB 5BQ7B 2FWOA 5E08L 2J6EA 2CGRH 4YXLL 2FX9L 3BKMH 3C2AH 4O2FB 4WGVB 3KYOB 5HGHA 1WV7T 4GKSB 5GSRA 5C0CA 3H0TB 2HWZL 1CQKA 1MCSA 1B3JA 1HNGA 3BIKB 4S11A 2NTFA 4Z7NE 1G9MH 2X4UB 1P1ZA 1NC4A 3MA7B 1VGEH 1BD2E 5FYJH 5ACMA 3HUJE 2FJHA 3FO0H 4QF1B 5C0IB 1J5OL 3BZEB 1CLZL 1J1OH 5KOVC 4X5WB 2AJUL 2EDYA 4NO0D 4WUKH 4OM0H 4NQDB 1BLNB 4TNVF 4UBDC 5GS1C 4FABL 4LEXH 5J89A 4BUGA 1CLOL 2DQGH 4OIAA 4R4BB 2V7HA 5ETUA 2G2RB 5SWZA 5DMKA 5FUCC 2Q86B 2WBWB 3H42H 3EO9L 1ZLWH 2ICEB 2X5PA 2XKNA 4HGWB 3MYJA 4PJIB 3V4VH 4JKWA 2OMNA 1NMAL 4JGMA 1JV5A 4KUZH 4BH8A 2VLLB 3TBTA 3QJFA 5E9DD 1N3NB 3GSRB 1EVUA 1OPGL 4WHYG 1N26A 3FONB 1KLGA 3K74B 5GGTA 4JN2A 4F7TA 1RUAH 4BUHA 5CEZL 3ZL4H 4R8WL 2YPKB 1JZ7A 1TJIH 1OP9A 5F9WB 4P23D 1NPUA 1WJ3A 4I77L 1T66D 2IALA 1NCWH 2DTMH 1DL7H 2VSDA 5C09A 2ZJSL 1S9KC 3SDAD 1QHPA 1YN7B 4X4MA 5CINH 1JNNL 5I8CB 1VFAA 4LVEA 5T3ZL 4GUPB 3TJHC 2OJEB 2XNAB 5ESVA 3TO4B 3SGDH 2P4AB 4X99A 3V4VL 3LZFL 3SOBL 3PABB 1UJ3C 5C08A 5IFHH 2AK1L 5TE6H 4UDTA 2MPAL 2P8LB 1F90L 1I8IA 2AXHA 2AXJA 4NC1C 3RNQB 3GIZH 1HH6A 1IGTB 1Z6JT 5EN2A 3MLRL 1MCCA 2B4CC 1PG7L 5C08D 1Q94B 1A6AA 1F6AB 1LNUA 1U8KA 4RRPG 4XBPB 5JPMB 4GW5A 5E4IA 4L5FL 3WFCL 2HLAB 4Q6IC 3VWJC 5KG9A 2NMSA 5J6GB 4Z7UA 1KJMB 3ZTJH 1G7HB 2CMRL 3MRMB 3UJJL 3GMLA 1QKZH 3Q1SH 1C5BL 4JCMA 1MCBA 4LVNB 3T0WA 3SDXF 4OLZH 1CFSB 1INQB 1YEIH 1VGEL 3U82B 1AKJA 4ZNEE 1HK6A 4GQPH 1D6EA 2IQ9H 3HC4H 1HNFA 2PXYD 2XQBH 5I6XB 1DBBL 5IJKA 1F00I 1XF4B 1IZKA 3LEXB 2BVQB 3MACL 3E3QC 3VJ6A 3SPVB 4PRDB 1MY5A 4LDOB 1LD9A 4JDZA 4CW1A 3LRSB 2UYLA 1NFDE 4O4YH 5HD8C 5E6ID 3RL1B 1LGVA 3O3UN 4IRZH 4MNQA 3P0VL 2R69L 4P48A 2NY6C 5I8KH 4IJ3C 1RZ8A 3HMXA 4KMQA 4W68A 5E03A 5E2UL 2A73A 5K33A 5HHMD 2Z91B 1RMFL 1WBZB 5TH2A 5CBAB 1ZE3C 2A83B 3DARA 3D0VA 1YMMD 1U41A 2Q3AA 1S7VB 3CU7A 3PUCA 4ZFFB 4HDIB 2R1XA 3GEWB 1T83C 1RUQH 1JWMB 3L5WA 4Y4HB 4NUGH 1FH5H 5J3HD 4HZLB 4B0MM 3U0PB 2F5BH 5E99L 15C8L 4NFCA 1BAFL 4WTXA 1QQDB 1NBYB 4XGZB 3VFVB 4NWTH 4OTXH 1CG9B 1KJ3H 2Z91A 2PO6A 5LG1A 1T1ZB 1HCFX 2ZNWA 4OLWL 5HDQL 3LKSB 4LGSB 3MLYH 1ZMYA 2UZYB 3HFML 3QAZB 3RUGE 5EOTA 1UFUA 1AXSB 3S5LG 1TMCB 1U36A 3BEWA 3MNWA 3PWPD 4EUPH 1JZ2A 4RAUB 3IJSB 3KPRA 3FB8B 3TP4A 5EBWA 4X4XB 1CU4H 2I27N 4FTVA 1OAXL 1U3HB 5HGGS 1KN4L 1RFDL 2BSED 4KMLB 4EQ3A 5K9QG 2C4XA 3VU2A 2CO6B 4YDIL 1JZ4A 4JRYB 1N64L 3DX7B 4B50A 3SOBH 1S7UA 3V0VA 1IAIH 4U0RC 3VDBA 3O8XA 1IAOA 5J7CC 2VZVA 1D9KB 4JO2H 3DYPA 1CFNB 3ULVD 1HHGA 2NQCA 3LD8B 4WU5B 5CILL 3JTTA 5CMAA 5EUKB 4LGPB 1NLBL 4XCYA 1WFUA 2VLJE 1DEEA 2VAAA 3OQ3B 4G9DA 1WVZA 3EO0A 1FVCA 2HVJB 2GY7B 3NZHL 1BEYL 4QRPE 4JY4B 1Q94A 4GS7C 4NN6B 4JFPB 3ARBB 4IRSD 5EIQA 5TF0A 1AXSA 1UCBH 4NQCA 1BX2B 4XC1H 1IEHA 5IB1A 4ODBD 2X4SA 1JPFB 5C3LD 4RWHA 2W60A 3N06B 3QEUA 4KVNH 2XZZA 4JRXB 4TUKL 5IFAH 4ZFGL 1ZA6B 4N8CL 3WFBL 4PLOB 2WIIA 2MHAA 5IW3A 3VRLF 4U6VL 4LCCC 5IF0A 5DD3H 1C5CL 4XBGA 2OBGA 2P8PB 5F6IB 4YUEL 1GL4B 3BMVA 4PPTA 5DJ0A 3MV8A 3EKCA 4K23L 3RBSA 2YR3A 4HX1A 1OAYH 4MXWH 3NZ8A 4FFWD 1X5GA 4L1HA 3OR6B 5I75C 1NSNL 3EO1B 5GRVL 4WTWA 4RNRB 4V2CB 1NAMB 5B8CC 1GSMA 1UACL 5M7QA 3STZA 4X6BB 2E6QA 3OGCA 3ARSA 1E4XI 1MPAL 