3TA4D

Small laccase from amycolatopsis sp. atcc 39116 complexed with 1-(3,4-dimethoxyphenyl)-2-(2-methoxyphenoxy)-1,3-dihydroxypropane
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
273
structure length
273
Chain Sequence
GTTRRITMYAEKISDELYGYGLAPGGATVPGPVLEMWEGDTLEIDLVNTTDRVLSLHPHGVDYDVNSDGTLMNGSAVMPGQTRRYTWRSHVGYRRADGSWAEGTAGYWHYHDHAMGTEHGTEGVLKGLYGALVVRRQGDLLPKRQFTVVFNDMMINNRAHHDAPTFEANLGERVEWIAIGHGSNFHTFHLHGHRWLDNRTGMRTSEYDPSPLIDIKDLNPGVSFGFQVIAGEGVGPGMWMYHCHVQNHSDMGMAGMFLVRNADGTMPAGVHEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords small laccase, multi-copper oxidase
publication title Roles of small laccases from Streptomyces in lignin degradation.
pubmed doi rcsb
source organism Amycolatopsis sp. atcc 39116
total genus 79
structure length 273
sequence length 273
chains with identical sequence E, F
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07731 Cu-oxidase_2 Multicopper oxidase
D PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ta4D01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ta4D02
1JVOA 1E5ZA 4A2EA 2EIMB 2AZUA 5I6KA 4F2FA 4NAJA 1AS7A 1M57B 1PLAA 3PPSA 2BW5A 2FQFA 3FU7A 1JZJA 4YSDA 2XLLA 2DY2A 4Q8BA 1NINA 4HCIA 1JXGA 3MX0B 1DZ0A 1JOIA 1NDTA 3X1GA 2EIKB 3X1BA 5B1JC 4JKNA 1JXDA 2IDUA 3OM3B 1SF3A 2J56A 2VM4A 3OD3A 1IUZA 2YARA 4YSOA 5B7MA 2GC7C 4GP5B 1JZGA 2YQBA 2FQDA 4KNTA 5I5MA 3UABA 4ENZA 3ABLB 1NZRA 3EF4A 2HX8A 4E9RA 2OJ1A 1EZLA 1L9TA 1JZHA 2AVFA 3S3DB 1GY1A 2HRGA 3NYKA 3FYEB 4DP9X 3FT0A 1AQ8A 2H3XC 3DTUB 1ZDSA 5D4IA 2H5UA 1E65A 2AANA 5LDUA 2OCCB 3FQ1A 3QJVB 1AACA 4M4RB 1XB3A 4PAZA 1BXVA 1HAWA 1FA4A 1AS6A 1PNDA 2IDQA 1HFUA 4M3HA 5B7EA 2HLEB 3PLYA 1T5KA 1KYAA 2GI0A 1JVLA 3CDZA 2FNWA 1OOWA 4FA7B 5D4HA 2BHFA 4YSAA 2UXFA 4A68A 1OE3A 5I6LA 1GY2A 1GS6X 3WNIA 3L45A 4UF7C 1AZRA 2Y69B 5B1JA 2CJ3A 2HXAA 1ASQA 4G7QB 3FYIB 1SFHA 1J9SA 6PCYA 2BO0A 3ZDWA 2E86A 3S8GB 4QKTA 1KGYE 1JXFA 1BYPA 1NPJA 3T6VA 1W8EA 3UAEA 1PF3A 2BP8A 2UX7A 1OE1A 1PZCA 2OV0A 4DP0X 2R7EA 3AY2A 2YAMA 3NSYA 1F56A 4BXVA 4A2HA 3ASOB 1NIEA 3QJUB 1SFDA 3T6ZA 1A65A 1QLEB 1TU2A 4DP5X 4AKPA 1NICA 5D4JA 3V9CA 3ABGA 4HZ1A 4KO6A 5A7EA 1R1CA 4AKOA 3X1FA 1JZFA 1RKRA 1V54B 2PCYA 2YAFA 4GP4B 4BWUA 2EIJB 1OCZB 3TASA 3GYRA 5TK4A 1PZBA 1KBVA 1GW0A 2MTAA 1KDIA 1J9RA 3AG4B 4HHGA 1KBWA 1CYXA 3AG3B 4HCFA 3WG7B 1SNRA 2VMJA 2HZHA 4MFHA 3NJKA 1J5DA 5AZUA 3S8FB 3DKHA 2XYBA 1IKOP 1WS8A 4GYBA 1A4AA 3PAUA 1WA2X 1E67A 2DWTA 2CUAA 1NIFA 3X2QB 1NWOA 1RZPA 1L9RA 3SBQA 2XXGA 4A66A 2BP8B 3FS9A 2PPDA 4E9YA 2GIMA 2IDSA 2R7EB 1OF0A 2TSAA 3GDCA 4CSZA 2PP9A 1ADWA 3KW8A 2J5WA 2YAPA 1ZPUA 1YLBB 4CSPA 3AG1B 3NJGA 2PPFA 1BEXA 2XV0A 1ZDQA 3NJNA 3X1EA 1V55B 4Q89A 1PAZA 2FQEA 1GR7A 4AZUA 3QJTB 2BP0A 2QT6A 3UACA 1KCBA 1L9QA 1KV7A 2YAQA 1M9WA 3IN2A 1BXUA 4HALA 2IWFA 2XXFA 2TSBA 2DYSB 2GC4C 3WIAA 4N8UA 2BWDA 1ETJA 1XB8A 4E9XA 2X87A 1OV8A 2Q9OA 3OMIB 4DP8X 1CC3A 1PCSA 9PCYA 2EINB 3ZIYA 2A3TA 1PNCA 2GB2A 2N0MA 3SBRA 3U25A 1A3ZA 3CG8A 3FU8A 3QJQB 3G5WA 2AZAA 2CALA 4YVNA 4F2EA 1CYWA 3TBCA 3BQVA 3FU9A 4BXSV 2ZXWB 3HB3B 2VSMB 1VLXA 1NPNA 4TXVB 4KOCA 4BWTA 2ZWNA 2HX7A 2NRDA 1SF5A 2BWIA 1MG2C 3NSDA 5EHFA 1J9TA 2BP0B 4BDVA 2IH9A 1NIBA 1SHWA 4GXFA 3JT2A 4HIPA 4FAAB 4QLWA 1L9SA 3BVDB 2I7SA 2YXVA 1IC0A 4G7RB 3RYMA 4P5SA 3NP4A 1UATA 4YSQA 1PLCA 2GHZA 3WKQA 1W6WA 4WTQA 3GXUB 4YL4A 4YSCA 1ILUA 1B3IA 4F7KA 1OCRB 3AW5A 1DYZA 4A2GA 1ASPA 1BYOA 4DP1X 4HAKA 1AOZA 2UXVA 2PPCA 5I28A 2W88A 1SJMA 2IWEA 2JXMA 3H4FA 1L9OA 2VN3A 2CCWA 2XX1A 4A2DA 5B1BB 1ILSA 7PCYA 2QDVA 1SDDB 6PAZA 1E30A 2IAAC 3DIVA 2VSKB 3IEAA 1NIAA 1GSKA 2B08A 3T6XA 3V9EA 1SHXA 1CUOA 2VW4A 3CVCA 1KCWA 1X9UA 2XX0A 4HCGA 1AZCA 5FC9A 1RCYA 4BDVB 4AKQA 3QPKA 1GS7A 4YSPA 4E9WA 2PP7A 3ABMB 3AZUA 2ZONA 4AI7A 2J57A 1M56B 2YAOA 2HRHA 3FSWA 3FSAA 1J5CA 1QHQA 1PMYA 3AG2B 3FQYA 5B1AB 3ZX1A 2UX6A 4KOBA 2I85A 3FQ2A 2PPAA 2BZ7A 3CVDA 2WSDA 1AANA 1XB6A 1ZV2A 1PZAA 3WI9A 2ZOOA 2LLNA 4E9VA 1JERA 4UANA 3N2JA 1MZZA 4EF3A 1WAEA 4E9SA 1ZIBA 1IBYA 2FQGA 1GYCA 4DP6X 1OE2A 4KNUA 1N70A 4ZK8A 1ZIAA 4GP8B 2MRYA 1AAJA 1GS8A 5F7BA 3TU6A 3T71A 3PCYA 4RH4A 1N68A 1RZQA 1AIZA 4W1TA 3NT0A 5I5JA 1BXAA 3S3CB 1A4BA 4P5RA 1W6LA 1CURA 3EHBB 4DP2X 1TKWA 2PLTA 1URIA 1WS7A 1NWPA 4YVUA 3ZBMA 4A67A 3H56A 5I26A 1WA1X 2GBAA 2X88A 1X9RA 2JFCA 3WKPA 5AFAA 4K9JA 2YXWA 4AX3A 2PCFA 2Y1AA 2FTAA 1PY0A 3HEIB 3NJHA 4DPAX 1AZNA 1BQ5A 3T6WA 4G71B 3ABKB 1A8ZA 2DWSA 2DYRB 1AR1B 1PLBA 5I6NA 3NJMA 1A4CA 4PCYA 1J9QA 7PAZA 4UAHA 1ID2A 3ERXA 2B3IA 3PAVA 5E9NA 3MBWB 3CVBA 1AS8A 1IBZA 1MDAA 5I6MA 4G70B 3NJLA 3UGEA 2YAEA 3QJSB 4BWWA 1ET7A 3FSVA 1HAUA 2AFNA 2XUWA 2UXTA 3TA4D 4YSEA 4WKXA 4BK5C 2YAHA 1NIDA 1SDDA 1BQRA 2W8CA 4L0PB 5IY5B 1TEFA 3FSZA 4E9QA 2IDTA 1BAWA 3IN0A 2FWLB 2XVBA 5I6PA 3D12B 2FJSA 2HX9A 2CBPA 3JTBA 2DV6A 4KO9A 3FU7B 2WO3B 2EILB 5PAZA 3FPXA 3QQXA 2VW7A 3H4HA 1ET5A 3T9WA 3X1NA 4DPBX 5AKRA 3C75A 3NSFA 3NJJA 3OQRA 1QNIA 3EH3B 5ANHA 1MG3C 4DP4X 2BW4A 2P80D 2VM3A 4W9ZA 1AZBA 2IH8A 5I5IA 5TK2A 3N55A 4YSSA 2IWKA 3EH5B 1E5YA 1KDJA 4N4YB 2BZCA 3ASNB 3SQRA 1TEGA 5F7AA 1JZIA 5PCYA 2J55A 2Q5BA 4JHUA 1I53A 1FWXA 1MZYA 1OCCB 1V10A 2XV3A 1OCOB 4YSUA 3QJRB 3NJIA 4KNSA 3IBOA 3SBPA 2QPDB 2FT7A 4DP7X 1NTDA 3IE9A 3WNJA 4GY4A 2QPEB 1ET8A 5B3SB 2I7OA 2VW6A 5B1KA 2XV2A 2WO2B 4X4KA 1AZUA 2XU9A 3KW7A 3S3BB 1AG6A 1WA0X 3NSCA 2FT8A 2JKWA 1AG0A 2P80A 3CZUB 4NB7A 1JZEA 4KO5A 5I6OA 1FFTB 4YSRA 4HHWA 2RACA 4YSTA 2QDWA 3NP3A 5B7FA 3CDZB 4NERA 2IDFA 3NJFA 3UADA 1L9PA 3UAAA 4G7SB 4JHVA 4DPCX 4KO7A 3EH4B 4A2FA 2PPEA 3OMNB 8PAZA 2FT6A 4G72B 3OMAB 1ASOA 1BQKA 3PXLA 3TBBA 2XWZA 3PAZA 2CAKA 2H47C 3FPYA 1EHKB 4E9TA 2PP8A 2UXGA 2GSMB 1XMEB
