3F00A

Crystal structure of synaptotagmin i c2a domain with cu(ii)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
143
structure length
142
Chain Sequence
GSPGIGGGGGGILDSVEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Synaptotagmin I C2A
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Synaptotagmin-1
total genus 23
structure length 142
sequence length 143
ec nomenclature
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3f00A01
2DMGA 2NQ3A 1BDYA 1DJWA 3L4CA 3L54A 2X38A 3N5AA 1BYNA 2RD0A 3M7FB 3F05A 4AJWA 2K8MA 3W57A 2DMHA 2ZKMX 4FA6A 3PFQA 2WXKA 2WXJA 3FBKA 5JHBA 1UGKA 2YRBA 3QR1A 3GPEA 4IHBA 3R7RA 3ZIMA 4FHJA 2Q3XA 4ANXA 3NZSA 3QARA 4G11A 4MJJA 4XE0A 5T8IA 4ANVA 2CHDA 3JZYA 4BFRA 5CCJA 2ISDA 4L2YA 3L13A 4EZKA 4TS6A 1CJYA 4URKA 2WXMA 1W16A 4PS7A 2ENJA 4TUUA 2LHAA 4NS0A 3PRZA 1RLWA 2WXRA 3S2AA 3W56A 4EZJA 1DJIA 3QR0A 3PYCA 1UOVA 3HHMA 4LDCA 4KZ0A 4WEEA 1BCIA 1DJYA 5H4YA 4PS3A 4JPSA 3ML9A 3ENEA 3PREA 2K45A 1DQVA 1TJMA 2JQZA 1QASA 4OVVA 4WAFA 5H4ZA 2CHXA 5KJ7E 4QJ3B 3ML8A 5EDSA 2ENQA 2K4AA 2WXIA 4GB9A 3L9BA 3B7YA 3PS6A 2QZ5A 4LT7A 4WWNA 4Y1TA 4AOFA 1W15A 4ICWA 4HLEA 2WXFA 2YOAA 1E8WA 2CJSA 4TV3A 4NPKA 1RSYA 4XZ4A 3CSFA 4L1LA 3R7QA 1E7UA 2FK9A 3CSTA 4XX5A 3F00A 2CHZA 2K3HA 2EP6A 2WXPA 4FULA 3NZUA 1E8ZA 2R83A 2Y3AA 4EZLA 4ANUA 4F91B 5JHAA 4NPJA 3LJ3A 5G2NA 3ZW3A 1K5WA 3HN8A 1UOWA 1E7VA 3FDWA 4L1BA 4J6IA 1RH8A 5CCGE 3TWYA 3HIZA 3P2BA 1A25A 1HE8A 1WFMA 4WWPA 4FLHA 4BGDA 2CM5A 1TJXA 3APCA 1WFJA 1YRKA 4ANWA 4OVUA 4FHKA 4NP9A 2FJUB 1DJGA 2A5UA 2ENPA 2UZPA 4V11A 4A55A 1DJZA 4QJ5B 4KZCA 2V4LA 3L17A 3RPBA 3ZVVA 1E8YA 2D8KA 2N1TE 2NCEA 3IBEA 3QJZA 3T8MA 4F1SA 4KITB 1DJHA 1GMIA 3APFA 2WXGA 4F93B 2WXHA 3QAQA 3KWUA 3F04A 4FADA 4QJ4B 2WXOA 3IM1A 1V27A 2NSQA 3L08A 1DSYA 1E8XA 2BWQA 2CM6A 3SD5A 4FJYA 5CCHE 2KI6A 4WWOA 2CJTA 3OHMB 3QK0A 3APDA 4FJZA 4ICXA 2CHWA 2WXQA 3DPDA 4DNLA 4Y1SA 2QZQA 2A4ZA 3F01A 4IQHA 5G55A 3RDJA 4DK5A 2WXNA 2Z0UA 3DBSA 4PS8A 1E90A 4LCVA 4GNKB 3TJPA 1QATA 3KWTA 4L23A 1DJXA 2Q0ZX 3NSJA 3OAWA 4HVBA 4F92B 2WXLA 3L16A 4QAMB 3TL5A 3MJWA 2B3RA
chains in the Genus database with same CATH superfamily
4G72B 3V9EA 1BPVA 5HHXH 5C7XH 3EDFA 4AJWA 2B59B 1YY8A 4JR9L 4CJ0A 5I23A 1P0SE 4JRLA 4OI9A 3GSUB 5I8CB 1AGDB 4PJ8C 5CKAA 4OCYH 1JNHB 1YEDB 5JW3L 3UPRB 1DVFA 5D7KD 3KLAA 4ZMVA 3QH3A 3VGGA 9CGTA 2X9WA 4E9WA 4QJ5B 1YHPA 1GGTA 1MCWM 3IJYA 1LHZA 1KJ2L 2ICEA 1NPNA 4JJOA 2BSRA 4TS6A 2XKNB 4DTGL 4UIMB 3P9LA 3DBXA 3L4XA 5KYXA 3MUGA 2J21A 4JJ5B 1UKQA 1NM9A 3TS8A 1D9KC 4GMTL 3IK2A 4WFED 1JFQL 1OAZH 5HYJA 3VWJA 1KFGA 1TJHL 1S9WB 2BOCA 3GMLA 5BZDA 3BQVA 5E5LA 1UWEH 2OMWB 5ABDE 1DVTA 1RUAH 2VDLL 3N9GL 1RIUH 2RCSL 2VAAA 5E1IA 1CFQB 1OAYH 3IFOB 3GJEA 5HJ3B 2DJSA 1UQSA 2HKHH 2ZSWA 1VEOA 3PUUA 4QAWA 3OHXC 3OZLA 4BK5C 1K8DA 3RY6A 1QFWM 3ZE2B 3FSZA 4NAMA 5HVGB 4AUYA 1E7UA 3CVIH 2YAMA 3GK8H 1KYFA 5I18H 1FYTA 4Y7MA 4FULA 3D0VA 3DOSB 3BMVA 1L9MA 3QZMA 4HBQA 1EAPB 4U1NA 3OX8A 2QV2A 5AZUA 5IQNA 4K07A 4NQDD 4U6XA 3S34L 4HEME 1RURH 1XMWA 3LB6D 4XWOD 2TSBA 2OMVB 3HB3B 1RIHL 4QRUB 3W39A 1D5ZA 2ESVB 1YNTA 1M56B 3CUPA 5E9DE 2W0FB 4RMQA 3DJZA 2IFGA 4NWTH 1KBWA 1NAKL 3QNXA 4TUJA 1JUFB 2C1OB 4U1GC 4OZ4A 1LE9B 1P4UA 3V0EA 1P5VB 3LNFA 4RGNC 4UILL 1IAOA 4KX7A 4FMKA 1FC2D 3SEPA 1E4JA 3T8MA 4KZEL 3CG8A 2FR4A 5I1AB 3UC0L 4WU7A 1CG9A 5AW4B 2ADFL 2PKDA 3T3ME 4MA7L 4X98B 5CD5C 1V27A 4HEPG 3EFDH 4NHUB 4FJYA 3IRPX 4I1NB 5L88L 2F74A 4OFVA 2DJMA 1HESA 3IKCB 3DWTA 3WXWH 4MCZA 4OFDA 3EO9H 2AJZA 3IJEA 4XXCC 3WTYA 3C6LC 3QCUH 4PVNA 4LQFH 1HZKA 1ZJAA 3VI4F 1SYVB 1QTYT 3MXWH 1KCWA 1JS4A 1QW8A 3MLZH 4ADGA 2KUTA 2R2EB 3HMXL 5IHBA 1JVKA 4K7FB 2A9NH 1DQKA 2J5LC 1U3NA 3STZB 2ZWNA 1TCMA 5KVGE 1XH3B 4WTWA 4OF3A 3MACH 1ZT7A 2APBA 3PF2A 5BV7H 5J6SA 3FO0L 1YNLL 3P30L 4JVPA 3AABA 5IIEA 5T3ZL 4KRPC 4Y9BA 1Q0EA 1S6NA 3PFQA 1BF5A 1KV3A 1N18A 3BH4A 1RMFH 4TVPL 3QQXA 1KC5L 1K2DA 4XP1L 3T08A 1THAA 4W4NA 2EXYD 3QYNA 5HY9A 1MVUA 4YL4A 3F5WB 3BEWA 1V7MH 2ED8A 3OJ2C 2GSMB 1G7PA 4UQ9A 5DA4A 2HPTA 4FZ8H 4HH9B 1II4E 5D1QC 2JK5B 3L3KB 4KZ0A 1HAUA 2R2HB 1KPVB 3CN1A 3FS9A 3F2LA 2DICA 1I1FA 1QW9A 1UXSA 2F1EA 4IRSA 4LLAA 5GRZA 5JA8B 1NBYA 2FD6H 3L1FA 3RTQC 1TPXC 4DQAA 3MNWA 2IPKB 2G75A 2I7OA 2MKWA 3ML8A 4PLJD 5IB4A 3MV9B 2DBLH 2K4AA 2Y3NA 4P5TA 2O61A 2AK1L 2Z31B 5FHAL 1KB9K 5E6YA 5CCKL 4Y16B 1YLBB 5A6LA 4F24A 2L7JA 4KNQA 3JT2A 5ITFB 3IJSB 2Y5TA 5C0FA 1U8LA 5GRJH 4WK2B 2Y2WA 1N59B 4BKLB 2OP4L 1MCFA 5I82A 3B9AA 2PUQT 3MTXA 2NW2A 2ZUVA 4O58H 2VDPL 3DX6A 1Q94B 4F5CE 4NKQB 3R1GH 5DDHB 1NEZB 4OFYD 1T80A 3VXOA 3DSFH 3L3DA 1JYXA 4KRPB 3E1F1 3APCA 4U0RC 2PW2B 1E9QB 2X4OB 4L5FH 3SE6A 3FBQA 5T1KD 4XN5A 5I66A 1Z9LA 3SBWA 3NRFA 2A0LD 2N1TE 3IBEA 1DEDA 1PG7X 3NCBB 2WXGA 3MMEB 2VCOA 4UB0L 1T7XA 1WF5A 1RZJH 4QJ4B 1CN4A 1UB5A 4OCNC 1I3UA 1N6QH 2GEEA 4WWOA 2ZUUA 1SDYA 4A7GA 1SN2A 5F9JB 4BELD 2A4EA 1ZLWH 1JRHI 2QVMA 3RVWD 1OCRB 4A2EA 4JY5H 4DN4L 5D5MF 2BERA 4EIUA 2BHUA 3IXAB 3MV7E 5DK2A 2A6IA 2Z0UA 5C0GA 3DXAB 1R33A 2CK0H 4P3DA 2VDQL 1Y7VA 1HHIA 4GG6A 5INCA 1K85A 1P5UA 1T1ZB 2ERJC 3RG1C 1GRWA 2X0VA 1BAWA 1A9EA 