2ESVE

Structure of the hla-e-vmaprtlil/kk50.4 tcr complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
240
structure length
240
Chain Sequence
GVTQFPSHSVIEKGQTVTLRCDPISGHDNLYWYRRVMGKEIKFLLHFVKESKQDESGMPNNRFLAERTGGTYSTLKVQPAELEDSGVYFCASSQDRDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, alpha chain E
publication title Structural basis for a major histocompatibility complex class Ib-restricted T cell response
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2esvE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2esvE02
1FG9C 3QUML 4W4OA 1J0JA 1DBJH 3HC4L 8CGTA 3U0PB 2EYRA 4GQ9L 4WI6A 4JFPB 4K55A 1X5KA 2VN4A 4U1LB 2KH2B 4DZBB 1T1XA 2NCMA 2I9TA 2QSVA 3V7AE 3OB0K 5TDNA 4EUPH 3B8SA 3VA2C 5CILL 2DQUH 2EYRB 3HN3A 2PYED 1QBLL 4U1HB 1CLOH 1AGCA 4L3AA 2I9TB 1T1XB 4DN4H 1J8HE 5TDNB 4H1LH 5IFAH 1CE6A 4XWGH 2F8VA 1FCCA 1AGCB 4F9PC 4XP9L 2DL2A 3BT2L 2EDXA 5LQBH 3VU2A 2WLZA 4IOIB 4Y1AE 4YHZH 4TTGA 5JIIA 4RQQA 4Z76A 3GJEA 4XMLL 4YHKL 2P7TA 1FSKB 1YEGL 5T5FH 4XPBL 1JHLH 5MENA 2K7QA 1WWAX 1IC1A 1J8KA 5FFLA 4D9QE 4RQQB 4C55A 2EDLA 5IM7A 2P7TB 3SE3A 4UU9A 4YDLC 1XF5A 3W39A 5B3JF 5EOCL 4YO0A 3BVNB 1S7VA 4OLEA 5IM7B 5L0QC 2ZCHL 1LILA 4RRPA 3W39B 4DK3A 3QEGL 4LCYB 2YXFA 4YO0B 4NQDA 4TQEL 2VDKH 3SDDC 2E7HA 1LNUA 4MAUL 2VXTH 4S0SD 3C8KB 3RKPA 2NY5C 1M7XA 1UVQB 4HWEL 1OT2A 1AC6A 4NQDB 1LNUB 5I74C 5ACLA 1PFCA 3RIFK 1GHFH 4F3FA 3NTCH 1ONQB 3IT8D 2WLYA 1OQOA 5DD0H 4HKXB 2AXJA 1T0NA 2FYYA 4F3FB 1U8OB 1FGVL 5FUZL 4Y16D 1PY4A 1HNGA 2APWA 3A67H 3X3GL 1I1CA 1T0NB 1MJUH 2FYYB 3C87A 2FX9L 1VPOL 5C9JB 4KUCD 2JJWA 3VFRA 2R69H 4PLKD 1CFQB 4RGOH 4BZ1L 2OBGA 3MYJB 4Y5VC 3TJHC 1Q9LA 3K80A 5BRZA 2VAJA 4HV8A 1MF2H 4HS8L 1GC1L 1WFOA 2XT1B 3H7LA 4QRPA 2OR9L 3VFRB 1PAMA 2A74A 2R29H 2VLJE 3NFSL 4OZHE 4PYHA 1Q9LB 5BRZB 3MRGA 4HV8B 3WE6A 4GS7C 4U7SA 2NY1D 1K8IA 4C83A 2A74B 2I5YL 2IAMC 3GIVA 4JVPA 3BD4A 1DANT 3RUGF 5BOPA 4P5KA 2R1XA 3I2CL 5CJ5A 3MRGB 4MA3A 4OQ1A 3WE6B 3ZZ1A 4C83B 1K8IB 1MCOL 1P6AB 3D3VE 2AXHA 4WGVB 3GIVB 4HUVA 4JANA 1IKNC 2R1XB 2AKRB 2EYTA 4MA3B 4Y8DC 5C0CD 3VFUA 4ZOEA 3RZCA 2VLMD 2AV7B 4HMEA 3LD8C 5EG6C 3NABH 1CDYA 4HUVB 3N0PB 4JANB 3L3GA 1DUZA 1MCCA 1S9KC 4WHYG 2EYTB 3O9WC 4C58B 1GXEA 5JR1L 3VFUB 3REVA 1YEEH 1FZMA 2QQQA 1FAIH 4YHIA 5HI3D 4M7KH 1LMKA 3L3GB 1GVIA 3OF6A 4ZTPH 4FQ2H 5J12B 3REVB 2B1AH 2BSTA 4HG4J 2HT3C 4YHIB 2WSKA 4XBPA 3TT3H 2NY6D 3MRRA 4RBPH 1A6VH 3MRPB 1TVHB 1JMXA 5I66A 3X3FH 2VMFA 3HC3H 4NQVA 2VTFA 4QHLA 4XBPB 1RVFL 5EBWA 2NY4B 3V5DA 4X5XB 2ARJQ 4KPHL 2BX5A 1QPXA 3IDIA 1OQXA 4ZSOE 4MB3A 4NQVB 5C09E 2NXYC 3C5ZC 4QHLB 4BH8A 2LTQB 3UTZB 1KSRA 4KWUA 3V5DB 4K3JH 2VZOA 1KXQE 3IDIB 1XT5A 2DICA 1UG9A 1DBAH 3RTQD 4BH8B 4L4VD 5FHBH 2ATPB 3V5HA 4PJEA 5C86A 5ADPH 1DCLA 2COQA 15C8H 2C1PA 2QADB 5CWSA 2JCCA 2RJMA 1EERB 3MXVL 1UT9A 1MCJA 3BAEH 3V5HB 4PJEB 1J1OL 3DSFH 5D6CB 2E27H 1DQDL 4K07A 4LP5A 1Q1JL 4NHCL 3SO3B 5CWSB 2JCCB 4K7PH 3ROLA 1N8ZA 3JWOL 4KV5E 4GXUN 4IDJH 2AGJL 3Q6FB 4JFOB 1ZTXL 4RNRA 3ROLB 1N8ZB 2Z8WC 2CDGA 2Z4QB 1A5FH 3KPMA 5ABDE 3MLYH 2AAVA 2FGWL 2R1YA 4N68A 4RNRB 1SEBA 2CDGB 4I2XE 1KUMA 4PJIE 1UCBL 1UJ3A 4TRPL 5K9OA 1RURL 4HZLA 3TCXA 1SEBB 3TIEB 3MV9B 5CSGA 1UJ3B 4JQXC 2H32B 5K9OB 3D85B 4R8WH 5J13C 2YZ1A 1MCDA 1IM9D 2JJTC 4QNPE 4GSDH 2FX8H 3PJSB 5CJBA 4I77H 3TP4A 1YYMH 3FQWB 3RVWC 4C56A 5DD5L 4Q6IC 2ICEA 1I3GL 1FIGH 1SEQH 4HIXL 3BE1L 3R1GL 4HUXA 1INDH 3S97C 4ZFOL 3GKWL 4C56B 3A6BL 2DQFA 2DQTL 4Z7VA 5F71A 4NP4L 2FD6L 1YYLL 1DR9A 4HUXB 3B5HA 4LDLB 2RFXA 1KCRH 1HHIA 2DQFB 4YBQD 4MNHA 4XP5L 4Z7VB 4G80A 2Q7YA 2A6KB 4OQTA 3UJIH 2L7JA 5IKCA 5DJZB 2HH0L 3FQNA 3GEWB 4MNHB 3GSNH 3NCBB 4JM4L 4G80B 2Q7YB 4M5ZH 1RU9L 3ZT6A 3C6LD 5I6XB 3HPLA 2NZIA 4RA3A 5IKCB 4PRBA 2NYYC 4CU8A 3FQNB 4AQ1B 2XY2A 1QLFB 5BS0A 4HJJH 3HPLB 4P3CL 5E2UH 5C0AD 4XZUB 5LVEA 3SQOL 5BS0B 3OAYH 4JRXB 4PJBE 4U6VL 2B4CC 1MFDH 3DXAD 1OP5H 1HINH 4LSRL 3U9PH 1PG7L 2YRLA 2DLFH 1A7RH 3KVQA 4HQQH 5JPNA 4NN6B 4P9HC 4U6YB 2R0LH 3KLHC 2D0HA 1KJ3L 5F70A 4KZEL 1QLEH 2J2ZA 1T5WA 3MV8E 4KRPB 4OSUH 3V4PH 4YHLL 4Z7WF 3D5OF 5JPNB 1ITBB 3EYOA 5DYOA 2Z31C 4ISVA 2A6JA 1EGJL 4LAQH 1T5WB 4AM0A 1L0XA 3EYOB 5DYOB 3FRUA 4ISVB 2YPLD 4N9GA 2A6JB 4AM0B 4G7VL 3LB6D 4U1GB 2BSRA 1WGOA 4JY5L 4AQOA 4N9GB 4HGWA 3U30B 5DMYA 4C54A 4JN1H 3UZEA 4HC1L 1GRWA 4KJPD 4GAJH 4I4WA 4JM2F 5DJ6A 1GGBL 1S7QA 4HGWB 4TVPE 4ZOAA 1NANI 1M6OA 1RZIB 3EW3B 4I4WB 5DJ6B 1S7QB 4V1DB 5I1IH 3LRGA 3BD3A 3H9SA 4WY7L 3RAJH 3B43A 3I9GH 1IT9H 4JFFD 4MD4A 1WZMA 3SDXE 3MRDA 4POZD 5EORL 1KCUL 1RIVH 4DW2L 1KPUA 5TGBA 1ROWA 3S3PA 3H9SB 2A1WL 5T1KB 1BQHG 3FO1A 4NOBA 3MRKA 4DKAA 4MD4B 4KMTL 1KPUB 5TGBB 3ARTA 1L9NA 3I84A 3HPJA 3UAJC 1HIMH 3MRKB 5GRJH 4AG4L 2X42A 1JPGA 3FMGL 2D03L 3G9VA 3GB7B 1NCWL 3O6FA 1CLYL 1F3DJ 2BVPB 1D9KA 1ZLVH 5J0BA 2GJZA 2AI0H 1EVUA 4EXKA 4JFEB 1JPGB 3CH1A 1X7QB 4LPTA 3O6FB 3KPQA 2HFGH 1UYWL 1OVZA 4MJIA 3NIDE 2J7LA 4IJ3C 3TWCH 1OARL 4N8VG 4E42A 3BIKB 3CH1B 3EO9L 3I6LE 1PKQA 4MQTB 4MJIB 5FYKL 4EBQL 5F6HJ 4MJ5A 4XCEA 1KJMA 4E42B 2OXHA 2LVCA 4O4YH 1R0AH 4LSSL 1GZPA 2YWYA 4M8QB 4Z0BL 4XGZB 4XCEB 2K7PA 1KJMB 1HQ4A 