2ESVE

Structure of the hla-e-vmaprtlil/kk50.4 tcr complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
240
structure length
240
Chain Sequence
GVTQFPSHSVIEKGQTVTLRCDPISGHDNLYWYRRVMGKEIKFLLHFVKESKQDESGMPNNRFLAERTGGTYSTLKVQPAELEDSGVYFCASSQDRDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, alpha chain E
publication title Structural basis for a major histocompatibility complex class Ib-restricted T cell response
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 56
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2esvE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2esvE02
2APTA 3WSQH 1U8JB 5I1IL 1VDGA 1GCFA 3CVIL 3BVNA 2EICA 1VADB 2EE3A 5E56A 5HHOA 1CE1H 1YEEH 1F11A 5IGXL 4CN1A 3X11A 1MVFA 3FQWA 3TJHC 2X4PA 5JIPA 1HH6B 1EV2E 2VDNH 1FSKB 1NEZA 3MOAH 1D5ZB 1J1PH 3AY4A 3RGVD 4AT6A 1MVUB 4JVUA 5L7XH 3MRIA 5E4IA 3L3IA 3O45B 1DTUA 1UM6L 4TSBH 1P5VA 4KY1L 2V7HB 2VYRE 1TVHA 4JREC 1ZTXL 3SDXE 3QUZA 2DTMH 2VXUL 3GBML 1AC6A 4V1DA 5CEYB 1JNHA 2HT2C 2Y6SC 3VI4E 1X5XA 1UB6A 3BMWA 3MUHL 4ELME 2PKDA 2OR7A 1T1YB 3GSNA 1OTTC 3ES6A 5I1EL 1OLZA 1IAIL 3UTPD 4JRXD 3ARGC 1D5XB 1NGYA 1M7DB 3BDBA 4TRPH 1KLUA 1NQBA 3L3KB 3AREA 1XF2A 4Y5XB 3OKKB 1GHFL 1IGFL 5ACLA 2W0LA 1QFUH 3PQYE 4JO1L 2RFXA 2Z9TA 2XKUA 3N1MC 1CDBA 4LSDA 4XP6L 4GRWB 3EOAA 3KPQA 4HK0A 4MXVF 5FHBH 4Z7NE 3KR3L 3IF1B 1EZVY 1AI1L 2B7DT 5D1QC 3WNMA 1S78C 4YDIH 3LDBC 2A6IB 4OB5H 3HRZB 3IFPA 4GAJL 3VXPA 3NIGF 5C0JA 1G7LA 3ZYJA 1JYVA 4NQCD 5L8LB 4LLVA 4QYOA 1TCRB 1KN4H 1YMMB 2VC2L 3EOTH 1MFBL 4YGAB 3V6OC 2YWYA 2OK0L 1MAMH 4ZNEA 3MPCA 2QKIA 4HKJB 4KPHH 2PO6A 3RWGB 3S3JA 1TJHH 2K7PA 4P5MA 4ZXBA 1MRDH 4G8FB 2Q8BL 4WO4B 4OZHE 3I3BA 3B5TA 5HI4D 3LEVH 4P2QA 1TJGL 3P73A 5JPMB 3VDBA 1S7WB 1FFNB 2WLZA 4KGLA 4NZUH 1OTSD 3ARBD 5JDJA 2VAJA 3OPZL 1JNLH 1QA9A 3DVNA 4HUMB 5CEXA 2BY2A 1PYWA 2Y23A 3JTTB 4PJCF 3UJIH 2C26A 2YZ1A 4IRZH 2WWKO 5E94A 1VGKA 4UILH 3VWJA 4HUWB 3QEQE 3RIAK 2OTWB 3QFDA 3QXVA 4XCFH 4K8RL 4O02H 1BX2A 4OZGB 1Q1JH 2BVUA 4NYLA 1YNKL 2B39A 5MI0C 2NX5D 4UDUA 1MJ8L 3RNQA 5CIPB 2AJVL 4JM2F 4U1NB 5EU6A 5TF0A 5J1SC 4WI3A 4WWID 3V0VB 3UPRB 4K3DH 1QFHA 3CLFH 3IU3B 4LSVH 1M7IB 1UCBH 3SDCB 3OHXB 1A4JB 2Y7QA 4M6ML 1L7TL 1N6UA 1UB5B 3EZ8A 3GNMH 2FX8H 3H3PH 1L7IL 5IV2A 1B4JH 5I17B 3GIVB 1KB5B 2UUDK 1ZAGA 4NQDD 3IXTB 2IALB 2CLZB 1NC2D 5DK0A 1OP5H 2Y9RT 1NSNH 4LCIH 2CK0L 5T5NF 4OQ1A 4NC0B 4KKCC 3ULUF 1UVQB 4L4JA 4HS3B 4LOUC 4XNZC 3OKEB 1IGYB 5T3XH 4NKDA 1A7OH 4JLRB 3VXQB 2MFNA 4IMKA 2KUTA 3BWAB 1U92B 1HYSD 2NXZC 1NUDA 4P2OC 1R5IA 4U7KA 1WZMA 3L5JA 1K4CA 1K8DA 2ATKB 4CAGA 5C0IA 3PABB 4JN2A 3FONB 2H2SD 1FFQA 4X83A 3CCHB 4NM4L 3ZO0A 3OKLA 3PNWB 2WBJA 2ZSWB 1DBBH 3HE7D 3SGKC 5CLTA 3T1FB 4N0YL 3C6SB 2C3VA 5C0AE 4OSUH 3CVHB 3OB0K 3IT8D 5EULV 3WXWL 5EU3B 3QXTA 4NZJA 4ONGH 3RWEA 4WFGE 1OAYH 3GJFH 2GKIA 1FH5H 3OKNA 5AZ2H 1IVLA 2H26A 3GMOB 2J4WH 3B5HA 1MHHA 2NYYD 4O2CB 3CH1A 1INQB 1ZLUK 4Z7UE 3W2DH 1I3GL 2A77L 2XRAL 1CYGA 2DQCH 3WDIA 2DBLL 4TSBL 5DD5L 5KSUA 1PY4A 2Q8AH 2PW2A 5EO0B 1EERB 4JFQA 2DTML 4RAHA 3CFDA 1U8KA 5IFJA 3EYOB 2NTFA 4DKEL 2HKFH 1KELL 3RZCA 3GMQA 4FTVA 5JQ6L 4IRJB 3MUZ1 3AY4C 2R2EA 4M03A 2APBA 1C8PA 3ULSA 4PLJD 4P2RE 1AHWC 1N64L 1OAXL 2BSSB 3QUZC 2ZCLH 4DK3A 1AO7B 3L95A 3QNYA 4CL7A 3BP7A 3T2PA 3FB5B 1NCDH 3B2UC 1OSZB 2DIAA 4GRMA 4MZ3A 4UT6H 4WFHD 3OL2A 5I66B 2JELL 4PUBL 2WBWB 5D2LE 1PBYA 3QUMB 4A6YL 4QHNB 2D4DA 1QLFB 3F62A 5A3IC 1AQDB 4HV8B 4I0KA 2SEBB 3VXMB 5E70A 5ALBL 1UXWA 3NA4A 1I8LA 4IRSB 1JF5A 3WXVH 1RAMA 4HW6A 2KKQA 3GZKA 1MPAH 3QUKB 1OGAE 4P46A 3FB7B 1EVUA 1QFWH 1GGTA 4ONHA 4I3SH 4Z7VF 5IEKA 2E3VA 1A6TB 4JM4H 2YPLA 4AK1A 1MREL 3CXDH 1HHGA 3K46A 4JHWL 2MCG1 4MNHB 3GBLA 3K2UL 3QXAB 4FABL 3PJSA 2ESVE 4WI7A 3FMGL 3FZUD 3GSOA 4Y5VC 3AU1A 3EOBA 5DR5L 3ZDZE 3D39A 1AGCB 1J1OL 2UVEA 4ZODA 1TJHL 4DGYL 1A6ZB 3OTTA 4TVPH 5JHDA 5CJXA 4G9FA 3L7EA 4LLMB 3LEVL 2XOTA 4V2CB 4ZUUB 3RI5K 2Z8WC 3KPNA 4PJIB 3QRFM 3DV6A 1A7QL 5K9JH 3TIDA 4L8CA 4R6UA 5JPNA 3LKPA 1JNLL 1TXKA 1FFOA 3G6DL 4R0LA 1N6QH 4PBXA 4X6FA 5KVGL 2CLVA 3G5VA 1C16A 4LSRH 1FJ1A 2RCSL 2QADD 2RBLA 4JRYB 5BVJB 3ISWA 1RUAH 2I9LA 3VG0H 5J6HA 5LCVH 1IEHA 3P9WB 3GHBL 1E6JH 4YHLH 3MYJB 3MOQA 3QJHA 5E6ZA 1WJ3A 5M7QA 1JFQH 5BW7A 4I18C 2WM0A 1WAAE 3RIAF 5LWYH 2BHUA 4K3DL 1KENL 4LSVL 5I8OL 5B3JE 3LPFA 2A0LC 2YD8A 4QWWD 4OLUH 3H3PL 4GUPB 3MZGB 2J8UB 1KFAH 4BH7B 2DWDA 1XCQA 4BFIA 5INCB 4CRPA 3RY5A 4OD1H 1NSNL 4LCIL 1FVDA 4XP4H 1WK0A 3V95A 1CE6B 4PLNC 2JIXB 5LAXA 5C0GA 4LF3A 1ZT7B 4G3YL 3T1WA 2OCFD 1JVKA 3DETD 5LGHL 2VL5A 2NX5E 2DIBA 4P23C 3V52H 4TUOB 2NY2C 5MEOB 3PWUB 3VXRE 1U8OA 1NMAH 3QDJD 1TVBB 2F54B 5DJ6B 5FIEA 2BHYA 2YN3A 5D7LE 2NY5H 2FO1A 4TTGA 4LLWB 5J89A 4ZAKB 1LD9A 5IMLA 1IFHL 4OSUL 5FYKH 1E28A 3JWOC 5CEZD 3INUL 3Q3GA 4BUHA 4NJ9L 3IDGA 3ZYIA 5DRWB 2L4OA 3SJVE 4XRCB 5J06A 4X4MA 3W2DL 2Y5EA 5H37G 2HTLD 3PIQA 5GJTH 5CD5C 3EFDL 4G42A 3VWKC 3NZHL 5FV2A 2C4FU 2F19L 4P4RB 1TJIL 1C5CL 4L8SC 1KGCD 4DGVH 3WFCL 4BK5A 5ADPL 2CUIA 2CXGA 4XMKH 2IPUG 5ALCL 1WITA 4HMCA 1MCQA 4JFEE 1EEZB 1VFBB 4ZDHA 3T8XB 2QQKH 4MA3B 2IBZX 3T2OA 1WF5A 1A6AB 2JJWA 4OZIF 