1XT5A 1OTUD 3WN5C 3LQAL 1BEYL 1YY9D 2NQ3A 4NC2B 4FABL 2CGZA 3PP4H 5CN1A 1O7VA 2CALA 3RUGE 1WS7A 5AOKA 3RDTA 4JHUA 2K8MA 2IDTA 1SGKA 1YEKL 2UY6A 2WO3B 3TIDA 2GJZA 3K0YA 3RWGA 4LSQH 5JQ6L 4XOCA 1S7VA 4A7TA 2VDOB 3QJTB 4Z1PA 1XIWA 1J9RA 2Y23A 3KYNA 4HCRL 3WSQH 5JYMA 4CGUB 2WLMA 2A73A 3OQ3B 3V4VL 2JF1A 1NM4A 3VI3F 3LNGA 3G5ZB 2MOGA 3FZUC 3R06B 1RERA 2OAAA 2OULB 3BD3A 5JHLL 3U4EB 3PWVB 4MJ6B 3FRPB 2E46A 2X9ZA 1A4CA 4NM4L 4YEEA 1ONQB 1H3GA 2VLKE 2LABA 2JQAA 5K59E 4HJJH 4PJ8B 3OG4B 3BDYH 3FO0H 3NIDF 3P30H 4WI6A 4NN6B 1NGYA 1UT2A 1ECZA 4MDJB 5CBEA 1TG8A 2DWXA 1HEZB 7FABH 3QXVA 3KPLB 3QQ4B 5EWIL 5DEGA 2M26A 4GXFA 5IB5A 1RD6A 3ZE1E 4ZS7L 5LB1A 3FQNB 4P59H 4W1TA 5D7IB 1HX0A 3LN4A 3WY1A 2FO4B 4XCCL 3VMPA 2EUZA 3C6LD 2AXFA 4YL9A 1NFIB 5GJTH 3C09B 2DMCA 4QHKJ 1MREH 5EUOA 2E7CA 3ARVA 1ZPUA 3AU1A 1PL3A 2IO5A 5C09E 2CNZA 3GHEH 3KL5A 5GISH 2R51A 4X9GA 1DFBL 1Q0YH 4BRVA 1RPUA 2X6CA 4F8NA 3ESNA 4MZ3A 2WCGA 1SJEA 4YE0A 4FXLA 4ORGA 2Q7AA 2YEZA 4OD3H 3V6OE 4DIXA 1YPZF 1R3KA 2VITA 1KTRL 1PD0A 1I9IL 3ME0B 4BZYA 5ISZE 5I16B 1XGPA 1INQB 1MWAL 3DV4B 2Z35B 1PKQB 1WFUA 4G8EB 3ARDB 4TNVK 3O41A 3SDDD 3A22A 3CFEB 2UV3A 3L3OA 5I1EH 4OLWL 3R8BB 4GAYA 3IS0X 1F4XL 5EOQL 3QDJE 1DL7H 4G7QB 2WQUA 1DFBH 5ECJE 1SXAA 1DJXA 5DRXA 2HAZA 2NR6D 4PTUA 3ZYJA 4F5CA 5DLML 2N3JA 3U9PH 3VXUE 4C59B 3B7SA 5IHHA 1DLFL 3AU0A 4PRHA 2GEQA 4LNRB 3CVHL 1JPSL 3SSGA 1KWGA 1TT6A 2YPVH 2XWRA 1V3JA 4HALA 4G8GD 1RUKH 5F3HB 3S3SA 3C12A 4FNRA 5SWSD 4HG4J 2VJ0A 4D9LH 1FBIH 2YRBA 2Y22A 4DAGH 3E9UA 4NB7A 4U3HA 3WTVA 5F97E 3UDWC 3GINA 3TO4C 5KVFL 1F1DA 2H0FA 1C8QA 1PJ9A 4YC2B 3WYRA 2BVEA 3W0WA 4M48H 1OPGL 2HTLC 1U91A 3PHQA 1HI6A 1HQRA 1U92B 2FX9L 5T1MB 2OJ1A 3CD4A 1HHGA 2ZKYA 1QHOA 3OX8B 4ODWB 3FC8A 2NPLX 3KPOB 4P2RE 5EORH 3U9WA 2YR3A 3OXSB 4LXFA 2EVFA 3SDDB 4QXTA 4RFOH 1K72A 4Z3HA 3DXAD 5D7JD 4APXA 1ZHBA 2VR3A 4L8SA 4ZZFA 2IAMC 2ZP9A 3O9WD 3W39B 2NT1A 4HIIA 4X9FA 4NQQA 2XT1B 4P49A 1QEWB 5ACLA 1I31A 3TBBA 4J5VA 3ARFB 3FFOA 1SVBA 1G6RA 5DJZB 4NENB 4HGWB 5BQ7A 5IQ9A 3QUYC 1A9VA 2E76C 2HT2D 1AXIB 4JY6A 1K6QL 5B3JE 3ARQA 3DO7A 4AH2A 1WWAX 4UQ2B 4CILA 4BQ6A 1S7WA 2X7LB 4Z78A 4LKCA 3BH8A 4K23L 3EH1A 1BGXL 4P2AA 4G6JL 1TJHH 4A38A 4U2ZA 4TNGA 2OYKA 3VVVA 3UG3A 1G6RH 1CI5A 1KBPA 1REIA 3EYSH 3LAFA 2B0SL 3EOTL 3V6FA 1KCSL 1TZGL 1WT5A 3GZPA 4JFFB 3AM8C 1E5ZA 4GRWF 2R2EA 2WZ6A 4LLMB 3O3UN 1QBLL 3APFA 35C8L 3HCVA 4POYA 1B2WL 2JKJA 1E9PB 4AW7A 5DS1A 1QSFE 5KAQG 4BH7A 4BH8A 4IBQA 4XNBA 2XNAB 1D2PA 1QBLH 3CSGA 1U3ZA 3ISWA 4ICXA 4Y8AA 4PMEA 1VLXA 5D1XA 4KOCA 1GTNA 4KZDH 4UDUB 2A4ZA 4LVOB 3ROLB 5I9QC 4OLXL 2C4FT 4MBOA 3CWGA 4L9LA 3U30C 4N9GB 2NXYB 2F7RA 1J05B 3ARGA 5HJBA 4AQAA 4K4KA 3WHE1 3MBWA 3FQ4A 1OY3B 3E9TA 1NGPH 4UNUA 5I18L 2KH2B 3P11H 4M8VA 3Q9PA 3JWOC 4XPGL 1KPVA 1OOAA 2A83A 1F4AA 4QRPD 5BRQA 1BEXA 4JZJB 3K71B 4PU2A 1J10A 4MB1A 3VMOA 2EDEA 3OAUH 3Q2LA 5EO9A 4G8IB 3PXLA 1P7KA 5JXEA 1XGUB 4WK0B 4AUUA 2BXZA 1SHSA 3R7RA 4P99A 3HNSH 3FOLA 2AK4B 3I75B 1G9NC 3T3PB 1OARL 4MJJA 1OW0A 2JCCE 5FF6A 2XSKA 2D3NA 5AKSA 4J1UA 1FPTL 2XWEA 3BKJH 2HFFA 2EE0A 4CN1A 3GTTA 1IC4H 3KCWA 3GSNH 2DQCH 2VUKA 2K6WA 2IV9A 3P4MA 5GZNC 1BCIA 1F02I 3TNMB 3Q5YA 3FRPG 2MCAA 3C5SB 1MHCA 1A6PA 4KK6C 4H8VA 4N2GA 2K1MA 2E4TA 2VZOA 4B9CA 1J1PL 4KROD 2JJUA 4JO2H 2PPAA 1E9QA 5GIRA 3RWJA 1PZAA 1KPUB 5ENWB 3S3BB 5AVVB 5I75C 1YEGH 4DVBB 1XAUA 2XG4B 4L1LA 4DOHE 1JGLH 4NX0A 1DCEA 3PV6B 1E30A 3ZYIA 4DKDC 2GITA 2CO6B 1MFAH 3AWGA 4LCIL 4NERA 2YPLD 3MKGA 5E8PB 3MLPA 1R3JB 2VTFA 4LBAA 3S36L 5CZXC 1MRDH 5F0JB 3U9PL 4ZFGL 3GWJA 3H3PL 3VD5A 5F9JA 4A39A 5CFHA 4OGAD 1IFHH 3MUJA 4UOW0 1BF8A 1ZVHA 3QULB 2YRLA 3CFDA 3BAXA 1BP3B 4UF7C 2A5UA 2HWZH 3VVWA 4AYGA 4U33A 1HSBB 4K5PA 3WJMA 3FUFA 5DK3A 3GUFA 1FL6B 4M7LH 4GG6B 3BX7C 3EKCA 3F83A 5AKVA 1ZS8B 1AGEB 4PJFE 1AVAA 2MHAB 1ANUA 2AKRA 3VXME 5IFJB 4RGNB 1Z9OA 4M93B 3MLTA 4MX7A 2IBZX 1SDAB 2F54B 2YPKB 3QFJB 3QK0A 3OZ9H 4ZW5A 1DBJL 2GIMA 3RE0A 1ZGLB 2YSSA 2BK8A 2I69A 2QPEB 3MO1B 4KTDH 2Z6FA 1NCOA 1TYEB 5A2IH 1TDQA 2J3SA 2PCPA 1F8TH 2XIDA 4I3SL 1IE5A 2GSGB 4I77H 1KB5L 1DFXA 3KWTA 1B2YA 3VI3A 2EE3A 4JRXA 1XL6A 4JQIA 3CX5K 3TFBA 2OR7A 3IGUA 1QACA 3C2AL 1HK6A 1TU2B 3OKNB 4GXUM 3QJFB 4MLSA 1S9KC 4GKOA 4X99B 2P48B 3LPPA 5TE4H 1VFAA 1NL0H 1PMYA 4XCEB 2F2HA 4NOBA 5DZJA 5HYJE 4A2FA 4FE9A 3QUXB 3IAQA 5AD0B 1UJTA 1ETZB 1NMBL 5GGTA 3AWFA 3TWCL 4IRJC 3MVSA 2VIRB 4ZMLA 3QNZA 5HGHA 5CJBA 4HISA 3S5YA 3NTCL 35C8H 1CO1A 1ZANH 4OM1L 2VLJA 3MRJA 1OD7A 3LS4H 2K45A 3A3YB 1F2XK 3SCMC 4AMWA 4XVJH 2ORBH 2OA9A 1G7IB 4U49A 2WP3T 1I1YB 4GKNA 3CZJA 4TULH 5EUOB 4N5EC 2O5ZH 4PV8B 3Q06A 3C8HA 2F5BH 3X13A 4FNSA 4GAGL 4NPKA 1DJSA 3GYRA 4X83A 2NTFB 1E27B 1UWXH 4EUPB 4W68A 3M1BA 3I9GH 1WHPA 1NCHA 2CDFA 3WL9A 1CZ8L 2LU3A 3ZMEA 3O6LH 2WQRA 3G04B 5IOPA 3HIZA 1YECH 4K71C 1NBZA 1BQSA 4PJFA 5HHVH 3WGVB 3WMPA 4B5ZA 4HDIA 2E56A 1S5HA 1OT2A 1PFCA 3FCTA 4HIPA 1HS6A 4P5MB 1PLBA 4HPYH 2VMFA 3KR3L 3R4DA 1AKJB 3SBPA 2W60A 1S2EA 3PDOA 2ZCLL 3QEHA 4Y19A 1P2CB 5IP4A 4JFDA 3T2OA 3IJ7A 3ZGIA 3UBFA 1KCVL 1E6OH 2BWIA 4KO5A 4UTBH 1KDIA 2C3WA 2X1XR 4LSUH 4FP8L 5TDOA 1NFKA 1EXGA 