3TA4D

Small laccase from amycolatopsis sp. atcc 39116 complexed with 1-(3,4-dimethoxyphenyl)-2-(2-methoxyphenoxy)-1,3-dihydroxypropane
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
273
structure length
273
Chain Sequence
b'GTTRRITMYAEKISDELYGYGLAPGGATVPGPVLEMWEGDTLEIDLVNTTDRVLSLHPHGVDYDVNSDGTLMNGSAVMPGQTRRYTWRSHVGYRRADGSWAEGTAGYWHYHDHAMGTEHGTEGVLKGLYGALVVRRQGDLLPKRQFTVVFNDMMINNRAHHDAPTFEANLGERVEWIAIGHGSNFHTFHLHGHRWLDNRTGMRTSEYDPSPLIDIKDLNPGVSFGFQVIAGEGVGPGMWMYHCHVQNHSDMGMAGMFLVRNADGTMPAGVHEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords small laccase, multi-copper oxidase
publication title Roles of small laccases from Streptomyces in lignin degradation.
pubmed doi rcsb
source organism Amycolatopsis sp. atcc 39116
molecule tags Oxidoreductase
total genus 79
structure length 273
sequence length 273
chains with identical sequence E, F
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07731 Cu-oxidase_2 Multicopper oxidase
D PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ta4D01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ta4D02
1BXAA 2GIMA 1RZPA 4E9QA 4KO9A 3JTBA 2XWZA 2FT6A 4M3HA 4TXVB 1BXVA 4AKOA 3IE9A 2VW4A 2YAPA 2XU9A 2TSAA 3JT2A 2HX7A 4Q89A 1WA2X 1ZV2A 1MZZA 2Q5BA 4UANA 4AKQA 1HFUA 5D4HA 2FNWA 3ASOB 2LLNA 1TKWA 2EILB 2VSKB 3HEIB 1VLXA 2XYBA 1GSKA 4A2HA 2EINB 2IDTA 2XV3A 5I26A 2PLTA 1AZNA 1EZLA 2VW6A 1XB3A 2YXVA 3UAEA 5I6MA 1PLBA 5I28A 5I6OA 5AFAA 1V54B 2FQDA 1AOZA 2FQFA 2BHFA 2GBAA 2YAFA 1QHQA 5AKRA 2PPFA 2PPDA 2R7EA 4CSPA 1BQKA 1PNCA 2XLLA 3KW8A 3WNJA 2HLEB 5ANHA 3KW7A 9PCYA 3FU8A 1J9QA 4MFHA 3TASA 3CDZA 5IY5B 2X87A 5B3SB 1IBYA 1JVLA 4N4YB 4YSRA 3ZDWA 3CVBA 3FSWA 1N68A 3TA4D 3NJIA 5TK2A 3ABGA 1W6LA 4AX3A 4F2FA 4FAAB 4G72B 2CAKA 4GYBA 4DPAX 4E9VA 2GB2A 3AZUA 5PCYA 3S8FB 1DZ0A 2UXTA 2PPCA 4ZK8A 3WI9A 1L9PA 2P80A 2CJ3A 3PAZA 3SBRA 3T6XA 3QJTB 4A68A 3OMAB 3FSVA 4G7RB 3UACA 4DP6X 4BDVB 1NTDA 3H4HA 1JZJA 1ASPA 1JOIA 5D4JA 4HIPA 2IH8A 5F7AA 3T9WA 3NSDA 4F7KA 4YSTA 1PMYA 3S3BB 3PXLA 5I5IA 2QDVA 3ZIYA 2DWTA 1A65A 1PZBA 1L9RA 2H5UA 1NZRA 1KDIA 1SDDA 1M56B 3D12B 4YSEA 2PPEA 1TU2A 3X1BA 1A4AA 3AG3B 2WO2B 5TK4A 4E9YA 1A4BA 4N8UA 1OOWA 2HRHA 1ZIBA 3X1EA 1PCSA 3FQ2A 5B1JC 1SNRA 4KO7A 2GHZA 2I7SA 2EIKB 2JXMA 1MZYA 