3F00A

Crystal structure of synaptotagmin i c2a domain with cu(ii)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
143
structure length
142
Chain Sequence
GSPGIGGGGGGILDSVEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Synaptotagmin I C2A
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Synaptotagmin-1
total genus 23
structure length 142
sequence length 143
ec nomenclature
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3f00A01
2NSQA 3L4CA 3ZVVA 2WXOA 4NPKA 4FA6A 5CCJA 1E8ZA 1RLWA 4V11A 3W56A 4WWOA 3P2BA 4L1BA 1DJWA 3W57A 3DBSA 3KWUA 1QASA 4OVVA 4LDCA 4Y1TA 4LCVA 5G55A 3IM1A 4IHBA 1UGKA 2A4ZA 1RH8A 1WFJA 3APFA 1DJZA 2BWQA 3FDWA 4FJYA 2CM6A 4PS8A 4EZLA 1K5WA 1CJYA 4NP9A 2UZPA 3F00A 1W15A 1UOVA 4FHJA 3KWTA 5JHAA 3OHMB 2FJUB 4F91B 2EP6A 2ENQA 3SD5A 1DJHA 1DJGA 4QAMB 2R83A 4ANVA 3OAWA 4G11A 4NS0A 4QJ5B 1DJYA 1A25A 2WXLA 3R7QA 2X38A 5T8IA 3RPBA 2V4LA 3F01A 4KZ0A 4FLHA 2Q3XA 1HE8A 1DJXA 2ISDA 3NSJA 2QZ5A 4L2YA 5KJ7E 4XE0A 4URKA 2K8MA 4OVUA 4XZ4A 3TL5A 2ZKMX 4PS3A 1E8XA 4HLEA 3QAQA 2JQZA 4EZJA 3APDA 4DNLA 1UOWA 3R7RA 4ANXA 2ENPA 1YRKA 3L54A 2CHWA 4WWPA 3TWYA 2CM5A 4AJWA 4FADA 4HVBA 5JHBA 2NCEA 4EZKA 4FULA 2WXHA 3N5AA 4TUUA 3ZIMA 2CHDA 4GB9A 4F93B 4L1LA 3ML9A 4AOFA 3QR0A 4BFRA 1W16A 2K45A 3ENEA 1E90A 3T8MA 3HHMA 4A55A 4PS7A 3MJWA 3PFQA 4ANWA 4LT7A 1E7VA 1BDYA 3S2AA 2KI6A 4F1SA 3B7YA 2WXMA 3NZUA 3L17A 1E7UA 2CHZA 3F05A 5H4ZA 2WXPA 4JPSA 3IBEA 4ICWA 3NZSA 2CJTA 4ANUA 5CCGE 2Q0ZX 1RSYA 4BGDA 4FJZA 2NQ3A 3LJ3A 3PYCA 3PRZA 3L13A 4KZCA 3APCA 4NPJA 4QJ4B 4KITB 4Y1SA 3HIZA 1BYNA 2A5UA 2WXNA 2YRBA 3L16A 2CJSA 3PS6A 2QZQA 3M7FB 3F04A 3L9BA 2WXJA 4TV3A 1BCIA 1TJXA 4TS6A 2WXQA 3DPDA 2K4AA 3CSFA 1E8WA 1TJMA 1WFMA 3ML8A 4GNKB 2B3RA 1DSYA 4F92B 1DQVA 3GPEA 2Z0UA 5G2NA 1GMIA 4FHKA 2ENJA 2LHAA 4WEEA 1DJIA 4J6IA 4XX5A 3RDJA 3PREA 4IQHA 4QJ3B 2RD0A 2WXFA 2DMHA 4MJJA 3HN8A 4L23A 2WXKA 3QK0A 3ZW3A 2FK9A 3JZYA 2N1TE 2D8KA 3QJZA 5EDSA 3QARA 4WWNA 2K3HA 1V27A 4WAFA 5H4YA 5CCHE 2DMGA 3FBKA 2Y3AA 3TJPA 1QATA 2WXRA 3CSTA 4ICXA 3QR1A 2WXGA 2CHXA 2WXIA 2YOAA 4DK5A 3L08A 1E8YA
chains in the Genus database with same CATH superfamily
1Q9KB 1UWFA 5AQ0A 4F7MA 4I13B 2Z4QB 2E8ZA 1BEYH 5F1NB 4RETB 1W0WB 4MXVE 2E7DA 4ETYA 4MQSB 5CD3B 3MNVB 2ZF9A 5FA4A 3UTSD 4DIXA 3CBKB 3JWNH 4L37A 5LVEA 3FDWA 5PCYA 3Q0HA 5IB5B 1A9BA 2X70A 5J9PA 4JM4H 1NCIA 3MLUH 4HGWB 1GJIA 1TJGH 1J9SA 3LN5B 3UTSE 2P48B 1A3LH 5EOCH 5IFJB 5C09E 3E6FA 1JZDC 1IM3A 3PY9A 4OFYD 4NBYB 4QHUA 5HGAB 3OAWA 4U4BA 4HBQA 2MCMA 1TEFA 3FQRB 3Q43A 4YDLC 3ZIYA 5I8KH 4GSRA 3G6AA 3V7AG 2EYTA 2YZ1A 1YMME 4OV5B 1ZWIA 3KYKL 4PJIA 4G6JL 4FG6C 2E7LA 1MCKA 3WNOA 1JHLL 3MLVL 1ZVSA 3CLEH 3F83A 4EZJA 4K5LA 3SJVA 3KWVA 5IQ7L 4X4XA 2W65A 4HGWA 2N7AA 4M9OA 3C8DA 2DQDH 1KPVA 1NCCH 1R3IL 5IF0B 4FXGB 3T0EC 4JO2H 3WV0A 4L8CB 2A73B 1XSOA 1AAJA 1C1EH 4ZFQA 4O02H 4BSVA 4ZZKA 1JXGA 1ZHBA 3RGVA 3DC0A 1XSKA 3PG2A 4TTDC 3TP4A 3M8OL 5D5ME 2B1AL 3UPRA 4OLYL 3R1GH 2CMRL 2ZCLH 4N0RA 1MRFH 3RUGB 4XOBA 4Y2DA 1BHGA 1CU4H 3DYOA 5D1ZA 3HJEA 1CXEA 4ZFOA 3EF4A 3BZDA 3OBAA 3X12B 5C6PB 4HWNA 4NIYE 3EFFA 1RQ5A 1ASQA 2YC1B 3ARGA 1TQVA 4GMSH 4C4BA 4WVRA 3K5SA 4FLRA 1X7QA 5IQ9B 4YHZH 4L29B 4JX0A 3BPLB 4MS6A 4RMSA 3UACA 4XC1H 1KTBA 2J44A 4RVBA 2KC0A 3GQFA 3SKNB 4KMLB 3U0WL 1YDPA 3QXAB 4FYTA 1UB6A 5FGSA 4E9RA 1RJZA 2OTWB 5HYQA 4MJID 3GJFB 3JTTA 4YLQT 4D0DA 4HD5A 4F5CA 1GCYA 2DB8A 3BKCL 3VRLF 3F2LA 4OZHF 3P0YH 4X98B 1PKQE 4P8QA 3UTTD 3QZNA 3L7FA 5ESVB 5IOPB 3QDME 2E4FA 1SMDA 2FD6L 1IU1A 1OARL 4PV1C 3WS6A 2Y25A 5CBEA 3SKOB 3MXVH 1C5BH 4UU9B 4LVEA 4PCKA 1QTPA 5KANG 4M43L 3SE6A 3ZDZF 4NZTL 3LN9A 5T5NF 1UZ8B 4JJ5B 3TZVB 2GK0A 1NCOA 3FTYA 1M7DB 4NQDE 4AM0A 5D9SA 2H2PD 3NGBC 4LKCA 3WUWG 1PEZA 4P2RD 1Y1DA 4L9LB 1NIEA 4H44C 4M93B 4E2OA 1H3WM 2AQTA 3L9RA 4UT7L 4RAUA 1QUPA 1LMIA 4W9KC 2G60L 5IK3B 3SDCB 1EAQA 3TNMB 4CBPA 1JWUA 2OYPA 1SYVB 2W0LA 3OB0K 2VLKB 2X4OB 3MTXA 5EU6B 3HNSL 1NPNA 4FQIL 2X6MA 3T3PE 2H2PC 1B0RA 3QUYA 4G7YH 2VDOL 2OCFD 2WOYA 2KUTA 3C9NB 4KK8C 1KBPA 4FQJL 4N0CC 3AJ7A 3LKPB 3QAQA 2FJHB 4JPKH 3APDA 5DMJB 3K71A 5I75B 3ARFA 2J88L 1UHVA 5C0RH 4EI0A 5GGVY 1PW3A 3IS0X 3CH1B 3WSQH 4D0BB 4S1DD 1N10A 2VKWA 3Q5YA 4HKXA 2VXQA 1SXCA 1F3RB 1T0NB 3NEXA 2OZ4L 1TOXA 1JWMB 3NIFB 3KPMB 1IBDA 5KVEE 3VFNA 4KXBA 3FFCA 2E56A 4WFFE 3BFWA 2OTUA 1EEZA 4RGMB 1A6VL 4G6FD 3RVXC 1NA8A 1YN7B 2JKIS 2P5EE 3V2AR 1A8JH 2X0WA 3CDZB 4KXAA 1HDMB 3QA3B 2FUQA 2AXHA 2XZCH 1SM3H 5HVWA 2XDHA 1DR9A 3BLPX 1KB5L 5GIRB 3W0WA 5JMOC 4OGXH 2NW2A 5D7LE 4UUJA 7PCYA 4L5FL 5AUMA 3LJ3A 3WJJC 2P8PB 4AUYA 4NRYB 3VD7A 2UZIL 3AUVA 4IIZA 1Q9OA 2A7BA 5EEYA 1Q38A 3AS0A 1KDJA 4D2NA 2P5WD 5EBMB 3NJFA 5F97E 4R83A 5ITFB 3J07A 3K7UA 3UO1L 3QEHA 3ZX1A 4HUVB 1OHQA 4DHLA 5FYKU 2X53A 4XVJL 4CKVX 1B3IA 1J87A 3BUYB 3HCVB 4ZFZB 3FYEB 1HX0A 3UBXA 1OGPA 4HK3N 3N06B 1U21A 3OGCB 1D5BA 1UATA 4P57B 3CZFB 3O8XC 1T1ZB 1CICC 5D2LA 2QV4A 5AZEL 4K2UH 5BVJB 3O4LB 4NQQA 1AKJD 1IC4L 1BG1A 1TKWA 2IPTH 3KCPB 3GTVA 1DLHB 1VB9A 4L4VE 5E2WH 3V5DA 1NDMA 3JTSA 1UEMA 1ZTMA 2Z8VC 3KPRB 3MJ9H 2GJ6E 2AQ3A 3AG4B 3LXBA 4UOQA 4D8PA 