4OF7A 2GHZA 4EBQH 3WV0A 3E7JA 1FRGH 1J8KA 2R27A 5CSBA 5I76A 4LASL 4UZGA 3QIUA 5CP7A 3HLKA 4JCLA 3TTSA 4NYLA 3L81A 4YHKH 1WSST 1SEQH 3H2PA 4R2GB 2APSA 4G1MB 5EU6E 3REVB 1HI6B 4YHZL 3MRIB 5JXAH 1LK3H 2FJHB 4PY7A 3QEQA 3ILQC 3FQUA 4M8QB 4KROC 5CU5A 5KS9A 1VFBB 1WYJA 3T3PE 1W6LA 5BRPA 2BVTA 4DQOL 1FZJA 1I85C 3NJMA 2ATAA 2JJWA 3HN5A 4M7ZC 4RAHA 3TBTA 5D7EA 4PR5A 2EIJB 5H2BB 2MQ3A 1AANA 1QP1A 2CH8A 2G9HA 3IPBA 5GS2D 4N28A 3EYOB 4MD0B 4ONFH 1ZGLP 3BVVA 3L4YA 5E8DH 4B3EA 4P4KD 3AAZB 3UZQA 4BXSV 4FQHB 4LSRH 4OBSA 4XO3A 5IJVB 1TQVA 1CUOA 2I7SA 2F7QA 1UOVA 2F5AH 3IFPA 3HHMA 3QHFL 4UQ2A 3B2MA 3VFWB 3DPBA 3FNKA 3G5VA 3RVTD 4B9JA 1KELH 1NIBA 2MFNA 4NUGH 1VPOL 1Z0MA 1SDDA 1EK3A 4P23A 3KAAA 4Y5YB 3NJFA 4HIHA 4LVEA 4N8CL 4JO5A 3JQOB 2E9WA 2YIHA 4QXUL 4XMUA 1L9TA 3FQXA 5TE7L 2MH4A 1BQHG 2XICA 3HG1D 4NUGL 1WP6A 1VJSA 4U4IA 1FNEB 2WWMC 3PJNA 2P5EB 4IDLA 4UAHA 4HJIA 4KH2A 3HC2A 4OLZH 1OZUA 3RFRA 1NCWH 5DD0H 3S3DB 3Q1EA 1U8HB 4LSRL 5LBSA 5JNYA 4PRAB 5DHDA 4OI8A 2NZ1A 2FUQA 5G2NA 5LNEA 4N3UA 1KIQB 2Z93A 1FQ9C 1ZRUA 2P7TA 5DR5L 4AZUA 4P4KB 3LVTA 1TJXA 2OJEA 1UZ8B 2AZUA 1M05A 1DZBA 3CVCA 3K7UA 5KSBB 5L2KD 4N2EA 4LQFL 1CE6A 2NY3C 3OB0K 1UEYA 1FZOA 1S78C 3SKMB 2I9LB 4JB9L 4X8XA 3LSOB 5F70A 3CPUA 2AITA 3LN5A 3E0GA 4WV1C 3KZ8A 1FNLA 3QAZC 4V1DB 1BVLA 4BKSC 1SY6A 3BPLB 2P44B 5L6YH 3HVNA 3MRLB 2F18A 4XN9A 4AG4L 4L4TD 5CHNA 5BV7L 3FKUS 2Z31D 3ZKQD 1E8XA 1BM7A 2LU7A 4HWZB 1NCBH 5T1LD 3FUEA 3HE7B 4KBPA 2VERN 3TJHD 4N3TA 4UOW1 1YPZE 4G80A 4M8UA 1EFXB 1YQVH 1GGBH 3NEXA 4HS6B 5DJ0A 4FP8H 3VRJB 3GS7A 3FN0L 4X5XB 4XP5H 2CMRH 1EAJA 1U8PB 1SEBB 3FTZA 3FO1A 3IMSA 1N0LA 1WBZA 2FECL 3AXLB 3QCTH 4UT7H 3HUJA 43C9B 2BOLA 5GGTH 2Q0ZX 2IOIA 1IAMA 3UMNA 5E8EA 2WUCH 3OLGA 8FABB 4JZNA 4LPYA 1JCVA 5HP5A 3U1SL 3VWKA 3M7FB 4HKJB 3QNYA 3QFDB 4TQIA 3PLYA 4N5ED 2APFA 4JG9A 4E5XG 4KDTA 2P5WA 3FF7A 3Q05A 4MAZA 5T1DH 2OL3A 2OMYA 3MGOA 5GIRB 3RWJB 1BBDL 1PLCA 2OYMA 3RY5A 4J6RL 3FU7A 4JRYE 1AOZA 4CC4C 2CDGB 2J71A 2VLKA 3GRGA 3O3BA 2FB4H 3QPXH 4IU3A 5FO2A 4WNJA 2HVJB 3E6FA 1M71B 2IFFH 4Y1AE 2XZCH 1S7RB 4D7BA 3V0HA 5LG1A 2W07A 2R7EA 2DQHL 2JQZA 2V2XB 5GGVY 2Z4QA 5K39A 1TKWB 1A2YB 2ATPA 2C4XA 3CX2A 5EPMB 2AEWA 3O11A 1GKOA 6PCYA 3CZFA 1NC2A 4B9YA 2Z8WC 2IBBA 1PX3A 4EN3D 3DXAE 3NESA 4CADA 3DRTA 1AGDA 2M8XA 2ZOTA 2IMMA 2DI7A 3IN2A 4PIBA 5JZ7D 5ESQB 2BW4A 2IH1A 1KB9J 5CGTA 4ZAKB 3NZUA 2IAMA 2QHRL 5FYKH 3ETBJ 3SPVA 5LXGL 4OGAC 3E6HA 2J2ZB 3UYRH 3ZXAC 1E2VA 4Y2DC 3V10A 3U4AA 2GTQA 3L7EB 1B88A 5CZXD 3VFSA 1K4DA 4ZW6A 4BFKA 1FNSL 3N04A 4KC3B 1WFNA 3ARYA 5HD8D 3WE6A 1J8HA 3SHSA 1UZ6E 3NGBC 4BSWA 4OZIB 1C12A 3U0PA 3VWJB 1IC5H 4MNHA 3MUHL 3WBDA 2YGNA 3ULUD 4R97C 2ZWYA 2EVJA 1XD0A 1DP0A 4XN7A 5LWYL 4LE8A 1UKSA 3C6LA 4O4YH 4PJ7B 4ZOEA 1O9ZA 5J7CC 4FC3E 2GG1A 1YEJL 4BFIA 3BP4A 4FQJH 1EXUB 4WGVB 2WBKA 2C5DC 1OT1A 2X9YA 4QHKI 4ZX3A 1PD6A 4GW5A 2OTUB 1BZOA 3CVDA 1JPTL 4P4KC 1P1ZA 3CPLB 3B1TA 1VRSA 4MJ5B 3DOHA 4U6XB 3I6GB 3V7AG 4QRRA 3QO0B 5E1QA 2CIKA 2WKOA 4U1GB 1MCDA 2Q5BA 3JUZA 3O45A 2O6FA 5KYYA 4N2AA 4OGQC 2VIRA 4E42B 2DQ6A 4Y4FA 5KSUB 1JHLL 1KCKA 3B5GA 5E00B 4NQXB 4L3ED 1K8IA 4KGJA 1A14H 2DMGA 1F6AB 2EILB 1IAIM 4Y4HB 1OT4A 1X7QB 3LRKA 2XN9B 2WLIB 2ZUYA 3GSQB 3X3GL 5HHPA 4U1JA 1NMAH 3ZU8A 4NPYA 5JPMC 1FJ1B 3WFZA 5KYWA 5AOJA 3DROA 1LK2A 2KQMA 1FZKB 4JRXD 4PG2A 4NQDB 5I1GH 4I1PA 3TBWA 4BA0A 1ZMYA 3JWNE 5AVUB 2FL5B 4N4YB 1H8SA 3LZNA 2NXZB 1BZ8A 2DW5A 3WTWA 1KLGB 3DHJA 3W56A 3PCYA 4R7XA 4KMTH 3QR0A 4IK6A 2X09A 4ETQB 4YK4C 1ORQB 5FUCE 4QRSB 4YNYA 4PS3A 4XRCB 4ZNCD 2OTWA 1MJ8L 3K6DA 3ZQXA 4HPHA 3GB7A 3HI6L 2NY3D 2OSXA 3VGAC 1U2HA 5TFSL 1BD2A 3ULVD 4A2LA 4JANA 1PKQE 2VQ1B 5F6HJ 4XBPB 1UA6L 1SQ2N 2R9HC 3CK0H 3FT4A 4PGCB 4YJZL 4XP1H 2P5WE 3KNBA 4I0CC 1ZWIB 5D72L 4JRFA 2F61A 1C1EH 5MERB 4YFDB 5GS0C 2IMNA 2GB2A 3EHBC 3BP6A 3B6SB 1AG0A 4K8RH 3N06B 3QZWG 4OFPA 2X12A 3TBSA 3OR6A 1LQSR 2BMKB 4TKWA 4IOIA 3BEWB 4K9EC 4Y1AA 1RHHB 5KTEH 5CLTA 4UQEA 4YXKL 2JJSC 2J12B 4N0YL 4NFBA 4R4FH 3BPNC 1CICB 4KXAA 3OJDB 1QMUA 2BVPB 3R0NA 4NCC1 2AXHA 1OAQH 4GMSH 4OT1H 1NOFA 1P1VA 2XA8L 3EBHA 3FSOA 3ARGD 3ECQA 3U2IA 3QRBA 4HZLB 5KVEL 2OX5A 4FADA 2FBJH 4M8QA 4PD4K 3V5HB 3LHPH 3VSQA 3TEYA 3T0DA 2ZPKH 3NJKA 2LFGA 5IMLB 2BWQA 3KLLA 4QGYA 4JRWA 3HAEA 2JI3A 3UPAA 2D3VA 4KUZL 3RKPA 1EJOL 3MTRA 3GM8A 5BOJA 3WS3B 3DX6B 1MHEA 1T03L 2E6PA 1MFBL 5AW8B 3HRPA 1KXVA 3U36A 1HL9A 2ADJA 4JKNA 4Y2NA 5HHXL 1CXKA 4PJCB 3TBCA 3MCG1 2A38A 4DH2A 1GC1C 2Y07H 3D2UB 1O7DE 5IFAH 4MMXB 2X4OA 2XWCA 1EV2E 1UASA 3BZFB 4C8XA 2KPNA 3LKRB 1M7IA 3U4KA 3UJJL 5E9AA 4ZTPH 3UYOD 3P3UA 4PRBA 5FB8B 3JV5A 5DHMC 3D69B 2FEJA 3BDYL 4Z7OE 2VLLB 1AZZC 3FQWA 2OMTB 3NAAL 3AT9A 4YE4H 2VMCA 3VXTB 5I8KH 4ODSL 5K9OA 4N90D 1P9MA 1U8OB 2AVFA 2Z34A 2I24N 2UX7A 5D1XD 4GW4B 5TQ2L 1FO0B 5H4YA 3ASNB 1G7LA 5FCSH 2ILLA 4LL1A 5D7LD 5B1AB 1HJBC 3I2CH 1HEJC 1OTSC 3BP5A 3OKEB 3ASWA 2XTJE 4AYDC 3QNXB 2HG5B 2E86A 4TQHA 3D2UD 1YEKH 4RDQF 3NZHL 3O6MH 2WCPA 1YEEL 4OV5B 3IFNH 3FQRA 5I1AA 2EP6A 5DJ8A 4DZ8B 2Y3AA 2TSAA 4KDVA 1C9SA 2YEQA 4HMEA 3VFVB 2BFVH 2GI0A 1PZ5A 3HS0C 1QG3A 3NGBB 1S7QB 2F7IA 2YAHA 3P3YA 