4XPHH 3U48A 1GZPB 3DV4A 3TBSA 1A6TA 1A7PH 1GAFH 2EDYA 4PJ7F 1TIUA 5KTEH 1U6AL 4PJXF 5CJQH 4N0RA 2F54A 1DUYA 1HQ4B 1TPXB 3QPXH 3DV4B 3TBSB 1B4JL 1A6TB 3HZKA 6CGTA 4R90H 1UXWA 5EUKA 1N4XL 3O3DA 3U0TA 1DUYB 3NH7L 4HMDA 3HLAA 4I3RL 5DR5H 1BOYA 3NZ8A 3HZKB 4OCRH 1V7NH 4FZ8H 5JXAH 1UXWB 3B9AA 3O3DB 5D6DC 3U0TB 2KPNA 3NZ8B 2ZUXA 4HT1H 2JE8A 3CK0L 4HWBA 3MRBA 3PQYA 3VE0B 4HG4K 3MBEA 1H3GA 2CO7B 2PXYB 2BRRL 3I02A 3ARSA 3KPSE 3MRBB 2ARWA 1N5AA 3GM0A 1BFVL 3PQYB 1KJ2A 4MZ3A 3TO2A 1P5UA 1N5AB 3ESVF 1XIWA 2LU7A 1KJ2B 3WFBH 5BOZG 2W0PA 4P99A 4QRUA 1IC7L 2NTFA 2P8MA 4RMQA 1ZA6A 1Q9WB 4CUCA 2VLRA 3SQBA 1CF8L 3VG0H 1XIWB 4PJCE 5EBGA 2CLZB 2DQCL 2NTFB 3ZKXC 1CI5A 2P8MB 1ZA6B 2AQ1A 2ENSA 2FHCA 1IGYA 2VLRB 5FM5M 1KCSH 1MCEA 5EA0L 3VD9A 4Y88A 2EDTA 2XQBL 5F88A 5I8OL 2Z35A 1IGYB 1XCTA 4JG0L 3GZKA 3B5GA 3T0WA 2D0GA 5IQ9A 1F02I 4YHOH 3SDDD 5F88B 1G6VK 3MGTA 1MCRA 2Z35B 1XCTB 4UTBL 4KMQA 4KFZC 1QEWA 3RNQA 3B6SA 1FPTL 3ARFC 3N85L 1KN2H 5IQ9B 1NAMA 3WSQH 3WNLA 2I60L 1Y6KR 3QRGL 3D69A 3RNQB 1MCQA 1D6VH 3MV01 1NAMB 5C6PB 2GJJA 5L7XH 1J5OL 4YX2L 2J5LC 3TBWA 5SWSE 2PN5A 5D1ZC 3FHAA 3DTXA 3VXSA 2Z91A 4MLSA 5INCA 2ATKA 1IQWL 1OLZA 2FLRT 3O45A 5HYSG 3TBWB 2BOBA 4TULH 4J23A 5IWLA 4R96A 3DTXB 3VXSB 2YOCA 3VGGA 2ATKB 3TCLA 3V2AR 3O45B 3I50L 4O02H 2BOBB 3WIFB 1U3YA 2EC8A 4YGVA 2ADFL 3BPCB 5TF0A 2CUMA 3FFDA 1NGZA 5DJCB 2VDQL 4PFEA 3TCLB 5I2IA 4LSVH 3WMSA 2IBBA 4PV9A 4RWYH 5FYKD 1FFPB 4PBWD 1YMME 5CEZE 4YGVB 5KVFH 5J3HD 3FFDB 1NGZB 5FUOL 3GFUA 1CK0H 3QI9A 4NPYB 1WEJH 1S9VB 4PV9B 2R39A 2UVFA 1IGIL 1PD6A 3X11A 4XH2A 4YFLI 1LO0H 1TCMA 2CD0A 4XC1L 3NCCB 5C0DA 3KS0H 3D39E 4GW4A 2BC4B 1AC0A 2F19L 4OCWH 2P43B 4OLXH 1OSPL 3LS5H 5HHOA 2E7MA 1Q9OB 5C0DB 2ESVD 4YFEA 1C7TA 1JZ5A 2PW2B 4MA7L 2X4OB 4TSCH 3B9VA 5HHOB 4HFUH 2EXYC 5D96C 1SJEB 2X5PA 2FIKA 4YLQT 3P0VH 4MZ2A 3CMGA 1QYGL 3RX5A 2QR0A 3CVIL 4ERSH 1JNNL 2B2XH 1AP2B 3MGOB 1RHFA 2CRYA 2YUVA 1AHWC 2OK0L 3KPRB 3SPVB 1YA5A 1N2RA 1FGNL 4QTIH 3MLVL 1OW0A 4YK4B 1VENA 3S6CA 3UTTE 1U0QA 1YPZF 1N2RB 5FKPA 4P9HL 5E99L 2GK0B 1W0WA 3NMEA 4I0PA 3BKJL 3VRJB 4F15B 1A4JA 1OLLA 2NW2A 4FOMA 4L8SA 3GBMH 1IGFH 3NACL 1SYVB 2V5MA 1U92A 1W0WB 1YN6A 2Q6WA 5F93C 3C8HA 5JW4Q 1NBVL 1S7RB 3QDJD 1A4JB 2M1KA 1XGTA 2NW2B 4G5ZH 4G7YH 2C7UA 5CD5D 5C7XL 2QSCL 4AL8H 1U92B 1YN6B 2Q6WB 4RMSA 4Z7OE 2Y1VA 3LZFH 3WN5A 4EUPB 2HKFL 1FJ1A 1XGTB 2LU3A 3RWJB 2EO1A 5GRUL 3RUGA 3QULA 4N0UA 2PO6A 1DBMH 1NMCB 5D7KE 3WN5B 2FX7L 1DQMH 1MAML 1GPOL 2X44D 3RUGB 4N0UB 1LO4H 5K59F 5GRVK 2B8OT 2R0WL 2YR3A 4OT1H 3O6LH 1HZHH 1FNLA 1T1WA 1OAZL 5C3TA 1QBML 3BO8A 3ARDC 4UAOC 3FOMA 5KZCB 1RIHH 2Q87A 1IM3A 1JPTH 3VCLA 2ORBH 3T0DA 3ZSTA 1MFAH 1NDMA 4JO1L 3FOMB 4WW2F 1K2DA 1KTLA 4OFKA 5DDHB 1IM3B 5KOMC 2ZUUA 1ACZA 3GIZL 3P77B 3VWKD 2GSIB 2B1HL 1NDMB 1K2DB 1KTLB 4JDZA 3LN9A 4QRRD 3VW3L 2Q8AL 1LO2L 1F45A 3VXMD 3IXAA 2V2WA 7FABH 1VESA 3RVWD 3RRQA 1DLFL 4X6FA 4JDZB 2UWEF 4M5YL 4X9GA 4B50A 3ZE2F 2G75A 3IXAB 2V2WB 3RVUC 4X6FB 2OQJA 2OMBA 3MR9A 4N0CD 3W82A 1G7HA 2G75B 1RZFL 3BPNC 1SVCP 4WFHE 3NZHL 2CKBH 2GEEA 1XF3A 1U95A 2OQJB 32C2A 2JJSA 5LXGH 1G7HB 5TFSL 4BZ2H 1A02N 2XRAL 1EO5A 1XF3B 1U95B 1UEMA 5DRWA 32C2B 5C09D 3ZDXE 4DOHE 4JFZH 2JLLA 1D5XB 3B2VL 4OIIH 2B5IB 2NYYD 5DRWB 4J4PA 5CZKA 4EN3A 5EN2B 1QKZL 4XNZB 3QWOA 3H42H 2DQGH 5HXMA 1MFCH 3CU7A 5DI8A 3HE7A 1RFDH 4Z78A 4EN3B 4CVWA 3KAAA 2A73B 3G5VA 3QUMH 3HC4H 3GJFH 5DI8B 3HE7B 3VFPA 4Z78B 1DLHA 3NA9H 4OF5A 5AEAA 4QXUL 1OP9A 4GQ9H 4KZDL 3G5VB 2XWJA 2N4IA 2IH3A 3VFPB 2V5SA 4PJHF 1DLHB 5CILH 1KLGA 3VDAA 3X17A 1AQDA 4P5TC 3GHBL 1QBLH 3MXWL 2XWJB 2IH3B 1P2CA 5DO2D 4RGNB 2Z31D 3WLWC 4EI6A 2VXSL 1AQDB 4WWKC 4XTRD 4XP9H 3BT2H 4LRIA 1Q8MA 4IS6A 4NM4H 3I75B 4EI6B 4QHNA 4GUPB 1G0DA 4UT7L 5FKAA 1T5XA 4XMLH 4YHKH 4OBSA 4NHUA 4IS6B 3ZL4L 5BW7A 4I18A 4QHNB 4XPBH 1VFBA 3DUHA 1KBGL 1ZA3A 3I3DA 1H3UA 1T5XB 4NHUB 3RI5F 4I18B 4K7FA 3MRHA 2JCCE 1VFBB 4KUCF 5DZNA 4BQ9A 1DQJA 3IS1X 5EOCH 2C9AA 3G9AB 3RDTA 4JHWL 2ZCHH 3MRJB 1T0MB 3MRHB 5JIPA 4K2UL 3QEGH 4X8JA 4TQEH 3RDTB 1P7QA 4MDJA 2CO6B 5GGRY 4M00A 5FA4B 2NY2B 3CXDL 4HWEH 1QHPA 4FXKA 2QJDA 4X8JB 3GSOA 2QBWA 4U1NA 1IGJA 1P7QB 4MDJB 3FQUA 4FXKB 5DMKA 5BVPL 3H9ZA 4U1NB 4RGMB 1IGJB 1JYVA 3L6FA 3MV9E 3IDXL 1A7NL 4EIZC 1NUNB 2ZKHL 3FQUB 5DMKB 2YD3A 1WFTA 2R4RL 5FUZH 3VD4A 4QGYA 3G6JF 3L6FB 1G0YR 2FX9H 5MI0B 1JZ6A 3NPZB 4ZPTB 3OXSA 5L8LB 1IE5A 4BZ1H 5K9JL 3FFCA 4Z7WB 1NL0L 3TJEL 4OB5H 5J12C 2IADB 1GC1H 4OM1L 1QLRB 2OR9H 4YNYA 2DLGA 3OXSB 3NFSH 1S7WB 3FFCB 3TIDA 3GRWH 4OCSL 3GBNL 4LSUL 4PJ8D 4YNYB 2EEDA 3ZHKA 2I5YH 4BZYA 4JVWA 4Z7VE 1EAPB 3KPOA 3I2CH 4ORZC 2NY4C 4JM2A 1MCOH 5IQ7H 4OZIF 2OTUA 3A6CL 3MLWL 1WUNT 4HEME 4JM2B 5HJ3B 4L3EE 4OM0H 1WITA 2OTUB 2VQUA 4L9LA 3QDHA 1CD9B 3BOVA 4Y19D 1JPSL 1CICB 2OL3L 5JR1H 5EU3A 3EZ8A 5IHUL 4PJGF 4QOKA 4JRXE 4L9LB 2HAZA 3GSNA 5EU3B 1ND0A 3DGCR 4P4RA 4HKBA 2IANA 3SO3C 4F7CA 4QOKB 4U05A 1HH9B 5JW4N 3GSNB 2CMRL 4RX4A 4KVCL 1C5CH 4HKBB 2IANB 1KFAL 4F7CB 2AEPL 5CINL 3ULUL 4UOW1 5E1AA 4KPHH 2AJ3B 1N7MH 4RIRA 3MLZL 5DLMH 2FGZA 1HXMA 5E00A 3RIFF 5H35A 4QHUA 3KPNA 3AU1A 3QIUC 5E1AB 1BVKA 4RIRB 