2PYFB 4Y4HA 3GMLA 1F42A 1RK1B 2IANB 5HI3C 2F53B 2LU4A 5D2NE 3TN0B 1P1ZA 5D71L 1MH5A 2DWEB 1F4AA 3K4ZA 1M71A 2QR0A 1KIPB 3OJDB 3MLSH 3SO3C 5I8CB 4C56E 5I76A 2JF1A 2PW1B 5JHLH 3VXSA 2AGJL 1M05B 1UYWH 1HKFA 5AYUL 1NANI 5EPMB 3T65A 1FFPB 1IKNA 3OBAA 3PP3H 4OCRH 4HKZB 1JGUH 1S7RB 2HLFD 4RSVA 4OZFB 5D8JH 4QRSA 3M17A 5E2JA 3TVMA 1LILA 1S9WB 2EDYA 5GS3A 5I8EA 1A1OA 1YUHB 1MWAB 4IHOB 5D1XA 3BXNB 1BQSA 5JMRA 5F9OL 2FWOB 1I8KB 3MV01 1DN0A 4AENB 1SBBA 3OKYA 4RIRA 1S9YA 1GL4B 2ZWLT 3MGTB 1CZ8H 3RWHB 3DX6B 2OJEB 1GZQA 5IHUH 4OF3A 4MX7B 4UQ3B 4F7CB 4P46C 4QWWC 1CXHA 1QYGL 5MEND 4PG2C 3T0EA 5SWQB 5JNYB 2OMNA 4FQCH 1CBVH 3QH3A 4DW2L 4X6CE 4XBPB 3REVB 2W9LA 4OIIH 5BS0D 4FXKA 3T2NH 5C0DB 3BKYL 4L3AA 5FKPB 3RP1A 1CFSA 4LL9A 3S36H 5K9JL 3U83A 3FQXB 2VXVL 1F3DJ 1IKFL 1NEUA 2NY1B 2XZAH 5BRZE 3DHMA 3T3MF 4NNYA 1N6QL 5TGBB 2DDQH 4KHXL 3RI5F 4Y1AB 3EZJB 1EMTH 4LSPH 3EYVA 3ECBA 1VKXA 4HZLA 5DJXB 5EO1B 3VG0L 2QQQA 4KV5F 2BNRA 3LS5L 1ZWIB 5DHYA 5CD3A 3T4AA 1JFQL 4R0LC 4QOKD 1B0GB 3C87A 4FFWC 4XBGA 1ZLWK 2BC4B 4P3CL 5E8PB 3MV9E 5FF6B 4L8BA 2JB6A 5ITFB 1K9TA 1KFAL 3EYUH 3U9PL 4LVOC 4OFVA 2FBOJ 1KJ2L 1KEGH 2GSIA 1Y0LB 3DRTB 3QJFA 4A6YA 3MRCA 3RVTC 3TJEH 3PGCB 9CGTA 1U8LB 3QPQD 1DBJH 2R2CA 3I3DA 4MQTB 4PRPE 3ZLQC 4OGXH 1XGUA 5C07A 3KLHC 1CIDA 5K59E 4L3EB 2MJWA 3BD5A 1UKTA 3ARUA 1P2CB 5DJCB 1K8IA 4KJWC 3U2SB 4FQLH 3C9NA 3DUUB 3OGCB 4WUUA 1C12A 3BH8B 1GGUA 2PR4H 3NAAL 4X4YA 2NY5L 1MJ7H 3W9DB 1SJHA 2E7HA 4Q2ZA 3LKSB 1B2WH 3C8DA 4YHYB 1FG9C 3OJ2C 4FNLH 2EYRB 4HFUH 3TZVD 1KPUA 2DLFH 3MA7B 1JZ4A 3TIEB 5E6IC 5FO7A 2EXYD 3LOWA 3EKCA 2C3WA 5D9SA 5GS2H 1YNTA 3ILQC 4F9PC 2AEQL 3BGMB 3T08A 3IDJB 2OSLA 5D7IE 1C7TA 4Z7WE 2AEWA 2R0LH 3ALXA 2LV4A 3VFVA 4LPWA 2EIBA 4HX1B 5J11C 1T1WA 1HOCA 4PJ5E 5FUCC 1DVFA 3V6FA 2QHRL 1CFTA 4POZD 3KLAA 1CFBA 3KPLB 1RFDL 4XMKL 1D9KA 4ZUWB 3W0WD 1A5FL 5C0CD 3H42H 3KXFE 4F3FA 1T3FA 3OR7A 4KJQC 2QQKL 4YK4B 5I15L 5TPWH 1TZHB 3TBTB 4JANB 1V7NH 3UPCA 1RY7B 4PRNA 4JVWA 3WIFA 1T0MA 3FFDB 6FABL 4HWBH 3CFIC 3T4YB 4WWKC 3VFPA 3GSVB 2W0KA 4LPCA 3QDMD 2V2TB 3MLSL 4QHKI 1FVCA 5J12C 2W60A 5JHLL 5JDSA 4KRNA 5EUKB 2P7TB 5TFSL 5C0BA 4Y4HC 2PCPA 3QQNA 2B20A 3QG7L 1EXUA 2QQNH 4K8RC 3U4EA 2VDPH 1EIBA 4Y4KD 4F7EA 4LCWE 3WFDL 2XPGB 5C70A 3WE6B 1BGXH 4NN5B 4PJGA 4C59B 5IMOB 4BELD 2PXYB 5C71A 4N90D 4DUVA 4TTDC 4XWOD 1CDYA 5IBTH 1F45A 2CRMA 1D3CA 5KS9E 3HCVA 3TH4T 1W72B 3WEXB 4MJIA 4YHKL 4PJAE 4EUPG 1NAMH 3U30B 4D0BB 1I4FA 3G9VA 5DS8A 5E4EC 2GJZA 2X1PA 5FGSA 5C9JB 1KIQB 2PYEA 1UJ3A 3MXVL 3U4BH 3L3OB 4KROB 4NSKA 2R1YB 4AIZA 4JY4A 4HCRA 2JCCB 3RVUC 2YSSA 4RMWA 5T1DL 3SE9H 3TVMC 2W0FB 3VE0A 4PLOB 3V8OA 5INDA 3BRGC 3OJVC 5DDHB 5D1XC 4Y5YC 2AXGB 2EDQA 3SE4A 2Q7NA 4FMKA 5ESVA 3MNVB 3QHZL 4PRIA 1AJ7L 5B4MD 1CI5A 3EDKA 2VR5A 4FQCL 3ARYA 2OP4H 1KJMA 4RMVA 3T2NL 4ODUA 4R7NB 3QUXB 3RKPA 5C09E 4M7LT 3JWNC 1EGJA 4LSQL 4MA8L 3BP4A 1ZHNA 1SYVB 1J1XH 3SN6N 1PX4A 3DLQR 4M5YH 1CK0L 3HZVB 1LO4H 1OAQL 5IW6B 3FO0L 3MCG1 3Q6GH 1CFQA 4ISVA 4NN7C 5E08L 2ICWJ 3B9KB 5GIRB 5IHZA 2ADGB 3HZMA 2BY1A 1UH4A 2EKSA 3VFWB 5IB2B 1BVLA 1Z9MA 1ZGLB 5DEGB 5CJBA 5E2WH 1U3HB 1GIGH 3GSXB 5F3BA 3GJEB 3S8WA 5E9DB 3P11H 2B2XL 3O8XD 4KKBD 3WUWB 5T3XD 1TETH 3CD4A 2P24B 4QRRE 5K9KA 1D5BA 1WBZA 2IC2A 4HF5H 4YX2H 4PV9A 4DOHE 1S9KC 1I1AB 3EYUL 3FQRA 1P5UA 4GG6A 4CADB 4XZUB 2YUWA 4G6KL 3EJZD 1QLEL 4WU7A 4HJJH 4YHNA 2KZWA 4K7PH 3RWCB 1U3JA 1P84K 3FRPG 2H9GA 3RUGA 1UACH 3S4SG 2CO7B 43C9B 2YD4A 2BRQA 3QZWB 5CGYD 4BFEA 5GGUA 4C83B 3ZDXE 1NCAL 3G6JB 4KDWA 1IAIM 3DXAE 3ME0A 2IBGA 3LV3A 1LEIA 2BVOB 3QIWD 4KZEL 2XWJA 5JLZB 2AJYL 2X89D 2YKLL 3FOMA 3HG1D 1N59A 1MJ7L 3K8KA 2X44D 2GI7A 4OI7A 2AV7B 4UAOC 4HUVA 4D2NA 3L3JB 4FNLL 4RAUA 1SJVA 3EDEA 4KQ3H 1H0DB 2R9HC 4KZDH 1SEQH 5DJAA 2BVPB 4U49A 4X9IA 4WW2F 4DZ8B 2W59A 5GZOC 4G8GE 4OZHA 3MV8A 3BHBB 3NACH 4NZRL 5L2KB 5EUOB 2APWA 4N1HB 4UINH 4Q9QH 5HPMB 1EHAA 1OAUL 3EW3B 3O3EA 5EA0H 1KB9K 4TQEH 4X7TB 5HHMD 5EH1A 3MV11 1DQLH 3AXLA 3Q5YA 4ONFH 4RZCA 3V4UL 3SBWA 3ARRA 1PSKH 1U8IA 4KQ4L 1WWWX 2B5IC 4OF5A 2CKBL 3RWIB 5DJDB 4OFYA 1F3JB 1JPFB 2AXFB 4PJ9A 3EDFA 2NY4D 3QEQA 1WLHA 3DURB 3GFUA 3NA9H 3I6KB 1V7NL 2G75A 5IESL 2VLKE 4I2XE 5C92A 2Q20A 4HWBL 2X2YA 4NQVB 1MJJA 4RGMC 3KHQA 3I75B 2R0ZH 1U93B 4LIQE 1XGQB 4FQXC 1R3KB 5AZEH 3H9SD 5F88A 3W0WE 5HTSA 5DD6B 2IPUK 2BY0A 4HUUB 4LASH 5DD1H 1V7ML 5LBSH 5D1ZB 4PD4J 1AR2A 3MJ8B 3RWJB 2DLEA 4QHLB 4NWTL 4GG6F 4WRLA 2I25N 4N9OB 2X7LA 1NL0L 2KQMA 1LNUA 4LLQA 2CMRH 3ARFA 4JPVL 3LD8B 2Z93A 4TVPD 12E8H 4LLDA 4C58B 5FO8A 1Z2KA 4QRPB 2HRLA 5HGHB 3Q1SH 4PBWD 2IQAB 4J3WA 1YEKH 2OR8A 1WBYB 3JXAA 3MO1A 4LAJH 4JN1H 2FR4B 4G6MH 5CP7A 3OKDB 5GS0L 2FGWH 5GZNC 4D9LH 2CRYA 2HJFA 2VDQL 3UYOD 3MRKB 1P4IH 3GEWB 1AD0A 4DEPC 4KK5C 1ZS8B 4DWHA 3C60D 1K2DA 5IFHL 2NW3B 3NFNB 3O2VH 5FYLE 2JJSC 1V3KA 3ZTJG 1ZSDA 1G7PA 5IQ7H 2NY3B 5ETUB 2V5SA 4FS0A 4HWUA 5HBBA 4P4KA 1HHKB 4ZO9A 4HKXB 3PWPD 2W91A 4M5YL 1TITA 1TDQA 3IFLH 4J3OC 5DQJA 4JGMA 4XNYH 3VFTB 1TQBC 3SDDC 1XZ0B 3L3DA 4NFDA 1JPTL 3P4OA 2YD1A 1HI6A 1CGUA 3BEVB 3WN5B 5DFWH 1DFBH 1MQ8A 3HMWH 1BM3H 1PVHA 2C3XA 5DYOB 3D48R 5TDNB 3N06B 