2ESVE

Structure of the hla-e-vmaprtlil/kk50.4 tcr complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
240
structure length
240
Chain Sequence
GVTQFPSHSVIEKGQTVTLRCDPISGHDNLYWYRRVMGKEIKFLLHFVKESKQDESGMPNNRFLAERTGGTYSTLKVQPAELEDSGVYFCASSQDRDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for a major histocompatibility complex class Ib-restricted T cell response
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, alpha chain E
total genus 56
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2esvE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2esvE02
1EJOL 3PQYD 5KN5B 4H1LA 4BK4A 4CJ0A 4GW5A 3GMQA 3F7VB 3GUTB 5JMOC 2J6EA 5EORL 3HLAA 1KJMA 3NH7L 5CEXA 2NY7L 4GRWB 4MMZC 5HHPA 1Q72L 3JTTB 3H3BC 5IOPA 3CFBA 3LQZA 3FB5A 2V2XB 2CD0A 3TNMA 5IW1A 1UM6H 5JIIA 3QG7H 5ESQA 1W0WA 1I7UB 2VDPH 1IEAB 3CFDB 1GPOL 3DHJA 3OMZA 2YEZA 4NN5C 2NY3C 1M7IA 5K59E 1AR1C 4HEME 4Y0GA 4UDTB 3F7PC 3DGGB 3MTRA 4K3EL 1IEHA 3PGCB 5EU3B 4F9LC 1YYML 3MBEA 3PQYB 4QXUH 1FZJA 4N1HB 8FABA 4PJXB 3WO4B 3FT2B 2XWBB 2CRZA 1YEGL 2XN9A 4P5MA 4YDLB 1T1ZB 2VXVL 1W72H 3FO1B 5ACZA 3UPCA 4JB9H 1VACB 4LBEA 5D7IB 4RMQA 4CRPA 4AG4L 2P7TB 1HYSD 4NQEA 4QYOA 1AO7D 4KKBC 2FGZA 4F7MA 1NAMA 4PUBH 5F72S 4XX1E 5EC1B 1TZGL 4JO4L 2DJ4A 4OF3A 4QOKB 1KJ3L 1S78C 2WLZA 2VUOA 5B22A 3CXHJ 1ZLSH 4JO4H 4JJHA 2UWEA 2WBJB 1OGAD 1AXSB 3UJTL 5C0GB 1KLFA 2NY0B 2E7LC 2OR7A 3GO1L 4YHLL 2V9RA 5C0CD 1XGQB 3RBGA 4MD0B 5KVGH 1SY6L 1CDJA 2GW5A 3ZE2E 4E5XB 2V5MA 2NQCA 5LAXB 1LE9B 3UTPE 5F7EL 2CH8A 3UYRH 3D9AL 2EDBA 4CVWA 1DBKL 5IW6B 1INEL 2AI0H 3EO1A 3IAGC 2Q6WB 1AXTH 3QHTC 3S97C 2NY5H 3TF7C 1LO2L 4PS4H 2EYSB 3EFDH 2Q6WA 3MLWL 3I6KB 1T04B 1L0XA 3OAZK 4P4KC 1H3TA 5HYSG 3F7YA 5I66B 3QWOB 3K46A 2DWEB 5FOBB 5IGXH 5GPRA 4JZJA 4K94C 5K9JL 1CXKA 2FDBP 5LAXA 4L8CB 1WCBB 5I8KL 1FYTB 4N0UB 2YD6A 4KQ3H 4LPUA 4X5LA 3MUHL 2VITB 1AGBA 3OXRA 2G60L 2JK5A 3D3VB 4R96A 5D5MA 5ITFB 1A6PA 1IC5L 3KYNB 2VC2H 3GSOA 3FTGA 3QIUA 3WE6A 1FE8H 4HWEL 2X4PA 1HHIA 3PP3H 2ARJB 4WW1B 2OI9B 3ARDD 1N7MH 3QIUD 2GCYA 4G6KL 4HHAA 4V1DB 4XWOD 3G5VA 3LPFA 5AUMA 1TETL 4QO1A 4XAWL 2EH8L 4PRBB 4U7SA 1QNZH 1RVFH 3W0WD 1Q9WB 2DDQH 4EDXA 4GG6F 2W65B 2AEIT 2WSKA 2NXZD 3AY4C 4MLSA 4OLXL 1A4KB 4OAWA 3QT2A 1YJDL 3GJFA 1BFVL 1NAML 1ZWIA 2CK0H 2EIEA 4NNXA 4LBEB 5D7IA 4OZIA 1BVLB 1FSKC 1CLYH 4LVHB 1ITCA 5JHLH 1YNTB 3K3QA 2JB5H 4U49A 3LQAC 1YECH 4YQXH 4QRSB 3MUGB 1AD0B 2HJFA 5F1OB 3W0WE 1MJ7H 1FC1A 8FABB 5I8CB 2ICWB 3QB7C 3DRQB 4LVOC 4BH8A 4PJAB 4FQLH 5GS0L 3D0LA 2CLRA 5AWNL 2PXYC 1XIWA 3MV8D 1OP3H 3RQ3A 1GZQA 2AK4E 4XP6H 5LCVH 3QI9B 1AD9B 3WSQL 3DX7B 1Q9LB 3O3AB 3F7RA 4PJ8D 1ZHLA 4N5UA 3T0XA 3V2AR 3WIHA 3PL6B 3TBSB 3U7WH 5IEKA 2AJUL 4XVUC 3LHPH 4OT1L 4LVHC 5IFAL 3OF6D 1A7NL 5MP6H 1Q94A 3PWLB 4OLWH 1XGUA 2H6PA 2F74A 4M9OA 4PJ9C 1C08A 3CX5J 2VB5A 3FQRB 4U1JB 2DQUH 1T0NB 3OJDA 1NC2B 2C1OA 2EO1A 2GJ6B 1JZ7A 3DOSA 1TQCC 1ZE3C 5ID0B 1A6VH 1AO7B 4GBXC 1KXVC 5CEYA 5AG8A 2APXA 2YKLH 4AEIH 5J12C 3O4OB 1F4XL 3TBYA 3G6JA 2PR4L 2YKLL 4GRLC 3VI4F 3U48A 2IFGA 1YDPA 3O6FC 5FCUL 2Y07L 5BXFB 4IS6A 4OLVL 5GS2H 2V7HA 5JR1H 4G6FB 1BZQK 4NO0B 4O2FA 2DM3A 3ECBA 5F7KC 3D2UB 1FNEA 3QH3B 4GAJL 3L3HA 1YEFL 5FECA 1DQMH 4XI5D 4UINL 3FB7B 4GXUM 2BCKA 1RZJC 1X4ZA 2EICA 1A3LH 1T7VA 1KELH 2HJKA 4OLYH 4WI5A 2YSSB 2OL3B 3AS0A 4BFEA 5CD3B 3D18A 4RFOL 1AO7A 1XGRB 1JP5A 5HHNB 5MP6L 2PCPB 3ECBB 1P9MA 2VXSL 3TA3A 3MV11 4QRTB 3HUJB 4L4TB 5HBBA 1KTRL 3IDXH 4M7KH 2VNCA 3VD9A 1BHGA 4Y7MA 3RY4A 4FP8L 5I16B 2W9LA 4Y1AD 5T1LD 1FVDB 1N26A 2O5XH 4AM0B 3U82B 1BGXL 3TBTA 1XF4A 4ZSOB 3MRQA 1KV3A 1QSED 1A1NA 1A5FH 3GSWA 4B41A 4TOYL 1F4WL 5EPMB 3DO7A 1N7ML 3OAZH 2OP4L 2GY7B 2IJ0C 5HYFA 3MRPB 3FQRA 1W8NA 4X6CB 4YFEA 3MXVH 4M93C 1HQRA 2JIXB 4YC2C 3DROB 1AD0A 2R69L 3VFUB 5EOQL 3N1QC 2Z92B 3CDCA 3O6KL 5LGJA 3B9DA 5C07B 3ULUD 2QJDA 3UXFA 2A83B 4OZHF 3PE9A 1Q0XH 2P49B 4K7PY 4K8RD 5KVDL 3QUZD 1EFQA 3D0LB 5LJYH 4G7VL 5CD5D 4PJBF 4WJ5B 4PG9A 2IFFL 4Q97A 3U9PH 1DBKH 5JXEA 4PRHD 2MWCA 1BOGA 1DCLA 4WU5A 5DJZB 1KIRB 2X4PB 2BFVL 4GG6E 3DVGA 4OCYH 1VSCA 1AJ7L 1FLRL 5DI8B 5BS0E 3HC0B 4OZIF 2WBWB 3EFDL 1JMZA 4BUGA 2I25N 3WNNA 1IFHL 3EGSB 1FAIL 5FUCE 1C5BH 2FEDD 3V6BR 3VFRB 3WXVL 5F7DA 1LE5B 2YD4A 5T3ZL 5FK9A 3UYRL 3WO3B 5BZWA 3NIDE 1CR9H 4YBLB 1MY7A 2HLFC 3CFJB 3HR6A 4XCEA 4JANB 3FQWB 4HWBA 1T0MB 2R1WB 1OTSC 5EWIL 4X7TA 1HI6A 3TBVA 5I1HH 4UV4H 5BV7L 2A73A 5HGBA 1EHAA 2IQAA 4G8GD 4NKDA 5I1HL 1SY6H 3VFWB 4L8CA 3WUWA 4LKCB 5C0EA 3WNKA 4KKLC 4ZO7A 1E27B 5FDYA 1NANH 3NFPB 3P4MB 4AT6B 4FNLH 3BGMB 5KVMC 3RJQB 3OJ2C 3PABA 3EYUH 1QYGL 3I6LD 3TJHD 3GIZL 2OSLA 5EOTA 4YDKH 1IGJB 1UM4H 4YPJA 2FR4B 4KUZL 4M1CC 2B5IB 5KVDH 4PJIA 4YDVB 2BY0A 2VDPL 3W0WA 5F7UA 3B43A 3H42L 4PRIE 4F7MB 3B8YA 4Y4KD 4Z76B 1T7YA 2W0FB 2IADB 2Y06H 3PWVA 2IALB 1RUMH 1AI1H 3BD3A 1GGCH 4GUPB 3MOBL 4NN6B 4Y4HA 5TF1H 4DOHE 2AJYL 3IDUA 1PZ5A 4LHQB 3FO1A 2HKHL 4F7CB 4XVJH 2FH6A 4MQSB 4NDMB 5J12B 1EVTC 2EDKA 4JO1L 1NUNB 4O51A 1HEZA 2I9TA 5E7BA 3PWUA 5ISZE 3D6GA 4JEGB 4PJ7A 2MTPA 2RQ8A 1R5VA 3MNVB 1CGSL 3RX7A 4XWOC 4G6AC 2BNRD 3HB3C 1G9EA 4MWFA 5EU6E 4QY8A 