1QFHA 1W2KT 2YKLL 1FP5A 3VXOA 1G9NC 1HXMB 1PG7X 1S78C 5CZXC 5E00B 5H35B 2AK1L 4QHUB 3KPNB 3Q5TA 1UM4L 4KROD 2FO4A 3G04A 1QRKA 4RZCA 2XXCB 4G9DA 3VXOB 4JQIL 3U6RA 4AENA 4POUB 2AJZA 3STZB 3MXVH 1IEBA 4KVNL 1RUQL 1J1OH 2FO4B 4I0CC 1DQDH 1OHQA 4G9DB 1Q1JH 4MQ7A 5E8DL 3MRQA 4PJ7A 4AENB 3U6RB 4PJ9B 4PJXA 4U49A 2AJZB 3JWOH 1IEBB 4BM7A 3O4OC 3ARFD 1QSFE 3PP4L 4PJ7B 2AGJH 3IXTB 4V1DE 4PJXB 2XWBA 1ZTXH 4JPIA 3QHFH 3H9YA 1CTOA 3HRZA 1CU4H 3F12A 5GZND 1EEUA 3H9SE 2FGWH 2BVTA 2PTTB 1Z0NA 1KCVH 2XWBB 1L7IL 4HH9A 1UC6A 3HRZB 1UGNA 3F12B 1UCBH 4KKBC 2VL4A 1N64L 4TRPH 2M8XA 4NOFA 3OWEA 4HH9B 5E9DD 5IB3B 1B6DA 3JBG7 2F8XC 3QAZC 3QFDA 1JZ4A 3HC0A 4JFEE 2GCYA 3PWVA 4ODXA 4Y4KC 2XTJD 1X3DA 1PYWA 3MLRL 4F37K 1AGFB 1EEZA 4IDLA 1I1FA 1JRHL 1A0QL 4ZNEE 4I48B 5ERWA 3PWVB 5DD5H 4ODXB 3SEPA 1PYWB 1UA6H 2OCFD 4QF1B 4XHJD 1HOCA 1EEZB 3R1GH 3BIBX 3DROA 1I1FB 1NCCL 2DD8L 3A6BH 4JZNA 3WHE0 4TNVK 2DQTH 5KSVB 5GGTL 1VEOA 4NP4H 1RZKL 1HOCB 1HHKA 1FH5L 1QVOA 3DROB 3E8UL 1N6QL 4JZNB 3CC5A 5T3ZL 3UTSA 4XP5H 4LF3B 5EU5B 1HHKB 1VA9A 4PRID 1QVOB 5DJ0A 2HH0H 4ODVL 3CC5B 3UTSB 3LKSA 1A3RL 4WI3A 4JM4H 5TH2A 1P7HL 4JPWL 1RU9H 1H5BA 4S11A 3KHQA 1MNUL 2EXYD 4Y5XC 5DJ0B 3MRCA 3QIWA 3LKSB 3FB7B 5TH2B 4P3CH 2ILLA 1DTUA 3MRCB 1UQSA 2GAZB 3QIWB 4U1GC 3FOLA 3SQOH 3MOAL 2C1OA 1JRHI 3QEHA 3BGAA 4U6VH 1FE8L 2OR8A 1BQSA 3OG4B 1UQSB 3DO7B 3FOLB 1G7QA 2C1OB 4LSRH 3ULUD 1PG7H 1MUJA 3BPOB 3GNML 5HYFA 3PQYE 4JFDD 1P4BL 3D0VA 4HKZA 1B9ZA 1CDIA 1CGSL 1VGEL 4KH2A 4KDWA 4XI5C 2FZ3B 1KJ3H 4KZEH 1G7QB 5EZLB 5DHYA 4QCIA 4CDGC 1MUJB 4YHLH 2XKSA 3TA3D 3D0VB 2MHAA 4K3DL 1EMTL 1AD0A 1KN4H 1X4YA 1IBGL 1BGXL 1EGJH 3T2PA 4QCIB 5EOTB 5IFJA 2NY3B 2HVKA 1AD0B 4MXWL 4UNVA 5SWQA 1YJDC 4LCWD 3CSBA 2VLRE 5HHME 3MODL 4G42A 5AZEH 3PDOA 4G7VH 2EE6A 5DK0A 2HVKB 2J6EL 4JY5H 5SWQB 4G6JL 1LHZA 2AJYH 4G42B 3PDOB 4HC1H 3WKMH 2BNRD 5DK0B 4GW1A 1GGBH 5LGHH 2BVOA 4XNUL 2FEDD 2DWEB 5AWNL 5CEZD 4HPYH 2BNQB 1RJYB 4JHAH 4GW1B 5D7IF 3ARDD 1LEIA 4WY7H 3MUHL 1SJHA 3CX5J 3QCVL 1T1ZA 1YQVL 4GBXC 5EORH 3CFBB 1KCUH 4F58L 4DW2H 1KLUA 4NQSA 3KYOA 1M1SA 1PQZA 4JO4L 1LEIB 2A1WH 5IROC 1T1ZB 2IH1A 4Y8AA 4KMTH 4EI5A 5EULV 5KJRL 1KLUB 3OJMB 5EU7C 5AD0A 2YMXL 2CSPA 2IH1B 3S3JA 1YPZA 3VXSE 1MJJA 4EI5B 3QUYA 3WUWG 2D03H 1TPXC 4JRYD 1NCWH 1RZJC 1CLYH 5E2VH 3SKOA 5AD0B 4OLYH 1YPZB 4P59L 4WUUD 5IB4A 5SV3A 4FQXA 3QUYB 3PG2A 5D1XC 3DUUA 2E7LA 5IVXE 3H3KA 3SKOB 1UYWH 4G8GE 2FJFA 1MVUA 5IB4B 2LE9A 2LV4A 3BKCH 3EO9H 1KYOJ 1VHPA 5FYKH 2EDHA 4EBQH 2FJFB 4JY4A 1MVUB 5AYUH 4MX7A 3UTTD 3MFFA 3ISWA 4PP1C 3DARA 4LLUA 5T3ZD 2CXGA 4XWOC 1MI5A 2PXYC 4Z0BH 2HTLC 4JY4B 5GISH 4MX7B 2XI9A 3MFFB 4LLUB 1E4WH 3K0WA 1QHOA 4JKLA 4CBPA 1MI5B 4F33A 4OJFL 5E4EB 1MCWW 5B3JE 3BEWA 5L2KA 4CMMA 2R4SL 4B53A 1NGXA 3UTQA 4JQVC 5FYLL 4F33B 1B4JH 1VKXA 3QEQD 5GGUB 4WV1A 3BEWB 4K9EC 5MEPA 5L2KB 4CMMB 4W68A 1N4XH 3NH7H 4JZJA 3U83A 3UTQB 5CD3A 2Q76A 2ZSVA 4LQ1A 4R9HA 2HT4C 4X4ZA 4PRPA 1VKXB 5MEPB 4DKEL 4KQ3L 2QTEA 1Z9OA 4TNWK 3PF2A 4Z77B 4JZJB 3ECBA 5CD3B 2Q76B 2ZSVB 3KPRE 4WW2A 4QRSA 3J7HA 4U0RC 4U6TA 1CXKA 1MQ8A 4PRPB 4Z95L 1IGTB 1SY6A 4G43B 3CK0H 3AXLA 4WI5A 1ES0B 3ECBB 1DSFL 4WW2B 4QRSB 3VG9B 3ALWA 3SO5A 4NGHL 2BRRH 1N0LA 3WLWD 4PRDA 4WWKD 1NSNL 2AK4A 1OAKL 2NMSA 3SDAB 2UWEA 2R2CA 4GMSH 4X6BA 3ELAT 1PW3A 4PRDB 3PNWA 2AK4B 4Q6YA 2YD6A 1JGDA 2UWEB 1IC7H 4X6BB 3DX7A 4NN5B 2EC9U 1K8DA 4OGXL 1G9NL 1CF8H 3T1FA 1KGCE 3PNWB 3NCFB 2ICWI 3RVTC 1JGDB 2DQCH 3DX7B 3GSQB 2PYEA 1K8DB 5EA0H 4LPYA 2DI7A 2XQBH 4LVOB 5I8OH 2PYEB 3RJDA 5C0IA 4JG0H 4ORGA 1NGYA 1AO7D 4M7LL 4OCLC 3MLUL 5ALBL 3AS2A 1OAUL 4TSBL 5GGSA 5C0IB 5CIPH 4ORGB 1NGYB 2JIXA 4PP2A 3GMQB 3GSWA 3MROB 3N85H 1ORQB 4ZXBA 5HY9A 2I60H 5GGSB 4DFHA 3L3DB 4PP2B 5JXEC 3QRGH 1OGAA 3GSWB 2MQ0A 5C2BL 1EPFA 4HS6B 3CSPA 4ZXBB 1KPVA 5HY9B 1J5OH 3ZE0E 1F58H 3LHPL 4CNIA 5EIQA 1F4WL 1OGAB 3OPZL 4F7PA 1JWSA 5JORA 3TYGL 1KPVB 4NKDA 1IQWH 3UC0L 4PJHA 3WXVL 2APTA 4X7DC 1GSMA 1I85C 2X1XR 2APVA 4XP1L 1BJ8A 1JWSB 5JORB 4NKDB 4PJHB 3I50H 1I3RA 1H3WM 1AI1L 2V17H 1EEYA 3CSYA 2ADFH 1F4XL 3QDGA 1ITCA 2VDQH 4JFHE 5HDQL 5A2LH 3U7YL 1EEYB 3CSYB 1SM3H 2CJUL 3QDGB 5FUOH 3TVMC 3JWDL 4I9WD 1MFNA 4KHTL 5KANI 4YK4C 1IGIH 5IHLB 2HRLA 1KB9J 1Z5LA 4WEBL 1GCFA 1YMHA 5CHNB 2ADGB 4OCXL 3PL6C 3BP7A 4WFED 4Y16B 3FAXA 2GI7A 1URLA 3EOBA 3DIFA 1J0HA 1FYHB 1NEZA 1Z5LB 2VZ1A 2YEZA 1YMHB 5D8JH 4JREB 3BP7B 2F19H 2N1KA 4HWUA 5EH1A 4LFHD 1FV1B 4I0KA 4LLQA 1OSPH 4YDVA 3EOBB 1E28B 1U3HC 3DIFB 3OX8A 3FO2A 4L8CA 1NEZB 1RULL 3FHQA 1MHPH 1LP9F 1DEDA 3CAFA 1IEHA 2HRPH 4MA7H 3FJTA 1NEUA 2CKBB 4N8CL 4YDVB 3O6ML 3OX8B 3FO2B 4L8CB 3WNPA 1U91A 4HK3J 4ACPA 2IPKA 1T7VA 3K2MC 1QYGH 5GJSH 2NY1B 3CVIH 1CD1A 3FT4A 1JNNH 1EAJA 1U91B 3B9EA 3BW9A 5T3XL 2OK0H 5EBMA 1F8TL 2IPKB 4XPFL 4WHTA 1FGNH 5J6HA 4HPOL 5I71C 3MLVH 3DPBA 3QHZL 2FCBA 1OPGL 3G6JA 4U1SA 3BW9B 3U82B 5EBMB 4P3DA 3QPQC 5J6HB 4OZHF 5C0CB 4P9HH 3IFLH 4RGNE 3G6JB 1U8IA 2FB4H 4U1SB 3QIUD 2Y25A 4ODUA 4YHML 4P3DB 3LOWA 3SBWA 2CDFA 2IPUK 5CZXD 1S78D 3MQIA 5CAYB 1ZHNB 3QUMB 1NBVH 3K1KC 3GJFB 1U8IB 1QG3A 5JDSB 2FJHA 5C7XH 5DK2B 1NQBA 3VRLF 4R2GC 1R3JA 