3VH8B 2EYSA 2MCPH 3P0VL 2Z92B 1CD1B 3FFCB 4H0GA 3TYFB 1XGRA 4KI5F 4WU5A 5IOPB 5E2WL 3QEHB 1J0ZA 2Q76B 4ELKA 5I1AB 4HLZH 4NCDA 4U1JB 2NZIA 4NFBA 2V2XB 4NBXB 1JHTA 3C5ZB 4EIZC 2P5WD 1CIUA 1TETL 1EDQA 2ZUSA 3BVNB 4NO0D 4HF5L 5L8JB 5HHOB 5D2LA 1F11B 1PG7W 4L3CA 4G43A 5FECA 5I71B 3X11B 3FQWB 3RWFA 3QIUD 2X4PB 2XTJB 3LH2H 3RTQC 1XT5A 2YMXH 4G9DA 5ENWB 2OXGA 1DUZA 3BAEH 4PJCB 3S7GA 4JO4L 1PQZA 4K7PL 4AT6B 4YXLL 3BRFA 3FN3A 3MRIB 3L3IB 3QFJB 1TZGH 4LHUD 4O4YH 5KN5A 1V5JA 1RMFL 1Z0NA 3HE6D 3TO4C 4JRXA 1T20B 3QUZB 1J0JA 3VD3A 2EH7L 5I1GL 5HGBA 3LS4H 4V1DB 1JNHB 5FYKD 1MFDH 1DL7L 4X99B 5K93A 4Q97A 2VDLH 3QUYA 2OQJA 4OV5A 1EAPA 1UB6B 4PJ7A 5T3ZE 4OLWL 3ES6B 3UC0H 1IEAA 4U6YA 5F89B 1YMME 1IGJA 1U2CA 4KQ3L 2ZJSL 1NGYB 1SEQL 4EI5C 1KLUB 5A2LH 4E5XA 3AREB 4X9HA 1XF2B 3QCTH 4RGND 1I9RL 3VG9C 2FBJL 3UO1H 4YC2C 4KK9C 2DQHL 5F9JA 2BCKA 4PJBF 2RFXB 4OCSH 4EBQH 1FNEA 4DVRH 4NQCA 3EOAB 3KPQB 2E9IA 3WS3A 1DQLL 2AS5M 4M7JL 1H15A 4WDIA 4L1DA 1CF8H 3MJ9H 3IGAB 2IBZY 1GGBH 1OM3L 4B53A 4XXCA 1MCNA 3QO0A 2FB4L 1JF6A 3H9HB 3IFPB 2YS4A 5HYQA 1MHCA 3VXPB 1GGIH 1KLGA 4LCCA 3V2AR 5C0JB 4OLZH 4ZPTA 3FKUS 3MLUH 4LLVB 3VRLE 3PV6A 4ZSOA 5SV4A 4QEGA 4OZGE 5IJVA 5DJZA 4U6HA 4U0QB 4NO2A 2BOBA 5JW3H 1NDGA 1ED3B 1JZ3A 4FMFA 4NKIL 4OM0L 5F9WC 2QKIB 5IBLD 2B1AH 2RB8A 2PO6B 2QSQA 5LJYH 4ZXBB 2GITA 3P9LA 3VFSA 4P2QB 4LASL 3RRQA 5DD1L 3P73B 1F97A 2V9QA 4HFWA 3ET9F 2GJJA 2NX5A 3DVNB 1FL5A 4ERSH 5D93C 5CEXB 4JQIH 3AUVA 2P47B 1PYWB 2WZPD 4ODHH 5HHXH 1ZANH 5E94B 1VGKB 2AJUL 3VWJB 3VXRA 2BVQA 1RV6X 4XP5L 3QFDB 3ARDC 1DQQA 4ALAL 4QTHA 4DVBA 2BSRA 8FABA 1LGVA 3CJJA 1K6QH 4NQDA 3SCMD 3WBDA 3V5KB 1G7IA 1CS6A 4JHZA 4H88H 1D6VH 5ITBL 1W0WA 4IDLA 4KFZC 2QJDA 1U8PA 4UDUB 3RNQB 5EU6B 4G6ML 4PJ7F 5KAQF 3RVWC 3VW3H 1FVEA 1DANT 4Y4FD 1A3RH 5FYLH 4KJPD 4ETYA 4FQJH 3UROR 4S1DD 3SJVA 3U82B 2F5AH 4KMTL 5IV2B 4BFBD 1JTPA 3MUGA 4D9QD 3CPLA 5E8DH 5IQ7L 1EO8H 3F7VB 1WZ1H 2NY5C 2A6KA 1KCVH 3NPSB 4RBPK 5EO9A 1OD9A 3RY4A 2C1PA 4Z9KB 3Q0HA 3HE7A 1RK0A 1EX0A 2H1PH 4NKDB 1FYTD 4GKSA 4XNYL 3OMZA 1G6RA 2BHZA 2I9TA 1KJ3L 4JFEA 1EJ6A 1S7UA 2CKBA 4OCLC 2O61A 1R5IB 2XNAA 4WENB 3QDGE 3HMWL 1K4CB 1K8DB 1R24A 3O6FC 4XNUL 1G9ML 3FT3A 3OKLB 2WBJB 4IBLT 3ZYZA 1RIHL 4KAQH 3JUYA 1ERNA 3T0AA 4UUJA 5EN2B 3QQ9D 2GY5A 4NGHL 4O2FA 3VFMA 2C3VB 2P4AB 1AO7E 1A64A 4MQXC 4PY7A 1FORL 1OPGH 3RX7A 2HA1A 5KSAD 3OKNB 3VA6A 3WFEH 2H26B 5ESQA 5TDOA 1MHHB 3VMNA 4EN3A 4GRWH 1LDPL 3M8OL 1J7VR 3FRUA 4ETQA 1Q9KA 4O4YL 1TZGL 3LZFH 3DNKA 5KSUB 1RURL 3VXME 2PW2B 2XYCA 4MS8D 4HSQA 3O0RH 4JFQB 2NY6D 3RKDD 1G0DA 3CFDB 4FZ8H 2QSCL 1F4YL 4A2MA 3RZCB 4HUNB 3GMQB 1BF2A 3PV7A 4FTVB 5GS2D 5E03A 2IFFL 2P42B 5GSVA 4NO3A 4RWYH 2R2EB 3DIFB 4FXGB 4BQ6A 3NIDE 4GRLD 3ULSB 4Q9RH 3HC3L 2COQA 4FN0A 3EFFA 4WHYH 3L95B 3QNYB 2ORBH 1QVOA 3BP7B 3ZL4L 2Y06L 3EHBD 3LAFA 3QUYC 1QPXA 4U6XA 1WV7T 3KVQA 4GRMB 5JZ7D 1RZJL 3G6AA 3DVIA 3VI3F 1IC4L 2GT9A 4H8WH 3QQ3A 4EBQL 2GTWA 1HNFA 4EUPA 4YFEA 1JK8A 1A9EA 2IAMD 4PJIE 1V8HA 1JI2A 1UXWB 1PLGH 1A14L 1U41A 1OTUC 1S3KH 2R4SH 5DK2A 1BWMA 2DQUL 3BZEA 3MA9L 4JFDD 4FFYH 2P8LA 5FOJA 5IEKB 2Z35A 4OLZL 5HVWA 2ARJA 3MLUL 3GMRA 4U1SB 3VD7A 3WIIL 1P4LA 1YEFL 2MKLC 1HHGB 4LVNB 1MCOL 2B1HH 5EOCJ 5CIPH 1HSBA 2BNQD 3PJSB 2D7TL 4LIQL 3AU1B 3ETBF 3BYYA 3EOBB 1E4XH 3D39B 3MV9A 3UTSD 4B0MM 3NFSH 2ZUQB 4MCZA 4IM8A 4O5LH 5JHDB 1A9BA 1Z5LA 5CHNA 5EBLA 4JY5H 4G9FB 3L7EB 1JYXA 4L29A 2J8UE 5JIHA 3DROB 3DECA 3PWJA 5TF1H 4MXWL 3KPNB 4N5ED 4R26H 4HBCL 3DV6B 7FABH 5F7MC 4L8CB 4PJ8C 2NR6C 4QCIB 3WL9A 4WHCA 1LVEA 2VLMD 2VLLA 4Y2DD 1N5YH 1NLBL 2OI9C 5JPNB 4JQIL 1FFOB 4NDMA 3I84A 4I0PC 4R0LB 4OZIB 2ZZUT 4X6FB 5HHXL 3MBED 2QQLL 3NCMA 3G5VB 1AD9A 1C16B 2HFTA 1DSFL 1FJ1B 2OXHA 4XPGH 1OD7A 1IAKA 4HC1H 1EJOH 5J6HB 3GK8H 2O5YL 4MD0A 3QJHB 3AAZA 2PN5A 2OL3H 3CVHH 2VL4A 3QSKB 3JWDH 1K3ZA 2WV3A 1TTGA 2CKNA 1FNLA 4BZYA 2P8MA 5FYLL 5HGAB 4FQJL 3FRPA 4PJFF 5D7IA 3S4SA 1QBLH 2DWDB 4TSAL 4XHJD 3M45A 1XCQB 4BFIB 2AXJA 4K3HA 1EHXA 3QDJA 2EIEA 2XKSA 5LAXB 2ED7A 3ALPA 4LF3B 3CSYA 3BKJH 1H5BC 2J7LA 5H2BA 2DMCA 3T3PE 3MV7D 1YNLH 2VL5B 2CLRA 1E6OH 3VFUB 4GKZA 5L9DH 3RDTB 3VD4A 4F57L 1U8OB 3PL6C 4UIMA 5DC0A 5EWIL 4Q7DA 3D5OF 5ILTH 3HMXL 3HNTH 4X80H 1U6AH 2XXMB 4NQEE 2GK0B 4XVSH 1LD9B 2IANE 4M7ZC 4QF1A 1MY7A 2F53E 3PWLA 2AQ2A 4HEPG 1E28B 1P6AB 4APQD 5JZ7C 4UTBH 4WFED 3Q3GB 1IE5A 1F3DH 2YD5A 2IH1A 3IDGB 3WFEL 5BV7B 4PGJA 3TA3C 4TYUA 1VGEL 4BJLA 4LHUG 5D2NC 4JFYA 4JCLA 4RMTA 5GS1A 4LLYB 4M8QA 4LDOB 4ODTL 4G42B 3NGBB 4H1LH 1YPZF 5KS9A 4R7DA 4QXUH 1AFVL 2C1OA 1WWCA 1UJTA 1VPOH 2A9NH 4PJAA 4P9HH 3TYGH 5T3ZL 1CLCA 4JFHE 3HAEH 4ZDHB 4HK3J 1UEYA 1BOYA 4RWYL 3V8CA 4OGAD 3GMLB 3AB0C 4MDJB 4Q9RL 4R2GB 3WFHA 2FL5A 5I1DA 1P1ZB 1MH5B 1HWGB 1M71B 1DQJA 2QR0B 5JW4R 5JTWA 3RY6A 2Q7YA 4PRBA 1T66D 5L8KB 2IADB 3BEWB 5I76B 2VNCA 1UWXH 3DSFL 1XGTA 4DN3H 5L2JA 2LVCA 2AK4E 3T65B 2J8HA 1T03L 3SQOL 4GBXD 1DQDH 2XA8H 3M17B 5F7DA 3SGDH 2MMXA 1U8MB 1ZHLA 2G5RA 3GKZA 4JG0H 5GS0C 1MCIA 3TVMB 1IQWH 5GGVH 1OVZA 5I8EB 1A1OB 4TUKH 1F58H 3BYTA 5MENA 1F3RB 4Y1AE 4QRUA 1DN0B 4RIRB 1PZUB 1S9YB 4TOYH 2A6JA 3WHXB 5DJ2B 5F7KC 