1RK1A 1UQSB 3FB5A 4OM1H 3IU3A 1BWMA 2ICEA 1EUTA 3S3JA 3UTZA 4UT9H 5GGRY 4BJLA 1JGEB 2HTKD 4HGKC 1RUQL 1UB5A 3IDXL 3QH3B 5GRUH 5D2NC 4RIRA 3MGTB 3T8XA 2FX8L 2ADGA 4QRPD 3PGCA 4NSKB 3MUJA 4HH9A 1Q72L 4JDVB 1YNKL 2XWJB 5KAQG 2V5YA 4NKMB 4PLJC 3W0WA 2AI0L 1E6JH 1TZHB 2PF6A 1XT5A 1GH7A 5E2UH 3MRQB 1FYTD 1IGFL 1EK3A 4WDIA 2DM3A 1FNGB 1I85C 1S7RA 4G8FB 3DX6B 3TVMD 5BOZG 3MUZ1 3GMOB 4U6XB 3VXTA 3IDGB 4FQJH 3QO1B 2VIRB 3RAJL 3MLWL 1PZ5A 4OF6A 4HS3B 1F8TL 2GT9B 3KPQA 4PB0H 3QHZH 2OP4L 5IBUB 5JTWA 5GISL 4PTUA 1UKSA 1RJLB 2ORBH 3S37X 5F1IB 2IBZX 1G0YR 1I8LA 3HNSL 3F62A 1AD0A 2DBLH 4P9MH 4HIHA 4P0DA 2GTWB 3BH8B 4UINL 4RGNC 3DROA 5LCVH 1CGYA 5I30H 3DNKA 1S3KH 5GGVY 1KLUB 4GRWF 3QDGD 4WENB 1NUNB 4JY5L 4OB5L 3ZKXB 3QCVL 4G3YH 4MCZA 3PQYB 3LVEA 4OQTH 4POYA 4UU9B 2VDKL 4G8GB 5B3JF 3QUYB 4KJQC 4LVHB 1JF6A 1RUMH 2QQLL 4R9HA 3MRNB 3DMMD 4Z7WA 2BNRD 3OGCB 5D7JC 5BS0B 2DYPB 1RK1B 3L6FB 4KAQH 5F8QC 1AGDB 2ZCHL 4FMFA 4LLQA 3FOMB 2XFXA 1D5ZA 1XF5B 3VFMA 4FNLL 5I15L 5GZOD 5JW4Q 1OTUD 3BZFB 4MB5A 3ZSSA 4DFHA 3LS5L 3TCLA 3UAJC 1U8OB 1OVZA 1A5FH 4XPGL 4GW1A 3QUXD 4Q9CA 1SJVA 2FL5A 4OZIE 1S5HA 2FATH 5DMGC 1RVFL 4GAJL 5KTEL 1BBDL 4PB9L 5JW5A 1BFOA 3ILPA 3VXUD 4X98A 1AQDB 1R5VA 3S37H 5A3ID 2V2TA 1EO8L 2BY3A 5SWSE 5FOBB 1NMBL 1X5AA 4YHNB 3ABZA 2VXTL 4UUJA 3FJTA 3O3AA 5JDJA 1KELH 4XNMA 5D7IB 1M7DB 3D85B 5F7HA 1MLCA 1IGFH 5HGHB 2HLAA 5IBTH 1E0OB 5KG9B 4OGAC 3O6FB 1I9IL 3LRGA 1JPST 4A6YB 3GMMB 1I1CA 3H0TA 5TGBB 4PGDB 4OCNC 4M4RA 1YDPB 5DD5L 1ERNA 4Z0XB 1H15A 2VXQL 3MV9B 5J9PB 1Q38A 1D3CA 3BAEL 4YK4C 1OAQL 1E28B 4TNWK 1QFWI 5IVNA 1WT5A 3TVMA 3Q1SL 1C5BH 2VAJA 4Y1AB 1I1AA 4DN3L 4MQ7B 2GJJA 2R56H 3GBNL 4RMTA 5JORB 3SE8L 4JO4H 4NO3A 1CIUA 3AGVA 1AJ7H 3EOBB 4X98B 1HZHL 1MHHB 3QDMB 1HXMA 3AS2A 1J0IA 1GIGL 1N2RA 3N1PC 1YNKH 1A1NB 4PP1D 3TWCH 5KJRH 1BQHG 5J4MA 4JKPH 2NXYD 5I19L 5B3JE 3O3BA 1D5ZB 5ANME 1J1PH 2D7PA 5DZOA 4BSWB 5T1KB 1SYVA 1A7QH 5KVMC 4JCLA 4LAQH 1U8QA 2J6EH 1HHIA 4IRJA 1XR8B 2HT4C 1F4WL 4P3DA 1VENA 4XNUL 1B0RB 4FFYL 4PYGA 5IB4A 4Y4HA 4JR9H 3SJVE 4FHBD 1JGUL 5TDPB 5TQ0L 1FFRA 5J11C 1NKOA 1D5BA 4KQ4H 3S97C 2JELH 2B0SL 2Q20A 3VCLB 5E4EB 3MRDB 2EYRA 2YC1A 4DTGH 4E5XB 5C0FA 4PRHD 2NY4B 2C4FT 4CU8A 5J1AA 3L95A 4AJ0A 3FRUA 2VLMD 2OTWA 1OGAD 4QHLB 2GFBA 5FYLH 4HBCH 3SJVD 1YPZE 1CFBA 3UZQA 3V0AC 4N8VA 2VLRA 3PXHA 4P2RB 2RGSA 3B9KA 3QIUD 1IGCH 2FX9H 4Z77B 4WEMB 4LSSL 1XFPA 5FFLA 3DIFB 3GSNH 5TDOA 3BSZH 3TV3L 4S1SL 1I9EA 2H6PB 4Z0BL 3ULUH 2DM7A 5D5MF 4W6YB 1G7IB 4FP8H 4KTEH 1RUML 2OTWB 2YD3A 4I3GA 4WFHD 4XXDB 4M7LH 1PD6A 4L4TA 3QO1A 4QCIA 5D2LE 1MNUL 1UXSA 3K4AA 4LLUA 4PUBH 1PZ5B 5A16B 5FO8A 1FL3A 4K2UL 4H20L 1IAKA 2NY7L 1J11A 4O2FA 3HFMH 5CILH 4XVTH 2VDQH 1FFOA 1MF2L 4YQXL 3IXTB 1FZKB 3TO4C 5CEXA 5LQBL 2CLZB 2V5TA 3AAZB 5I1AA 3AS3A 4NHCH 2OSLB 4HUNB 4XXDA 2IJ0C 4GAFB 4Y7MA 1NGXB 2A6IB 4X0KA 2NW3A 2FRGP 5SX4I 5D1QA 3CFKA 2DWEA 4F7MA 2HWZH 1G9NH 5IM7B 3R06A 3RL2B 3B8SA 1MJ7H 4E41A 5DS8A 3DTXA 1AO7D 4PD4K 1JRHL 1BF2A 1E4KA 3ZO0A 5C0AB 1T21A 5C0ND 4PUBL 5EOTB 3G08A 3TN0B 4OGXH 5C07E 3N1QC 3OXSA 2ARJQ 2Q86A 1P4BH 3V5DB 4ZS6C 5IJVA 3QPQD 5KS9A 