chains in the Genus database with same CATH superfamily
3TTSA 4KKLD 2V5YA 4OVUA 5CGBA 3ULVC 1ESOA 3FQXA 3A23A 3VXRE 2VZTA 2F7QA 3EO0A 3ML9A 5D2LE 5DLLA 5KSUA 5D8JL 4BH8A 3D4CA 3ZZ1A 4ZUWA 5E2TH 3CQPA 1W0VB 4OV5A 1MHPH 3MYJA 1TYJA 5F0PB 5DRWB 2GBVA 4MNGA 2AC0A 2ZOKB 1ZWIA 4M3KB 1A9EA 4JDZB 3N06B 1KXVA 1RZGA 5ENWB 4ANXA 1W8OA 4PJAF 5ITBH 1WLHA 1JXDA 4PJ5D 3VGFA 4IW4C 5E8DL 2B20A 3OD3A 4RNRB 3ESVF 3FT3B 5EZLB 3LQAC 2VDOH 3DYPA 3FFDB 5C0RL 4AL8H 2BZDA 4ANKA 2R0KH 3RX7A 1CL7I 4JFDA 3C5JB 3BZ4B 3I9IA 2V0AA 1SM3L 4X9HA 3R18A 3STLA 2Z1PA 4HXBH 3U1QA 4L3CA 1OLZA 3G3LA 4GW5B 1NCAL 4HMEA 3B9KD 4NHCL 4S1RH 5HPMA 2H3XC 5IOKA 3V95A 3DXAD 3HNSH 4RFEB 1JPSL 1S5HA 2H5UA 4HIEB 5BCAA 3BCDA 1JV5B 3BKYH 3HZVA 3LEVH 1OP9A 4LFHD 5FGSA 1F4XL 1XB3A 1J5OH 4PJGB 5IWLA 5C2UB 3DV4A 2H6PB 4YHKH 3ESNA 1CICB 2H0PA 4TQHA 1JZ5A 1MN4A 2APWA 4RCAA 4U4BA 5F0LB 2I9TA 1CXKA 3H3BC 3HPLA 3MR9A 1F1AA 4DSYA 3FRPG 3REWA 4POZC 4R4ND 3W2DL 1K2DB 4X6DA 1TZAA 2IGTA 2ZCHH 4NS0A 1H3GA 1CBJA 2DEYX 3EADA 5A3ID 3S4SA 3KHQA 4NC2B 1OGAE 3FB6A 1NDGA 2O26U 3EOBA 1DVZA 3ATDA 3EJRA 4HMDA 4QY8A 5C08B 1RFDL 3BJLA 4JY4B 1P1VA 1LEKA 5DS8B 4Z7NE 2Y69B 1ACCA 2JJSC 3O6FA 3WD5H 1DDHA 1U6AL 4HX1A 3H8NA 3GMRA 4ZSOE 1CGYA 5E4EB 4UTBL 2EQDA 1W8EA 3OMZA 4MX7A 3FT9A 5F9AC 2VLJA 3DJRA 2QVMA 4OD2A 3ULAB 1CFBA 1KN4L 2EE3A 3PRZA 2QSCH 4MXVF 2D3JA 2YD4A 3RE0A 2FATL 4LQFH 1SN5A 4G83A 4G5AA 3L1FA 3TBVB 2PO6B 3GJEA 3TO4D 1J86A 4HZ1A 3U0TA 3KEHA 1RZKH 4RWYL 1ZT7B 5DZNA 4LFHG 2EIJB 2NXYC 3ULUD 2B8OT 2N59A 3Q44A 4X5QA 3E9UA 1KBVA 4XCEA 4C83A 3HR6A 3DYMA 4NN5C 3VFRB 2J1WA 1FNHA 3QUHA 1I7RA 1HJBC 3GZKA 2VR8A 3EDKA 4BBWA 3QFJE 3DA0A 3P54A 4KROC 5C0CD 2BS8A 4MMZA 3W38A 3SE8L 3OPZH 4E36A 3TZVA 1UURA 3SZKC 3KL3A 3OXRA 5DS1A 4A66A 3FS9A 1NFDB 2F74A 1DL7H 4G6MH 1RZ8B 3HMXA 1RIUH 5ICZA 3T4YA 2Z31C 4Z3GA 1ZLWH 4W4NA 3WE1A 3EJSA 4JZNA 4L8BA 5LO7A 5SWQA 5DC0A 2ADYA 5INDB 4BHUA 2YAPA 5GJTH 5KAQG 3F7VA 1BEXA 4GRMA 1MWAB 4KGLA 4AYBA 4JB9L 2XHNA 1WCBB 5T1DH 3LV3B 1T1WB 3GUFA 1DR9A 2VLMD 3NCEB 4LLWA 2Y5TB 5HGGS 5HHME 1YMHA 3P0GB 5FDYA 2D8KA 1IC5H 2X4PB 3B9DA 3LJ3A 3UAJC 3MLYL 1WD8A 3UACA 4OFDA 1MRFL 1F4YH 2EDFA 4I18A 1JPTL 4MD5A 1U41A 3O3DA 2IWFA 1LE5A 5IGXL 2BC4A 4DESA 1J1OL 2HVJB 3WIAA 2IANB 1PDKA 2J8UF 4GXVL 4WI3A 2DMGA 4U1HA 1X7SA 1INEL 1JGEB 3LZNA 1G7JB 1U93A 3FUFA 4RESB 2KI6A 4FFZH 3TPUB 2O30A 3D9AH 3VXPA 2F7OA 3PP3H 4N6RA 4WTXA 5KYXB 1I1RA 4WI2A 4HS8H 2HFFB 2QQLL 2ZCLL 4PJXE 4F8TA 4YEEA 4GG8B 1EWHA 1X7TA 3FU8A 5LGHL 2EE0A 2L7QA 4YVNA 2NSQA 1CYWA 2MMXA 3TBCA 5A2BA 2X7LA 4KXBA 4WU5B 4BXSV 1W0WA 1WSST 2DQEL 4UMSA 2KERA 3TBTB 1UKSA 1QTYT 2DQDH 4NSKA 4RAVA 5JPMB 1MG2C 2DEWX 4EXKA 1O6SB 3OZKA 5HGBA 5GRUL 4ZS7H 1RIHH 3E7JA 3O6KH 3IB4A 5C0BD 1EZUA 2QADB 1A21A 2R23B 2R4RH 1NC2B 1TZGL 4FL4C 5GGSA 4F9PA 1ACZA 4RISH 4GAYA 2XIIA 3CFCL 4JN1L 1DLHB 5GGVH 3SJVE 4LSPL 1UCBH 3IF1A 3T0AA 3JQOB 4HJGA 1B0IA 4TNFA 5J11B 1P4LA 3CZFA 4KVNL 4ZAKD 3HC0A 3Q8BA 2XQBH 5ISZD 4UV7H 2AJSL 2JJUA 1AOZA 1U8OA 1FNGA 5E8OB 4KTDH 2VXQH 1NBCA 2CK0H 1KGXA 2E47A 1P6AB 3NZ8B 5ABZA 1JRHI 3PHOA 2ESVE 1DQDH 3GMOA 4GAAA 3L54A 2FLRT 1A4KB 1X5YA 2HFGL 4X6CB 4LK4A 1BD2B 2OSLA 4WW2B 3MV7E 2F8XC 1MRDH 2UUDH 4IOIB 4XN4A 2BINA 2D2CC 5K1JA 5IMKA 1FI8C 1NIAA 5TQ0H 1YNTF 2XQ0A 3FB8A 4KVCH 4TOYL 1RH8A 3BP7B 1CUOA 4KBPA 4NNYA 1K8IA 4H8VA 3FH7A 3L4YA 4KRPD 3HB3D 4QYOB 1LMIA 3RIFK 3SKUD 1QATA 5IJVB 4YFLF 4U0QB 3QPKA 3GXPA 1UZ6E 1M56B 4Y4HC 4AQOA 4FNUA 1IBGL 3BCFA 3RVWD 3AG2B 3L1OH 3SCMD 2ZKHH 1E6OH 2H0EA 2OYMA 2E46A 3ECQA 1ZHBB 3L3OA 1KXTA 3WGVB 5LJYH 3IE4A 2DYPB 4QHMB 4ZOCA 5SWZD 3N2JA 4OZGA 4PBDA 4TNGA 1J5IA 1IFHH 1U8IA 2ICEB 2SEBB 4LLVA 2WN2A 4Z7UF 4AQ1A 5L2KB 1U8JB 3AADB 1UXMA 4AEHL 4ZK8A 1KYOK 3CAFA 2ADJB 4IDJH 1JZ3A 1FIEA 4PJHA 4MJ2A 5AKTA 3SKMB 3MRBB 2O5XL 1YEGH 3F2LA 3MUY1 4HJEA 1AH1A 4JBSA 3MKKA 4F3FB 1XSJA 1WTGT 5DEFB 5IBLD 4UQEA 4TN9A 4X4ZA 1Z5LB 5CLTA 3JXAA 1DFBH 5EMYA 4JFQA 3SY0A 1URIA 1WS7A 3U36A 2P8LB 2WJ5A 3VRJB 2ED7A 4R6UA 1BECA 3J07A 3MOBL 4ZX3A 4J3TA 4XAWH 4QRQA 2MCAA 1X9RA 5D1QC 4NZTH 2AK1H 2NY2C 1PY0A 1YPZB 2AABL 2XFGB 1MSPA 4V33A 3BSHA 3TONA 2GTQA 2RR3A 3VFMB 4G1EB 5HYQB 3ZKXB 1W91A 1SXZA 3MZGB 3BAIA 4AVJA 3MBWB 1K5WA 3CN3A 1MKFA 4UT9L 3UTSB 3IAGC 1DJWA 1H3WM 3ZR5A 2H9GA 1MVFA 1HCVA 4G70B 4O02L 1SMDA 5KOVC 3RUGB 1F6LL 4PTUB 4KK5C 4N2MA 3N1QC 4PS4L 3MRGB 5KJ7E 2R15A 1Y0LB 2AEPH 2GJRA 2W8CA 1EXUA 5IY5B 3RVUD 2CGRH 3WJLA 1BAWA 2D03H 2P7TB 5B4MD 3RIKA 2APTA 1MWAH 1DVSA 3ARWA 3QORD 5I8KL 2XA8H 2QJDA 3FCTA 1DSWA 4F7PB 1U8LB 3V6FA 1QSEB 3GSNL 4LCIL 3ZDXE 4M4PA 3WFDL 1EAJA 4OLVH 3O2VL 4YK4B 3GLZA 5FHBH 2VISA 2V5RA 5FUZL 3NSFA 4DO5A 4PYGA 2L7JA 4HEMA 4DP4X 