4N2GA 2MCAA 1PZUB 4WI4A 3X3FH 1SJXA 3TPUA 4HK3J 2OMVB 5M7QA 1J8KA 1HOCA 5KSAD 3Q7JA 4IRJB 1HWHB 4IU2B 1NOLA 2K70A 4W93A 2NY4D 3B5TA 3DX6A 1W2KT 2HVJB 5I6XC 4MMZC 5FUCE 2C9SA 3BKYH 5EOQL 4XXWC 4H25B 3KL3A 1CICA 3DXAE 4Z3HA 2Z1KA 3O3DB 4HV8A 1R33A 4A7SA 3S5LB 1A5FH 2ADJB 1U0QA 1SUHA 1ND0A 4GSDH 1TTRA 1U8IB 1GYUA 2FBJL 5GZNC 5GGQH 3TA3D 1JOIA 1DQKA 1SJEA 5KAQF 1MFEL 4JB9H 3NDYE 1AI1L 3EO0A 5T3ZL 1TETH 3FT2B 4K7PX 4O51B 3QR2A 2H6PB 1G43A 2R1YB 4N86A 4NP4H 3OQRA 3O2WH 4ZMZA 4EI5C 3ETBF 1KYUA 4D9RE 2ZNXA 1F2QA 2BNQE 4HU2A 2Q7NA 4QAWA 4NENB 5FWQA 1W72B 2DWDA 3CUPA 5IUSA 1PDKA 3VTTA 3WN5A 4K15A 3MRDA 4GQPH 2GSGA 1BF8A 1LO3H 1MFUA 5KYYA 1FJ1A 2B1HL 1A4KA 2HJFA 1HEZB 3WY1A 2VN3A 1NJ9B 1IVLA 4AQ1A 2Q3ZA 3LEXB 3RA7H 5JA8B 4UM8A 1IQWL 5C0AB 4Z7VA 2MRYA 5IQNA 1OZUA 4G7VL 3N43B 5IW1B 4Y89A 2NY7H 4FTVB 4Q6IA 3BZ4B 3LVTA 1NL0H 2WGXA 1QAWA 3PRZA 3BZEB 4JZJC 1BXAA 1GZHA 3B2PA 4X6CA 5DC2A 4JDEB 4PJAE 1ANUA 5D2NE 5E6ID 4K5NA 2I5YH 2CO4A 5IFHH 2MH4A 2OX5A 4NSKB 2XBDA 1PX8A 4MNQD 4UQ3B 3AG3B 4E9YA 7FABH 3BE1L 4P05A 3EH3B 4F57L 3D12B 3V10A 3IWUA 4AIEA 1PIFA 4HEPG 3PIQB 3TBYA 4KTDL 2NCMA 2WYZA 2AXFB 4JVUA 3TASA 2HJLA 2PO6C 4P23D 4YDZA 3OPZL 3H9HA 5ESQA 1BZEA 1IFHH 3TF7C 1GS7A 3ZZQA 5AAWC 1P7HL 2RMNA 2DQUH 2VOTA 4MB1A 4KPHH 3CSYA 3GXNA 3S8GB 1VKXB 2HN7A 1KWKA 1ASOA 4LSPL 2FBJH 5IV2A 3TT3H 3CLWA 3BDYL 3I50L 4N85A 5L7XH 3PHQA 5I73B 1NFKA 2P24B 5AVWB 1L5GB 3LKNA 1A02N 4DKEL 4XVTH 5IKCB 1L7TL 5IM7B 2X10A 3TJEL 1YQVL 5GGSB 5MEND 3LXAA 1KJ2A 4MAYD 4JNXA 1NLDH 2C9VA 2X4NA 4PPTA 3RIFK 5AG9A 2N1KA 2J4WH 2V17L 5J56B 3K8MA 1F58L 2ZWZA 5MI0B 1HQRB 4HS8H 4PR5B 5E6SB 4RQQA 1YEGH 1LLAA 2EYRB 4L4TD 1MI5A 5T1LD 2APXA 2DN7A 4UBDD 1N5AA 1LWHA 3HZYB 4BK4A 5J13C 4KZEL 5GGSA 3JWDL 2DBJA 1A6PA 4ZS6D 4A66A 5IKCA 1G0DA 2DI9A 2FWUA 1WBZB 4S2SA 4GYBA 1L5GA 2P24A 5EN2B 3P0GB 1JDAA 3NPSC 4G70B 2E9JA 4W9ZA 2K45A 4Y5XB 3CBRA 5E7FA 2ZONA 4JO2L 5GGTL 1BMZA 1W0YT 1HEHC 3ABKB 3WHXB 5SV4A 1TNMA 4I1NB 4XTRD 5DZJA 1U6AH 4BCZA 5ICYB 4V1DA 3IPEA 2WINA 2NY4C 2OA9A 2VJXA 3N1GC 3OVUB 3FRPB 1A9EA 1AZZC 2B1AH 2GAZA 3CFCH 2W92A 1E7UA 4WW2B 4FABL 5I71C 4DKAA 2HMID 4FZ8L 3UDWA 1K3IA 5LCVH 1ZK5A 3LYRA 2DYPA 3PHSA 4KX7A 4P3CL 1T1YA 2ZG2A 5L6YH 4QKTA 1RZGB 2IH1A 1JG9A 2J25A 2F54B 2V37A 1NUFA 1TO4A 1MAJA 3DECA 2OS7A 2DQDL 5TK2A 5I5MA 4Y4FD 4XOCA 1A7PH 4ZW7A 1X5LA 3H53A 3B2MA 4OZGB 5T3XD 4AYFA 1QRKA 4IRZA 4M61B 3DIVA 4X4YB 4GNKB 2KQNA 2ZOLB 3BUBA 1HJBC 4TQ8A 2OSXA 2XU9A 3F7YA 3VMNA 2FO1A 2RHEA 1X5KA 5JYMA 3HC0A 4PWHA 2PCPB 5J12C 3FS9A 1AZNA 1UXSB 2DL9A 4Q6IB 4HOZA 3P69A 1NIDA 5BXFA 1YEEH 3E6HB 4BFFA 3BGMB 1Z6JT 5B22A 5CCHE 4D0CA 4DH2A 1RZKC 2O1AA 3PWVB 5AEAA 4WRLA 3REVA 2F8XC 3LEXA 4RGMC 5HHQB 5DC0A 1I8MB 4XPFH 1AGDB 3UTTA 1FFOA 4L3AA 4P9HC 3T0VA 1RPKA 1HEZA 2HRHA 3LH9A 5KOVC 3S48A 4HQQH 4FKHA 3HHSA 3IJEB 3MLSL 2ADIA 1SLUA 4WHTB 2BNQB 3F12A 1BIIA 2R0WH 3UH8A 1LWRA 2OI9C 3FO2A 3AWEA 4JS7A 1FWXA 1TVHA 4OF5A 3U4EB 4MQ7B 1DQML 3LMJH 5E70A 3DI3B 1VADA 3LDBC 4KGJA 4Y4KD 5FS5A 5IVXA 4PJHF 4F91B 2LAGB 4WJKB 1KGCD 4OLEA 1KF9B 2X2UA 2IANA 4P9MH 1HL5A 5FO2A 4ETQB 4TPRL 3VG9B 5ID0B 2IDSA 4HH8A 4K5OA 3VJ6B 1NGXB 1T03L 1MCFA 1XIWD 1ZDQA 1WIOA 3CZNA 4PLJD 4WJ5B 4M29A 4DGUA 3NJNA 2EDFA 3G5VB 4G42A 4BKSC 1J9RA 4LSDA 4QXUH 4PBWD 3RG1C 4WF7A 2WB1A 3DX6B 2EINB 2VB5A 2R1XA 4KO7A 3LEYL 2C3GA 2OMTA 3O9WB 5IB4A 5LCVA 3V5HA 3GSXA 3GLZA 3LRKA 1OM9A 4WEUD 1TSRA 5JOPE 4LSQL 3FF7A 5C0FB 4TLSA 1HI6B 4M48H 3V6BR 2I9LA 3VXPB 4P5TD 1BZQK 2IGTA 3CFQA 4ZOCA 5KTEH 1G1CA 5MEOB 4DQOL 2MOVA 4WI3A 1YPZB 3MR9B 3PQYE 5SX5K 4X7EC 2D31A 4GSQA 1S7XA 3RILA 1BM3L 3B9KB 6FABH 5HP5A 4CSTA 4Z95L 1S7WA 1XH3B 4YX2L 4HWZB 2AQ2A 3FB7A 2OK0L 4XPFL 4M5ZL 1QQDA 4AGLA 1M2OA 2I69A 3N1FC 5I17B 5I1CH 4HX1A 2XSKA 3VX0A 4AQEB 3INOA 5LQBL 2QADB 5EBLA 2XWRA 5F6HJ 4PJEA 5ID1B 4GG6A 2YGNA 2VW6A 4UQ2A 2IV8A 2RACA 4V2CB 2YD2A 3KLKA 5DRXA 3UABA 4UUJB 5GHWH 4P5RA 1I3RB 4JO1H 3W0WB 4UT7H 3QA3A 2WWKT 3AXIA 1N3NB 4U6YA 3IFLH 2ODHA 3TO2B 2JWYA 1RV6X 3HTLX 2E59A 4YDKH 1CF8H 1YECH 2VISA 3TCTA 1EHLL 4I0PB 5D7JD 2DJUA 4JG0L 4DOHE 1ET7A 1H9DA 2TRHA 3P2BA 1MWAL 3Q48A 5I74C 1WICA 3ESVF 5I1DA 1CFQB 2DEXX 3FPXA 3QIWA 4HKXB 3PGDA 4YNYA 5CZRA 1OAQL 3FUNA 5DUPL 1GTFA 3WN5C 1AGEA 2O5ZL 4QRTA 3PWJA 2BRQA 2BOLA 1NFIA 2EIDA 1OW0A 5DQ9B 4HOMA 1GZHC 4NCC2 3RKDC 5HI4C 5L9DH 4CRPA 3QIBB 3CVHB 2YIHA 3NMEA 4RAHA 2DLFL 3MV8E 4LQFL 1JMXA 4PJDE 2R83A 5AZ2H 1WITA 3IMVA 4DKTA 2FEJA 3DSNA 2UV3A 2APWA 3ZGIA 5I28A 2ISDA 1N12A 4B9IA 1GIGL 1VFMA 3MFFB 2O30A 2WWOA 3BEWB 1H6FA 3SDXF 1JERA 5C97A 3RWDB 3RGHA 4AT6B 2CNYA 1CFNB 2PO6A 4KKAD 4Y9FA 3BW9A 4CILA 3LRLA 3V4UL 4MJ5A 2ENYA 1E5UI 2YA1A 1Q72H 2E7BA 4HWUA 3P4LA 2R4RH 5HJBA 3KYMA 3L2LA 4EZKA 4P4KD 5B7MA 3EDKA 1WZ1L 2ADGA 2ORBL 4HS6A 5DJAA 3QEQE 1F11A 2QV2A 1QOKA 2GK0B 4OCRH 4AM0B 1H3VA 1MCSA 1WT5A 3S34L 1ONQB 3WL9A 4RLDA 3ZHDA 3ZN6A 1YJDL 1NBYB 3QUHA 1I7ZB 1HYSC 1OAYH 2ZX6A 5FO7A 4XCNA 3IJYB 5EDXA 1KJVB 1GIGH 3LNEA 5D55A 5E1GA 1R5WB 2JLPA 3G5YA 1MWAB 1TT6A 4JJHA 3K46A 1FL5B 2IBZY 4XNZB 2N0KA 3FOMA 4R4NC 1JDDA 4QY8A 5GRVK 5GISL 4P2YA 1JNNH 5JNYA 1XCQB 4XWGL 