1XIWC 3MREB 3LKRA 5B39G 1DR9A 3CFBA 4AEEA 1FFPA 3OKLA 2VXSH 3FB7B 1NBQA 1TENA 3ROOA 4JFFA 4N5ED 1KCRL 3C6SA 1BHGA 3KPMA 1CVRA 4WI8A 3C8KB 1V3JA 3GJFA 4W70A 1B0RA 3I6LD 3I85A 4NCDA 3ETBF 3MA7A 4X6EB 3GRWA 1UEMA 3CVHA 3RQ3A 3WD5L 3MNZB 5T1LD 4NZDA 1NSNH 1X5KA 5F89B 4HZAA 3U46B 4HXAL 3T1FA 1CFVH 2AKRB 1FBIH 4HIXH 4XZUB 2HG5B 1QSFD 2AJZA 4DFIA 4NFDA 2FEEL 1C12B 1L6ZA 3MRHA 5FIEA 1MFAH 1A6ZA 4YX2L 3OAUL 5IVXF 2X05A 4DKEL 4JO3L 2VXSL 3OF6D 3OKMA 4FQXB 5I1KL 4UT9L 2XZQL 3SKMB 4HIEB 2XICA 1D9KA 1XGYL 3CNKA 4YWGL 3TPUB 3WE6B 4PJDB 4ZUWB 3WJJC 3ULSB 3B4NA 1T6VN 3BRDA 3AB0C 3QUZC 5MI0B 4HKXB 2VN4A 5E8PB 3GSXA 1U93B 1OGAA 2OP4H 4GW5B 1YMME 3U0WH 3MRBB 1FN4B 4YDLB 3O4LB 3HZYA 3TEUA 2E8ZA 4NRYA 3LKNA 1YC7A 1CFVL 2NY1B 1U2HA 3KGRA 3MFGB 3QUZD 4XX1G 1I7TB 3GI8L 2BSSA 5CEZD 4M7ZB 1I3VA 5HPOA 4PJDA 1ZVSA 4HWEL 3GBLA 1QA9A 3M17B 2CJUL 3LKQA 4ZFZA 3MRNA 3C60C 3UYRH 3V8CA 1Z3GH 4O5LL 4PJDF 2VC2H 4L8SB 1TCRB 4LLYB 4P23A 3KWWA 1JPSL 3T0EE 1P4IH 3MCKB 2A6KA 3PWPE 2MKLC 4NUGL 5F1NA 2ITCA 5IQ9B 2QQLH 2XYCA 5I1CH 3D69A 4MLIA 4RGOH 4I48B 4O51A 4XP5L 3RKDC 1Q8MA 1TVBA 1DBJH 5F9AC 1NH6A 3V5HA 4R3SA 4ODWA 3I2CH 3PP3K 4ORGA 4U1SA 5EBMA 3IDGA 2LQRA 1DEDA 4LARL 2VNCA 3RZWA 1FYHB 3CVIH 3IDJA 3L3HA 2ID5A 4K71B 4LLDB 1GAFH 2NY2B 4RDQF 3HRZB 2DOCA 3T65B 1PSKH 2GW5A 4Y2DA 1JWMA 3V6ZA 4NQDE 4S1QL 4X5LA 3UBXB 5F9JA 4JFDB 3GIVB 2FIKB 3FB7A 5TPWL 3BO8A 1INQA 1CFSA 4KK8C 4MAYB 5GISH 3BDBA 3MLTA 4UT7L 2FLRT 1G7IA 3O4OC 4L3AA 1FZOB 1FRGL 4GRLA 5EUOA 3RY6A 4L9LB 2P46B 4IOFC 4J3SA 2VZOA 1FBIL 5DEFA 1BD2D 3MNVA 1S7RB 4G8FA 1PX4A 2R29L 4NQXB 3RVXD 5DVKA 4U1JB 2ZUSA 3BW9A 1IAKB 1IC5H 1YEFL 4WV1B 5EZOL 1IM9B 3UEZA 3WIHH 4JG0L 3N1MC 4EEEA 1BD2A 3RI5F 5LGJA 3PJSA 3QFDB 4NWUH 4GAGL 4WCYH 4IHOA 1J10A 5FDYA 1AR2A 2FATL 4D0CB 2ZOLA 4J2XA 1YY8B 3WNPA 1PBYA 1PGRB 3GJEA 4XCCH 2FX7L 3VW3H 4OCXH 2XTLA 1OLLA 2Y6SC 4M8VA 1D5IH 5CSBA 1FVDA 5DYOB 2OXGA 3E6HB 2M8XA 3O81A 4W6WB 4L9LA 1V7ML 1CDGA 4IJ3B 5K9KA 4K9EH 3UTPD 4U31A 1FN4A 1GGIL 2AXGA 3E8UL 1IQDA 5C6TH 4U2YA 2GAZB 2E5EA 1VERA 3BEVB 4HIJB 2Q7YB 2X9XA 4WW2A 1Z0MA 3GSUB 4G42B 5CLTA 3OZ9L 2F74A 4OZGB 4WFFE 3ULUL 4J6RL 3D85A 4KKLD 4PJ7F 3ZYZA 4KJWD 1G7QB 3MYJB 4PJIA 4AYFA 2OR9H 1P7QB 4HS8L 1CE6B 5CS7A 4ESKA 4ZSOE 2NYYD 5CEYA 3H8NA 1H15B 3MV9A 3F7RA 4WU7A 2VZ3A 4NM4H 5IB2B 4GJTB 4D0BA 1KB5A 1UB6B 3MCLH 4JFQA 1BOYA 2APVA 4YHLL 2OI9C 2H41A 5KJRL 3VRJB 4MA1B 2OX5A 1CICC 4NQSB 4JFHE 2EYSB 1GGIH 3PGDB 4FQ1H 5C08E 1X4ZA 2NW2B 3CLFH 3MX0A 1WWWX 4ZTPL 4G7YL 2UZIL 4KRNA 4XCFL 4XNZB 1UEYA 3HMXH 4ENED 4ZQKA 1P5VA 4YFLI 5JOPD 2X4SB 5I0ZA 3S3PA 3C6SB 3KPMB 2EDXA 3TA3D 3ELAT 3C8KA 3O3BB 3U7AA 2WINB 1HIML 3G9AB 4P4KC 4A6YL 4K23H 3UP1A 3N85L 3HCVB 5FO9B 3TYFA 1HEZA 2EH8L 2DQGL 2DTML 5T3XE 5HHPA 3SCMA 3AM8C 3W39B 3Q6GL 4GFTB 4ZO7A 2JJSC 1ZANH 4M61B 3O8XB 2BNQE 1BOGB 1IGML 1BZ9B 5CCKH 4DAGL 4MQ7A 2XQYG 5LQBH 4OCSL 4P4KB 1JZ6A 3HZYB 1NCCL 1IFHL 4XPFH 1FNSL 2DQTH 1AO7E 3EYUL 1ZS8A 2W0FB 4Y5VA 3RY4A 3EW3B 3GUTB 3NAAL 4ZTPH 1ZGLB 3UZEA 1ZLVK 3MOBH 3L3OB 4TVPL 5DXWA 5FGBC 3CGTA 1NFDF 1T7YA 1JGVH 2PUQT 4ZFOL 2Y5EA 3TC9A 4M7LL 4XRCB 1JK8A 1XGUA 