2HKFH 3QDAA 2DMCA 5EU6D 2FJHB 2XZAL 3R0NA 3QRFM 1R3JB 5DTFA 3RHWK 4EOWH 2FX7H 4OZIA 1NC2A 3QCUL 1BX2A 3IF1A 1MAMH 1GPOH 1UEYA 3L3JB 4DKFL 1NCTA 1MRFH 2WUCL 1X6NA 4M62H 5DTFB 1RUPH 3FRPG 5GRYA 4OZIB 3RTQA 1BQHB 4L4VA 4FP8L 4UMGA 3Q6GL 1OAZH 4JE4B 5T1LA 1NGWA 1QBMH 4D3CL 2UZYB 3RTQB 2XPGA 4L4VB 3RY6C 2VZUA 2APBA 1JGVL 3F7QA 4TOYL 1NGWB 3HI5H 3WFZA 5GGQL 1UZ8A 4Y4HC 3VXTA 4PJGB 4G6KL 2MTPA 4JO1H 1NLDL 4V2BA 3S98A 3QH3A 5JIHA 1I9IH 2I26N 3GIZH 2WIMA 3LIZL 2Q8BL 2B1HH 2Q86A 4L3ED 3ARGC 4NM8L 1B0RA 3VW3H 3NCYP 1RZJL 3O2VL 3QH3B 4PUBL 2Q8AH 1LO2H 1UM6L 4LVHB 4OZGF 1HSAA 1I8KB 1CD8A 4M5YH 1B0RB 4O2EA 1CFTA 4Z7WE 1BLNA 1ULVA 4L9DA 2WZPD 5C0JA 2W65A 1BFOA 1JN6A 4O2EB 1CFTB 1RK0B 3FFCE 1BLNB 4KV5F 1RZFH 1TENA 2FLBT 3FO9A 5K9KA 3NZHH 5J11B 2W65B 5KVEL 1KYOK 4KKCC 4R97B 1BFOB 4XBEL 1IM9A 2FATL 1NBYB 1JN6B 2W07A 3O6KL 4UB0H 5TFSH 4AMKL 4NNYA 2PUQT 3BDXA 3IETA 2XRAH 3FO9B 5K9KB 4G9FD 5CUSL 1HYSC 4OFYD 1IM9B 1EJOL 2HT2C 3ULSB 3IETB 1C1EL 3B2VH 4XXCC 3GRWA 1KEGL 3MV7D 4XP4L 1LK3L 5M7QA 4F2MB 4OKVA 3W0WA 1QKZH 3QUZC 5DUPL 2X7LA 1SBSL 5ILTL 4BH7A 4FTVD 8FABA 1T2JA 3GSUA 4NUJA 2NY7L 4OKVB 3W0WB 4NNPL 3QDMD 2X7LB 3LS4L 5HDBF 4BH7B 5C0BD 4GRLC 8FABB 5SWZE 5HDLA 4PRHA 2Y5TB 5D2NA 3H0TA 4KI1A 4QXUH 1DZBA 5GIRB 2HYMA 3CDCA 4KAQH 2H41A 4KZDH 5IMLA 3DHMA 1FVEB 1QSFD 2IANE 5D2NB 3H0TB 2WANA 3GHBH 5I17B 1I9JL 1A2YB 3C6LB 3MXWH 5IMLB 4P2OC 4I13B 4UIMA 4XXDB 3ARUA 5C0AA 1ZGLP 1J87A 4WO4C 4LNRB 1QR4A 4EDXB 3G08B 1F90H 2VXSH 5KVDL 3CFKA 3BH9B 3K4ZA 4HCRL 1MAJA 1OM3L 1QSED 2FL5B 1GIGL 5HVFB 4UIMB 5GS2D 5C0AB 1ZHKA 4LFHG 4PRNA 3H3PH 1Q9KA 4UT7H 3WO4B 1T0PB 3LEXA 4FZEL 3LQAC 4OD3L 5MEOA 4PRNB 3ZL4H 2DF3A 5EUOE 4S10A 3T0VA 3DXAB 4NWUL 1KBGH 4YZFF 2Y4SA 2A38A 1BD2A 3LEXB 5DEGA 5MEOB 5J06A 4PIRF 2EXWC 5DJ2A 5EZIL 3SCMA 3V5KA 4H88H 5E6ID 1BD2B 1J7VR 1VFOA 5DEGB 3RWDA 1FNEA 4PJ7E 1IJ9A 4PJXE 2GSGA 5DJ2B 1T21B 4PJBF 4K2UH 3MRMA 3F7VA 3F7RA 1FORL 4JPKL 3RWDB 1FNEB 3WL9A 3MLPA 3CXDH 4NO3B 3MRMB 5MHSD 2YPLB 3DVIA 5AAMA 3U4EA 2R2EA 4BJLA 2VRAA 1JI2A 3WJJC 3WL9B 5BVPH 4PY7A 1V5JA 4GKNB 4JLRB 2GT9A 3OBAA 4R3SA 3U4EB 5IJKC 1JNLL 3IDXH 4K94C 3BQUC 2ZKHH 3SGEI 1D5ZA 2R4RH 4PY7B 3L3HB 4RFNB 4NJ9H 3HNSL 2GT9B 4JFFA 5D1XD 4I3GA 4KHXL 5I75C 1BECA 1D5ZB 4LPXA 1CICC 3ZKSD 1YY9C 2P8LA 1RSFA 1AKJD 4I1NB 4JFFB 1YNLL 1FG2B 5K9JH 1QNZL 2YHGA 3VXRD 2YPKA 1NL0H 3B2UC 3TJEH 1YEDA 3BZEB 4OM1H 5KANG 2OI9B 4PP1D 3A0OA 3B3IA 3L9RA 1CDHA 1MCHA 1NFIB 1CDCA 5ITBL 2QHLA 1YEDB 3MBXL 4J3XA 3GBNH 1IFHL 3EOTL 4OCSH 5I9QB 4LSUH 3B3IB 2IC2A 3C5JB 3L9RB 3R06B 2GITA 3PWPA 1TJHH 4M6NL 3RA7L 4DJMA 2O61A 3SDXF 5JMOC 5F3BA 5DT1L 3UTSE 2BVYA 2GITB 3DYMA 3A6CH 4P23A 2O61B 3VFWA 1S7TA 3ALXA 4P2QE 3S8WA 3HNVL 3IKCA 2WWKO 5JUEL 4ODBD 5HHMD 1JPSH 1P84J 3VFWB 2OL3H 1FO0L 1S7TB 4UQ3B 1BOGB 1RI8A 5D7IB 4JG1L 5IHUH 3IKCB 1MLBA 1CGTA 3MO1A 4N0FA 1AIFA 3WFEL 3BGFB 4NQCD 1MLBB 4PJ9C 1HDMB 3ARRA 4X6CA 3CXHJ 3NIDF 4QXGL 4LRNL 2ZUWA 3MO1B 1OSZA 2CMRH 4N0FB 4Z8FH 3RWEB 1AIFB 5EC1A 5A43C 2AEPH 4NC2B 1JBJA 3BUYA 5CINH 5HYQA 1FRGL 2CK0H 1OSZB 3ULUH 4YDJA 5FV2A 4S2SA 2W38A 3MLZH 4E41D 2Q7NA 5LKNA 3BUYB 4OIBA 5HYQB 5FO8A 2OX5A 3KGRA 4OCYL 4YDJB 2FEEL 4S2SB 3MC0A 5E4IA 5FV1L 3RVTD 2YKLH 4JY6B 2PETA 2AK1H 3D1MC 5FO8B 3CX2A 4UILL 1UM4H 5KS9E 3JVGC 4HWNA 3WS6C 5FGRA 4JQIH 4J6RL 1Q38A 4YPGB 4F9PA 3MUGB 4KVNH 1RUQH 3V7AG 5E8DH 2C3GA 1FL3A 4J8RB 1AFVH 1KIQA 2RBLA 3FQXA 2BNQE 1T80A 4BK4A 1AY1L 3PP4H 4U33A 5JLZA 5C0FA 1FL3B 2VAAA 1KIQB 3SGKC 3NGBC 4YFDB 5JXED 3FQXB 4J12A 3UPCA 3VI3E 5CEZH 2HMIC 4P57A 5J7CC 5C0FB 1WLHA 2VAAB 1L7IH 1UACL 2QHRH 2VZSA 4NKIL 4P57B 1YEKL 2OP4L 3EBAA 4YDLB 2YD7A 1N64H 4JGUA 4UV4L 3UZQA 5FK9A 1A64A 3SDDA 1CS6A 2EEAA 3O2DL 4E0RA 3QQ3A 3F5WA 5L0QB 5C92A 3V6BR 3HB3C 3CFJB 3SDDB 2ZNXA 4E0RB 4PJCF 4DKDC 1FVDA 4NBYB 3QQ3B 3F5WB 4ZFGL 5EFIB 1JI1A 2PTVA 1T04A 3EGSA 3LQZB 1TZHA 3MLRH 4W70A 5I1KL 3EDDA 4QO1A 2P1YA 4NKQB 5I74B 4A6YL 4H26A 5I1EL 1JRHH 1A0QH 3TVMD 5D7LE 1T04B 1MWAL 4LQFL 2J8UF 3EGSB 1TZHB 3BRGC 3S36L 2F53E 2YPVL 1NCCH 1U2CA 5B8CC 1RZKH 2Y6SD 1FH5H 3LSOA 3E8UH 1N6QH 5C0EA 3FT3A 5T3ZH 3IRPX 2YD1A 1DVFC 1MI5E 4Y5VA 2DAVA 5DQDL 4LOUC 3U46A 4X4XB 5IMOA 1U3HD 1WJ3A 3LSOB 3CLFL 3KXFD 5C0EB 3FT3B 4ODVH 4RDQG 3T0EC 1A3RH 1HI6B 5CGYC 3KJ4C 4JPWH 3KYMA 1U8PA 3WV0A 3U46B 3RZCC 5IMOB 1MNUH 2IAMA 3SKJL 2NY3C 3EUUA 4X7EC 4NRXA 4RBPK 4U6HB 3KYMB 4Q9RL 4GS7B 1U8PB 4U3XA 3DV6A 2DOCA 4HJ0C 3PGDA 1C08B 1KB5L 2WBKA 5DWUH 2V7HA 1IKNA 4U1KA 4GXUM 4NRXB 4P2RD 3MOAH 3TN0C 3TO4D 3K8LA 1GGUA 5KBNC 4NO2A 5MEQA 4MMXC 3DV6B 5J57B 4X4ME 3OJVC 2VIRA 1FE8H 2EDEA 2V7HB 4HW6A 1S7SA 4PLNC 5FOJA 4Y4FD 4Y1AA 3O9WA 3QNYA 3QPQD 4FQHA 2V6HA 1T66C 3O3EA 5MEQB 3CPLA 2VIRB 3LD8B 3GNMH 2D7MA 4X8XA 1BIIA 1FN4A 1CGSH 1VGEH 4PJAF 3AAZA 1S7SB 4OD2A 1JNJA 4FQHB 1FFQA 3O3EB 3F8UB 2ESVB 2BVEA 3CPLB 5CJ8A 5DUBA 3SDCD 3K7UA 1BIIB 1FN4B 1EMTH 2X4RA 3AAZB 4OD2B 4HEPG 2J88L 2EIDA 2ERJC 3QWRD 1IBGH 3ZE2E 1BGXH 2A83B 4UUJB 5DUBB 4R2GD 1Z0MA 1LD9A 1E27A 3N1FC 1F42A 1ODAA 2X4RB 4MXWH 3DI2B 3VWJC 2X4NA 3LQAL 5FDWA 4ZG1A 3O11A 3MODH 2VR9A 5ICXA 1LD9B 1E27B 3WIHH 3OZ9L 