2I60H 1K85A 4PB0H 5HI5D 3SY0A 5D6DC 2F8OA 4FRWA 4BZ1H 2Q86A 4Z95L 3ZKXC 4JO3H 1AGDA 4QRRA 3IJYA 4WI2A 3T0EB 3IB4A 1KB5L 1R3JA 3HPJA 4ODBD 4O5LL 3QH3B 2YBRA 3WV0A 1ADQA 3SOBH 2E6PA 5TF1L 4J2XA 3WNLA 1CFSB 5M95B 1UWEH 1QRND 4KI1A 4NO5A 3L3GA 1LO5A 3DUHA 1JN6B 1GC1L 3GHEL 4NUGL 1HHIA 4QOKA 4AM0B 4NNYB 3F7QA 4PGZA 3DXAA 4KJYA 2NXYC 4M1CD 3IJHA 4YDVA 5DFVC 1FIGL 4JG1H 4L3EE 3Q5TA 3ECBB 3GMNA 4HZLB 2Y36L 5GRZA 1EJOL 1PG7X 5DWUH 32C2B 5DHYB 5CD3B 1X7QB 2EO1A 3T4AB 1FNSH 3MODH 2DI7A 3HFMH 1DEEA 4K07A 2E9JA 3I6LD 1FPTH 2J2ZA 4LSUH 4IJ3C 1Z0MA 4MXQC 2NTSP 4I4WB 4XBGB 4YZFF 1LMKA 3PWNA 1IBGL 2JB6B 2R4RL 4L8BB 2APXA 2YEZA 5ISZB 1L0QA 1Q72H 1IJ9A 3BZ4A 2BOCA 2HRPL 3MBXL 5FYJD 4XPTL 5FHAH 4DKFH 4WJ5A 4RFEA 1JRHL 2GSIB 4Z7OE 1H9VA 3QJFB 1S9XA 4A6YB 3MRCB 3BIKA 3FQNA 4XC1L 3T0BA 1WZKA 1MCKA 3DBXA 3I3EA 5KANG 1XAUA 1XGUB 5C07B 2NPLX 5EZOH 5D7JD 2NY0D 3GI8H 4GXVL 2D2OA 4OZFG 1ZA3A 1OCWL 1K8IB 1K4DA 1DE4B 1NDMA 1IARB 1MCEA 3V0WH 5HVHB 1A7PH 5KSVA 2YK1L 2H2PD 4GAGL 1AC0A 1C12B 5GGTL 4X80L 3F7RA 4X4YB 1SJHB 3HI5H 4G6FD 2AK1L 4L9LA 3BT2H 3FO9A 4MAYD 1CDHA 1ZV5A 3OX8A 1KPUB 2OR9H 5C0RL 4UTBL 1UA6H 1I9EA 2CDGB 3V7AG 2XT1B 5D9SB 2BY3A 2HFEA 3W0WA 1KSRA 1FBIL 5C0CA 2VERN 3QUML 2VMFA 3C2AH 1VFUA 4I5BA 1JL8A 1XMWA 5HJ3A 2ZOKA 3VFVB 1OP3H 1CGWA 3QBTB 5D5MF 1MRFH 4ODWA 3K0WA 1FFRA 1T1WB 4XX1G 4YLQT 1HOCB 4HIHA 1DVFB 1H8SA 3TBYB 1MWAH 4PYGA 2XZQH 2MHAA 3D25A 3KLAB 1Q0XL 3ZDYE 2A9NL 3KS0H 1D9KB 3MLVH 4JDTH 2K1MA 1NGPL 4Q9CA 4F3FB 3OR7B 1JTOA 3QI9D 2VXSL 1YJDL 5HI5C 5KVMC 4OF7A 3MRRB 1VFMA 2AABH 4M7LL 2X4RA 3CSPA 4PRNB 3WCYA 1FO0A 3WIFB 1CQYA 4J1UB 3O4LE 2KDGA 3OAYH 3VGAC 1H3GA 3VFPB 2DQTL 4XCCH 3H7BA 2JCCE 4QHKJ 4ZD3L 1A7RL 1QSED 5IJKA 1FVCB 2XTLA 5DA0B 2W60B 3HC4H 4MB5A 5JDSB 3K8LA 3CSBA 5C0FA 5C0BB 1KOAA 4JJ5A 2PCPB 1RJZA 3VD5A 4B41A 1EXUB 1L6XA 3BPOC 3GJFK 3KPRD 3U4EB 4M4RA 4ZTPL 4F7EB 1DQDL 1ZMYA 4Y19D 3RU8H 5MP6H 2DAVA 3HB3D 1S9VA 3TT1L 2LAGB 2DJSA 3W11D 4JG0L 4U6VH 4OF8A 1IQWL 5GGVL 3JTSA 4TUKL 4M1CC 1AR1C 3HCVB 5IFAH 3CZFA 4R90H 5FYKU 1I4FB 3L1OL 5DS8B 2GJZB 4JDVA 2PYEB 1UJ3B 5GPRA 4DTGH 4NSKB 6CGTA 2OZ4H 4U3CA 1SVCP 2CIIB 4JY4B 3QIBB 1SEBA 3VE0B 3HPLA 5I9QC 4KRPD 3HMXA 1B4RA 1YQVL 3J8F7 1DBKL 3B83A 4M6AA 2FEEI 4LU5H 4M43L 5ESVB 4PRIB 5E9DE 3L6FB 2I07A 1CLYH 4XCEA 1INDL 3TP4A 4NHUB 3RJDA 4NC2B 4OCXL 4QHMA 1KJMB 2LU3A 4I48A 4G5ZL 2DJUA 3RNKA 2G5BB 1G9MC 1MJUH 1KLFA 4PRAB 4W68A 1BJMA 2ADIA 4U1LA 3IF1A 4XVUC 3WS6C 1ZHNB 2DYPB 3QAZC 1CDCA 1T2JA 2G60L 4AIXA 5I19H 4PS4H 5IVNA 1T6VN 3HRZA 3B9VA 5AUMA 3O8XA 5IG7A 3OF6A 5K9QG 4JFFD 1CFQB 4WW1B 3G6JE 1NBVL 5IHZB 4MNGA 2V7NB 3SDAD 3HZMB 1A7NH 3FL7A 4X8JA 3MODL 4NOBA 1BVLB 4RNRA 5DHVH 3MFGB 4N8VB 3GO1L 1BVKA 5F3BB 3AC0A 1F4WL 3BPCA 2W0PA 1T7WA 3IRPX 5AG8A 2YD6A 1I9JL 1D5BB 1WBZB 2CK2A 1BHGA 4PV9B 1NCUA 1T2QH 2WIMA 3FQRB 4GG6B 2O5XH 1NGQH 4J4PD 4JFZH 5EUOE 3DX7A 4RCAA 4DAGL 3ARTA 2IMMA 3QIWA 5BVPL 1FFNA 4WU7B 2DF3A 3BDXA 4YHNB 1OARH 2EH8H 3HG1A 5F44A 2WAHA 2UZIL 1B6DA 1I8IA 3RUGB 3R8BB 3IU4L 1YEDA 2ERJC 5GGUB 5FDWA 4NT6B 3FAWA 1A47A 3KPOA 2IEPA 5BZWB 1RZJC 4CMHC 3LV3B 1LEIB 5C0NC 5E99H 2XWJB 4OZGA 5C0EA 4CU7A 1QKZL 5F9AC 4OF0A 4HUVB 2YPVH 4KVCH 3JV4A 4JDZA 4RAUB 1RZGA 4OQTL 3O6MH 1U95A 3V0VA 3UPRA 3CFBA 4U1MA 2EDWA 1CDGA 1CXFA 4XNXH 1R3HA 4OZHB 3MV8B 5CBEA 5HHNA 4WFFE 1C5BH 3GIVA 1KB5A 3GSWA 3IXTA 4LNRA 1N4XL 4GAFB 1LEGA 4OT1H 1MRFL 1WEJH 4YBHA 4NQTA 5BMFH 3AXLB 4PB9H 4RZCB 1MWAL 1QUNA 1KCRL 3KPSD 1IM9D 1W72H 1B0RA 4JLRA 3SKJL 4PJ9B 3F12A 2DKSA 4PPTA 1FV1A 2FD6L 1O7VA 4ACPA 3GMMA 3RWDA 4WO4D 4EOWL 1Q9OB 1NGZA 3H9SA 2G75B 3PABA 2EE9A 5T33H 1HWHB 2OBGA 2FYYA 3CCHA 4LVEA 1NKRA 5F7YC 4UT7H 4QRPE 4NKMA 1CDIA 4LRNH 1MJJB 4P49A 2XKNA 4M93B 4OGZA 4AEIH 5ERWA 3HC4L 5IMKA 2E6QA 3K4AA 3RA7L 4UIKH 2AJ3B 5F88B 2ADJA 3RVXC 1INQA 1JV5A 3T2QA 4TUJB 2GTZA 4OLYL 3FQUB 4PJHA 3NIGE 1MY5A 3KWWA 4KHTH 3MNWA 1A6VH 4R90L 4JHAL 1MUJA 3BQUB 3QDGA 5DQDH 1OQOA 3B9DA 2X7LB 3BSZL 4DQOH 1LNUB 3QEGH 3ARFB 5FFLA 1M4KA 2ZP0T 4LARL 2Z93B 1FSKC 3C60A 5DRNB 4FFVD 1E4KA 1WICA 3X3FH 4LLDB 3BJ91 4S11A 2RJMA 3BKCH 5FO8B 4CDHA 1VFOA 5KVEL 2VKWA 2R1XB 1LO2H 4HIXL 4DFIA 3V9FA 1BQLH 1NLDH 3FFCE 5GGTA 1AIFB 3RX5A 3MO1B 4F8QA 4M6NL 3X3GL 4XPHL 4YR6A 1CLYL 1I1YA 4OIAA 2HJFB 1YMHA 5DD0H 2RIKA 4MMZC 3RPKA 1LK3H 1K2DB 5KOMC 5HHOE 2D0GA 1FZOA 4NNXA 1ZSDB 1G7PB 1JE6A 2XTJE 4DJMA 1U8HA 4P4KB 1FDLH 1TPXB 1AGBA 4PJCE 3QFJE 3QNZA 3U46B 5DQJB 3MLWH 2AI0L 4PS4L 4Y5XC 3WDHA 1BJ1J 1TIUA 4WV1B 4M62H 1N7MH 1UXSA 4HUXA 4I77H 3LHPH 2P5WA 3L3DB 2DM2A 3P4OB 4RISH 3NVQA 1HI6B 4P9MH 4AEHL 4X6EA 4V1DE 3WO3B 4NQUA 5LGJA 5HDLA 3W81A 2IPTH 3QIUA 1XGRB 1KTDA 1LQSR 2WIIA 4WU5B 3L5XH 2EKJA 3MCLL 1Q0YL 5SV3A 3RGVB 2IG2L 2R0KH 2A83A 3PP4L 2W65A 2NQCA 1JHTB 1I7UA 3LVEA 4YHPA 4QTIH 3DMMD 5EIVA 1UM4L 3KJ4B 1T2QL 2O5XL 5JXED 4G43B 3RWFB 4Z0BH 4ZUUA 1K3IA 3ULUE 4DK6A 4G9DB 4PJIA 2BXZA 3CDFA 3B2VL 4KK6D 1I9IL 4HLZG 1PQZB 3U1SH 1DQTA 1J18A 5KN5B 5F8QC 4D3CH 4QGTA 3AS2A 3HNSH 3R1GH 3VGBA 4JRXB 1AP2A 4LGRB 5HGBB 3LRHA 2UY6A 4UBDC 1RZKL 5DMJB 4Y0GA 3JVGA 4YEEA 5ELIA 5AWNH 1SMAA 4OV5B 5E99L 1FAIH 1EAPB 