1CXEA 1A64A 2A73B 4G9FB 1XVSA 2IPTL 3NTCH 1DSFL 1JJUA 3AREC 4QHUB 3DJSA 3GSOB 1BBDH 3E3QE 3WKML 4LSTH 2HLAA 2AJYH 4QT5A 3UGEA 3CFKA 1N3NA 1BD2E 1JTTA 3ZQ9A 4YC2C 1TO4A 4O51B 1JGVL 3VX0A 2WZPD 3KYOA 3FTUA 2UWEE 2WXHA 3FH8A 3BH9B 5EG6C 1O6VA 1T83C 5IBLC 5E5UB 1U8JA 3MDJA 3H2WA 4YWGL 4XPBH 3WNLA 3BKCL 3F58H 4AMKL 2BVOA 3CV5A 5IMMA 2IGFH 3D51A 5H35A 1BA9A 1GOHA 2AQNA 3DSFL 4DFIA 3GSWB 3KJ6H 3DYOA 2AXFB 2OXHA 1NUFA 1PQZB 2HVJA 3E6FB 4L23A 4A7UA 2YC1B 5FGBC 4O58L 5DUJA 1TMQA 4H2CA 3S4SB 3QA3B 2Z3FA 2P5ED 2AAVA 4HBCL 4HC1H 3B37A 4UINL 1D6EB 2DLEA 4WSGA 2FGWL 3N91A 1CDCA 3P9MB 4UM8A 3TVMC 5J6HA 1IJ9A 1XB6A 1N4XL 3L3HB 4CJ1A 5KVGH 4KJWC 1JVOA 4X6FB 5I26A 3WDJA 2ZOKB 3OHXA 1G1YA 3CZFB 4M6OH 1JD9A 3PJSA 1WIUA 3AQZA 1YYLH 3QARA 3V5DA 3WLWD 5EB9A 4PBWD 4JPQA 4EXKA 4U3CA 2NYYD 3MRRB 3TTYA 3VRLE 5CEZL 4OLWH 4OQ1A 1UZ6F 1CLZH 5AZEL 5HVHB 2UY7A 3MRMB 1ZY9A 4FZEL 4I0PC 4DVRH 1U2CA 2ZKWA 3BLBA 3SYCA 2DM2A 1ODAA 3T77B 2Y6TE 1GA2A 3FPYA 4J4PD 4NN5B 2OK0L 2CHXA 3H55A 1AXTH 3MLYH 4JFDD 2PW1A 2X2JA 25C8L 4N2OA 3ABGA 5KSAD 2PF6A 4ELKA 5EBGA 5IF0B 3O3EA 4EDWL 4Z7NF 3WUWG 1RK0A 1F56A 5L4JA 2CRMA 1UVQB 1ZVSB 3GXMA 1AXTL 1EIBA 1AGFA 2X4NA 4ZUSB 1TF4A 4QXUH 4M5SA 1NCJA 5F3HA 5FDYA 4L3CA 4UBDD 4X0KA 4Z7WB 4KTEH 3U9UA 3PY9A 2EDKA 2K6ZA 4RZCA 3KDPB 1ZE3H 4HCRH 4X4XB 5ILTL 3NP4A 2KL6A 4OY9A 4CVWA 1HCZA 4GXVL 5SX5K 5AUMA 5DFAA 1VGEH 1JXGA 4ZO9A 3SDDC 3OSKA 3LRSB 4FRWA 2HRPL 4FLHA 1W8NA 2HVKB 3WNJA 2C3HA 2WVVA 5CSGA 1T7ZA 4HQQH 2AANA 4NO2B 3V55A 3UTSA 4JHBA 2FJUB 3WGUB 2DI9A 1FG2B 3VGAB 2NY2B 2XUWA 2AEPL 3VSUA 2Y06L 1RXLA 4LBEB 4PHZA 3EFDL 2MNUA 5KYYB 4PJDB 1JCKA 2PYEB 5KSAB 2WWMD 3ZIYA 3QPXL 3RKDD 5DJDB 4LVNC 4JY4B 1F18A 2ADIB 3QFGA 4HGWA 5F96L 4XVTL 4J3OF 2ZAIA 5JDSB 2NUPA 3ALWA 4DF9A 1AGBA 5INDA 4S1SL 5DQDL 5BZZA 1K5NB 5GZOD 1FJ1A 3NT0A 3ZYOA 2CHWA 5A2JH 4AWJC 4DGVH 1I8MB 4BQBA 1VA9A 2X2IA 4D8PA 4XP9L 3HNTL 4H0LC 4X6BA 3NFPB 4GUPB 1N5YL 4ODVL 3F6IA 3VXUA 4JAMA 1FIGH 4K5MA 1QLEL 4IBYA 4ZSOA 1NMCC 2XZCL 4GEJA 5BRZD 3F7VB 2EIDA 4EXPX 3KWWA 2B4CL 5D7JC 3ZHLA 12E8H 4PRIB 2X4PB 4LCCC 4NZ8A 4PP1C 1A3LL 4PPTA 2F15A 3H56A 3ARFC 3M7OA 4ZAKD 1ASQA 1Q4NX 5FO7B 4XAKD 3O3AA 1DSFH 1P5UC 3NJJA 4XBPA 4BH8B 1JTPA 1X5MA 1Z3GH 1DQLH 1MRFL 3LZFH 4MKTA 4Z77A 4B9IA 2BFVL 4N2HA 2K0RA 3F62A 1AXSB 4OIIH 1C5CL 3FTGB 5EEVA 1U8KB 5H8DA 3PNRB 4LEEA 5DK0B 1FFNB 5IB5B 3UAJD 3NMEA 3ZZQA 3UADA 1X5FA 3QUZB 1OSEA 2CGRH 3FF8A 3MREB 4UT7L 2XPYA 4L8BA 1A7QH 1QFWH 3WOVA 3V0VA 2AI0L 4FHBD 3HPJA 4MQ7B 2LAAA 5ADPH 2ZCLH 1UOLA 3D18B 2V9RA 4W9IC 3MV7B 4XI5C 4AV0A 3S5LA 3RZCA 1MH5B 3ZDXE 1R9FA 5E2TL 1UB6A 3NP3A 3QVAA 5CIPB 3V5HA 1ZSDA 3AREB 1JWMA 4GS7C 4KQ3H 2FEDD 3H0TB 5D96B 4FG6D 5F9AC 3ZPDA 2YZ1A 4JDEA 2CBTA 4JKWA 4HSCX 3WJLC 1U93B 4UV4L 4AM0Q 3OWRA 5I0VA 4XNZB 1GJUA 1IT9H 3D30A 1PNCA 4KHTH 3VGDA 4AIOA 3ECBA 3VW3L 4P2RA 3GHBH 1A3ZA 3C5SA 3X2QB 4X5WB 2K7QA 3L2LA 4LCWA 4HKXA 4PJGA 2VDNH 4DW2H 3FTSA 1V3MA 1HAWA 4R8WL 2Z92B 1GMIA 1J1OL 3S35H 4PIRF 1HH9B 4P5TD 2E7HA 1CDJA 3KWUA 1JFHA 4MA3A 3D85B 2JTYA 2P8PA 4TNWK 1AD0A 3KPPB 3BISA 5DS8A 2X1WL 4ZQTA 1T03H 1TQTA 2QGCA 5FB8A 4ENZA 4NQCD 2IGTA 3MRBB 4N9OB 1I9RH 4DNLA 2A9CA 3IDNB 3EO0A 3JTTB 2ZKXA 5SX4H 3FQWB 1N6VA 3P0YH 3MKKA 3QT2A 3QI9D 4QHLA 2VZUA 3QG7L 1XF5A 2W9LA 4RH4A 2OBGA 1G1CA 1AHWB 3MOAH 4AW4A 4LRIA 4KHXL 4NKDB 4JS7A 4AQ8A 5E2UL 25C8H 4U31A 2C9QA 4PJHA 3OMZA 1FO0A 4MHHG 2BSBA 3BAEH 4LSPL 2MTAA 1OAKL 3OAZK 1MI5E 2IPUG 1UWGH 3HG0A 4WWKC 2J44A 3KPRA 5GZOA 1LE5A 2ZYIA 4KKZA 4BZ2L 3V4VA 1IL1B 4CMMB 32C2B 1WO2A 1R5IB 4R5XA 1ASPA 4G11A 1Q9LA 4TLKA 5IMKB 1SM3L 4BFRA 5I5IA 4S2SB 3CU1A 4G7VH 4RWYH 1OGAE 3SE4C 5HJDA 1KOAA 3EO9L 1ZEAL 4J3VA 1RJLB 4PGDB 1DUZA 4LLDB 5T1KB 2PCPB 3NUKA 4ZPVB 1BX2A 5GS3A 4C83B 2NY4C 5ALCL 4X6EA 5A7BA 4WVRA 4OJEH 4DOHB 1IILE 2X2HA 1R1CA 2X0UA 2N0KA 5F72S 3BHBA 1AH1A 1PY4A 3P4OA 3B8SA 2ZKHL 2HLAB 3KG5A 4NQSA 5BS0D 3BW9B 3ESUF 3GDCA 3QRGL 1HOEA 4HWEL 4K5LA 5DS2A 1RSYA 3FO2A 3RNKA 4WI3A 3VQ1C 2NZ9D 2VLME 12E8L 1R3LA 4L4VD 4X5RA 5CBAB 1JNNH 5JHAA 4YLCA 4ABVA 4LARL 1F4YL 1OE2A 3HE7C 1BZ7B 1D3CA 1QWUA 3VU1A 2CK2A 3STBA 1GW0A 1EEUA 3BQUB 2BVOB 3FFCB 4PWIA 1DZ0A 4HMDA 4MNQA 1RZKH 2NNAA 5JOEA 2G3MA 2GBTA 1AZUA 1FYTD 4HK3N 5F6IB 1SXBA 1FVEA 2MCMA 1H8NA 1HXMA 1YAIA 3QDGB 3SPIA 4AENB 4PRDA 1NUGA 3KH4A 4Y4KB 3H54A 1NCIA 2W5PA 4WKZA 5IK3B 4JO2L 1DE4B 5D7JA 5I8KL 3W11C 2I60H 2WB7A 2NY3B 3PIQA 2GJRA 3NBNA 4JFSA 1OCOB 4KKBC 3T0XA 2B08A 2FT8A 1QFUL 4HZAA 5I75B 1A7QL 3ASOB 1X5JA 1UXWA 3MV7D 2B1HL 2H4EA 1A8JH 1NGWB 2RAMA 1XF2A 4HJ0D 1FPTH 3BKJL 4OIIL 5DC9B 3WL9B 3ZL4L 4XC3L 2DJ4A 5D6DC 1NKGA 2WNKA 1MHPH 3UAJC 1XSOA 5CEXB 4MVBC 2I07B 4X50A 4BWUA 5HI5D 3MJ9L 2D4DA 4AC2A 2G60L 4UYQA 2ZCKL 1G6VK 4A67A 3I50L 1L6PA 4M6NL 1XEUA 3MLXH 1T66D 4EI0A 2XXCB 1FYTB 2ENSA 3CN2A 4BA8A 5F0MB 3C60C 3QUKB 1HXKA 3H3KA 3HTLX 5DD5L 1NZRA 2VDKL 2ENYA 3EYUH 4PJGE 5D2NA 2GFBB 1RK0B 2GPZA 2LU5A 4G6KL 3RTLA 3MLUH 4TUOB 1RKRA 3BGMA 4PJXB 4QHMB 2PR9A 2OK0H 4QI3A 1JGEA 1KN2L 3JWDL 3F8UB 5D5MA 3UTPD 3Q43A 2F8OA 3O6FB 4ZPTA 4I77L 1S7SB 2CKBB 4WU7B 4BYHA 1DQVA 4G1MA 3REVA 3CAFA 4X6CB 