1IMHC 4EIZC 1ZLUK 3OTTA 1DQJA 5FHBL 1JFQL 5ESQB 1HKLH 1LQSR 1P69B 1KN2L 3MRRB 4Y4HC 3QCUL 1NBVH 4PRDB 3P4NA 1NANI 3C5SA 2DQEH 2Q20A 3GSNA 3O3DA 2VDMH 3KPRA 1C08B 1NMCB 2WP3O 2VDNH 1SBSL 4IRZH 4UAOC 1J1PH 1KCVH 4NKQB 4ELMF 1YN6A 1EO5A 5BJTA 1CXFA 4GW5B 2YUVA 2G5RA 3SJVA 1SJXA 3L3IA 4K2UL 2VKXA 3X13A 4BQCA 5GS2D 3SKMB 4ALAL 4MAYA 4DGVH 2DTML 3OKEB 4I1NB 3SKMA 2GITA 3RPKA 1A4JB 1Q1JH 2YS4A 4WDIB 2XXCB 2CDFA 1DBBH 2AW2A 4TNVK 1OGAE 4NCDA 4EXKA 4GMTH 2VDLH 5KSBB 3LCYA 2HA1A 3CCHA 1N2RA 3DVFA 3HZMA 3CFIC 3DUSB 3RPIB 3HE6B 3HE7D 3BP6B 2A6KB 4ZD3L 3EFFA 4K8RC 1S9XA 1QLFB 2WIIB 3WNPA 4UV7L 4DVRH 2FZ3B 1UEYA 3U0WH 5I18H 2C1PA 1JZ6A 4L4TE 1C16B 4K9EL 4LLAA 1DQJB 2D7OA 2WIMA 3KJ6H 3WDIA 3NN8B 3RVXD 4P9MH 4OM0L 2DYPA 3CFKB 4ONGL 4NYLA 5IHZB 2NY3B 4NP4L 4CMMB 1JVKA 4IIQA 5D7JA 4NQVA 3WL9A 3DVNB 3AS3A 2BOCB 3OKDB 1I9IH 4D0BA 1U3HB 4JM2D 1KT2A 3LKRB 3MJ8A 3QNYB 2XKNB 3T0EB 1PLGL 4OFIA 3L7EB 2IBZY 5B8CB 1D6VL 4M1DL 5T1DH 4PJEF 4TVPD 1CQKA 5T1DL 4AJ0A 3GGWA 3AY4A 3CD4A 5C6TH 1BBJB 4NWUH 4UDUB 1QLRB 5I8OL 4XAKD 1D5MA 4F7EA 4OF5A 4XNUH 3LS4H 4UT9H 2AJUH 1CWVA 4JFDE 4MA7L 4N8PA 3L5HA 4FQXC 4PBXA 3VXSD 4PGEB 2DTMH 4QXGH 2JJSC 3VRIA 1EEZB 5D93C 5I1GH 1NCBH 1K9TA 2OR8A 5BZDB 5EU4B 5I1EL 5JLZA 1EEUA 4XBGB 3KLHC 1J0ZA 2XTJB 2W9EL 2F53E 3AC0A 2HTKD 2O5YL 3T0VA 3FQWA 4RMUA 3D69A 4XCEB 3VGAB 4LP5A 2DQJL 4DEPC 5A40E 1JWSB 4ZNEA 2MQCA 4LCYB 5GZOC 3V6ZB 5IJKC 4RX4D 3QDGD 5D1ZD 3KDMB 5JXEC 4QYOB 5E2JA 2G60H 4FZ8H 3D48R 1OOAA 3MFFA 1FHGA 2QLVB 2EZ0C 4X9FA 1TPXB 3FRPA 1MAMH 2J8UA 2YWZA 2AV7B 3BMVA 3IJSA 5JORB 6FABL 1U41A 5DA0B 2CRMA 5JPNA 3D25B 3RX5A 1A7PH 4MQTB 4HGWB 1ZEAH 1FFNA 4GXVL 3CC5A 1A7QH 4L5FL 1VFAB 2QR0B 4RA3A 3BGFC 5C7XL 4NZJA 3OKDA 4U0RC 2XXMB 2BHUA 4I0KA 2JJTC 2A74B 3VWKD 1EZVY 3FQNA 4M3JA 3VXRD 4F9PA 4L3EB 3IKCA 3B2UC 2J5LB 1KB5A 4DZBA 2VC2L 4KV5E 4KROD 4EI6A 1LO4H 5IB5A 1OP5H 1DANU 2M2DA 5SX4H 5T1MA 1C16A 4OF8A 2X4UB 1KJ2H 3MLZL 3HMWH 2YZ8A 2ZG2A 1TJGL 5IG7B 1CLZL 3F6IA 4XGZA 4PJIE 2GTWA 5JW4M 2VQTA 4P0DA 3RPIA 4LK4A 2J4WL 1EDQA 2AJYH 4HKZA 4X98B 4ZFZB 4NZTH 2FO1A 3GBML 3EYUL 1AI1L 2LTQC 3L3KA 4E0RB 1YYLH 5IQ7L 4JPWL 3SDDB 5F7EH 1YC8A 4KK9C 1D9KC 1DL7L 1NDGB 3ZKMC 5C0RL 3HRPA 2DI9A 4R0LC 4NM8L 4EN3A 3I6GB 4U0QB 2X4QB 3GMNA 4PJFE 1KCSL 3BP4A 1YEHH 5AEAA 4K07A 2EEBA 3QFJB 3D85D 3LPWA 5B38B 3TN0B 2AK4B 3MRRA 1X7QB 3K80A 1NCCL 4X99B 5GISH 2P8PA 1CYGA 2HLAA 4XXDA 3QIBA 2VTFA 4RSVA 1T2QH 1G7LA 5E94A 3GSQB 2FYYA 4JPKL 4JY5H 4JFEE 4JQIH 4I0PC 4JLRA 3H3PL 2OTWA 9CGTA 3KYOB 2CKBL 3PGDA 3QUKB 2GT9B 3DMMD 3TWCL 1FZKA 4PD4K 4HUUA 4N90D 4OCYL 2Y7QB 4R4FL 1A6UH 1NCDH 2A38A 4O2FB 2GEEA 4Y4FD 5CBAA 1SJEB 5EUOF 1TLKA 3BKCH 4XBPA 3V6FA 4UB0H 1CFSB 3OAYH 1YYMH 3DX6B 1HNFA 3WXVH 3HMWL 2B4CH 1HDMA 5FYJH 3QQ4A 1WIOA 3LKSA 3CGTA 5EO9B 2IANA 3QPXL 1UJ3C 1CTOA 1EXUA 4FQ2H 1ZLVK 4JLRB 2NY4C 4KQ4L 3SGJC 5D2LE 2ZUUA 5GQBA 4NQSA 4TN9A 5F1KC 5AAWA 1ED3A 5DJXA 3NGBC 3HE7A 3VG9B 2MJWA 4M7KL 4MJIA 4D3CL 1H15A 4J3WA 2I60H 4YR6B 5F97E 2CKNA 4PD4J 3OR7B 5EO1A 4GBXB 2WAHA 8CGTA 1KLGB 1IBGH 1XCTA 1T1YB 1BJ1J 4KPHL 4OCXL 1E4XH 4NKDB 1ND0A 5E1AA 3VG0H 2WBJC 3GHBH 1NDGA 4LLYA 2G2RA 4ZUUB 1FVEB 2FCBA 4HUXA 1JYVA 3O6FB 4U33A 2VN4A 1NMAL 4WV1A 3TC9A 1ODAA 3BDXA 4WI8A 4OIIH 4L29B 4YXHL 1G7JB 4P23C 4ZFZA 2R4RH 3ARGA 5B39A 4ZFOL 2ZUWA 1VGKA 3KPMB 3LZFH 5E5UB 2I9LA 1DUYB 1NCAH 5HHQB 1A3LL 4ZQKB 3MRKA 1JPST 1GGYA 4KHTL 4EEEA 1IKFH 1NSNH 3E6FA 4KROC 1BVLA 2A6JB 5E8DH 3GBNL 1ORQA 3QDGA 2EC8A 4M1GH 4RWHA 5DI8A 1A4KA 4OAWB 1A1OA 1DN2A 3BPOB 1NCBL 3B9VA 2I07B 1FNAA 1TMCB 1JGVL 1TQCB 5DK3A 1XH3B 2I9LB 5LGHH 2D7TL 4JG1H 3QI9C 5MEQA 4NQDB 4DVBB 1XH3A 2FIRT 3MCG1 3S3PA 4PJ9A 3O41B 5IR1B 3UAJD 2O61A 4LLVA 4MQ7B 4GRLB 4RFEB 3GKWL 4W68A 5HGAA 4P2RA 4P2QB 3FTGB 2ZUVA 4N9OB 2R0ZH 25C8H 4RZCB 3QIUC 5GGRB 1XZ0B 4UINH 1MF2L 5I71C 4OFVA 1KTDA 1SYVB 4LCCA 3RUGB 3BHBB 1IAIL 5I30L 1QOKA 4M1DH 1JPGB 2VLRB 3FZUC 5FGCE 1I8LC 3TVMD 5HHQA 2H26B 3R1GH 2V9QA 2A1WH 4KWUA 1H8NA 1BBDL 1JPFB 3WFBH 5EO1B 4FN0A 2F8OA 3JWDH 4JDZA 4M5ZL 1UH2A 2EIZA 3SGDI 1IC1A 2CSPA 4Z7UA 3VXME 3OKKA 1KULA 4G6JL 2FX8H 2K7QA 2EDLA 1JHTA 3QXDA 4Z7VF 1LE9A 4LCIL 4JPIB 3PQYE 1U8QA 4QTIH 5AWNH 4FQXB 5D7IF 5HVHC 5CP3A 5K9KA 4M1GL 4YPGA 4U1MA 1WICA 5LBSL 3EO9L 3O2VH 4OFYA 6CGTA 1I3RA 2E7LA 1GVIA 3CU1A 5TE7L 5GS0H 3RU8L 4MNQA 1E6OH 4ORGB 3MNZA 1FLTX 2BVTA 1JRHH 3P30L 1G9NL 1PVHA 1S7UA 4PJEB 4HWEH 4R97C 3U79A 3K0WA 5JA8B 2B5IC 2HJKB 2BY3A 5J1TC 4OLUL 3OR6A 2DJUA 4UDUA 3HZYA 5B8CC 1IGFL 3G6DH 2BNRA 4PY7B 3T0AA 1NCTA 1VACA 4PFEA 4NGHH 4X99A 2ZSVA 3AMKA 4LPXA 4HUVB 3JWDC 1CQYA 4MJ6B 3AFLA 4P59H 3FQUB 3MRNA 2XFXA 4I3SH 4HBCL 5EU6B 5F88B 1CXIA 1CGSH 3ZT7A 1HOCA 1QSVA 3DBXB 3N9GL 3KPSE 5D8JL 1MCEA 2XPGA 5CHNB 2DIBA 2ZCLH 4XAWH 5DJ0B 3CLEH 3GI9H 5KVEH 2V2WA 1U3HD 4IIQB 5DSCA 3BRGC 3RWEB 1TTUA 4PJ5D 2XTLA 3MLRL 4YJZL 4AIOA 4BQ8A 3RGVB 3TO4C 1F6LL 1KIUA 2ATKB 5A2IH 1UZ8A 1CFVL 3KG5A 1W72B 3IDMB 5CEYB 4OZHA 2RIKA 4I2XB 1Q9KB 2DD8H 4L8BB 5E5MA 1GZPB 2HH0L 3GIZH 4F3FA 3K4ZA 5HHXH 5IT2H 1AGCB 1V5JA 1A3QA 2C1OB 1YY8B 5JHDA 2D31B 5HPOA 2WLYA 5JHDB 4FQQB 1F11B 4KZEL 3IDYC 