3F00A

Crystal structure of synaptotagmin i c2a domain with cu(ii)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
143
structure length
142
Chain Sequence
GSPGIGGGGGGILDSVEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Synaptotagmin-1
publication title Crystal structure of Synaptotagmin I C2A
rcsb
source organism Homo sapiens
total genus 23
structure length 142
sequence length 143
ec nomenclature
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3f00A01
3TWYA 2WXKA 2KI6A 4WWOA 3HHMA 2Y3AA 5T8IA 4LT7A 4ANWA 3L08A 5KJ7E 4DK5A 3W56A 1CJYA 4ANXA 4NS0A 3PYCA 2ISDA 4FA6A 5H4ZA 4KZ0A 1TJXA 3HN8A 3OAWA 3KWUA 4AOFA 1DQVA 4IHBA 2K8MA 4A55A 2Q3XA 1UGKA 4HLEA 3QAQA 3T8MA 3RDJA 2V4LA 2ENQA 3L16A 4QAMB 2WXIA 3N5AA 2CHWA 2K4AA 3NSJA 5G2NA 3L9BA 2WXHA 3L13A 4FULA 3L17A 4L23A 4TV3A 3KWTA 1E7VA 4TUUA 3QARA 4QJ3B 4URKA 2R83A 2CHXA 3TJPA 4ANUA 1V27A 2WXLA 3L54A 1RSYA 4BFRA 4BGDA 3W57A 3CSFA 3APFA 1DJXA 3P2BA 4KITB 2B3RA 3PREA 3LJ3A 3APCA 2RD0A 4TS6A 4V11A 3ZVVA 1E90A 3F04A 3R7RA 4NPKA 2DMHA 3R7QA 4WAFA 3F01A 2CHDA 3ML9A 3PRZA 4EZLA 2CJTA 4L1BA 2WXNA 4FADA 4WWNA 4MJJA 4ANVA 2NCEA 2WXFA 1DJYA 2QZ5A 1DSYA 2ZKMX 2WXGA 2K3HA 1WFMA 5CCGE 1E8ZA 4NPJA 3ZW3A 3OHMB 2ENJA 3QR1A 4FJYA 1W16A 4PS7A 4WEEA 3IBEA 4F91B 1HE8A 5CCHE 1RH8A 4JPSA 3FDWA 2WXMA 5EDSA 3JZYA 1DJIA 2UZPA 3GPEA 4Y1TA 1E7UA 2WXQA 2NQ3A 1TJMA 1YRKA 2Z0UA 3F00A 2JQZA 1WFJA 4XX5A 4J6IA 2X38A 1W15A 5JHAA 1K5WA 4EZKA 2LHAA 1UOWA 3FBKA 2Q0ZX 1RLWA 3B7YA 1E8XA 4FLHA 4WWPA 3MJWA 2YRBA 4KZCA 3NZSA 2A5UA 5G55A 4IQHA 4QJ5B 3CSTA 4EZJA 2CM6A 1QASA 4FJZA 3SD5A 3QR0A 5CCJA 5JHBA 1UOVA 3DBSA 4AJWA 4ICWA 2D8KA 1BDYA 4L2YA 2ENPA 3DPDA 4LDCA 3PFQA 1BCIA 1E8YA 2WXOA 4FHJA 4XZ4A 2YOAA 2K45A 2NSQA 2WXJA 3QJZA 1QATA 4L1LA 1E8WA 2CHZA 4GNKB 2CM5A 4Y1SA 4QJ4B 4OVVA 5H4YA 2A4ZA 3S2AA 4G11A 4XE0A 1GMIA 3F05A 3ENEA 1BYNA 3L4CA 1DJZA 1DJHA 1DJWA 2BWQA 2WXPA 4OVUA 2CJSA 2WXRA 3QK0A 3RPBA 2QZQA 3ZIMA 4LCVA 2FK9A 3PS6A 4FHKA 4F93B 4PS3A 1A25A 3APDA 4GB9A 3NZUA 3HIZA 1DJGA 3IM1A 2EP6A 3M7FB 4HVBA 3TL5A 4F92B 4PS8A 4F1SA 2DMGA 4DNLA 4ICXA 3ML8A 2FJUB 2N1TE 4NP9A
chains in the Genus database with same CATH superfamily
2V2WB 3BZFA 2AJYH 4ZFQA 2HFGH 3CV5A 3PWNA 1S7VB 1O6SB 3OQRA 3GYRA 4KZ0A 4S2SA 1OY3B 1ACYH 1AE6L 4QTHA 2HRHA 4Q4EA 1MFBL 2DM7A 1LE9A 2CUHA 4Y2NA 5MENA 4LASH 4FX5A 2AJ3B 3ZKQD 4UDTA 4FQHA 4TLKA 4FTDA 5ISZA 5FCUH 2BFVL 1A7PH 1ZV5A 5HDQL 1DBML 2XV6B 1V27A 5DVPA 2ORBL 4MBRA 1JHKH 1WZMA 2X12A 3L2LA 3OG4B 3RP1A 4PW4A 2IALB 1INEH 4LLAA 1GSMA 4WNJA 4D94A 3CH1A 1X7SA 3GSOA 1AI1L 3KCPB 4WV1A 1IGIL 2ICWJ 5KOMC 3ZZ1A 4LPVA 3T08A 2BNQD 4IIQC 1XH2A 2D3NA 1HHIB 3ULVF 4ZT1A 3RGVD 4PJCB 5EN2B 3PP3K 1EZUA 2UY7B 2YMXL 3O6KL 4UB0L 4WTZA 1ZLVH 1OW0A 3DVFA 4JM2B 1Z5HA 4GRWB 5IHZA 4OLVH 2DBJA 3TYFB 4KVCL 4HZAA 1ZT4B 3FTSA 3ABMB 5ALBH 3D39E 1HHHB 1UVQB 4GSRA 5JIIA 5LGKA 3BUQA 4C56D 4MRBA 3T6XA 5GIRA 3VD0A 1KB9K 2MFNA 5DJ0B 4M7LT 4EZJA 1SEQH 3I74A 3WE1A 3K81A 1RIUH 4KK5C 1F97A 3VW3L 1DUYB 2ITDA 4ZXBC 3JSSA 1NCWH 1HCVA 1AXSA 4GT7A 2HKHH 2APBA 4HUWB 3V5KA 3ZTDC 4JPIB 3LH8A 5ESVB 1I1FB 3US9A 3MXWL 3QAZC 4LSPH 5FB8A 1HOEA 1CGTA 4LVOC 5DSCB 1BA9A 3F58H 1KZYA 4NNXA 4AEHH 2J72A 4IOIA 2EH7L 3K80A 3HPLB 2YEZA 3L4ZA 1SY6H 4KK5D 4M8QA 4GSDL 4XPTL 4NI3A 1JYXA 5PCYA 1IM3D 3N2JA 3T3PE 2MPAH 3T0DA 1HEHC 1UD3A 4YLBA 4LCCA 2MNUA 4NN6B 1NGYB 3DO3A 1RJLB 2HN7A 1FA4A 3FOLA 4J1UA 2HPTA 4H8WH 1AP2A 1NGPH 2J71A 4LHJB 4OM0L 3O3BA 5DQDL 5IW6A 2XTJE 3TN0A 5KVFL 4QAWA 5F1OB 5FGBA 5FK9B 2E0PA 4YR6B 4YDJB 2DLFL 3KPSE 2DYPD 2BDNH 3D39A 3ES6B 3Q2CA 3GS4A 3IJ8A 1OANA 4KJWC 4KUZH 2WXIA 3ZDYF 4AK1A 4BV1A 3N06B 2JI1A 3MJ8A 3ZO9A 4ALAH 3BXNB 5D2LB 5IBTL 3V6ZA 5JDSB 2A2QT 3KXFA 3WDHA 4OFYD 2BY2A 4OF8A 4XCCL 2X28A 5C09E 1IM9D 5AB9A 2NW3A 2LR4A 5FECA 4CNIA 2D0HA 3L54A 1E65A 2YGOA 2VQ4A 1XHHA 3ECVA 1HHKA 3LVEA 4Q0XH 4YO0A 2FX7L 4JKPH 3APFA 3C8DA 1DJXA 4OCXL 4OD3H 2WINA 5E8EB 4NQEE 3WL9A 1CK0H 1XGRB 1ZLEA 2I07B 4CC0A 2Y07H 3MRQA 1XGYH 4Y5YC 5HDOA 4K3DL 4OQTH 4PY8J 3LRLA 5I26A 2WUCL 2J57A 4XP9L 2EXTA 2R1WB 2D7QA 3RZCD 1ML0A 1SHMA 2YEQA 4KI5C 3VUAA 5D1XC 4P4KD 1RZFL 2WIIB 2YD6A 5J1AB 1IQWH 1A3RL 2FD6H 4OCWH 4PH8A 1YPZB 2C1PB 1QOKA 3RWCA 3CLEH 3U36B 3ZDZE 3I6SA 1ZT7A 2ZCHL 3PL6A 3QJUB 4W9EC 3L1OL 4TSAL 1AQHA 3TBWA 5DDHB 1Y07A 5DF0A 1FLRL 3CZJA 1ILUA 4B9FA 2AJXL 1F4WH 2X70B 3LRHA 3WMQA 1T0NB 2ZKYA 3O2DH 4KI5D 3UTTA 2F19H 2HLEB 4RA0C 3PLYA 2DTMH 5D1XD 1B4RA 3JWNC 5IEHB 1I7ZB 1UUSA 2NXYB 1NEZA 1WBZA 3MLWL 3GSVB 5KUKA 5DHXB 2ED6A 3BFQG 3ZKMD 4U0RB 4OCRL 1ACCA 3TWCH 5MHSE 3BKML 3V95A 1E5UI 2LGNA 4DGUA 2OMUA 1RK0B 1RMFL 4AYFA 4E5XG 1ACXA 2APWA 4ZMPA 2NY3D 2CBOA 1FO0B 2FHFA 4DSYA 3NA9L 3HB3B 4K94H 2NUPB 1CFTB 4HCRA 4HWZB 1L9MA 1I85C 2XZQL 4CMMA 5F6HJ 1XB8A 1L9OA 4Z7NE 1LDPH 3BD5A 2YARA 3FT1A 2SODB 3OXSA 4NQEA 4QCIA 1DBKH 2WLLA 2EP6A 4P3CH 3MNDA 4H2AA 5JPMA 2ZG1A 1O9ZA 1B3IA 5JIPA 2DMGA 5CGYD 5HHME 1SVZA 5BXFB 1OWRM 4BE5A 3L2MA 3DYMA 4GRLA 5I0DA 3W56A 3S4SA 3TO2A 1EJ8A 3O2WL 3ESMA 4Q6YA 3NJGA 3MBEB 1JGDB 4D9QE 1P0SE 2ATKB 3GSNH 4JG0H 2BP3A 3ZTCC 5ESAB 2DJMA 4DAGL 2KZWA 