5MHSD 4PJ7B 1I1RA 2Z31D 2FH8A 1IEAB 3G5ZA 2YPVL 4KVCL 4U6YB 3A6BL 5JOFB 3IDXL 4J3SA 1XF3A 4UV7H 3OG4B 1UZ6F 4E5XB 3SE3A 2N56A 3MLRH 3HI6H 1H8OA 3GBNL 1VEPA 3UXFA 4MLIA 4UTAL 1FNHA 1MCFA 3KJ6L 4Z8FL 5HHQA 5FUOH 2DQJH 4OKVA 4OT1L 5F9JB 2BCKB 1FNEB 4P2QE 4NQCB 2JIXA 4MJ4A 5BMFL 3WS3B 1H15B 1ZT7A 4WDIB 3O9WD 3ZHLA 1IAOA 3IDUA 3SDCC 2AKRA 3QO0B 5GSRA 4ZOBA 3FB6A 1MHCB 3UAJD 1KLGB 4LCCB 3O4OB 4GAYA 1N6VA 4PFEA 3OR6B 1TVBA 5DJ6A 3PV6B 4LEOA 4ZSOB 4ZS6D 4JRWA 5IJVB 5DJZB 5ADOL 4UT7L 5IVZA 4O58H 4U6HB 5FCUH 1PKQE 3MMEA 2DLGA 4LLWA 2BOBB 1NDGB 2EZ0C 3ARBB 2DI9A 1PG7L 3LN9A 5EU6E 4AEIL 1AGEB 4UIKL 2GITB 2Z91A 2ZUYA 1FZJA 4CMMA 3VFSB 1ZEAL 1RUKL 2J88L 4NZDA 1FL3A 3PDOA 4HPYH 4OLXH 3SPVB 1E4XI 3H0TB 4KKLC 3CX5J 5SWSD 3B8YA 2X9WA 3SCMA 1OAKH 4HFWB 5E2UH 5HDOA 5CGMA 5I16B 2NX5B 1FL5B 3JWDC 3C08H 4XB8A 4Z7VE 4YXKH 1CFVH 5E2VL 2VJXA 5I6XB 5DQDL 1PD6A 1EZVX 4LQFH 3VXRB 4XP9L 1JPGA 4N68A 2BVQB 4Y4FA 25C8L 2HVJA 4QTHB 1A6AA 2BSRB 3EJYC 8FABB 1CLOH 4NQDB 4NQEA 1ZHKB 4D9RD 2DM7A 1G7IB 4PJEF 1C5DA 3CMOH 2IANA 1QEWA 4PGBA 1W0WB 4K71B 5F6IC 1A21A 1U8PB 1WZLA 3WJJA 5LQBL 2AV1A 5FCSH 4K7PY 1NCNA 3MNZA 4OQTA 4LGSB 1OAZH 1FYTA 2X42A 1FVEB 3CDCA 4X0KA 1SBSL 2GHWB 3DHJA 3FT4A 4IRJC 1LK3L 1E4KC 3KNBA 3VXOA 1M05A 2AXHA 3CK0L 1F6AA 3CPLB 3EO9L 1FFPA 4EEEA 4WY7H 5LG1A 5JR1L 3LSOA 3VXUD 2F54D 1S5IH 1T80A 4MJ2A 5IROA 4OZFA 1FDLL 5EO9B 1R0AH 4ORZC 5T5NG 1YEGH 4M5ZL 2J6EL 4DUWA 2C1PB 2C4FT 1RK0B 3HE7B 4PJDF 3MC0A 1FNFA 5T1KD 4GKSB 1G6RB 3LHPL 2V9TA 1S7UB 35C8H 4XI5D 4P9ML 2O61B 2XNAB 1AE6H 1XF4A 1I8KA 5KSBA 5SWZD 1JRHI 2YA0A 3CDGA 3GSNH 4FTVE 4XTRC 3VFNA 3D3VE 4XMPH 3FT3B 3VFOA 3L5XL 4G6AC 4IRSC 3BUYA 4JQVC 1JPST 2H3NA 2R0KL 4UUJB 5B38B 5DMGD 3V7MA 4PY7B 4QTIL 5SWQA 5D70H 4YHOL 4N1CA 5JNYA 2AK4A 5GGSY 5LXGH 1YJDC 4H25A 3X13A 5TDOB 5ESQB 4TSCH 2HFGL 4Z0BL 4EN3B 2A9MH 5BQ7A 2WMPA 3BN9D 3FRUB 4ETQB 1Q9KB 3S35H 3FOLA 4GRLA 4MNQD 4D3CL 2IF7A 3LRSA 3C6LA 3FB8B 2D0HA 2C9AA 5CCKH 4X6DA 1MCJA 3OXSA 1Y6KR 4YFLI 5GRUH 3KYKL 4LLAA 4HG4K 3N1FC 3P0GB 1EFQA 2EDKA 3H6JA 3UTQA 3MSPA 2R69L 4GW1A 1REIA 2YD2A 1JHLH 4HULB 3RVVD 2JB5H 2Z0BA 4GW4A 2GSGA 2IAMA 3EFFB 1XIWD 1EVTC 1QVOB 1G0XA 3S5LB 5IMMA 3TESA 4X98A 4IDJL 4R3SA 5KOVC 1YC7A 1T4KA 5FUOL 3LCYA 5FYJU 4JFDA 1LO0H 5JHDE 1BD2D 2KQNA 3VFGL 3QQ3B 4G9FE 3MLYH 2GTWB 4AMKH 1B88A 4HPOH 4U05A 1G7MA 1HYRC 4EUPB 1JK8B 3HI1A 1A9EB 2AW2A 3KDMA 3NCYP 4JKLA 5FAAA 3H9ZA 4WHYG 2BNQA 1WIPA 3MX0A 2FZ3A 1F2QA 3WLWD 3UTSA 5DK2B 4OZIE 3BZEB 4ZG1A 2P8LB 3KPTA 2ARJB 2EDEA 3OGCA 3GMRB 3SGDI 1P4LB 2WUBL 1EEQA 5ICXA 1NAMA 4HIJA 4I3RH 5DJ0A 3I9GH 3LN5A 1HSBB 3T0DA 1CICD 2NY1D 3MUY1 3QRGH 1BIIB 4Y2DA 2EYRA 3MA7A 3VJ6A 5EU7C 3LKRA 4YNYB 4OV6F 1HDMA 4MCZB 1KYOK 3BGMA 4NRXB 4TULL 2MNUA 1A9BB 1Z5LB 2EDRA 3HTLX 1G1CA 3OZ9L 5CHNB 5EBLB 2AAVA 2D31A 3BD4A 1CL7L 4L29B 1DN2A 2XI9A 2QADB 4MWFB 5CILL 4OLXL 3QXDA 4ZAKC 3TT3H 2DMBA 5A2IH 3WL9B 1F5WA 2ICES 1J86A 2VLLB 4HT1H 4KUZL 3U0WL 3PDDA 2DICA 4NDMB 1WSST 3JV5A 4ENEC 3MREA 3JWOH 4U3HA 1HH9A 1AD9B 4R97B 2BVEA 1IAKB 3TBTA 2WSKA 3LB6D 3TBSA 3CMOL 4MD0B 5IWLC 3U6RA 5ICZA 3AAZB 1KCLA 1CVRA 4KTDH 4M1DL 4H5SA 1T21A 3DUSB 1OAZL 5DVKA 4C55A 3DYMA 2P8MB 1IGCH 1RZFH 3C5JA 5D7IB 2ZCKH 4PTTA 3S4SB 4RFNB 5C7XL 4JKPL 2QL1A 4GQ9L 2FEDD 3QDJB 3P30H 3TN0C 4FG6C 4M4PA 3UTOA 1MIMH 5C6TL 1DR9A 4RGOH 4XNMB 3CSYB 1A6WL 5IMOA 5DUPL 1IC5L 5T1LD 5H2BB 4R4FL 2HH0H 2HN7A 4RMUA 3AROA 1TENA 5I1JL 2CLRB 2YN5A 1FIEA 4KV5E 1YN7B 1AE6L 4GKZB 4XAWL 5GRVK 4G7YL 4UIMB 5GHWH 3O4LA 4FZEH 4JPWH 4P5TA 2BNUA 1MIEH 2B4CH 2H8PA 4YGVA 3FO2A 3PWLB 3RL1A 4F9LA 5FKAA 5HYJD 1V3LA 1U58A 5D70L 3ULUL 4EI6B 1YEHH 5LXGL 3V4VL 3ZTNL 4G7VL 4TSCL 5C3LD 5I1CL 1YEIH 2JJTA 3F7PC 3STLA 2A9ML 5HHVH 1C7SA 1OLLA 5GS1B 4M8QB 1YEJL 3HS0B 4IOFD 1T6WA 2JLLA 4KXZH 5GRJH 3WFBH 4NP4L 3QCUH 4Y16D 1GAFH 4JR9L 4HIIB 5KS9B 4NZTH 4R7DB 4LP4A 4WHTA 1MCWW 2C1OB 3N9GL 4PGEA 5I8KH 1SHMA 2HG5B 1M1SA 2XZCL 5IW6A 3BE1H 1A4KA 2K3TA 1NMBH 5D72L 1MRCL 2BMKA 4FFZL 1PFCA 3KYNA 1NAKH 4JO2H 4XAKE 1JHLL 3BPOB 4GBXA 4H1LG 4N9GB 5IB2A 5DEGA 3WFHB 3C6LC 2FL5B 4HJ0C 5I1DB 5IHLB 3THMH 2XFXB 1DQJB 5TE4L 1ORQA 1R5WA 2Q7YB 4PRBB 4X7SL 2LTQB 3OB0H 2DMKA 5I1IH 5DEFA 2P24A 1HQ4A 3HAEG 4JQXC 3T0EE 5ANMA 1XGTB 2NCMA 4Z6AT 4JB9H 5IGXH 2NMSA 1NUFA 4NHCL 5A2JH 4F58L 5DZLA 1ZLUH 1OQXA 4AMKL 5C9KA 2CSPA 2P45B 1IGTA 5F7DB 3RWCA 5DTFB 1ZHLB 5FGBA 1UM6H 4W6WB 2APVA 4KY1H 4CVUA 2HT3C 2CDFB 1I7ZA 2J6EA 2GIYA 5E24E 2EDTA 3GBMH 5MENB 3G6JA 2C5DC 3EJJX 3JUZA 4QRUB 2H32H 1QSFD 3I85A 2A6JB 3DV4B 5TQ0L 2BJML 5I1EH 3BWUC 1IAIH 3L3JA 4N0FA 3UTTD 2Q86B 3PHOA 2UYLA 4U2YA 3ARQA 3UEZA 4QRRB 3N85L 3WJLA 4PRHD 3UZEA 4E42A 5TJWK 1R3JB 4K2UL 2YBRB 1IGFH 3ZKSD 5ISZE 2CXKA 1EBAA 1B3JA 4WI6A 1KPVA 4YHYC 3TT3L 4XP6H 4HK3N 4X7TA 3TJHD 1BAFL 4NO5B 3L3GB 1LO5B 3KR3H 4HT1L 5CP3A 3EYFA 3EDJA 4QOKB 1R5VB 5DJDA 5DT1L 4HMDA 1LP9A 4XT1C 1URLA 3GKWL 2ZPKH 1JNNL 5C07E 4KJYB 3MJ6A 4YDVB 3IJHB 1VEOA 3DURA 3TNMA 1S8DA 3GMNB 1GOHA 3I6KA 2L7JA 2HT2D 3QWRD 3BD3A 1HK6A 4U0RB 1MFBH 2ZUUA 1GZPA 4F15B 5F1KC 3ROOA 1OTTD 5EIIB 2HLAA 4YK4C 1XEDA 1IGCL 2DN7A 5F71A 1W0YT 5BV7H 