1I1AA 4MJ5A 4LGSB 2NY5L 4JO3H 1I1FA 1KB5L 1JE6A 3D87B 1RUML 4IMLB 1FDLH 2CDGA 3JZ7A 3MRBA 4BYHA 1L0QA 4YHLH 1Q9LA 3O3AA 3WJLC 3F58H 1W8OA 1F90H 5IGXL 1OSZA 2QSTA 5E70A 2G9HB 4X98A 1T5WA 3OB8A 1CICD 4OCWL 4M48H 3KPNB 5A2KH 2VXVH 5MENE 4NM4H 1UACH 3D2UD 4ODVL 1JWUA 4UOW0 2VLJE 3RRQA 3TVMC 2DMBA 3K4AA 5L2KE 3GM8A 5CUSH 3P4NB 3VXUE 1S9WB 2EH7L 4XPTH 2J2ZA 4I2XA 5HDLA 1YNTA 5DC0A 3KVQA 2CR3A 5ENWB 5F9AC 5I8EA 5IIEB 2BVQA 4G6AD 1JZ5A 1EH9A 4LCCC 4L3EA 2NNAA 4ZUTB 5DQJA 1BQHA 4JO2H 3FFDB 1JTPA 2BOBB 2XWTA 3HC4L 3V6ZA 2ZPKL 4TQEH 4HUNB 2NZIA 4R90L 1N4XH 5C7XH 3VXNB 2IMNA 4JGJA 2RFXB 4J3TA 1PY4A 1FFNB 4KKNA 5HYSB 5F7HA 4HD9A 1D5XB 4U2ZA 4P57A 3VJ6A 4NFDA 1IAMA 1NGQL 4JFYA 4TRPL 2W60A 1PKQA 3MOQA 1Z9SA 1KOAA 1GYAA 1CGVA 4BFBD 3MFFB 4X7FC 3RA7L 2IADA 4PY8I 4U05A 3LV3A 1U8QB 4PGBB 3STZB 5FKPB 1YNKL 2VIRB 1EEYA 3C5JA 3ARFA 1UYWL 3U4AA 4IMKA 2VLKD 1JJUA 2ZKHH 3C60B 1G9NH 2CK2A 4QXUL 5C07E 2K1MA 3R0MA 4Z7QF 1QRNB 1S3KL 3QDHA 4KAQH 3RZCA 5TE4H 1SVCP 4PBWD 5F6HJ 1S7QA 3IFPA 3GMPA 1UQSB 3VXQB 3T3PF 2SEBA 1S7RB 1BBJA 4CVXB 4KMLB 3ZMRA 1E27A 3MRCB 1FYTD 1FCCA 2XTJD 4XPGL 2VLJB 3BWUC 4FQXA 2P8LA 2XT1B 5D1ZA 4O58H 3ULUL 3ARVA 1G0YR 1VKXB 5F3BA 5FIEA 4FOMA 5I1KL 1S7SA 2Z35B 1KN4L 3K1KC 5TQ0H 4FABL 1HQ4B 3RKDC 3C2AH 3G6AA 1CG9A 4ZMAT 3SOBL 4Q9CA 5CCKL 2R56L 2OP4H 4LDOB 1F45A 4D9LH 2A6DB 5DRXB 3LDBB 4ACPA 3GJFK 1DLFH 5MEOB 5FK9B 1NLBH 1RULH 2NY4D 3KPLA 1X6NA 3WJLA 2EDYA 4DW2H 4G8GE 1J10A 1WBXA 4MDJB 4LLWA 4H0GA 2O5XL 3L5XL 5B8CA 4MB4A 4NPYB 1N4XL 1XZ0A 3P0YH 3MOAH 3ELAT 2FWOB 2PETA 3RTQA 3RL1B 3OGCB 4QXGL 3MRKB 3QEGL 3U30B 1CT8A 4MHHI 3BP6A 4UUJA 3DIFB 4YBHA 1E0OB 1A21A 3GJEB 5CZVL 5D7JB 3WL9B 4WJ5A 3IXAA 4QHUB 1MHEB 4LSVL 2AXFB 1OL0A 3F62A 3QJFA 4OCNC 1M7IB 1X4YA 1JGVH 1A4JA 1PG7L 5DUBA 4ETQA 2KUTA 2CDGB 4N5EC 4RMWA 1TZIB 2QQLH 2DLHA 2GAZB 4M48L 1U8LB 3MRGB 3V52L 4ONOA 4NUGH 4XNYL 3AAZB 4Y16A 1F11A 1QFHA 1TENA 1V7NL 3BZEA 4MDIB 5KG9A 3KLAB 1YY8A 2YXFA 1JHKL 5GS1A 3V0VB 2BVPA 3CCHB 3NCFB 1AGDB 1ZVSA 3PXHA 5C08D 1Q9KA 4L8BA 3DSNA 3QJHA 4TSCH 3MODH 1KYOJ 4FFYH 3U0PA 1JNNH 4WCYH 5FO9A 3VH8A 3BIBX 3C6LB 3P3YA 1QFWM 4ZOEA 1VFUA 4OJFL 3HNTL 4ZUSB 3RI5K 1OB1A 1KJ2A 2YMXL 4HS8H 1AQKH 1GHFH 4CVZB 4XMPL 4I3RL 5F7MC 3KJ6L 3N06B 2NR6D 4OIIL 5D1QA 1IJ9A 2FJHA 3HI1A 1E6JH 3QQ4B 1MAKA 1V05A 4AENB 2AP2A 1MCNA 5JIPA 2A6IA 2D7QA 5DO2D 4F15B 4M00A 1H15B 5JQHC 3UP1A 1PZ5B 1BZ9A 2QHLA 2XWJB 4N0UE 4O2CB 5CS7A 2A77H 5DA4A 4OGXH 3MLXH 4IRZL 2Q1EA 3O9WD 2H32B 4R8WL 3S98A 5DWUH 1YJDH 2YSSA 1MFCH 4NRXB 4JFDB 3VW3H 2EDOA 1QSFE 4WIQA 3LKSB 4W70A 1NEZG 1YPZA 1UYWH 1WZLA 4OLXH 2R8SL 4KQ4H 1CD0A 4HIXL 4OLUH 4XVJL 3H9HB 3HAEH 1MI5B 5F7FA 5F9DC 3BGMA 2AXHA 3B4NA 1P6FA 1XF2B 5D7LE 1FZKB 2VABA 1ZHNB 1CGWA 1A14H 3CSYB 5DO2C 2NW2A 3W2DH 3B9KD 2P5WE 4MD4A 3O3EB 3AM8C 4OZFB 4YXKL 1SM3L 4UQ2B 1HSBB 1IC4L 2WM0A 4LSPH 5HYJA 1IGML 2UWEE 3A6CL 5F71A 1GGIH 4LRNL 3GSRB 4KJPC 4RMSA 3U0PB 5MENB 1TVBA 3ARGD 4LSUH 1AGDA 5ID0A 5FO8B 3GMOB 2AQ3A 2AABH 3AB0B 5JA9A 4F37F 5F21B 3SDXE 2NY2B 3I6GA 4YBLC 4MDIA 1TZHA 2HTKC 3NFPA 3SDAC 4PLNC 5KG9B 3BZEB 3VFPB 5IBUB 1JPGA 2C4XA 1KCUL 5ALBL 1XGUB 3LN5A 3ZSTA 4AMKL 1QYGH 3RX8A 5C2UB 2EH7H 2GAZA 1HI6B 4R90H 2D0GA 4JFFA 4ZUVA 3MLUL 2EYTA 1GSMA 5TE6H 2F19H 4DTGL 5KVFL 5TGBB 1LP9A 2IMMA 3U1SH 1NBZB 3BGFB 4OZGF 4FQXD 3MYJB 2UUDH 4MA3B 1MEXL 1KTKE 4M5YL 4DZ8A 3ARRA 1UA6L 5IFHL 4WI3A 4KI1A 2J4WH 1UWXK 2FL5B 2DBLH 3SDAB 5DMIH 1S7VB 5ID1B 4UU9A 3QFDA 2DMKA 2MFNA 3FOLA 1IGYB 5DMIL 4ODVH 3MLVH 1GIGL 3EUUA 5EU5B 3GSXB 5JPNB 1K4CB 4UTAL 3GHEH 2Q7YA 3KXFE 1F3DJ 3UTSA 4UT6L 3SDXF 2YPVH 3JXAA 5IB1A 1TJIL 5BMFL 4JKKA 3RVWD 1L9MA 2JF1A 1BAFH 5I0ZA 1M05B 1KYOK 5HGHB 1KG0A 3MO1B 1VENA 2UVEA 4UMGA 3BSZL 3HAEG 4QRRE 3O6FA 1ACZA 1I8KA 3RKDD 1A7PL 3QIUB 3GSOB 4V1DD 3WE6B 2R2EB 3P9WB 2PYEA 1G0DA 4X6DB 3BWAB 4LPCA 5BVJB 2X4RB 3ZKMD 2AS5M 3SOBH 1K6QL 4OQTL 2SEBB 1FYTA 3MV7E 2C3GA 2CXKA 4DKDC 3GSVB 4Y88A 4YLQT 1FFOB 4EI5D 5C1MB 1NDMA 2WWKT 2ZJSH 4OI7A 1T04A 3RNQB 1P9MC 3TA3C 3O4OC 3RL2A 2W9DH 3DUHA 1QFOA 3ZDYE 5EIIA 3UYPA 5HDBE 1XF4B 4ZSOA 3ZKXC 4Y5YA 3TNNA 4X6CE 1KEGH 2I27N 4KY1L 3HI6L 1GL4B 3QNXA 3QUMA 5H37G 4YHPA 3V0WH 2DLEA 2G75A 1QEWB 4KHXH 1FO0L 2Q3ZA 5IROC 2KQNA 4FZ8L 4NT6B 4WEUD 5HYSA 2MQ0A 4PB0L 4YHKH 4UNVA 4JVPA 2Y72A 1XF3A 4HXAH 4F7EB 4R2GB 2VL4A 2VXSH 1KPRA 4FP8H 2ICES 3BP7A 4S11A 4RFOH 3H2WA 3UO1L 3GZKA 1KGCE 1J7VR 4HFWA 2F5AH 3DVNA 4LSRL 5DZNA 2BCKB 4QCIB 2DWDA 3BZ4B 4H20L 4ZYKA 4Q6IA 4AQ1B 4MXVF 4MXQC 3EOTH 4RMRA 3MREB 4WTZG 3ZYJA 1A0QH 2VZSA 1D6VH 3Q6GH 2UZYB 3TN0A 4QWWD 4XH2A 4XXCC 5J3HC 2O5ZH 3VXUD 4G5ZH 4G8IB 1BF8A 2X4QA 3LKRA 1J11A 1MHHA 3MJ8B 4FXLA 4HH8A 4OJFH 3E8UH 4PJCB 3LS4L 3MC0A 1DUZA 3LKNA 4NHUA 5DEGB 3MRJA 3DGGA 3RWDA 4NJAH 3IETA 2OTUB 1OSZB 4PJDA 5IMLA 3T2NH 3DGCR 5ETUB 3TT3L 3QG6B 4QRPB 4XRCA 3DRTA 5HVFB 1PLGH 3R4DA 4NSKB 4WDIA 4IRSA 1F58H 5DUPH 3GRWH 3IRPX 3OKEA 4XAKE 4N90E 4JAMA 1EO8L 4EQ2A 1I1FB 2CR6A 3B83A 3FB5B 3P9LB 2VJXA 5DD0L 3V5HA 4Z7VA 2QSQA 4LL9A 3CIQA 3M8OL 4E9LA 2R4SL 4U1JA 1LDPL 3HE6A 4Z0BH 4XGZB 3SDCB 5F3HB 3D85B 4UIKH 4O9HL 5DQ9B 4K9EH 3L5IA 3DTXA 