2QQKH 4IMKA 2J7LA 1TEFA 1KB3A 5D1ZC 3KPLB 5DD1L 5EC1A 5FA3A 5AW5B 4K07A 1AHWB 1P4UA 1CN4A 4FFZL 4GSUA 5IBUB 4OZ4B 2OL3H 4PGBA 3STZB 2X1WL 4LASL 5TK4A 2D3LA 4Y9EA 1Z5YD 1MQKH 4OTXL 2IDUA 3WIHA 4LGPB 1FL6B 4LNRB 4PV8B 3KR3L 4N2MA 4PJXF 4DJMA 3MPCA 4KROB 4AZ8B 4KITB 3PREA 5I8OL 4X5XA 4MMZB 3RPIB 1I1AC 5C0DA 1RQ5A 1ZHLB 1X5LA 4JRFA 5ESQB 3W81A 3RY6A 1NCHA 5I24A 4RCAA 3LHPH 3TF4A 2BVPB 2K9FB 4LIQE 5TQ0L 4C59B 3LN9A 3ARTA 1VAHA 2NY6D 1W8OA 3OX8B 2VMJA 1EO7A 3K6SB 3WN5B 3ARUA 4F20A 3MGOA 4FKEA 1HH6B 1UXWB 3ZL2A 3B9KB 3IGAB 3WNLA 2A6KB 5M7QA 1KACB 5AB2A 1GYWA 2FR4A 1LO0L 1U8IA 2VZTA 2BXZA 1NQBA 1N12A 2VDML 1RK7A 4NBYB 4OGYL 2EYRA 1KGJA 1R3IL 3IDXL 3AU1B 4HJEA 5LHDA 1UC6A 5IFAH 3IJSA 2DQGH 2AXFA 4B3VA 2A9NL 2W88A 4FEIA 1GIGH 5TE4H 4QHUA 3TCXA 2ADJB 2QEJA 5C0AB 2A0LD 2FYVA 1VACB 2WTRA 4U1MA 4Y7OC 5LWYH 1XGZA 1CLYH 5EU6E 3WS3A 2R0WH 5JQ6H 3QJRB 1RI8A 3DX6A 4HKBA 1N18A 4NKMA 5CM1A 4WWKB 4U1KA 1JPFA 1UWFA 1KULA 1GKOA 4N22A 5IVZA 1H5BC 1P7QD 3V6FA 4HJ1A 5GGUB 4YHIB 3Q5YA 2R0ZL 4UQ9A 4LBEB 3VFPB 1HTYA 4LSPL 3LD8B 1DBAL 5I8EA 2VXQH 2KS0A 1FYTD 4AEHL 2FECL 4ONOA 5DC9B 1AQDB 3DVNB 1JGEB 1P5VB 2GJ6E 1SMDA 3GRBA 4LFHG 4UV4L 4HKXA 3GMRB 1JWMA 2OTWA 3GM8A 1FIEA 1RUPH 4FDWA 4S1RH 4DP5X 2B1AH 3WFBH 3BQVA 4P5MA 3X11B 3HAEB 1J9TA 2VZVA 5FO9B 4TVSa 4NOBA 1JRHI 1R17A 1BQLL 1HCFX 4LT7A 5BMFL 3RJOA 1GCYA 3P9MB 5LO7A 3TESA 4D0BA 2NTFB 2XWCA 1A7QH 3REWB 2DEYX 2W60A 3EDKA 4HEME 1C16B 1G1OA 5G4OA 3W5MA 2VRAA 5DJ6A 3MLTA 4GI6A 4X50A 4MNQB 3MGAA 1KYUA 2FWLB 3NRFA 3QIBD 4U6VH 2Q8BH 4WKZB 4CVXA 4KFZC 2NYZA 3N0AA 3OSVA 4Y7MA 3WGVB 3N41B 4DZBA 3G7TA 5HDBB 2VM4A 3ZKXC 5GSVA 1PZ2A 1COBA 5F3HA 5KSVB 1CE6B 4MD5A 5ICXA 4WTWA 1UQSA 2B14A 3CX5K 2H2PC 3B9EA 4HFUL 1KIRB 1L3NA 1P2CB 4QIRA 1KTLB 5AUMA 5E4IA 4RMSA 4HIPA 5F89B 2KLTA 4WEBL 2EH8H 1QW9A 3KG5A 1L6PA 3T2QA 4E68A 3BP5A 4BDVB 4JFFA 5K9QG 3MOBH 5BRZD 1FBIL 4AK2A 4F24A 4YN3A 2JCWA 1NKGA 3C87A 3P9WB 4R3SB 3ZSSA 4PJ8D 4MB4A 2OAAA 4G6JH 5KSAB 2WLHA 1U3HB 5GGQL 1T03H 2ITFA 1K2DB 3KLLA 4M5YH 3UG4A 3LEXA 4PRHE 3AU0A 3M17A 2IQAA 4OBSA 2O30A 2FD6L 4YZWA 1O9WA 3QWRA 3P0VL 3T65B 2HKFL 4OH2A 4GPVA 1S3RA 3LXUX 5IB1A 1KPVB 2BOBB 2CXGA 3EYQD 4JQIA 3WMSA 4K3GA 2J44A 2Q3ZA 5DGRA 2FQFA 1WVZA 4F8NA 4BQCA 5HYSG 1F4WL 2VZUA 1SXAA 1UEMA 5DMJB 3BRDA 1F6AB 5JLZA 1NDGA 4X6EA 4TQ8A 4X9BA 3WTXA 4ZFGL 4WZ9A 3GEFA 1WH0A 3TO4C 3A6BH 3BMVA 5D96B 4ZMLA 4PLOB 2JKTM 3H3PL 2EDXA 4CSSA 3QK0A 5BJTA 1S7UB 2EDMA 1F86A 3PNWA 5DK0B 2X53A 5D7IF 5DJCA 4W70A 1LNUB 2OYLA 3BUYA 1JCKA 4YE4H 2GK0B 4BEIA 4WHDA 3RWJB 1LDPL 4TOYH 3WIFB 1D6VH 4Z77A 2EXSA 2A38A 3K6IA 5IWLC 5DURB 3SDCD 3A22A 3HZMB 5F71A 1UWGL 5DQJA 3T0XA 4A7GF 2R2EA 1NL0H 1JV2A 1P7BA 1J86A 1TQWA 3DC0A 5DHDA 3FFOA 1GAFH 1CGXA 5AG9A 4YQXL 1GW0A 1L9PA 3O45A 2P5WB 4AOFA 1W91A 1V7NH 2CO6B 1E67A 2VERN 3KS0J 3LN4A 4PHZA 2V4LA 1E4XH 4U4IA 1Z9MA 3L7FA 2J6WA 3DETC 4U1NB 1NICA 4WKXA 1CTNA 1IAII 2FX9L 3J7HA 2ZKWA 5DZ9A 1ZD6A 4QPEA 3EDEA 4LLUB 3QARA 4FA7B 4P3DA 5CD5D 2DWTA 5E8NB 3NRQA 3O3UN 3VXQA 2R8SL 3CFJB 4OGZA 2CBMA 2IADB 4AIEA 1PGRB 2GKIA 2O5ZH 3C60C 3IDUA 4JN1H 1A6AA 4YSAA 2OV0A 4IRJA 1LQBC 4M7LL 3AREC 2CK0L 2BNUB 4M9PA 4BH7B 2NT1A 2Z8RA 4F3FB 5HI5C 2CHDA 2W91A 2H4EA 3KBEA 1TQSA 1I8IA 3IDNA 4X4KA 5ALCH 1DVYA 2BVOA 3ULSB 1MFMA 3PWPD 1HSAB 2ENJA 2AEQH 1SLWA 5CEZH 4HPOL 4JPSA 2Z35B 2OCJA 1G87A 3ARED 3Q8AA 3OMIB 1HT6A 5I6XB 1T89C 3BLPX 4R4FH 5E6RB 4E0RA 1WBXB 4JY6A 2DL9A 4K8RD 4QYOB 3GZKA 2A6IA 3L45A 2KZKA 4TTDC 3D85D 5E5UB 2DAVA 1S7SB 3N42B 2BZ7A 3S34H 2XWEA 3BVNA 4QJ5B 2Q7YA 4UZSA 5HYJB 3ARDD 3VCLA 4U49A 1T22A 3GJFH 4MDIB 5I71C 3ARXA 3PHQB 2DQGL 4GG6B 4UOZA 2IXQB 2UXVA 4XXWA 4BYHA 1MI5E 5FOBB 3CFDA 5IG7B 1J0JA 2JF1A 4OJDH 4U7MA 3L4CA 1BMWA 4NDMA 4L05A 2HFTA 1SN0A 5A6LA 1N4XH 3GMNA 2E9WA 4M6OH 4ZRGA 5C86A 1OQOA 2CRYA 4PWJA 4YSEA 5I9QC 3WY4A 3ARFC 3P2DA 3B2VH 4DEPC 3OGCA 2NX5D 1S9WA 4ZZKA 3D0AA 3QXTA 3QVAA 4BFNA 1XD1A 4JG1L 2OJZH 1TJGL 4ZUWB 3P3TA 4ONFL 1NLBL 4EUPH 2CGYA 4S1RL 4MJID 3W37A 1GGIH 1D5IH 2A73A 3VFVA 1WA0X 4RFEA 4W9GC 4LOVA 2AKRB 1SDDB 5T1LA 3BWAB 4ZX6A 1CQKA 4FFYH 3NRPA 4KTDL 2VDPB 2E7LC 3QW9A 4D9LL 1MHHA 2XPZA 4TRPL 2VDLB 5CEXB 4MZ2A 3WHE0 2X9ZA 3RLSA 5SWZB 4IGBC 3WY3A 3PWLA 4MBOA 5EA0L 3B6SA 2IDCA 3NJIA 4RFNB 1JGUH 4XO9A 3BRFA 2VDRH 1MRFH 2A74C 2ED9A 1HXMB 3VI4B 5IVOA 3HBQA 5EORL 3OJDA 3UYOD 8FABA 2Q20A 3AY2A 3JT0A 5FOJA 4HK0A 3PV6A 3QDJA 2ZOUA 2DI8A 2QDVA 3KGTA 5AD0A 1FFNA 3VMOA 4JCMA 3O6LL 5CF3A 5JZ7C 2XG5A 3CGTA 1XZ0A 2CLZA 3D2UD 4RFOH 3IRPX 3US0A 1MAMH 4B0MB 1K6QH 1AACA 2XVLA 3D7PA 4NJ9L 3BZFB 3OPZH 1MW3A 2EDKA 5I5IA 2JJWA 3PWNB 3EBAA 1MJUH 1MNUL 1BXXA 3VGAC 4S2SB 3VXNA 3G08A 4I3GA 4QTHB 3LS5H 4A7UA 2OX5A 1F4AA 4LLDA 1LE9B 3MACH 1YEKH 1F8TH 2Q76A 2XZCL 4R9HA 5MENB 1FYHB 1MCHA 5TF1H 3WXWL 3TBVA 3RYMA 5F7YC 3GDBA 4UDTB 4FQHB 5CWSA 3T2NL 1OAYL 5ISZB 3DHMA 1MCNA 1GXEA 3HI5L 1VCBC 2YUWA 4JHBA 5FYKD 3P4MA 1FVEA 2K70A 4C55A 1JMZA 3UGUA 5HI3C 1IKFL 3GWJA 4K73A 3N85L 3A47A 1LMKA 1AMXA 4Y2DA 3M88A 1U6AH 2I5YH 1I9IL 2FUQA 4NSKA 2C9PA 1I3VA 4Y5XC 1QUNA 5I6MA 1BQHA 4W4OC 2F1EA 1EEYA 2NY0B 3WE6A 3P0YH 3CH1B 1SXNA 