1YMME 4MS8D 2OMNA 2VM3A 2WVVB 3KDPB 5KVGL 1KCRL 2F15A 1KCVL 3K2MC 4UM8B 3ZHKA 2PW2B 1T66C 1JGIA 1TZHB 3LTVA 4R7NA 4U05A 3RKDC 4BJLA 1BOGB 3HZ3A 2MNJB 4E41E 3BPOB 4JREC 3S88L 5C0AD 4XNMB 4YNYB 3VGDA 5HHPA 4P99A 2APFA 1G9NC 3Q43A 1OF2B 3L1GA 1NCDH 2EE9A 3PU7A 4NC0B 3V6ZA 1VPOH 3VYOA 4NM8H 1AHWB 2FJFB 1TVHB 4Q97A 5EA0L 5L4MA 1ADQH 3D3VD 3FQRB 2ZNXA 4PN6A 3O9WD 3KBPA 4I9WD 3E6HB 4P4KC 1U2CA 3NABH 4OIFA 4OJCA 3GUTB 4HOXA 3DPBB 5DRWA 1FRGL 1NFIB 4GW1B 4PJ5B 1NGPL 2IBGA 2HJKA 5ENWA 3ZDXF 1J8HD 5HI4C 2TRHA 4IYKA 3WS6A 3X11B 3B2MA 5EOCJ 3QJFA 1PTZA 4HK0A 3FT3A 1Z2KA 4BV1A 3L4CA 2E7BA 5DURD 3UZQB 1TQWA 4K5LA 4Q9RL 2K1MA 2HT3C 3D08A 3V5DA 3ZLQC 5HPOA 3I02B 5ACLA 5I8OL 2A9MH 3BZ4A 5IHWA 1S9KC 3N6YA 3B9KB 3QA3A 3DXAB 4PY7B 5CF3A 5GHWL 3PWJB 1ZEAH 2GSMB 3O6LL 4G8AC 1NCJA 2YFOA 3OR6A 4J3XA 4YHOL 4RFEA 4ILDA 4HIEA 1DLFL 1LJMA 2BOBB 1NLDL 1JV5A 2WBJD 4OQ1A 5EZOH 5F9OL 5KVEH 5IVOA 3VVWA 4U2ZA 3K74B 2DD8H 5FUOL 4N8CH 3ZTDC 4PJGA 3ABZA 4N8PA 2H6PA 2VR3A 1KIRB 2R29A 3FTXA 3NH7L 4FZ8H 1LO4H 1VDGA 1ZANH 2WQ8A 4IU2B 5GSRB 3X1GA 4ZT1A 2YGPA 5B1JC 3ZT5A 3VD9A 2GK0B 1K3ZA 1J0YA 1XF5A 2DM4A 3ULSA 3UBGA 1SF3A 4Q4IA 4GP5B 5F6IB 4WFEE 2HAZA 4NQED 1P7KB 2YQBA 4N0FB 3DI3B 5BNXD 5C08A 3LEYH 4ZW6A 4JY4A 3A6BH 2ZSVA 3RIAK 5DS8A 4GIAA 3L5XL 3QEUA 3F84A 4ELKB 2QQKL 1KZQA 1JZHA 1LLAA 2CDGB 2VR6A 3UG5A 3WKMH 4LGRB 5J13C 4EN3B 2DQTL 3KR3H 1QHOA 4FCAA 1K72A 4XNXH 1AFVL 4DP9X 3IGKA 2BNRD 1UQSB 4X6DE 4TUOA 3ZL4L 4BZ2L 4YDIL 1L9MA 4K3JH 3C5ZC 4XXWA 1BF8A 3MLWH 5DJYA 3TH4T 4LAQL 1T5XA 2PF6A 5FYJL 4MKTA 3VD2A 4NKDB 2K6ZA 2ZYRA 3TO4B 2V5SA 2YUWA 4JFFA 1FA4A 1E43A 3L2MA 2PO6A 1BAGA 5BMFH 4Y9EA 3KLAA 4BQ8A 4FQIH 4HOWA 5B7EA 2HLEB 3L5IA 1CE6B 1NCWH 5BRZE 2HPOA 3BE1H 3ZE1F 1SBSL 1DP0A 4HLZG 3TLRA 3DDGA 3N42F 4NDMB 1MQ8A 1KENH 4ZODA 3ZL2A 1G9EA 3RHWK 5MP6H 2A9DA 2GW5A 3PQYA 5FYKD 5HDBB 5IF0B 2MQ3A 4ZFZB 3VFRA 2AQ3A 1C5BL 4PGDB 4XOEA 3FULA 4U7MA 1XF3B 5I6XB 1X44A 3MLSL 4KJQD 2VDNL 3QFDB 1EV2E 5TE6L 2W0PA 1WBXB 3CIAA 5H4YA 4G7QB 3B7RL 3WIIL 1VACB 3RDTB 4OKVB 2ZUTA 3TN0D 1HXMA 3N1MC 4MB4A 5DMIH 1EVTC 4YDNA 2J88H 1BYPA 4QHUA 4N2EA 4X4XB 2E9BA 1MFAL 4IS6B 1UYWL 1NFDA 1RZ8A 1C12A 1AMYA 4EI6B 5HDLA 1OM3L 4XBGA 1R4XA 4I3GA 1FNSH 4GO9A 1ERNA 5EIVA 1FJ1B 1A02N 3UZVA 1NIEA 2DQFB 1ROWA 4L2YA 3DBSA 4AKOA 5CIPB 4MQ7A 1T1WA 1JDCA 2PABA 2E76C 2Y5TA 3TBSB 4BZ2A 1KBGH 5DHYB 1GGUA 1X5AA 4TSAH 5HVWA 3RTQA 4AMKL 5JIDA 2YEZB 2OTUB 4L4TD 3NUKA 4HKXA 1J9RA 4KH9A 2O61B 2VL5A 1K6QH 4YHZH 5B8CA 4ODHL 5CUSH 4F1SA 2FX7H 2HVJA 1R46A 1KELL 3MFFB 1J5DA 4RRPM 3IMRA 3WNNA 1WZAA 5C9KA 3PL6A 4R2GB 1JGEA 1UWGL 4DN4H 1G7JA 2X1WL 4BK8A 1E67A 4L5FL 4UYPA 3SQOH 4M5ZL 3TPUA 4JGJA 1VF5C 5I18L 4ZOBA 3H1ZA 2WQXA 2Q3AA 2JF1A 3CIQA 3JTSB 3WIHH 3VD1A 3TVMB 2ZKXA 4CGTA 2NYKA 1C5CL 1I8AA 4CRPA 1AGBB 4FHBD 3A24A 3NCYS 4RDQF 2GY7B 2V7NA 1W2KT 4J3OC 4ODVL 1ADQA 1VFMA 1IE4A 1KCUL 4XP6L 3ZE2F 3TBTA 5KYWB 4MHHG 2PYEB 4IDLA 3GMMB 3WTYA 1B4RA 2YLKA 1KUMA 5JPMA 5HGDB 2W91A 2YOCA 2FIRT 1MUJB 4XP1H 4FTVD 4Z3FA 4RAHA 5GGRY 3SYCA 1CXIA 1P5UC 4GG6A 5D2NC 3L4VA 2IDCA 5IESL 4DQOL 1NC2A 3AMKA 3IDXL 2ZG3A 1DLHA 3VA6A 4ERSL 1LWRA 3D4GA 3TCTA 1C08A 2DWXA 3WXVH 1AYRA 3TF7C 4QI3A 4H44C 4M56A 1E8WA 2B4CC 4P46A 2KPNA 3KYOB 1RJCA 3OMIB 2EEFA 1XX9C 5SWSE 4RRPA 5ISZB 4G9FD 3ULVF 1PCSA 1FYTA 4JG0L 4NHUB 2R59A 3PIQB 1CFVH 1UVQB 2VSDA 4M1DH 5CEZE 1AD9B 1MW2A 4IJTA 3GF8A 5E8OA 1G7MA 3QDMB 2RQ8A 4Q9QL 1PCXA 5JXEA 1GGBH 2NCEA 3BAJA 4N22A 4F2EA 3CSTA 4ZX4A 1UXLA 4FQLL 4OCYL 3IKCB 3NSJA 2CD0A 3BQVA 3G5YA 3FU9A 1I1AD 3BT2H 4M43H 4WW2A 3T08A 4TULH 1SLXA 4KRPB 3HB3B 5FGCE 1WD9A 5TF0A 1NBYA 1YAIA 1PD0A 3BP7A 4QYOA 5JW5A 4O9HH 4DW2L 4BKLA 1Q0XL 3F62A 2JCWA 4NZJA 4RQQB 4J27A 4LEXL 1NGQL 5IJVA 3QHTC 8FABB 4PVBA 1NIBA 2QQQA 3QQ3B 5TE4L 1PSKL 4BQ9A 2CRYA 43CAB 3DIDA 4QLWA 4JY5L 4KZEH 1MRCH 3QXDA 3S37L 4X5RA 4CGUB 5SWZB 5JXAH 5E2UL 2J43A 5AB0A 3BUYB 3LIUA 3OSKA 4PJDF 3ZDYF 5I24A 2A7BA 4M6MH 3TV3H 2GHZA 4ENED 5CS7A 4BSWA 2SEBA 4X99A 4N0YL 5L2KA 2G3XA 5JW4N 1GZHC 2PN5A 3B9VA 1V3JA 2VERN 3A21A 1LO3L 4M6AA 1GZQB 2ADJA 2EE2A 3S36L 3P9MB 4D94A 3U82B 3MRBA 4DAGL 4AT6B 4EKJA 1CDHA 3FCUB 4P3DA 7FABH 4EAEA 4RLDA 3ULUH 3ZXAC 1C5DB 5DEFA 4U3XA 1WIOA 5IW1B 5AWNL 5T3XD 3HRZA 2N7SA 4ODWA 1Z5LA 4OZGE 4ZX5A 4APQA 3O3EB 4UZSA 1CI5A 2P8LA 4RMUA 3P4NB 1FN4A 32C2B 4DIXA 2ZJSL 1ZPLA 3OXSA 4TKWA 25C8L 3FT4B 1KJ2B 1CLOL 3AZUA 3K46A 4PJFB 3MV9A 2XFXB 4Q0XL 1YEJL 4I2XB 5EORH 3IVKB 15C8H 2AQ1A 5EEWA 3D48R 3G9AB 4FQQA 1JDAA 1I7ZB 2X4UA 4WFHD 5B1AB 5HYQA 2I85A 3MLRH 1G1YA 3MBWA 5EU4A 4ZZFA 4FNPA 4YN3A 4NZ8A 4Y1AD 4EF3A 2WB7A 3EF7A 4JZJB 3PWVA 4L8SB 3II2A 1SQ2N 1R3KA 2A4EA 3MRGA 1MHCB 1Y0LA 4J4PD 1OE2A 4KNUA 1ZIAA 2BJMH 3V0GA 3QORB 2CLZA 1DVTA 2P7TA 2PR4H 3G6JB 2E56A 4O4YL 4WENB 5F7BA 3VGHA 2AXGB 3PCYA 1N68A 5CIPH 4OU3A 1EHNA 4FYQA 1M1XA 3ZMNA 1FSKC 1ECYA 5EC2B 4AM0B 1BXAA 1L6PA 2HJFB 3CJJA 1W6LA 3W3BA 2J1YA 1EZSA 4IHBA 2HJLB 1N64H 2WQUA 3MLZL 4JVWA 4TS6A 3RWIB 3B6SB 5DVLA 1DQKA 4KK8C 1SVCP 3SKJL 4Y16D 2UZIL 3VSUA 4K3EH 2E6JA 4XC3H 3DLQR 5C92A 2Y4SA 2R2HA 3W37A 3HEIB 5AW1B 1XH1A 2WVVA 3KPLB 4PB9H 1C7TA 2FO4B 2PW2A 5TQ2L 1TZHA 2HTLD 5J57B 1J9QA 7PAZA 3APFA 4KX7A 