3VRLE 4PJ8C 1XGYL 4Y16D 2QGCA 3B7UX 1F4AA 1U3YA 5C07D 2ZOKA 3W9EB 3VU2A 1CLYL 3GT6A 43C9A 3STZA 1KYOK 4PJHE 4PRHB 3ARGB 1UA6H 1FZKB 4M00A 1JD9A 4WK4B 3SDDD 3RDJA 1OE3A 4AVJA 4WHCA 5DFTA 5E9DD 3J27A 2PYFB 2CE6A 3JV0A 3P2TA 1R47A 2H26A 1WWWX 2ALWA 2EDQA 3D39D 1ZCRA 3I9GL 3RTQB 3RYMA 5DF0A 2TSBA 4Q9QH 1WFNA 3KPOB 2WKLA 3IXTB 2KL6A 4ZFOL 2VDOB 4CVZB 4K8RD 5E8DL 1P4BL 2ZZUT 4D3CH 3RWIA 2A9NL 1A21A 4X9IA 3HG1D 5DD5H 1JZ7A 4YPJA 3LHPL 4WWOA 4YHOL 3Q6FB 2FT7A 1DVFA 5F8QC 5AAMA 4GIOA 4G6KH 4MCYB 1Z3RA 3DOHA 3HB3D 2C4FU 4JG1L 3NTCH 1E43A 3ARBB 3EUUA 4BYHA 4M03A 1KYAA 3VXMB 2V2XA 3QIUD 2UY6B 2DQGL 1VCAA 3LTVA 1OSZB 2R7EA 3HRZA 1UOKA 2GI0A 2ZYIA 4OLUH 4JM2D 2KYIA 4NNYA 4CN1A 4Q6IC 1L7IL 3SCMA 4PRIA 1DQDH 3MROB 5E1IA 1PAZA 1WGOA 2ENQA 5J06A 3HI1B 3X14B 3UBGA 3LZOA 1CIDA 1KENH 4G1EB 1MG2C 2EYTB 3V6OA 3O45A 2BSED 1TMQA 1VZHA 4MGXA 4IBVA 2VLME 4MSWB 4LLQA 1ED3B 4P3CH 5TE4L 2XWXA 5AZUA 1P7QD 1UVQA 2X4SA 1RL1A 1QHPA 4JMXA 3FCSB 4O00A 3C60A 4XP5L 4YUEL 1KYOJ 5K9JL 1GGCH 4OGQC 4PGCB 3T2PA 1A9BB 1PX4A 5J9PB 4YHMH 2Q20A 3I50H 1L9SA 2WXHA 1T0OA 3SPGA 3BUPA 4U1LB 2ZIDA 2R2HA 3VU1A 1W0WA 4PJAB 3OLDA 2KT6A 1BSIA 3Q6GL 4WWKD 2P7TA 5KS9A 4L1DA 1AGFA 5FCUH 4ZSOA 5CJXA 3HE7B 2DLTA 3GKWL 5JXEC 1OD7A 3O4OC 3T0XA 2E7LC 5EU3B 2DW5A 1ERNA 1TQBB 4LLYA 5AYUH 4KTEH 2AABH 2J1XA 4K7PH 5KVGE 4LASL 1IRAY 4L4VA 1E40A 3H85A 2A2QT 2ZXEB 3WDHA 1F4YH 4QT5A 1IGJA 4A63A 3Q2VA 5FYJE 3QJVB 1GGCL 3JVGA 1T5WA 3DKHA 4XMLL 3WXWH 1JPTH 1NANH 1RIVH 1CFTB 2GUOB 3LZPA 4JFTA 4ONGH 2PCFB 1KLFA 1D5XA 3ZJAA 3DUHA 4WI7A 3CFKA 3QHTC 1U8PB 4E9TA 1FZJB 1SBSL 3LMJL 2FHCA 2WZAA 4DGVL 4JO3H 2B3RA 4ODSH 5KVFL 3T04D 3QRGL 5FYLD 2BWDA 1LP9B 3WMSA 4C56A 5IHHA 3RL2B 1TG8A 3N04A 5FM4A 1BZ7A 3CHRA 5DR5H 3EHBC 2CKNA 4Y7OC 4FQLH 1HCZA 3B3IB 4KI1A 2YXMA 4L8SB 4ONHA 4WFGD 1PKQB 4EOWL 5DYOB 5KSVB 1A4JA 3QZOA 4YXKH 2QGBA 5A6IA 4KFZC 1Q0YH 4ELKB 2AJXL 5IG7B 2Q7YA 1DBAL 1H8LA 2H8PA 3QYNA 1EO5A 1GHFL 3KBFA 3DI2B 4B60A 1DVQA 3QFJB 5LGKA 5L88H 2XKSA 1MCCA 3ARXA 3L6FA 2ZP0T 4EI5D 4KJQD 1PGRB 3VTMA 5H35A 4MS8D 3NIFE 4PJ8A 3PWUB 5I23A 2JJSC 3GSRB 3CXHJ 2Y3NA 2JJTC 2UZPA 2I7SA 4MAUH 4PCSA 5A2IH 5AD0B 5FECA 2BHYA 4TLUA 4GRWE 4YE0A 3TA3A 1OGAB 4FOMA 1N9PA 1QZ1A 5LKNA 1MCHA 1RUKL 1CDUA 5E2UH 2YEZB 3O11B 4FFYA 1Y0LB 1ZLVH 3QQ4B 1TENA 1X6NA 2OMNA 4LKXB 4HIXH 1BVNT 5TDPB 1IV8A 1UD8A 3BIAX 1N59B 3NSXA 4EN3D 2K8MA 2Z64C 3SBWA 3AU0A 3HR5A 1YJDC 5JW5A 3ZRSA 1T7ZA 4Y1AD 3NG5A 1QI5A 3NQKA 1GS8A 4JEGB 4LLDA 2D4DA 3G6DH 2Z8SA 3RWEA 2BNRA 3CJJA 4GP5B 2ZXQA 4NHUB 1FGNL 1MY7A 4W9GC 2AVFA 4GQQA 3RWHA 4F20A 3ARFD 3B3BA 5D7IB 1C16B 2E9WA 3GK8H 3ASNB 3GJEA 3C6SB 4FTDA 1LO4H 5BS0B 2MFNA 2X89A 2Z7UA 3AM8C 3ARGD 2MTAA 3ORJA 5LN8A 1R3LB 4N28A 4UTCA 3ZKSD 3FL7A 2MOGA 1OOWA 3EOAB 3MAWA 2WOBA 1ORQA 4KDTA 2WYHA 3IE9A 7PAZA 2VSMB 2CSPA 4FNPA 4YSTA 1KEML 1F4XL 2EVGA 3UZVB 1MAML 1J8HD 5DD1H 3IDXL 3VWKB 1ZMYA 1R0AL 1MEXH 4N24A 3QXTA 3T6WA 4A6YA 4ZI8A 1FO0B 1KGXA 1AQMA 4QF1A 4QRSB 1DUZA 1WJ3A 2JIXA 4GMTL 1M2VB 4ZT1A 3RAJL 2VL5B 3T0EA 3DX4A 3HB3B 4PJFF 1DO6A 2WTRA 2XG4B 5E94A 3U4BL 4U1HA 1DQVA 4ZTPL 1SGKA 1U3HB 3DETD 2FQDA 5IWLA 4EKJA 2DLFH 4Q2ZA 1R3JA 4J3OH 1P84K 1KTRL 4GG8A 5K69A 1EPFA 4M8RA 4YXLH 3MRHB 2VW7A 2ZYHA 5EBGA 1O9ZA 4ZFGH 5DHVA 3T8XB 2B2XL 4C56D 2DIEA 1G7PA 4YSUA 1P6FA 5IZ7A 5CINL 1GXEA 4FFWD 2R69L 3HKZA 4XXCA 4O9HL 1O6TA 1I1YB 2BP8A 3RRQA 4CU7A 3KLHD 3HLKA 4M8QB 4XPBL 1JPGB 5FGRA 3FT4B 3QUZC 4QRRB 3INUH 1PG7X 1G7JA 2XBTA 2R2CA 1MHEB 2JV6A 5KBDA 1LO3L 3HE6D 4MB5A 3L9EA 1EDYA 1LE5A 3CCHA 4LAJH 3MLTA 2YBRB 2D73A 1WBXA 4WKZA 1FIEA 3K72B 3M17A 4IGBD 2CO7A 2I26N 1ZAGA 1KEGH 1A0QH 3RBGA 1OAYL 2NT0A 1SEQH 4YHNA 2XCMC 3BZFB 3UAFA 4KKBD 5A7BA 5FV1L 1IO4C 1RZIA 3CVDA 4GI9A 2VLJD 2VN7A 3HC3H 2YMTA 1CDBA 1N8ZB 3AU1A 5J5EA 2OKMA 3HE7C 4P2OC 1GGIH 4HKZB 4AEIL 3HLAA 3QUXB 2H3KA 4IU3B 2AV7A 3ARTA 3BPLC 1EBPA 3DHPA 1L9OA 2EIEA 4TUUA 4FRWA 5FHAH 4KTGA 1TZGH 3G5XB 2JJSA 4I9WE 2JQMA 2XA8L 8FABB 1UB5A 2XWEA 3LRSB 1TFPA 2A77L 4OUUA 2BMKB 3EOBB 3RKDD 1LQBC 2DYRB 3RVUC 3V0FA 1CDYA 5F96H 5AL0A 4S1RL 1II4E 1TNNA 3HRZC 3VYPA 4F37K 1CMOA 4UDUB 4N1EA 5DCCA 5FLVA 3MBEA 4HJ1A 3C6LD 3S97C 3B2VL 1JGEA 1XGUB 1ZIBA 2VMJA 2VR5A 3V4VH 5A16B 1JZ8A 3UAJD 2IWGA 5DDHB 4H1LH 3VD0A 5JQHC 3PU7A 4K73A 3ZSSA 4JFXB 2HB0A 1A1OA 3V0GA 1J9CT 3MUGA 1TEYA 3UAJA 5GGUB 5I0ZA 1NTDA 3OAZH 5J6HA 5ALBH 1A14L 2IAMC 5FGCB 4CC0A 4PG2A 1E28B 3JWNC 4Q6KA 4PJDF 1FVCA 3F6LA 1ECYA 4N8VA 4U6VH 4U2YA 1BD2B 4BZ1A 1MVUB 2C8NA 4MS8C 2O5ZH 4KROB 1RHHA 4N2KA 3MOAL 5LLIC 1V27A 4OI9A 1BFTA 5E03A 3G5ZA 1MFVA 3CN4A 5A2KH 1KIRA 5JXAH 1M05A 1E28A 3QORD 4LSRL 3V8OA 5L2KE 4L3CB 4K23L 2WXOA 1EAPB 4QTIL 2BS9A 4U1SA 1NBZA 3V55A 5IQ7H 4KBPA 1JNNL 3MUGB 1ZLSH 3VRIA 3MLPA 2P5WE 3BUTA 3QI9D 4AIZA 4D9QD 1IAKB 1XAUA 4NHCH 2IPKB 3GJFK 1WLHA 3ROOB 3SHSA 3T2LA 1H6EA 5FWRA 1RUAL 1XGUA 5ABAA 4QRFA 3F7QA 5IMLB 3CU7A 2HP4A 5F72S 2DM2A 2R2EB 1IQDA 5DI8B 5SX5H 4F7TA 3FQUA 3AREB 4H8WC 4HF5H 4JQVA 3RWCB 3RY5A 5IP4A 2G2RA 2JVUA 3BH8A 2YD0A 1THAA 5F9OH 1S2EA 3FZUC 3F58H 3ARQA 3HAEA 4K8RH 5KAQG 4EE2A 1HYRC 4APQA 5CP7A 1UTDA 2NDFA 2FZ3B 