3GSOB 4JFZL 3NTCL 4ZUTA 3HNTL 5LQBL 3ULVE 1KLUA 3NIDF 2Z8VC 2XPYA 4XB8A 4Y19A 2AAAA 1T5WB 3H6AA 5HYQB 2VN7A 5SWSE 4MAYA 1CIDA 3NJXA 4UF7C 4CGUB 1NFAA 5IHZB 1WFOA 2R0LH 3D50A 1ZWIA 3NEOA 3L3KB 1T0MA 3WY1A 1QFWH 4WK4B 4F15C 2YUVA 5L88H 5G4MA 4JFHE 4U1HA 2ZONA 2W1NA 2J8UF 3P11H 4EQ3A 5HGHA 3B3IA 4HWNA 2P9RA 1OCWH 5AKRA 1H15A 4QI3A 4TOYL 1D6VL 1NCIA 1CPUA 1WS8A 3RX7A 4DK5A 2V5YA 5IGXL 1DDHA 1AZRA 2ITDB 1S78D 2FHCA 4CC1A 5J13C 4ERSH 5IVNA 4KQ3H 5GZND 2R29H 1FE8H 1NM4A 3CFCH 3PAVA 1WO2A 4XC1L 5FB8B 2FUTA 5I23A 2XWXA 1YZZA 2VWEC 5KYXA 4GIPD 4C58B 2P5ED 1IZKA 1QYGL 2ICCA 2OFQA 2YPLD 4IOIB 3VA6A 2I27N 1KB5H 1RP8A 2YEZB 3EZ8A 4M8QB 1U8CA 4I0KA 1FNHA 1XH1A 1WAPA 1YMMD 3QWNA 4TNVF 1CLCA 2BSSA 4Z7OF 4KO7A 2Z4QA 4KAQL 3RNQA 3C75A 4LCCB 1X5JA 3TA4D 1Z9NA 2HN7B 1KDJA 4GXVH 5D93C 1LO2H 3FOLB 4J1UB 4L4TD 3VXRD 1PAZA 1G9ML 1AP2B 5FFGA 5IW6B 3O3BB 3DROA 3C5ZC 4KK8D 2I9LA 1S5IL 1DSYA 3TN0B 1Z2KA 4AYEC 3BFWA 5GHWH 3CHOA 3TH2T 2CRIA 4UILL 4N8VA 3ZZLA 3D39B 3W2DH 4ZS7H 3Q9PA 1BBDH 2NQ3A 2L04A 3WJJC 4JNXA 1IAIH 3V6ZB 2L7QA 5IHLB 3FB8A 5IMMA 1QAWA 1UOWA 4BKTC 2J5LB 4FLHA 3O9WB 3CSBA 1F56A 1A9BA 1M57B 3SCMD 1E3ZA 5D71L 5I0YA 2NW3B 3FC8A 5FECB 3L4WA 2EDRA 4CNIB 2I26N 4YO0B 1BDYA 4N8CH 4XZ4A 2DDQH 2AW2A 4X98A 2J6EH 2Y7MA 4TNWF 5I1HL 1K4DA 1YDPA 1V7ML 3WL9B 4AWJC 3OKDA 4Z3HA 5T3ZE 3RZWA 4F1ZA 3MRQB 1TJHH 5FYJL 3SYPA 3PWJA 5DUMH 1A6UL 2HJFA 4J6RH 2V17H 2BM3A 3NGBC 2DWEB 5AZEH 1CGUA 3T0ED 2QTEA 4AW4A 4ZMOA 3MODH 4OF7A 4OLYH 4APQC 3RWCB 4NO0A 4TSCH 2XICA 3OQ3B 1IC7L 1ZT7B 3PL6B 2D2CC 3KHQA 1BM3L 4FQLH 4J3VA 5I28A 1GCFA 1FSKB 3TBWB 2G5RA 4ODHH 3GBEA 2XTJB 1TTUA 1GGBL 4NCC1 3RWEA 1BZ7A 1MCSA 1I8LC 2Y2TA 1ACZA 4ZMNA 4HD9A 3DGCR 1WBZB 4N90E 2VKXA 4AZUA 5HVWA 2ZXBA 5IQ9A 1IGTA 5IKCB 4J2XA 4TSBH 3S88H 2ALWA 1F6LL 4LOFA 3ULUH 2OMUB 4MQ7B 1ZA6A 4AYFB 4KKBC 3MA9H 5JIHA 4F7TA 5G2NA 2FIKA 3UJIL 4BH8A 5C09B 4XNYL 2ICWI 4LKXA 2OSYA 4PG2C 1P7HL 4CMMB 2DQHL 1JGUL 1P4BL 2HLFD 1IEHA 1KIQA 3OXSB 3ZTNL 3N44F 2MQ0A 3MNWA 3FU8A 4NQEB 4QCIB 5GISH 5CR1A 2CUAA 2WLLB 2ZP9A 1ZLDA 3P3YA 5JPMB 2EKSB 2HRGA 4UDUA 2YJQA 4KKBD 1H6FA 1XSIA 3CU7A 2DZEA 4OF3A 5DRXA 2F53A 2V3DA 3D18A 4FNTA 3GC3A 2ZUYA 1YEFL 4NZRH 1XQ4A 3S4SB 3TO2B 1JRHL 1MAML 1HXYA 5BRQA 4XE5B 1WCQA 3D0VB 2GPZA 4H25A 4KOBA 4JKKA 5FHBH 3HS0C 4W68A 5JYMA 5CCHE 1ZHNA 1WS7A 4KJYA 1EV2E 2ADGA 4GKOA 3WSQL 5EZOH 5CU5A 4IIZA 5EC1B 1MCBA 1JGLL 2DKSA 2GAZA 3VXOA 5CSZA 1T7ZA 3BWUF 4HUUA 3AS0A 4EE2A 4PGBB 2X88A 4JM2D 2JMRA 2B1HL 5GRUH 3PJNA 1E28A 3AUVA 4LB8A 5CHNA 4J39A 3FCBA 1KZQA 3PPEA 4KJPC 4PJXE 4JM4H 1JNLH 2QELA 1ZTXE 4U6YA 4U33A 1H3VA 1UT9A 1XB6A 1TYEB 4A7TA 4OSUH 4X5XB 3CZUB 2PP8A 3ILPB 4YBLB 3PGCA 5C0DB 4QRPE 1JNJA 2RIKA 1LM8V 4KWUA 5JXED 1HWWA 1Y6MR 4L4VE 5LGJB 5A2LH 2AK4E 2N3JA 2WCGA 3DX0A 4GIAA 4PLJD 5HHVL 2ZWLT 3DO4A 3MRKB 2WAHA 5E70A 4YSSA 4Q9QH 3CFNA 1UACH 5LBVA 4Z7NB 4J28A 3U4AA 3N40F 4MS6A 4ZMWA 1RUKL 5DD0H 5K9JH 5E6ID 2WLZA 3GLEA 3U4KA 1QR1A 3MGOB 3QG6A 3QHZL 5FYLL 1U91A 1QD0A 5J3HC 2FR4B 2NXZB 3G5ZA 1U8IB 5IESL 1LP9F 1R3LA 4MA8L 4LHUD 4DPAX 2EYRB 4F57H 5G4NA 3QORA 1FIGH 4BZ1A 4JGJA 2KERA 5J4MA 3IJSB 1WUNT 4RSYA 2ZUUA 2AXFB 4QHMA 3ZO0A 3G6DH 4MD0A 4QHUB 1RIVL 1OK0A 4GI8A 3BP6A 4U1MB 2WTRB 2Z6FA 4R83A 2LU4A 3MJ9H 5SX4I 3WS3B 5I1IH 5C07E 5GZOA 2JSFA 1TZ8A 4WGWB 1R3KA 2AJSH 2D7TH 3DX6B 4HKBB 3X3GL 4NKMB 1P84J 5ID1B 4Z76A 4IW4C 4BA0A 1JPFB 1S7XB 5IVZB 3V6FB 3O8XD 4HJ0C 1BMZA 2ZXAA 4PBWD 4C83A 4GLRH 4AY0A 4PY8I 3VDBA 1BPVA 1NPUA 5LNEA 3SYCA 4PJXA 1Q90A 5I8EB 3DDFA 4IJTA 4ODSL 1A3ZA 1E40A 4IDJL 3ZKSD 1GC1L 4A6YA 4UIMA 1KB5L 4HKXB 4JREB 4EKJA 4DUXA 1HILA 1JWMB 1JZHA 4QRPA 2OTWB 2VLMD 4EN3C 25C8H 2PWEA 1LO5B 4P5MB 1L3WA 2EO1A 3NSFA 1MQ8A 4HSAC 1N5AA 2OR8A 1X5IA 5GS1A 2VXSL 3SQOH 4GEIA 4D0BB 1KOAA 4CAGA 3GI9L 3SBQA 4K71C 2W60B 1XAKA 3SBWC 1EXHA 1RH8A 4DEUA 1OP3H 2ZUQC 1SZNA 5DJ6B 3MLTB 1I3RA 5F7MC 5CLYA 3IJ9A 4CDGC 4CVXB 1NDTA 1QI5A 1R3JB 3LDBC 2WNKA 1ECYA 2EECA 2IH3A 3F8UB 2Z8SA 4ZPTA 5E2TH 1X44A 4DZBB 3EO9L 3BGFC 5F3HB 4MD5B 1CI3M 5ICXB 5T5NG 1UQSB 2QPEB 3BJLA 3HE6A 4NNPL 3MLXH 5EU6B 3SJVA 1VFMA 5CCJA 5DMIH 4GBXA 5F6HI 2L7JA 1HH9A 5AUMB 4NZDA 4QY8A 3KYOA 1IE4A 4K9EH 3RDTC 4HJGA 4P59H 4XBGA 4L5FL 3BP5B 4JFFB 5F1NA 1F02I 1QHOA 2QMKA 4Y1SA 3C8KA 5A2FA 4IK6A 2NXYD 4R90H 1G43A 3LYRA 3BKYH 3JTTA 5F72S 2NY1B 2CIIA 4YHKL 1DYZA 4WK0B 4FYTA 5ACMA 2V17L 3CZSA 3HLKA 1FUNA 5CGMA 1THCA 1QFUH 2NNXA 4HOXA 3LEXB 3VAEA 2VLJD 2FB4L 3HB3D 3M17B 2IQAB 5LDUA 4HJSA 4N2CA 5LJYH 3BAIA 2X6UA 1PMYA 1EEZA 4K7PH 4KXZI 5TK2A 2UX6A 4DNLA 4XN8A 3E8VA 2AEPL 1RAMA 2K8QA 3MBEC 3LN5A 4FQLL 1QVOA 5IB1B 1HZHH 4FQ2H 2H6OA 2YD7A 5EEWA 3GS7A 4YDVA 1OLLA 1YG9A 3FZUD 3O81A 1IC4H 1KY7A 2WCPA 1SOXA 5JLZB 1NDGB 4X6EB 3WBDA 1AHWC 2WN2A 2MSPA 2ZXEB 3QH3A 2D73A 5LXGL 4Q14A 4L8DA 1SXCA 1G9MC 3D34A 5DWUL 3MBED 2WYTA 5CU9A 1YEJH 3VYOA 5D7IE 5BJTB 5KTEL 2VDPL 3AROA 3EH1A 3MGTA 4GY4A 1ECZA 3PNWB 5DJCB 5GSRA 4MYPA 5GGSA 5A2KH 5HYFA 2AC0A 3BUYB 2W9DH 4XAKD 3VH8A 5ELIA 4Z77B 5FW8A 4LVNB 1JGVL 3MTRA 4E36A 4CSPA 3SGDH 3ARGB 4FG6D 1DLHA 5DQJB 1O6TA 3H85A 3MVSA 3QUXC 5LCVA 4ELME 3WN5C 