4H8WH 2GJZB 4V1DE 3B5TA 4OI8A 4HG4J 3ARED 4MJ2A 2DKSA 1T4KB 3RBGA 4DKAA 1BFVH 4JPWL 3QNXB 2P44B 4Y16B 3CX2A 4H1LH 2VIRA 2DIJA 5HTSA 1TETH 4AEIH 3IKCB 4LSSH 4OLYH 1S8DA 3SCMB 5KZCD 1TTFA 1NJ9A 5DTFA 1HXYA 4XP6L 1CL7L 3HRPA 3QIWB 4ZUUB 1GHFL 4XP4L 1XCTB 1MFAL 1M7IB 2IH3A 2DQTL 4M6OL 2DQDH 3EYUH 1EFQA 4CADA 5CUSL 4WUUD 4OJFH 4QHMA 4OFKA 5EU6B 2HVKB 3H9SA 5FYKE 3O6MH 2GEEA 4AH2A 2HLFD 1S5IL 1REIA 3JV5A 4BQBA 1MWAB 1RUAL 5DRWB 3UAJD 5KVEL 4ZUVA 3IYLW 5I66B 1KLUA 5KVFH 3IU3B 2OR9L 5DRXA 4UDUB 4AIZA 3KXFD 3NIGE 4WIQA 2CIIB 3PXJA 4AK1A 1B6DA 3ZE1E 1R3HA 3MMEA 4LCUB 3JWDH 3KAAA 4QTIL 1JPTL 5C3TA 5D7JD 5JQ6L 2YPVL 2HFGH 1MI5D 3ZHDA 2NY0D 5F7EH 4TSCL 1MRDH 4OV5B 4XCFH 3QG6B 5I1LB 3V52H 3HS0A 1ZOXA 3UTTA 3DMMA 1PLGH 2V2WA 3CFCH 4FQ1L 5D72H 1KC5H 3FONA 5BV7C 4P5KB 5K9JH 1XF3B 3OKEB 3FT3B 1FIGL 4GUPA 4WY7H 1UZ8B 4YHZH 1F42A 4M48L 1QBAA 4OLWH 4WEBH 4KJPC 3H9HB 1K85A 1KG0B 1UWXH 2RCSL 4Z8FH 2Y6SD 5CZKA 3C9NA 4XCNB 4C59B 1HH6B 4KK6D 5MP6L 1QKZL 5H94B 1UGNA 2WBJA 5EUOF 2F54A 2BX5A 2IQ9L 4G9DB 1EUUA 1BZQK 3RWFB 4PJFE 1KJ2H 3LQMA 3GSNA 4RGMB 3O2DH 1MHHA 3EOTL 2EKSA 3HZKB 4X4ZA 3T0DA 5I9QC 5IKCA 1NL0H 4Y0GA 3A0OA 1NMCC 3C60A 1SEBB 1JP5A 1PJ9A 4LASH 2DQEL 3ISWA 5LAXB 1DE4A 3G5XB 4P2OA 5C0RH 3PGCB 5FYLE 3TM6A 1IKFL 1KG0A 1FHGA 3O6FC 1MH5B 2HKHH 4MVBD 3UBXA 3OKDB 4GMTL 4HT1H 1K4DA 4IMLB 3MSPA 4DCQB 1DP0A 1RZFL 3DUSB 4NWUL 3PV6B 5IFJA 3W81A 2DKMA 2E9BA 5FF6B 4HS6B 2K9UA 2P5WA 1QSVA 4PJEA 3LMJH 3BIBX 1G6VK 2J4WL 3SKJL 3FO0L 3Q5OA 2X4TB 4S0SD 2EDWA 5JW5B 5C0AE 5L8LB 3L5WB 1J8HD 1OTTC 3KYOA 1FIEA 3WFDL 4U1LB 1ZLUK 1HHIB 2YD4A 4IRJB 1Q72H 2I5YL 4JZOB 1LO5B 2A2QT 4WU7B 1F2QA 4PJAA 2Y4SA 2PO6B 5GZNC 3ZKQD 4ZO6A 2Z93B 1F4XL 4LCWD 1NMAH 3UJJH 4M6NL 2MQ3A 3DRQB 3QEQB 5K59E 4WY7L 5JMRA 4M3JA 2APBA 3FFDA 5AD0A 3HNVH 4QYOB 4DVRH 3HB3C 1UADC 3ULUF 3I2CL 5ID1B 5IOPB 5FK9A 1X6NA 2IFFL 1OAYL 5EU7C 5E8EA 2B8OT 4ZD3L 1TJHH 3CAFA 3BH9A 1IGIL 4P2QD 4TULH 5I75B 3VH8A 3GSNL 3D39D 4I2XA 4M03A 2ESVB 3E1F1 5HGAB 4UNTA 4PJEF 5GGRA 3HLAA 35C8L 3DURA 2ZJSH 1DQTA 2WWMC 3WXWH 2AQ1A 1VSCA 5I1DB 1QLRA 4Q0XH 5EA0L 2A38A 4MQTB 3ZE2E 1A21A 2WWKT 1Z9MA 1WC7B 5DFTA 1AD9A 4B41A 3L1OH 2GQHA 5DSCB 3GMNB 1T89A 5CFHA 1EFXD 1C5DB 3QEQD 3WJLC 3G5YA 4M7ZC 4MNQB 4IMKA 1A7NH 1NLDL 2A1WH 4FQPA 5F6IC 4OTXL 3TZVD 1R3JA 4JY5H 4IRSC 4NQSA 3TBWB 3UJTH 4E9LA 4Z78A 1KTDA 4I3SL 4U1GC 3CFJA 3TBYA 1I7ZA 3IAQA 4BH7A 4Y4KC 3GGWA 4PIRF 4IRJD 3VWKC 3NIDF 1P4LA 1DJSA 4ELKB 1B9ZA 2QV2A 2Q8AH 1GRWA 2HA1A 2MCG1 2J8UB 5AG9A 1WK0A 3MRGA 1X5FA 4N90D 4KAQL 3QG6A 4KHTH 4JN2B 2ATKB 3BQUB 4H26B 5IFJB 2YRPA 5ISZE 3J7HA 1U95A 4G6JL 4QHNB 3OMZA 2FNBA 4LL9A 1KJVB 3VXSA 4XVTL 4KI5C 3IDUA 3BEVA 4L5FH 1YA5A 1T89C 3BYTA 1J12A 4ALAH 2NNAA 2PCPA 4K7PX 4HUMB 3HNTL 5ENWA 4ERSL 4OLYL 3PL6B 4S1DC 1F4HA 3EOAB 4IIQC 1NBVL 5F1NB 1EXUA 2P48B 4EOWL 1FJ1A 4PV8A 3ME0A 2BSTA 4MB3A 4Y4KA 4MNGB 2Z92A 43CAA 3MRRA 4PJ9C 2YD7A 1AI1H 2ZOKA 4F7MB 2ORBL 5IEKA 1NMBH 4JKLA 4OGXL 4YPJA 2DLFH 2AVGA 5DMKB 3MLVH 5E8NB 2KDGA 4NNYA 3LKOB 1PFCA 1LMKA 3T4YA 2DQIL 2X1WL 2HFEB 3PWUB 5TE7L 3VDAA 1ZLSH 4XP9H 4ZNCD 8FABB 2CDGB 5FM5M 1EGJL 3L5JA 