3T65B 2E27L 4NRYA 4Y4KC 5SX5K 3MRLA 3V5KA 2F53D 1T22B 4KV5F 1UZ8B 1F13A 3LQMA 2IAMC 1OTSD 2OBGA 4MAYB 1QZ1A 2EIBA 1XCQA 5DJCB 5CJXA 1KIQA 3RNKB 4PJ8B 4LAQH 3BN3B 5IBLD 4P46C 3SY0A 5JMRA 1NGPL 3WHE0 4I0CC 1INQB 1A2YA 1RZ8A 3QQ3A 5I19H 3QDGE 1NMAH 1PG7W 4YNYA 3RUGE 5ICYB 2AEQL 2VAAB 1T20B 3MLRH 3RKPA 3D25A 4F7CA 3BH8A 3GEWB 3VG0L 4O02L 2JELL 1NAMH 3SKOB 3CZJA 2XRAL 5L88L 1NFKA 3HZYB 4YE4H 3QCTL 1Q1JL 1YQVL 4UT7H 1F6AA 5CJOL 5IKCB 3E0GA 2P1YA 4WHCA 4WENB 4M02A 2DLTA 4OUUA 4IDJH 3T0BA 3C9NA 3T1FA 2EDHA 4LVNB 5BS0A 3EDDA 1KCVL 4HLJA 2F54B 2FRGP 3EDKA 4PLJC 3HTLX 4WHTA 4X5WB 2Q8BL 5IFJA 4HDIB 2VL5A 3RZCD 2Q8BH 4WUUE 1XGYL 1DBJH 3VFWA 4N0FB 2IQAB 3WXWL 1OAYH 4EJ1C 3LOWA 1OP3K 4FRWA 1RZIA 3H42H 5FB8B 4WFHD 1B2WH 4PP1C 4ESKA 1RZKC 2JCCF 5FGRA 1FZMA 5C0GA 1I8MB 1GC1H 1RAMA 1RK1A 3L3OB 4S0SD 4MAUL 5C0IA 3L9RA 1MQKH 1FGVH 4M9PA 4G6KH 3D9AH 3IJHA 1FFOA 2H26A 5DURB 4DN3L 2KKQA 4OCRH 3G5YB 4LCWE 4PJHB 4D9RE 1T0PB 3BESR 2R1WA 3FRUA 1BZ7A 2XY2A 4N1EA 4MQXC 5HYQB 4LHUG 4XC1L 5CZXC 5GRWA 1ZV5A 1LNUB 3QNYA 4ODSH 2D4FA 3LMJH 5KSUA 4DVBA 4K7FB 1BECA 2NLJA 2XN9D 5D7KE 2PYEE 1BM3L 1JYWA 4GQPH 2VXQH 2MCPL 1WQVT 4XMKH 4PJHE 1SVZA 4I77L 4CU8A 1NFDB 5FYLE 1YEHL 1CD1A 4Z8FL 4I77H 5CZKA 5GGVL 5DS8B 1RUAL 1Z9OA 4M6AA 3PL6C 3ZL4H 5DURD 3U4BH 3RVTC 1IQDA 2CIKB 4MB3A 1NMCC 4FZEH 5DJ2A 5L0QB 5LQBL 4ZSOE 4NC2B 4NZUH 3C08L 3FT2A 1I1CA 4FQ1L 3EJJX 4X6CA 4POYA 1MLCB 4HUWA 1MCWW 4X6DF 3U9PL 3BVNA 1PX3A 1J8HB 1MJUH 2F5BL 3I3EA 3OG6B 1CR9L 4PRAB 5C6PB 5L9DL 4HFUL 1M7DA 4PRPB 1SYSB 1T4KA 2H3NA 4Y5YC 1F4HA 3NCEB 2VOTA 4HJGA 3AXLA 4BZ1H 1MQKL 3TV3H 1FVDA 1MFBL 4YEEA 5CCKH 1BQHG 1XR9B 4RCAA 1T1YA 3GMRA 2AEPL 3TO2A 1G6RL 4UOJA 3VFPA 1DBML 3V4PL 4Z7WE 4DN4L 3DMMA 32C2A 4X8JB 4ORZC 1NGWB 1XF5B 4NKIH 4PRIB 2PN5A 1G6RB 1VADB 1A1NB 4XVUD 1RK1B 3L3OA 4WY7L 3HMXL 5ABDE 5MENA 1ITBB 5D72L 4YHZL 1A6WH 3WNMA 1JF5A 4HZLA 5H37H 1QFWL 2H2SD 3L1OL 3O0RH 1YN7A 1RV6X 1OP5K 5I1JH 3VXUA 4JKMA 2IPTL 1RHFA 4G9FE 4Z5RB 2VABB 4L4TA 4NBXB 3VW3L 1QRND 4GS7C 4C56D 2IAMB 2R1YB 1ADQH 1RJYB 2PCPA 3KJ4B 1OPGL 3LB6D 3Q3GB 5BS0B 2CPCA 3F5WB 4WO4C 4P2QE 4Z7VE 1EFXD 1NBQA 43CAB 3KYKL 1IGIH 3DXAD 2P45B 4C54A 1T66C 1FL6B 3PG2A 1M71A 5FGCB 2OS7A 1YPZF 2BJMH 4O2CA 1MVUA 4JDTL 4LAQL 2B1HL 1VB9A 3FT4A 4PRIA 4BZ1L 1T89A 3HNTH 3FL7A 2AEPH 4HBQA 2A9MH 2NXYD 1K3IA 4M7LH 2NXZC 4I4WA 1EGJA 4KK5D 2YUZA 4ENEC 3TBYB 3LN4A 3L3KB 2GYSA 1UXSA 1BREA 2W07A 4XP9L 5E6ZA 5C70A 1V7NH 1M7DB 4JG0L 4LLDB 4PRPA 3BE1L 4JR9H 4F9PC 3OGOE 4M7ZB 4MCZA 4XP5L 2B4CC 1C8PA 3BN9D 4WU7A 3HMXA 1CU4H 5KOVC 1U91A 1MREL 2R2BB 1R24B 4H8WL 5L6YL 3C87A 3C60C 1HWGB 2F54E 4JO3L 3U4BL 4UIMA 3U30C 2VDRH 2OLDA 1SYSA 1T4KB 1YEJH 4J4PA 5F9JA 5IF0B 3LSOA 2DM7A 2R2CA 1NC4B 4ONGH 1BEYH 2VDLL 4R2GD 3SJVE 4PJAA 1U93B 4ZTOL 1RZFL 2P48B 5DEGA 3PHOB 1CN4A 5J9PA 3FO2A 4UQ3B 4UUJB 4RRPG 4IJ3C 4I3GA 3TFKC 5M95B 1U9KA 4H26B 1A64A 4QRSA 3PXJA 3QHFH 3ARBD 5GGUB 1HYSC 3IVKA 1ZWIB 1J88A 4CDGC 4YXHH 1EO7A 1PYWA 4YBQD 1RIVH 2BSTA 1AR2A 3BH9A 1NFDA 1WCBA 4JREB 4U6VL 4OBSA 1Y6KR 1ZHKB 3LEXA 1SEQH 1I1YB 3SCMA 3QZWG 2R8SH 2PTVA 1T6VN 3FN9A 4ODUB 4TUJA 4OCLC 3OWEA 5D1QC 1DVFD 2R29H 4OTXL 1BF2A 1GC1L 3GSWB 2ARJA 4K8RH 3ESUF 5GXBB 3ESVF 4ZFFB 1DVFA 1FVCB 1RIHL 2ADGB 4Y1AA 2VDML 1HZHL 4ZDHB 1QNZL 1RVFL 1V3KA 1SY6A 1AGBB 3SKUD 5I76A 3KHQA 2GHWB 2DJSA 4KTEH 5JLZB 1Y18A 1KPVB 3P30H 2R9HD 4Q6IC 1KPVA 3CUPA 3A67H 4FTVB 1OAXH 1S5IH 1I7TA 2Q76B 5GGSB 1G9NC 3WLBB 3E6HB 4OFDA 3QEQE 2MCG1 2R1XB 5E2WL 5T3XE 1BIIB 5HD8D 2LV4A 3ARED 5EIIB 5HHNA 2WW8A 1BIIA 1ONQA 1ZA6A 1AXTL 2ENSA 2OK0H 4NQCD 3MPCA 1CD8A 1MFEH 4OFKA 3ZYZA 4DCQA 3F6LA 2YD8A 1EEYB 3HZKA 3QHFL 3ALXA 5EZIH 5IKCA 4N0FA 1JNNL 4L8SA 4PJFA 3WLWD 2BSTB 4IRSC 1NGXA 4Y8AA 1MCQA 3L95A 3Q1SL 4M5ZH 1Y0LA 4HAGA 4PGJA 4KGJA 2XG5A 3CVHL 3IFNH 4WI4A 4Y1AB 1BBDH 4ZFFA 5L8JB 5CMAA 3JV6B 4X7SL 5C6TL 4LEXL 1N5YL 5D6CA 4NUJB 5EC1A 2YUXA 3NBNA 3TM6A 1GIGH 3TVMB 3VXOB 3D5OF 5CSGA 1ZS8A 3EYFB 3HNSL 4XVTH 3TT3H 4LQFH 5E8NA 5FUZL 2C1PB 1I7ZA 1I7RA 1UC6A 3T77B 1OW0C 3BI9X 4EUPB 3JV0A 3BH8B 1NH6A 3QR2A 1FNSH 4Z7NF 4H0HB 2VLLB 4BSVA 1BQSA 5FYLL 3EFFB 3MBEB 2L7UA 3SDCA 5E8OB 3UX9B 2ERJB 2BSRA 5SX4I 4HPOL 3RWFA 3Q6FB 1AHWB 4FQJH 5E8DL 4G8FB 1UFUA 1PDKA 3OAUL 4PJ8A 3STBA 1VEMA 2ORBH 3X12A 4MJIE 3DX7A 2WUBH 3QI9A 3MROA 1JRHI 3X12B 4UIMB 4MZ3A 3MV9D 2Z9TA 3U4EA 5I1AB 5HHPB 2ZUYA 3P0VH 2VE6A 3I50H 1DBBL 3LHPL 1KJMB 2NY7H 3ZYOA 5E8EA 3LKNB 1KN4H 4QHKJ 3NABL 5D2NB 3TIDA 2R2BA 3JWOC 2FJFA 1R3LA 1JZ3A 2ERJC 4NNPH 3VH8G 4H20H 4JDTH 3P9LA 4Z7VB 3V5HB 1Q8MA 4IRJD 3TYFA 1A9BA 5E8NB 2R39A 4EIGB 4MWFB 3RDTB 2WQ8A 4HXBH 1QO3A 4IRJC 5EFIB 3ES6A 2ENYA 43CAA 1XR8A 2K3TA 1WBZA 3O3EA 1DUZB 4NHUB 3MRFA 4PJCA 1MAML 3CMGA 5J06A 4PJAF 4K94L 1E4XI 2R23B 3PUCA 1XF3B 4LLUA 5FV2A 3MRDA 3MJGX 3WFEL 1OM3H 4PRPE 3FONB 4KI5F 2VITA 1EIBA 5FM5O 3RDTD 2IALA 3BXNB 3PV6A 3BPLC 3OQ3B 3LEYL 3SO3C 3QNXB 4M6NL 4ONFL 4PP2B 3MRIA 1T1XB 4IRJB 3TZVA 4QF1A 2H2PC 4E42A 2AJ3B 3BQUA 1IGJA 3EO0A 2IBBA 3MSPA 4WFGE 5F7YC 3UBXI 2EYSA 1MJJB 1T21B 3I50L 1VADA 2CGRH 4ORGA 2R1XA 4ZO6A 1RJYA 3EYQD 2P5EB 3MV7A 5JUEH 