4XNMA 1Z5YD 2IWGA 3HAEB 3EBHA 3OZ9L 4OD3L 1T1XB 1QYGL 2DAVA 4LVNC 5CJXC 1AQHA 2Z92B 2GHWB 5D70L 4XX5A 3WFBL 1OF2A 3FRPA 4I3SH 3SB3A 1R3LB 4N5EC 2UXTA 3D3VB 2G4GA 4E5XB 1A3RL 3O9WB 4L0PB 4EQ3A 2G9HB 2FJFA 3BX7C 1AVAA 2O6DA 3FQRA 5D7SH 3WIHA 5I0XA 3E6HA 1IC4H 2E8ZA 1IKNC 3GUTA 2K8QA 4HK3N 3DPBA 3OAUH 4GUQA 1J8HB 1NFIA 5HD8D 4GW1A 1LP9F 1NOAA 5C6TH 2ISDA 3HG4A 5KSBA 1Q9LA 3O2WH 4PJ5A 4PPTA 1DBJL 2WZ5A 3EHBD 1OW0A 5DURB 3C75A 1KBKA 1PIFA 1D5ZA 1QPKA 3X11A 2PWFA 1WGOA 4RMVA 3QNXB 3WY1A 4MJID 1DUZB 2DBJA 3UTQB 2PXYC 1I3GL 2COQA 2W60A 2X28A 2HVKA 3DHJA 1F4AA 3VGAC 1MCOH 1NKRA 2Q3ZA 2V6HA 3I02A 2JLLA 3B9KA 2AQQA 3LVEA 5LQBL 2CLRB 1JZIA 3DXAA 2EIZB 1CFQB 4JCMA 1JGDB 4PY7A 1WEJL 2WBJB 4ZUTB 1EBAA 2F0CA 1M7DB 1ZXKA 2KS0A 1OCOB 4YSUA 1RL1A 2D7NA 4KNSA 3SKMA 5DO8A 3FFCB 2BOBA 1A7OH 1SUHA 2BRQA 2QPDB 3OKLB 3IE9A 3E3QE 3BAEH 5HDOA 3G5XB 3S5YA 5EU7C 5B3SB 2BOLA 4Z7QF 4H0IA 2VH5H 1NUNB 3U30B 4LHQB 1AP2A 2K45A 4AW4A 1NCGA 4RX4D 1Q0YH 1WA0X 2Y0SA 4TLSA 3T0EE 2L04A 1KIRA 2LTQB 1E42A 4P5TC 5EIIG 5GSRA 5IBUG 3IXAA 3KPQA 4KO5A 3HJEA 3VCLA 3HCVB 1MLBA 3JWNC 3FN0H 2GSGB 4G3YH 1JTOA 2OI9B 4NQEB 1OSZB 5HGAB 2N1TE 3KL0A 3X12B 4H0GA 4XZUB 5KVGE 2W0FA 4NIYE 3U2IA 1M6UA 2OR7A 5D1ZD 4BFKA 4PJ8B 1R0AH 3EH4B 3QDGE 8PAZA 4X8XA 3BWZA 1XZWA 4NKMB 1IE5A 5CM1A 4LHUB 4H20L 2ZUWA 3TOPA 3TBBA 4ELKA 3ZKMD 2CDGA 4MJJA 2BNRB 3UTPE 4Q9CA 2WB1A 4KQ4H 5IBTL 5C0JA 5TH2A 4DVBA 1G7PB 4Z0BL 3SGKA 1EHKB 2OP4L 3IU4L 4RA3A 2Y7QA 1A6VH 3MBXH 1FBIL 3P77B 1VSCA 2P46B 1CIDA 4PVNA 2ZAGA 3TO4A 4IMKA 4FP8H 1E28A 1EEZB 1JOIA 5DI8B 3F8UB 1IBBA 2JB6B 3DO3A 2R0LL 1QKZH 3MNMA 5FO9A 4Z5RA 4FQPA 2P5WD 1EUTA 3S5LG 1BBDL 1KJ2H 3H42L 4F58H 3TEWA 4NDMA 1OT4A 3APMA 3NPZB 5DD3H 5FV2A 5DUMH 3DJZA 5IF0A 3B56A 4RIRB 2X4RA 4ZFZA 4PGDA 1OEZW 2ZX7A 4JPKL 4JFFE 4L9DA 4Z8FL 3AXLB 5H35B 3GO1L 5IB1A 5C0CA 2NY7L 4G42B 3AU0A 1MOEA 1WBXA 3EF4A 1J05A 3HE7C 4JAMA 4PP2B 1VACA 4OF0A 4OKVA 5IR1B 1XCTA 3U0PB 4OBRA 3KE0A 4ZNEA 2JE8A 4C47A 1BVLA 3OAYH 4IKJA 3O4OB 5C7XH 3NPSB 3PQYE 4N0CD 5I1DB 1HVXA 2LAAA 5IKCA 1XAKA 2IPKB 3JV6B 1MEXL 2VZVA 3GIVA 4D2NA 4XTRD 3IETB 1IAKA 2OCCB 1G7IA 4JKLA 5ALBL 3H7BB 4YOKA 5EEZA 3Q7JA 1FNAA 2FR4B 2Z7YA 3L4TA 3UEQA 4PAZA 1FJ1A 2RD0A 1P5VB 1OAKL 5KSAC 4J5VA 2FL5A 3V0EA 2N1KA 1G0YR 2CK2A 3MROB 3BIBX 3FTSA 5CIPA 4ONGH 1JVLA 5I1IH 3V6OC 1HN1A 3GPEA 4G80B 2JB5H 3IU3B 1DBAL 3TBSA 4L4TB 4FA7B 4HKJB 5DHYA 4XNQB 5HBBA 2EUXA 1AJ7L 1QFWL 5K9OA 5AOMA 4WEMB 1JF6A 1KGIA 1TQSA 2XXMB 2VR7A 3O11A 5HYEA 3BP5B 3C08H 5K5YA 2BMKA 2O61A 5I1HL 3BVTA 1BJ1H 1HZKA 4NRZA 1I4FA 1XCQA 2BS71 1NANH 1AZRA 1NCCH 1SN0A 2XTJB 3HAEH 3IWUA 4J3OF 5DZVA 4Z7OB 3HR5B 4DQAA 1RLBA 3OX8B 4BFFA 3FYIB 1N19A 1F1GA 3GFUA 4M1CD 1EGJL 1DSFL 3F6JA 3MGOA 4RBPH 5A6IA 5I1KL 1JXFA 4IU3A 3T8XB 3LRMA 1I8MB 3CZJA 5E1AB 4S1DC 4ZS6C 1N3NB 4HOMA 1HCYA 4PEEA 4BQBA 4Q6YA 1PS3A 3BZFB 4XGZB 1AGBA 2IOIA 2OXGB 1KTCA 4LSSH 1SFDA 4QHPA 3DJSA 3ESOA 4ZMOA 5DFVD 4I4WB 1NCTA 4AUYA 3BUIA 3MTXA 1TJIH 4ONHB 4YZFE 3BVWA 4XVJH 2YAFA 1L0QA 3NIDB 3W39B 4D9LH 4N1HB 4FTVB 4XNBA 5ESQA 5C0BA 1HKLH 1J0IA 3LKOB 5F7LB 4U1IA 1KC5H 1BVNT 3GYRA 3W9DA 3Q2CA 4JFYA 5TFSL 5A2FA 3BUQA 3VFUA 3TH2T 3WTSA 3U9WA 1IT9H 5EOTA 1HE7A 1NCHA 2EEAA 3RWDB 2HZHA 3MJ8A 3VI3A 4G9FB 2JH2A 5I9QC 4OVVA 4G8EB 4ZAKA 3HI5H 3BH4A 2XWBA 1IQWH 3T2OA 3LH2H 3PAUA 4U33A 5ISZA 4KQ3H 1GYVA 2EABA 3P0VH 4KX9A 3RURA 4NHUA 3UBXI 2MJWA 1P4IH 1YHPA 3D0AA 1AD9A 4EDXB 3QH3B 3SDCC 4GG6E 4W9GC 2DKSA 4E9YA 3SQBB 2EJ1A 1WK0A 2TSAA 3UYPB 3Q1SH 1I1AB 1TO5A 4XNYL 1ADWA 2ROYA 4GQQA 4YHLH 2Q8AL 2BY1A 1ZLWK 4OW6A 2YUVA 1XR8B 2XV0A 2CIIA 2J6EL 4OCSL 5L4FA 3C09B 1GJWA 1X9QA 1FYTE 2D7TH 1NAML 4UIMB 4EQ2A 3SDAD 2BOCB 1V7NH 2K0RA 3VXNA 3ARSA 4RQQA 4AZ8B 2NCMA 3DOSA 4QXTB 3TEUA 5CCGE 3X3FL 5I8CA 3QQ3A 1N9PA 4MDRA 4LSQH 3GPSA 3WFHA 4U0RB 4ANUA 2K4WA 4WCYH 3SCMA 3SBWA 43CAA 3VXSE 2WKOA 3LHPL 2DQGL 3HHSA 1UOVA 4FQHA 5A2AA 2WXFA 4TPRL 2YS4A 4NQQA 5EV7A 2DB8A 2X87A 3QW9A 1IC7H 2Q9OA 4PV9B 1RHFA 3KJ6H 5D71L 5EWIH 1G9HA 2R9HC 4R7DB 3K1KC 2F53E 2VXVH 3R7QA 2IBBA 4OGYL 3WJJA 5H94A 1A3ZA 1EEQA 1NJ9B 3RLSA 1OP4A 4LSUL 3EGDA 4AT6A 4X42A 4XI5C 4WHTA 5JHLH 3A47A 2VAAA 4U6VL 3QUMA 3FO1B 3NRQA 1C5DA 1ZA3B 1WAAA 3JUYA 4E42B 5IW1A 3ALWA 1INDH 4LMQE 3N44F 1BJMA 2ZNWA 4FFYH 5IROC 3EYUH 5ECGA 3S3PA 2HX7A 2NRDA 1KTDB 3O3EA 2CKBB 3WS3A 5I1GL 4GT7A 5CILH 3P4NA 1TLMA 1EMTL 4FNQA 4YHML 3FT4A 1DJSA 1LWJA 1T1ZB 1DQML 3DROB 5BV7B 4KI1A 5FO7A 1CLVA 4I2XA 4JJHA 4K5NA 5L4IA 1XL4A 2BCKB 2KZKA 4AENB 1JGLH 1NMBL 2VN7A 3TBYB 4R5TA 2I7SA 4HBCH 3APDA 4Y1AB 5M95B 2AEQH 4C57C 4KK6C 3TNNB 3WTWA 3LAFA 4G1MB 5E6ID 3RFZB 5L88H 3FHQA 5JPNB 1M3JA 4X7CC 4YSCA 5EU5A 1AC6A 1MHCA 5GZND 4UOW1 1XH2A 3MV9E 4YC2B 5CCKL 4KTYA 1A3LH 1MY7A 1UD4A 3ARBD 4QRRD 5HDQL 2H0JA 5EF2A 4PRHB 1RK1A 2AXGA 2F68X 1VJSA 2QDVA 3L7FB 3MRPA 4LU5L 1I9EA 1MXDA 3L16A 5F8RC 1PU0A 1H5BC 5EC2A 3DX4A 3F83A 4KHTL 2HJFA 2CRZA 5DK2B 5I82A 2K4AA 1FNLA 3MACH 4UT7H 2HJLA 4YL9A 3A4DA 4HOZA 3B6SA 1HH6A 3H3PH 2RB8A 3K2UH 3MRIB 1IJNA 4UQIM 3SGJA 2CJTA 2V33A 1GGCH 1LK2B 2Y3NA 1NMAL 2X9ZA 1IM9D 5CD5C 5KSVB 4FMFA 3EFFB 2GUYA 4M8VA 3DARA 4B0MB 1HYSD 2FO4A 1BQLH 1TT6A 2ZWKA 5C0AA 3TYGL 