3UTTD 2YPVH 1IAIM 4Q0XL 4HCRA 5E2VL 4I2XB 3ULVH 1DQJA 5E95B 2I9LA 4P5MB 4EDXB 1FORL 1YQ2A 5B39B 3P0GB 4JREC 2ZCKH 2BFVH 4QWWC 2P7TA 2VUYA 3RY6C 4U1KB 5E2WH 1LEKA 3FHQA 1U8MA 1KT2B 4PJ8C 3D6GA 2ZSVA 3MJGX 3OXRB 4PV9A 3BESR 3NCCB 3BWUC 4J3TA 4UQ2A 4QEGA 4RAUA 4JKPL 5L2JB 1R3HB 3BEWB 5EWIH 3IXAA 2GKIA 1MCWW 2D2OA 3NCJL 3PHQB 3VFTB 3FB8A 1EERB 1ND0B 4QHNA 1MI5B 3MV7A 3QUZB 5GIRB 5MI0C 4PRIE 1I7RA 5HYJA 5IW1B 3TIDA 3WDHA 4C56E 2GFBB 4EXPX 4FFYH 4HWZA 1HHKA 1J0ZA 5A2IH 4XH2B 2JCCA 3H7BA 1G9EA 3QQ3A 3MCKA 1LO5A 1GOHA 4YWGH 4MA1C 4MA7L 3DSNA 5ETUB 5FGCB 1W2KT 3R1GL 4R96A 3C6LB 1U8NA 2IG2L 3TESA 1T7ZA 1LO4L 5I1HL 3WL9B 1HYSD 3VI4F 4ZFGH 4YUEH 3QEQA 3O6KL 1EFXA 4PY7A 4DKFL 4LEXL 1DBAL 2V5RA 4ENEC 3RZCC 1HXMB 2OJZH 1QD0A 3VG9C 3BKML 3ZL4L 5IMMA 1TNNA 2RCSH 5IBLD 3QEHA 3VFPB 4LLVA 5IROA 2YMXL 2VDQL 3QXAB 4PRHE 5J06A 4P9HL 1ND0A 4U6YA 3DVGB 3IDYB 4UT6H 4AT6A 5GIRA 2F15A 4XVJH 4XAKD 2QBWA 1XGRB 5MEND 1FFNA 3U4EA 3AREB 1UM4L 3EHBD 2XIDA 4XPAH 5F96L 4PJ8D 2JKXA 3FN3A 4X6DF 3PP3H 4DQOH 1OW0A 1BVLB 3W0WD 5FECB 4D9LL 1VFBB 2APFA 4QOKA 5JO5A 1A6WH 3PGFL 4Y5YC 3S36H 4TUOB 4HWUA 1YEJH 3V6OA 5J9PA 3NMEA 2O61A 4HIJA 3KPNA 3MGOA 1IT9H 1RU9H 4IRZL 1MUJB 2H3NA 1MEXH 3VDCA 3IXAB 4WHDA 4K55A 1NCWL 5IBUG 1SYSB 3TNMB 2WW8A 1AC0A 2GSIB 2FHBA 1FYTE 4OUUB 4QXTA 5DLMH 3TN0D 4X7DC 4X6DE 2ZCKL 4RIRB 3DJ9A 3G6DH 2CO7B 4WV1C 5C0AD 2CRZA 1VADA 4YXKH 3EOYG 4QXUL 2EDJA 5DUPL 5IT2L 1MREH 2A6DB 4U1NA 3IFLL 3ROOB 3B5GA 1LO4H 4HUWB 1OF2A 4WUUE 5LJYH 4GQ9H 2ADFH 3QZWB 5ALBH 5DD6B 4ZODA 4F3FB 2UV3A 4LKCB 2ZUYA 5H37G 3NCBB 4Z7NF 5E7BA 4GW1B 1TJHL 4LRIC 5E8OB 2FBOJ 1R5IB 3TBVB 3VGHA 4BZ2L 2R69H 3HR5B 5I74B 2J88H 4ZQKB 1T22A 3T4AA 1Z0NA 1TQCC 1NCDL 4CVUA 2VUOA 3DO7B 3F58H 3TT3L 4QHUB 3MA9H 3WLWD 1UWEL 1CF8H 4ELMF 1Y18A 3SE8H 5JPNB 4GG6A 4G42A 4TOYL 3V7MA 1EAPB 4ODHL 4YNYA 4ZO9A 3HC3L 4PRPB 4K94L 3HR5A 1NDMB 2EC9U 4IRJC 3RU8L 4YFEA 5IQ7H 3ARBA 5KW9H 4XWGH 5KSUB 3O8XC 4P9HH 1OY3B 1DUZA 2VJXA 3WFDH 1DVFA 4TPRL 5EPMA 1N59A 1BWWA 3KYKL 3S98A 5J0BA 3L3GA 3DETC 2J1KA 4GG8A 1HILA 4EBQH 2C1PA 5I1IL 2NY4D 1G7JA 1CDIA 4ZMAT 5FA4B 1SY6H 1W0VA 1H0DB 1QSFE 3RWIB 3S36L 2R4SH 1PG7W 1JZ5A 3RIAF 4KK6C 5I73B 5D96B 3QDGA 3BN3B 1HWGB 2CLVB 4GSDH 3GBMH 4DK6A 1YUHA 3W11C 1MQ8A 5ADPL 1ORQA 3G6JA 3KJ4C 5LWYH 5DRNA 3IDIB 4BQCA 5ITFB 3UJTL 4PBVC 1CI5A 4P5KA 5HI4C 3MPCA 4XMLL 3HNTH 2CIKB 3O3DB 1FGVH 2FBJL 1AE6H 3IT8D 3KVQA 4PJ8B 1KXVC 2DQFA 1R6VA 4OGYL 3ZKND 2ADGB 1ZWIA 4KMTH 3WNOA 2VDLH 1Z2KA 3GKWL 3L1OL 4OFPA 1Z3GL 2DJ4A 4O5LH 4HUKB 5GRYA 1C7SA 4PP2A 4UZGA 4PR5B 4EQ2A 4HMCA 4EXKA 3ULSA 2BNQD 1JNHA 4XAWL 4HCRH 3SDXE 1C5CH 5AZEL 5CGMA 3BN9C 4KDWA 5GZND 1JHKL 4XTRC 2GITA 5C0BE 8CGTA 3QNYB 3PHOA 3UCRA 1T4KA 3ZHKA 1DUYB 5DJ0B 2F5AH 1X5YA 4X7EC 5IHUL 1CDHA 1IGJB 4I3SH 3RGVA 1ES0B 2NY5C 3KDMA 2WUBL 4YDVA 7FABH 3TN0C 3REVB 3QA3B 2CR6A 1MVUA 1KACB 3L3JB 1T6WA 3RIFF 5D6CA 4ZO8A 3BISA 2XXMB 4LCWE 3QJHA 2R2EB 1RJYB 4R4ND 1PVHA 1U3HC 3ZTNH 1S7VA 4HWNA 2AXFB 3FL7A 4O2EB 5TE6L 3W2DL 3CK0H 5JNYB 1FV1B 1KENL 4BQ9A 3HZVB 4QTIH 4CMHB 5D1XC 4G80A 1CWVA 5I16B 2P8MA 2YA0A 4NDMA 1W8OA 3BKCH 4X4YA 4QNPE 