3C5ZA 4XAWL 35C8L 2J6EH 4PY8J 5FDWB 2X4NB 4G6JH 2PYEE 1N5YL 3O11B 4F37F 4KUZL 1MCKA 1ZLWH 1EXUA 4JJ5A 3JTTA 3C5ZB 2QV2A 4XNUH 5DMGC 4FFVC 4JKWA 4BQ6A 1JHTA 3HMXA 2YN3A 1LP9A 2WK2A 5HI5D 1EXUB 4JJ5B 2GHWB 3JTTB 3WEXA 4RFEA 4TNVF 5DURD 3QDJB 5DEFA 1IILE 4OF8A 1B0WA 1JHTB 3QCVH 3DURA 1LP9B 1YNTA 3WEXB 3SDYL 3MNVA 4C4KT 3H9HA 5LAXA 4JO4H 5DEFB 2CRIA 3Q0HA 3EO0A 4OFIA 5CIPA 5KJRH 5I8KL 3G6AA 4IRSD 5FO9A 5IV2A 1D5BA 3H9HB 5LAXB 3B9KC 3ARGD 4OI9A 3QXDA 4G8FA 1IGMH 2Z93A 2YMXH 3EO0B 4PG2C 4K94L 1G1CA 5HPOA 5B4MD 4AJ0A 2VLJA 2ZSWB 5CIPB 4OTXH 3G6AB 4OZHA 4KQ4H 5FO9B 5IV2B 1D5BB 1UWGL 3ZT5A 2Z93B 1WTGT 1UXSB 1G84A 1I7UB 4P59H 1U58A 4DQOL 5IB2A 4OZHB 3QG6B 2DJSA 2WP3O 5JZ7D 3KS0J 3VMPA 2VC2H 5IUSA 3D3VA 3GSVA 1X5AA 4LLMA 1U58B 3RQ3A 4NO0D 5IB2B 4JQXA 1WSST 2ZUVA 2H45A 5F9OL 3KLAB 2JJTA 3MRFB 3GSVB 5TJWK 5BO1L 4HIEA 4LLMB 4O2CA 1QFPA 1E4XL 1XF2A 4WEMB 5ANME 5J13B 1T2QL 4WCYH 4ONHA 1R5IB 2HT2D 4B5EA 4O2CB 1ED3B 4QRRB 1QFWL 2VLLA 3SDAC 4NC0B 4ZUTA 4Q0XL 5I8EA 2FR4B 5I1AA 3MLSL 4OJFH 1SQ2N 1AXTL 4ONHB 1KULA 2D31B 5DMJB 2I07A 4Y2DC 1C5BL 1BAFH 2R4SH 3SE4C 4Q6IB 3QUZD 2VLLB 3C5SA 4ZUTB 3ZTNH 5I1AB 4NN5C 1ZVSA 1WIPA 4H0GA 1GYAA 4M1CC 3AS3A 1RY7B 1C5DA 2NY0D 3QUKB 4OUUA 4ODWA 3S5LA 3WJLC 3C5SB 2IEPA 4GRLD 5CSZA 1P53A 3Q3GA 3ARBA 1ZVSB 1P84K 1YY8B 4DKEH 3HI1A 3QUXD 4KQ3H 4EEEA 4M03A 2O26U 4ZSOA 3S5LB 4OUUB 2R9HD 5C09A 4AIZB 5I15L 2W9LA 5CSZB 3P11L 3Q3GB 1P6FA 2DQJL 4Z95H 4AZ8A 3HMWL 4ZSOB 5E1HB 5FB8A 1DSFH 5C09B 5B38G 4M3JA 3F7YA 4P2OD 3BI9X 4KMLB 5C0CE 5HPMA 2VLME 1E4XI 4NFBA 4OZGA 2QKIA 4BA8A 3E3QE 1NSNH 5FB8B 3RGVC 3M07A 3F7YB 1H3PL 1CXHA 1A7OL 5HPMB 1QFWI 4X9BA 5FYJL 5ESVB 4OZGB 2QKIB 4WDIA 3MRLA 2EC9T 3T2OA 5F89A 1L7TL 4OGZA 1J05A 1MHEA 3STBA 3VFGL 4OGXH 1G9NH 3P4OA 4IOSD 3CMOL 4WDIB 3MRLB 3P9MA 2ZJSL 3GI9L 1WAAE 3UBXA 3P4OB 3TPKA 3P9MB 3S96A 3AGVA 1J88A 5HHNA 2Z31A 4TVSa 5DJYA 3UBXB 2ZUTA 2IGFL 5FF6A 3HKFA 4M7LH 4M7ZC 4OZIE 3MOQA 1FHGA 5HHNB 2Z31B 1TTUA 3MLUH 5ALBH 1OAUH 1AGBA 4BELD 1NC4D 2W0FA 1TVBA 4XMKL 1VEPA 2E7BA 4L4VE 1U2HA 3BSZL 2B0SL 2BSSA 3AROA 1TVBB 2DYPA 5C2BH 4PJGE 5I1JL 3VFOB 1KEML 4OAWA 1UWEH 4Y16C 2AV1A 2E6QA 3LHPH 3BQUD 2BSSB 1MCFA 2DYPB 3OPZH 3IDNA 3EYFA 3TYGH 3UC0H 3WXWL 3WXVH 1LDPH 1FVCB 4KI5D 2AV1B 4ZQKA 3L7EA 3Q1SL 4FMKA 1YNKH 1CFVL 4XP1H 2O5XL 3IDNB 3EYFB 4KK5D 5INDA 4HIIA 1CQYA 1AI1H 5GS1C 4AEIL 1X6LA 2XN9E 3L7EB 3B2UD 1ZHLB 2XYCA 4NKMB 4TNWF 1L6ZA 1F4XH 3IDUA 5INDB 4HIIB 4E5XB 5HGHB 1E6JL 1KC5L 5HDQH 5SWZD 1ADQA 2VXUL 3U7YH 5IBLD 1W0VA 3ZHDA 1T3FA 4LCIL 4PGCB 5E8PA 3JWDH 4LSPL 4KHTH 1NFDF 1W0VB 1T3FB 4RWHA 5E8EA 5E8PB 4OCXH 4YAQA 3EDKA 5FM8A 1EHAA 4ONFH 3F6IA 2BVUA 5E8EB 4DGVH 3E3QC 2VISA 4YAQB 4P46C 4PJBA 4IJ3B 2BFVH 5E8OB 4HUUA 5KSBF 1E6OL 1RULH 2V5RA 2VISB 1X44A 1FNGA 4OD1H 5L88L 5KSAD 1MJ7L 3QG7L 1QUNA 4N8CH 5B39G 4FNLL 3VD7A 4ZO6A 1FNGB 4XX1E 1NMBH 5EOQH 3HS0A 3VXPA 3HAEG 4M3KB 2NY6C 5AG8A 1T03H 2VDNH 3P3YA 1JWMA 4NZDA 4ALAL 5EZOL 1ZEAL 5J1AA 3HS0B 3VXPB 3PWLA 4XPFH 1DBBL 5D72L 4HPOH 1BPVA 3P4NA 3QHZH 1NDGA 5ID1A 5IVOA 3DGGA 1JWMB 1OPGH 2YUXA 1OGTA 4Y19A 1CE1H 5CJOL 3P4NB 2VOTA 1NDGB 5D6DA 5ID1B 5EWIL 3DGGB 3KLDA 1YN7A 2X6MA 4Y19B 5EOCJ 5B21A 5C0AE 4WI8A 5C0ND 3RNKA 3N1PC 2W60A 4D0DA 1YN7B 4K8RC 1GGIL 5GS2H 5MEND 1YJDH 3DXAE 4WTZG 3BP4A 3RNKB 2W9EL 3LRHA 5FUCE 2XICA 2W60B 4KJWD 5F9DC 1TTFA 4D0DB 3STLB 5I19L 2ADJB 4U2ZA 2XZAH 1A4KB 3ILQD 3SDXA 3BP4B 4U31A 5C07D 1JZ3A 3WYRA 2DBLL 2HVJB 3QCUH 4U7KA 4DKFH 5HYIA 1FLRL 5D2LE 1Z9SA 4JZOA 3SDXB 5DRXA 1ZMYA 3IDJA 2DN7A 3BZFA 2HMID 3V4VL 4QWWD 2AJUH 5DZLA 5DF0A 3Q6GH 5DRXB 3ZKXB 4D3CH 2Q20A 2YPLE 3IDJB 1DQQA 5IESL 4KROB 4OV6F 4IMLA 4U6XB 1AQKH 1JGVH 3WUWB 4OLZL 4DTGL 4TOYH 2CRMA 3F65A 5GGQH 1T22A 4G6KH 4L1HA 1DQQB 2FJGA 3ZMRA 1NLDH 2F58L 4IMLB 3ARFA 4HF5H 4FQQA 3CVHA 5E94A 3CUPA 2PR4L 3BWUC 2XWTA 2Q8BH 1T22B 4P2QD 1GC1C 2UYLA 1NAKL 3ARFB 4NM8H 3S3SA 3HR5A 1RZJH 3O2VH 3PGFL 3CVHB 4FQQB 4HLZG 5E94B 2HLAA 5HGDB 3O2WL 4CN4A 1UM6H 3E2HC 3N9GL 1AGDA 5D1ZA 4JFFE 2UYLB 2GFBB 5BRZD 4QRPD 2D9QB 2J5LB 5L9DL 1AGDB 5D1ZB 4LPCA 2YRPA 5E9DA 4NUGL 4YBQC 4HUKB 4CRPA 4JAMA 5C08E 3K74B 2Z8VC 4MXVE 2FATH 1DVFD 4JO2L 5E9DB 1A9BA 4EZMA 2WW8A 3QP3A 5C3LD 4LOUD 4Z7UF 3JZ7A 1D6EA 1YECH 5CUSH 4JAMB 4L4TD 3T0ED 2VABA 2BNUA 5CGYD 4J3WA 1A9BB 1C1EH 3RZCD 2EECA 2XTJB 2CK2A 1D6EB 1KEGH 2MSPA 1LK3H 3MJ9H 2VABB 3QSKB 3BHBA 2XOTA 3ARWA 1KELL 4IMKA 1EFXA 5DUPH 3WO4C 1DQLL 3E6HA 5D7IE 1SBSH 5ILTH 1JWUA 4X7SL 3LRSB 2ZCKL 3BHBB 3OF6D 2NY7H 3TN0D 3AB0B 4LEXL 4NNPH 1WBYA 2X1PA 3ARVA 3RHWF 3E6HB 3LS4H 1O5DT 3UP1A 4BQCA 5T1DL 4UBDC 1T66D 1FDLL 4M4RA 1Z6JT 2OL3A 5DJAA 4PJCA 5J1TC 3ES6A 4FHBD 4G8IA 3T2NH 1NUFA 4PYGA 2AEIT 1H3XA 1I9JH 4KGLA 2OL3B 1H3VA 5DJAB 1A21A 2IMNA 5T5NF 4PJCB 5D96B 2VXQH 3RWHB 1QR1A 1CCZA 1R3HA 4HSQA 1BHGA 3FZUC 5DD3L 3QZWA 1A1NA 3IFPA 4HCRH 1OM3H 1TTGA 1GIGH 4Z18A 5IBUG 4DZ8A 3AVEA 3K46A 3VWJD 1OWWA 1AHWB 1R3HB 3EOYG 1ZWIB 3QZWB 1A1NB 1X5LA 3IFPB 4YHNA 3JWOC 4FZEH 3SGEH 2J8UB 1JF1B 4OD3H 5EDXA 4NWUH 3MOBL 3W2DL 1TZGL 3BPLC 3X13A 4RFNC 4YHNB 1QRND 2H6PB 2NNAA 4OGAD 3WLBB 5DMGD 4JFDB 4FFVD 