1O75A 3CX5K 3VDCA 1FNAA 1H9VA 2VABB 2X1PA 4OZFB 4R7DA 4L1SA 2DMCA 3CDGA 1QLEB 2W0FA 5CJQL 4M5TA 4QEGA 3WMQA 2WO2B 1ADWA 4W9FC 1U8JA 3UTSA 5I1AB 2DTMH 2XZQL 1QTSA 2OZ4H 4X99A 3ML9A 5F44A 3LX9A 5JHLH 4DGVH 3KNBA 4PGBA 4HBCH 2YFOA 5TTRA 1KJMA 2HLAA 4GP8B 5CHNA 3QZWA 4W70A 4HF5L 3VSVA 4GRLA 3EJYC 1RZIB 5KSUB 4WNQA 4U7MA 2PPFA 1QACA 3OKYA 1PY9A 2WYIA 3TO4A 2PMZA 3A4DA 2CO7B 4KNQA 3JYCA 3K72A 2PXYA 2VO5A 2IH9A 2ZNWA 3M17B 4G7QB 1F1AA 4J2XA 3RZCB 1JHLH 1IE4A 3MXVL 5F89B 4K3JL 3VD9A 3V0WH 1NDGB 2VXTH 3HOGA 4H8WL 2Z31B 3VM5A 4MA7L 4UM9A 3MODL 4KZEH 1BYNA 3BT0A 3EH4B 1NGYA 4KRLB 4BGLA 2AZAA 2DYPD 4HWBH 4I3RL 4OBSA 2RJMA 3H2PA 1M7XA 5DRZB 1U92B 5D5MA 1Q0XL 1XZ0A 2G3MA 1RK0B 2YSTA 5KW9L 5TJWK 4P5KA 3TF4A 1K4CB 2NY5L 1ZT1A 4P06A 3CX5J 1DZ0A 1YHPA 4KRPC 4QJ3B 4BFIB 1MCWW 3FU0A 4YAQA 4AC4A 3EFOA 4P9ML 5BQ7B 5CR1A 1R3JB 3CFIC 3EHBD 3VM7A 1ODAA 3B4NA 3MA7B 4Z7VE 3FUEA 1YN6B 1TQCB 4L9DA 1NCBL 3F7KA 1JI2A 3GXMA 1KENL 3OKOB 4UM9B 4XGZA 2VL5A 5T1LA 3MRIB 3B6SA 3NJIA 3WJMA 3A6CH 3KHOA 4S1QH 4ES8A 3EJUA 5KZCD 1KBWA 4HQQL 1AG6A 1WHOA 3C6LC 3HNVH 3AT9A 3VGEA 1X4XA 2NXZB 4H20L 2PPDA 4LSQH 4FJYA 4P48A 1NGZB 2OXGA 2XQ0A 4OZFG 3W38A 3HMXA 4I5BA 2QBWA 3PWPD 3J8F7 3GEFA 3TWCL 4IOSA 1AGBA 2Y0SA 4XPTL 3ETSA 4PUBL 3FUFA 3QPQC 3K5RA 1E6OL 4PJ9C 1DBML 1RZ7L 3KJ6L 5HJDA 2V5RA 1UQSA 2GEEA 5JIQA 2XXFA 3K1DA 5DHMC 1PMYA 1IAIM 2QKIC 4Y4KC 3O3BB 3RWHB 5LJYH 3BFQG 4V1DE 1WWCA 5E2VL 1AANA 4G5AA 5AB0A 2YK1H 2PTTA 2QADC 4AMKL 4Z3TA 5SWQB 3SZ6A 1HQ4B 4V1DD 1AE6H 5HHPA 2BCKA 2J5WA 1EIBA 4PJDA 2AI0H 1I1FB 3ALXA 3U0TB 4HXBH 4PJ5A 1KCUL 2QFPA 2X87A 3MRGB 4LIQH 1H15B 2A6IA 3P73B 4CMHB 1ZPLA 3EYSH 4U1IB 3CZGA 4TOYL 1T22B 3ISRA 1HWGB 1J05A 3I6KA 4NC1C 3LKRA 5IMLA 1B2YA 4OM1L 3PV6B 3GRGA 1KUMA 2CHZA 3D85D 2IPKA 4KROD 5CLXA 3WTVA 4JPSA 4OD3L 2BVPA 1GVIA 2CUIA 4YK4B 1LO5A 4KTYA 2UX6A 5AVXB 3BN9C 4J27A 4YHLH 3VRIB 4FE9A 1JZ2A 1JCKA 2JJTA 1NBZB 1I9EA 4BSWA 2O61B 3FT3B 3K91A 5BW7A 1U41A 1IILE 4FNTA 3ISWA 2AJXH 2QQLH 3C08L 4O58H 5H35B 1MCDA 2VC2L 4H8HA 2H47C 5JLZA 3O9WD 4HIEA 3LKQB 1Z5HA 3GM0A 3I9PA 3TJHC 3TVMD 4Y5YA 2F7IA 3N0PB 4OF3A 4AK2A 4YDVA 4AVKA 7CGTA 4Q6YA 2NXYB 2Q7YB 3X1FA 2NY6D 5D7KE 1USQA 1WP6A 1JGVL 2BWIA 3KDMA 1M3IA 4K23H 4R3SA 1LWJA 2GT9B 4K3EH 3GS0A 3UADA 4FQ1H 4ZTPH 3EJJX 3ZTCC 2WXKA 3IF1B 3FB8A 4G9DA 4DZBA 2XIDA 1NBQA 4LHQB 4B9PA 2BY1A 4M7KH 3QUMH 3D4GA 4CN6A 2NY1C 3DTXB 3D25B 3NQIA 5GRUL 1HSAB 2WQRA 4HAGA 3KLAA 4ODBD 1KEMH 1MQKL 4U6TA 3IAQA 3IJHA 4J7RA 3OXRA 3OZ9L 3PHOB 4P2OA 5HJ3A 3DROA 3RVXD 3HS9A 1HNFA 3VB9A 5EG6C 5DVPA 5DMKB 3VFMB 2VITB 1UXMA 2XT1B 3SE3C 1LO0L 4JFQA 3HG4A 1CS6A 1RUMH 5DJYA 4P59L 1JRHI 4PGDA 1WAEA 3AAZB 3SGEH 2VCOA 3KBHE 1BVKA 5FW6A 2XA8H 4J3OC 3QCUL 5F9JB 2HRGA 3C2AH 3GI8L 2VXQH 2P80A 3GHBH 3MV9A 3P77A 4R5XA 5HGHA 3NCWA 1EO8H 5IEHA 4Z7WA 5D6CA 2JELL 1IQWH 2X38A 4HKJB 5KSAA 1UD4A 3D85A 4HUXA 3GHEH 4R0LC 4Z0BL 1DLFH 2HFGH 5KBPA 5JPNA 4GUPB 3FCUB 5F7DA 4PJAA 3GSUB 3MCLL 4PRBB 3MRJB 5DWUH 1HZKA 3CV5A 1ZVNA 4PJ7F 3RPKA 5D93C 1D6VH 1MHHA 3HI5L 1OSPL 1ILSA 2NCEA 4UOJA 2Y2WA 3O2WL 1TSHA 1KGIA 3C60B 4XHQA 4N6RB 5B39A 1QR1A 2ZUWA 1UACL 4W4NA 5MEPB 5SX4H 4FHBD 3O6MH 2X4QA 3CVIL 2V5SA 1X4ZA 1PG7H 3VQ2C 3QIBD 3Q5OA 3VFOA 1Z7JA 5GRXG 1M7IB 3U1SH 4ZUTA 3VFTB 5MERA 1I4FB 1BYPA 2FSDA 5CSZB 2F8IA 2X4PB 2OR9H 3UYRL 2WNWA 4PJ5D 2FJFB 3BMVA 4X2UA 4PN6A 1DUYB 1T6BX 1TU2A 1PYWA 3FQTA 3GZQA 4JFDB 5B8CB 4G8EA 3A24A 2BSSB 2D3VA 4UILH 3WGVB 1D5IH 3BVUA 3IK2A 4PBVC 4WFEE 5D7IE 2IH3B 2ITCB 2E7MA 3AXLA 2Y69B 4LSPH 4HCRH 4NP4L 4YO0A 4XVSH 3MRHA 1B9KA 3GMLB 5JOPD 4NHCL 4DKFH 1AHWA 2NX5D 5KZCB 2D03H 3FTZA 4YDMA 2IAMD 1E2VA 4NPYA 2MQ0A 1CQKA 1YMHA 3SYPA 1MNNA 4NFCA 3IU3B 3GTTA 1EANA 2KDYA 2EKSA 4G80A 2RA1A 3O41B 5E94B 3KWWB 2XV3A 4RFNC 2AJUL 2GPZA 1NEUA 3IRZA 4NM4H 3P4NA 2EDKA 2NY7L 3DPBA 4ELMF 4LVNB 4J28A 2ZT9C 1P9MA 4HFWA 1HOEA 1HFUA 4HJJL 4Y9CA 4ZD3H 4OKVB 5L4IA 4LQ1A 4DN3L 2GC4C 4LVOC 5F3BB 5INDB 1WAPA 1WIPA 2F19H 1ZLUK 1ZE3C 4QD2E 2BFGA 4YHIB 5AYTA 3KJ4C 1AVAA 4PG9B 4MZ3A 4E41E 2MTPA 2BSSA 4ZK8A 1HWWA 5B8CA 4WO0A 4EN3A 4H2CA 3OB8A 1BX2B 3L3HA 3P11L 1E42A 3Q8FA 4KI5D 2AK1H 4MDJA 1DBAH 4UB0H 4GQ9L 5AOKA 4H88L 3TVMC 1XGTA 2Y1AA 3U6RA 3ATBA 2YPLB 4ELMA 1DQDL 2DIAA 4XBGB 4M8VA 4DCQB 3QEGH 4MMZA 2JCCF 3TV8A 4MXQD 1NLDL 4ODVL 5D1QA 4UAOB 2C3VB 5I30H 4QYOA 3S8FB 5MEPA 1ZHNA 4A6YH 5E4EC 4HC1H 1BIHA 4CDHA 1J8RA 1J11A 4ZMXA 1OF0A 4LLUB 1Y1UA 5CBAA 2P9RA 2YARA 2QMKA 3UTQB 4RMQA 1QD0A 1MHHB 1C5CH 1XDTT 4LKXA 2CGRL 1P84J 1R19A 3O3AA 3MRJA 4KXCA 3VW3L 2GCYA 3RWDA 2Y6SD 4FXKB 4WU7B 5I6NA 1D5ZA 1MFBL 4LSUL 3QNYA 2QHRL 4OZGF 7TAAA 2AJ3B 1G4MA 3KS0H 1Q72L 3DUUA 2YSSA 4ZFFB 1LE9A 3O6LL 4V2BA 3MV8A 5DT1H 5HGHB 3C08H 4WU5A 4IIQB 2YKKA 5IHZA 3EGXA 1MJ8H 1W8OA 5F9JA 3CSBA 3GBNH 4KVCH 5KUKA 4YL4A 1BVKB 1PZAA 5CJOH 1T3FB 4GAGH 2WZ0A 2WLYA 2CZNA 1DBBH 1LDPH 4AK1A 4KU1A 4OZ4A 3IMWA 3WIAA 5HTSA 2WXJA 2D2OA 3QJTB 5F7HA 1AQDB 2D3LA 3IPFA 4LEOB 5DYOA 1J0YA 4APQC 3AGWA 2IH8A 3D0VA 4OQTL 1JJUA 1NC4D 3CC5B 1M42A 2VZTA 4X6FA 4C8XA 5L4MA 2A9CA 5DRNB 5BRPA 2H1PL 1XGYH 1NGQH 4Y2DC 3GSNA 3IF1A 3BX7C 3H8NA 4PY8J 