2UYLB 4XPTH 2NY1D 3KJ6L 2P43B 1N5AB 3NCEB 5HDOA 1YEGL 1DL7L 3MODL 3RWCA 3O4LD 3MRLB 3I9GL 4FQLH 1AE6L 4YHKL 3MNWB 3TFKD 2P8LA 2F53A 3RRQA 2GJ6B 4ZSOA 2BVUA 3C60B 4F58L 1ZEAL 4OM1L 3F6LA 5HJ3A 1AKJB 4G6KL 1I1YA 3MJ8A 5ALCH 5D1ZC 1F90H 3DUHA 5EBLB 4KC3B 3PQYD 4HJGA 2H2SD 3IDMA 1BJ8A 1JRHI 2HT2D 3QXTA 1BBJB 1JMZA 3MUGA 3A6BH 1IAII 3VFSA 1JPTH 3Q2CA 2DDQL 3ES6B 3ARTA 1QFHA 3HCVA 1DFBH 1EX0A 1KIRA 4GSDL 1KNOB 4Q9RH 1HYSC 6FABH 2LFGA 4L8CB 1IKFH 3MRKA 1NBVH 3PDOB 2FGZA 1LEGB 3MLXL 3RX8A 3RDTC 4EBQL 4M1CC 4Z7QF 4OKVB 1A14L 5CJXA 3REWA 3QDJE 5EU6E 1CD9B 4PJCA 2CLRA 1LO3L 5CSGA 1FORH 2XPGB 1H5BA 3UDWA 5E24E 4YZFF 3S35L 3DO7A 4RFNC 5MEQA 4PLNC 3HE7B 2QQNL 2RIKA 3MLVL 4WTZG 2IH1A 2FJGA 5C09D 1VEOA 5BZDB 4HC1A 5GSVA 1MFDH 2NY0C 1DBAH 1RZ8B 2G2RA 2NX5E 1IGYB 1AO7A 4C57C 3P4OA 4K7PL 2A73B 3MZGB 5FB8B 1H3PL 4TULL 5K93A 3LQAC 1FZMB 3ZYJA 6FABL 4OGZA 2XPGA 4EVNB 1JF1B 3DTXB 2VZTA 2E7LC 4Z95H 5T5NF 2BVOA 5D96C 1WBYA 3QHZL 3DXAB 1EA9C 3BD4A 2HLFC 3VXRA 5F3BA 1WFTA 2F54B 2JLLA 4YFLF 3PWVB 2DMKA 2O5ZH 3JV4B 1S7WB 3OSKA 3U9UB 4Y4FD 5IJVB 4TTGA 4M5YL 4PD4J 4R4BA 3GFUA 4U1HB 3O2VL 3IXTA 1V5JA 2ADFL 5SWQB 3SKOA 3GMRA 1KPRB 2B2XL 2VXVH 2YA2A 5F7YC 2HFFB 1W72H 5CJQH 3RPKA 4P59L 4J8RA 5HDQH 4QXGL 2O26U 4HJGB 4M1CD 4H88L 2Y36H 5MERB 4FZ8L 4D9RE 3C8HA 1XCQB 5F97E 3HUJA 4NKMA 1YEEL 4P57B 5DZNA 4D0CA 4L29A 1OARL 4H25A 5AEAA 3JV4A 3MLTB 1T1YB 3WFZA 1MY7A 1U91B 2C9AA 4S1DD 5C09E 3HS0B 2HT2C 2PO6C 3G6DL 3H2WA 1T66C 4CKVX 4TRPH 2ZUQB 3RWHA 1Q0XL 4M3KB 2JK5A 4TVPE 2H2PC 2IH3B 4NQEB 3F7YB 2AV7B 4RA0C 4LQFH 1I85A 3DYOA 5SWZE 3RVXC 3N1GC 5CP3H 2R1WA 4XP6H 4APQC 1C8PA 2VTFA 3LEVH 4ZUVB 3QIUB 3PWLB 4LARH 1BGXL 3RNKB 3T77A 5CD3A 2OI9B 4EI5A 3VXNB 5D70H 1JVKA 3HI1A 1JZ3A 2DS4A 1UM4H 2HMIC 4OGAD 4B7IA 2UWEF 5IB5A 1U93A 3EDDA 4F57H 2WIIB 5DF0A 4M43H 4D9LH 1ZXQA 4CU6A 5E1AA 3CUPB 2AEWA 4JPIA 43C9B 5FUZL 2FJFA 4LPVA 2CLRB 1UM5L 3EAKA 1CFQB 5EO1A 4DTGL 2QKIB 4AIOA 3VFPA 1U3HD 2DD8H 3NCMA 4DZBA 3QJHB 4NUJB 4F9PC 3OR6A 2A9ML 4LNVA 1A4JB 1U8JA 3TNNA 5FYJU 3FQTA 4Y16C 3TT1H 5CIPH 3FOMA 4QHKI 3TH2T 4PJFA 1RZ7L 3IETA 5FO9A 1DQDL 4Q9QH 3OV6A 1WCBA 1T03H 3IFOB 1S9WA 5D70L 1HSAB 4LF3B 3TBSB 3W5MA 3NFPB 3VFRB 4LSTL 5MENB 2J8UE 2VOTA 3O6LH 3O45B 1RQ5A 4KKLC 5JQHC 3HPLB 1JF5A 2QR0B 4HS6A 1MRFL 4JM4H 2Z31A 1SY6L 1HSBB 1OAZH 1I7RB 1R3KA 1NEUA 2VDOL 4P5TB 1K4CA 4M61A 3STLB 5ECJE 4LU5L 5EZJB 1CGVA 5B21A 4H1LG 2H3NB 1FFPB 2HTLC 3OKLB 4WFGE 3UYPA 4NC2B 1DVFD 2BP3A 2QADD 5JQ6H 2EO1A 2GTZA 4JZJB 3UTQB 2AABH 3B83A 4U0RB 1S7TA 5ABDE 4M1DH 3EYFA 1PY9A 3ARPA 3ARZA 1A6PA 1UWXK 4PJEE 3J8F7 2YS4A 2Z35A 1U8MB 3C5SA 4F2MA 1GCFA 3RUGA 5DHXB 4G6AD 4L4JA 1V3LA 4L9DA 1WZLA 4F57L 4WW1B 3GMPA 4FQCL 4GXVH 2X4RB 1Q9OA 4HPOL 4LSRH 5HHPB 3GKZA 3DBXB 4PJ9B 4PV8B 2HRLA 3DVIA 4AM0B 2HG5A 1CDUA 4WEBL 2CRMA 1KLFA 1ZGLP 1F2XK 3DVFA 4JAMB 2VXVL 3X3GH 1F11B 4RFEA 3VI4E 3ARYA 2AJXL 4K2UH 4LU5H 3EFFA 3KJ4B 3QIBD 4N9GB 4NJ9L 4HH9B 1TDQA 3FQXA 1UACH 2HJFA 2WQ8A 3GMQB 4UINH 4RISL 2PETA 3IS0X 3DETD 3V52L 2HKFH 2VH5H 3P11H 3KPLA 1GC1H 5DMJB 5JPNA 1CXFA 2CKBB 1YEKL 2FDBP 4M6NH 4Z7WB 3OTTA 3IVKB 2LTQB 5GS1A 