2NY7L 3HI6L 3ARYA 4G83A 4KROD 4NRYB 3MLSL 1AMYA 3O45B 4HAFA 1FJ1A 3D5OF 4X6DF 4ABUA 3BPLB 2F5BL 4PRHB 1OSPL 3LN4B 5PAZA 3GRWA 4IBVA 1R24A 3L7FB 4QRRE 2X38A 3DA0A 2YGVA 1C7TA 2D3JA 4EQ2A 1AGFA 1EK3A 2ENSA 4KJQD 1XSJA 5I15H 1UASA 1MW2A 1LWJA 3PAZA 1I3UA 3KEHA 3AQDA 4P3DB 4HZ1A 3WFCL 3B9KD 3VXQB 3LZFH 4Z8FH 3QDGE 3E6FA 3DPDA 3HMWH 3H9HA 1YNKH 4XVOA 5CGBA 3N40P 4IRJB 5DS2A 1N64L 2IDTA 4PRPE 3LD8C 1H3TA 1I7TA 5KVGL 1TZHA 3VXSA 2WJ7A 1ZHBA 4JFPA 5C0AD 2Q87A 4N8PA 3I02A 3HRZA 1I8IB 1T1WA 3IDNB 3ZE2F 5JW3H 1IU1A 5CJXA 2BVOB 2MTPA 5IK3A 5ADOH 5CINL 2X2YA 5D8JH 4WWKD 2JJTC 3EDJA 1A4BA 4IBZA 2XQYA 2HFFA 2YSTA 3LKRA 1S9YA 5K9JL 1YJDL 3BE1H 3EOTH 3ABLB 3K4DA 4HUNB 4JY6B 4Q89A 4XVJL 3TTSA 3BIBX 1S6NA 4I87A 2A6IB 1QQDB 3VMNA 4EAEA 3NCMA 2VLLA 4M5ZH 4NM4L 1N0LA 2BIOA 1ED3B 1JDCA 3BVNB 2Q7YB 4R7DB 4K8RH 5B39A 1YVLA 3VCLB 1FIGL 2D2OA 1QR4A 3GZPA 4Q6IA 4NZ8A 4M48L 5IJVA 4GP8B 3RKDC 4JRYE 1A4JB 2G0LA 3FN0L 3EF4A 3TYGL 5CD3A 3GINA 3E9UA 3D09A 1QA9A 1NLDH 1DANU 4UIKH 3CVHB 15C8H 4AW7A 4NDMB 4LU5L 2WVTA 4QRFA 43CAA 5LG6A 3QDGA 3GMNB 4M8VA 5I1EL 2O4EA 3QCVL 2NYKA 4MDRA 1RZ8A 5I1JL 2RCSH 4FQPA 4U6XA 1WD9A 3OGCB 3SGEI 3NUKA 1U8LA 1P1VA 3LVTA 2CGZA 3N1MC 1KCUH 1S2EA 4M6NL 4WWNA 3G6JE 4FKHA 5KSAC 2A1WH 2A73B 1E5ZA 4RFEB 3VFVB 5SX4H 5KOVC 2V2TA 4DTGL 3F83A 5T1LB 3HHRB 4RBPH 3SDAA 3II3A 1FVDB 2BNRE 1MHHB 3Q8FA 3LRMA 3JV5A 3QP3A 1NUNB 2BX5A 1KPRA 4H88H 3ATBA 1FDLL 4H0GA 3PWLB 1SM3H 4PRAA 5DHMC 3B6SB 4AMKL 4OM1L 1TQCC 3T1FA 1JN6B 1FVCA 1HI6A 3H9ZA 3HMXL 4H20L 1HL4A 2XG4A 3OJDB 3FBQA 5CZVH 5JA9A 8FABB 1U3HD 2EIBA 2ESVE 4HK0B 1AQKH 1L5GA 5J12C 3PV6B 5E2TL 2YZ1A 4KO5A 3IJEA 4JFYB 3GK8L 4N2DA 3ZY7A 7PCYA 1MI5B 5AD0B 1FFNB 1Z9LA 3DKHA 4C54A 3W9DA 3Q1SL 5DRWA 2XG5B 3V79C 4P2AA 2CLZB 2JIXA 3ZT5A 3AZUA 3TP4A 4XXCC 1TR7A 4R8WL 5H4YA 2HX9A 1AZBA 1GKEA 4XBEH 3UTQA 1V5JA 1U2HA 1CICC 1U41A 3BSHA 1YY9C 4M43L 3LEVH 4GG8A 2X0WA 3P4LA 3VXNB 3G08B 2IG2H 1QRNA 3QZWG 3TBYA 1EJOH 1OTSD 3BKYL 1QSEA 3ISYA 4PRBA 5FPIA 3CXHK 2Q76B 2ZKHH 4LSQH 1EXUA 4UV7L 1AGDA 2HRLA 2YC1A 1MCEA 1E9OB 1SLUA 3TBVB 1CZ8H 5L9DL 5CWSB 5IJKA 1IBYA 1IVTA 3P4MB 4ADIA 2VAAA 1FVEB 1E6OL 1DVUA 1CYXA 4BINA 3MXVH 4UMGA 1KYFA 1NCBL 4PB9H 4Y2DB 1GC1C 4NSKB 5A16A 5ANME 3HUJF 4QXVA 5FYKH 4ABWA 4E9LA 1N68A 1QUNB 3MZTA 5DURD 1OVZA 1BQHB 2BW4A 1BAFH 4HKZA 2RBLA 1EEYB 3WE6B 3QHFH 4JQVA 1F0LA 2P47B 4IMLA 2VDOL 4ZUTB 4FQIH 4UOW1 2C3VA 3ZL4L 4M9OA 3L13A 1KLUB 2WZAA 4A1RA 2JK5A 1NC4A 4Y19B 2P5WD 1Q1JH 4MAYB 3MV8D 4AEEA 3MUGA 3P54A 2DLGA 4QHNA 2WWNA 3SKOA 1ZWIB 5CR8A 1UENA 1JZDC 3QQ9D 2B9BA 1T0MB 1NH6A 3QI9B 4JO3L 3WI9A 3NCWA 4PD4J 2NUTA 5AVSB 1TLMA 3V4PH 5HGHB 3B3IB 4OGAD 4HCRL 1HDMA 4YSTA 3H54A 3WENA 3I50H 3BO8A 3WTUA 1H15B 2ADFH 1TSRA 1I9RL 2Z31A 1DSFH 1DDHB 1E4KC 3QUMA 4GOSA 1QACA 4ATWA 4N6QA 2KKQA 1KTJA 5AZ2H 1O7DC 4B41A 1EFXA 1IQDA 2APVA 3W11C 4NGHL 5I6XC 4AGOA 4ZOEA 2V37A 3HZVA 4BHUI 5EPMA 1JK8A 3FRUB 4Y4FC 3VXTA 5EZIH 4PBDA 4AYID 5KYXB 3S48A 1R47A 4OJCA 3LKOA 4L29A 2DQTH 2EIJB 3FAXA 3H4FA 3V6OA 4DFIA 2NZ9C 2HLAA 2JJSC 3QUGA 1N19A 1U8CB 1CLOL 1DANT 4HETA 4Z7OE 1T7XA 1ET8A 2BSSB 3W11D 3QRGH 3UP6A 5I15L 3DSNA 3RNKB 2Z4QB 1JZ3A 4TM9A 2C9VA 4M5TA 1QWNA 4Z8FL 3M8OL 1AKJA 1LK2A 2ITCA 2KMWA 2E4FA 5HYJD 2IAMA 4RLDA 4W9HC 3FQ1A 3AITA 3BRGC 4ABVA 2I9LB 3L4YA 3BDXA 5C2BL 4A2MA 3CVIL 3K1DA 3S5YA 3IPBA 1D5ZA 1RK1A 2BP8A 3R06B 1Q9KA 1YMHA 2J8UA 1G4RA 4N8VB 2OMXA 2H0JA 4LPCA 3T71A 4Z7WF 3KLHC 3PQYE 2UWEF 1BJ1J 2QT6A 1NPJA 5D8JL 2CIKA 1T2QL 5IMMB 1NIBA 1UJ3A 4Q8BA 3TWYA 4I4WA 4RMUA 1A9BB 2Z1KA 4BWUA 1Y6KR 2IWKA 4POZD 3J07A 3HG4A 1PY4A 1BQRA 3O6FB 4KGJA 4JGNA 1FWXA 3ZPDA 5JHLA 1FG2A 2K0RA 3K4AA 2N7BA 4PYHA 2MIZA 5FM8A 5C97A 2EICA 4RFNC 4UQ2A 1K4DB 1YDPB 2X2UA 2B7DT 1RKRA 3OKDB 2GCYA 3WU1A 4YBHA 5ES4B 5AVRB 1XSKA 3MRIB 4PVMA 1F58H 3PWJB 2MMXA 3I6LD 5DD5H 2X6VA 2BWIA 43C9A 3TCTA 3QXVA 4MVBD 4F8QA 3TFKD 4U7KA 3MJ6A 1LVEA 1KPUA 4KY1H 1JZ8A 4MZ3A 1DBJL 4R2GC 3I3BA 3B5TA 4NO0B 2V33A 4WFGD 3US1A 1SN2A 4NAJA 4NPKA 3AT8A 3AY4A 3RWEB 3PRZA 4FNPA 5DQ9A 3K4ZA 1GOHA 1X5XA 4XX1G 1ZGLM 3S36L 4AGLA 1QNIA 1FP5A 3ZDYB 4FG2A 5IQ9B 1IGTB 3ZKNC 1MKFA 4MWFA 4XNUH 1BEXA 1BPLB 3NK4A 2WIMA 3MFFB 2Y23A 4LIQL 1I7RA 1ZA6B 1GL4B 1ID5I 4F7TB 4IHOA 4YFEA 4ZFFA 4LXFA 1OP3K 2FIKB 3K74B 4BH8B 3QFGA 2NY2B 4WJG3 4U3CA 4H88L 4KKAD 4FP8H 5DEZA 4F8PA 3MJWA 3SE3C 4J3OD 1O6VA 1N10A 1KWKA 3JV4A 2EVGA 3AQXA 1KIQB 4DZ8B 1OLZA 4N2HA 1UOVA 3QO0A 4GO9A 3BW9B 4EBQL 5MEND 3MNWB 3IKKA 3LMJL 2NY0C 1QKZL 5B1AB 3RAJL 2XDHA 2AXGA 5ISZD 1YJDC 4D8PA 4M3HA 2Y1AA 4F9LA 5IJCC 5DRXB 2F53B 4UT6H 4A7QA 2EVJA 4UTBA 3D18B 3P73A 4WY7H 1XBDA 3X1BA 5CP7A 5JIKA 3SZ6A 1OW0C 3NJHA 4RRPA 3EHBD 1HXYB 2A6DA 3UDWC 3ALXA 4H25B 3TS8A 1V3LA 2NY0D 1FLTX 2M1KA 1ZHNB 4KJYB 3H8NA 4ODVH 2COVD 3KD4A 4CBZA 4F92B 2OXGA 1JZ7A 2GAZB 3NEEA 4JL1A 4F1SA 3VXOB 2JLLA 5CSZB 5LGHL 4HUUB 1HC1A 1F42A 1A14L 2RR3A 3L4TA 1E28B 2YKKA 5AVXB 2FWOA 1CZ8L 3LXAA 3HBZA 1MCPL 1MHCA 5CHNB 2OZ4L 3TEWA 1W0WB 4DP9X 1RP9A 4YHMH 4ZNEE 2EKJA 4OFKA 4U6YB 5AW3B 4ZFOL 4GRWH 4HC1H 5F0LB 3MXVL 2MWCA 3IT8D 3BVTA 3H0TA 5HDWA 1BVNT 3VGFA 2PPFA 1LWHA 