1OY3B 3P73A 3L3KA 4X98A 5I18H 3X13B 2BMKA 3UTOA 1WTLA 5D1QC 4OZ4B 1S7UA 2NNAB 4M6OL 4LKXA 4POZC 1WZ1L 4M93C 3L3KB 4X98B 1G9ML 1HWGB 5BZWA 3QNZB 2OI9C 1FORH 4JPKH 4LKXB 4XB8A 5JTWA 2NLJA 1OL0A 5DJXA 5BZWB 1L9MA 3VGBA 4ZAKC 3R0MA 3SY0A 1XF1A 2NLJB 5IVNA 3OKYA 4CAGA 3W9EA 3ULVL 5DJXB 4M48L 1MCWM 1JNLH 3SY0B 2FNBA 1A14L 1YMMA 2BHZA 5A16A 4FQCL 3W9EB 5GS0C 4PJAA 3ARDA 4HX1A 4NBXB 1U8MB 1OP3H 2OTPA 4H25A 3OKOB 1YMMB 1AJ7H 4KHXH 4LIQL 3KYAA 4OZFH 3IJYB 4PJAB 3ARDB 4UAOB 4HX1B 3FKUS 4C56D 1QBBA 1I8LC 1X5YA 4S1QL 1B3JA 4H25B 3FB5A 1YNLH 1QNZH 2YD8A 3ESUF 5A40E 4RRPG 4ZUSA 4CKVX 3D39A 4D8PA 2QQLL 2FBJL 1FL6A 1K5NB 5LCVL 3FB5B 4RAVA 5F1IA 4ZUSB 3PABA 4JRYA 3MBXH 1DFBL 4D8PB 2EDKA 1IFHH 3EOTH 4ZS7L 4PTUB 4OF3A 3LKPB 5F1IB 2JJSC 3BDYH 3U4AA 4M6NH 3PABB 2KQMA 4JRYB 4Y2OA 4Y2DD 5CGTA 5DT1H 3QXAA 1KT2A 3S36X 4WUUB 5E24E 2O5YL 2XA8L 3P4LA 2QSQA 3M45A 4BUGA 4J3SA 4U1LA 5C9KA 1CWVA 4M1CD 5FYKE 3QXAB 1KT2B 1MOEA 1U9KA 3L5XL 3HNVH 5A2FA 3UTTA 2EICA 3BPNB 4U1HA 1Q0XL 2NPLX 1FO0H 1LWRA 2EKJA 4HUMB 4JG1H 5FECB 2UVEA 4LDEB 3UTTB 2VJXA 2ZUQC 1V3LA 3QFJE 3C2AH 4Q9CA 5D7JC 2CLVB 4L8BA 2CIKB 3WFEH 1B88A 5IVXF 2VKXA 4IOIA 3JTSA 4QXGH 4LRNH 3RL1B 4HWBL 5CLWA 5BV7L 3B4NA 2H3NA 4L8BB 4P48A 4RSVA 3RGVD 4CDHA 4PPTA 1DN2A 1MJ8H 3JTSB 5DMIL 2ESVE 2H3NB 3QEQB 1KJ2L 2H2PD 3CDYA 1BF8A 5DHXB 2BRQA 5DK3A 1HHHB 3BVNA 4Z9KB 5F96H 4OKDA 1YEJL 2PYFA 4KKLC 4OCYH 4U1IA 3MA7B 1TFHA 5FIEA 4FFYL 1G7MB 1OTSC 4K8RL 4LCYA 4P5TA 4UILH 5GSVA 2PYFB 4U1IB 1KLFA 2A2QT 1RJLB 3C8KA 2DB8A 4RAUB 1UVQA 4DAGL 1ZANL 4J6RH 4WWKA 4P5TB 1ZV5A 5GSVB 5L6YL 3DO3A 4BSWB 4WWKB 3C08H 2WBWB 1CFNA 1ONQA 5KOVC 4HKXA 1K6QL 4H20L 1U8OA 1Q72L 3QDJE 1ZVYA 3DNKA 3RGHA 1CFNB 1X5XA 3WIHA 3L1OL 2VZ3A 1LP9E 5AYQA 1MCNA 3FO0L 4TUOB 2GW5A 5C9JA 4KK8C 3ULVD 1IRAY 1UACH 3E0GA 1ZE3C 1CFQA 4NKIH 4MNQD 4GLRH 1YEKH 2OP4H 3K8MA 1AO7A 3MYJA 5J8OA 1IAOA 5E08L 4P5MB 4UV4H 3RP1A 2VLKE 5FAAA 3O2DH 5BJTB 3BUTA 2Z9TA 4X7FC 1AO7B 2C4FU 1IAOB 2IBGA 1WICA 4YHYC 4K71C 1D9KD 1B2WL 1EO7A 2P46B 4ZFGH 4EDWL 1R3IL 2D7TH 1T89C 2MKWA 3KWWA 5I1KH 3UZVB 5J3HC 4MJID 3RY4A 4A6YH 3IDMB 4WW1A 5I1EH 4EXPX 1PDKA 1AR1D 3ZTJG 5ADOL 5CFHA 3KWWB 3HAEH 2AKRA 4LQFH 5EO9B 3F7PC 3S36H 2AV7A 4WW1B 1I1YA 3IAQA 3VRLE 1DL7H 4DOHB 1FCGA 5F1KC 1LO3L 1REIA 5IB1A 1I1YB 4JFQB 4QRRE 1A1MA 2EH7L 5M94B 2DJ4A 1UFUA 2K1MA 3BYYA 4P46D 2BXZA 3VXME 4UTAL 3SHSA 5IB1B 2F54D 2W9DL 3K4AA 3CLFH 4NFCA 2JB6B 1A1MB 5I8CA 4JDVA 3EFDL 4IBLT 3ZE0F 2IFFL 3MRPA 3T8XA 1TVHA 1EO8L 3H7BB 3SKJH 5GSRB 5DA4A 5I8CB 1BJ1H 4JDVB 3MFGB 3RL2B 4Q9RH 4X5XA 3T8XB 1KB5H 3L5WA 3BKYL 3UTZA 3TNNA 5GQBA 1FNAA 1FYTE 3MBED 2Z92A 3FCTA 3L5WB 4R4BB 4JEGB 2ATPA 3TNNB 2ICWB 3JV0A 3SKUD 3KNBA 1ZHBA 3MNWA 2Z92B 3W11C 3FCTB 1RUAL 1CXIA 3WNNA 1BM3L 4UNTA 5D6CA 5CD5C 3KNBB 4OZGE 1ZHBB 3MNWB 5DJ8A 2DKSA 2J88H 4K8RD 1NJ9A 3NVQA 2P8PA 1DEEA 4PJFF 4QHKI 3BGMA 5GJTL 5DJ8B 1IAIM 3Q6FA 4X7TA 5F9WC 4JFOA 1NJ9B 3LQAH 2F5AL 2P8PB 1DEEB 2Z4QA 5CKGA 5F7LB 2I25N 3BGMB 3LKNA 3OZ9H 2VKWA 4WI9A 5EC2A 4X7TB 4XAWH 1NFDB 35C8H 3PWJA 4R26L 4PD4K 4N1HB 4NQUA 3QIUA 5CCKL 1N5YH 2X05A 4KUZH 2XN9D 1EZVX 3LKNB 3S4SA 5EC2B 1FQ9C 1KACB 3PWJB 1HKLL 2VXVL 3EZJB 3M1BA 4HWZA 5KSBA 3QIUB 2C3XA 3QYCA 3TIEA 5TE4L 1MY7A 3MV9A 3S4SB 2H32A 3D85A 3GI8L 3M1BB 4HWZB 4MJ6A 5KSBB 2K3TA 3VXNA 2YD2A 5CP3A 3PJSA 2ZZUT 3OAUL 3O4LD 4MJ6B 3VWKC 3FQWA 3VXNB 5EU6B 5HDBE 4NJAL 3GMPA 4JFYB 1CGVA 5I8KH 1NPUA 2FO1A 1P4LA 3O4OB 3QO0B 4K94H 3GMPB 5GS0L 1UWGH 1P4LB 2ADIA 4XPTL 4MDIA 5ISZE 4DQOH 5DZOA 2VDML 4FXGA 5FEBA 4N0CC 2A6KA 3LEVH 2ADIB 4XT1C 4MDIB 4YC2C 5LWYL 5DJZA 5E6YA 4PTTA 2N7AA 4FXGB 4P3WA 4OFDA 3QI9D 4U0QB 1U93A 5F9OH 3RVVC 4KRMB 2X4SA 3A67L 5BO1H 2ZP0T 4L3EA 4PTTB 1XEDA 3I3EA 3M8OL 2EE3A 1E4XH 4Y4KA 1QLFA 3C60C 1U93B 1T2QH 3QAZB 2PTUA 4YZFE 2X4SB 2X41A 4XZUA 4ZS6D 4L3EB 3S88L 3QQ4B 2VR5A 4Y4KB 1QFWH 3OJ2C 4JRXA 4Q0XH 2FH6A 3P4MA 3MLSH 4PGDB 2VL5B 1AXTH 5JOEA 3ZYJA 1C5BH 1PGRB 4MD5A 5HHOD 4G3YL 3TEUA 3VFTA 5C71A 2YRZA 3P4MB 4Q2ZA 3JUZA 1VADA 4LSQL 4MD5B 4U6YA 3T04D 3VFTB 4Q9QL 4KJYA 1R5VA 2FRGP 4Q2ZB 2EE9A 1KIPA 4ZYKA 3H8NA 1YEFL 2CGRH 1VADB 3K4DA 5IW6B 4UBDD 4GFTB 3NCMA 4LU5H 4OFYA 3A6OA 4GXVH 4KJYB 4MQSB 4PB0L 4JFXB 1R5VB 2E8YA 5I15H 1KIPB 4ZYKB 2GYSA 4G9FB 2EEBA 3ZDYF 4Y5XA 2NW3B 3UYRL 4EQ3A 5BVJA 5IOPA 5DO2C 3TBYA 1BBDH 1HCFX 2BERA 4I0PD 4XTRC 2NX5E 1HHGA 2IF7A 1FAIL 3HCVA 2W59A 3MV7B 4Y5XB 5BVJB 4M7KL 1BWMA 5IOPB 1UM5L 3FZUD 3MJ8A 2IWGA 3TBYB 3VRIA 1MFBL 1H3PH 4FQ2L 4HXBL 4Y19E 4R0LC 2W92A 1A7OH 1HHGB 3HCVB 2VSCA 5GXBB 1FBIL 3INUL 3MJ8B 4FQ1L 5E5MA 3VRIB 2DDQL 1L7TH 3VXUD 4QLRA 1F4AA 1RZIA 1LEGA 4LARL 4N9OB 1QSFA 3CMOH 3SE9H 5E5MB 4V1DA 4OLVL 2ZJSH 3QB7C 4KI5F 1JHKL 3GI9H 4YWGL 2PO6D 4XVUC 1LEGB 1QSFB 2X89D 2ZG3A 4X99A 3S37L 5T1KA 1LE5A 5D1QD 4CGTA 3FB6A 4PG9B 1Q0YH 4Z7UB 5JQHC 2IGFH 1QSEA 4X99B 1H9VA 5EIIA 3HZYA 1LE5B 4NZUL 5FXCH 3FB6B 3C09C 1AH1A 1ZLSH 1QSEB 1X5HA 2XZZA 3GB7A 4O5LH 3AC0A 4XMKH 5EIIB 3HZYB 4ZAKD 2EE2A 2BVPA 1O7SA 5C08D 3CSGA 2P5WE 3BSZH 2B0SH 5ITFA 4HULB 4JFEA 4XVTL 1X7QA 4QXTA 5I1JH 1KTRL 1KEMH 3T08A 2HWZL 5I30L 1C8PA 5ITFB 3BIKA 