4BFEA 2H3KA 3MROA 4NRXA 3MV8D 3ZDXB 4L4VA 3AUWB 1EDHA 1JV5A 3BIKA 2VUYA 5DMGD 5HI3C 2GAZA 4X6CF 1TZGH 3OV6A 4XNYL 2IDSA 4WF7A 5D7SL 1QPXA 2X6UA 4L3EB 2BSTA 5D7LE 5GS0L 3OKOB 3SDXE 3NDYE 3P73A 1Y1UA 4JPVL 4LLYB 3HHSA 4TLSA 4FQXD 4P46C 4G6JH 2MQCA 2WXPA 4I18A 1ESOA 1IEAA 2WQWA 2HTLD 2JKSA 2VE6B 3G6JF 4B96A 4UQDA 1AIFB 1J12A 5F1NA 5D6CA 1K3IA 2AK4D 3AMKA 4KQ4L 4QUOA 2XV2A 1L9QA 1RH8A 3M6DA 2CHNA 2HWZL 5D1XC 3A4FA 4OQTA 2H0EA 4PJIF 3GMMB 4RAVB 3K5RA 5BMFH 3L4WA 2VSCA 1HWGB 4X6BB 1SJXA 2X4SA 1TETL 3ARXA 5C0AA 4MHHI 3FTVA 3VTTA 4P04A 3NZ8A 3VXSD 2OMWA 1JPGA 1MW3A 1KPRA 2FJSA 4LMQE 3VXRB 1BFVH 4AKOA 2K70A 3TCXA 2HUHA 3L5XL 1IEBB 4WWKA 3O6FC 5EIIA 1W6WA 4HH9A 4JFYA 1AS7A 3RVVC 4BHUA 2P3YA 4HP5A 5G4NA 4HC1A 4C54A 4X99A 4FYRA 3WKQA 1KT2B 4E41D 5IVZA 5T3ZE 3QUZD 1UURA 5ACMA 4H26B 3HMXH 1W8OA 4K7PX 4F57L 5CF3A 3QEQE 5HPOA 3U6RB 3FK3A 2O26U 4JO4H 1KF9B 4L3AA 2AV1A 2R2BB 4GT7A 3V6ZA 1AXSA 3IN0A 4MJ2A 1B3JA 1U8KA 4M3HA 1NFDA 2Y5TB 3ARFD 4NNPL 5TFSH 3KEHA 3X12A 3HE6C 3T09A 3IE4A 1MJ8H 2QFRA 5EA0H 3WIHL 3QIWD 3V4LA 3K5SA 4TTGA 4UT9A 4JHVA 1A1NB 1RPKA 3ZY7A 3I74A 1JGIA 1G7IA 5E9DD 3VXSB 2DKUA 4Q9CA 4R7NB 1EHAA 1NEZA 4Y2LA 4YZFE 4AQZA 4N6RA 5CINH 1QSZA 2BH0A 3MCYA 2CIIA 2PO6D 4K3DL 1UM6H 3JZYA 4L2LA 3EJRA 5FFOA 4C57C 1J0IA 3FYEB 1MFUA 1XR9A 2GHWB 2WVTA 1MUJA 1T3FA 3BO8B 5I66B 5JXED 1I8KA 1K4CA 1GYWA 1AAJA 4K3HA 3WAKA 1TJMA 1KJ2A 4TM9A 4ZW3A 3OJMB 2OV0A 3IDIA 5CD3B 3T2NH 3QFJE 4NZTH 3IPEA 2ARJB 4O02A 3S8GB 3VW3H 1JGVH 5HHNB 2LU4A 3INOA 2HX8A 3B56A 3TVMD 1BECA 1TUPA 3C5JA 5KS9E 1UM5L 4ONHB 4PWKA 4B60A 5IHZB 2IQ9H 2OZNA 5LN4A 3SD2A 4Z7IA 3D39D 4JG1L 4XCFL 2FATH 3UBXB 4F3FA 1RJCA 1A3RH 1RFDH 2WW8A 2ZCKH 4GRLA 4N85A 2Z92A 4M7JH 1CYWA 2O6PA 3C5ZD 3KXFB 1XCXA 1TEYA 4XN4A 4KUCD 5ETUB 5L2JB 1OAJA 2EH7H 1YEJH 3DIDA 1I1AD 1YYML 4GKSA 1NGQL 2XQBH 2A9BA 4J27A 2BSSB 2EEAA 3V6OC 1YQ2A 1BD2D 5TGBB 2PYFB 3SPGA 2R59A 3BWAA 3CBJB 4HOWA 1UA7A 3L2MA 4AEEA 4WJ5A 1H3UA 2FHCA 4BZ1H 2WVSA 5D6DA 1MW1A 4Z7UE 2W07B 5FPIA 3DDFA 4IRSB 2C3VB 3TN0B 4XMWA 4I2XB 1G7HA 4YFEA 3H53A 3GBNL 3VFNB 1VCBC 4G9DB 3KGTA 5F3BB 1YUKB 1SPDA 2OCCB 3NPSB 5E0QA 4FCAA 2ZG1A 5C6PB 5KN5A 1XHHA 5FGSA 4RESB 5ICXA 5T1DL 4AZ8B 2EABA 3GMRA 2IH9A 2J1KA 3MNMA 3QEUA 1NGQH 2XQBL 2E7LC 2R4RL 1TZAA 4FKKA 5C07B 3EOBA 5E56A 3RBSA 3U4EA 2X1QA 5FOJA 3ZE2F 1YMMA 2V0AA 1MLBA 4ZFZB 3BT0A 4K3JH 4YDLB 4FEMA 2QPUA 4Y5XC 2V6HA 4YDVB 1JN6B 3D06A 4W9CC 3QQDA 1MWAB 3O2DA 5E2WL 5EBWA 4CMHC 3AMLA 1EHNA 2WTOA 3K1DA 3SE3C 4M5ZH 1VF5C 1YEFL 3ALPA 4MWFA 4ZT1A 3GGWB 3KPLA 3QQ4A 3GSXB 1L0XA 4QTHB 5F88A 3KD4A 5H94B 4IGBD 4XO9A 5FYLD 2VR6A 4ERSL 2Y07L 2YPLB 1PTZA 2XZQH 5D93B 1ZT1A 1OCCB 3P3RA 2P8MB 3O3DB 4F7MA 4UNIA 3OQRA 1B90A 4M62H 1JXDA 1FLRH 1BYPA 3TYFB 2CPUA 2YA2A 3FU6A 4BFNA 4ZYKB 3PWLA 4S1SH 2ZT9C 1HOCB 1HT6A 5DQDH 4JFFE 3L13A 5F1SA 4BUQA 5JPNB 4LCCA 3VM5A 3U0WL 4RCAA 1H9DA 3CIAA 2WXRA 3EJQA 1U8MA 3AS3A 2CKBL 2A6JA 2EUVA 5I17A 3O81A 5TJWK 1TTRA 1GGCH 4ORGB 1QLFA 5I0XA 4G8GA 4ODUB 1G9ML 4EVNB 5J1AA 5INCB 3Q2WA 3JVFC 1YMHA 5HDBE 4Y4KC 4U1SB 3SDXB 5T3ZD 3WTTA 3K4ZA 4JFED 5CLZA 1NINA 3SDXF 2AQPA 5BXFA 1SN0A 5JIIA 1OAQL 1JWUA 4YZFF 5C0ND 4F33A 4X6CE 4DGYL 2R29A 3QIWB 2LFEA 1FNGA 3MRHA 3MV9E 4JM0A 1DE4A 1RZFL 1T0PB 2O6CA 1BVLB 4W9LC 3LKSB 1GIGL 4UOJA 3GQFA 3N42B 4AGLA 4MZRA 3TT1L 5CZKA 4HUKB 3TBVB 3X1BA 2OLDA 3CZGA 2FEEI 2IANB 5EZOL 3V5KA 3WFEL 1IGIL 3FMGH 4PG9B 5TE6L 1IBFA 4PLNC 1G9HA 3IGLA 4XAKE 5B8CA 2G2RB 5EN2B 4LDOB 3TO4B 4AKQA 2J88H 3KM1A 3U30B 2AK4E 4KXCA 2J5WA 1KULA 1BG1A 1E5UI 4WGWB 1AFVH 1U95A 1UH4A 3SQOH 3V4PH 2DV6A 4LLQB 3HUJB 1YNLH 3K2IA 4W9FC 1WCBA 4E9XA 8FABA 1HFUA 4TMPA 1L4IA 3T0BA 4OU3A 1XEDA 4HWBH 4JEGB 3BC9A 1FHGA 3D39B 2XKUA 4MNGA 5JORB 1DN0B 4M6OL 1AYRA 1MFCL 4Q2ZB 4MVBD 5D2NB 3IMWA 2AJ3B 3RVXD 5IVNA 2YO3A 4JPVH 3DMMA 3PNWB 1HHJA 2FO4A 4KY2A 1EVTC 4LLWA 4XO8A 5I1JH 2B4CC 4V2BA 2QDVA 5C6TL 3S97C 4X2UA 3I6LE 4QOKB 2Z1PA 1IAKB 4PJ5A 4HUUB 2OI9C 4RIRB 1KLUB 5HI5C 2JJVA 5KZCB 4WFHD 2A74C 4KJQC 1U6AH 2AABL 3L3GB 4P5TC 2DQMA 5TF1H 3W57A 4EUPH 1A2YA 2JMRA 2YUXA 4L4VB 5CEZH 1FSKB 4XN2A 3VFMA 2GAZB 1MPAH 2DQEH 3IGAB 2JELH 1P7BA 4LCYB 3OKKA 1R24B 2ZSVA 3K8KA 2VDQB 3QJXA 4XNQA 1F3RB 4LLYA 2RBLA 3MLVH 4PS4L 3QI9C 4PTTA 4OR1A 1GZQB 4M8RA 2V7NB 4O2CA 3VI4E 4KI1A 2APXA 1OB0A 4HCRA 4ODHH 5H37G 4CVZB 4UZUA 4PJCA 4A37A 4AVIA 4B5EA 4XPFL 3VFSB 4PJEF 1XGYL 2WAHA 4XNUL 4DKEH 2LTQB 4LPVA 4DN4H 2J7LA 4BSWB 5F1IB 4PRHB 3X14B 1PKOA 5D8JL 5JZ7C 3BZFA 3VXPB 2CUAA 1VFUA 2MTPA 3C08L 4KXDA 1H15A 1MHPL 2PWFA 1A1OB 1L3WA 1L3NA 2K7PA 4J2QA 3TEWA 5TPWH 1S5IL 3Q8CA 4NWUL 3TM6A 3DETC 4X9BA 1NBQA 4G82A 5IMOA 4WHDA 2JKXA 4MCYA 1YC8A 2P42B 1RJZA 3ZW3A 3HG1A 2X3CA 4GBXC 1LO2L 3B9KD 4JPIA 3I9IA 1JMZA 1IBYA 5D9SA 3D3VE 2H7WA 4L5FL 5C8JB 1ZLSH 1FFTB 2BIHA 2OTUA 3EF4A 4YK4B 4KXZH 3SKNA 4XBEH 4H26A 3QZNA 3CPLA 3UBHA 3VA2C 5EFIB 1ZHBB 3PQYA 2A9AA 3ABZA 4XXWC 4B9PA 4FZ8L 5J1SC 1UACL 4E42A 6FABL 3RURA 3P11L 1JOIA 2OCJA 1SHMA 4X6DA 4YHML 3QAQA 4HS8H 1FFOB 3GF8A 5IB2A 2X40A 4JKMA 4A04A 1Q9WA 4IJTA 2CR0A 3IDGA 5FGCB 1X4XA 3CXHK 2GTZB 2YOCA 3IFNL 1J0ZA 5JIHA 