3SDYH 4FQ2L 5GGTL 1F8TL 2XG4A 3ECVA 2PPAA 3QIBD 3MOQA 3MV01 1FF5A 5CJQH 1SEBB 1TQCB 5KW9H 4H8QA 1RHHA 3HAEA 3FTWA 5IQNA 2Z92A 1V7MH 2P48B 1WAEA 3A3YB 4OSUH 5BPPA 5DT1H 1R3LA 3PP4H 4PJCF 3VMOA 1DBMH 1P6FA 2G9HA 4GP8B 4ZTOL 3CFBB 3WUWB 2H3NB 2Y9RT 4U1SB 4Y2OB 4C54A 5DCCA 3EYVB 5B3JE 3TIEB 1J8HA 2V17L 3S3CB 3MJ7A 1U42A 5AYUH 3MRKA 1AKJD 2X1PA 2V9QA 3BDYH 3EHBB 1R3JB 4V1DD 1VFBA 4I0PA 1AQKL 3HTLX 1XF1A 4LRNH 4MJIB 1IKFH 2EYTB 1AO7D 2FECI 3SPCA 3MCLL 1WA1X 3NAAL 4YO0A 3RIFF 3IDMB 5ESAB 5GRJH 2BLFA 5HI5D 2BX5A 3ETSA 1DUZA 4D0DB 2X2UA 4EVNB 3IFOA 1SJXA 3DETD 3OV6A 2RGSA 5IVXA 1E4XL 1ZY9A 3CXHK 4U1JA 1FFQA 5GGUA 3B5GA 3IXTB 2CLRA 1T22B 2EIZA 2DMCA 5CN1A 1NCUA 1JGDA 3BN3B 2WBJA 1DQLH 3QJSB 4ZUTA 5AAWA 5LVEA 1XMWA 2AFNA 3ILPA 2NPLX 2YAHA 2X2IA 4HIXH 1JGVL 1WISA 3KJ4B 1A7BA 1XSIA 3V0FA 1YEDB 2QVKA 2OMTA 5I6PA 1WFMA 2X6BA 1G43A 2J1ZA 3HHRB 1ZTMA 1H9VA 2CZNA 3DX2A 3U46A 3CMOH 2EUZA 5DVOA 2NOYA 3HJ0A 5EEVA 1A7QL 3PYCA 4UINL 4JE0A 4L4VD 1IGTB 2GSGA 1EO8H 5F97E 1NCNA 3MRFA 4NQEA 5ITFB 3SKOB 3TA3C 1OSZA 4M5TA 5DGRA 3X12A 1DQQB 2XY2A 4R7XA 5DFWH 2Z6FA 1ZLSH 3EJTA 2ZIDA 4NIKB 3I9PA 3U6XS 3LKNA 3FO0L 3WNKA 2Z4QB 3A4AA 2UZPA 4OFQA 3K6NA 5ACZB 1P1ZB 4J6RL 5BJTB 4GLRH 4HXAL 3DX8A 1UB6B 3AB0C 4X80H 2BNRA 3V6OE 1AY1L 1Z1WA 4PJIE 3VJ6A 1YVLA 4BA0A 2ZUSA 3GHPA 1G7PA 1J10A 5DK3A 3BP6A 2H32B 3K4ZA 3Q6GH 4XMWA 5DUBA 1JZ2A 3M8OH 2NNRA 5T3XH 1BZ8A 5TE7L 1B0RB 3L2LA 5LKNA 2FT7A 1QRNB 1U8QB 5CXPA 3GBNH 1A1NA 2X0UA 4GY4A 4HPHA 5L7XH 4R26H 5D7LD 2BIHA 4ZW8A 5E4IA 2VKXA 4RWHA 2I7OA 1RULH 5JW4M 2H2PD 3AS2A 4JE4B 1FH2A 3I6GB 4X6BB 4F15C 1GAFH 2NW2A 4M3JA 2CKBH 5DI8A 2YQ2A 3T5WA 1KBPA 1V3LA 4M7LT 1A6TB 1AXSA 1O9ZA 5HVHC 1KPRA 4KU1A 4O00A 5CBAA 1N4XH 5BV7H 3KVQA 2QDWA 3WTUA 4KV5F 1IVLA 5AW6B 4ZMNA 3K1DA 1MHPL 4RIRA 3EOTH 4G7SB 5EB9A 5I16A 4NJAH 2ZYIA 4QRSB 5H35A 3TN0A 1TVBA 3KPRE 4P9HH 4PP2A 1MJ8H 2XQYK 5CP7B 2OK0H 4PJBB 1E4JA 4K9EH 4MNQE 4EI5C 1G1CA 4E9TA 3BN9C 3VUAA 2PP8A 2VDOL 4PJEB 5I1DA 2EICA 2AJZB 4TUKH 4AL8L 5I6KA 2VQUA 1HXYB 2IPKA 2Y07H 3JV6A 2R0KL 1JCKA 5FM8A 5C97A 2CXKA 4BQCA 4K7PL 2X6VA 1M57B 1IIIA 4K8RD 2YRPA 1MVUB 3H7BA 3PPSA 4N1CA 1HINL 4YXLH 4A7VA 2FR4A 2AITA 2P9RA 3LN5A 3KLQA 3RB5A 3X13A 4ETQB 4D0BB 2WWMD 5IFAH 4TUJB 2WVTA 4NCC2 1EEYB 3OHMB 3VH8B 4PREB 1R33A 4R90L 4QGTA 1J0KA 2H1XA 2PWHA 3PUUA 4KJWC 3CLWA 2VERA 4HS3B 3AMLA 4U4IA 4ZMLA 1HOCA 4L4TA 3O6FC 5BZZA 5E23A 3DVNA 2IDUA 4FG4A 4XNQA 3GJFA 4JRYD 4UQ3B 3PWPA 4F7CA 4OQTA 4CMMA 2GC7C 4B9JA 2X4OB 3FN3A 4OM1H 2BP5M 3U4BH 1BQUA 1VFOA 4QJ3B 5AVXB 3LN4A 3W0WD 5T5FH 2VLME 5KYYB 4KUCD 2P47B 3HR5A 1L9TA 1TQVA 1UXWB 2JLPA 2UY7A 3G5ZB 3QUYB 4RFNC 1UC6A 5TDNA 2JVUA 4DEPC 1HHJB 4LP5A 3UH8A 4WY7H 1N12A 3DIFB 3SYPA 3T8XA 1J5HA 3KGUA 3WHXA 2PETA 3M17B 1N3NA 3FCSB 5D6CB 4JRXE 5HYSG 4HS6B 4XGZA 5T3ZD 3VTAA 3W57A 3ZHNA 4ELME 3QGVA 4AGMA 3WLBB 3WMSA 3MNDA 4ONHA 1GYAA 3W39A 2BNQE 4FTVA 5CZXD 5FFOA 4L48A 4DZ8B 3CFKB 1ETB1 4GQ9H 4XXDB 2QSCL 1XT5A 5MENB 1JZ8A 3KGRA 5IHBA 4HD9A 1KXQE 3BEWA 4HJSA 3E8UH 2HTKC 3RWDA 4FG6D 3L95B 4Y89A 1I85C 2ZSWB 4G9FA 1P0SE 4G8EA 2A83A 2HKFL 2Y2YA 3P02A 4GBXD 5CMAA 6PCYA 5C0BE 3K0YA 4WI6A 3S8GB 4ICWA 1DCLA 4NAQA 3AAZA 5J7CC 4OV6F 2Q20A 4ABVA 4EDXA 2AEOA 2Z4TA 3EXJA 2HRPH 2UWEF 3SQBA 3LD8B 3LPOA 4GRWE 1CL7H 4I89A 2JCCB 1I1AA 2PWGA 2YIHA 4KY1H 1F56A 1MPAL 1X5JA 3LY6A 3VI3E 4FEMA 4XCNA 5DTFB 5IK3A 2G3MA 1MFCH 4I18C 3AXIA 4XPGL 2X70B 1P4BL 3QXUA 3SDAB 3QXAA 3U6RB 2X4SB 1R1CA 3CU7A 2WINA 1DL7L 3C6LC 2TRYA 4G6ML 4FNLH 3QUZD 5J3HC 4GP4B 2MCMA 4EO5A 3VDAA 4UILH 3DSFH 2F1AA 1QUNB 3QVAA 1J7VR 1KJ3L 5E8EB 4AZ8A 5LNDA 4QXGH 2GI7A 3HNTH 1D5RA 5DJ6B 1XGUB 3K8MA 3EH1A 4MWFB 4QXTA 5MERB 4G7VL 5GJTL 5T8IA 1JZ7A 4IOFC 2WQVA 3FRUA 2XN0A 5A43C 1UD2A 3FOLA 3GXTA 1XQ4A 3MO1B 2OR8A 4HGMA 4QRPD 2X12A 1R5WA 5F1KC 3T0XA 5JLZA 1OAZH 4JRFA 1VERA 2CO1A 4JHAH 4L2LA 2H32H 5L0QB 2FEDC 4PV9A 1BM3L 1IC5L 2DWTA 35C8H 3RAJL 3BZEB 3HS0A 3WN5A 3ZTJG 2ARWA 4H26B 5TGBA 1RZPA 3Q2LA 3WKYA 1KYDA 3RPKA 2XXGA 1SJEB 5F88B 2ATPB 5MI0C 2QGCA 4PGEB 2YD2A 4XPAH 2ZUXA 1NJ9A 3WU1A 4XHJC 6CGTA 3RGHA 4CW1B 1OANA 3GXIA 2WLIB 3H9SB 5LN4A 4OUUB 4KK9C 5JQIB 4FFZL 5I30L 3D9AL 1DQTA 3EBIA 3GIZL 3FO1A 3FUKA 1MFEH 4QPEA 4E42A 2YC1B 4HS8L 2ZXCA 3D87B 5F9DC 2BH0A 4EEEA 4MAUL 2ICCA 3EYQC 1YYMH 4J28A 4OZHF 1KTDA 2DL2A 3DURB 4AL8C 4YHPB 2DOCA 3ZE0E 2QT6A 3QBTB 4B0MM 2OJZL 3VRIB 4FULA 1FH5L 1KV7A 4NLHA 3SKNB 1MHEB 5IHHA 1T2XA 1L0XA 4KKBD 1PZUB 4PLKC 4QRTA 3FC8A 2BCKA 4AENA 1EO7A 3MUHL 1IBFA 3P69A 5EO9A 4M8RA 4U6TA 4OLXL 2DQDL 4Z7WB 4Y1AA 4LP4A 1W15A 4M9OA 4WI8A 1CT8B 3TNNA 4ZS7L 2YGQA 3RFZA 1RIVH 2X89D 5JPNA 3HMWH 4J4PA 2R4RL 2P44B 5FW8A 1ZT1A 3TWCH 3O4LB 1JZDC 1MAJA 2ATKB 4DFHA 2D4FA 3ARBB 2BSDA 3QJQB 3UDWA 5GGVL 1M05B 1UCBL 4WVRA 3BGFC 3UIYA 3QUKA 4QNPE 4PRNA 4TVPL 4AQ8A 3L7FA 2YSSA 3D0VB 5F7NC 3FH5A 5FCUL 2E75C 2XQBL 4OGXH 4Y5VB 1AZVA 2VQ4A 4EUPA 1KTLA 5DK2A 2AJXL 4KTDL 2VXQL 2MFNA 3EOYG 4Y16A 3HLAB 1DQDL 3L3OC 4UIKL 3LSOB 1IM9B 1FO0L 3S9DB 4URTB 4NEHB 3J27A 4NP4H 3HA0A 4LAJH 4DZBB 5C8JA 5TQ0L 1SQMA 3IGLA 1OTTD 3VWKD 5DR5H 1O7DC 1WZ1L 5JHDB 3O2DH 5FLVA 3GC3A 4XN2A 1OM9A 1MJJB 3D1MC 3RYMA 1BM7A 5AVRB 4YSQA 1SEBA 5T5FA 