2D03L 3EJPA 5DMGC 1L6ZA 1KLFB 5D1XE 1MF2H 1KGUA 3WIHL 2GUOA 1LEGA 2X4UB 1U36A 2XA3A 4OZ4B 2MPVA 5GZOA 4RX4A 2HT3D 5I6XB 2MKWA 1ZHLB 1P7QA 5C0BB 3W0WE 5D1XD 1V3JA 2FNBA 2NQDA 1XWVA 5IVNA 2VXQL 3P9WB 1D7FA 4CC4C 5EZLA 4LDCA 3H42L 1A6WH 2VAAA 5I19L 4UT9H 3SYQA 2IFFH 3UGUA 4F9LC 1DJZA 3MPCA 1K6QH 3ARRA 3MV7E 4O4YH 3RDTB 8PAZA 4U1MB 2QGDA 4TSBL 3WLBB 3TH4T 1U95A 2JCWA 3PV6A 4FQLL 5I5JA 2GCYB 4W68A 5K9KA 2IWEA 4W9IC 4LDOB 5AW1B 3PNRB 4UIKL 4WNSA 3TOPA 4K4KA 1DHKA 3VXPA 3UTQA 1YEHH 2F5BL 4G7YL 1BVLA 1JV2B 5DFVC 4PJ5B 2P5PA 3IMTA 4CU8A 1CN4A 5CKAA 5DVMA 4BIKA 3SPVA 5HD8D 3C8KB 4DAGL 2BCKB 4IKIA 4H4NA 4LLQB 4AKPA 5IFAH 3IEAA 3ZDXB 4OLVH 4X4ME 1F4YL 3MRFB 3HUJA 1TCRA 2GYSA 4KKRA 4GG6E 1FZMA 3UO8B 1CU4L 1T5KA 4NNXA 3ULVD 1AZUA 3MUUA 3O4LD 2NNCA 5DURD 2RH0A 6PAZA 4FI7A 3SCMB 1OGAD 3T1WA 4XCCL 1FBIL 1KBBA 3L2MA 3P3RA 4JJOA 1KBKA 4PJAF 3CSPA 4UQDA 5D7JA 3UZEC 5FKAA 5I6LA 1QBBA 4NXKA 2H9GB 2HKFH 3AC0A 2VNCA 5HI3C 3NYKA 5AALA 1MFBH 3H6JA 1SMOA 2HSIA 2E4TA 4JRXB 4QXGH 2OXGB 2NX5A 2R2BA 3E1F1 5KVFE 5GXBB 3HFFA 4NXSA 1JWSB 4MNGB 2J56A 2P45B 3QG6B 4XTRC 5LXGH 4KFMA 2IOIA 2P46B 1S7SB 3WJLC 3NJLA 1SXBA 3FHEA 3IDUA 3C6EA 4Y19B 5EOTA 1NOFA 3P4MA 2EE9A 2V5YA 3TURA 1E27A 1OM3H 4IW4C 1EEUA 4D7BA 2OXHB 4WSKA 5DJ2A 3QHZL 1ZA3B 3P4MB 1YN6A 4P2QB 5DS2A 5DEFB 3RPIA 4Q9RH 1CL7H 3IPBA 4P5TC 1FZKA 3IMSA 3TZVC 5LGJA 1AIFB 1XZWA 2ZF8A 2K3HA 5DJZB 4IJTA 2YPVA 3B2XA 2AC0A 2MPAH 1H5BC 3QW9A 5BO1L 5K59F 1JZ4A 3BQUD 5B38A 4X42A 3CQQA 4NKMA 2Y7MA 1EO7A 4E9QA 4KI5C 3QORC 4N90E 3KWUA 5E1HB 3NACH 1QG3A 4M3KB 3I9AA 4XPHL 4Q58C 1OM3L 4NNXB 4AYMC 5AENA 2H0PA 3T3ME 3JTBA 4XOEA 5BVPL 1NCGA 3HFMH 1B6DA 2EIKB 2VLLB 2WHVA 2A0LD 2PCXA 3ESMA 4K94H 3WO4B 3Q06A 2WCGA 5DJAB 2AP2A 1A25A 4Y2DD 2CBMA 2FEEI 5F7FA 1X3DA 2N01B 1LJMA 5HHOA 1F4WH 2ROYA 3BHBB 1I75A 4H40A 3WKYA 1KCVL 4HLZH 3O0LA 1EEYB 1OV8A 1U2YA 2LOEA 2W0KA 4JG0H 4NKQB 1NCCL 2QVKA 4ZNEA 3QIWD 3BD3A 1YUKB 2R56L 1Z9LA 2J1KA 3CFBA 4HISA 1A3LL 4KNTA 2Y36L 2BNRE 2ARJQ 3IXAB 4HUXB 3VVWA 1AO7D 5E8EA 3WLBA 1YA5A 2P8LA 4JW3A 3BI9X 1XR8B 2ICWJ 1UM4L 1G94A 2GY7B 3CDGB 3SPCA 5GGRY 1HHGA 3K6NA 1IT9L 3P77B 5FYJU 2Q10A 2V7HA 4GAGL 5IMOA 5IT2H 1YYMH 1IE5A 2ID5A 5TE4H 1KCRL 3W39A 1KIUB 4F1SA 2I24N 1YJDH 1E4KA 1MCOH 4YR6A 2WXPA 1IFRA 2OZ4A 2D7PA 4WQOA 5DI8A 3V9FA 4F7TB 4OCXL 2C9QA 4GXUN 4Y0GA 4BGDA 4M5YH 1N18A 5E99H 1LEIB 2ZX7A 1C7TA 3KPNB 3POHA 5IUCA 3DOSB 2BVTA 3PHOA 4N2LA 1J1OH 1F00I 4P2OB 4XPGH 1QKZH 4K9EL 3TO2A 4XPAH 4AC2A 2JE8A 1TJXA 2OV0A 4I4WB 4OD3H 1BVOA 3NESA 1EAPA 2W81C 4LO9A 5DO2D 4G9DB 3DOSA 3SDDC 4DZBB 3TJEH 5ABDE 4S11A 4GW5B 4FABH 2Z0UA 5D7HA 1KIRB 1CK0L 1LD9A 1MW2A 3APNA 3I9IA 3PREA 2ESVB 4N6QA 2BIQA 4NERA 1Y18A 4PJ9D 4YDVB 3WIFB 4X0KB 2DWSA 2CWRA 4YHKL 4OLXH 1KIUA 2X6CA 4GW1B 3NZHL 5C6TH 3NBNA 1UCBL 1G7MB 1L6PA 1VGEL 1QBMH 4Q89A 5TPWL 1HCVA 2XI9A 5IMOB 3EH1A 4PJ7E 3KH4A 4GLRH 4DWHA 5J6HB 5DC9B 1ETJA 1D7BA 4X7CC 4MJ6A 2OJZH 4KRNA 4UQ3A 3GXPA 1GAFL 2P1YA 4FDWA 3EO9H 4UV4L 1QASA 3HNTL 1INDL 1BZ9A 3AB0B 2J8OA 4G5ZL 4KK8D 3TEXA 2XVKA 5BZWB 4RWYH 1GH7A 4ZXBD 3ZDYB 4M6MH 2Y7QA 3SE4C 1MKFA 3H7BB 4HMEA 5C0JB 2VJ8A 3LB6C 5DJDA 2FJUB 3DV4A 4JHBA 5B7EA 4C55A 5AYQA 3TU6A 1E5ZA 2A6IB 3ABMB 3P73A 2PPEA 1JF6A 3HKFA 2WWMD 2ICCA 2XV6B 3IKKA 1QUNB 2OMTB 2HJFB 3U2SA 3OF6A 32C2B 8FABA 4ZXBC 1P9MC 3OR6B 1DANT 3MBED 2VLLA 2EUVA 3OB0H 3MACH 3Q8BA 4ODWB 3U6RB 3DX1A 5DUMH 3QGVA 3BRDA 2ZXDA 3B8YA 4F2ME 4M5YL 1DTUA 1ZV9A 3CN2A 4HKZA 3BAKA 1AQKL 1YQ2A 1OP4A 5IGXH 5AW5B 4L1TA 1SJEB 3RJOA 4OR1A 3A23A 2IANB 3PUCA 5EZJB 1ND0B 4I5BB 3BZFA 1R9FA 3Q44A 4P2QD 5INCA 5FHAL 4BZ1L 4O2EA 4F80A 2JLLA 4UQAA 4F8QA 3CH8A 1WT5C 2VMDA 4X4MA 4CADA 4WI6A 3BGFB 2BNQA 5IHUL 4FG6D 1AFVL 1KLUA 3P4NB 5K5YA 2FHFA 1GYCA 3MRIA 2HRPH 4M3JA 2CBQA 5A2CA 3R4RA 3ZKND 5HVHC 2ZD0A 5DJ2B 4HK0B 3CG8A 1AGDA 3KDPB 2VXTL 3RIAK 1DQIA 1F42A 4DEPB 1XSJA 3S4SG 1YMHB 4ODUA 2YXVA 1YY8B 4UT9L 5DVLA 3V6OC 3DPDA 2IXQA 2JK5A 5EO0A 4J3OG 1KT2A 3KWXA 4Z7WE 1N67A 1RVFH 4WW2C 3MV9E 4N2EA 3TO4C 4DPBX 4R96B 2ZKXA 2WZ6A 4TPRH 3MRPB 5IESL 4I3SH 3WOVA 2PW1B 3ZMNA 3PXLA 2KLRA 3QJHB 3U7WL 5FKAB 4HALA 4NUJB 4UOZA 3EYQC 2B08A 1MNUL 3EJCA 3LQAC 1PYWB 1GYWA 3FQTB 5D70H 5E4AA 5GGRB 4OZIE 4Z7NB 4F58H 4RBPH 3IGAB 2H45A 4YSRA 3W56A 4YSPA 1YAIA 3FO1A 1M2VA 1FHNA 2EZ0D 1T1YB 3VFTA 3MRFA 2E6JA 1I3GH 3UEQA 4A6YB 1XXDC 4H8VA 1I8LA 4WW2A 1JHTB 1JS4A 2H6UA 4PS8A 3IDNA 3WKMH 4Z23A 1G1OA 2PR4H 2BOBA 2X1WL 1W15A 1AO7B 1AMXA 4WNQB 4AVHA 3KPQA 3EZJB 1QWNA 1H8SA 4TULL 4QO1B 5E2JA 3QEQB 1MQKH 1RCYA 3K0WA 1OAXL 4UIMA 4WO4B 2OULB 3VFUB 1VZGA 1FAKT 2V9UA 1LHZA 4QXWA 4N0FA 1Q0YL 1BGXL 1AI1H 1TPXB 4GI8A 4JY5H 3ILDA 4XE0A 1CFMA 3C6SA 3X1GA 1ITBB 4DFIA 1GW0A 5L2KD 4BHUA 1I9JH 3UTSB 3T0DA 3KH3A 3BMWA 4LL1A 5D7IA 1P4LB 1XQ4A 2JQZA 4E41B 4NQDD 2W0FB 2OMWB 4U1MA 1UM6L 4N8CL 3CNKA 1HIMH 2V0AA 2XKNA 1CD1B 1KXTA 3GMOB 4JFSA 4YZFF 4NQXA 4MA7H 4YEFA 4IBUA 4GBXA 3DMMA 3QXWA 4LCWB 2ILLA 4CSPA 1UT2A 2K6ZA 3NSCA 1CIUA 4OM0H 2UY7A 4BWTA 1ZHLA 3OMAB 1JZJA 4TMPA 1HZHH 2OCCB 1B0RB 3JVFC 1FNEB 5EO9A 4Z7IA 3ISYA 2EJ1A 3MX0A 5DWUL 1QO3B 1WA0X 3NZUA 4U0RB 5GS2D 