3ARGD 3PWNB 4J3TA 2YEZB 1U8QB 3S37H 1TTFA 3BZ4B 5D7JA 2BOCB 3L5HA 5C08D 2VLJE 2Z8SA 4HUUA 5MEPA 4WJ5B 1TJGH 2A74A 3P30L 1S9XB 3BIKB 4ZUVA 3RWJA 2Q1EA 5IW1A 1BOGA 2XICA 3DBXB 5D1QD 3WLBA 5BOPA 3WNKA 3TZVB 1S78D 2WW8A 4EKXA 1ZA3B 2GJ6D 3KPMA 4L4VD 1NDMB 3BGAA 4QXGL 3GI9L 4JPWL 4K8RH 5KSVB 5JUEL 4NN5C 1YNKH 2PXYC 3CX2A 3RL2A 4L9LB 3VCLB 2B4CL 5HDBF 3UZQA 1MJ8H 3FO9B 2AJVH 5DMIL 2FR4A 3OKDA 2HKHH 3QB7C 2FECL 5FA3A 1ACYL 3SEPA 4AYFA 3MRKA 5E00B 1RIVL 1YEHL 2I24N 3W0WB 1ZS8A 1L7TH 5C0CB 4KROC 1L7IH 4N0UE 3QI9A 2CRIA 4P3DA 4P5TC 5C0BE 1YA5A 5HJ3B 1NCBL 5HHVL 1MFNA 2ZOKB 4F33A 1HCFX 2CK0H 2AJXL 3QCUL 1HHKA 4HIHB 2X1WL 4E9LA 2MHAB 3D25B 1QSEA 3QDMB 1YY9C 1P7QD 1ULVA 4FQHA 3ELAT 3QUXC 3TWCH 5BOZG 1TCMA 4K94H 2EDBA 5TDNA 2X4RB 5J3HC 3KPRA 3FT2A 1FO0B 2PYEE 2Z92A 4K3GA 4Y4KB 4Y19A 4NM4H 3HC0A 2Q6WA 1CLZH 2Q76A 3H7BB 1NKOA 1NBZB 4N0YH 3C5ZA 1A3LL 3EDDA 3WXWH 5IM7A 4PRIE 2QSTA 3B9KC 4ESKA 5C0FB 5B21A 4JB9L 4JJ5B 1IAMA 1RJZB 5J57B 1FNGA 3ZSTA 1U3HC 5ENWA 5DVMA 5IK3A 1I3GH 2A77H 2XRAH 4XVTL 4PJCA 4PP2A 1S9VB 3I50L 3QFJA 2YUVA 5TQ2L 4ZFGL 1CGSH 2DBLH 5DD5H 3E8UH 1FE8L 4R4BA 4KKCD 3JTSB 4XWGL 1T20A 4LOUD 3D69A 2YA1A 3CZFB 4OJFL 3SDYL 1I1AC 4KK8C 1BEYL 3V5DA 4DKEH 4X99A 5DVLA 1KELH 4MA1B 1ITCA 1CD9B 2CQVA 4JM2A 5JQ6H 4JDVB 2P49B 2NXZD 5GGQL 4D8PA 5L6YH 4P2OD 3QHFL 4A2LA 1H3PL 5FGBC 5E95B 1SEBB 5F89A 3HPLB 1N64H 5FOBA 1OAXH 5SX5H 1U3ZA 3I02B 2WP3T 4NN6B 4UNTA 1RQ5A 2I07B 4XCEB 5JOPE 4QHMB 4I48B 4JFFA 1L9MA 2JELH 4PUBH 3RNKB 3O3BA 1T89C 3UX9B 4GG6E 3G9AB 4A6YH 1CD8A 3BH9A 3SDAA 2ADIB 1EEUA 4U1LB 5ALBH 3IGAA 3RUGE 3UTTE 2ZPKL 3H9HA 1DP0A 3I2CL 1KCSL 1A2YA 2M1KA 3O8XB 5AUMB 4N0CC 5IG7B 1D5IL 1MFAL 3KLSA 4Q6IA 1QHPA 4MNGB 2WWMC 4UV4L 4J4PA 1MREH 1QACA 4X8XA 3NPZB 5HYEA 4X8JB 4JHWH 5JOEA 4RNRB 1JBJA 3K2UH 4JFXA 4PP1C 4FABH 1BVKB 1ED3A 1MEXL 3FMGH 4POYA 5I1HL 5DR5H 3BPCB 5BV7L 1J1OH 3QUZD 2ZG2A 1XFPA 4DGYH 3S37L 3NOIA 1KCKA 1J8HD 4U31A 3MV8E 5IEHA 5FM8A 1QD0A 5J9PB 4LHQB 3B2UD 3DX7B 5DUML 3GJFB 5A2KH 3QIWB 3VXNA 2P5ED 4NRZA 1A7QH 2HWZL 5EOQL 3HG1B 1RZ7L 1I8IB 1U9KA 5IR1A 5A3ID 2HJKB 1X5HA 1YEDB 3CFJA 3G6DH 3MRFB 1EBPA 5KVGH 3U36A 5EC2A 5J8OA 5FDWB 1BECA 1A6UL 1EO7A 3IS1X 4PLKC 4PJXA 3MRGB 3KPOB 2RCSH 4M6OL 1ZLSH 4KI5E 2W9EL 5D1ZC 5GJSL 5JA8B 4F2MA 4X9BA 5C0EB 3WO4B 3MLTA 1PKQA 3T77A 3V5KA 3GHBH 3JV4B 4JDZB 3TPKA 1RZGB 1AGFA 5HHMB 1F4HA 1RZ8A 4LKXA 4LQ1A 2HKHL 2NZ9C 1U95B 2Y07L 3CFBB 1IM9A 3H8NA 1KENH 2AJSL 4U1MB 5I8OH 1ODAA 3L3HA 3LD8C 1R3HB 5GGVY 2R1WA 3K1KC 5CBEB 2NY4B 4W70A 1EUUA 5F70A 5HHNB 4LAQL 1NUNB 5F8RC 3GSWB 4LNRB 1LE5A 3IAGC 2Z8RA 1LEGB 4YDLB 1BJ1H 3F7VA 4NKQB 3PXJA 4PG9A 1MCPL 3Q2CA 2CIKA 4G3YH 1FLRL 4Z7VA 5DZNA 5E2TL 1B0RB 5LGHH 1MFCL 5ID0A 4WGWB 3F12B 2EYTA 2I5YH 1WT5A 1FV1B 3TWCL 3GMMB 3RWDB 1QSZA 2NY3C 1CGVA 4X4ZA 5CJ8A 2J5LB 1NGZB 3H9SB 4K94L 2F8XC 3GB7A 2DLIA 2FYYB 3SGJA 3K2MC 1CLZL 1Z9LA 1TTUA 2IBBA 4NKMB 2E5EA 2R29L 5EN2A 1IFHH 2MQCA 1OF2A 2XKNB 3Q5OA 1XR8B 3WN5C 1SY6A 3ULVE 5ERWB 4DZBA 3INUH 2OYPA 5IMKB 2X4UA 4NJ9H 1R6VA 4N8VG 1ND0A 2ADJB 2VDKH 2A0LD 2IJ0C 3GDBA 1EGJH 1L0XA 3T0WA 5H35B 1JV5B 2AJZA 5E7BA 2WANA 1ZA6A 3EFDH 2GTZB 1X9QA 3C5ZC 1CGSL 3NZHH 3E8UL 2F19H 3BIAX 1KACB 4I9WE 4PJHB 1TJIH 1C5CH 4QRQB 1T5WA 1GOGA 3KWWB 4UDTB 5F6IB 1ZGLM 3MNWB 3WFCH 1MUJB 5ADPH 3QDGB 5ALCH 1CL7I 5F7HA 5I71C 5ECJE 4GRWF 2XTJC 2EECA 1L4IA 1IQDA 4P23D 3C60B 5L6YL 4AJ0A 3D3VA 2NY2D 5E1HB 1CGXA 3DIFA 4FXGA 1QO3A 3AGVA 4PJXF 1P9MA 2QSVA 4S1QH 2DL9A 4HC1A 1QRKA 2CUMA 2WP3O 2E7LA 5D71H 4YR6B 3QO1A 1I1YB 1KUMA 1YMHB 2P8PB 4GKOA 4JM2C 3HZKA 3L9RA 4XB7A 5DO2C 2AGJH 3DX9B 1UWXK 5AYUH 1FZOB 4NNXB 3MCKA 4AG4L 1AXTH 3MJGX 2JJUA 4I8DA 1U8HB 1PW3A 4Z5RA 1AGBB 3AREC 3QNZB 1FGNL 5CD5D 3VWKD 4HUXB 1UXSB 3ULUC 3UTPE 2P5WB 4JRXE 2YC1A 2MWCA 5F9OH 4D0CA 5I30L 3DMMA 4X6EB 5IB5A 5EBMA 1FCGA 4U1SA 2BFVL 5JXEA 5LGJB 3QHTC 3QIUB 4FQ1H 4PJ7E 1KTDB 2WIIB 2MPAL 3PUCA 4LHUB 1ES0A 1G7JA 2A83B 4Y7MA 2W65B 4YPGA 1MLCB 1HQRA 5HI3D 1JWSA 1I7UB 4L4TD 1QYGH 4YHPB 4OI8A 4S10A 5KW9H 1MF2L 4DW2H 4OLEA 3DROA 3BKYH 2Z31A 4X6BA 4QCIA 2VXVH 4YPJA 1IKFH 1I7RA 4NQCE 5IT2L 4UB0L 2XN9D 5EG6C 3WD5L 2PO6C 1X3DA 4JZNA 4ZXBC 4OZIA 1AP2B 4KHXH 2V2WA 4PJEB 4URTB 4RGNB 1ZLSL 4OKDA 2I27N 4JGJA 3B8SA 4ODVH 1FZKA 4QNPF 3DJ9A 3D0LB 4O51A 3LS5H 1VA9A 3HAEA 4HD9A 4NJAL 4UOW1 1J0HA 1OSPL 5F7EL 1SYSA 1CFNA 4IIQA 3G5ZB 4ZSOE 1E4WH 1XF3B 3O9WA 4AIOA 3VWJC 5GISL 4LSTL 4R4NC 4P3CH 2WBKA 4P46D 3WNOA 5HGAA 4K23L 1IT9L 3D9AH 5D7KD 5HHQB 3U9PH 2YPLD 1XF5A 4OKVB 2R2HB 1KJ2H 3U9UB 3ZMRA 3P9MB 3QYCA 3BP5A 1IAOB 4OBSA 1JGLL 2ZUWA 4U3XA 2AKRB 5GSRB 1JI1A 4K9EL 3FB6B 1MFEH 2I5YL 2O26U 3VFUA 1J0KA 1J87A 3BKML 5IBUG 1KIRA 2HT4C 3RDTA 2D7QA 3OJMB 4GAYB 1O0VA 1NFIB 3NPSC 4HCRL 1Q38A 4MB4A 4LEOB 5CZXD 2WUCL 3NAAH 4NQDE 5IVZB 1NCCL 3TFKC 1IC1A 4QHUA 5SWSA 3MMEB 4X5LA 2GK0A 3L5WA 4IMKC 3Q6FA 5F96L 4RX4A 2Y1VA 4OAWB 2EDNA 4ZO6A 5KJRL 2AEQH 4FFWD 3ZKMC 1ZLVH 2VDRL 2Z91B 3REWA 2VDKL 1FZJB 4CMMB 1EGJL 2D9QB 2AEPH 3S96B 1FL3B 3PDOB 2WBJC 4LLYA 1JPSL 1OY3B 5F3HA 3T0VA 3SCMB 2JTDA 1JIBA 4PTUA 2QHRH 5CJQL 3RVTD 2ED9A 1GH7A 4HGKC 1RFDH 2VABA 1A5FH 