2IALA 5DWUL 5JORB 5EIIA 3BP4A 4TNVF 4CMHB 1J0ZA 1DJXA 4UUJB 5IMOA 3RVXD 3RI5K 5JQHC 3C8DA 3C5SB 4GO8A 4IRZH 5F3FA 5D9SA 2HPTA 4JKPL 2QR0B 3MUGB 3GBMH 2HN7B 1E6OL 1JWMB 3CFBA 3EUUA 3WUWA 4U1SA 1MREL 1RZKC 2Q2LA 4B60A 4LRIA 5I0ZA 1JP5A 2ICES 3EYVA 4V1DB 3TIEA 1HQRB 2QLYA 3H85A 4LF3B 4FKEA 3V9EA 2P5ED 3EO9H 4PJ7B 3W5NA 3UJJH 3LRSA 1Z9SA 1C8QA 4ADGA 1DVFC 2N7BA 1H9DA 3QHZL 2ADFH 4MJIA 2EYTA 3QI9C 4I9WE 5F1IA 2WXGA 1ODUA 3IDMA 3V10A 2WQSA 3GS4A 5K9QG 2I32A 3MBEB 3FSWA 2JIXD 3NA9L 4B9GA 4EVNA 4PJ9B 4FFWC 1QSFD 3JVGA 1DFBL 3EDDA 5D93B 4X5LA 2FIKA 3TEXA 3ME0A 5F7EH 3CVDA 4XAWL 1T22A 4IGBD 3MRHB 1ML0A 2ZOOA 4KMTH 2AK1L 2LW3A 3QEQD 2Q3XA 3S5LA 3FTGA 4LDCA 4OCWH 3T0BA 3ILQC 5E00B 5E9AA 4F92B 4DFIA 3UJTH 3C2AH 5IVXE 1WC7B 1KJMB 1YEIH 1MCWM 5AAMC 3SGDH 1YEDA 4RX4A 4E5XG 4YPGB 4DGVL 2IAMC 2ICWI 1JHTA 3Q5YA 1TQBC 5T1LB 5LLIC 1H15B 4KI5C 4LVHB 4HJ0C 1XAUA 5K69A 4K7PY 4LCWD 1AD0A 4L4VB 4XCCH 4MQSB 1ZK5A 2EADA 3VXUE 3GMQB 4OAWB 3CFIC 2MPAH 1T0PB 5D1ZA 3SKOA 3ZBMA 5DD6B 2D03L 4A63A 1LEGB 2Y5QA 5I26A 3U2SB 4NOFA 3HLKA 2JELH 3K6FA 4J2XA 1ZTXL 2CDFA 5GRXG 1KPVB 3UC0H 1BPLB 3QPQD 4FXGB 3ABKB 2Z4QA 3CLFL 4DUVA 4OCXH 1S5IH 2R69H 1A6PA 4OLVL 1WZKA 1H19A 4QTIL 1LL1A 1BP3B 5IQLA 2MWCA 1B88A 4H8UA 2BIIA 1TCMA 1NM4A 4ORZC 2H32A 3GMLA 5KBLA 3THMH 5IV2B 4WKXA 2ZT9C 1GL4B 1SDDA 5ES4B 1IV8A 2BNUB 2RQEA 1F41A 2IDTA 4GRLB 1P84J 3BAYA 1TJGH 3HIZA 3I6GA 3MGAA 2ZF9A 2FCBA 3EYFB 2P5WA 1FCGA 5TF1H 2F5BH 3F12B 4F20A 2DV6A 3ARDD 3TYFA 3VXTA 1YYLH 1A6TA 4I0KA 3GHEH 5FM5M 4Y19D 1VPOL 1T21A 4WKZB 1OAXL 1EQWA 4IBVA 3FJTA 4LEBA 2R1YB 3D2TA 4AITA 1WG3A 3CVHH 5ANHA 3TT1H 1G1KA 3TT3L 3CHOA 3BSZL 3FCBA 5CINH 2EP6A 4HC1L 2HT4D 3HFMH 4NKIL 3UPCA 3PV6B 2IC2A 5TK2A 4NBXB 5KYUB 4QWWC 2RH0A 1NSNH 3A6OA 1WF5A 3SQRA 4YDVA 5FYKE 4LHUG 5PCYA 2ARJB 1UA7A 3P4OB 4FJ6A 5IHZB 2Y7MA 3GINA 1TDQA 2NY4D 2QPFA 4PJEA 5E70A 2E4FA 5LGYA 1CICC 3T3PE 4OZFB 1MZYA 2XV3A 3MLTA 4LGSB 2AJZA 3HOGA 4N25A 4P4RA 5ADPH 2ZP0T 3F65A 1FL6B 5ILTH 1MVUA 4R0LB 3QULB 1QBML 1A7RH 5JIHA 2AMGA 1MJUH 2G2NA 1HT6A 4FMVA 3NSCA 3BT0A 3NCMA 1EEYA 4WDIB 1ZEAL 1G7HB 1A6WL 3KWTA 1M71B 3L3HA 4NLAA 3HUJF 2APVA 3I6KA 4H13C 3EJPA 2RACA 5EZOL 4NI6A 5GPRA 2NQCA 3IDIB 4HUUA 3NP3A 4UQ3A 2DD8L 3GK8L 2Z34A 4X98B 1XH3B 2FUTA 2NY0D 4N8CL 2X4OA 5E4EC 3W0WB 4ZTPL 1FGVH 1RJZB 1BJ8A 1MI5E 4XXWC 1ZANL 2F2HA 4G72B 2VLRD 2NTFA 1JNNL 1A8JH 1TETL 4GOSA 3TIDB 1UXWA 3P0YL 3SDXE 2R0ZH 2V2TA 3VXRD 3CFEA 1YUKB 2PO6C 1U8CA 3FPYA 3O2DA 5JHAA 2UXGA 3DIFA 4GNKB 3PWPE 1BVKB 3RL1A 2GEEA 3VB8A 2EC9T 5KVDH 3M17A 3LEYL 3QCTL 2GJPA 3A6BL 3K6IA 2E27H 5HDWA 5CJ5A 4M9PA 3WUZA 3FCSA 5D6CA 4IRZA 5H37G 4HS6A 4XODA 4YSDA 2Q8BH 4Q8BA 3KR3L 3PHQA 3N9GL 4NQCB 3C60D 4M62H 4WK4B 3U4AA 3M46A 4JW3A 4PBXA 3MLWL 1BEYH 2GTZA 3K72B 4I3RH 3OKEA 1E9OB 4DZ8A 5ALCH 4DERA 2YARA 3I6SA 4RGNB 2EVFA 4AQEB 1Q72H 5E08L 4GAGH 1N6QH 3QG6B 5BMFL 4TM9A 4FQIL 4OLZH 4R5XA 5AKSA 2LV4A 4ALAL 4GBXB 2ZSWA 3X14A 3GSOA 3VW3H 2DM2A 3S35H 1KENL 3S3DB 3T3MF 1L7IH 2RAMA 3T77A 3L48A 2OJEA 3SDXF 1SUJA 1FFPB 4Q58C 5JDJA 3H2WA 4N2GA 5HY9A 1AE6H 2B59B 4IOSA 2ZXDA 3FAXA 1U3NA 1A14L 3QJVB 5IIEB 1KEMH 2AV7B 2C4FT 3GI9L 4A7GA 5CZVL 2P8PA 4NUPA 2J88L 3QUZB 3QWOA 4HWBH 1JWSA 4KFZC 2X4SA 2Z8RA 4E2OA 4PRIE 1DBBL 1JTPA 3CSFA 3RGVB 5F9JA 3VNYA 3RZCB 4JL1A 3ZUCA 1OOWA 5JNYB 2BHFA 1OGAD 2OULB 5KTEH 3IDYB 2WCSA 1XGUA 5DJ6A 4MWFA 2OSWA 5MERA 5GSVB 2DICA 5E5RB 5KS9A 3DUSB 3WN6A 1G0DA 2NR6D 1IVTA 1COBA 1Y6KR 1ASQA 3QEHB 5DUPH 5I66B 1KBGL 4XC1H 5IVZB 4TSAL 3UIZA 2VM9A 1LMKA 4OI9A 4H26A 4PRDB 1SJEA 3ARXA 2ATPA 1K6QL 4GH7B 2WLHA 5CUSL 1CF8H 1CZ8H 4BSVA 5GRWA 3QUGA 4CW1A 5JPMC 1Y1UA 2H2SC 1DVUA 3O81A 5DU7A 3LKQB 4OUUA 3BUPA 4UOJA 3WNOA 1WFIA 3C8KB 3D5OF 2QADC 3LH9A 3FQWB 1JGUH 3L5WB 4J3UA 4S10A 1TU2A 5LBVA 2YC1A 4JFWA 4ZW7A 3GRWL 5CHNA 4JPVH 2R4SH 3MGTB 3DURA 5DD5H 4AGQA 4LCUB 1S3KL 5BO0D 1XD0A 1G7LA 5J11C 4Y0GA 3VB9A 3IJHB 3NZSA 4JO2H 1CB4A 4NYLB 3VRIA 3ZRFC 4N2OA 3HI6H 2MTAA 3CH8A 3QFJD 4HPYH 2X05A 4BFIB 1MHEA 4ZFQA 1H8NA 3PFUA 4DEUA 3EGSB 4F2MA 2GJJA 4W68A 3NJVA 4WK2B 5E6IA 1XCXA 4Z7WA 1I7UB 2AW2A 2FYYA 2XYBA 1A9BA 1CT8A 4OZFH 1XH0A 5DZPA 1K4CB 2OTPA 2EDEA 4WW2C 1BFTA 1YYCA 3U1SH 3VMNA 3QR1A 1MW1A 3WY2A 3CFDB 5BUGA 2F6AA 1FL5B 1GOFA 1A6ZA 1HTYA 4QRRA 3ARBA 2XI9A 4WFHE 3IJYB 2HRLA 3VFWB 1IGIH 3OG4B 1SYSA 3BVNA 4CSPA 4K55A 4H8WH 3D0VA 5C0GB 3M88A 4YH6A 5HHMD 3DOHA 3NN8B 2F19H 4PJHF 1CFVL 4Y5VA 2X3BA 2X5PA 2E9GA 4LPUA 4YBQD 5E8NB 3HLAA 1GGBL 1FV1A 1IM9A 3L3GB 3DWTA 1A6AA 2YPVH 4N24A 1ITCA 3VGGA 1Z3RA 4ZFOL 2CO6B 4OI8A 3VWKB 2ICEC 4DZBA 4TULL 3PJSA 1IFRA 4K5OA 3B4NA 2VLKE 3QIBA 4GS7B 3BHBB 8CGTA 4UU9A 4O9HL 3EFOB 1AIFB 4RAUB 1MJJA 3MRMA 4E9XA 4AV0A 4G9DB 2JK5B 3WXWH 4DP8X 2A6KB 3G04B 3N85H 1VA9A 3N40F 1QLFA 2Z35B 2I5YH 3QR0A 3NIFB 1RUQH 2CSPA 4DPRA 2IXQA 1OARH 1TJHH 4P2RB 2HVBA 3TJHD 5JMOC 1W8NA 3BW9B 5LN8A 2HN7A 1VFAA 3F7RA 1S9XA 2RFXB 3Q8FA 4LIQL 2X1QA 4ZFGL 2W65B 2UYLB 3IRZA 3CZKA 2P5EB 2X4TB 5HI3C 3LZLA 1AKJA 5HHVL 4V1DA 3SEPA 4HDIB 4LF3A 3JUZA 1JFQH 3DVIA 5TDOB 4BE6A 1ZS8A 1MCEA 1AO7A 3ZKXC 2DZEA 2A6IB 2XACC 3ZQWA 1X5ZA 4Z7AA 2X1XR 5E99H 4CDGC 2JIXB 1U3HD 1VGEL 5GQBA 3BOVA 5B1CA 5BOJA 