3VXSA 1IVTA 1B0GA 3VFVA 4Y89A 4R90H 3QPKA 4HWBL 4ADIA 4NAJA 5DR5H 2V17H 3QRLA 1UD6A 2HJLA 3JTSA 2RA1A 2BHYA 1V7NL 1Z9PA 3DARA 5F1KC 2C1PA 3EH3B 1KLGA 4YAQA 3GDBA 3S48A 1LP9B 2ORBL 4QAMB 1HYSD 3MXWL 4HX1A 1NCCL 1QKZH 3V4PL 5JO5A 2E8ZA 3T2LA 4KAQH 4JHAL 2UWEA 3GJFH 4ALAH 4DPBX 3MFGB 3OTTA 5LCVA 5C2BH 3DUHA 5BJTB 4L9DA 1X7SA 5DQ9A 1IB5A 1I1CA 3BSHA 2EDMA 4WTXA 4NBZB 2EUXA 2Q3XA 3LH8A 3BWUC 2ZUQB 2G3NA 4FMFA 1EJOH 1T0MB 3F7YB 1WBXB 1MCBA 3K1KC 4JO4L 3N40P 1BVNT 1T0NA 5F1OB 3O4LB 3QG6A 3FW6A 1GPOL 2FBJL 2BX5A 4X5LA 3FHEA 4PJFF 4Y4FC 3K6SB 2VXQH 2XWZA 2ZE0A 3QH3B 2XDHA 3SDAC 1D9KD 1LYQA 2Y7SA 3N1FC 2OL3H 2HG0A 4F2MA 2J4WL 3WD5H 3VFRB 1BPLB 4LT7A 3BPOB 3VYPA 1DVXA 2FGWH 4M7KH 4NUJB 4QYOB 4YDJB 3OKLB 2JV6A 4DQOH 3EHBD 5ID0A 1QI5A 1L0YA 2H0PA 2YPVA 4RQQA 3N6YA 3CFQA 1NLDL 2Z0BA 4OM0H 4TOYL 1P84J 3KJ4B 1C16B 4X7TB 3RQ3A 4DEWA 3F65A 1A7NL 1MZYA 5EBMB 1NAMH 3HZKA 4JRXB 3V4UH 1A4JA 1NCNA 1PDKB 3C5ZC 4NQEE 2HFFB 2V7HA 5TD4A 4IIQA 5J9PA 1TXKA 4YBHA 1ETA1 4AYSA 2JKLA 2M2DA 3TIEA 1MLBB 4P46A 4Z7VF 1DUYA 1RURL 3K0WA 1JZEA 1TQWA 4HXBL 5FYKD 2E7DA 1SJHA 4OW6A 4Z7VB 3VFOB 3GMNA 3QQ3B 4A6YB 3JV6A 4JRYA 4P9HC 4D0DA 5TQ0L 3V0DA 4MWFB 4TOYH 4YDIH 1UVQA 1SRDA 1ZVSA 4KV5F 1KPUA 3SCMB 1JD7A 3HLAB 5FHBL 2NZIA 2W0FA 5HGHB 2ITDB 3PWPE 4NKIL 4LAJH 3ZT6A 5I1EL 3QR2A 5JIQA 4LLUB 4KUCF 4OZ4B 1J7VR 1N70A 4DKFH 3HG1E 4DETA 4RX4D 1RUAL 3TC9A 4LDEB 2WZPA 3JWDH 1INDL 3NCWA 2H6UA 4WRLA 5AL0A 4GKNB 2R0ZL 3CVHA 3TNNB 3ARBA 3SOBL 4I9WD 4K8RD 2DTML 2OMXB 3QO1A 4HIJB 4PP2B 4U0RB 4X80L 1F3JB 4JMXA 5DJYB 3QEGH 4RVBA 1ZA3A 3A47A 4FNQA 5AALA 1AQKH 1T5XB 2BSEA 2ZWLT 2QEJA 4CSPA 2R0KH 1FG2A 2D2CC 4QDGA 2NY4B 3AG4B 5T33L 4R4BA 2DMHA 2EDHA 2DQFA 3K46A 3LPOA 3RX7A 1SYVA 4DKAA 2Y7QB 1D5BA 4G83A 2HRLA 2FX7L 4H5SA 2HG5A 2VXTL 3B7UX 4AE0A 2G0KA 1MCLA 5CCJA 1WJ3A 3T0EA 1H3XA 4Z0XB 1N67A 1E6JH 3GNML 4X8JA 5T1JA 1ZGLA 4L4VE 1U8QB 1IARB 2F54D 3OKMA 3FQRB 2WYHA 4PAZA 1R5VA 1X6LA 2JI1A 3GD1C 1QBMH 2COQA 1I8AA 1MCKA 3PDOB 4HV8A 4O4YL 1BFSA 1W2KT 4Q7DA 5E6UB 4ZO6A 2NYKA 4A2GA 1G6RL 1BM3L 2X5PA 3GMPB 1CFSA 1RIVH 4J3OC 4IU2A 2BP8A 1E0OB 5D1QB 1SJMA 4C55A 1FFPB 1MVUB 1V8HA 3RWCB 4M1CD 1U30A 1RJYA 2VSDA 3CLEL 1WT5C 1ORSB 1JPST 1R3HB 4Y4HC 1TNNA 1F3DJ 1XCTA 2WXFA 4PSRA 3BD4A 3PP3H 2VLRD 3L3KA 1UUNA 4L37A 3AZUA 1OW0C 1NQBA 3SOBH 4ODBD 4DP7X 4JFPB 1E5AA 1ZHNB 1G5AA 2GJPA 4PCKA 3V4VH 4NO0B 3WI9A 4KNUA 5MEQB 1OSPH 3VO0A 4ZFOA 4PW4A 2VWEC 3W82A 1O6SB 3T3PF 2AJXL 3D1MC 4KVNL 3ESPA 1KYOK 3GIZL 1QRNB 2XXGA 5FEBA 3AQDA 1WBYA 4LIQL 1JNHA 3GSRA 3GEWB 3TU6A 3TO2B 1HIML 2Y5EA 5F0PB 4HWEH 4F92B 4TULL 3ROOA 1PQZA 4U6VH 1KFAH 1C5CH 2F68X 1WG3A 3HBGA 43CAA 4ALAC 5IB3A 1E28A 1N5AA 1U8NB 3KWVA 4AKPA 4YEFA 5I1CH 5ALBH 4NXSA 3AXIA 3P77B 5I1LB 2X4QB 3GIVB 5E4AA 1CIDA 3I6SA 3WKYA 5A3IC 5CJQH 2IH3A 2AGJH 4JUSA 4AGOA 3IPFA 1SDDB 1DBAH 3NSCA 3VXQA 3QUYA 3RUGA 1QAWA 3BVWA 2C3GA 3WY4A 3VG9C 5IROA 5CZRA 5CEYA 3G5XA 3FRUB 1O75A 3LNEA 5KBNC 2V3EA 4CBZA 1S7UB 2WCSA 2C3XA 4AVHA 2L4OA 2QVFB 3T77A 5DHYA 1N19A 4I3RH 3MLYL 5FX3A 1A7RH 5HHME 5TDPB 1TZHA 3K81A 3E2HC 2MCPL 3L8QA 5F71A 5F0LB 1AP2A 3RB7A 2Z4TA 2NQCA 2DKMA 2R69A 3APNA 3DURA 1XSKA 4MDRA 3WN5B 5EC2A 2BDNH 3JT0A 2WVUA 3X14A 1ZLDA 1BQLL 2OJZH 2QTEA 4LQ1A 2XY2A 4PJEA 3ZUNC 2BJMH 1A7NH 3VA6A 1EAOA 5CJOH 5IUSA 2GBAA 5D96C 3F3HA 3QWOA 2BNRA 3DX8B 1CBJA 1ET5A 2KZKA 5AFAA 5L2KA 3E3QC 1M7DA 2IWGA 5I6XC 3IBOA 4F15B 4ELMB 5JPNC 4KI5D 1DLFH 5AVSB 4PV9B 5I6LA 5KBPA 4I13B 3KPSE 4QJ3B 2IVFC 2BP0A 5IQMA 4U1KB 3WY2A 2WXIA 1S9XA 1DEEA 5B1BB 1UUSA 2WNWA 1MJJA 1QNIA 3ZT5A 1W15A 3UTSB 4S1QH 1VFBA 1CD0A 1JERA 2NY0C 3N44B 3MODL 4PJBA 5C9JA 3U7AA 4HA1A 1LE5B 4HIEB 3IDYC 1U4EA 4PJDA 3RWFA 2VH5H 1AI1H 3N44F 4GRWE 2XX1A 3FO1B 5JW4R 3J8F7 4RAUA 5IW6B 4APQB 2VKXA 1FDLL 1E4HA 1KJVA 1WV7T 3STZA 3DRQA 3IDMB 4EKXA 2FSEA 4MSWA 3KPQA 3Q44A 3P2BA 3MJ8A 4NT6B 5MENB 3P69A 1O7DC 2EC8A 3MRCB 1NJ9B 4HKJA 5AL8A 5CEZE 3MRQA 4X7CC 3QYMA 4Y9GA 4AYFB 5BV7B 3BKYH 5SWZA 3FOMA 2Q76B 5J06A 4TUKH 5TE6H 5F7DA 1CTMA 4N8CH 1TOXA 3LDBC 4X6EB 2V2WB 1WIPA 4B0MB 1MREL 3RWEA 1IKOP 1CT8B 5HYSA 4ZUTA 4IHOA 3KDMB 3ULSB 3TA3A 3RGVC 5L8KB 2A9ML 5I6XB 2X4PA 3WKNA 1UJ3C 3DO4A 1G7PB 4ILDA 2UWEF 1M71A 1TEFA 2AI0H 3CDGB 5I0DA 3HZMA 4M1DL 1XSJA 3MRFB 4S0TD 1KB5A 3ZDZF 1VAHA 3LHAA 4J3SA 3LXBA 2JKWA 1NBYB 4M6ML 2KPWA 2R1XA 3FONB 4S1RH 1MCIA 5DA0B 4Z76A 4NN7B 5JMRA 1RU9L 2WXNA 3C5ZB 1DQTA 3EJYD 5EPMA 3UTPE 4EF3A 2O61B 5D7LB 5IUCA 4HBCH 5F7WC 1IT9L 2EXTA 3FFCA 5I1DA 1T0NB 1IGMH 4FLSA 4N0FB 5BS0B 5C0FB 5AG9A 3IWVA 2XTJB 2XPGB 4PRDB 1IGJA 4BKLA 1ZTXL 4U1LB 5IR1B 5E4EC 2GUYA 3MPCA 1QI3A 1CCZA 1T21B 3LQZA 4KJYB 3GMOA 3I02B 3JV4B 2E47A 3S3JA 3T3MF 5L2KE 1D9KA 2YWYA 1XGZA 3FUMA 1TR7A 4X4YB 3C09C 4IRJD 1J11A 4IRZH 4WU5A 3U1SH 2YXVA 4OZIE 1J9TA 3HFML 4BE6A 1XMEB 4G9FD 4XHQA 3LY6A 3EADA 4IRZL 1KACB 3HE7D 5D1QE 4LPCA 1T83A 3U25A 1G9NH 3CGTA 1ZSDB 1G9MC 1MCOH 4GAFB 3ZO0A 2B77A 4ZD3L 1OM3L 4WAFA 1YJDL 1E3XA 2EQDA 1A6WH 1I7RA 3D2TA 5JIDA 2FBOJ 2X42A 3DX1A 4OZFB 2HH0H 2VT0A 1XF3A 4XODA 4MJID 3B9DA 1N0XH 2WO2B 4KWUA 5EUKA 4P46B 4X4MA 2OP4H 3L6FB 2BIIA 2VLKD 