1KN2H 4I18A 1DBBH 1NGZA 4JHWL 5IB5B 2NY0B 4G6MH 3UTTB 4N9GA 2X42A 3SE4A 2B20A 5C0EA 5T3ZE 5M95B 1AXTL 5AZEH 4YPGB 1G0XA 2EDOA 4QRRE 2QADC 3VXRB 3KYMB 1K8IA 4DZ8A 2PW2B 3FT4A 3SDXB 3WFCH 1CGWA 1LK2A 4OFYA 1NFIA 4XP9L 2ILLA 2OJZL 4YBLC 1I8MA 5E08H 1CGSH 5KSAB 1AH1A 1I9JH 3NGBB 2F74B 4M1GL 2OXHA 4C54A 3QIBC 3NPZB 4FFWC 1VHPA 5E94A 4XP4H 4BSWA 1BVZA 3RKDD 1SY6A 1KYOJ 1TZIB 4LSVH 3QQNA 4M62H 3EYFB 5HGBB 1YNTA 2F5BL 4ELKA 4E42B 4MA8H 3AB0B 3LN4B 1LILA 1LP9E 3KPTA 5JUEH 3HHRB 3OPZH 4EJ1C 1DQJB 4YDIH 5KZCB 3NIFF 1UT9A 5ESVB 2CDFB 4LCCA 4G6AC 4QRPA 1ITCA 4Y16D 4N0UE 2CPCA 2CKBL 3G6JB 4LLDA 1FG9C 1RIVL 5JW3H 2I5YH 4HUXB 2Z31B 5IVZB 1HXYB 1KBGH 1J18A 4U1HA 2ZSWA 1DQDH 5GHWL 1RIHH 4QXTB 1MFBH 4U7MA 5I76A 2DAVA 3CVIL 4E42A 4U1IB 3O4LA 1HYRC 1I9JL 4PGJA 1N6UA 4I8DA 5IB3B 5IUSA 3V6FB 5I1GL 4NQDD 1QR1A 2X09A 1OAQH 1QZ1A 1F6FB 2C3HA 5IHZA 1N6QH 1PEZA 1HHGB 3CFDB 4WI5A 4WU5A 4TUKH 3U4EB 2AAVA 2EE6A 4BH8B 3QFJD 1OP5K 3MRPB 4GRWH 3MRQA 4X4YB 4G6ML 3QPXH 7CGTA 2GYSA 1K3IA 2AK4A 4K8RC 1XGQB 2ZG2A 4FQIL 3KPSD 1C1EH 1FC1A 2CGRL 2YUZA 2N7BA 4KGLA 4Y5YB 4AEIL 3UDWC 2IBZY 3P30H 3W9EB 2EYSA 1X4YA 3I6LE 1EFXB 2H2PD 1G9MC 1HHJB 1MAMH 5TFSL 2XACC 1RIHL 5FKAA 3U36B 3CLFL 3U7WL 1HQRA 3N9GH 4M8QA 1O7SA 5LBSL 1HI6A 3Q5TA 4LLVB 4PJHB 3VD5A 3TLRA 2JB5L 3VGGA 1A47A 3RZCD 4MA3A 1S7QA 1Z9SA 2ICCA 4JY6B 3FQRA 2ESVD 2XWTA 3OB0K 3NFPA 4Y16A 3VFRA 3D39B 4ETYA 5L88L 1R3LB 3QPXL 4P2QB 3WFHA 5JOEA 2R23A 1ZANL 1GVIA 3EYSH 5HI5D 1ZHLA 1RULL 2JF1A 2OQJA 2WV3A 3RWDA 3MR9B 1LQSR 5DD6A 1DSFH 4YZFE 1WGOA 3QSKB 2BJML 5FYKU 2RR3A 3MNZA 2EE9A 4XC1L 1YQVL 5FDWB 5ISZD 2WM0A 1OQXA 3ZYOA 5EU4B 4PJEB 5B22A 1ZK9A 1GZPA 4QT5B 4KQ4L 1YN6A 4CMMA 2J7LA 2Q3ZA 2B1AH 5IKCB 1R24B 2AJYH 4UT7H 4NQEA 4R7DA 4M43L 5CIPA 5GGVL 2IPTL 1NCBH 5D7SH 5I1DA 3ZTJG 2PO6D 1QR1B 2C3WA 4Y19B 2I9TB 1S78D 4RGNB 1AI1L 4OFVA 5L2KD 3LN5A 1D5IL 3RL2A 1ITBB 4C56A 5I19H 1XAUA 3GSQB 4ETQB 3BOVA 1XMWA 4ELMB 3O3DA 5DQ9A 3DPBA 3D3VB 3TN0A 2FB4H 4LAJH 2ZSWB 2Y7QB 4S2SB 4JG0H 2V9TA 5I1IH 4FMKA 2NZIA 4OLXL 3EDEA 4JVWA 3MRHB 4WI7A 4FQJL 5D7LB 1WITA 1FL5A 5CWSA 3Q0HA 1FFNB 1YYMH 3DRTB 4MJIA 4HDIA 5L0QB 2DLFL 3QQ3B 2ZOLB 3EBAA 4L4TB 3MRJA 1DLFL 4HXBL 4TQEL 3MACH 4CJ0A 5E99H 4Z8FL 4X80H 2ZOKB 2W59A 1BM3L 4NP4L 1FAKT 1ZT4A 3H3PL 3FCTA 5CJQL 1NBYA 3VFVA 4OZIA 4JQIL 5HHMB 4NHCL 1EGJH 5T3ZD 3NTCH 3SDAC 4PRDA 3LH2H 2Y23A 5FYKD 5J1TC 1A7PH 4ZYKB 4JDZB 1W8NA 2X1QA 3QWRD 1NFIB 2BRRL 2PTTB 2IEPA 5FA3B 4JFDD 4IIQB 5ANMA 5FKPB 3OKEA 3AMLA 5CGYD 4IMKC 1SJEA 1T7VA 5DJ6B 3FAXA 3FRUB 3PIQB 3L3DA 3X14A 2NY1C 4F58H 2FIRT 4LMQI 4FQCH 4M93B 2AK4D 1KUMA 5BO1L 1JHKH 2HT4D 1I7ZB 1U6AH 1HH9A 2AI0H 4ZUUA 5A2FA 2APWA 1AY1H 1DSFL 1MCHA 1BM3H 3BP4B 2P47B 3M07A 4X6DA 2CDFA 4LCCB 5HHVH 3DGCR 4FRWA 1F6AA 1LNUB 5CLWA 1DQMH 5CINL 3C2AL 3FFCE 4NCC2 3GSQA 4ETQA 4PP1C 3S6CA 5C0IA 1MJ8L 4I1NB 5C9KA 1WFOA 1G7MB 2YC1B 4UOW1 2BOCA 1GC1L 3VD7A 4F9LC 2IPTH 5E0QA 2Y7QA 1J1XH 4WI3A 2EDDA 4NKQB 3V7AG 3G04A 3G5YB 2IANB 1D5XA 1ZEAH 1MIML 5D7LA 2CD0A 3LKQB 5IHLB 1AGFB 4R0LB 1Q9KA 4KI5F 4LBEB 5ENWB 4GRWE 3MCLL 1OAZL 5DURD 3KXFB 1A6TB 5I30L 1B2WH 3BN9D 2V7NA 