5D5MF 2DLGA 5EO1B 2KDYA 1G1OA 1B6DA 1YUHB 1D7DA 3M1BA 4XMPH 2H7WA 3ETBF 5DZJA 4AYMC 1F90H 2YXVA 4IGBB 4G7RB 4KI5F 4OFPA 4F5CE 3MLVL 3QEQB 4EE2A 3H6AA 2OL3B 5JYMA 5CFHA 4XRCB 1W6WA 5J89A 5A2JH 1UEMA 2YJLA 2ESVD 3Q8CA 2K9FB 3CHSA 2W81C 4LASL 1ED3B 2QHRH 5EORL 1TG8A 5E6UB 1N6UA 4IRJB 4N2AA 2Z8SA 3MV7D 2W88A 5E00A 1SJMA 4ZFOA 3OAZH 4OZIE 4DUXA 4TVPE 3GHBH 4YK4C 4MD0A 1KJMA 3HG3A 4H5SA 4LCWB 4NO5A 1EAQA 1QLRA 5E9DE 5ELIA 3BRGC 5ABDE 4NUGH 3FO2B 4MVBC 1CDGA 4L4VA 1MFUA 3BO8B 3OKDB 1BV8A 4QRUB 4YE0A 4CVWA 3GMQA 4OAWA 4HWBA 5K9KB 2EDXA 3BPOC 5C9JB 1AZCA 3U1PA 1MQKH 2PR4L 1LEGA 4YHNA 2UY6B 4LMQI 2PP7A 2B0SL 1H3XA 4KKLC 3RZWA 4AI7A 3DI2B 1A3QA 3TO2B 5F96H 4XMLH 4IQHA 4L1TA 4XN8A 3GSXB 1MHHB 1M3IA 3FUDA 1U8HB 1AHWC 4HUMB 5F6HI 2DJ4A 3HE6A 2BZ7A 5KBNC 3ET9F 1NEZB 2R39A 2XBDA 2VXTH 1XB6A 5CBEB 2ZWZA 3WI9A 3N1PC 1VIWA 4K3EL 4XC3L 4YBLC 5GJSL 2RTTA 4ZUUA 4OCRH 4E9SA 5K33A 2E9WA 4AW7A 5IV2A 5D7LA 1IGCH 3WDIA 3P9WB 1FLTX 5E5LA 4G82A 1AAJA 4X7SH 1ZA6B 1OW0C 1CD9B 3ARDB 4Q56A 1UACH 4AJWA 1U9KA 1NEUA 4Y19B 1DJZA 3EYFA 3NT0A 3F12A 1JJUA 2OMUA 2Y06L 3LOWA 5B39B 2X09A 2RMNA 3SGEI 4PJGF 2NZIA 4GSDH 2XWRA 3B9KC 3MA7B 4G8FB 2R1YA 2EH7H 4IBQA 5AD0B 1TXKA 4NNXB 3VU1A 3TURA 1E3FA 3OAUL 1S7TA 3CX5K 4AWJC 1A8ZA 1U8PB 2DYRB 2WXLA 2P5WE 2WXRA 3GXDA 3TNMA 5KYUA 4L1HA 4ODSL 5F72S 5AOJA 5E9NA 3JZ7A 2QV2A 2ARJA 3IJEB 2DH3A 3P4OA 4OIIH 4ORGB 2EXYD 3N41B 1ET7A 3QIWA 1H3PH 1I75A 4OZFA 4OZ4A 3INUH 3L13A 4R4NC 3VMPA 4YSEA 1U91B 5IMMB 4N2BA 1FL6A 1MCOL 4WI9A 5BXFA 3KBFA 5A2CA 1ONQB 2QVTA 1PFOA 1P2CB 4R0LA 3QULA 2X2YA 1T7WA 5F6HJ 3D8MA 4PWKA 5F6IC 2NY5L 3STBA 1AGEA 3U7WH 3LIZA 1HH9A 1G7HA 3FU7B 1M71A 1U3YA 2D73A 3SE3A 3I3DA 4JRYA 3ZDZB 5LWYL 1E3XA 3HS9A 2EDWA 2JKSA 5JQ6H 1GTNA 3KPPA 1YMMD 4KTGA 1A7PH 4CNIB 3BAEL 1ZTXE 3LKSB 4C4KT 5JDSB 1ND0B 2NUTA 4MJ5B 4EN3C 2VMEA 1QNIA 4WJ5A 4X98A 3SGKC 1MG3C 2VH5L 2EVHA 1MCDA 3RU8H 3W0WA 4E41D 2L3BA 2VLRB 2P80D 1Q0YL 1RJZA 3MQIA 1P7QD 1AZBA 2YPVA 3T4AB 5I5IA 1VZHA 5EZIL 3DNKA 3VI4A 4POZD 2FK9A 3TIDA 3VXRB 3F7YA 5C09D 1CTMA 5D2LB 3TO4C 4HKBB 4A04A 3CXDL 2A73B 5HHOE 5C07D 1QVOB 3KPTA 3QAZB 3H9ZA 4NZFA 4TMPA 5LBSA 3ZZSA 4X4YB 1BVKA 3ZL1A 1R0AL 2CJUL 2C1OA 3NJIA 4Q74A 4AEIL 3ULUC 1E9QB 1UZ8A 3KYKL 3B43A 4JM2B 1QMUA 4U1KA 5HYFA 5E4OA 1PG7X 5DC4B 1NFDF 4U1MB 3C60B 4JKWA 4KQ4L 2RBLA 3BD4A 5FK9B 3V4PL 5A16A 5G5DB 2FJHA 4X9FA 2OLDA 3VFOB 5I6XC 4KKCD 1Y1DA 3HC2A 2HKHL 1A6VL 4NB7A 2AKRB 4XNUL 4LLDB 1E9OA 4HHWA 5E5UB 4YSTA 1OALA 3RDTC 4OJFL 4U1NB 3HS8A 3K7UA 1M2OA 4F57H 4PGJA 4GI6A 2BY2A 2IDFA 5E2WL 1PG7H 1YEEL 3UADA 3QG6A 5B38B 4FP8L 4YX2L 2DIAA 2XPGA 2ORBL 3P2TA 1C8PA 2O5ZL 5DJDB 2OL3H 4GBXA 3LQZA 1KJ2L 1KB9K 3CK0H 3PXLA 5CFAA 1B6UA 2F08A 4PS7A 3D39E 4LNRB 4OD1H 1HIML 1ZLUH 4LLYB 3E6FB 3I84A 3UCRA 2V3FA 2A6DA 2F5AH 2Y72A 1QR1B 4FXLA 2J44A 3L3DB 3FZUD 2FQFA 4QAMB 4Z3HA 2F58L 1PW3A 3DHMA 5F0JB 4FXKB 3CDCA 1NINA 1GZPB 2A9BA 2IG2L 2ZAIA 3APNA 3QUZA 2B14A 1FL3A 5C7XL 2WLLB 1ES0A 1OGAB 2EIKB 4H4NA 3RWCB 3AQZA 4WFED 1BCIA 5T5NF 4ANVA 1BIIB 3K5SA 3Q5TA 4R2GC 3UBXB 4Z7NB 2J8HA 4CKVX 1RUML 4XPHL 1XTMA 3O6MH 4FTDA 3IPFA 1USZA 2Z93B 3TBWB 2G9KA 5GSVA 4QRPA 4ZSOB 5HHXL 1HJCA 2X40A 1QEXA 2BSSA 3DUSA 3LXBA 2EO9A 4HZLB 4ONGL 4Y8AA 1FPTH 3ARFB 1K8DA 3G6DH 3TVMC 5I1IL 2JB5L 4QO1B 2ZX9A 3TPKA 1QO3B 3QEHA 3GT6A 2Q7YA 5GIRB 4JY6B 5DSCB 2GSIB 2HRGA 3MV11 5HJBA 3FO9B 1PBYA 4LCYB 2Y22A 4K0OA 1CDUA 3LPPA 1EX0A 3QDHA 1S7SB 1KGUA 3C08L 5AZ2L 1OAYH 1ZDSA 2D9QB 3JSSA 4WUKL 3BVVA 1XGQB 4G43A 1E5AA 4WV1A 4H1LG 1RVFH 1S9VB 1NCCL 3OVUB 4NBYB 1NPUA 2D2OA 1AACA 4B9YA 3VFSB 5BRZD 4XVUC 4JFEE 3FQWA 1AYOA 3L5WA 1HFUA 3F3HA 4X6CF 4OJYA 2O5YL 4AGPA 5FYJU 4WW2F 4BZYA 3TGXA 3KG5A 2FNWA 5CZKA 5AL8A 1UH2A 2AMUA 3C6SB 4ZUVA 1P53A 3QFJB 2XDHA 3DX7B 2GFBB 1ORQB 2WWKT 3IJHA 1XCWA 2WYHA 3NZHL 2R83A 4I13B 4Q6IB 4M8QB 4QHNB 3V9FA 1GS6X 2AQSA 2VWEC 1D2PA 3HFFA 4LSSL 5LXGL 1RUAL 2YEQA 2ZUYA 2YK1L 4XWGH 3SOBH 1F3DH 4XVJL 2ITFA 4YHIA 4D9LL 2QZQA 5I8EB 2IMNA 1UKTA 2LFGA 2N7AA 4OFYD 1HKLL 3RY6A 1KC5L 1RU9L 2F61A 2E86A 1R24A 4AQAA 1LK3H 4R3SB 4KRPC 3HB3C 5D7EA 5DHVB 5ETUB 3CFDA 2JSFA 1IT9L 1Q38A 3GKWL 5AW8B 2IO5A 2UX7A 1BZ7B 5DWPA 5EH1A 4M48H 1VZGA 4DCQB 4M6NH 4F2ME 2CIKB 3IJYA 2APXA 5HHMB 4ZDHB 3VFWA 3DGCR 3HI5L 5JOEA 2YMTA 3CUPA 3I2CH 3LH2L 4G6KH 5FO2A 3TZVD 3RVWC 1GOGA 1MLCB 3B7SA 3NN8A 1U36A 3SBWC 3U7YH 4LEEA 3X1FA 1JXJA 4NM4H 1OGTB 4N86A 3Q1SL 4QRRE 1HHHA 5I23A 3L3GA 1IL1B 1GW0A 4YHLL 3I50H 5DVPA 1KDIA 4M8UA 5L6YL 1E27B 1JV2B 4KTEL 1RSFA 2W9DH 1CDBA 4HCFA 1PZSA 3AG3B 2XZCL 5IEHA 2OYKA 5IB5B 1OP5H 4DKAA 5FKAB 3WJJC 2BVUA 4MFHA 3NJKA 1BBJA 2H8PB 3BHBA 4PJXB 2J1KA 3R1GH 4YE4H 2NLJB 1YPZF 4RAUA 2Q87A 1HHGB 5IBLC 4G9DA 4PRAB 4PW3A 2GIYA 3JWDL 2JK5A 5TPWH 5HYIA 1BF5A 1KULA 1I3RA 4HU8A 1DUYB 1L9RA 4C55A 4LSQL 4B9IA 4KQ0A 2MHAB 1HZLA 4P48A 5D72H 1HK6A 3K3QA 2MCPL 4M4RA 3U7AA 3BW9A 5GS0L 5AVTB 5HTSA 3RUGF 4JQIH 2B2XL 2RFXA 4LSTL 2W65A 2UYLA 2J5WA 1I8IB 2P5EA 3EYSL 4F8OA 3KJ6L 5EWIL 4RDQG 3ZO9A 1I1CA 1V55B 3PREA 4MSWA 3B7TA 3WDHA 1THAA 2ENYA 3MU3A 4HQQH 1U3HB 1BVOA 2QSTA 5DD0L 3SJVB 5IW6B 2A6IA 5BVPL 3O3BA 4GMTL 2JIXA 1GA2A 5DLML 4AG4H 4MASA 1MDTA 2Y24A 5JHLL 