3SOBH 4RMTA 2AP2A 2V3FA 4LARH 1D6EA 1IIIA 4P04A 1W0VA 2CD0A 5FF6A 5FR3A 3DJ9A 1QR1B 2UZIH 1UXLA 3QG6B 4MAZA 5TF0A 4JCLA 4ELDA 1U91B 1PZSA 1WITA 2R69A 1FGVL 1OTTC 1LP9E 3P2BA 5IUCA 1HCZA 3G5ZB 4XMVA 2GITA 5FA4B 3VI3F 4G5ZL 1R3LB 2F15A 2JTYA 4ZD3H 4Y89A 5AAWA 3QORB 4YDIL 1MXDA 3ZYZA 2GBVA 1PEZA 3H42H 1URIA 1KXTA 3P02A 4EOWH 3THML 4QHMB 4MD0B 3CIQA 2ZKMX 2MCPL 3BP6B 5AVQB 4XB3A 2JWYA 3FH5A 3MNVA 5CFHA 3V4VA 1IJNA 1R3KB 2WB7A 3GSRA 4OKVA 1TJIH 3KLAB 4GUPA 4Q56A 4RGND 3WEMA 2P8MA 2HMIC 4LHQB 2VN3A 5CZRA 3L3JA 3O9WC 1ZAGA 3TN0D 4QDGA 4IEFB 5FWRA 4K9EC 4DPCX 2PR4L 4C83B 1F4XL 3K6FA 4MKTA 1L6XA 3HEIB 4P2RA 3GS0A 2BHFA 4WU7A 2NT0A 4EIZC 4PJXB 1MW0A 4WHYH 1IGFL 3L1EA 3SEPA 1KBGH 4G6KL 2OK0L 4A6YB 4I8DA 5IREA 5BO1L 3GJEA 4UIMB 3RKPA 3M45A 1WICA 1HILB 2ZCLH 4FHJA 1OAXH 3ZHFA 2J8HA 4QRPB 5T1KA 3BESR 1H9VA 3KXFD 3RWHA 3QUYC 4CVUA 3B2DC 1QG3A 3CDGA 5BOPA 1ZY9A 4LP4A 4QJ4B 1N5AB 3FQXA 5C08E 5GS1B 4OIAA 2QR0A 3HZYA 2VT0A 5D7KE 1FNSL 2FX8L 2HJLB 5DCCA 2E27L 2MQ3A 5DK2A 4FHKA 4LBAA 1UM6H 3L3DA 1ULVA 1A25A 3PL6C 4N2EA 4PJBE 3ZE0F 4F8LA 2XTJC 5EF3A 3BDBA 2B5IB 3SKNA 1TETL 1B4TA 2DB8A 4HBCL 4ZPTB 2IH3B 4TPRH 5HGAA 1TTRA 1MCIA 1YLBB 3WJLC 5L2KE 4AX3A 1OGSA 1K8DA 5A3ID 4IRZH 3CFIC 4J7RA 1NCAH 3S37H 4I48B 4GBXB 3PL6D 5DLMH 4I89A 2H26A 1BQUA 1HH9B 3NPSC 1BFVL 1KB9J 4HJGB 4XBGB 4HLEA 2AHIA 3U7YL 3ZHLA 4IOFD 4NRZA 1MCLA 4XNXH 1CTOA 3UTTD 4N25A 5JW5A 4M1CC 3ZRCC 3C8KB 2J25A 1JZ4A 4N5EC 4AQZA 4AIOA 1XEDA 3F7KA 3JTTB 5I73B 4KRNA 2DJSA 2CIIB 3GRGA 1UJTA 4K4KA 5DD5L 1CD0A 5C0CA 3CQQA 1J48A 1PCSA 2WBJC 1R4XA 2JB5L 2BS8A 4CL7A 4S1QL 2L7UA 4JZNA 3QXAA 2VNCA 2B3RA 3NZHH 1VGEH 1RZQA 3QQ3B 3CVHL 5C08A 4R96B 1EEZB 4XNZC 2EEFA 3D12B 1FO0H 1MFUA 3FTYA 3LN5B 3VJ6A 4R0LB 4NQED 5EFIA 4JUSA 3WFEH 1MREL 4YDVB 5MERA 2G5BA 4XH2A 2EYTA 3NYKA 4WW2F 3KEDA 2DJ4A 1OP9A 3K2IA 1ONQA 2K1MA 5CJQH 3C5SA 4FQ1H 4IKJA 4L8CA 1OEZW 3JWDL 4RBPK 3ETBF 3JV6A 3WLWD 4GRLD 1YRKA 5L2KA 3QH3B 3DX7B 3FUIA 4L8DB 3IGKA 2ROXA 4EZKA 2M26A 2MRYA 5LN4A 4ONHA 4MZRA 2COQA 2AQ3A 3F7YA 5HHOE 4FXLA 3TIDA 1NGWA 1XXDC 3MGTB 5GSRB 2EIKB 5GGSB 4X6CF 2VM9A 2DD8L 4FP8L 4PSRA 4XCFH 4ANKA 4JO5A 1YECH 4YBLC 3VH8B 1PY9A 4OCYL 3RY6C 2WLNA 4FMFA 3ZXAC 4UOQA 3EOYG 4DW2H 5C0RL 2RALA 3GXPA 2IGFL 5ADPL 5TQ2H 3G3LA 5D2NE 4LLQA 2RA1A 1MIEL 1LXMA 2AEOA 4IIQA 2X4NB 5HVHC 5SWQA 5MHSD 4PJAF 3NJVA 1FZJB 2A9CA 5JA8B 2VYRE 4LQFH 3M1BA 3TBCA 1FJ1B 1G5AA 1KG0A 5A43C 3AXIA 1NMAH 2NXZC 3LIZA 5I2IB 2W8CA 1BOGA 1VRSA 1WAEA 5ILTH 2F8XC 2XWJA 3IM1A 3VG0H 1R24B 2AF2A 3T77A 5D7SH 2A9BA 3F7LA 3CWGA 1DQQA 1AGFB 3F65A 1N70A 3HR6A 2Y6TE 1N6QL 4ZZFA 4LAQH 1BVZA 1MHPH 4Z3EA 4PJHE 2P1YA 35C8H 3NACH 1PX8A 5BVJA 3KJ4B 2NXZD 3E6FB 3IETB 1G9HA 2WNGA 3H9HB 1J1PL 4C4BA 4YL4A 1DQVA 1RLBA 4ZXBA 4PLNC 2LE9A 3SD2A 4KQ4L 2VC2B 4O4YH 4QAMB 1EGJH 4YHML 1I7TB 1Q0YH 1TZHB 4JHWL 4D9QD 1ZHBB 4JFPB 5D7IB 3VXMA 1D7DA 5SX5H 3I02B 3HRZB 1T1WB 1R33A 5BZDA 3KPTA 1N8ZA 5IK3B 2CA4A 5H37H 4P48A 2AXWA 1FH5H 1B2YA 3IN2A 3HG1A 1NCCH 2HFFB 5LAXA 2FNBA 1IBZA 1S9YB 2R1YA 3ZDXF 4K7PX 4O02H 2X6AA 3QEQE 3FYEB 1BFOA 2XYBA 2ZWNA 3INOA 5ITBH 1H6UA 1E4WH 2YN5A 3DBXA 3MZGB 2B59A 3K8MA 3P3RA 1N0LB 3FK3A 3ABZA 4LMQE 4X6DA 5DZAA 3W0WE 4NFBA 1ASOA 5B39B 4XMPL 1FH2A 4PMFA 1GOGA 4PN6A 1SJHA 4Q6IB 5C6TH 5LXVA 1F18A 2QBWA 4UQBA 5HD8C 5IJVB 5EF2A 1YNTF 3ZQ9A 1ETB1 4H8PA 3FO1A 5E94A 5HP5A 1FI8C 3Q5OA 4BKSC 5CD3B 3LS4H 1LGVA 2WMPA 2YPKB 1QA9B 3PP4L 4QRUB 2J43A 3FRPB 2XFGB 3U30B 2JKJA 2QQNL 3EFOA 3D3VA 43CAB 7FABH 3QDGB 4RVBA 1TUPA 1MAKA 3QFDA 4CRPA 1HYSC 1DJSA 1JWSA 1AAJA 3DJTA 4G59C 1EBPA 1RZ8B 4OF0A 4U6XB 1RU9H 2BP5M 2FBOJ 1G7HA 3U9UA 3TTYA 1U8LB 3UPAA 3HS8A 4M93B 4KZEH 2P80A 3ESOA 4OVVA 2G4EA 2ZUXA 1I31A 2VXUH 3MCLH 1NFDE 2YSSB 4M4RA 1QSFA 2V2TB 2CLVA 3LNFA 3SDAB 4U31A 3S97C 2WSPA 4JFFD 3ULVL 1UA3A 4N8UA 1ROCA 2J1ZA 3UOAB 1KPRB 2QSCL 1HNGA 4PRAB 2Q86A 2YBGA 4QD2E 2YHGA 4HGMA 5DJYA 3T1FB 4E5XA 1FVCB 1HI6B 2EDEA 2NY1D 1ILSA 1R1CA 4JHUA 1DLFL 1WAAE 2XG4B 4ZTOH 4ZG1A 4WVRA 4X8JA 5EOCH 3GFUA 4B50A 1N67A 4HV8A 3MRBA 1L5GB 3QQ4B 2QPUA 4B9KC 3IJEB 5AFAA 2OR9H 2VN5A 3OR6A 2V2XA 2XVGA 4L9LA 2AXJA 4JFDE 4BWWA 5KYNA 1SLVA 3QWRD 4ODTL 4JRXE 3W9DB 2E6PA 4XTRC 5D5MF 1MIML 5DRWB 4ZO7A 2JIXB 1FNEA 1WZKA 1DQIA 5B1BB 3AADB 1E9QA 4M62L 1SXSA 4YXLL 2BOCA 3ARZA 3UTQB 4F7CA 2Z9TA 3K8KA 3QC5X 4KFMA 4PWKA 3DJSA 5JOFA 4GG8B 4HEPG 2BPBA 1DHKA 1I85A 4BA8A 4MNGE 1G94A 4KDTC 4OZGE 1QRNB 3TBYB 1FCCA 1WA2X 4PRBB 4YHLH 1OHZA 5D70H 4JCWA 1EXUB 1AGDB 2YC1B 3ARGC 5D1QE 4MJ5B 2BS71 3K2UL 1P4LA 1CL7H 2FGZA 4DKEH 2EE6A 1G0DA 3TEXA 1HHGA 2VAAB 1TZIA 3OKEA 1VGEL 4KX9A 4TVUA 3W38A 1ZSDA 4OI8A 2H32B 3HUJE 3CFMA 1UKSA 1QFOA 5A16B 2WZ0A 1G5GA 4PS7A 3SE8H 3OTTA 2Q3AA 2NZ1A 4HKZB 4PMEA 4AG4H 4DGIL 3RU8L 2X4TB 5D1ZA 4MSWB 3FUDA 4IMLB 3C08H 3GZQA 1F3DJ 2C3VB 4N0CC 2ESVB 2I60H 2J8OA 2IMNA 2JK5B 2ZOLB 1RUAL 3L9RA 1NC4B 2PLTA 1PL3A 1U33A 1PG7H 4MA7L 1T66D 3MUGB 4MXWH 4DIXA 5C0BA 3G6AB 3SKOB 3A6CH 4P99A 3LQAH 2EJ1A 2WCSA 1OF2A 2DQUL 2NUTB 3FU3A 4RAUA 2LFEA 3EOAA 3CX5J 2F7QA 1YEDA 1FFPA 3R4RA 3TH4T 1FFOA 1BZQK 3BO8B 3RFRA 4IOSA 2BMKA 1SFHA 4ZQTA 2VZ3A 