1I4FA 3BUTA 4OZFB 3MJ7A 2BSSB 1VEPA 5IMLB 2GJZA 3CSBA 1T20B 4Q9QL 4FN0A 4R4FL 4B53A 2DQCH 3RX5A 4BZYA 3HI6L 25C8H 4MHHG 4QYOA 1BREA 1D7FA 1UYWL 1U2CA 4AG4H 4GG6E 4YHIB 1BJ1J 5DUPH 4CNIA 5T5FH 5KSBE 3S8WA 3KPPB 4OI7A 5FYKL 1DUYA 1QOKA 1XGRA 4DN3H 3PE9A 2BHZA 1XGTB 4OFYD 5DHYA 4RX4A 2W0FA 1EBAA 5E9DB 4EIGB 3TPUA 3DV4A 4OCRH 4LVNC 2NXZB 1U8IA 2EH8H 3W5NA 1C12A 3JTSB 2PNDA 2IF7A 1A6ZB 3HI5H 1OAKL 3RPIA 1T1XA 3VXMA 1B4JL 3MRFA 2NY3B 1JNLL 4ONHB 4FQ2L 5EZLA 4ZUSA 5MEOA 1SMAA 1QYGH 3PP4H 3QNZB 5HHQA 5GZOC 4HSQA 1SBSL 2WIMA 3HZVA 3CZFB 4JFXB 4UOJA 2FEDC 2X4QA 3QUXA 2CXGA 3U48A 1QA9B 4NO0B 2C1OA 2VABB 1PY4A 1XGPB 4M62L 3QDGE 2FD6H 1HI6B 2QL1A 1S7SB 1A3LL 4CADB 3JVGC 4O2CA 2R1XB 4PJXB 4Y4FA 1IMHC 3O8XD 2GTZB 2RJMA 1CLZH 1J1OL 5H2BB 3HI1B 3JWDL 1HINH 1KXTB 1DQML 1S7XA 4XCYB 2GJ6E 1I7UA 1SEQH 1T5WB 5CEYB 4X6CB 4BYHA 4UQ3B 4NZJA 2YRLA 1MJ8H 5IV2A 2J8OA 4P2OC 3FRPA 2FJHB 4QF1A 5I8EB 3SKMA 5MP6H 3W11D 5SV4A 3BP5A 4MNHB 1BVLA 2WK2A 4KPHL 1NBZB 5K59F 3VJ6B 3ZMRA 4OQTL 4JFOB 5J11B 3R0MA 4DUXA 1UH4A 3QA3A 3BD3A 4M48H 4ZAKB 2ARWA 3FO2A 4KKBD 3IAPA 2NY7H 5IK3A 3WNKA 1N7MH 1FSKC 1IEBA 5BQ7A 5F71A 1MIMH 1QEWB 3NPSC 1CXIA 2R2HB 5D7JA 4NOBA 5LWYL 1TZGH 3TVMC 5J13B 1CGSL 2CKBH 4H25B 4DW2H 4NRZB 5EIVA 3T2NH 1CD1A 3NCJH 1ETZA 4JFFE 2DQUH 5AWNL 4NRXB 3PWNA 3P0VH 4R90H 4Y5VC 4RGMC 1LE5A 3U1SH 3MRRB 4NN7C 3CMOH 5C0GB 3CUPA 4LLUB 4N5EC 2R0WH 3RWHB 1FNAA 3MGAA 4U33A 1JNNH 2YN5A 2BSRA 2WQRA 1OOAA 4XPHH 4KZDL 3MLWH 4KJPD 1U8HB 4TUJA 4ODHH 5C9JA 1FNLA 4MCZB 1XIWD 3C5JB 1OHQA 5F88A 4ZS6D 3ZDYE 2HTLD 4YK4B 1GC1C 2LVEA 2NX5D 5FHAL 4K7PY 1LK2B 1RSFA 1MLBB 4H5SB 5DJDB 3WD5H 5JIPA 3F7VA 1J05B 5C6TL 5KN5A 2MKWA 3HG1E 4GBXA 4QY8B 3QCVH 4N1CA 1TTGA 2COQA 4P2OB 2BZDA 4Z7VA 4H0GA 4PRHB 4LMQE 4HC1H 4XWOD 1QRKA 1BQUA 2BC4A 3R1GH 3BO8B 5AAMA 5LXGH 1FFQA 2ZZUT 4OZHF 3VFUA 4BSJA 1T21B 4YNYB 1OF2B 4HUWA 2FX7H 1J0KA 3LS4H 4X83A 3VXQB 4DCQA 5H35B 4P57A 2F58H 2F8OA 5JPMA 2HJFB 1M6OA 2Z8WC 3BWAB 4YR6B 1GIGH 1EHXA 4JVUA 4JFED 4PYHA 3X3GL 2XRAH 1A5FL 4NQCB 4U6TA 3BIKA 1JK8B 4BQ6A 3G5ZB 4NQVB 1SVZA 3UMTA 3O6FA 4MAYD 4A6YA 4XNXL 1WEJH 3U9PH 4L3CB 4HLZG 3I84A 3VMPA 3K7UA 1KTLB 4Y1AD 5F3HB 1R3KB 4P5TA 3VMOA 4TVPD 3ZDZF 4PG2C 2YBRB 3L7FB 4GT7A 2V2WB 2BOCB 2NY2D 4NN5B 3ZDXF 3FFCB 4PRID 3SDCD 3MLPA 4TOYH 5FCSH 1F58L 3EO1A 5ITBH 4C4KO 4NRYB 1QNZL 4Z7OE 3DUUB 3TPKA 2D0FA 4NIKB 3QH3A 4L1DA 1MHCA 4K94C 5ESQA 3FQWA 4Y2OA 5IOPA 4ORZC 1JGLL 5FYJD 2K1MA 4UT6L 2VDMH 1JFQH 3LHPL 5IHUH 4RWYH 2YD6A 3O2DA 5I16A 4X9GA 1AHWB 4OIBA 2QSCH 4OF5A 4GAJH 3ESVF 2XKSA 7FABL 4ZUWA 1XR9B 4LSTH 2DJSA 3K8MA 3BZEA 2B1HL 4AH2B 2D7NA 3QNZA 4MSWA 4XMKL 5IMKB 1VDGA 2D0GA 1MWAA 3O41A 3G6AA 1JGVL 3QHTC 5AZ2L 1BFSA 1GYAA 2FSEA 3QUXB 2X4QB 1ONQB 5FYJL 1HSAA 1QSEE 4A6YH 1F45A 4OBRA 4ONOA 3FKUS 5TDPA 4JHWH 3WO3B 4FNLH 4KKAD 4PGEA 5D1ZB 4I4WB 3MR9A 5LGHL 3MMEB 2NLJB 1RUKL 1U6AL 3BPLC 4WWKA 4MQSB 1WBZA 1KBGL 2VLKB 4OAWB 5E6IC 3LCYA 4FFVC 4QXWA 5K9OB 4MD4A 5D6DA 3O4OB 1KB5H 5TQ0H 5EZLB 1NAML 1W72B 1YEHH 4XNUH 5IMOA 2GSGA 3SE9L 4PJ5A 3O2WL 2NYYC 1AIFB 3R06B 1A6WL 3R0NA 3U0TB 4NO3B 4OZHB 4QWWD 5ALBL 2B39A 32C2B