3LEVL 4OLZH 4GAFB 1ZXQA 2GSIA 1KEMH 1BFTA 4XWGL 4GKNB 1U8OB 4MA8H 1MFBH 3D3VD 4JRXB 3HPLA 3D39D 5J7CC 5INCA 2XQBH 2K7PA 1AY1L 3VXMA 3G08B 1DVFB 4JANA 3V9FA 4P5TD 4APQB 3EDFA 5EOCH 3VXMD 4XNQA 5F1IB 3V5DB 2EO9A 4NUGL 4XNYH 3GSNL 1BAFL 4U6YA 1EJ6A 4XC1H 1I1YA 3SCMB 3UC0H 4IBLT 4PJIF 5E0QA 5DVNA 3M17B 4GKZB 1CDIA 2F58H 4NQED 2PYEB 4ZTPH 5KS9F 5FUZH 5TFSH 2PYED 1I8KB 3WN5C 2EECA 4PTUA 3S3SA 3REWB 3ABZA 4PV8A 2OXGA 5FYKH 4JM2A 1H3XA 1OQXA 3LQAH 1MNUL 3SCMD 1FCGA 1QSFD 4WW2F 5I18L 5A16A 1KB5H 5FDWA 1KLUA 3BKYH 3LIZL 3V4UL 3V6OA 1WGOA 4F57H 1ZMYA 4L4VD 5T5FH 1I7UA 3RL1A 4RA0C 3ZKND 2P5EE 1UM5L 3QEQA 4EI5C 4PPTA 3QDJE 1JYXA 1A14L 3KPSA 5HHOA 4KTEL 4GSDH 4X4YB 4HULB 4G7VH 1D5BB 1DR9A 3HRZA 5ID1A 2GQHA 3T09A 3ISWA 2WP3T 4DKEL 3QG7L 2E6PA 4XHJD 4P2RD 3VI3E 1HHKB 1KENH 4KPHH 3G6AB 4OZHE 4OGZA 3QDAA 3FRUB 3Q48A 2EEDA 2V5YA 2YA0A 3AGVA 4YGVA 4LDLB 2WWMD 3WO4C 4HWUA 5EB9A 1PJ9A 1U8OA 1M6OB 2P8LB 5D1ZB 4NGHL 4XTRC 4P2RE 2NY0C 4HV8A 1UZ6F 2QKIB 4OZFH 1IAKB 1EAPA 1I9JH 3PNWA 4F15C 2E9JA 4Y5VB 1S8DA 1U8KB 2BX5A 4KRPC 2ICEB 1QRNA 3WHXA 1I8MA 5DT1H 1P2CB 4WFFD 4NQXA 3UEZA 3IDXL 4JQVA 2XA3A 4GRWH 3DLQR 3FB7A 1P4IL 4JFDA 4P4KD 3OPZL 3BJLA 4UBDD 3STZA 3RWJB 4MJ2A 4U1LB 1JF6A 4Z7UE 3SPVA 1KBGH 1G7HB 3QH3A 1WF5A 1CFTB 4K3GA 3D2UA 2LABA 2Y06L 4O9HH 4L8DB 4XBPB 3V6FB 4KMTH 1RU9L 3ET9F 4J1UB 5CSZB 3X14A 2R23A 4BSWB 1D5XA 3OXSA 3C9NB 5CSZA 1V8HA 2CUMA 3MRFB 1WBZB 5EOCL 4QRRB 5DDHB 3GO1H 2CMRH 2VZVA 1MWAL 4JN1L 2FIKB 3SHSA 5EA0L 4MNQE 1A7BA 1XCQB 5IEHB 3GSQA 4PREB 3QO0A 3TESA 1RJLA 4HJJH 4OIBA 4OFPA 3WNOA 4CAGA 1QR1B 1ADQA 1LO5B 4N9GA 1U8HB 3QJHB 3RIFK 2KDGA 4Z77B 4Q9RL 4N8CL 1T0NA 3OJDB 3WUWG 3EYVA 1FJ1A 2NMSA 3IDGA 1B0RA 3SDDC 3W81A 4WWKC 2IBGA 2WQRA 4EUPG 5E8EB 3PWPE 5FA4A 1A2YB 1CFBA 2DQFB 5L0QC 3TYGH 4PJ5B 4DW2L 3QULB 3GRWL 4QT5B 1RZKH 4XPBH 3TN0D 3IFOB 4FQIH 1A9EA 2B7DT 1C12A 1BPVA 1OARL 2YUWA 4DJMA 4HLZH 3D39A 5FUCC 1PX4A 5C09B 2JB6A 3JBG7 1DFBL 3MBXH 4P48A 4ELMB 2BP3A 3TCLA 1V7ML 4LAJH 1JPSL 4S1SL 5GS1B 4WUUD 3T8XA 1JWMB 3K4DA 2ITCA 3VGGA 1IGIL 1MHHB 3GB7A 1D6EA 2AK1L 3IJYA 1FNFA 1YEEH 4KI5C 1Q72H 4LSRH 3S35X 2M1KA 1SMAA 5A1AA 2ZCLL 5C0DA 1K8IA 3WD5H 3ZO0A 5TQ0L 5E5RB 3WFDL 4YHMH 2EKSA 2AXFA 3TN0C 5I73C 1NBVL 5KSBE 4QCIA 3RWDB 1RJCA 3Q5TA 4GQ9H 3UTTE 5C6WH 3UTOA 5DD5H 3UBXA 1L6ZA 4WW1A 3JV6A 4ISVA 5JOPD 5EUOB 4FQ2L 1E4WH 1FH5H 1JTTA 2DDQL 2IH1A 2I60L 1UG9A 2G75B 3PWPB 1F4WH 4RGMC 2VLJA 4L8SC 2Q87A 4JZJB 5E6YA 4L3CB 2VXTH 5I73B 2ESVE 4GKZA 4LP4A 2X6MA 5DGQA 4I18B 2Z93A 3OAUH 2B1AH 3MACL 1YMMA 3FFCE 2DS4A 1I8LA 4ZOAA 5D2LB 4LHUD 4U6HA 3MFGB 1KPRB 2D9CA 3SGJA 3HE6C 1O0VA 1UWXH 1FZMB 1G7MA 4H88H 4XNQB 2WUCL 2Q76A 5IUSA 2BMKA 4UT6H 4FQIL 5CP3H 2YZ1A 3BZFA 4OV6F 4Z7WA 3EZJB 1ULVA 3DYOA 1JMXA 2ZCKL 3DETD 1H3PH 1INDH 3FFCD 1FFRA 4XNXL 3WDHA 2PXYB 1MJUL 2F5BH 4NC0B 5KS9B 2V2TB 4EKXA 1HHGB 5LGKA 3OZ9L 2PTUA 3QUML 4JZOB 1BJMA 4I0PD 4Y5YB 5FYKD 5FGBA 4Z9KB 3VJ6B 1U36A 5GS0D 3RL2B 4JZNA 1R3HA 1YEKL 2X7LB 1J05A 1UADC 4ODUA 5ADOH 5I2IA 5GS3A 3BIKA 1CGUA 4G9FA 5EBWA 5HGDB 1MPAH 2Z93B 4JDVA 3LV3B 2MHAA 5DJYA 5EULV 3ZE2F 3IU4H 3FOMB 4XBEH 2DBLL 2VQ1B 1F3JA 4K3HA 3E3QC 1EVUA 3MRMA 5LGHL 1K4CA 2WWMC 2Z31B 1N5YH 3MLVL 5T3ZH 3MA7A 1DL7H 2FHFA 5J8OA 2ED9A 4LLUB 4PJXA 5I1IL 3MO1A 2MKLC 3KNBB 4Z95L 5ICYA 1YYLL 3VXNA 5FYLH 3O41A 4P9HC 1BD2D 4LPTA 4J3OC 1M05A 4BKLA 4ZG1A 3KPNA 1KC5L 1BQHB 5EZLB 1YPZE 4ERSH 3ULUE 4N0RA 3SBWA 4MA3A 2NYYD 5BV7C 1OAZL 5DK2A 5DTFA 7FABH 3TPUA 4NQTA 5I15L 5C0DB 2FX7L 3LKQA 1XGYH 3HZVB 5E03A 4YO0A 2LU4A 2UV3A 3LN5B 5K59F 3RVWC 3SKNB 5B3JE 3VA6A 1D6EB 2ADJB 4MCYA 2FL5A 3HI5L 4WFEE 2FJFB 1I4FB 3GUTA 4MJID 4L4VE 5SWSA 4YXKH 5D7JC 3K81A 1I9RH 1VEPA 5DRNA 5E5MB 3DXAA 4JFHD 3S9DB 5BV7B 5CSBA 1NBZA 1T5XB 5TGBA 4CJ1A 2VZ1A 2FHBA 3H8NA 3HUJE 4KDTA 1ZSDA 3MV9B 1KB9J 3CSPA 3HPJA 4OD2B 2X09A 1HSBA 5TF0A 5ALCH 1KENL 3QWQB 4PRID 3QRFM 1GGTA 5BJTB 1ZANL 4QHNB 5H94B 3G6DL 2ADJA 4MCYB 5D2NC 1NAKH 1J12A 1AE6H 2KBGA 2VYRE 3HN3A 3FQUA 1Q0YH 1DEEA 1UH4A 1YMHA 2C3VB 1TETH 1I7RB 1U58A 1OAQH 3MGTB 3GK8L 2FLRT 4ODBD 1HXMA 2OZ4H 2XYCA 4S1QH 4UQ2A 5DJ6B 5TQ2L 3U7YH 2V2WB 2IQ9L 2KH2B 3MZTA 3QXVA 3M1BB 5KOMC 1OAUH 1BZ9B 5GRJH 2H32H 3MA7B 5A2FA 3I3BA 4HK3N 5CMAB 5IJVB 2EDFA 3BRDA 4MAYD 5GJTL 2QQLL 1JNLH 2HT4D 3K8KA 1KPUB 1WK0A 1A22B 4U1LA 5I8OH 1ZTXH 4XCNB 3SJVD 4AEEA 2PNDA 2GSGB 4OSUH 4YHNB 4ODHL 4PJIB 4YDVA 4J4PD 2B2XH 4X4XB 2R4SH 2GI7A 2AJZB 5DFVD 1UB5A 2J6EL 2AK4A 4JGMA 1RZFH 4ODWB 1IVLA 1H8OA 1TVDA 4G6MH 3KPTA 4XP9H 2C4FT 4JY4A 4P9ML 1OF2A 5JDSB 1B88A 3EJZD 25C8L 3WFZA 3P4MA 4MXQD 2BXYA 3BKJL 4HQQH 4EQ3A 2GJ6E 1MCRA 4JPIA 4Z6AT 4YHYC 4G3YL 1ES0B 4PYHA 4U7MA 2ZOKB 4EI5A 4OI8A 3VWKB 3VXRB 4S1RH 3STLA 2F58L 5FO9B 1J86A 3ROOB 4G8EB 1H5BB 1KJ2L 1WUNT 4KVNH 1CFQA 2DB8A 4LLMA 4N8VB 3TIEB 4R3SA 3S96B 2O61B 1MHEA 1ZK9A 4QHUA 1A0QL 1JHLL 1KCLA 5MEQB 1JPFA 1KTLA 2QL1A 5IB4A 3FN0L 3J7HA 4YBQC 1WWAX 5DD3H 2ESVA 3MLTB 4G5ZL 5D2LF 5GSRB 2PO6B 4TULH 3LEYH 4FXGB 1IQWL 2DQIH 4NZRH 5D7SH 5E7FA 4ZODA 3DX9B 1SMOA 2NCMA 5A3IC 1YMMD 2X5PA 4YH6A 2DQGL 1GJIA 2J88H 4OF0A 3A0OA 4N0CC 3I75A 1JTOA 4OLZL 