4A6YL 4WUUA 4Z3TA 1QLRB 4GIPD 1HHGB 1QUPA 2HH0L 3EYVB 4RMBA 4ABQA 2BY3A 4R7DB 1QSFD 3ORJA 3WLWC 2XWJB 4PVLA 4PFEA 4QLWA 5KBLA 4AL8C 3WU1A 4ZNEE 5CLYA 4AQ8C 1DQDL 4MMXC 1DQQA 1OF0A 4PBXA 3IJHA 3LKQB 4OCRL 1FNHA 1Q9OB 4P2OC 2A1WH 4E0RA 5C2UB 2F53E 3RDTB 5EZJB 2Y7OA 5KYUA 4LZKA 5IQOA 2EAEA 5HDRA 2CJUL 5EF2A 3DO7B 4FI6A 5K39B 1LEIB 3BAEL 3K6FA 5HHOA 1B6DA 1U3HB 3EFOB 3TEUA 4RMTA 4KVCH 4DPRA 4ODXA 1ZANL 4KJPD 3HI1B 3STLB 3HMWH 5FCUL 2WXOA 4UBDC 3II1A 1XH2A 1NC2D 4TNEA 4YHNA 5C08D 2VDPH 4HYTB 4PI0A 2D7MA 5EORL 4BSVB 3DETD 5C97A 1NDTA 3H6JA 3CZEA 2DL9A 1KTDB 2ZWZA 1WE5A 1YN7B 3GKWL 1IIIA 5BOPA 1CICC 3BUYA 3BQUC 1OP3H 4JANB 5ICUA 1E9PA 1RZFH 3ILQD 3L5IA 4BQ8A 5F9WB 3CC5B 4OIFA 3ZUCA 3T65B 5AVWB 5DD0L 4UTAH 1TJGH 3U6XA 3DHPA 1DLHA 2DQUL 2X4SB 5FM5O 3FUIA 4MJHA 5DO8A 2WYZA 4IS6B 4ZW7A 5ILTH 1ZLEA 1DQMH 3QJQB 3V4UL 3DX9B 3FL7A 5D1QA 4PJ9A 3V7MA 4PJXE 4ZO7A 3Q9QA 1T4KA 3G5YB 4UM9D 4IOIB 1LQBC 4JQXA 2FLMA 4K3EH 2Q8AH 4D0CB 1EXHA 3OAYK 4A2MA 3CSBA 5SWSE 4F27A 5FM4A 1A65A 3NACH 2PXYC 4W93A 1KCUL 2EDLA 1GR7A 2ATKA 2BZ7A 1QQDB 4HHAB 4JFHE 4LIQE 1EERB 4XOBA 1TQSA 3RILA 4WHYH 5C3LD 1X5IA 4LRIC 4PLOB 4AMKH 3L95A 2DLGA 2DYPA 3UPRA 1PZCA 3BRDA 5K93A 1FN4A 1A14L 1KXHA 4MAYD 1WD8A 5I73C 5FA3B 2CUMA 2WOBA 4MMZA 1GGCL 3US9A 5LLIC 2NX5D 1INQA 5F7EH 4JFOB 2W0PA 3LEYH 4Y4HD 4MJIE 1AMXA 1ITCA 3HBPA 4GBXA 4H0GA 4CW1A 4L0YA 1DQJB 2WQAA 5I6OA 5EEUA 4NNPH 1XXFC 2CIIB 4XP6H 4MB4A 4XXDA 3FN3A 4ZX6A 4FYSA 2JJTA 4OGZA 1ID5I 2C7FA 2XG4A 15C8L 5LQBH 1BQLH 3Q2NA 4DUXA 3O6LL 4U6VL 4QRSA 4YNYB 3TV3H 3LTVA 5CFAA 3NIGB 3WNPA 1JXJA 5FUCC 1YN6A 1R3JA 4QEGA 3SKUD 1G1KA 4WEBL 3MA7B 3SN6N 1A5FH 1YO4A 2FQDA 4OLVH 3F58L 3MV8A 3W0WB 4I0PB 1JK8A 2IALB 4OCXH 4YLBA 3C5JB 3GSNL 2I9TA 4PGCA 4RBPH 2AEIT 4XO4A 3CFDB 3SPHA 1W91A 1YNTB 4LOVA 4QRPA 3H2QA 5IBTH 3W2DH 2VN6A 2L7UA 1HSBA 4YO0A 3GXNA 4IKNA 3IU4L 4O2EB 2J56A 2QVTA 3RZCC 2UYLA 4EI5A 3GS4A 4RZKA 2WLYA 3AB0C 2XQYA 4PGEB 3BSZA 1E90A 1RHHA 5G4OA 2PYFA 1JHTB 2NY7L 1LO3H 4Y1AD 1GMEA 2B39A 4OIBA 4FS0A 2WJ7A 1W0VA 1JZ8A 3AFLA 1B0IA 3OKDA 1JPEA 1N10A 1ECYA 5FWRA 1NCDH 2FX8L 2RD0A 1CK0L 4JPKH 4G9DA 3DIFB 2WUBH 2DB8A 5FGRA 4NRXB 5GS0H 4QRQA 2WXKA 1PX4A 3BE1H 3M8OL 5J12C 1T1YB 3WFBL 4XNYH 2WWNA 4HUNB 3BJLA 3JYCA 3O0LA 1NWPA 4B53A 1BF2A 1QVOA 1S9VB 1T1WA 2KT6A 3HKFA 3Q1SL 2JI2A 4YHOL 3WNKA 2LE9A 2DH3A 2RTTA 4ATWA 2VC2L 2YPLE 3Q8EA 4B27A 4IK7A 3LIUA 3RB5A 5LWYH 4YHIB 2WK2A 2G60H 4RMWA 2MPAH 3MI6A 1AY1H 4HK3J 3KLHC 1EWHA 2W1NA 5K59F 2YK1H 4OCWL 1D5XA 4U1MA 4GPVA 4R2GD 3PL6C 4ZQKA 3L9BA 2N01B 4AQOA 4ZXBB 4YSRA 3FOMB 3GSXA 2CCVA 5ESAB 2QL1A 1OANA 2P43B 1UA3A 3F7KA 1YYCA 3TF4A 1JPGB 4YLQT 2CR3A 4NCC2 4ZUTB 2ZD0A 1OSYA 4Z3GA 2B15A 4K3GA 4PCTA 1HE7A 1OWWA 4K3DH 2YUWA 3S98A 4AYID 3MODH 4WNQA 3SY0A 4J8RB 2F53A 2IAAC 3X1EA 5GS1B 1DVUA 1KJ3H 4RISH 1P6AB 3IJ9A 3LEVH 1SHXA 4XMLH 1N9PA 4NC0B 5A2KH 2DI8A 3ZL4H 1ZK5A 3Q5TA 1IQWH 5AWNL 1VADA 5I17B 3U6RA 3WJLA 5EF1A 1BFVL 5HYJB 5I1JL 2QPSA 4OUUA 1P7KB 3K80A 2NRDA 2CLZA 2H26A 2KC0A 3BVTA 2EH8L 1QNZH 1UA6H 1HSAB 5MP6H 3MRRA 4J1UB 3EBIA 1RCYA 3WJJC 1YMME 4X8CA 1BIIA 1BREA 3OJVC 1A4AA 1ZPLA 2IADA 2YJQA 1SFHA 4G42A 4Y16D 4C56D 4OV5A 2V5RA 1HHHA 4JFDE 4UDTB 4TSAL 1ACXA 3V0JA 2F19L 4ZS6D 2OMZB 3QDMD 3BKCH 1P4BH 5F89B 4DUWA 4HOXA 3F7RA 5ITBH 4B50A 4KPHL 3BSGA 1S7TB 4TSBL 4G9FA 1ZKAA 3EGDB 1MFAL 5TDOB 5FO8A 4F7PB 3N40F 3PGDA 4N2MA 1P4BL 4Z7UA 4YS4A 1KYAA 4EN3B 4FEIA 4EEEA 5LDSA 4TUJB 1BWWA 5JHMA 4D9QD 2PPDA 3BEVB 3UTZA 1GS6X 2E8YA 3L5HA 1A1MA 3L4VA 4PBVC 3ULAB 4JO3L 1BMGA 1CI3M 1X5YA 2A6IB 2HKHL 3T1WA 5AUMB 1M3IA 2XWBA 4MXWL 3HHRB 4YSTA 2HPOA 1FH5H 1Z5LA 4FQIH 4FHJA 2C26A 1KBGH 5AW0B 2AERT 3FFCD 1EJFA 3QCUL 3V7AE 2QPFA 2ZJSL 4D9LL 2IDUA 4XP6L 3RIAK 5JXEC 4XPHH 3RDTD 1NCTA 2VRAA 1LVEA 3V9FA 2D7TH 3JTBA 2XFXB 2YD5A 4G3YH 1NGZA 1JV2A 1ZS8A 1XD1A 1DVFB 2G9HB 3CMOH 4CKVX 3MUZ1 5A6IA 2ICEB 1EUUA 2C9SA 1E3ZA 1QI4A 3N1PC 4AOFA 5EIVA 4F7CA 5DMYA 5KYUB 2DQTL 3F12B 3ILPB 4JFEE 1GOFA 1QFWI 2X4RA 3BYYA 3IRCA 4GXUN 5B3JF 1JNLH 4P2RD 1ACYH 5J6HB 2ZNXA 4I0KA 1H0DA 4OI7A 5C0DA 1GAFH 4P2QB 1AJ7L 3X1FA 2WO4A 1MKFA 3INUL 3B2PA 4XVUC 3GM0A 4X6DF 3EYQD 4G6ML 1FNSH 4QNPF 5IVXF 3ZKSD 1OF2A 3LJ3A 3QDAA 4ODSH 1DVSA 9PCYA 1F58L 1OM3H 2FX8H 4WDIA 1CL7I 1P7QD 2P1YA 4YHPA 3SJVE 1P7HL 3APMA 5E2WH 2D7PA 4NP9A 1RULH 4FFWD 1MXGA 3S88L 3D0VB 1AHWC 3QQ9D 3CLFH 3SODB 2H2PD 3NJXA 5ID1B 2GJ6A 3CC5A 1E4KC 1TJGL 2Q8BL 2G5BB 5DD1L 5DC2A 2NX5E 1QKZL 1U58B 5DQJB 5DSCA 5I28A 4PJ5D 3VXPA 5MHSE 3QNZB 3QUHA 3BZEA 4WI7A 1M05B 3ABKB 4KY1L 5DD6A 5DK0A 3A6CL 4WSJA 4PJ9B 3FT3B 3SKMA 2P4AB 4LPTA 2Z31C 5FS5A 3LPFA 4LARH 2FWSA 4JFQB 2H2SC 4JHWH 4Z18A 4KHTL 4K23H 1ZDQA 3IYLW 1CFBA 4FLOA 4XNXH 4I18C 1I1AB 5KJ4A 2DQIH 5I6NA 3FZUD 1CDHA 1Y0LB 2JXMA 4G7YH 4XVSH 1DBML 2WBJB 4WFEE 5FYJH 4HSAC 3BDBA 4HU2A 2ZNWA 4OLUL 1WHOA 4LAQL 4S0SD 3MX0A 4H0HB 1P9MC 5FYKL 5IT2H 4XVJL 1N2RB 1PLAA 1UACH 2F8VA 3RGVD 3EDEA 4U1SA 1IKNA 3PQYD 1EQWA 1ND0B 2ZWSA 1NAMB 3LV3B 1CMOA 4R7VA 3P02A 1U93A 2QADC 3T71A 1S7XA 1UT1A 1UB5B 4NC1C 3WLBA 4OB5H 1TQBC 4JG1H 5EOTA 4HIXL 4L3FA 3W9DA 1A5FL 5AB0A 5T1LB 