1J8KA 2CR6A 3CFCH 1JPGB 4HIEB 4LEXL 4Y4FB 5I15H 3KLHD 2JE8A 2HVJB 5DLML 3B4NA 3VXTA 4YE4L 4NQEB 4OI9A 4KJWD 4S1QL 5JIKA 3UBXI 3B9EA 2DRUA 1C5DB 4MDJA 3VXUA 4AL8L 6FABH 1AKJD 1QEWB 4PGBB 2Q3ZA 4LRIA 2AV1B 5H37H 1QBMH 3OAYK 3CNKA 1CDUA 1DDHA 3MNZB 1C08A 3V79C 1MNUL 3RZCC 5KAQG 1FYTB 5T1KA 3ZSSA 3NIDF 4ONOA 2IADA 3BEWA 4X0KB 3FT4B 3FJTA 3KNBB 3VXOB 5TFSH 5E6ID 1F6AB 3ILQD 3QG7H 1P9MC 1AY1L 5SWZA 4BYHA 3LSOB 1AXTL 3WFDH 4F37K 2E7LC 2B4CC 1U8MA 2DQDL 2QTEA 1MELA 5E5MA 4KKAC 4I13B 3U7WL 3AM8A 1WCQA 1YY8A 4OFPA 5ID1A 1WQVT 2X10A 5TE6L 4YHKH 4Q74A 1XF4B 5KSBB 1EH9A 3CDGB 1NEZG 2CR3A 3KHOA 5KSAB 4KJQD 3WHXA 1BZ9A 3MXVH 5DJ2A 3VFNB 4FQ1L 4WFHE 3V6ZB 2RQ8A 1KXTB 1AXSA 3VFOB 1I8LC 3BUYB 5T1DH 5EC1B 2H3NB 4P57A 3STZB 5HGDA 4WWKD 3QHZH 4M7KL 1Z3GH 1AJ7H 2NY6B 5KW9L 2AK4B 1ZVYA 3ZKNC 3X13B 4H25B 4HGWA 2H41A 4LVNC 4NRYA 1S7TA 3O3AB 4Y4HD 5BQ7B 4ZFZB 1FRGH 4LSQH 4K8RD 4MA8H 3G08A 2CJUL 1T1XA 4R2GD 5I1KL 3FOLB 3HR5B 4GRLB 1JN6A 2ADFL 2QEJA 4RFOH 2ZUQC 1CK0H 3LRSB 4AM0A 3C6LB 2OJZL 1OAQH 1XIWA 3V5HA 4ZPVB 4X6DB 3M07A 3OXSB 4G80A 4DKDC 1DZBA 2IQ9L 5CJXC 2ICWA 4LCYB 4TTDD 3FO0H 3QDHA 5CZXC 3VXSD 4ODVL 4KXZI 5E08H 3UTQB 1UM5L 2F9BT 3LMJL 1IL1B 3KPPA 4GW1B 32C2A 1BD2A 1X7QA 4NCC2 1G6VK 2EXWC 3JSSA 1H3WM 1E4WL 3FAXA 4GW4B 2GSGB 2IAMB 5EORL 3RVUD 1ZT4A 3TVMD 1LO3L 4I4WA 2B2XH 3CXHJ 5F9DC 1N0LA 4M61B 4OLVL 5D1XD 3T04D 5IMMB 5ISZA 3QXUA 4X98B 1KG0A 4R3SB 4DN4L 4PD4K 3D9AL 1T4KB 4JFDB 1YPZE 4Z7QF 3GUTB 4G6KH 3UJJH 5BW7C 1QLEH 1G7MB 1ONQA 1X4YA 3HI1B 2DQEH 2EDFA 3KDMB 3R0NA 1DLHB 2BNQB 1CICA 1B9ZA 2ZKHH 2FZ3B 3TBWA 1PEZA 3MJ7A 1MFEL 3UTSB 3D85D 1NCAH 2D7OA 1E4JA 2H45A 2EO9A 4KDTA 5AG9A 1DE4A 3F6LA 4KZEH 2AJYH 2YKLH 4OCWH 5ICXB 1NAMB 4FA8A 4HIJB 5D7KE 4BSVA 5DJ0B 3LN5B 3ULVL 3MRHA 2OTUA 3MGOA 4QXWA 4Y2DB 3B5GA 2LFGA 1KT2A 1EAJA 3VJ6B 1CDJA 1I85A 3RDTC 5J13B 3LKRB 2CDGA 3ORJA 1J5OH 1HDMB 2D0FA 3A6OA 5DUBB 3MBEB 5KZCD 4NZRH 2VLJA 3VGEA 2D31B 4GW5A 5B38G 1OAUH 1IAII 2AEPL 1V3MA 2BNRD 3QXDB 3EYQC 3UMTA 1JF1B 3QDJE 3V4UH 1G6RH 3MRDB 3TBYA 4DKAA 4KQ4H 2F74A 3V4PH 2CKBH 5BV7C 1YECL 3MREB 3CFCL 1BMGA 1HH9B 4XPFH 5CEZE 1N2RA 3MRRA 1VFAB 3NGBC 1S7XA 2UV3A 5IESH 1DQMH 3TBSB 4J1UA 5IF0A 3U6RB 5ICZB 3UBXG 1QBML 2X4SA 1CXKA 3SHSA 4H5SB 5T1LA 1T21B 5DHVA 2M2DA 2GY7B 1KEMH 3MV7B 3HRPA 4UOW0 4NOFA 8CGTA 1XGPA 1BFVL 2R9HD 3C5JB 4N0UA 1KGCE 1QR4A 4EDXA 4PTTB 3AMLA 4NUJA 5GZOD 4R2GC 4GMSL 5ACMA 1ZKAA 4WUUD 4LRIC 1V7MH 4WUKH 3S5LG 5I2IA 4NWTH 3Q48A 5D6CB 4ZUTB 2VLRD 4UQ2A 5HD8C 2HN7B 2DKMA 3VRJA 1ORSA 4Z77A 3PWVA 4GSDL 4EXKA 4F37F 1NL0H 1OT1A 1IKNC 2CRZA 4S1SL 3OXRB 4Z76B 5I74B 4JPVH 3O3DA 5HYSG 2UZXB 5B22A 3O4LB 2CIIA 4P5TB 1YC8A 3QIBA 4WEMB 2DM3A 4WW2A 5FDYA 2DL2A 2B0SL 2BNUB 2C7UA 3D2UD 3HR6A 1RZIA 3GRWA 4YZFE 2H8PB 1BF8A 1XF1A 4Y16A 4YGVB 3FO2B 4PRDA 4YDJA 5GS0H 3RL1B 5FKAB 2X4TA 2YA2A 3L6FA 1Z3GL 5CBAA 2VDQH 1U58B 4NHUA 3CDYA 5IFHH 2Z4QA 4K94C 2G5BA 4FQXD 3STLB 3TC9A 1MCSA 4BUGA 3FQTA 4PRAA 4EUPH 1FRGL 3LEYH 1DEDA 2AQ3A 3QWOA 3QPXH 4RBPH 4DGIH 4RFOL 2DYPA 4J3VA 3DPBA 3T0EC 2VZOA 4WHTB 4ZFOA 3UDWA 3CU1A 4PGEB 2HTKC 1A4KB 1JPTH 5DFTA 5MENE 4I3GA 4WW1A 2BMKB 5GRWA 4JPIA 2V7NA 3KYNB 1CT8A 3KS0J 3P0VH 4GBXB 5BS0E 2VXTL 4N8VA 1MI5D 2FJFB 3NCJH 3T0XA 1ORQB 1JWMA 1R5WB 4PV8A 3UCRA 3HNVL 5DEFB 2MQ0A 1HQ4B 4MJID 1HXMA 5ANMB 5GZND 5D5ME 3BPLB 2YD7A 5I18L 1FGVH 1RULL 1F4XL 4KK5D 2V5MA 4WTZG 5CSZA 1G7HA 1QSFA 3UJJL 4JPKL 2DQEL 4JO4H 5TE7L 4YXLH 1IGTB 4BQCA 3HUJF 4MJ6B 1RMFH 3UTTA 2ZKHL 1AH1A 3ALWA 1IC7L 1PZ5B 1I7ZB 4QOKE 2EH7H 3O2DA 5I1GH 4HXBL 4YBQC 4NT6A 3NCFB 1DL7H 4PRHA 4RA0C 5BZWA 4KTEL 3SDDD 3ABZA 5DJYA 4E41D 4OCWL 4UOJA 4OLWH 2FSEB 3BGFB 3FN0H 2GCYA 3IDNA 3GSUA 1VHPA 4N0FB 1UC6A 3B43A 2UYLB 3PHOB 2ZJSH 5CJOH 1QTYT 1J5OL 4KDTC 2QLVB 3N1QC 4E42B 1EO5A 2P48B 2R56L 5HVHC 1I9RH 2FBJH 5EFIA 2DQHH 1JHKL 4HXAL 3VD9A 1KPVB 4R96A 1KTKE 3QWRA 4JFOA 4YAQA 3RTQD 4M7JH 4CJ1A 1G6RL 3EYFB 4XP1L 1I85C 3V4PL 4UU9A 2A1WL 4L1HA 1LP9B 1OM3H 2GAZA 2FB4H 1QLRA 5CEZH 1HIMH 5A2FA 3TO4D 3TNMB 4XPFL 1S8DB 1MAJA 3PQYD 1Q9OA 1MOEA 1RIUL 1BZ7A 5C08A 1DQML 5DEZA 5EZLA 1DVFC 5D7SH 3TCLA 1VENA 1OL0A 1J0YA 4L5FL 1GZPB 3G04B 4G6JL 2UY7A 2NLJA 3ZE2F 1D9KC 2ARWA 3ROOB 5MERB 3TEUA 3N1PC 2HLAB 4OD3L 4NKIH 2YPKA 1KEML 4OM0H 5D1QA 2Q87A 4OFIA 1N0XL 3S3PA 4DCQA 2HJLA 4EI5D 2AJ3A 2FATH 2JCCF 4ZO7A 5D7JB 5J1AB 2NY0B 1GVIA 4O2EB 5C0CE 2GJ6A 4L4VA 5IUSA 5MEPB 2A74B 5IQ9B 4WUKL 4KK9D 4TUJA 4ZUVB 3O41A 3DOSA 5IW1B 1BOGB 4G6FB 3FQUA 1QP1A 4MAYB 3WLBB 4G8IA 3QQ4A 1QQDA 3BQUA 3V6OA 3QDME 1ZVHA 1HKLL 4J8RB 2AJUH 3KPMB 4XP5H 3U0TA 4GMTL 3BPNC 5DRNA 4ALAH 3SO5A 5JQHC 2R1XA 5IB3A 3RL2B 5ITBH 1AIFA 1I3UA 3X14A 3NCYS 1GPOH 4K9EC 1KN2L 4PJBA 3SE8H 5FA3B 1CG9A 3LY6A 4N90E 3QEQD 1P7QA 1S5HA 1UJ3C 4OCMC 3TNNA 4KMTH 3QI9B 4P3DB 2D3VA 3QIBC 3LEYL 3NBNA 5F1IA 4F33B 3QPXL 4DGIL 3SE4C 3LEXA 4EVNA 1YYML 4X5WA 1IMHC 3U46A 1KV3A 1ROWA 4GG8A 1IM3A 3IVKA 1QSEB 2GYSA 4WV1A 5DMKA 4MD5A 1KJ3H 4FQHB 2HFFA 5FB8A 4RAVA 1HEZB 1RI8A 4GS7B 4ZTOL 2FNBA 4XNUH 1G9MH 3KPRB 3FT2B 4YHIA 3ARDD 4Y19B 1ZGLP 3HC0B 1SQ2N 2Q6WB 3ZTJH 3UDWC 3RGVA 1RIHH 1I3RB 3NCJL 3BISA 