4U7KA 3LEVH 3CFEB 1OAKH 3KPLB 4O2EB 4K94H 3IXAB 1M7XA 1NJ9A 4Z0XB 1TJHH 1C5DB 3QUZC 1U0QA 4GQ9L 2BNQA 4OCXH 2AGJL 3V4PH 1IM9D 3VDBA 1LP9B 2AGJH 1NC4A 2YD1A 1A9EB 1K8DB 3OV6A 3VXSA 1FVEA 1QHOA 2ZOKA 4HUXB 4EI5B 1WBYB 3UTTD 2DQFA 2WV3A 4MS8D 4DGIL 2JIXA 3O8XC 1AKJD 1WVZA 1A6WL 3BN9C 1VGKB 1XFPA 2PO6D 3KPMA 3W11C 3N1MC 1XGPB 3ARGB 1QQDA 4FQHB 5FO8A 2IWGA 3QUZB 4DGYL 3TPKA 4MXWH 3HC4H 5CGYD 4V2CB 4JY6B 4CNIB 1PEZA 3NA9H 1RJLB 2MSPA 2EE3A 4PLKD 3QUXC 5EN2B 1QSEE 3MLYL 4X6BA 1QFUL 1FL3B 1YNKH 3BSZH 2IBZX 4NO2B 5E1AB 1EXUB 5HHMB 4U3HA 2V6HA 4QRRA 4GKNA 3DV6B 1PKQE 3X11B 4D0DB 1GGBL 1MI5A 1DEDA 1QBAA 3ULVC 5IJVA 2FATH 2FBOJ 4Y5XC 4I9WE 1A6UL 3FT4B 1T2QL 5CEZL 3DX8B 3WIIH 5I1DA 2CRYA 3TWCH 4BJLA 2GKIA 5C9JA 2XTJC 2CKBH 3VXTA 1WAAE 2A2QT 3ZKXB 2Y9RT 4F58H 3OKYA 1O5DT 3U1SL 5D5MF 3QA3A 4QRPD 3AROA 4MVBC 2NNAB 1N0LA 4M4PA 1KPUA 2DF3A 3ARSA 3MRHA 1NKRA 3IDNA 4OM1H 5D6DC 4OD1H 3SDAD 4JFYB 4XXCA 2ICWJ 3FMGL 4OCWH 1FNEB 4OM1L 4HC1A 1OGAB 3VFTA 3WHXB 5D93B 2WBJD 3AB0C 4P3WA 5TDOA 2X10A 4W6WB 2D7NA 2EZ0D 1KBGL 1NCNA 2DLGA 1NGYB 2X89D 1OW0A 5D1ZC 3T0EE 5ANME 5EG6C 1QVOB 4J2XA 5I8EB 5IIEA 3VH8B 3TBWB 2FHCA 1X7QA 5DT1L 4JFXA 5GHWH 3QUZA 3CU7A 3C6LC 3O81A 5DMKB 1L7IL 1HYRC 5DQ9A 4P5TC 3D85A 1S9XB 4HWZB 3CDFA 4RDQF 2D31A 4Z7QE 4M6OH 2ILLA 2AQ1A 3DECA 1J0IA 4FQLL 5L2KB 4F3FB 4YO0B 4RFNB 4MS8C 1RSFA 2PXYD 1V3JA 1R3IH 5DUBB 3QCTH 5BVPH 2OXHA 1IGTA 2NX5A 1VGEL 3MROB 4R7DB 4KJWD 3UZEA 2NY1D 3MLXL 5C2BL 1NC2D 4IEFB 5DSCB 1I9RL 1C5DA 3THML 1HCFX 3K8LA 4K71B 1I4FA 1NJ9B 3DRQA 4BH8B 2XPGB 5E8OA 1JNHA 3OHXB 1OT1A 2O5YH 1VESA 2AEWA 2FWOA 3PL6D 3MRNB 4X4YA 4GAGL 1YY9C 1VERA 2YPKB 4Y4KB 2Z31A 3O9WB 1Y6MR 4JRWA 4LF3B 1KB5B 4NWTH 1QG3A 4ODXB 2E6QA 4HFWB 4QHMB 1D9KD 1FIEA 3ARDC 3VRLE 3E2HC 3KYMA 3NACH 3QDJA 2A77L 5ANMB 3S88L 1JWSA 3DNKA 3WS3A 4YWGL 4BM7A 5D6CB 1JGUL 1N8ZB 3O8XD 4JZNB 4MNQB 1S7SB 4NT6A 3P11H 4PTUB 3EOAA 1Y6NR 4G8GB 3IDYB 4U6VH 2Y1VA 4GAJH 3IS1X 3IB4A 1MNUH 4U1MB 2X1OA 3MCKA 4MSWA 4FHBD 1BD2E 4XNZC 1ETZA 2J7LA 3BIKB 4MJ4A 1LDPH 4PGEA 4G6JH 4DOHB 3ZKNC 3MV7B 4XI5C 1NCWH 4FFVC 3RTQC 3K8MA 3N0PB 1AHWC 3BE1H 4Z0BL 2GSGA 5DFVC 4XPHH 3I6LE 4RMTA 5EBLA 1YEJL 2GK0B 4XNMB 5DHVA 3GIVB 4N0YL 1P7HL 4X7TB 2NY2D 3IU4L 4GRLD 5J57B 4MMXC 5IFJB 2IG2L 4BH7B 2NY5C 5JW3L 2O5ZL 4KJQC 1PQZB 3CXDH 2LFGA 4BUHA 5DJDB 1LWRA 2NY4B 3HCVA 4LARH 4JHAL 4FQCH 5ECJE 4QHMA 1FNLA 3DYMA 3JV4B 5ICZA 5DJ6A 3C6SB 3CZFB 4ELKA 1HXMB 5D9SB 4CW1A 4P99A 1NAMB 3CPLB 1D7FA 1YNLL 5ENWA 3LKPA 3HC0A 5C09E 2XZZA 5IBUG 3MRDB 2DAVA 4M7LL 3VGFA 3C2AL 1MCSA 2AJSL 5J6GA 4P2QA 1PSKH 4TSBL 3T3MF 4JFFE 3U2SA 3KXFB 1S7VA 4NFBA 4P2OC 4DGIH 1IILE 1DUYA 2UY6A 1UCTA 4QXWA 1OSPH 2BOCA 4XPFH 4G42A 1GXEA 3O3BB 1RZ8B 3QQ3B 4X80L 1YQ2A 3GRWA 4JFPB 4KRLB 4XPGH 3NH7H 2VDKL 5F1NB 3MYJA 1RUKL 2CDFB 4OD3H 4M6MH 3BPNC 3EOYG 1C12B 5DJCA 2Y6SC 5IF0A 3ZE1F 3QPXH 3RZWA 5BOPA 4FFZL 1TJHL 5I1CL 4YIQB 4PJGE 4TVPL 4MJ5B 3B9KB 5DZOA 2WZPD 4KY1H 3EDJA 3QAZC 4R0LB 4J3SA 4HWZA 4ZNCD 1R24A 1ADQL 1BGXH 4J3VA 1N2RB 1M1SA 1DN0A 1JPSH 4YR6A 3F7VA 4PRDA 4RGMB 1FO0H 3N1GC 3U4EB 3LDBC 5I1AA 1RK0A 3V0WL 4XB7A 1ZGLM 3ILPA 5E99L 4L9LA 3ROLB 2P8MB 3QXTA 5K93A 3P9MB 4MQXD 1P5UA 1FE8L 5HI5C 4G8FA 4XP4H 1OD9A 3BW9B 3OKNA 3V7AG 4FQJL 3TV3L 5C0ND 1ACYL 2NW3A 1T1WA 1S7XB 4NKOA 2DL9A 1FYTE 3OKMA 5A2JH 4QRTA 3VFTB 1DBMH 4X6FA 3W82A 3VWJB 5BV7H 5JNYB 4L1HA 4Y4HB 1UM4L 4J8RB 4MNHA 3IKKA 4R7NB 5GGRY 3PGDB 5IK3B 4PB9L 1HCVA 1UJ3B 1C1EL 1CFNA 3U9UB 5LQBH 5EBWB 5HGDA 1FNSL 5M94B 5FKAA 5C0AB 2YN5A 1I3VA 3ZL4L 1KCUH 5CD5C 3DX6A 3BYTA 3FRPG 4EBQH 5I9QB 1ERNA 3BPCB 1F2XK 4HPOH 4M5YH 5ELIA 3VRLF 2CLZB 4MA1B 4F33A 4DKFH 5K9QI 3P4OB 1ORSA 2AKRA 5DGRA 3T2PA 4GKOA 1G7HA 2XNAA 4DK6A 2YD2A 1AJ7H 3MGOA 5IBTH 4POUB 4UTAH 3PJSB 4W6XB 1IAOA 4PJHF 3C8HA 2OTPA 1F90L 3MV8B 3WYRA 1JHTB 5EZIL 3N1PC 3UBXG 1HHJA 2DRUA 2X70B 3EYOA 3S37X 1P2CA 2NX5D 2WINB 2XICA 2I24N 3PWJA 4TUJB 3VDAA 5DRZB 5DVKA 3GK8H 4EN3B 4M61B 2GTWB 3G9AB 5DHXB 4HV8B 3WUWB 4A2LA 4LSPL 5HDBF 3JSSA 5HHMD 5HDQL 1JI1A 2VLJD 1G7PA 5IVXA 4S10A 3MACH 3QEQB 3S5LB 4NQDD 3NCCB 5EORH 4GXVH 4IOSD 1GZQB 1REIA 1IC7H 3HFML 4NQDA 5I1CH 1KIPA 1T66D 35C8L 2HWZH 3B9AA 3HR5B 4HC1L 1N6UA 3MA9L 4JM2F 1MUJB 3ZSSA 4JE4B 4L3AA 4L1DA 1YQVH 3MUGA 5FM5M 4PG2C 3DX9A 4I5BA 5IWLA 5AZEH 2AXGA 5IB5B 1K5NA 3K1DA 4ZUWB 5GRZA 3WJJC 3GJFB 2G5BB 2IEPA 2R9HC 3G04A 4YAQB 2VDQL 3M17A 5GZND 3BKYL 3LIZH 4BZ2L 5J9PB 2Y23A 4A6YL 4NRZA 1LHZA 4EN3D 2R29L 5D7SL 4TOYH 3ZKQD 3QXAB 4JHZA 1D3CA 2R0WH 2A1WL 4P23D 3REWA 3STLB 2ZOLA 5F9JB 3VGAC 5BRZB 4P2OD 1SJVA 3F7QA 4LLYB 2J8UB 2R2HB 4N8VG 1TQBC 4WWKA 5TFSL 4L4VA 4XBGA 1LO2H 2Z91B 5GSVB 4ONHB 2KZWA 2JELH 3VXQA 3KS0H 3L3GA 1WCQA 4YDIL 1EHLL 4RWYH 2E8ZA 1Z5LB 4OQ1A 1EAJA 2WWKO 2BZDA 4QRRD 4QRUA 2FB4L 3ARGC 3HUJA 1HINH 2P43B 4XP5H 2E5EA 4LLDA 5DRWA 5EOCJ 3MJ9L 3PWNA 1OP9A 2AJ3A 2FIKA 3GSRA 3LS5H 4Y19D 1I8IB 1FNHA 3BX7C 4OLEA 1EBPA 5DDHA 1HHHA 4P2QD 3HG1B 3VD3A 4EBQL 1NSNL 3QIWD 2GTZA 4P4KB 3MV01 1TZGH 3VRIB 2DQTH 1RJZB 4RISL 4OGYL 2VL5B 4J1UA 4BSWA 4WUKH 2X05A 3V7MA 3PDDA 3EYSH 2DQCH 2CMRL 2B1HH 1S5HB 4U3XA 1A7NH 1SJHB 