4ZNEA 2JK5B 4QXTB 5GRWA 5GS0D 4MHHI 4LSDA 2HFEB 1RMFL 1K3ZA 3TT1L 3WXWH 3VGHA 1JTTA 3QXUA 4GBXA 4K3EL 3T77A 3Q1SH 2MFNA 1CFVH 1A22B 2O5XH 4M8QA 5IROA 1CVRA 3R4DA 3SGDH 5EUOF 4XGZA 4AEIH 4GBXB 2R0KL 3ME0A 3T77B 5E2JA 3SKMA 4WRLA 2HJKA 3DMMC 2ED7A 2V9TA 4NRZB 1KC5H 3T2QA 4PJ8C 2VXUH 2VUYA 4LCIH 3SKMB 5TDPA 2W1NA 4R8WL 2HJKB 5EZJA 4LSPH 1OAYH 5E9DE 4GSDL 4Z7NE 3K8KA 1A3QA 1S5HA 5D1XA 5TDPB 4I77L 5F8QC 1G1YA 5IR1B 5EZJB 1YYML 4U3CA 2LAGB 3KYKL 2DQEL 1S5HB 5D1XB 2XTJE 1RPQA 3VXRA 5ICZA 2CH8A 1MPAL 3QEUA 4J4PD 5DEZA 5HHXL 3T3MF 5FOBB 3VE0A 3PIQB 4Y7MA 1TITA 2PXYA 3VXRB 5ICZB 5L88H 5ICYA 1PY9A 3QEUB 3RWIB 1MJ7H 3QG7H 3HZMA 3G5XB 3MREB 1KCRL 4FNLH 4ZO7A 1MCLA 1JK8A 2RCSL 5D7JD 2PF6A 5DFWH 5ICYB 2Y36H 2R2BA 1W72A 3HZMB 4M9PA 1WIOA 5J6GA 1LGVA 3MJ9A 1JK8B 1NCDL 5EZOH 3GSNL 4ALAH 4Y89A 4JQVA 1DE4A 4M5ZL 5TPWL 3V52H 1ACYL 1Q9WA 2X09A 1DBBH 2R2BB 1W72B 3DX8B 4PRIE 1PZUB 4YXHL 2OSLB 5J6GB 1BQLH 1FZJA 2CLZA 1K4DB 2AXFB 2WQ8A 1ZT7B 5CGMA 5CJXC 4AYFA 2HTKC 1BMGA 1DE4B 4OIAA 5E2UL 4JPVL 5CJOH 1KNOB 5L8JB 1JF6A 2OZ4A 2XZQL 1FZJB 5CP7B 5EWIH 2VQTA 4KKLD 1U8NA 3WS3A 5HHMB 4MSWB 2F9BT 4KROC 1OTSD 3UROR 4NQCA 3PDDA 1N6UA 4U0RB 5ACZA 1U8NB 3WS3B 2J8UE 4LHUA 4NN7C 2X1QA 1Z3GL 4FS0A 2W9EH 4NQCB 2VDLH 5ACZB 1QLEL 3ULUE 4LHUB 5F44A 2L4OA 4XVSL 1M05A 4JFDE 5FCSH 2VDPL 5GRXG 4BQ8A 4HIJA 1I3UA 3RDTD 2DBLH 1MRDH 1I9EA 1FLRH 1M05B 1M71A 1YUHB 5F7WC 4DN3L 4IM8A 3ZHLA 4E41B 4HIJB 5GZNC 2VR4A 4JO3L 4YXLL 3V4VH 1M71B 3OQ3B 3X12A 4KK8D 4LCWE 3ARZA 1MVFA 5CS7A 3VH8A 5IESH 3WIFA 4GAJL 1RZ7H 3X12B 3BPCA 3O41A 4EUPG 5DJCA 1DBKL 4DTGH 5GZOD 5IVXA 4M1DH 1FFPA 3VH8B 4G8GA 4PJ5D 3FQTA 2F58H 1H8NA 4WHYH 2BNRE 3DBXA 3O41B 3PE9A 2XKNA 4NPYA 4MD0B 5KW9L 2PR4H 2XTJC 5IVXB 1S9VA 4L8DB 1FZKA 5JXEA 1RK1A 4G8GB 3FQTB 4OFVA 5JOFB 3DBXB 3PGFH 2XKNB 3O2WH 4PJAE 3TZVC 1U8JA 2JKXA 4XHJC 1FZKB 5KS9F 1B4RA 4MB5A 4A2MA 1RK1B 4ZODA 5DC0A 3O8XC 3AB0C 2X10A 1EEQA 1KF9B 3QFJD 1EA9C 5HYJE 2BC4A 1U8JB 3TPUA 1IAKB 2JB5L 3S9DB 1K85A 5HTSA 4NQXB 4R4FH 5IB5B 1I85A 5GRJL 1Q9OA 4NUGH 2AEQL 4XVJL 2ZUSA 2DTSA 5CEXB 4OZFA 3TPUB 1XH3A 2PW2A 2X4OA 4DVRL 3OKMA 4MB4A 1N59B 1IVLA 4JO2H 1SJEA 4N90D 3U7WL 2QLVB 4JRYE 1T4KA 4JM2D 3VI3F 2H1PL 3U0WH 4OZFB 1EUTA 1XH3B 3OKMB 2WM0A 1Y0LA 1AP2A 3MGOA 4WUUE 2DWDA 3WHXA 1H0DB 3KPRA 4LHQB 3TVMA 1T4KB 4M02A 4X0KA 3SPVA 1Y0LB 1YZZA 2DWDB 4HAFA 3WHXB 1KELH 2CLRB 3TVMB 4X0KB 3PL6A 4M6MH 4X7SH 2GK0A 2ZCKH 4QOKD 3VRJA 5T3ZE 4XPHL 1ZT4A 3BXNA 1E0OB 1XAUA 3IDGA 5D93C 3PL6B 2XG5A 1SYVA 3ULUC 4JB9L 1QTYT 1JYNA 1U3HA 2KL6A 5T1DH 5F21B 1S7RA 3CDFA 4X4YB 1RIUL 1ZT4B 4GO6B 1P9MC 1QACA 3BXNB 3QPXL 3OKKA 3VDBA 4PLOB 3IDGB 1FDLH 3QISA 1GJIA 3W11D 4W6WB 5MERB 1U3HB 4BSVA 4EUPA 3TA3C 3L95A 3KXFB 2J1KA 3RWJA 3OKKB 4KKAC 5JNYA 1UJTA 1MY5A 3ZLQC 3QEQE 5EO0A 1JYXA 3D87B 1D7FA 4BSVB 4H1LA 3L95B 3IFNL 5JNYB 3RY5A 4P2RA 4RMUA 4HT1L 5EO0B 4XCYA 5JW4R 4YHPA 2AW2A 1X5GA 4H1LB 1HNFA 2YD9A 2VLKD 4P2RB 5A1AA 3TO4B 3UJJL 5I71B 4XCYB 3G5ZA 4YHPB 1PJ9A 4POYA 1J11A 3MOBH 3W2DH 1TZGH 2FEDC 5CKAA 2Y06L 2QL1A 3G5ZB 4DVBA 2DQDL 1A7QL 3WFBL 3DX9A 3VD5A 2P49B 2XA3A 3IDYC 3K3QA 5JOPE 2J4WL 3QWRA 4WTWA 4M6OH 3VG0L 1UKQA 4DVBB 5DDHA 3SDCB 3TFKD 1RHHA 2OM5A 1WZ1H 3DX9B 3P77A 2GSIA 1PLGH 4OLWL 1G9MH 3V8OA 1QBAA 5T1MB 1F2QA 2CR6A 4R2GB 3CCHA 4F9LC 1RHHB 4HUWA 3K2UL 3Q2CA 4ZD3L 1U8QA 3CZFA 5JA9A 3LCYA 4MHHG 3CCHB 5K93A 2Y23A 4HUWB 4YHOL 3RWCA 3EO1B 3ULVH 3OR7A 2A6IA 1U8QB 3CZFB 1S8DA 4U1MA 3J8F7 2PCPB 1B6UA 1AO7E 1A14H 1FFNA 2F15A 3ARXA 1G7JA 2WNGA 1NLBL 3RWCB 4FQCH 4JGMA 3OR7B 2A6IB 3RY6A 1S8DB 4U1MB 5IFHL 1FFNB 5HHVL 1G7JB 3GMRA 4LIQH 4IRJC 4WJ5A 4Y4HA 5TQ2L 4KTEH 5DURB 3OSKA 2XFXB 1RZKC 4FABL 5FGBC 3MNZB 1HHJA 3DECA 2EDBA 4PJFA 3GMRB 3RVVD 4WJ5B 1D5XA 4Y4HB 2VDOL 3BISA 5DUML 3ARGA 1SYSB 2FBJH 4RA0C 1FYTD 5LCVH 3KPLB 1HHJB 4NQTA 4TULL 1TJGL 3I6GB 3C60D 4PJFB 5EN2A 1WV7T 2A9ML 4IRSB 1DFBH 4OF6A 3ARGB 4ZS7H 1A6PA 2KUTA 5DXWA 3B8YA 1MRCL 2A73A 2XQYK 4LSVL 1FIEA 3NFPA 4RWYL 1YQ2A 3VJ6A 1B90A 2XKUA 4KY1L 4ZO8A 2O5YH 2XA8H 4NO0A 4JKPL 4LVNB 3HAEB 4WTXA 3NFPB 5I1CL 3VJ6B 3QIWD 3L5XH 4NO0B 1EV2E 4I9WE 4PY8I 1OB1A 3E1F1 3BJLA 4XXCA 4WFEE 9CGTA 2GQHA 4OLXL 3AREC 3D25A 3CFEA 3I75A 1OB1B 3LS5L 4NKOB 4A2LA 4GUPA 3QUZA 4NBZB 1SY6L 4HWBH 5BV7H 3GUTB 1Y6MR 2I9LA 3ILPA 3D25B 1P4IL 3CFEB 3QUZB 1I8MB 3P0VL 2LFGA 5DMIH 5C2UB 4GRLA 2I9LB 2XNAA 3ILPB 1KJ2H 1YEGH 1KB5B 1IEAA 5GGRA 3ULVF 2NY0B 1HH6B 4GRLB 4XCNA 2XNAB 4MJ2A 2AABL 3MRJA 1T0MA 3FQRA 1IEAB 4FFYH 5GGRB 2VH5L 4K8RH 1L4IA 4XVUD 2EDWA 4P2OA 4XCNB 1GOHA 5FA4A 2P45B 4DAGH 1HN1A 3FQRB 1ZANH 1NFDE 1UH3A 4WO4A 1WK0A 3GMNA 1J9CT 4HKJA 5A2KH 4MAUH 4P2OB 5ISZD 5L6YH 3S35L 1CLZL 4P2YA 4WO4B 3GMNB 5DGRA 4G5ZL 4R7DB 4HKJB 2VITA 4F7TB 2KZ1B 4H20H 1Q72H 5KSBE 1EK3A 3IU3A 3L1OH 3PUCA 5J89A 4ODTL 4XC3L 2VITB 4MNGE 5ESAB 1BEYL 5ID0B 4MWFB 1FGVH 4W81A 1UENA 3CFCL 3FO0H 3THML 3U2SA 3SGJC 3NA4A 3IU3B 4ELME 4ZPTA 3RIAK 3X3GH 5EU6E 1JTOA 4RMTA 4QY8A 1L0QA 1FC2D 2WBJC 4QHMA 4QGTA 5I16A 4Z7WA 1CDGA 3U2SB 1VPOH 3O6LL 2IADA 2OJEB 1QLRA 2C4FT 5KVGL 1UWXK 4QY8B 4B0MM 5I16B 4HH8A 4OGYL 4QHMB 1S7WA 2VN7A 