5D1ZB 3VWKB 2AV7B 4P23C 3S2AA 4C56B 5IIEB 2IWKA 1LO0L 3GI8H 1IGCL 2AXGB 3RL2A 3IWUA 5C0GB 5LQBL 5KG9B 4TQPA 2OL3B 5C0BE 4OVVA 1CDIA 3T8XA 1NDMB 3CK0L 5JW4M 3H6AA 2J1WA 1NCBL 1H5BC 4WW2B 3RFZB 5KYNA 5C07E 3WIFA 3IVKB 2F58L 3LRLA 5I2IA 3RHWF 5BVJB 5CWSB 1BYOA 2ADYA 4TV3A 3QFJD 5I71B 4ZUVB 1S7RA 3JYBA 2ZOWA 1KBVA 3NIFB 3NACL 4RWYL 2NUTA 1IGML 3B2UC 2BY1A 1OM9A 5CMAB 1T1XA 5FDWB 3G6DL 2WUCL 3FDWA 4JN2A 1NFDE 4BFFA 2LGNA 5IG7A 4ZBJA 1SFDA 4RMRA 4ZMZA 3PPEA 4FMVA 4LP5A 3CFIC 1KCRH 4D3CH 3ARTA 3QORD 3GLZA 3BPLC 3GTNA 4ENEC 4NZDA 3QIUD 4G6AD 1GC1H 2EEFA 1T6VN 2OKMA 4ZXBC 4BFBD 2J6EH 2IAMB 4X7SL 3Q7JA 1NKRA 4F58L 2WLKA 3L17A 4PJCE 4KHXH 5LGKA 1ONQA 5K1JA 1T22B 4GRMB 1X6NA 3MOBH 4YDZA 5J5EA 3ZO9A 2K8QA 3CVBA 4CU8A 2VDRL 3AAZA 3QXWA 1KLUA 5B8CC 2YGQA 3HC0B 3NH7L 3OKLA 4JM2B 2XETA 4XZUA 4O5LH 1SOQA 5IEKB 2YA0A 1SYSA 4WHCA 3ZL2A 5HVFB 2Y1VA 3MR9A 3OB0H 2P24B 2I5YL 2VDMH 4N0RA 4PJBE 1WGOA 2YUVA 2BVQB 2ITFA 2LAGB 3EJUA 1F00I 2DQGL 4RFEB 3P2DA 3MMEA 4WI4A 3Q0HA 1ETB1 3VYOA 3QWQB 5ISZB 4HS3B 1J88A 4PTTB 4FTVB 5C92A 2D0GA 4LEOA 2FO1A 4JDVA 1FWXA 2COVD 5JOFB 3EHBB 1DYZA 4FQ2L 3GLEA 1G9MH 3CDZA 4XNMA 3VFPA 4S1QL 3KS0J 2XA3A 3PABA 4GG8A 4HJJL 5GQBA 4NO0D 2WLNA 1UGKA 1BZ7A 3FB8A 2ZXEB 1VACB 2OMBA 4P8QA 3ZKND 4C4BA 3HLAA 1CLYH 4U1HA 5E00A 4MASA 4WI9A 3COOA 1Y6MR 3IMUA 4LLUA 2CU9A 5KJRL 2ZX9A 1NA8A 2EE6A 1AQDB 3MA9H 4ORZC 2EKSA 2QSQA 1RI8A 2UZXB 3DTUB 3NFSL 5DD1H 4D9RE 5IMOB 4ZMAT 2ARJQ 1KJMA 1KLFA 5ESVB 5TH2B 3HZVB 1QYGH 3O2VL 5EZPA 4NQDA 2VZ1A 4PP2A 3OLEA 4FXKB 2G2NA 2VERA 5FYLL 2ENQA 1YEFH 1NFDF 3QQ9C 4HUMB 5D71H 2WSKA 5J11C 4IGBC 1OKEA 4WGKA 4AVKA 2EVIA 1BQUA 5J4MA 1N8ZB 4FGMA 4DKTA 2YAOA 1LEKA 2DQFB 1KUMA 3AY4C 3S34H 2AHIA 1VFMA 3CSTA 1DBBH 5KW9L 3PDDA 2CBMA 5FOBA 2C9AA 1E8ZA 4Q9BA 3G6AA 3QI9A 3AXHA 3SZKC 2NDFA 2BIOA 2DWSA 1PG7L 3SJVA 4P5KB 5CEZD 2L8AA 2MPAL 4LAQH 1QO3B 5FKPA 4CSZA 2PLTA 1HCFX 5DTFB 3KNBB 3MNZB 4GP8B 3KCPB 4HHGA 4EKJA 3ES6A 3C87A 2WINA 3BWUF 1IGFH 4OVUA 4ODWA 3WENA 2YFOA 5DMKB 3HBZA 4NNXA 2BP8B 4APXB 3C8KA 3H9HB 3A5VA 3IFLH 2DQCL 3BPOC 5D7IA 1A6TB 4PJ6A 1DVQA 3EYSL 1IGCH 1BZ9A 1NEUA 1IBZA 3UGUA 5DRNA 4Z7UB 3QWNA 4BQCA 3UBGA 4HX1B 3IM1A 3ARFA 3GSVA 3OD3A 5K9KB 1B4TA 5DJZA 5IJKC 3FFDB 4XP9H 3AACA 4QF1A 4K7PH 3K6OA 4Z7UF 4UI2A 5FYJE 1F0LA 4HIXH 1DVYA 1QFUH 1TO5A 1FH5L 3G5WA 5B38A 4J3OG 4R4NC 2Q87A 1AO7B 2JIXB 4FXGA 4AQ1C 1KIPA 3L3JA 4HZLA 5DEZA 4F2FA 3EXLA 4Q9RL 2MHAA 1DSWA 2HZHA 5C7XL 4H20L 3VGHA 2VRKA 2A74A 3B3IA 3SKJL 4CVXA 3OKOA 2X28A 4XXWA 5JPMB 3QISA 1KFAL 2BSRB 1HXMB 4AENA 1PZ2A 2X87A 2PWEA 2EDQA 1DJWA 1HIMH 2ODHA 2QLYA 3AW5A 3OXRA 1L7IH 5JUEL 3AT0A 5CCKH 5EU5A 5D2LB 1IV8A 2HRPH 1JAEA 4HUVB 4GAYB 2HKAA 3HMXA 2Y24A 2D3JA 2ZUWA 1YDPA 4TSAH 1N5AB 1ACYL 1J48A 5GGRB 3OZKA 3CFMA 4GI8A 4HJ1A 4TUUA 3E8VA 3MOQA 3MLZL 4PJIA 4Q6YA 2X10A 1K8DB 3NK4A 1UYWH 5MP6L 3BXNB 5EBMA 2ZOOA 3LKOB 2A77L 3FSWA 4G59C 3MRNB 3Q3GA 4HUWA 4WO4B 2HFTA 3RWIA 1YNKL 4I48A 5AWNH 3U46A 1A47A 4LRNL 5T33H 1U8CB 1AHMA 4JFVA 1KT2A 5T1MA 2WN2A 1P7QA 3U4BH 1MCPL 4AQ1A 3EYQC 3QDJB 3GMNB 1SOKA 3S8WA 3DTXA 3ZR6A 4MD5B 2CXKA 2HYMA 2AV1B 3V6ZB 4U6HA 1EEZA 3VTMA 4M61A 2OYPA 3TA4D 4KRLB 4NWTL 3QDGE 2KLRA 2N7SA 3LNDA 2AQRA 4HJGB 1A7RL 4NUQA 3FT3A 1USQA 2YGPA 4DKFL 4BGDA 2FX7H 1MY5A 2YARA 3LQAC 3PU7A 4KU1A 4JREB 4JFQA 2OQJB 4AT6B 1H5BB 4G1EB 1KN4L 4WW2C 3IKCA 4DZ8A 2IXQB 5SWSB 5IWLA 1UOKA 2JE8A 1YPZB 4FFWC 1AQKL 4WO4D 1M2VB 3QDHA 1INEL 5CGYD 1G1OA 3S7GA 5EA0L 1OQOA 4UILH 5EO1A 3WDHA 1CF8L 3TYGL 1T6BX 3GBEA 3L4ZA 4NN7C 4GUCA 3VI4A 1JDCA 2VR7A 2R39A 2JKRM 1GGIH 2Y1YA 3H85A 3SYPA 5A1AA 5CR1A 4ZS7H 5H37H 1KJ2B 4FQIL 1PCSA 4FQXA 4ZX5A 2HXAA 2J6EA 4LHUG 4BK5A 3L9RB 5F1NB 2ZUXA 2Y7NA 2Q3ZA 4NQCE 1C5DA 2QBWA 3MJ8B 4NT6A 2F54E 5MENA 3RPIB 4E9VA 4IEFB 2PR4L 3KHOA 3QZOA 5LCVL 4DP5X 5AVQB 3GXFA 2J8UB 3LKPA 1TCRA 2HVBA 5C0AB 2CLVA 3SGJC 4NM4H 1T4WA 2R1WB 4BK4A 2HCZX 4N0CD 3SBRA 4F7EB 1I7TA 1CT8A 3V0WL 1WQVT 2Z7ZA 5IV2B 3DX7A 2W59A 3EJCA 3GRBA 5IT2L 4YFLI 3LN9A 5FFLA 2PTUA 1I9IH 4W81A 3VXRD 4J3TA 4HOZA 3QA3A 4WHYG 4DEPC 2J8HA 2AJUH 3DBXB 3K71A 5FYKU 5KS9F 1BZQK 3RI5F 4AI7A 4G43B 4UNTA 2ZTBA 4ZO8A 2ITEA 4NO0A 4KDTC 4QKXB 2XKSA 3SO3B 3PDGA 5LGJA 4MQXC 4MA8H 4YSPA 3NG5A 1N59A 5DUML 2OR9H 1J0JA 3T4YB 3Q6FB 1JP5A 2F5BL 5IB1B 1ZTMA 2QFPA 4M7LT 4J4PC 4YUEH 1E40A 3B7YA 3IJYB 4P2QE 5F8RC 4V33A 5AZ2H 7PCYA 2EDNA 3ZRFC 2NZ9C 4N0UA 1MNUH 4JUTA 1UATA 4ZDHA 3CCHB 2JCCA 2BM3A 3OB8A 1NSNL 1N7MH 3N85L 2XY1A 5CN3A 3UTSE 4H4NA 1OTTD 3MRPB 1JHLH 1HKFA 1J8HE 5T3XE 5AD0A 1P69B 3HN8A 4XPGH 5AEAA 4FNTA 5AOIA 1A3LH 1WCQA 3K8LA 1CFQA 3IFOA 1BLNB 5EEYA 3M17B 2B2XL 3CHQA 1H3TA 4DSYA 2YAPA 3QIBD 1AC0A 5DI8A 3KBEA 5K1NA 3SDAD 4HD9A 1AC6A 4RSVA 3SB3A 2W9EL 2VDKH 4UV7H 4XMTA 1R0AL 2VDOL 5IFAL 4TVPE 2DTMH 5I1HL 2CE6A 3KPRD 4ONGL 2FWOA 4B9GA 5JNYB 3SGDI 2RB8A 3EJZC 3L7FA 2VN4A 4F93B 4AM0B 4LCCB 4S11A 4DESA 1O9VA 4XX1E 1E42A 3LZOA 2OJEB 1RZIA 4XMPL 4PJDE 2W81C 5EN3A 1CU4H 1XIWC 2AJZB 3F01A 2X89A 5CJ5A 5DRZA 1RP8A 4NP4H 2GJZB 3VFUB 3LQAH 4YVNA 5EO0A 2AQTA 5IOPB 2V9TA 2NCMA 4NJ9L 1SBSH 5BO1H 1FV1A 4YIQB 5JDSA 1NFAA 4DPAX