3MZGB 3D0VB 1U3HA 5EZJA 1LO3H 2ZUTA 3U7WL 4JKLA 3FFDA 4PJCE 3CNKA 4IRJA 1FG2A 3H7BA 3QUXD 3CDGA 4X6EB 4BSJA 5C0FA 5IM7B 2P8PB 3QQ9D 3WMSA 3NN8A 5C86A 1IBGL 3EOTL 3L7EA 4H8WC 4LCWA 3SE8L 2XWJA 4HKBA 3UROR 1PFCA 3M07A 1DSFL 1QFUH 4P5MB 1CLCA 5CFHA 1EGJH 2YOCA 3QCUH 2R56H 1QSZA 3HI1B 3DURA 1FV1B 1U3JA 2HG5A 3WBDA 5J6HA 4AH2B 4F8TA 4X9GA 5DYOA 5D1XD 5JHDE 1F2QA 4E0RA 2X4OB 1T3FA 4HC1H 1IEAA 2DQDH 2VH5H 3CFDA 2FNBA 3ILPB 1CBVH 3HMXH 3B6SA 4TUKL 12E8H 3X13B 4TRPH 3HC3L 1I1AB 3HFMH 2GJ6A 4NRYB 5SWZE 5KSBF 5MERA 1YN6B 1EMTH 3SEPA 4B53A 3K74B 3BAEH 4LIQE 5BRZE 4N0CD 5F3HA 1TIUA 1MOEA 1IARB 3JUYA 1RMFH 1FAKT 5HVGB 1S3KH 4KAQL 4NO5B 1KSRA 3HZVA 5DD5L 3SE3C 2ZKHL 1IQDB 2CIKA 5T1MB 3T77A 1U8LA 1MWAA 2GFBB 2PYFB 2PKDA 2IAND 3BEVA 3NPZB 4HFUH 3FQNB 3QDJD 3WIHL 4DAGH 2JE8A 4I2XE 4U6XA 3VE0B 2O26U 3TVMA 3MNVA 3VXOA 3S4SG 4AH2A 3RWFB 4RAUA 2AQ2A 1U95A 3RAJL 1MRFL 2BVOB 5E1HB 5GIRA 2FX9H 4LVEA 2O93L 4OUOA 4RAVA 1OTTD 1IKNA 3VXPB 2JCCA 1NCCH 1FN4B 3BO8B 1JN6B 1WISA 4JO2L 1KXTB 2EDWA 2BNQE 4LLWB 5IQ7H 5KW9H 3CH1A 4JPKH 4JY5L 4WGVB 1NGQH 2WUBL 1IL1A 1T7ZA 1H3WM 5AUMB 1R3HB 4LNRB 3W9EB 3D0VA 3DHMA 2EE2A 3B2VH 1AR1D 3QAZB 5HI5D 4M43H 1PQZA 4WTZA 2AI0L 1TVHB 2FGWH 1FIGL 2AJXL 1VFOA 3OXRB 1R5IB 4S0TD 4Q9RH 4JRXA 2UZXB 2Y25A 4GH7B 2GK0A 1UGNA 5CLTA 4NN5B 1KJ3H 3F58L 1BIHA 1MJ8L 4Q2ZB 5DD1H 1XGQA 4ODHH 1N59B 3TNNB 1KUMA 1FVCA 2ADGA 3OG4B 2FR4A 3CK0L 4M62H 1X5GA 2J8HA 2UWEB 1X5HA 1LD9B 1CGXA 3HS0A 4JQVC 43C9B 1KCKA 4K7PX 3EKCA 2ZUSA 2XZQH 3CJJA 4F37K 3MRIB 5DMGC 2XQYK 4N68A 3ZHDA 1IFHH 1F6AB 4NZDA 3OX8A 3BHBA 1VFBA 4ONHA 2EYRA 2P7TA 5C0AE 4X6DA 2AXJA 4PBVC 5GGQL 4G8GA 1FNGA 4I3SL 2Z8RA 5HGGS 5DJAA 3ALPA 4JKWA 4APQC 1J1XH 5KVEL 2OJEB 4U1NB 4PJBA 4YNYB 5AYQA 3QNZA 4QOKA 5HVHB 1UVQB 3QDJB 4PG9B 3RIFF 1XR8B 4JPVL 1FH5L 1Z0NA 1CFVH 3C5ZB 3PHQB 1QR4A 2QQNL 3ARPA 1AE6L 3PWPD 3RNKA 1UWEH 5E08L 3OB0H 1RZGA 2HMIC 2FECL 5J56B 5MHSD 1N3NB 3QCVL 3DVGB 3RVXC 4Y4KA 5D7KD 1OSPL 4B7LA 4YEFA 3MNWB 3ARQA 3FO9B 3KPPB 1HQRB 1CXLA 1R3LB 4UT9L 1MHPL 1RIHH 3AM8A 3PDOB 3HR5A 3NMEA 4M6ML 5CJXC 1U3ZA 3QQNA 4ZOBA 4QRPE 2KQMA 4KVCL 4LU5H 1T03L 4XPAH 3ZDXE 2HN7A 3MLSL 3TO4A 2W9EH 1MRCL 1MWAB 1GOGA 5GS1C 2EDRA 1V7MH 3JWNC 4JFFB 3MODL 3CXDL 1ZHBA 4XCFH 4ZAKC 3G5ZB 1P1ZB 2HP4A 5CWSB 3RJDA 1AHWA 5LWYL 1FV1A 2HG5B 5J6HB 1AIFA 4F7PB 1X3DA 3MRJB 5IESL 2IG2H 4KJYB 5JQ6H 3GKWH 4JFOA 2NY6C 2WNGA 2WANA 1R5WA 4H1LB 5I17A 4G8IA 3DV4A 5D7IE 3ULUC 3SBWC 2Q7NA 4EDWL 4LCWB 5GRVL 5I19L 3FB6A 1S78D 1MH5B 4NO3B 3WFBL 1NGPH 5BQ7B 1D5ZB 5D70L 4QY8B 2LTQB 3SO3B 1BWWA 5IVZB 4Q9QL 5KJRL 5E4EB 1LK3H 2E6JA 4JN2B 1FG2B 3DURB 3U0WL 5JR1L 4MD4B 1N6QH 5IHUH 1RIUL 2A9ML 5GS0C 2XKUA 4X9IA 4HPYL 4NO0D 1R3KA 1FO0A 1T80A 2Z4QA 1U6AL 1H5BC 5DUPL 4HG4K 1I9EA 4LCWD 4CMHC 4HKBB 1U6AH 4F33B 4AL8L 3X3GL 4Y2OA 2I5YL 1I9IL 5CD3A 2DMCA 2OL3A 5DD0H 1B3JA 2W59A 3WHE1 3KYOA 1FZOA 4YHPB 3SE9L 2QQKH 4YDLC 4Y16C 4KVCH 5IVOA 3MCLL 3MUJA 1ONQB 1SJHA 4M1CD 3QZWA 2ZCKH 2HFTA 3MNZB 1G6RA 1OPGH 3KYKH 1A6ZB 4R4NC 3DV4B 4OKDA 3L6FA 2VLKE 3MLSH 4FTVA 4DGVL 4D3CH 4Z78A 4KHXL 1AGFA 4FABH 1EZVX 1ZHBB 3NACL 4P2OB 4HCRA 3SDXA 4QWWC 4KXZH 2DQEL 1HILA 3S4SA 5EIVA 3VFMA 1YECL 4L3ED 4BA8A 3DUUA 5GRUH 2QSVA 3DVIA 3FCTA 4D9LL 2YXMA 5HGHA 1IC7L 1ZVSB 5KAQF 1I3UA 2ZJSL 4NRZB 3ARYA 4HXAL 2ZSWA 2DN7A 1RZJL 3V0VA 4KJYA 2H8PB 4R0LA 2QQNH 4R4ND 3MA9H 3IRZA 3FO9A 3LD8C 5BO1L 5F9OL 35C8H 2Q7YB 5E9DD 3TBSA 2EH8H 1KTDB 4HJGB 3VD4A 5F9WC 5FHBH 4Y2DB 2HN7B 3VXSB 5C0BA 2IH3B 1UWGH 2CLRB 1BOGB 3QXAA 1KEGL 5K33A 1DQLL 1Z3GH 5T33L 3ARUA 1LO0H 1KIPB 5I15H 4NJ9H 3GJEA 1IQWH 5IMOB 1E4KA 1F4YH 4KI5E 4V1DA 1FSKB 4NHCL 1JZ2A 4HGWA 4PJEE 1CVRA 3LVEA 4R2GC 1B9ZA 4Y2DA 2I07A 4P2CG 4I5BB 3FQXA 1U42A 5IV2A 4MGXA 2ARJQ 2GJZA 4JPWH 5HJ3A 3BQUD 3FHAA 3ETBF 1H8SA 2X1PA 5GSRA 1BVZA 1WFNA 2XZQL 2DICA 4CW1B 5IB2B 4ELKB 4M61A 2H1PL 3QWOA 1UVQA 5JOFA 4Z7UF 3I9GH 1CDGA 1WTGT 1DZBA 3DO7B 1G7JA 4PJ5E 1WT5A 1CFQB 1PBYA 4N8VA 3TIEA 5CGMA 1DQQB 3VCLB 1MHCA 4WV1B 3KYNA 3D3VA 4R96B 2M8XA 4PB9H 4JQIL 5EC2A 2MCPH 3S36H 3VWKA 3VXRA 5AD0B 3MV8A 3IAPA 4PJBE 4OZFA 1IT9H 4QOKE 1W72L 2XNAB 4MD0A 4LASH 4QNPF 2CDEA 5KVFH 1YY9D 3OR7A 3H9SA 1J1OH 5E2VL 3QZWB 4HAFA 3KPQB 3LN9A 2ZP0T 4P5TB 1LEIA 2WINA 1CDCA 1MCBA 3EYOB 3GNML 1MIEH 4FS0A 4OUUB 1ED3B 5DJXB 4N5ED 1BFSA 1YPZB 3FQTA 3ARFB 2XQYG 4Q2ZA 4NRXA 4PGBA 2ARWA 2NY1C 3BMWA 3UYOD 3VRJB 1FFPB 1UJ3A 3PF2A 2D7MA 3L3HB 3AS2A 2UWEF 4QLRA 3SKOA 1FPTL 3MMEB 3FONA 4KRPD 2W60B 1LO4L 4RMVA 2GK2A 4HMDA 3HHRB 4BQ9A 5FM8A 5LG1A 1CF8L 1ROWA 1SM3H 3WXWH 1K3ZA 4Z5RA 5BXFA 5GGVY 1DE4B 1JGDB 4AENA 4WW2A 4MAUH 4YZFE 1J18A 2VWEC 3UTSE 3VXUB 4MD5B 5A2LH 3UMTA 2F8VA 2VMFA 3OKNB 1NCUA 2X4SA 2BOBA 2XWTB 4U6XB 3VE0A 1JGEB 2X4NA 3LH2L 4G43A 4HIIB 5DQJB 1E4KC 3ARZA 1KIQB 4QHKI 4JGUA 1DDHB 5INDA 5D1XA 2N7AA 1C7SA 2RAMA 2GJ6D 1U58B 2VQUA 3VWJA 2VZTA 5ACZB 1IGFH 4PJDE 3KWWB 1B0WA 4NO5A 5GJSL 4YE4L 2MNUA 2BVPB 3DUSA 1JWUB 1EMTL 4U31A 4GLRH 1INQA 4OGXL 1L4IA 4ZXBC 3OSKA 4WY7H 1XR9A 2Q86A 3EJYD 4KJWC 4TYUA 3RU8H 3QI9D 1T5WB 1ZT4A 5IEKB 2YEZB 1CBVL 3PL6A 4KC3B 4MA1C 4PJXE 3P9MA 3EJZC 3MV9A 