2Z31B 4DW2L 4HYTB 1A5FL 2MCMA 1BZ8A 3DXAA 3QUMB 2VDNB 2MCG1 5T3ZL 2QFRA 3AXLB 4FNSA 1AFVL 1TQVA 4IRJD 1VZIA 3FN9A 4M1DH 1TU2A 1QLEB 1IQDB 1EFXB 3O6MH 5KVEH 1TQBB 3UCQA 3HZVB 4CBPA 5EPMB 4YWGH 2CLRA 5KYWA 1JK8B 3VXTB 1IGYA 2YAFA 1LEIA 1DDTA 2CDFA 1B9ZA 1B3JA 1AQMA 3LKOB 4L29B 6PAZA 1P53A 2HLAB 3HUJA 3FUJA 2Y6SC 1AZUA 3EGXA 4PVBA 3NCXA 2MEJB 4I88A 4N2AA 3R0MA 3EUDA 3ZSTA 3NIDB 4POYA 1R5WA 1IX2A 4JDTL 3PJLA 2ENQA 2YD2A 1AKJB 1LK2B 2ITCB 3EYUL 2CBQA 1C1EH 1FORL 2J1YA 3FUMA 4JVWA 4KDWA 1H5BA 2IAMB 4PY7A 4DETA 3BEVA 4APXA 3TPKA 1CG9A 5DUJA 4MGXA 1Q0YL 2DI7A 4XP5L 1D5ZB 1RK1B 4HXBL 2BP8B 4NEHB 4Z7WE 4A2GA 1YMHB 2J8UB 2UWEE 2IGTA 3BH8A 2OMXB 3RVVD 4WWID 32C2A 1M6UA 3JWDC 4FL4C 5F9OH 3C09B 2RMNA 1G6RL 1UJ3B 2APSA 4XP4H 1TYRA 5IFHH 3LEYH 4ETQA 4O02L 3RVWC 1BLIA 2QV4A 3HC4L 3C2SA 4GT0A 3MLZH 2XN2A 3NSCA 4A2EA 2D0GA 2K3HA 2XETA 4XMLH 3KYKL 2MTAA 3U4BH 5HHQA 1FG2B 3JT2A 4PS4H 4J4PC 1OPOA 4ZFZA 1Q9WA 1QTPA 5LAPA 4UQ2B 5EDSA 2FE0A 5JNYA 4AQAA 4E42A 2FBJL 2GCYB 1R3HA 4NKIL 1FAKT 1QBLL 3BOVA 2ZAIA 43C9B 5AWNH 3SYQA 2NR6C 5T1LD 2AI0L 2DQIL 2ZJSH 4Z7OB 2JQAA 4KKCC 4CSTA 1KPUB 1N8OE 3RWGB 2GIYA 3CBKB 2KQNA 2GSGA 4JFEA 4XRCA 5CUSH 1GZQB 4Q2ZA 1QATA 4YDKL 2VDLH 3O41A 3SDDB 2VLRA 4AVJA 1G0XA 4DQOH 1PSKH 4Y9GA 4Y1AE 5DQ9B 3QDJD 5T1DH 2TSAA 1U3NA 2BVYA 1ZTXL 2JLPA 3P9LA 4DFHA 2D7PA 1BQSA 1GGYA 4PSPA 5E5MA 5MI0B 1PIGA 1LLAA 2UWEA 4OAWA 4ONGH 3TU6A 5HYSA 4MWFB 4W9FC 4NQCA 3U1SL 3KWWA 1KCRH 3L2NA 1MUJB 1OCRB 5TDPA 3PCYA 4IHOB 3MLRH 4LAJH 4ZFFB 3I6GA 3EH5B 2LW3A 2HT4D 2VH5H 3TCLA 1N5YH 1ZXQA 3UBXG 2XKNA 2JELH 3FU9A 4M7ZB 3JV4B 1KLGA 2Y5TA 3QO0B 4FA6A 5I16A 1NGXA 3NZ8A 4DGVH 2C4FU 1MJ7H 1JPST 1VFOA 4LSUL 2AXGB 3KPPA 4HDIA 4YXHH 4PJGA 2JKIS 4QF1A 4D8PB 3WFDH 1NA8A 1BX2A 2BCMA 2HVKA 5LNGA 1MJ8L 3P73B 1E43A 4B95C 1JFQH 3QDHA 3TO4A 4AKOA 5CP7B 4MAYC 2E4TA 3WIIL 4Y2DD 3ROOA 1AJ7H 2A6DB 2CE6A 2IWGA 4OZHF 3UO1L 4ENED 4UYQA 3CN4A 3QJHA 3QI9C 2EXWC 1UKQA 2CDGA 1VEMA 4MQXC 4TXVB 3UP1A 3EH4B 2OXGB 3O3AA 4JFVA 3MLUH 5DZVA 3BN9D 1S7RA 4Y19D 1D7BA 3D4GA 5IWLA 2BVQA 4LL9A 2AAVA 4MAYD 4XOEA 2L3BA 1KF9B 3AMLA 3WXVH 3ZOAA 5C7ZA 3VRJA 1NKOA 3RPKA 2FWOB 1U93A 1DFBH 2WQ8A 2BFGA 1MHCB 4FA8A 4H8VA 2O6EA 4XP6L 3AB0B 4MQXD 4OY9A 4LHUG 5LBSH 5INCA 4HXAL 4N24A 4OCSL 3H0TB 5JHMA 3PJSA 2R56H 2IFFL 1A7BA 1V3JA 2Y72A 1OB1B 1S4IA 1K8IA 5SV3A 3T1WA 3TJEL 3EOBA 3T6WA 5L8JB 3N44B 4XCEA 5FGSA 3L6FA 5EIIA 1D6EB 1FL3A 1W0VB 5FF6B 4W9KC 3WEXA 4JHAL 4O58H 1IGML 4D0DB 3H55A 5AYUH 1D5BA 3JTBA 5E4EC 4AV4A 5I66A 2EUZA 3WDIA 2C3WA 3ULVC 3FCUB 3VI3E 1GZHA 4WHYG 1A6WH 3MRFA 3C60A 4MXWL 3OKOA 3ETBJ 4UTCA 3EYSH 1H3XA 1LK3L 1IGJA 5TJWK 2PYEA 3VFGL 3ZYJA 4AVIA 1YQVL 2WW8A 4ZNCD 3MSPA 1HYRC 1KXTB 1RFDL 3ENEA 1VPOL 3H9SE 4KOCA 5HI4D 3V9CA 1DJWA 4N2NA 3LRSA 3ZE1F 1BJMA 5JPNC 1A22B 4FNUA 3D25A 5JUEH 3MNVB 2I69A 3V4VB 2BS9A 4OKVB 2VUKA 3GSRB 4R7VA 2WYZA 4GUPB 1SOKA 4LLMA 2P8MB 5D7LE 5I8KH 4HVBA 3OVUB 4PM1A 1RUQL 3L3JB 1UD8A 4BQ9A 3HPJB 5I30H 2ZWSA 1T89A 2XLLA 3O6FC 5HGGS 3V6BR 3O4LA 4P2RB 4WU7B 5DA0B 3D4YA 5GGVH 2MPVA 3UZVA 3GJEB 4KKNA 2H1XA 4HGWA 3RX5A 5D4QA 5T1KB 4NO2B 3IK2A 3RWHB 3B2UC 2MQGA 3AT9A 4P3WA 4K3JL 4X7EC 3NABH 3EJCA 3CDGB 2G60H 5DMGD 2FLBT 3N5AA 3V5HA 4KTYA 3BUBA 2YD1A 3FQXB 5KBDA 2QR0B 2W0PA 1G6VK 1ORSA 4G8GA 3NDYE 5DVLA 3B2MA 3ZYIA 2PW2A 1DN0B 1XEUA 2R83A 2PTVA 4TQIA 5SX5K 1RVFH 3VI3A 4XPBL 4OZFA 1LP9B 5DK2B 3ZE0E 2VC2L 1L7IL 4XMZA 4LEEA 3TA3A 1CT8A 2WQRA 1I8MA 2A77H 4ZTPH 3ARFA 3SKNB 3K5SA 1UWXH 5FKPA 4YUEH 5DZLA 1BXVA 5HGAB 1SRDA 4FFZA 1XF2A 4GYBA 1YQ2A 1K8DB 3B7UX 1JI2A 1FZMA 2QPSA 2OULB 2PETA 2XN9E 4JFTA 4NO0D 5E2VL 5F7EL 5T3XD 5I0VA 2QQLH 3IRZA 3LEYL 2GBAA 2H26B 2NLJA 5F1SA 4DPRA 3VSVA 2DQDH 5D7LA 2WK2A 2E7LA 3D4ZA 1M42A 3D07A 5IJBC 3V8OA 3KJ6L 4NRZB 2C4FT 4IGBA 4P57A 5JW5B 3E3QE 3MRJA 5I74B 4ECNA 4C57C 1QZ1A 3L4UA 4UNIA 2R9HC 2A74A 2YRBA 3ZT7A 2WOBA 5C0CB 1QASA 4H1LA 1PX3A 4KNQA 2DWSA 5T8IA 4V1DA 3DYOA 1UWEH 4UT9L 1EO8L 4JZNB 3FO9A 1UH2A 2IDSA 3QXAB 2NY2D 1ADQH 4QKTA 1CGSH 3EH2A 5C08B 2CHZA 5GRXG 4GQRA 5K33A 1S9KC 4RISL 4IRSC 2BSBA 2X1XR 4HUXA 3VJ6B 4KGLA 4LDEB 3MI6A 1FRGH 3R1GH 4GRMA 3MUUA 1DJHA 4OVUA 4X6FB 4X9FA 5JW4R 5MERB 2G5BB 4XH2B 2EYTB 5IBUG 4LCVA 4G3YL 2H0FA 1Q1PA 1ONQB 2F53D 3C6LC 1R75A 1TNMA 3C5SB 4KNTA 4YHPA 4L8CB 4B97A 5E9DA 3JV6B 3Q9QA 4I3RH 2V9QA 2X41A 4OW6A 5L2KB 5E9AA 4MFHA 5KJ4A 2EO7A 3TBTB 3ARSA 4ONHB 3BWSA 2HG0A 1L7TL 3TIDB 3BFOA 2BSED 4HT1L 4X6CE 3AQZA 3KVPA 1MRCH 2CG9X 5FKAA 2X7LA 4W9DC 5FHAL 8CGTA 4OZIA 1SQMA 3U2JA 2AVGA 5JORA 1BXUA 1F1AA 2QGCA 1MCWM 4Y5XA 5HHXL 1H0DA 1MCKA 4PJ7E 3F3HA 4XVUD 4GAGL 3WUWG 5KYYB 4WI3A 3OR7B 2G3ZA 4UOJA 1KGWA 1PD6A 3CDZB 4WUKH 4J12A 4IIQB 5EUOF 4DKFH 5SWQB 4IKLA 4PJDE 1FPTL 2C1OA 2NRDA 3M1BB 2MOVA 4WIQA 1RULH 1YUKB 3LB6C 1YO4A 3QWOA 4X4YA 1KG0B 4YHOH 3WIHH 3E1F1 1F90H 1OM3L 2DLEA 5DRZB 4XWOD 1BOGB 2H0EA 2XWJB 3B5HA 4PUBL 3Q6GL 1CF8H 3QORC 5H37G 5H8DA 3T77B 4PVLA 3C9NA 1UXSA 1QTSA 3B9VA 3OPUA 2WZPA 1GGCL 4E41E 4WAFA 2B2XH 3HTLX 2PABA 3S37X 4WW2A 1NCDH 1M1SA 1BFTA 2D7NA 4BK5C 1U8NA 3MRCA 1YEGL 2FEDD 4MMXC 4FZEL 1B0RA 1IUZA 3T3MF 5BVJB 