1NC4A 1BVLA 4HS8H 4NCDA 5F7FA 2VDRL 4FQXD 1ZSDB 3WJJA 4U4BA 1S9YB 1EAPA 1NC4B 4EDWH 2ORBL 3DMMD 1BVLB 1R3IH 1WAAF 2W91A 5EB9A 2EDDA 3OR6A 1DN0B 1FNSL 3BQUA 5ADOH 3NCYS 3UTPE 4N1EA 3OR6B 5HJ3A 1IC5L 2ICWJ 1T7ZA 4PBVC 3BQUB 1EJ6A 3DYOA 3UX9B 1CICA 1C16B 5HD8D 5ENWA 1M7IB 7FABL 4ETYA 2NX5D 3ABZA 3HI6L 1TNMA 4WUKL 1GOFA 4K3HA 2EH7H 5I75B 2MCG1 5JW5B 5ENWB 4UTAH 2JJUA 5L2KD 5F97E 2D4DA 5SWZA 1HH9A 5TE7L 4LMQI 3EFDH 4GRMA 2IFFH 3LQMA 25C8L 3ALPA 1EO8H 5SWZB 4NC1C 4PR5A 5DFVC 4GRMB 2JJVA 3BKML 1MHCB 1QQDA 1GH7A 2AJ3A 3CDGA 2XTLA 1UB6A 4KXZI 4PR5B 1BF2A 5E6ZA 2H9GA 1RVFH 4JFZL 2B7DT 4G9FE 1S9XB 1QQDB 4LLWA 3CDGB 4ZOBA 1UB6B 2VSDA 3HUJF 2AXGA 3P30L 2HTKD 4XRCA 2H9GB 3EOAA 2JELL 1YEIL 4LLWB 3MV7E 4Q7DA 3V95A 2AK4D 3ETBF 2FECL 2AXGB 4WENB 3L3OA 4XRCB 3D6GA 5F1SA 3EOAB 5EUOA 3STZA 1RUAH 2P5WD 1BM3H 4FTVE 4WU7B 5KSAB 2APXA 3L3OB 4PJ9A 3NA9L 5EUOB 3QDME 4NYLA 5T3XE 1G0XA 1K9TA 4NQED 2F8OA 5C0BE 4FQIL 5DHYB 5GJTH 4NHCH 2MQCA 3GM8A 3IXTA 3AM8C 4NYLB 4I5BA 2F5AH 2D3VA 1QZ1A 2PTTA 4R26H 4APQC 4I5BB 5CCKH 4Z7UE 1OTUD 1T7WA 2AJSL 4NM4L 2QQKL 1CE6B 1HKLH 2VXVH 1UADC 5E7BA 2JIXD 5TE4H 5IB3A 1QSEE 3JVGA 4X6DF 3WS6A 1RURH 3C8DA 3GI8H 4ZXBD 4OI8A 2FECI 4Z76B 5K9QG 3GJEB 2LU4A 1OGAD 3S37X 2IQAA 1XGYL 5DFTA 4BYHA 5MENB 4MQXC 3OAUH 1EZVY 1MCIA 4LSTL 3AFLA 1AGFA 5C07A 4ZO9A 1ZT1A 3V6ZA 4I48A 1IAMA 2CR3A 2IQAB 4NJAH 4UU9B 3ZKNC 3U79A 1XF5B 3BZDA 2ID5A 4QF1A 3QIBC 3SGKA 5C07B 1ZT1B 1S7VB 3NPSC 3MTRA 3V6ZB 2UY7A 5KSVA 5GS0H 4P4KC 1I3GH 3TZVD 4HIXH 1LDSA 3NGBB 3BE1H 4XMPL 4XPTH 2MPAL 3JWDC 1H15A 2Y5EA 3GKWH 3O8XD 4K23L 4K7PX 3MLXL 5DD6A 2VDMH 3QDGD 4LF3A 2FD6H 5EU5A 1YYLH 1G7LA 5LGKA 2G60L 3WIIL 5MHSE 3PHQA 1H15B 5LWYH 4IRZL 3OKEA 5DD6B 5HVHC 1JGLL 3UPAA 5EU7E 1G7LB 5D2LF 1BP3B 1FNHA 3LVEA 3PHQB 4LCCC 3OKEB 4P2QA 4PLJD 2N56A 3FB7A 3M8OH 4L4JA 4YDIL 3V6OE 4UNUA 4UQ2A 2C4XA 3IYLW 2DRUA 4P2QB 1HILA 4E9LA 3S88H 2GAZA 3NIGE 2Y7QA 4OB5L 4UQ2B 3RX8A 3D9AL 2WAHA 3D2UD 1HILB 4G3YH 3DO7A 5B8CA 3VXRE 5BMFL 3GRWL 1TETL 2Y7QB 4QRPB 3MMEA 4LSQH 4ZMAT 1FFOA 4R4ND 3LN4A 4Y5YC 5I1LA 1JL8A 4Q9QH 1NANH 5B8CB 2FZ3A 1DVFA 3VXQA 5EZLA 3MMEB 1YEFH 5IQ7L 1FFOB 4L4TA 3T0EA 3LN4B 1JYWA 1INEL 4NZTL 5I1LB 4P5KB 1DVFB 4PB0H 3VXQB 3SE8L 5EOTA 1ZVHA 3AMKA 2HFFA 4DGIL 1GGYA 4L4TB 4OM0L 3UYRH 2MNUA 3T0EB 4GAYA 4KKAD 4OLUL 1M7DA 1F11A 3KJ4B 3RZCB 4LGRB 2HFFB 3O0RL 3QO1A 5KS9A 4GKOA 4GAYB 1UM5H 1DUZB 1M7DB 1F11B 2XQYG 4LPUA 5C0GA 3TN0A 4MXVF 1MFBH 4HXBH 1FZMB 3H2WA 3ZE1E 3VGDA 3QO1B 4ZUVA 5KS9B 4QXWA 4M6AA 4R7NA 1FBIH 3INUH 4FQ1H 3TN0B 5C0GB 2IALA 1ZLWK 2DDQH 4S1DC 2DWEA 3UDWC 1C5CL 4RFOL 2ICCA 2BSTB 1G6RL 2BNQA 2YUZA 4LARH 4ZUVB 1RJYA 1NCUA 4NQCE 4R7NB 3IFOA 1MQKL 4OLVH 2IALB 2KBGA 1JHKH 5D70L 4YWGH 3MRRB 3IRZA 5E6IC 1N7ML 3CFBA 5DLML 5I66B 1NC2D 2YXMA 4PJDF 3IFOB 3S37H 5EBWB 3MRNA 3L5IA 4NIKB 5FHAL 4ZFFA 4BFBD 3WKNA 4E41E 4Z6AT 5HYJD 3VGAC 2ERJB 3VWJA 3NCJL 4NZUH 3MRNB 2BK8A 3MUZ1 4ZFFB 5T1LD 2CUHA 1T83A 5F6IC 3VWJB 1PVHA 5KAQG 1D5IL 1QRNA 1YEHL 2Y72A 2C1PB 4AG4H 3FMGH 4XVTH 2HN7A 5IP4A 2HWZH 1JPST 3V6OC 5I30H 3L3IA 1PSKL 2P5ED 1QRNB 2HN7B 3B5TA 1A47A 5D7LA 2ITDA 3C2SA 1RMFH 3TT1H 3L3IB 3SKNA 3QHFL 2AQ2A 2BHUA 2F53A 1BZQK 1OARH 1TXKA 2UZXB 1CU4L 4IRJD 4K3EH 3G5YA 5D7LB 3WFCL 1KCVL 2ITDB 3WFDL 4FQJL 1RJCA 1P7KA 3SKNB 5KG9A 3KPMB 2VB5A 2F53B 1AR2A 2R0KH 4XAKD 2DMKA 4LSSH 2R1YB 3G5YB 1RQ5A 3B9KA 3V7MA 1P7KB 2D7OA 3QQ9C 4PG2A 5KG9B 2FBOJ 2OTWA 3ZYIA 3B9KB 4HZLB 1OF2A 5GGUA 2MOVA 2F74A 1JFQL 1U6AH 1OWRM 2OTWB 3EYQC 3CFDA 1OF2B 4ENED 2F74B 4UIKL 3KYKH 4ZUWA 2DQEH 4LVEA 4Z77A 2G5RA 4I3RH 4OCMC 3CFDB 1UA6L 3VI4F 1IGTA 1MPAH 4UOJA 4G43A 5HHXH 4X4MA 3W0WD 1ES0A 4ZUWB 2ICEB 2GJ6D 4TPRL 3JV6A 5HHQA 4MMZC 4TTDC 5T33L 2MWCA 3KR3L 3RKDC 3SDAA 5E70A 2RCSH 2VQ1A 3JV6B 4UDTA 5HHQB 3X14A 3ARED 3ARBC 4Y2DA 2RFXB 3QT2A 4PRHD 1BFVH 3SE4A 1HHIB 3PP3K 5F7DA 1NCDH 5F8RC 3MX0A 2AS5M 2VQ1B 5TPWH 1OD7A 5JOPD 4UDTB 1ACYH 3X14B 5DVNA 2P44B 4ZDHA 1WCBA 4Y2DB 1OAQL 3WD5L 4YXHH 3KXFE 5F7DB 3WJLA 1GGTA 2V2TA 3GSQA 1QFOA 4ZDHB 1WCBB 4JPVH 4PRBB 2XZQH 2CRZA 3EJZD 1IKFL 1NEZG 2Y9RT 4XNXL 5EIVA 2V2TB 2Z8SA 4UT6L 4MA1C 4LDOB 1NGQL 4LPVA 4P2RE 1I1AC 4Z0XA 3TYFA 3KHOA 2DLEA 4JHZA 3GMQA 1CXEA 1Z3GH 3MROA 3RGVA 2HKHL 1KTKE 4DUXA 2ARJA 1ORQA 1BD2D 1OCWL 3BWAA 5EU4A 4UTBH 3L3DA 4Z0XB 3TYFB 4DGYL 4J7RA 4XVSH 1FPTH 2VDPH 3RGVB 1KN4L 3SCMD 4HS6A 5D9SA 2ARJB 3BWAB 5EU4B 4KRNA 2EDNA 4DN3H 1ZOXA 2YZ8A 4LK4A 2H8PA 5D9SB 1PBYA 4JO3H 3HA0A 4YXLH 4YX2H 5AZEL 1CLCA 2H8PB 5D5MF 3FRUB 1WT5C 2AJYL 1SJVA 2WBJD 1WCQA 4NO5A 4YDKL 4YPJA 3HG1D 3WKML 2BSRB 1DBKH 1UZ6E 5LGHL 3MLTA 5IW1A 1NKRA 4UT9L 2HFTA 43C9A 2YK1L 4NO5B 4HPYL 3GHEL 3NOIA 3U1SL 4M7ZB 4JHAL 5KW9H 3MLTB 5IW1B 3LMJL 43C9B 2NY5L 3SJVE 3T4AA 1M6OB 4HDIA 3IJSA 1U8LA 5ANMA 5CHNA 2ADGA 3TV3L 4Y16A 3T4AB 1PG7W 4HDIB 3MRDB 3C6SA 3IJSB 3OGCA 4KJQC 5D7SL 1U8LB 4MNQA 5ANMB 1KV3A 4H0HB 3FO1B 1WQVT 3F58L 2JB5H 2Y6SC 1FV1A 3BD5A 4XC1H 1E28A 4PJFE 3C6SB 3D18A 3OGCB 4MNQB 5E7FA 4HD9A 2AEQH 3HPJB 4XVJH 5FYLD 1WZKA 5E2VL 2YD5A 5GS1A 4DVRH 2CKBA 3MCG1 3PWPD 4OLYL 3D18B 4WHDA 3U7WH 3MJGX 4HUNB 2H1PH 3DYPA