5LBSH 4UINH 4CC4A 1XR9A 5DMKA 4XCFL 2K78A 1IL1B 1GOFA 3IJHB 2NYYC 3VFGL 3U46A 4KXDA 1B6UA 4PP1C 4GRMA 4BHUI 3VXUB 1I82A 2HJKA 2ZWSA 3VGGA 2UXGA 4OKDA 3ULUH 4MZ2A 4L9LA 1MFDH 1M05B 2UZIH 2BIIA 2NY3C 2YMXH 1O7DE 4LEOA 1BLNB 5ISZB 2HWZL 1DN2A 1KELL 3QFJA 2WVVB 4KTDH 5MENA 3S36X 4XMTA 4AV5A 4ERSH 3LZFH 5ALCH 4B53A 3BSZL 4ELME 5IG7A 4HEMA 5DJ0A 5ACZA 3P40A 4LNVA 2JKRM 1PKQA 5KVDE 5IHZB 5D1QE 4ALAC 4PRAA 1INQA 4XC1L 4WU5B 4BSWB 2MNJB 2O61A 3CSTA 3UTPE 4U33A 2CK0H 5KYXB 2A83B 2YSSB 3TBSB 1NKOA 3FT0A 1J5CA 4AQ8C 1GC1C 3WO3B 3VGHA 5I9QB 4UQCA 3T0EE 1PKOA 1FZJA 3ZYIA 2XC8A 3FZUD 3N42B 1JGEB 3MBEB 2C1OB 1T22A 5AW6B 1AYRA 2GJPA 4FQCL 4IHBA 1UGKA 1V7NL 4AGQA 1MF2L 3WIHH 4EZLA 1UWEL 4OJCA 4LLUA 4NGHH 4ERSL 3TIDB 5C8JA 3IGKA 5I75C 3L3JA 9PCYA 1EDQA 4KVPA 1P4IH 3GMOA 3II1A 4L8BA 3VGAC 3VI3B 3CQPA 1I85A 3NA9H 3LNFA 5I1KH 2JKJA 1FJ1B 3QCTL 1G84A 4NS0A 4KOCA 5C0RL 4QHMA 4HPOL 2V5MA 1X5IA 3RZCC 4P46C 1AGFB 4X6DE 1PDKB 3G5XA 3L95A 2G60H 3RGVB 2F53B 1E5AA 4B7LA 3UG4A 4MA3A 4HG4J 1HJCA 3L3HB 4D8OA 2FO8A 5CEYA 5DS8A 2D3JA 2C7FA 3D2UD 3O2DH 1W72H 3HLAB 3QIWC 1N64H 3DJ9A 1K4DB 3GS4A 4G43B 4OZGE 1PLGH 4FFYH 4KQ3L 1JGUL 4WDIA 3DNKA 3KPQB 4MKTA 2X4SB 2VR6A 4HT1H 3UAEA 4IOFC 4GXUM 2GJJA 4M1GH 4JG9A 3I84A 1MREH 3GWJA 3SE3A 4L5FH 5HYSG 4HC1A 1SOXA 1PG7L 2X41A 2P5EA 1TTBA 1LO2L 4ENEC 4IBTA 3VUAA 3NZ8A 3QUZA 1DVZA 4NIKB 2EKSB 1AS8A 4ZZFA 3OJ2C 3IU3A 1A7NH 1YNLL 3FB6B 3RX8A 4DO5A 3SZKC 1AZRA 4CMMB 4RFOL 4CSZA 1SLXA 3ZE0E 2Y07L 5IVXF 3QPKA 3EFOB 1Z5YD 4P2RE 3L9BA 4X50A 4TVPH 2FATL 1DVFB 3X1NA 4PCTA 1CG9A 2NY3B 4JHWH 2FWSA 3F65A 4GG8B 4LLVA 3IGLA 2IQ9L 4E5XG 3NEEA 5DD1L 2IXQB 2JK5B 2IH3A 2ITCA 3FN0H 5KVGL 3VH8G 4RMTA 2VDRH 5E1AA 5AYUL 4JQVC 4CVZA 4RA0C 1OCCB 2QQLL 4GW4A 4K9EC 1AIZA 1S9WB 2DD8H 2BDNL 3ZK0A 4OT1L 1KELH 3QEHB 3V4LA 2Y4SA 1N4XH 4Z7NF 1P7BA 1I4FA 2P5WB 1S46A 2WKOF 4QF1B 4ZMVA 4NO0D 4ZAKD 2VYRE 4K3EL 4LLMB 4NRYA 2BRRL 4HXAH 5KW9H 3VACA 3TO4B 5AUMB 3J7HA 3UZVA 5I1HH 2VW4A 2DJ4A 3HUJE 1YAZA 4GLRI 2VDNB 3DOIA 3X3GL 1MCJA 4ORGA 4OI7A 2DM7A 2XVGA 2X6AA 4LZKA 1K4DA 4G43A 3HNSH 1UOVA 4DEPC 3ARSA 5DS8B 2Z92A 3GSUA 3KPRD 4PRBA 3UP6A 4XO9A 3O8XA 5CEXB 1PFCA 5JUEH 1BMGA 3DRTB 1RUML 2WXLA 1T0NA 5GS3A 3UPAA 1IKOP 2B20A 4HKJA 5KSAB 4J39A 3D7PA 1I9IL 2BERA 1COBA 1QPPA 4WSJA 4UTAL 3KR3H 3RQ3A 1X9LA 3WAKA 3MRMB 2DKUA 2F58H 1REIA 3UJIH 2ADYA 2K8QA 1I31A 2FJHA 2XACC 3FU3A 3CLEL 2QQKL 4TQEH 3E8VA 3WELA 3RIFF 2W94A 4A67A 4DW2L 1IUZA 1E9QA 4N8PA 3UCRA 2R2EA 3LNIA 2C1OA 2FLRT 4KK6C 3H7BA 2KZWA 2X42A 4M7LL 3KPTA 1J1OL 3JWOC 2LU4A 4TVUA 3FSAA 4PU2A 4HH9B 4OGZA 3TA3B 1TQBC 1JWUB 2YLKA 4GQ9H 3WENA 2Q87A 2J21A 1CWVA 3IDMB 6FABL 4WI8A 2H1LM 1ML0A 2ZCLL 3E38A 2XTJE 3HB3C 1ES0A 2NR6A 1SMAA 3QIUC 1NAKL 1XF1A 3T65A 5B1KA 4UTAA 2GKIA 4HKBB 3NZHH 4Z7UE 4I2XB 4GOSA 3NOIA 4Y5YB 3MNWB 2TSAA 2FR4A 4E36A 1YSOA 2J5LC 2J1WA 2CNZA 5E99L 3E9UA 3SODB 3M1CA 2NUPB 5DZNA 3N85H 4D94A 3FUJA 1DYZA 4FTVD 3NCJL 4I4WA 2DM4A 4WI2A 2O4EA 4XPTH 3U46B 3WTSA 1OTUC 3A6BL 1KTDB 1PCSA 1Z1WA 5AZEH 2BLFA 4PIBA 3E0GA 5DDHA 3KPNA 5H4YA 4BV1A 3S5YA 3T77B 3VXOB 1HILA 3CZLA 3MX0B 3MKKA 4NRXA 1ZK9A 2VLRB 2ARWA 1S5IL 2R29H 4NC2B 1QW8A 1E9OB 2LAAA 2FL5B 2OSYA 3H9SB 3CHPA 5AW3B 3T3MF 1LO0H 4QLWA 1OK0A 2MWCA 4GBXB 3QYMA 3FH5A 5ECJE 3PPEA 4D9RD 1LVEA 1A3RH 1RJCA 1NOAA 1HQ4A 5EU3A 1AHWC 1UB5B 3LPPA 1MJ7L 4EZMA 4BCYA 5DQJA 2LVCA 2XN2A 1M9SA 5IROA 5EWIL 3QUML 2CJUH 4NX0A 4E41A 2CLVA 3LIZA 1AQ8A 5JHLA 4AEHL 1KYFA 4DP8X 3A6BH 1EDHA 4TQHA 3B9AA 5T5FA 1A4CA 1ACCA 4XBEL 1U8HA 4C57C 4N0FB 4Y1AE 2OMZB 4FXGA 1NSNH 1Q9WB 1WF5A 1N8ZA 2G2NA 3AU1B 3E8UH 3FCTB 3GYRA 1KPVB 3QEQA 3QRFM 1TQTA 5FUOL 5FKPB 1AGBB 3WCYA 43CAA 1DEEB 3U30C 1ZE3H 2XZZA 3BZ5A 2BOBB 4OU3A 5C0BD 4F9PC 4PSRA 4P4RB 5JHBA 1DVFC 1E4XL 1HKLH 4Y2OA 4F9LA 2ATKB 2GHZA 3ZT7A 4HIJB 3H4HA 2Q86B 4OV5A 1U33A 2ZCHH 4PV8A 3BP4A 4KQ0A 2FIKA 5IIEA 4Q8BA 3HI1A 5T1LB 3X14A 1EXUA 1NGWB 2C9UA 4Y8DC 3E6FB 3K2UH 4J8RB 4JRWA 2XTJB 5K1NA 2IDTA 4H8PA 4NUJA 1SF3A 4PRNA 4QGYA 3HRZB 3FU9A 3STLA 1DVUA 2V2XB 4OY9A 3WNLA 5FA4B 4QXTB 4UTBA 2A74B 1NANI 1Z0NA 3E2HB 1GGTA 4KDWA 4R96A 3GMNB 4XNYH 2HLFC 4MCYA 5F1NA 2WK2A 1P5VB 4Z7OF 4PJ5E 2BXZA 2QVFB 1DE4B 4W9EC 4LFHG 1CFSB 4OGAC 4MRCA 1K4CA 3A6OA 2VMEA 4MVBD 2AJSH 4QR7A 3RWIB 3SOBH 1BIIB 4X7SH 4OJAA 1U92A 3B9DA 3GRBA 1WUNT 5LXGL 3S0PA 2V2TA 1LEKB 1J48A 1TQUA 3VXMD 3D4YA 4FNLH 4ZMWA 5HHQA 4RBPK 1T21B 4PHZA 2YD1A 1TZAA 4GI6A 2WBKA 3PWVA 4NQCD 2RFXA 4X7TB 3NA9L 5F89A 2L4OA 3E6HA 1RAMA 5I76A 3DX9A 1MPAH 5BRZB 3RGBA 4YGVB 1A6AA 2OJEA 1A2YA 1UXSA 4LBAA 5CN3A 4IHOB 1AXSB 5INCB 5JPNC 2X9XA 2DQMA 3QULA 4GUCA 3VXQB 5JNYB 1G0XA 2AXGB 3VG0L 2MPAL 3BKCH 3OKEB 3QZWB 4LCIH 5E6IA 5MEQB 1GRWA 4LOVA 1FV1B 1YEEL 4KO9A 2NNXA 4GIAA 3FH7A 4S1SH 1FZOA 1BZ8A 1UT9A 1R5VA 3NAAH 3ZL4H 4C58B 2A6JB 1H3GA 3QB7C 1ACYL 4ZS7L 1C16A 1RZGA 4ODWA 3BP5A 5GJSL 3U25A 4K5PA 1JZIA 3FQYA 5F0PB 2PETA 4W9LC 5CN2A 32C2A 5B3SB 3S5LG 5L9DL 3FRPA 1BBJB 2ATAA 2GBAA 1AS6A 2YRLA 3ECBA 1GPOH 2W59A 4L48A 4GXFA 2G4EA 4RMRA 3NSJA 1JMZA 3KYMB 5D71H 4UV4H 4TSBH 1S9VA 4K9JA 2BHFA 3FQUB 3G08B 5IBTH 3TT1L 4ZMPA 