1ZSDB 1TCMA 4J6RH 4UILH 3P73B 1MCOL 5LBSH 5IW1B 1YEFH 2X9WA 3L3IB 1RIVL 4L4TD 4YXLH 3QJFB 5FYJD 3NIFF 5EDXA 1NQBA 3O2DL 4WEBL 5ADPL 2RHEA 1WITA 3C6LD 5T5FL 4RIRA 1FQ9C 2GUOB 3B5TA 1NUFA 3OGCA 1TITA 1FORH 4XNUL 3RTQB 2H2SC 1ZKAA 1NEUA 3V6OC 1LEKB 5I1EH 5L2KD 3ZTNH 5I1GL 3WKMH 1WBXB 3O45B 3QIWB 3S34L 5DFTA 2EXYC 5I30H 5C92A 3IETB 3OAYK 4MD5A 3ARDB 3C6SA 3CZFA 4OGYH 1TCRA 3QISA 4D9QE 4GAYB 4IHOB 3QXUA 1CCZA 4YX2L 5F6IC 1QFPA 4WVRA 5IHUL 3C8KB 3LPGA 1K2DB 2ZG1A 1HQ4A 1G9MH 2F53A 4P4RA 1GH7A 1LK3L 1MFDH 4ZAKA 1MWAH 2J1KA 2PW2B 3T2QA 4OLWL 3BUTA 1MCLA 1RHHA 4HS3A 4GUPA 4AEIL 3QFJE 1CU4L 1Y0LB 1OGAA 4XCYB 3PV7A 1BLNB 3NIFE 5CJ5A 5HPMB 3A6BL 3OX8B 1F3JB 2YPLD 1U2HA 3CDGB 3HG1A 2DWDB 3BZ4A 2E8YA 4PR5A 2YD3A 4GKSA 4YFLI 4HIEB 4X0KA 1RU9H 4IOFD 3HS0B 43C9A 3I6KA 3B8SA 4LCYA 5C0IB 2P24B 2X1QA 3LY6A 5GZNC 2XZAL 1J05B 1J5OH 4JJ5A 2J8UE 3H9SB 4RQQA 5C8JB 5FYKE 1IGCL 1N59A 2H2PD 3I02A 1NLBL 1I7TB 1RULL 4LRIC 4OQTA 4RBPK 5C0BE 5F3BB 3O2WH 3W39B 4XPAL 3NGBB 1MFEL 5DHVB 4WEBH 5FKPA 4YDJB 2W38A 1HKFA 4YDJA 4PLKC 3GMPB 7CGTA 1IKFL 4X6CF 4LSSH 1MHCB 5FYKU 3T0DA 2ZOLB 4JRYD 1MLBB 2P42B 3IGAB 2R0KH 4Q0XL 1CE6A 3ILQD 2IGFH 5BZWB 3BEWB 2QADC 1QBLL 5F96L 4OIAA 5B4MD 4GAGH 1QQDB 5IB2A 1ZHKA 1X6LA 2NYYC 5EZOL 3QDMB 4PRHA 1G6VK 5J13C 5F89A 3CFCL 2VLKB 1CLYL 4KQ3L 3PWPA 3RUGA 4NKIL 4JQXC 2HJLB 3ZE1E 5JW4Q 1QFWH 3L1OH 3O0RL 2PTTB 2XWBA 1IGYA 3HUJF 1H0DA 3QDMD 2F53B 4P4RB 4YHZH 4RFEA 1NCDL 4MQ7A 2XA8H 3PHOA 1A6AB 4DFIA 1JPTH 2QHRH 3MOBH 5TF1L 1AGEA 3BPOC 1CD9B 3SDCD 1G1YA 4XVSL 1XGTA 4WHYG 3I2CH 3LB6C 3VFGH 3MJ6A 3G6JF 5DD1L 1ZOXA 2DM2A 5F70A 1VGEH 5GGTA 5IBTL 5KSAA 2FSEA 3LQZB 5DZLA 3TNMB 4UI2A 5CEXB 3H3PH 1LK2A 2F8XC 3C08H 4M6OL 5TJWK 1U3YA 1HXYB 3GB7B 3SDAA 4M43L 1A6TA 4LPYA 2ORBL 2VDRL 4S1DD 4NM8H 3MLWH 3QHZL 5KSBA 3RWIB 1FPTH 4ELMA 4U6TA 5SWZA 5L6YH 5BW7C 2GITB 1TJIH 4AM0A 4K71C 4K55A 4PIRF 1FFQA 5IMLB 5ADOL 3NCJL 5DVMA 1ES0A 4AG4H 4HK0A 5I16A 3QPQC 4P49A 2HYMA 4RBPH 3FMGH 4YDKL 1HNGA 1A7OL 2IANE 3KR3L 4AIZA 4F9LA 4GFTB 4XBEL 4Y4HD 1FRGH 1HOCB 3F65A 5C0AD 3HNSH 1ORSB 3O3DB 1XT5A 3C5SB 4YGAB 3GMOA 4GXUN 5IVXF 3RAJH 5GZOD 2C7UB 2CLZA 1GZPA 3BPCA 5F7NC 4XMKL 2XI9A 5HHXL 5JHDD 2LVEA 3KWWA 3TBWA 1ZT7B 3TLRA 3WLWC 4NN7B 2OZ4A 1RZ7L 4EN3C 4GRMB 4MNGB 2YA1A 3R8QA 4K3JL 3MRHB 1QPXA 4YHNA 3NA9L 3PJSA 3MLZH 5E95B 5DMJB 4G43B 3QIBD 5L8LB 4XCCL 2DL2A 2H32A 1ZHNA 2R69H 4LOUD 5IMMA 2Y36H 3AREC 3DBXA 1LO0L 4X4MA 2JCCE 1H3PL 1S9YA 2XG4A 4O51B 5LKNA 2VR5A 3DX8A 1A7QL 3GMLB 4L5FH 4HEPG 5D7JD 1WSST 3U46B 4S1QL 4N1CA 4UOW1 1OAYL 1FL5B 4G9DB 3GMLA 5EU7C 1JCKA 4PGCB 2Y6SD 4XP4L 4QEGA 1F3DH 1W0YT 3FKUS 1J87A 3M1BA 4HLZG 4UZGA 4QGTA 1CFNB 2VLMD 5K9OA 1MSPA 3G6JB 3QEUB 5BQ7A 2HAZA 4MX7B 2P8MA 3V4VL 5I1DB 3C6LA 4H5SA 4M7JL 2CKBB 4CUCA 2BVEA 1VEOA 4X6FB 4P5TA 1LEIB 2P47B 4DGYH 4TUOA 32C2B 4X8JA 2EIDA 5TH2A 1YA5A 4FFZH 3UPRA 3WD5L 4NKOB 3GMNB 4ZS7L 2H6PB 4GRWE 1U8PA 4K8RL 2X89A 4K3DH 1Q0XL 4X7DC 4HK0B 4QTIL 1KJ2B 2IF7A 1IRAY 2H3NB 2UYLB 4PP1D 4NOBA 5BW7A 1CIUA 1CLOH 5CKAA 4LIQH 4JRYB 2EIZB 3C5ZC 2ADIA 2I5YH 4D8PB 4XHQA 3PDOA 2NY2C 4X6DE 3FAXA 1OAZH 1YNLH 4RISH 2FX8L 4XZUA 3E2HB 1YUHB 4X5XB 4KZDH 5DJ2B 4HCRH 3IAQA 1LK2B 1ZLWK 3SE9H 1ZLUH 1DQML 2A9NH 3EAKA 4FQPA 2VSDA 1JHLH 4LLQB 1JZ4A 3FQXB 4PRPD 4UIKL 3LQAL 4EUPH 4FG6D 1DFBH 3RUGF 3FOLB 3LS5L 4LCIH 2YPVL 3NCYS 3LRHA 4N8CH 5HVWA 4WFFE 1KLUB 1F02I 5JO5B 4G42B 3Q5YA 5IMOA 1AGEB 1OLZA 4NQUA 5E24E 3CVIH 5E4EC 3RVUC 1FG9C 1L0YA 3BT2L 2Z35A 3B9EA 4URTB 2ADFH 4ZXBB 1F4XH 5DJ8B 4APQD 4RGND 5CAYB 4OT1H 3E8UL 5HYEA 1PAMA 1ND0B 1FGNH 4NP4H 3CMOL 1BMGA 1WZMA 3FOMA 3NIGF 3P40A 4F7TA 5DRZA 4JFQB 3JV4A 5ICZB 1F58L 1DLFL 2DIJA 1VA9A 1PW3A 3O8XA 4LCUA 5IESH 4ODWA 3EHBC 2Y07H 2DOCA 4KHTH 5GJTH 5EPMA 3EBAA 4G8EA 5L7XL 1MHPH 1NFIB 4PJGA 3C60A 5MHSE 4QOKD 4JM4L 4NQSB 1W2KT 1RD6A 5EO0B 4BFGA 4JZOA 2WUCH 4FFWD 2OI9C 3WS6A 4MSWB 2D3VA 4K2UH 2C3XA 3MRCA 4LEOB 4Y19E 4K7PL 4F2MA 1MRCH 3O6ML 5CP7A 1R3JB 4W6YB 3VWJC 3H9HA 3UZQA 4M03A 3BZFB 1FL5A 4G9DA 3W39A 4X5WA 2F54A 1MJ7L 4ZPVB 1IC4H 2CKBA 1UB5B 1YC7A 3G9VA 3PP4H 3INUL 5H35A 3I84A 3THMH 3GM0A 3TA3B 3U36A 4XT1C 1JNJA 4HUUB 4OV5B 4MHHG 2HFGL 4GMTL 1N6VA 1M4KA 5FGBC 5HDOA 4J23A 2BXZA 4NWTL 5I9QC 3WSQH 5J3HD 1ZLWH 2NY1B 1HDMB 4XXDB 2QBWA 5JNYA 4HMEA 3SCMC 4RAVB 4K3DL 3ARXA 4A6YB 5K9JH 2YPKA 2CIIB 3AREA 4QXTB 1SHMA 2PW2A 2VDNL 5F7WC 4C83A 2HKHH 1O7VA 1NAKL 2BNQD 3BP4B 3B3IB 5JXAL 3PQYA 4UAOB 2B0SL 5ILTL 1T1WB 3AU1A 5JW5B 2FJHB 1IM9A 5EU6D 4KUCD 4WHYH 1W0VA 1DVFC 5C3LD 1NFDE 3GI8L 1OGTB 3NZHL 4Y4FB 4ZUSA 3HPJB 1G7LB 3QIBB 3SDDA 2DYPB 3CFKA 1WC7B 5IVZA 2GFBA 2PYFA 4H0IA 1YMHB 2C3VA 1H9VA 3NZ8B 1DBAL 3JTTA 2ZPKH 5HI3C 2MQ3A 1GHFL 4K23H 2WIIA 2EDJA 3CK0H 2RJMA 1JNHB 1I1AD 3KLAA 1JWMA 2ZNXA 5IMKA 5AG9A 2AK4D 3BRFA 5E6IB 5KN5A 3HZMB 5GHWL 1Q94B 4R97B 2LVCA 1D5IH 4Y4FC 5GGTL 4U1GC 4JAMB 1ZLVH 3F8UB 4X4ME 1X44A 4R7DA 4TSAL 1T3FB 4FNLL 2X4OA 1T5XA 5KSVB 1KNOA 5T3ZE 1S7TB 2MPAL 3UJJH 3IS0X 2A74A 5EH1A 3G5XA 3V79C 4BKLB 5FAAA 3AU1B 1CICA 1DJSA 4JFHE 1J0JA 4KMQA 4V2BA 4DKFL 4JN1H 1AY1H 5F88A 2NR6C 2QEJA 2XFXB 1FRGL 1FAIH 5B21A