5IBLC 3ZJAA 2DI9A 1BOYA 3ULUF 3R19A 5CKGA 4ZXBB 3QORD 1X4ZA 3QAZB 5DR5H 5AAPA 2DQCH 4HS8H 5INDA 3SYOA 3K6OA 1HKLL 3BP7B 5LBSL 2P45B 3VXMB 4J27A 2NDGA 3IYLW 1UCTA 1MRDH 4X6CA 2OM5A 3U4EB 5D6CA 3BISA 3TZVA 5GZOD 2EEAA 4G7YH 2WM0A 2XUWA 4LPWA 1QNZL 5FO7A 4Z3IA 1T83A 3UADA 4OQTA 4RAHA 3HG1B 2VDQH 4FXTA 3ROLA 3ZDXE 5LAXB 2LLGA 5GGVY 2F61A 2R1YB 1CS6A 4ZW7A 3UTSE 1P1ZA 1BFOB 5D2NB 5GS1C 1KBKA 3LKQA 1BJ8A 1TTAA 4PJAA 3OKLA 2B59B 4HG4K 3NA4A 4X0KB 5ICYA 1OPGL 3IKCA 4X6DB 1A3QA 1B2WH 4FOMA 5CIPA 5BVPL 4HWEL 3C5ZA 2EILB 2F54A 4QRPD 3BLBA 1SJHB 3ZIMA 2XA8H 1GPOH 4YHZL 3FS9A 3FO1B 5E94B 2NY5H 4G6MH 4B5ZA 1S8DA 3WJJA 2WMPB 1HU8A 2O5YH 3CFKA 3CJJA 1KXQA 2XN0A 3OAYH 2VDNL 4MHHG 3NJNA 3EFOB 3D3VB 3RUGF 4GBXC 3QFDB 3L08A 4HCIA 1MWAH 1QLEL 1Z3GH 5BS0E 4GQQA 2WC7A 4L0YA 1XCXA 1JWSB 1VEOA 1D9KA 2P8PA 3ME0A 4LMQI 2VLKE 1BAWA 3NESA 2Q3XA 1G7HB 1I7UA 3A67L 3RX8A 3U9UB 5I1DA 1XXFC 4F33A 1RURH 3ZE2B 1KYDA 2ERJC 5FX3A 2E8YA 5F9JA 3HE6D 5I73C 3SJVD 2WKOF 3ESPA 4FZ8H 4FULA 4DCQA 1QI4A 1QSFB 4M4RB 5F7FA 1SMAA 2CLVB 4G1EA 5TFSL 3FFCA 3QCTH 3MMEA 2XWDA 4APQA 1SFDA 3PU7A 4N0YH 4XNAA 1N0XL 4Q4IA 4MA3B 4RMQA 3EAKA 4FQJL 5CFAA 5DJYB 4E5XB 5EZLB 4R0LC 4RMVA 3VVWA 1YNLL 3BPOB 2AABH 1RIHH 2V8LA 4X8JB 4NCC2 2HYMA 5B7MA 2BIHA 4HV8B 3MRBB 1I8LA 4ZSOE 1HK6A 4FS0A 4AE1A 1GHFH 3LH2L 3H7LA 1EHNA 2OL3A 2V2XB 3KGRA 4L9LB 3QNZA 5D5ME 2PNDA 5EOQL 5I18H 3FFDA 1JZ5A 4ADJA 3VFUA 4GH7B 4MAUL 1LL1A 2QQLL 1S9VA 4M6MH 4FCAA 3KYNA 5EWIL 1E9QB 2XU9A 2HT3C 2BOCB 5T33H 4F7CB 2P8LA 4WO4C 5EEUA 3WNNA 5JOFB 1AR1D 1UADC 2HTLC 1HJCA 4JQIH 4PG2A 1I3GH 2EC8A 4N28A 2R0KL 4FQXC 4ODUA 2HVBA 1UOKA 3IPFA 4N2GA 1TDQA 4OLZH 5I1GL 2YKLH 3KM2A 4EF3A 5JW4N 1B4JL 4LNVA 4QWWC 1YEHH 3ELAT 1P4LB 2ARJQ 4UQEA 3U0WH 1HHGB 2IANA 4AEFA 1JPSL 1ADQL 1MFVA 1TZIB 3OKEB 3FHAA 3DOHA 3DSFL 3QZNA 4UZUA 1EO5A 4KK6D 3RPBA 1S9XA 2QZQA 1R34A 4DWHA 1FRGL 4PS3A 3SKJH 1DEEA 1BD2E 3HS0A 3OM3B 1EAPA 5D1ZB 3M7OA 1HHHA 1L4IA 3QT2A 3TEZA 5E2JA 5KN5A 4F5CE 3B7RL 4JVPA 3RWFA 3L9RB 2X42A 2HFEB 2Y06L 4S1DC 3MA7A 1A2YA 3LZOA 5C92A 2F7RA 2YXWA 1CXIA 4WI5A 3BSZL 5D5MA 2CO1A 5J11C 5C0BB 3B83A 5L4MA 2D0FA 1IAKA 3RBGA 1DTUA 3OKYA 3VQ1C 4LGSB 4Z0XA 3SIKA 4RAUB 1SUHA 4Y88A 2XRAH 2H45A 3EOAB 4I0PA 1F3JB 3KWVA 1FFPB 1U0QA 1FFOB 6TAAA 5CJXC 2BMKB 1WGOA 2VZ1A 1UCBH 1GY2A 4XXDA 3WTTA 4NHUA 3DXAB 2GI7A 2F7PA 4KH2A 4BQ8A 1VKXA 1KJ2L 1TU2B 1XDTT 3TV8A 4OJFH 5GRJH 4JJOA 3T3PF 3VD9A 1Z9PA 5D1QB 3VXSD 4OR1A 1EMTL 3GM0A 2CLRB 3E8UL 1LEIB 1IGYB 5I5MA 2YAOA 1JZFA 4MB1A 3ASWA 2RD0A 1SOSA 5GS2D 2CDFB 2XOTA 3ZVVA 2JKWA 2GI0A 1XB3A 3VQLA 2AJUL 4TUKL 2P3YA 3QHTC 4UAOC 3HUJB 1AANA 2X3AA 1JDAA 2NCEA 4JFWA 3EBGA 1L9NA 2FHBA 3EJQA 1ZT1A 3EGXB 4YDJA 2C7FA 3COOA 1BD2A 4RGOL 4C4UA 1MW1A 2EUWA 2E9IA 2DLHA 3A4EA 3LNDA 4P9ML 2YPVL 1EZVY 5KBLA 3BXNA 2K3TA 4B7IA 3U30C 5KS9E 1H6EA 2RB8A 1A7RH 1UM5L 1LEKB 3CPLB 3X17A 4M7KL 4NXSA 3BEVB 1UFUA 3FONA 2K7QA 2DMBA 3SPCA 1DVXA 4APXB 1E8XA 5A6MA 3DUUA 4F58H 1CG9B 5FM5O 3CK0H 4FJZA 1MCOH 2CGRH 5JHDE 2HH0L 1MRDL 1NGZB 3I2CL 3UJJH 5K9QI 1CFBA 1FC2D 1HNFA 1E8YA 3TIEA 1HINH 2N7AA 2R4RH 32C2B 3HC0A 1U4FA 4WRLA 3QFJA 4EN3A 2VDQL 1NJ9A 2EDNA 3QDGD 3U9WA 4NKQB 4ZMQA 1MVUA 2HT2D 2Y25A 5CCKL 1QZNA 4DO4A 2W38A 5FCSH 5E08H 2L7EA 4GEJA 3QISA 3NSYA 4G6AC 3X1FA 4CJ1A 1IARB 2R51A 3O4OB 3TASA 5HHQB 2C1PA 1L0YA 4TULH 3PS6A 1B2WL 1ZS8A 1Q9WB 4WSJA 1YYMH 2JQMA 4ZFZB 3SBWA 5JNYB 4AQAB 3ZDZF 4TKWA 4E42B 1CDGA 1JV5B 2BK8A 2H47C 3BUIA 3INUL 3NCYS 1GPOL 1R3HB 1FV1A 3LKNA 2ZUSA 4ZI8A 4NT6A 1PG7X 2JXMA 3QO1B 5DUBB 3SDAD 2NY5L 4G6AD 4E2OA 3V4VL 4H0LC 1FFRA 2GSGB 4BXVA 1LMIA 2EE9A 2Z34A 3ET9F 2JH2A 4JFEB 4LSSH 4XRCB 2WZ5A 3HN8A 3S35L 2P48B 3AMKA 2NNFA 1NKRA 3O41B 3GKZA 3KM1A 2DEXX 3RDJA 3RDTA 3IJHA 5BUAA 1OKEA 1WZ1L 2VLRB 3HC3H 3KPQA 1WWBX 2QKIC 2A9DA 3BAJA 1BEYL 1TKWA 4FQCL 3IGFA 5JXAL 1OAZL 3P9LB 3SDYH 4JO2H 5E5MB 4Z7WB 5HGBA 5IW1B 2UWEB 4TUJA 1I9JH 4ETYA 5HYSB 1KXVA 4FZ8L 4NQCB 2JIXD 3KWWB 1KNOA 5TDPB 2HWZL 2N4IA 2GEEA 3I6GB 1XF5A 4X9GA 4I2XA 5IQOA 1DL7H 4RDQF 1WTLA 5EEYA 4WFHD 1QRND 1J7VR 1PLGL 2IFGA 2XHNA 1QSED 2ATKA 1KLGB 2Y5TB 2YIHA 3GNMH 4NUQA 2VR7A 5TE6H 4JDEA 1NGXB 1EEQA 3NZ8B 4NFDA 2J4WL 3KPLA 3KPPB 4XPFH 3PGFL 5I1LA 2MH4A 4WTZG 3UAJC 3CZKA 2A83A 5IROC 1BX2B 2HVKB 1GVIA 1PVHA 1TZAA 2DQJL 4XX5A 4XMTA 4UM9A 3TO4B 2MNJB 1P4IH 1CTMA 5DHYA 3X14A 3ROOB 3OGOE 3EDDA 2Z8WC 2VSKB 1Q9LA 2EIEA 4WI0B 4XVTH 5EB9A 1J5OL 3QJHB 4H8HA 4NHCL 1EUTA 4W6YB 2LVEA 3ECBA 2BRRH 4LRNH 4ZMVA 2CDGB 5BOJA 3DMMB 3RPIA 4NQXB 4N3TA 1I3GL 1NC4D 1S7RB 4ES9A 2OZNA 2Z31C 4TN9A 5DS1A 3V9EA 2BVQB 1OGAE 2H0PA 2AJZA 4LO9A 4YBQC 3X13B 3RTLA 4PB0L 5IF0A 3GHBL 4G11A 3VRJB 2GBTA 4OLZL 4AGQA 3GBMH 1U93B 3FSZA 3QUXA 4XHJC 3WN5A 4ENZA 3GEWB 1KIUA 4DP7X 5AVWB 1JPTH 3KPRE 3KAAA 4LEXH 3TNNB 2C9XA 2UXTA 3TT1H 5INCB 5EO9A 1KY6A 3UX9B 5IB5A 5A2IH 2OP4L 3D51A 3CC1A 3H7BA 3PJSB 1MFCH 4JFSA 4XMKL 2Z31D 4YXKH 3QPQC 5ICZA 2GTZA 4UQIM 3U7WL 3EOBB 3Q2LA 3WD5L 2H6PA 4BFBD 1NMCB 4DGYH 2N1TE 3L6FB 5EIIB 5B1CA 1E4JA 1NIDA 7PAZA 2ADJA 3TJHC 3WEXB 4H0IA 5DT1H 2HRPH 4D2NA 3HFML 5F7NC 2IO5A 4G9FE 2V9RA 3FF8A 4OT1L 