1TFHA 4WEUD 5F72S 4NGHH 3WIHL 5CFHA 2E27L 5IM7B 3DTXA 1FORH 3RVWD 1FGVL 1NJ9A 4W81A 1FNGB 5CZVL 2FX7L 5IK3B 43CAA 1L0YA 1QPPA 3R06B 1T2XA 5DGQA 1LDPH 4PP2B 1A1MA 3M8OH 3QA3A 4S2SA 1BBJA 4KRPB 5EUOF 1RURH 5C0AD 2VISB 4R4BB 5HHPA 2X4NA 2A38A 2FLBT 4WFGD 3D69B 3IETA 1CR9L 2BVYA 3V5DB 1N5AA 5HYFA 1JWUB 2QSCH 4M8VA 3HN3A 1F4YH 2QHLA 4NNPL 3CH8A 5T3XE 4XH2A 4JM2B 3RJQB 4D8PB 2IFFH 4EIGB 2HMIC 5JW5B 3WUZA 1OW0A 3VMPA 3FN0L 4JAMA 3O6FD 4MNGE 2YXFA 1EEYA 1HINH 3MROB 5JOFA 3HC3H 1Y6MR 5FOBB 5KTEL 5CJOL 3W39A 3ARSA 5FM4A 3ZL4H 2Y06H 3DRQA 5F1NA 1WCBA 4MQXD 4JFFB 1RZJH 3OKMA 1IC4H 3O3BB 3BFOA 4OUOA 4WI5A 5C2BH 1BFTA 1BFOA 1UG9A 4P2RD 3BH9B 3SDAB 4E41E 4XPBL 3HG1E 1A14H 1NBQA 2HYMA 5KG9A 3WNNA 3GIZH 4U6TA 2C4XA 5CEZL 3DGGA 1AHWA 1HIML 1A2YB 4JY6A 1A8JH 2DQUH 3MA9H 3B3IA 3BW9B 1J8HA 2FHFA 4Q6IB 1QR1B 4YWGH 3OR6A 3WIIH 1YEFH 1PGRB 3SBWC 5D7SL 1MCOH 4JFXB 2Z8VC 2P5EA 3K80A 4W4NA 3ARBA 2FJGB 1UQSA 2D7TH 2G9HA 4LIQH 4PJ9C 5JO5B 3CLEL 2K7QA 5HHME 4M3KB 1OGAD 4KI5C 2HP4A 3LRGA 2YRZA 3KYMA 3DYOA 5DMYA 4RA3A 1AGEA 4FQIL 2FATL 5IEHB 3QUYD 1LE9A 5A1AA 3D18A 4MVBC 4MXWH 3E6HA 4ZS7L 4HBCH 3SPVA 3H0TA 4NRZB 3VXNB 1KCUH 1AQKH 2ESVD 5EBWA 1ZVSA 1KC5L 3NFPA 5CUSH 1NLBH 5I16A 4M93C 5IR1B 5JA9A 1F6LL 2DKUA 3CFJB 1BLNA 1PEWA 1X5JA 3MYZA 5EC2B 3U36B 2DD8L 2QQLH 4PJXB 4NQXA 1OTUD 3OAUH 4Y5VA 3SKNB 4MDIA 1DSFH 4X9GA 3MRJA 1P7KA 5FK9A 5CGTA 1FO0H 4HS8L 4F2MB 5J7CC 2DLTA 1ZHKA 3H9SE 5MEQA 3MLTB 1PKQB 3T77B 3AS0A 5KVDL 1NC2A 2O5YH 3IDMA 1II4E 2DIJA 1AGFB 4YEFA 1F00I 3BQUC 1RZ8B 4LKXB 1QHOA 1GPOL 1WWAX 3SE8L 1LDSA 3KPSB 1IM9B 3ARFC 3L3HB 3S88L 2R1WB 1RU9L 4Q0XL 3C8KA 4TSAH 1RJYA 1LE5B 2YXMA 4PG9B 2CGRL 4OCNC 4OM1H 5EZIH 5I75C 4TVPE 3ULVC 2CIKB 3BZFA 4Z7VB 5DURD 3IDIA 4PJ8D 2NR6D 4X5XB 4PJHE 4GXUN 5ID0B 4ODSL 2EYTB 4WCYL 4I18A 1I1FA 3U0PA 1DLFL 4I0PD 3TPUA 4F57H 3GB7B 4P4KC 2C3GA 5EWIH 1TPXC 3QDAA 2ENYA 4JKKA 3HMXH 5DK3A 1NMCB 1UZ6E 5EOTB 4WV1C 5B38A 4MD4A 3O3UN 2X41A 3B6SA 1OF2B 1QSVA 3O11B 2VZ1A 2X1XR 3PWPE 3QNXA 4DZBB 5DD3L 2VUOA 1ADQL 4PY8J 4JZOA 3VXRD 2X4UB 4KGJA 3MOBH 1ND0B 2D7NA 1VGEH 4NQSA 4P23A 3O6KH 5D7LD 2GUOA 3RGVC 2AJZB 1EHLL 1NGWA 1BVZA 3KAAA 1KXQE 1ZA6B 4ODTH 2EDLA 1WFTA 1P4BH 1MLBA 4U4BA 4OZ4A 1T5WB 1AFVH 3FB8A 1X4ZA 3VGFA 3KJ4C 3AVEA 5T3ZH 1L9NA 3UBXA 2P5WE 3SJVD 1IQDB 4KVNH 4XMLH 3D3VB 3IS0X 4V2BA 1AXIB 1QO3B 3PL6D 1CCZA 1HINL 4HS6A 4BSJA 4PJFA 4K7FA 5DI8B 3RZWA 5DRXB 1NC4D 2VUYA 4OBRA 4U1GB 5KVFL 3QO1B 3WNPA 4JFED 3VWKA 2ENSA 3S5LA 3WSQL 2OL3B 3S36X 3HA0A 3HZKB 3DSFH 3L9RB 4L8SA 1OW0C 2MKWA 1CE1L 1YEEL 1KF9B 5FYKE 5C2BL 1T03H 3MCKB 3SQOH 3KGRA 4QT5A 4XCYB 3TA3D 4F80A 3F5WB 3DWTA 2VDNL 3MOAL 1J1PL 4Z5RB 5L7XL 5HYSA 4JZJB 5E0QA 3GIZL 3TBVA 4C56D 1TMCB 3MRMA 4K55A 4RMQA 2YC1B 4L4TA 1WIUA 2YR3A 1R3IH 4D0CB 3DMMB 5IB5B 1ZHBB 5EBMB 4PJEE 3LKQA 4RGNE 3ESVF 4YWGL 4EN3D 3MRLB 2X4OA 2XWBB 5HPOA 4HWZB 4XXCC 1PKOA 1ES0B 1G7JB 1BIIA 4YPGB 4Z95H 1HQRB 2XN9A 1JWSB 4LCCC 4YO0A 3O4OC 4TRPL 4YNYA 3WIHA 3NIFF 1KB5H 1WBXA 2XWTA 4NRXA 5HI4C 3PHQA 1F2XK 1YPZA 3HLAA 4HDIA 3IFNH 4MWFA 1QFUL 3BMVA 4PJDE 1OTSC 1KCUL 1AQKL 5D96B 3ARBC 2Z31B 4X6BB 3MLXH 1I7RB 4GJTB 5CUSL 5FHBL 3C09B 1GC1H 3GHEH 4LVHB 4NUGH 4YDIL 4JZNB 2VIRA 4H1LB 3S9DB 4OB5L 2V2WB 4MMXC 1NCWH 5EDXA 5GS0D 3OAUL 2IH3A 3UPAA 2DTSA 1G7QA 3S97C 1FIGH 4HUKB 1FO0L 1FZKB 4PG2A 2Y36H 4O51B 4WVRA 5HSFA 3HAEB 2GEEA 5JW4M 1Q9WB 4MYWB 4HAFA 1SYSB 1CFNB 4IIQB 5BRZD 1KN4L 3EOTL 3P0YH 2MOVA 5BO1H 2EDXA 5L0QB 5F7FA 1HE7A 5I6XC 4QRTA 4WTZA 1MAML 3O9WB 3GSQB 1P7HL 3DUSA 5I0DA 2OMBA 4BKLB 4ZYKA 3BZDA 4WGVB 3SKMA 4MAUH 4MJ5B 4KPHL 1IBGH 2R4RH 3CFKA 1FLTX 4WHDA 3R0MA 3X17A 1MRDL 2D7MA 5CKGA 2HRPH 3MBXH 1XF5B 2W07A 4YFDB 4XPTH 5HGGS 4K71C 4OM1L 4K3EH 5EZIL 1JRHH 1ZT1A 4XHQA 3RBSA 4XNMA 1IGMH 2FCBA 1JGDA 4XC1H 3ROLA 1SM3H 4NZUL 3BP5B 2UVFA 4X7CC 4ORGB 4FQ2H 3S98A 1HSAA 2ZG3A 3MV9D 1HYSC 1YN7A 5IVXA 1HXYB 3AFLA 3UJIL 1KIRB 4GXVH 1IEBB 5I73B 4IRZL 3U4AA 1OCWH 4UILL 2XG5A 2CUHA 4U1HB 1NGXA 2H2SC 4XCFL 2NXYD 3K8MA 5DFVD 2YK1H 3O6LH 4GAGH 3DO7B 4O02L 5GGTH 1Q1JL 2H32A 3HE7C 4D9QE 1KIUA 4QHUB 5SWSB 1CTNA 4ZQKA 2AK1H 3L5WB 4PRPD 3Q6FB 5C0RH 2XY2A 4MXQD 1FNAA 4EI6A 1FYTE 1BQHG 3MOBL 3CLFL 1FBIH 3M1BA 1UCBL 3REWB 2NYYC 5A40E 4M48H 3QUMH 3GNML 2FX8L 1B4JL 1H3XA 3O6KL 5TDPA 7CGTA 3HS0A 3PGFH 5F3HB 3GSRA 1FC2D 1P4BL 1QBAA 5J6GA 4HIIA 4YJZL 1AKJA 3O2WH 3IDYB 4PTUB 3HZYA 2A2QT 1QOKA 5T3XL 1Q0XH 2HG5A 2VABB 3GM8A 3H2WA 4CGTA 1A7OL 1S7QB 1NGPH 4EN3C 3ZHDA 1JUFA 2VXSH 4KVNL 1YJDH 4XMLL 4O00A 5E6IA 5KSBE 3VXTB 4M7LH 4F9PA 2VQTA 1UENA 4PLJC 3VDCA 3VXUB 4N9GA 3V7AE 4PJ5D 5B8CB 5EBGA 3VGDA 1F13A 1JZ5A 3LN4A 2DQTH 4X9FA 3EYSH 1DBBL 4GOSA 4ZD3H 2XFXA 1A7RH 4KDVA 3WKNA 5IKCA 1DDHB 1C08B 3KXFD 5T1KB 3C2SA 5SX4I 4OIBA 2VE6A 4ONGL 3VRIA 1OAYL 4XX1E 1FH5L 4KC3B 5AZ2L 3W5MA 5SWZB 2J4WL 2W9DH 4ZTPH 5FGCE 2N1KA 1JZ7A 2ITCA 4EQ2A 5D4QA 2DQCL 5DTFA 3TT1H 4S0TD 3BI9X 1EFXD 4YHZH 5E5MB 2CDFA 2Q8AL 5DZOA 2OLDA 1YY8B 5TH2B 5ID1B 4WWKA 4XCNA 1R3IL 4X6DE 2M8XA 4KRMB 3L1OH 2HKFL 3MR9A 4LCWD 5DSCA 1BZ9B 1DBMH 3DV4A 5BS0A 2X5PA 5IVXF 1AXSB 3MFFA 1CTOA 1RUQH 3PGDA 3FZUC 1UZ8B