3SDDD 1RJLB 5AOKA 4JZJC 2FZ3B 4L8SC 1QSFA 1IEAB 1S78D 4UT6A 4YXHH 1QFWI 4PB0H 4O58H 3RVUC 3WLWD 5SWSD 4HIIA 5B4MC 4FFYL 1MAMH 1U8KB 2WWNA 1YUHA 2H26A 3HN8A 2VDRB 4RSYA 2YWZA 4OLUL 1PJWA 3MRCA 3QORC 2IADB 4IGBA 4AJYV 2VDML 1ETJA 1JZ6A 5CEZD 2ESVB 1AO7E 2R2CA 5CILL 5D1QD 4PP1D 3QEQA 1E4KA 1AXIB 2OL3A 5DEJA 2NY2D 4XRCA 2CDEB 4UTCA 1E5UI 3FB7B 1PNCA 3UMNA 1KACB 3T09A 2CGYA 4NPYA 1YEHH 3U25A 5J1SC 2Y1YA 3QAQA 4MZIA 3ZYOA 4QRFA 1IBDA 1BREA 4MS8C 1SXAA 4ZI8A 4MCZB 5FIEA 3V5HB 3D85D 4KK5D 2RCSL 1JK8B 2VC2L 4UDTB 3BUBA 3OKDA 3V0AC 4QRUA 4EPSA 3ATEA 4BZ1A 2YQ3A 3S2AA 5C9JA 3OC5A 1A3LL 1MF2L 3PJNA 1HEZA 4O2CB 4PGZA 4EZMA 2QL1A 4ATTA 3JT2A 2VJXA 4FERA 1DO6A 3TO2A 3VFPB 1XEDA 4FAAB 2I27N 3GSXA 2K78A 3HG2A 1JWUA 1QPXA 4JGUA 2QZ5A 2E9JA 4G8GE 5IEKA 3O9WC 4DVRL 5E94A 3P9LA 1KMGA 5HP5A 3K2UL 3DHPA 3NP4A 3Q13A 4TTDC 2IQAA 2P24B 3R7RA 4DK5A 2YZ1A 4DUWA 4F7MB 5FFGA 2XWCA 5DVNA 1IAIH 1Z6JT 3IDNA 2I24N 3BH8B 1TVDA 1GXEA 1ASPA 5AZEL 1BAFH 2H4EA 3UP6A 1BQLL 4LIQE 3NFSH 1KGCD 5IQ9B 2IWEA 3SDYL 4BCZA 4ZO7A 5LGKA 4S2SA 3V4VL 5ERWB 1TYEB 1SY6A 2YMOA 1ILSA 2VB5A 3ARDA 3F6LA 4JO3L 5CJQL 5KW9L 3UTZB 3HW7A 4S1QH 4Y19A 3LNIA 1J0HA 1V7ML 4OSUL 4OY9A 5DT1L 3PP4L 2VT0A 5E56A 1UOKA 1MIEH 1X9UA 3CE1A 3ALPA 5HHNA 5D7LE 4OB5H 4JO1L 5D7IB 3WGUB 5I1EH 3QPXL 2BHUA 3ABMB 5EBLB 4G8IA 2WBJC 5AAWC 4LOVA 4D9RE 3EO1B 1MNNA 3BKCH 4UQ2B 5IP4A 3CDYA 1JNLH 4JFUA 4B3VA 3BDYL 4ZO8A 5G4MA 1UD8A 1M42A 4M7ZB 3Q0HA 5LG1A 3VD5A 2R2EB 4LPYA 2XNAB 5DHVH 4BGDA 1IKFL 2WOYA 4PUBL 3U30C 3IJEA 4FKHA 5GRJL 5IFHL 3CQQA 4F33B 2BSRB 2LTQC 1IGMH 4M93B 1TQUA 5KVFL 5CJOH 4N2CA 1IAMA 4GKNB 1U91A 3ZYZA 2VDLB 4B97A 4PJAA 2OI9C 3RKPA 3RI5F 1P2CA 1BZDA 1W72B 3FQNA 2CNYA 4B7IA 1AIZA 1R3IH 3BEVA 4PJ8C 2C8NA 2GIXA 1DQLL 1YMMB 3L9YA 4DP2X 2V2XB 3MJ9A 2YA1A 3CV5A 3MRNA 4P2QE 4CNIA 4Y4KD 4GQRA 3LKSA 5JDSA 3J7HA 4E41B 2GBAA 4ZYKB 3ULUF 2DWEB 4NQDE 2VLRA 4DOHE 2A99A 5BO1H 4WI5A 2C3VA 1YJDH 4YDKL 3T4AA 3UGUA 4HFUL 5HDBF 1AR1B 2C4XA 3QE5A 3SYOA 2WSPA 2Y6TE 4PCYA 1OP3H 4JFPB 3VXRA 4BK4A 2JTYA 1TTGA 1EO8L 1OLLA 1C16B 5D2LA 4QT5A 1U58B 4HKBA 4IKKA 4ZD3H 4E0RA 3MRQB 4WUUD 3DVGA 1QVOA 4X4YA 3DUUB 3DBXB 3V2AR 2A74B 4WWID 2JJTC 1SEQL 1R75A 4N3TA 3ECBA 4PGBA 4LOUC 4U1MA 4J2QA 2VRQA 4X80L 3VI4E 2CBPA 3C60A 4KJQC 2X4QB 3NG5A 5FK9A 3AUWB 5G5DA 5CD3B 5KSUB 4JN2B 5EUOE 3VFOA 3TCLB 3Q6GL 5DC2A 4ZUWB 5PAZA 3RY4A 2AKRA 1AGDB 2KL6A 4HGWA 4BFGA 3NDYE 1FHNA 1NUGA 4LLDA 5EC1B 1XIWD 4PRBB 4UCFA 5LBGA 5L7XL 5T3ZE 2QKIA 2WANA 1A9EB 1KCLA 3CLEH 1X6LA 3EH3B 2AJYH 5FF6B 2J8OA 1FVEA 2VDRH 5CR8A 3NPSC 1G6VK 1Q9OB 5F3HB 1TF4A 5B38A 2CKBL 5AB2A 2R1WA 1BLNB 1LDPH 1MFBH 4MAZA 4RGMB 4XP9H 4DKFH 3L2NA 1QACA 4C56A 1GMIA 3MDJA 5DD1H 4HWUA 5FGBC 4M6OL 3CQFA 4KAQH 2EACA 2C9AA 2KQNA 4NC1E 5BV7L 5ADOH 4GUPB 1S7UA 1MFMA 3PGCB 1FNEA 4LNRA 3MXVH 1IAIM 3EOTL 3OKNB 4JGMA 1OCCB 4L3CB 4QOKD 1D5IL 4NJAL 4DT2A 2D7PA 1QR1A 1NTDA 3WNJA 3T0ED 5HPMB 1F18A 4I85A 1PLGH 4HKZB 2OK0L 3BGAA 4K9EL 5LB1A 4FXKA 4FNTA 3S3BB 4A7TA 1GZPA 1L6XA 4DGIL 1CLCA 1Y6NR 1C1EL 1OGAA 4P07A 4BK5A 3WEBA 2FBOJ 2XTJC 3C8HA 4J1UA 3U2JA 1MNUH 4YSRA 3DV4B 1BIIA 3UBXA 1Z3GH 3OLIA 2DQHH 3QDGD 2Y2TA 3FQTB 2I9TB 3MR9B 5HJGA 2Z93A 4JFSA 1BMWA 5IFAL 2NR6A 4ZSOA 4X9IA 1UUNA 1DHKA 4WI7A 2XVGA 3IMSA 4X6DB 4L18A 4PTTB 4PMFA 1RXLA 4HZLA 2Z7UA 3JT0A 4MCNA 4KDWA 3GLDA 3FB6B 4JY6A 1E4XI 1RZ7H 4HF5H 2GSIA 2WYZA 3CWGA 2HB0A 2YD9A 1DDHB 1OSPH 3VQ1C 3E1ZA 1HOEA 4HX1B 1SBBA 3GMRB 4NAJA 4QRPE 1LGVA 3EH2A 1S9VA 1ZD6A 3SSGA 5BRZB 4MX7B 1DEEB 1N5YH 2JQAA 4YUEL 1WWWX 2VLJB 5CKGA 2WN3A 4OD2B 2FO1A 3VFSA 4GQZA 1U4EA 4GIPD 3R8BB 1IB5A 2J5LB 4NO3B 4WY7L 2VXUL 2BRRH 1RK0B 3OJDA 3BIKA 1AQDA 4AVHA 3EZ8A 3ZGIA 4Q4EA 1AR2A 1ZJAA 2L0DA 3GJEB 1RPQA 3C6SA 3PG2A 3QFJA 3U0TB 4KPHL 3DX7A 3L7EB 4ZXBD 4F91B 4P9MH 4Q6IA 4KY2A 2G5BB 2YSTA 4MHHI 1ZGLP 4WF7A 1EZVY 3W9EA 2CM6A 1I9RL 3CD4A 1TTFA 1WVZA 4XCEB 2OTWB 5TTRA 1JHKL 1NKGA 1JNHA 4E9RA 3EDEA 5BZWB 4PD4J 1Z9LA 1I1AC 3PQYD 2ZPKL 4YGAB 1UA6H 1OCWH 5IB2A 4NGHH 4R8WH 4IBWA 4NJ9H 4JCWA 4R3SA 2FBJH 3U9PH 2VDLH 5DZAA 3CFTA 5ETUA 3VSVA 3C09C 4XP5H 1T1YB 2ALWA 3EG9B 1VENA 4MMZB 1E65A 4LKXA 1W72H 1BZ7A 3U9UA 4DCQA 3TZVB 2CIKA 3FQ1A 4G6JH 1NBZA 2EECA 3MNWB 4G6FD 4WWNA 3EJUA 3T4YB 1KIPB 1GC1H 1AS6A 2HG0A 4L3FA 3DSNA 1MLCA 4U0RC 1OK8A 1PKQE 4LSVL 2OMVA 1VCAA 4MAYA 5TDPB 4OGQC 2WVSA 3CDZA 1BIHA 1KFGA 2HRPL 5DEZA 3F7VB 1I9JH 4WWOA 4ENEC 1K3IA 5IJBC 1WAAF 1YN7A 3UERA 4WTZG 5F89A 1IL1A 4LLWB 2PW1B 1YMHB 5BUAA 1TZIB 3ZTNH 1E27A 1JV2A 4J6IA 2BIPA 4LBEB 3KPSE 3B2UD 2AGJH 3ZSSA 2CHWA 2H8PA 1ZLVK 2FGWL 2VN5A 1T6VN 4MD5B 4BRVA 3N50A 5LCVH 2ZOUA 4PJFF 2NLJA 3OGOE 3O3DB 1LE5B 2OZNA 5FYJD 1HHGA 4J3OG 5FA4B 2EDOA 4AEFA 2A9CA 4N2KA 5AVWB 4U1HB 5D1XE 2D9CA 4P3CH 1U93B 3UAEA 5E03A 2Z0BA 3KPNA 1BQSA 1BFVH 3VXPB 4UQ9A 1F58L 3AY2A 1XGPB 4BKTC 2AI0H 4JHAL 4A2HA 35C8L 1OVZA 1ZVNA 3T6ZA 1Z9MA 1S46A 2DI7A 3QJUB 1G9MC 4AKPA 1GKEA 2AJUH 2R8SH 4Z78B 3G6JF 1I82A 3NIGE 3PXHA 2X7LB 3P4MB 4M7JH 1U3HA 1W0WB 3SDDB 1MIMH 3STZA 2YLHA 4L8CA 2LABA 3D69B 2X41A 3RFZC 4P9HC 2ZKMX 5SWSB 5JPNC 4HSQA 4Y4FD 1MFEL 4Z7UA 4LVEA 4K9EC 3DK0A 2YBGA 2D7MA 2Y2WA 2AXFA 4CILA 1PX4A 2VMJA 1U8KA 4YC2C 5E1HB 3EZJB