3MRFB 1KN2H 3C60B 1IFHH 2HTKC 1ROWA 3OKOB 5DLLA 2IAMC 5BQ7A 1IGJB 2PYEB 3WDJA 1PJ9A 1KFAH 1MVFA 4OZHA 2ZUTA 1PZ5B 2ATAA 1INQA 4YL9A 2KYIA 3ZE1E 5L2JA 2MKLC 4KMTL 2Z7YA 3LRSB 3VG9C 1AQDA 2ZE0A 3DVNA 4U3SB 2ZOKB 3D25B 6CGTA 1A7NL 2BVTA 3ZR5A 3BKJL 2JJTA 1AKJD 1UD4A 4EUPA 4CILA 4LLMB 2IAMD 1NMBH 3OLGA 4WFFE 3X11A 3HAEA 1OGAA 3UC0H 1QFPA 2YQ2A 3P30H 4FFYA 5GRJL 1UZGA 5BZXA 3MU3A 3KPOA 2I85A 1ZA3A 1SYVA 3HOGA 4HJJL 5L6YH 1M6OA 3P9MA 3RG1C 2QVFB 3CXHJ 3QZOA 2XNAA 5AVZB 1OAKH 3WNIA 2X44D 3X1EA 3DV6A 3KPRA 3UZVB 3Q2VA 2DTSA 4JPKL 4HGWB 5I71B 2XI9A 1DBBH 3GXTA 3RVUC 3EFDL 4X5WA 4YSDA 1HEZA 4KKPA 1DQMH 3GI8H 3WIAA 4X80H 2W0KA 2A9ML 3V5HB 4AJ0A 4LOUD 1IV8A 1OV8A 4KY2A 5KSVA 1MCJA 1ORSB 2BNQE 4G8GB 3GBNH 4YOKA 3TM6A 1C8QA 1A8ZA 2VRKA 5C7XL 2A5UA 3KLKA 4G9FA 1Z9OA 2PW2B 4OF5A 3VI3B 1FFTB 4R84A 1WISA 4OZFB 4RWYH 1F00I 4RX4A 4X4ZA 2PKDA 3OLIA 3RVUD 1BCIA 4R4BA 5E8DH 1CT8B 3SDDC 5I9QB 3TA3B 1I8MB 4NQDA 3ARFB 1ZANH 3AY4C 3V2AR 5JW4Q 3B9AA 4DEPB 2VO5A 1NEZG 5FKPB 3UJJL 2KZ1B 2Y7LA 4L18A 2F58H 1XF2B 4C56E 5FUOL 3GLAA 1FZMB 4PJIE 1NUDA 5KSAA 4ZW5A 1O75A 1MF2H 1NOAA 2NLJB 4UBDC 2UVEA 5D7LB 2X3BA 4ZMYA 1UEYA 4WCYL 3VU1A 1YEEL 5T3XH 2E7BA 2A7BA 4HIIA 3AFLA 1QRKA 1KCSL 1C7SA 3VFWA 5F3FA 1E2VA 2E5EA 4MTMA 4NP9A 2PCPA 3HRPA 1UOLA 3WNJA 1B6DA 1JPGA 4QGTA 4P5KA 3OAYK 4H1LB 4R7XA 5AOJA 5EMYA 3WNKA 5M95B 2DF3A 4LGRB 1S7TA 5E8OA 3QZWA 3FO9B 3S4SG 1FHGA 4ZO6A 5JW4M 5KJRH 2FYYA 2ZG3A 2CHWA 4OB5H 3X1NA 4L48A 1Q8MA 3LPPA 1ETZA 4MXQD 4XXCA 1EDQA 4HUXB 4QEGA 3U2SA 1NPNA 3W82A 3SSGA 1CICA 1NEUA 3D8MA 3VB9A 1K4CA 3ZE0B 4RZKA 3VGAB 4AYDC 1B0GA 1J8HA 2EABA 2GK0A 2C7UA 4ANUA 3CH8A 4GQ9H 4YHPB 4KVNL 4JB9L 5E9DB 2ODHA 3LZLA 4OFQA 4RA3A 4HLZH 4RZCB 2DQEH 4NLHA 3E80A 1CFVH 4PJ6A 4JQXC 2IH8A 2XN9B 3F01A 2DL2A 3O2VH 4EEEA 3PGDB 1YEWA 4HK3J 2WXFA 1J18A 5FKAB 3KBFA 4X6BA 4B6ZA 4K5NA 4OI7A 3AQYA 3OHMB 5JORB 3IU4L 1JIBA 3U6XS 1KB5A 4EIGB 2NQDA 1UM4L 4F2EA 2O5NA 5IM7A 4Y5XB 1H0DB 4U1JB 4U1NA 5DD3H 3S3CB 3WNPA 1X5AA 3FQWA 2UX7A 2VTFA 2K4WA 4OI9A 2FZ3B 1J5HA 5EUOE 1AO7D 2B4CH 4JG5A 1XGQA 2X1QA 1OCZB 3I85A 3EBHA 2FEEI 5D72L 3ECWA 5E8NA 2YJLA 4JY5L 3EXLA 2C1OB 2IH9A 1ZLWH 4LSRH 4QXGH 2DM2A 3QWOB 4IBLT 4JO1H 4X4YB 1OCCB 4IJ3C 3TBSA 1S3KL 2H1PL 3GXMA 5K1JA 4BWTA 2LU3A 3BIKA 2E6QA 5AVTB 3G5VB 1IBBA 1MN4A 2WUBH 3CMOH 4F3FA 1JXFA 2TAAA 3C9NB 4F15B 3RY5A 1UXSB 1AHMA 2BRRL 4LRNL 5EO1A 3VFMB 2E9JA 2DS4A 3HKZA 3ZMNA 3LQZB 4PGJA 5FO2A 4WW2B 1DVSA 2NY5C 3RA7H 3IS1X 3GB7B 4UNUA 3T3ME 1CBVH 1U8NB 5HJGA 3MRCB 1B0RB 4G6FB 4LE8A 5TE7H 3ULUE 1E4KA 5GXBB 4MDJB 1A7OH 4A7VA 2B08A 2VR3A 1KEML 2N01B 1DP0A 5J13B 1NAMH 5EDXA 4EI0A 3Q8CA 3ORJA 4GQPH 4LLWA 1ZVYA 1WIOA 1WBXA 4O5LH 2OLDA 4KXBA 4G8FA 3SPJA 5INDB 1J1XH 2XZAL 4HS3A 4Y4FA 4N26A 4XODA 2ZOOA 4M6AA 1GYAA 2LFGA 2J6EA 4ZUVB 4X6CB 2NY4B 5MP6H 1DEDA 1AD0B 4JE4B 4BZ1H 5D6CB 4P06A 3TZVB 4X8XA 4YXKL 5FO7B 2JJSA 2E59A 4XX1E 1KXHA 3ROLB 4DGYL 4XAWL 1YAZA 4NB7A 3NP4A 4GAYA 5CJOH 1ZEAL 5FUCE 3AG3B 3FQUA 1Q72L 5DT1L 5FOBA 4PRIA 4M7JH 5EUOA 3M6DA 4FGMA 4P2RD 3LKQB 4PJAB 2K4AA 3OKLB 2VMEA 3KGSA 3FW6A 5ICYB 3BGMA 3U25A 4KQ0A 2X4SA 4FFWC 3C5ZB 2F54B 5T1KD 4Y4HC 4XOAA 1KV7A 4D7BA 3KMDA 1CFSA 4AYMC 4FABH 4A6YH 1ZLUH 3NFSL 1FAIH 5DXWA 4XC3L 3V0WL 5IQNA 3E38A 1S8DB 2AZAA 2BO0A 4PV9A 1ET7A 3CFKB 5EEXA 3QUZC 3AABA 3RUGE 4ZDHA 3S6CA 1NMBL 4FD0A 3ZZQA 2QVMA 2X05A 4FFWD 5E24E 1HL8A 2O5XL 5D6DC 4QXUL 3WEOA 1O0VA 2XWBA 4NI6A 1D9KB 2P8PB 3ME0B 3EFFA 3N9GH 4XPAH 2AANA 4E9XA 4P2CG 4R4ND 1I7UB 1XF1A 2X5PA 5AW8B 5IMLA 5HPMA 2UVFA 2J12B 1BBJA 1M1XB 5L7XH 4FTVE 5LUMA 4F8OA 2YK1H 5E1GA 4K3HA 5I6NA 2VMDA 4CC4C 4DCQB 3TF7C 1IIKA 2J88H 4UI2A 1NZRA 3ZDXB 4Q97A 1AC0A 2APTA 1N3NA 1T6BX 1LHZA 3MMEB 1MG2C 3OZKA 4IU2A 4OCNC 2GUOB 3C8HA 4JEGB 4F2MA 4IKIA 5H2BB 1H19A 2JKRM 4ZOAA 3U9PL 3VMPA 4KZDL 1PQZA 4LQ1A 4RWYL 3CHPA 2BERA 1QBBA 2EZ0D 2PXYB 4JO4H 2V5MA 3GSNB 2C3GA 3Q01A 2FRGP 3V4UL 2DMKA 4CA4A 5C0CD 4EDWH 3QG7H 5J1TC 1NAKL 1YNTB 1MPAH 2CK2A 3JWOL 2IBZX 4XN1A 1IGCH 2FWUA 3DDGA 4BJLA 5CZXC 2OL3B 4FN0A 1OHQA 3QNZB 5C08D 3FFDB 3VFUB 3RGBA 1S9VB 2DEWX 1F4YL 3A5VA 1RV6X 3KYNB 3LRKA 4AYGA 1IC5H 3LZPA 5BS0B 2P8LB 5DI8A 4OGXH 2BVUA 2E56A 2HAZA 3SE3A 2VLKB 5A2AA 4ANXA 1FYTE 4HMDA 4ODUB 1C12A 1B90A 3L95A 5L2KD 2AQ2A 2X40A 4FTVA 2YAPA 5CZKA 2NQCA 3I9GH 4QT5A 3UMTA 2AFNA 2Y1ZA 4ODXA 1NANI 4Q74A 1A6VL 1BP3B 3F6JA 3ZT6A 1T5WA 2IANB 5BOZG 5HYQA 1UYWH 3ABKB 1JZGA 2AV7B 4XPHL 1CLZL 1E9PA 5ABZA 3OBAA 5KJRL 3SB3A 1KJ3L 1S9XB 6FABL 4HPYH 3UDWA 1CE1L 3VQ2C 3L3KA 3MV9A 2XT1B 3NBNA 1DEEB 3HS0B 4JPWH 4NZTL 2PN5A 1C5CH 3LPGA 1EAPB 1MEXL 1A65A 4KRLB 1XGUA 1HIML 1NBVH 4TS6A 5C0IB 5EBWA 3R7RA 5KN5B 3RWFB 3S35X 2VQTA 3MA7B 1A2YB 1U2CA 1ASPA 1XAUA 4EI6A 3H4HA 4OJEH 5LCVH 5D5MB 4ORGA 4F7MA 3MRLA 4O2EA 4FC3E 5B38A 1H6TA 1U8KA 2F5AL 4I77H 2Y7QA 3FQRA 1IAKB 1Y18B 4Z0XB 1OOWA 3GRWH 1F2QA 3IMBA 4I0PB 2G2RA 4F7EA 1OAQH 5BRZE 4L4JA 2Z4TA 4XXDB 2ID5A 1WQVT 3FCTB 3PE9A 2EDTA 1OT1A 4NHUB 4K3EH 2Y36H 4QNPF 4S1SL 5BV7L 4ZXBD 4RDBA 1S7QB 1VKXB 4K2UL 3C2AH 1KN4H 1RZ7H 3MR9A 1JHLH 3F7VA 2ENPA 5D2NC 3N04A 3VXMD 1YUHB 1RHHA 3DOIA 4JK0D 2WGNB