3NFSL 2VN6A 2WLZA 5HDQL 4XX1G 1ESOA 3B37A 2YEZA 3GPSA 5AVZB 1ACZA 4G1MA 1BMWA 3CFUA 2WY3B 2HAZA 1U91A 1U95B 2DQHL 2K4WA 5IHWA 5AKRA 1E4XI 1QSFB 1I9RL 3MO1A 3QAZC 1A1MB 2WQVA 2EC9U 4FQQB 4MQXC 4X80H 4RQQB 4MJ6B 3G6DL 2I5YL 2ICES 1PY4A 1WC7A 4X7SL 3M86A 3QORB 3ZDXF 3RHWK 3CVHA 3GUFA 4PJ8B 1GZQA 1HNGA 2NY2C 2O72A 3KGRA 4JFVA 4P0DA 3K6OA 2CO1A 4EKXA 3MN8A 3U2IA 3HAEG 2EC9T 3TH2T 2FJGB 1F4WL 4R8WH 2BIPA 3EW3B 4X5WB 2PNDA 1MVUA 1MI5D 5KVDH 1QBML 5TPWH 1C5DB 4P5TB 5DMIL 4MQXD 1RJYB 4PJCA 2A4EA 4QHKI 1GGYA 5DTFB 3TVMA 1DDTA 2H2SD 4PFEA 1A4JB 4KMTH 2DEYX 4FFZA 1XF4B 3Q9PA 2GEQA 2WC7A 1FNSH 2BPBA 4I18C 4N2MA 2WO4A 4HOWA 5C7XL 1VKXA 2Y5EA 1WRFA 3ZKXB 3QQ3A 2WIIA 1U8KA 2LQRA 1P69B 2ZSVB 4TLKA 4Y2NA 2GFBA 3GPEA 3QZWG 2D0GA 3BVNB 3BCDA 4P4KC 4WIQA 3WKPA 3TFKC 4BKLA 4Z6AT 2EE2A 3VXUE 2XFGB 4JL2A 1K5NB 5EBLB 4JZOB 4NT6B 3L2NA 3OXSA 4QT5B 1IKFH 2HVBA 1S7QB 1GHFH 2YOCA 4ZW6A 3IB4A 4YDJA 3GI9H 3W39B 3V4PL 3TJHD 1WD8A 3FB7B 4XO8A 2MKLC 3W11D 3SDYH 4LLYB 3VXTB 4HUKB 4IIQA 3LNGA 2QQQA 1S7WB 4LSRH 1FYHB 4EDXB 4ZX6A 3MV8B 4KC3B 5I19H 1HAUA 1F13A 1PEWA 5ANHA 4MVBC 1KJ3H 4M9PA 4JDZA 4ZFFA 1LE9B 2YD4A 1HK6A 4LSVL 4Y16A 1JN6A 4NO0A 1A0QL 1KB3A 2P7TB 4YXLL 3QUMA 4JG1H 3LCYA 2AJYH 3IKCA 3OC8A 3NA4A 3AGVA 2QHRH 1QHOA 1VLXA 1B2WH 1I8KA 1XHHA 5C0AA 2XQBH 3QO0B 5GRZA 3DX3A 5I74B 4FNQA 3FN9A 1G7QA 1P1VA 3G7TA 3INUL 1VESA 4I0KA 4X9HA 5HHOB 3C5JB 4FQJH 4H88H 4I0PC 1JUFB 3LH2L 3GSXB 1RUQH 4L2YA 4JFEA 4MBRA 4XZ4A 1ED3A 5FDYA 5KG9A 1KN4L 4PLKD 2C3VA 1QLRA 1S7RA 4AYSA 1A1NA 2OL3L 2GSGB 1RZJL 2VUYA 3MLTB 2AK4A 3ZDZE 5I1KL 1UOWA 2YAFA 4QRRE 4HJIA 4J3WA 1O0VA 1VHPA 2JF1A 1MHEA 2FHBA 5CJQH 2VM9A 1UJ3C 4Y1AA 3W37A 4S1RH 1PZSA 3VCLB 2PLTA 2X2IA 3HEIB 4P2AA 2CA4A 3FU7B 4XT1C 3MV11 3VXNA 1IGIL 2J6EL 4PG9A 1B2WL 3AS1A 4PI2A 1KXHA 2ZCKH 2DY2A 2ADJA 5L0QB 2YWZA 4H8UA 1U3HD 2YUXA 3SJVE 3WEBA 1AJ7L 1EJOL 2A9MH 5A2FA 2DQJL 4B9YA 2BZCA 2MIZA 3L1GA 4HFWB 4X6DF 4LARH 1F86A 3UTPD 4AJYV 2EDHA 4N5EC 3HHSB 2CBPA 1WHPA 2VQ4A 3KPOA 4U1HB 3UJJL 5LWYH 3QIBC 1U93B 1QFUH 1T80A 5D6DC 5HHME 4JHAH 1DBKL 1XCTB 2OSWA 3JTSB 4O5LH 3SKMA 1DUZB 2JIXB 4RDQF 2IFFL 1OPGH 4PB0H 1CL7L 4U1NB 2COQA 4BFOA 2J8UB 2P44B 3JUZA 3EGSA 2VZUA 3UFIA 4DP2X 1TPXC 3MA9L 5CJ8A 4ATWA 1G6RB 4HUWB 3OGCA 4FLQA 4WUUD 4AY0A 4M6ML 1MFCH 3TJPA 4EAEA 3X2QB 3IYLW 4EDWH 2AJSL 4WUUE 4M93C 3ZU8A 2E9BA 5CINH 1RUPL 2FQEA 3GGWB 1OTTD 5K33A 1A7BA 1MCNA 3OMZA 1MJJB 4JFYB 2IH1B 5D7JC 1TXKA 1N19A 1UWXH 3LPWA 3S3SA 2OYMA 2P43B 4DN4L 1VCBC 1Q9OB 4L4VD 4JRYB 1UCBH 1WFJA 3PAVA 4OLZL 2GAZB 1A7QL 1MUJA 2QMJA 3X17A 3H4FA 5D71L 2MEJB 1Q90A 2ADGB 2W95A 4NKIL 1WD9A 2FECI 3L5JA 1M6OA 2IWKA 4FQXB 3D9AH 2OTUB 4PMFA 3QQ4A 1CGXA 3V6OE 1UD6A 4IYKA 3LZNA 1WBZA 1A47A 4S2SB 1JZ5A 5JW4M 3ARBD 2QELA 4G7RB 2UYLB 3W1ZA 5FOBB 4HUCA 3QBTB 2ZYSA 1CDJA 2YHGA 1QABA 4B9FA 5IW6B 1H3XA 1ZSDA 1E3XA 2AAVA 4KO5A 1T7VA 1OCZB 3GZOA 3QRLA 4WY7H 3WJLA 3WN6A 3VE0A 2EYSA 5TFSH 4R2GB 1CI3M 3CVIH 2DMBA 2QDVA 2W60A 3CVHL 3T4AB 2X4NB 1NFDE 2N56A 3AAZA 1R5IB 1P7QB 2AK4D 3NCCB 3LZFL 5C0BA 5C08D 4XP5H 4YUEH 3HAEH 1WQVT 3SDAA 5KS9E 3PUUA 3LXUX 1MCIA 2EDBA 1BQHA 2ICEB 3D39A 4UV7H 5F9AC 3ZE0F 3D39E 3LQZB 1E4WL 3P3TA 4R4BA 4I0PA 4NZFA 4ONHB 2EQDA 3MLYH 1IGIH 4MAYC 1WG3A 4CDGC 3ULUD 3CFEA 5EO1B 3TNNA 2MJWA 3AWGA 1N2RB 5T5FH 1T7YA 3FRUB 5HGBA 1JFQH 1S9XA 3FH8A 1OSEA 4MNQE 3DARA 4QTHB 4MXWH 1CGSH 5EEZA 4KK9C 3QNXA 2I7OA 1MY5A 3MSPA 4UT6H 1IC4H 2ZKHH 3SKJH 5DFVD 5CF3A 4RGND 3DWTA 3VYOA 5DJ6A 4JJ5A 3I6LE 1CE1L 1F6AB 2Q2EB 4K3JH 3RJDA 2BVOB 2D7TL 3HBPA 4NC1E 4OTXL 3M7OA 4RA3A 4RGNE 2ENJA 3LKQA 4WLCA 3PABB 2DMHA 2FH6A 4FNLL 2WQAA 2Y6TE 4WUKL 5FK9B 3U9PL 3FULA 5HHOE 5D7KD 5CZXC 5E8DH 4BM7A 4HEPA 4LCUA 4LSSL 2VZSA 5I8CA 1GPOL 2DQTH 2F1AA 5EIIA 4LRNH 5TE6L 4IKNA 3KCWA 1YPZE 4B5ZA 5I2IB 1S7XB 2AJ3A 3TC9A 2VDPB 1XEDA 3THMH 4UNIA 4HJ0C 2VZ1A 2YS4A 4NN5C 1KCSH 1HXYB 1ZV5A 4M02A 1J05B 2NXYC 2QTEA 5MEOA 1V5JA 1U4FA 3FU6A 2X6VA 4JM4L 2PP8A 3COOA 4KK6D 5E95B 1ZJAA 2XV2A 5ADOL 1HHKB 1MELA 1CQYA 4PGCA 3HN5A 5ALCL 5E6ZA 5T3ZE 1TTCA 1CI5A 4PJDB 4MHHG 1DJSA 1ZHNB 1XX9C 3IJSB 2VJ0A 1A4KB 4G59C 4DT2A 3UX9B 2JKNA 2R1XB 2ZSWA 2W88A 5D1QB 4CJ0A 3MRDB 3KLQA 4PWEA 1AE6L 4IOIA 4G1EA 5FFOA 1DJXA 3CPLB 2P52A 1WWAX 3FO9A 1IZKA 1MHCA 4R26L 4Z7OE 5JW4R 4BSVB 4P4KA 4HLEA 1T66C 1G7IB 2C1PB 3RWGA 3WFHB 4BQCA 5D2NA 3AB0C 4LCIL 5IVOA 2WO3B 4A2DA 3FT9A 2DQCL 4R5VA 5ID0A 1CLZL 4ZW5A 1OW0C 4IRSB 1D3CA 3TCLA 1CVSC 3ARBA 1I8LC 1G7IA 2C1PA 3RWGB 1AHMA 4YVNA 2J5LB 1E0OB 2NY4B 5D72H 3T09A 3UGEA 4OKVA 5EPMB 1AQHA 1AXTL 1NPJA 4N2AA 4TVPE 3KHQA 4G9FE 1F0LA 1TQWA 3SGDH 3F12B 1E7VA 1SQMA 2GSIB 1PX3A 2ZSWB 2ADIB 3S2AA 3IXTA 4IU2A 5ICUA 4B95C 1EJ6A 3I74A 3NH7H 1FFOB 5T3XL 3O41A 2XZAL 4OLXL 1SXNA 4Z8FL 1BG9A 3LN5A 2X9YA 4Y8AA 5DFWH 2KPNA 1F02I 4MHHI 3CFDB 1FLRH 3TH3T 1KV3A 1FP5A 3PP3K 2WZ5A 5T3XE 1KPRB 1QEWA 5GHWL 2EE6A 1CLVA 3O0RL 5CD3A 4LIQE 1TVDA 4JZNA 4XMXA 5LGHH 4J3TA 5CGBA 3W9EA 5BVJA 3MJ8B 4U3SB 5G4NA 4WK2B 2IOMA 2LFGA 1NWPA 5E0FA 1W6LA 3MRNA 3U6XA 1RFDH 5F93C 35C8L 2JB5L 3FN0L 5KVGH 1SDDA 2IEPA 1J18A 1MWAA 2JI1A 4KUZH 3BH9B 2HTKC 5DJXA 2EUXA 4O2FB 3DX7B 1M71B 3QQ9C 2X4RA 4FD0A 1JXJA 2XTLA 1UUSA 2I32A 4K94C 5FO7B 5D1ZD 5F8RC 3MRKA 3V0VB 4I1RA 4FQ1L 2X4QB 2UX7A 4D3CL 1F11B 5JYLA 4KH9A 4XPGL 2QQKH 4TQEL 5FEBA 4XOAA 2NYYD 3LHPH 4YHOH 3V95A 2YQGA 5KSUA 4YWGL 2SEBA 2PR4L 4AV4A 3AXHA 3VH8B 3TT3L 4GKOA 4XAWL 3FRUA 5HGBB 5EF3A 3OAUL 4A04A 4QHLB 3WFBH 3IETB 3CFEB 5EO1A 4M6OL 2XFXA 2PO6B 2DQHH 3QS2A 3D33A 4XN5A 5JPNB 5JR1L 3RFRA 3RU8L 4EUPB 3KPMA 5IBLC 1U8JB 1UFUA 3ES6A 4P23C 5T8IA 1P5UC 1N5AB 2BP0A 5DHDA 3PWPA 3SYCA 5GS0H 1MCRA 2Y7LA 2ZPKL 1IBGL 3MJ6A 4JHVA 1UH4A 3HAEB 4BDVA 1RMFL 5GZNA 4OLVL 2F9BT 4NBXB 1E9PA 5EC1B 4S1DC 4BD4A 3N5AA 4G5ZH 3TWCH 1KSRA 2AVGA 1JHKH 3B83A 2VWEC 1T89C 3GD1C 4AYDC 4DQAA 2DM3A 3FUIA 5DSCB 1CE6A 3GUTB 4H5SA 1H19A 2VITA 2ZWKA 2WQUA 1XF3B 4M8UA 4QPEA 3G6JA 5JHLL 5IGXL 3G6JE 3MQIA 1CBJA 2VISB 3QWNA 1P5UA 2W9DL 4L3EE 1EFXD 3V4VL 4B9JA 4GAYA 4W9CC 5D1QC 3VB8A 5D7IF 1I1AA 3GDBA 5ITBL 3CDYA 1R6VA 4GJTB 1ZV2A 1T1WB 3QUXD 4YXHL 1DSWA 1U58B 3H54A 4N9GB 1O7DC 4OCNC 1OAKL 2GTWA 3KAAA 5LO7A 2OR7A 2BHUA 4XMVA 5FR3A 4LRIA 5D9SB 4M5SA 2OQJA 3FN3A 4P3DB 3S96A 1HKFA 2X12A 4C4UA 4UQ2B 4D9LL 3QUYD 1UKSA 4Q4EA 4DPRA 3B34A 1XGQA 2R1WA 1SLWA 3KM2A 3IMUA 3OKDA 3TBTB 5JLZB 1P2CA 3QUGA 3WS3B 1E8WA 1JGVH 3VQ1C 1CDHA 4G6AC 1BVNP 1XH3A 1DL7L 1DJIA 4MKMA 2A99A 3CN0A 4OCYH 4IGBA 5AWNH 3OLIA 3QHFL 1J86A 3ARUA 1SVBA 4NZJA 5B21A 3V0HA 3WD5L 3HE7D 1K8IB 1ZLSL 3ET9F 2DV6A 4JDEA 4QUOA 4ZUVA 2EICA 1A5FL 4OCSH 3JT0A 1NGQL 2EDJA 2Z0BA 3D34A 4ALAL 3S3DB 2GBVA 3ARYA 3M46A 1MWOA 3MRLB 1UC6A 4GAFB 4XN7A 3BZ4A 2CKBL 5DEGB 4KKPA 2F7RA 3TN0A 3GRWH 4U1NA 1KXVA 2PYED 5IW1A 2HMIC 4G71B 3BJLA 3AROA 3MRGA 2F54D 3MOAH 1S7UA 4XI5C 2FO4A 4F37F 4UTAH 3SY0B 1I1FA 2ZPKH 1J7VR 3T3PB 2EZ0C 1ZOXA 1CTNA 3DVGA 4AZUA 2H32A 2XWZA 1TCMA 4NUMA 3N40F 5SWQA 3GO1H 4E9LA 4AVIA 3QG7L 4P5SA 2V7NA 2VC2B 4PJXF 1PF3A 4TNVK 1VPOL 3IFNL 3S3JA 3UZQB 2N0MA 4UMGA 1ZHBB 4XNBA 3H56A 1FQ9C 1IEAB 3EOTL 2KZBA 3DO3A 3NT0A 2R1YA 1SPDA 4NUGH 4F2MA 1CL7I 3QUXA 3X3GH 5FUZL 4XAWH 4JGMA 1HE8A 4NAMA 5E08L 5KJ7E 4ETQA 3EYFB 2WVUA 2YEQA 3DXAB 2HTLC 3OX8A 4UAHA 2AEWA 3MRBB 3SJVB 1IBBA 3FB5B 4ZTOL 3S5LA 8CGTA 4LDLB 1BM3H 1S8DA 2HRLA 4XBMA 2FJSA 2LLNA 1PBYA 5BV7H 1N6VA 4G7SB 4DUWA 5AW4B 3CCHB 3FO2B 2NPLX 3VXSB 1S7RB 2V9RA 4Y4KB 5HGDB 4R7VA 3NFNA 3PPSA 3NFPA 3QHZH 5D7LB 3OKOA 3BQUB 1RERA 5ESAA 1NLBH 5DK2B 3WHE1 3RL1A 1JPGA 3C5JA 3QWOB 3EZ8A 1MIEH 2YPVL 1KV7A 2XVLA 3MOBH 3REVB 3MA7A 2B3IA 1LP9F 1QVOA 2VQUA 4P23A 3TBVB 3WE6A 1FFNA 4KH2A 4CKQA 3DHJA 4TUKH 2CRYA 4ICWA 1IC1A 2EVHA 2GC7C 5K9QI 3EIFA 4A2HA 4PJGA 3MCYA 5ANMB 5D2LB 3IMBA 1D5BB 2XIIA 4LHUD 4HD9A 4P5KB 4FQHB 3W0WD 1JPFA 3SGKA 5EA0L 3KLSA 3NDZE 4ADJA 4D9QE 5D96B 1CF8L 1YECL 1EHLH 1XCXA 2RQEA 5F9WB 4LCCB 1G7HA 4OFIA 3BEVB 4WGWB 2QTVA 4Q14A 2WTRB 4PCYA 3C5ZD 2GTZB 2ZXGA 4YDJB 2XZAH 1GGBL 4Z8FH 4ZX5A 3MYZA 4YBHA 2E9GA 3BSZH 2DYPB 4U7SA 4B6ZA 1N4XL 3D2UA 2ITDB 3C5ZA 3K0YA 1U2HA 1EGJH 4BKTC 2V3EA 4FXKC 1F8TH 3HHRB 3WNJA 5HPOA 1S7VA 4XN8A 2WUBH 2ZSVA 1YYLL 3FUDA 1LL1A 3L9YA 3K8KA 4JN2A 4QGTA 2GJ6D 2BM3A 4N2DA 2K3TA 2EUWA 3O2DL 3F6JA 5DD6B 3BP7B 2ZTBA 3VG9C 1CXKA 1EEZB 4K7FA 5KBKA 4ZO7A 3AG1B 1V3KA 2R69A 2FDBP 1D6EB 3BE1H 3EYVA 3FUHA 1RH8A 3HZVB 4X8XA 4HLJA 1OWWA 1RJYA 4PJCB 3QDMA 3MYJA 3D4ZA 3QXUA 5BQDA 4DSYA 2AJUH 1YZZA 2DS4A 3TM6A 4D0BA 2COVD 4U0QB 3AS3A 2O6EA 1C5BL 1F6FB 4MRBA 1RP8A 1HQRA 2G5BB 1ZLUH 2DQEL 4WHYG 1I8AA 4JFZL 4KNSA 4R97B 4APQB 4J1UA 5JZ7C 3V9CA 4UCFA 1I7RB 4RRPA 3SN6N 2G2PA 3IDIA 5EUKA 2BFVL 4FQQA 4AXWB 2XNAB 2NY1D 3IFPB 3OKNA 4TVSa 3Q13A 4E9VA 3MV7A 2X88A 1U91B 4AH2B 3GSWB 3GBLA 3O0RH 4WFHE 1A9VA 1FBIH 3MV7B 1BGXH 4JY5L 5C0AE 3HI5H 1TIUA 4L8DB 2BOCB 1BFVH 1CTMA 3TLRA 4BBWA 4PRPD 5LAXB 3D4CA 3G08A 4AIZB 1KBGH 4PJ7B 1UD2A 4LPXA 1TJIH 5DS1A 4U1SB 2BNRD 1A7OL 4X6DA 2CA3A 4PRPE 4AQ8A 5HSFA 3US0A 4PRPA 4NLAA 4J1UB 2R0KH 3ZTEA 2XXCB 5IFAL 1TYEB 3ZTNL 4KTEL 1LK2B 4DUVA 4HXBL 3S4SA 1AP2B 3GZKA 3H9HB 4P3WA 2AQSA 3SGDI 1DCLA 1BD2A 5DK0B 3BISA 4JDTH 4MDIB 1OGTB 3L7EB 2E74C 3MLWH 2VDRB 3H9YA 4RDQG 4PYHA 2A5UA 3MLSH 1R5VB 2X6UA 1ZSHA 2H0FA 4GEJA 4LSUH 1EGJA 4JVPA 1ZJBA 1FO0L 2QR0B 5GISH 4XCFH 3MLYL 5MEQA 3HN3A 3O6FB 5DD6A 2OX5B 4NSKA 5ETUA 2ZX5A 1UB6B 1S9KC 3LSOA 1ETZA 4U05A 5AL8A 1FAIH 1AXSA 5IOKA 5ALBL 4J6IA 4XNXH 1PAMA 2WLJA 1QLEL 4HWEL 1A2YB 5GJTL 3ZW3A 2CDEB 5KS9F 4FG4A 5BRZA 3ZQXA 4JQXC 5C3IA 4QYAA 3EFFB 4M43H 4YSQA 3Q1SL 1U30A 4OT1H 5KYUB 4G8GA 5IR1B 3E80A 3N41F 3EOBA 2I60L 2OJ1A 3ECQA 3CIQA 3ZKXC 4DTGL 4KV5E 3F85A 1FVEB 5A43C 3P2DA 2OP4L 4OVVA 3SGKC 3UPRB 2O26U 1U8LB 1OALA 2DRUA 2YPKA 4PY8I 1QNZL 1MW0A 1S3KH 3QPXH 5G55A 3RVWD 3VFSB 4I89A 4RGOL 2OM5A 4EBQL 1GL4B 3CN1A 5KSBF 5HYIA 2H6PA 2IWFA 2R2HB 3MRRA 1FYTE 5IJCC 2WNGA 2AV1B 2YD9A 1BD2D 4HWEH 5EHFA 1QVOB 3ZL4L 4PP1D 4Z18A 3RTQD 5GGTH 4U6XB 3F01A 3O3DA 1OAZL 3GMPB 4X6EA 5DK2A 2GJRA 2NR6D 3B2UD 4QNPE 4AEFA 1TYRA 2YBRA 4HUMB 4NZUH 5F71A 2FIKB 4X7DC 5E8NA 2JKSA 3VFWA 5DZ9A 2VQ1B 3QRBA 2Q86A 4QRPB 1SEQL 1KJ3L 3GEWB 4ZAKC 1S8DB 1X5HA 2VR9A 2DLIA 4XNMA 4OM0L 5BO0D 4AOFA 2C5DC 2CRIA 3WNKA 3ZMRA 3VI4A 3WMPA 43CAB 2BFVH 2X70B 1JGDA