7PAZA 3UABA 5I6PA 1CUOA 1BYPA 3IEAA 2XVBA 8PAZA 1E30A 5E9NA 1IBZA 2IAAC 3GXUB 1E65A 2QT6A 4A2EA 2X88A 1SHXA 4A2DA 3SBQA 4KOCA 3NJKA 4BK5C 4HHGA 3H56A 1UATA 4ENZA 3QJQB 2BW4A 4KNTA 1PZAA 2YAMA 4BWTA 1ILUA 4QLWA 1TEFA 3DKHA 3L45A 3QJSB 3PPSA 3SBPA 3WNIA 1EHKB 2DYSB 4G71B 1IC0A 1JXGA 2IDSA 3FT0A 3CVCA 2WO3B 2I7OA 1KCBA 3GDCA 1OE3A 3AG2B 5F7BA 3NJFA 2YXWA 3FQ1A 1ASOA 1ET5A 1WA1X 2TSBA 1AG0A 1JXDA 1PNDA 2J5WA 1SDDB 4GXFA 1V55B 1KDJA 1OF0A 1GS7A 2BP0A 3G5WA 3CVDA 2PP7A 4YSPA 3UAAA 2PP8A 4YL4A 3NJHA 3QJRB 3CG8A 3IN0A 3AG4B 4YSUA 1PAZA 1SF5A 2PCFA 1X9UA 3PAVA 1RZQA 2JKWA 1JZFA 5B7MA 4YSDA 2YAEA 4DP1X 2Q9OA 1ET8A 1R1CA 3OMNB 4W1TA 3UADA 4KNSA 5A7EA 1M9WA 4A67A 1A3ZA 2UX6A 4YVUA 2XX1A 1JXFA 1T5KA 2P80D 2YAOA 6PAZA 5B1BB 1A8ZA 3X1FA 2DV6A 1IKOP 4DP7X 2B3IA 3OQRA 2RACA 2Y69B 4DP9X 4YSQA 2E86A 3AW5A 3T71A 3C75A 4A2FA 3ZBMA 2DYRB 1AZRA 4DPBX 1E5ZA 4P5SA 3T6VA 2PCYA 1SFHA 1AG6A 1NICA 1KYAA 4HAKA 3U25A 3FPXA 1XB8A 3NSYA 1CC3A 4WKXA 5AZUA 4YSSA 1OCRB 2XX0A 1KCWA 4DP5X 2FJSA 4KO6A 3WKPA 2YAHA 3NJNA 1FA4A 1YLBB 3S3CB 4FA7B 1X9RA 2HX9A 2A3TA 2ZWNA 2IWFA 4G7QB 1M57B 1N70A 1PLAA 4KO5A 1L9SA 2UXVA 3PAUA 3UGEA 1KGYE 4YVNA 2FQGA 2HZHA 1GYCA 3FSAA 3FU7A 2ZXWB 1AZBA 2J56A 2QDWA 2QPEB 4DP8X 1KBWA 2XXFA 3NP4A 1B3IA 5I6KA 4YSOA 1AZUA 1CYXA 3WKQA 3ABMB 5D4IA 7PCYA 1ETJA 1GY1A 1RCYA 2PPAA 3N55A 2W88A 1JZGA 1ET7A 2AZAA 3NJLA 1I53A 4BXSV 1ID2A 2R7EB 3ABKB 3EH5B 1ILSA 1IUZA 4DP4X 4NERA 1AQ8A 2XXGA 3BQVA 4JKNA 1AACA 1NPJA 3EHBB 3FYEB 4NAJA 1PZCA 2UX7A 3PCYA 3T6ZA 3CDZB 1OCCB 2GC7C 1GW0A 4DPCX 4KNUA 2BO0A 2BWDA 3TBCA 2GC4C 2IDQA 3QJVB 3IBOA 1ASQA 4A2GA 1J9RA 1NWPA 4CSZA 3BVDB 4E9WA 1JZEA 2N0MA 3NYKA 1W6WA 3ABLB 4M4RB 1SFDA 6PCYA 4NB7A 5FC9A 2AVFA 1PF3A 3NJJA 3NSCA 2CBPA 2HRGA 3EF4A 1NINA 2J57A 2YARA 2XUWA 4KOBA 2IWKA 1AAJA 2J55A 1JVOA 2MRYA 4PCYA 2PP9A 4E9RA 3FYIB 5LDUA 1OV8A 1PLCA 2IDFA 3EH3B 2IWEA 3ERXA 1E67A 4BXVA 3QJUB 3GYRA 4HZ1A 4GP4B 3SQRA 4EF3A 1BEXA 3FU7B 1WS7A 1J5DA 5B1AB 1FFTB 3OMIB 4AKPA 4G7SB 1CYWA 4HCFA 4YSAA 2CALA 3PLYA 2H3XC 2H47C 1A4CA 2VM3A 1HAUA 3MBWB 1OE1A 1URIA 1BYOA 2VN3A 1QNIA 3WG7B 1JZIA 3RYMA 1BQRA 1F56A 3NP3A 2ZOOA 4BDVA 1QLEB 1ZIAA 2AFNA 3DTUB 2B08A 2BP8A 2UXFA 1WA0X 1GS6X 4UF7C 4E9XA 4F2EA 1AS7A 2FQEA 1KBVA 3FS9A 2QPDB 1GY2A 4GP5B 4X4KA 3HB3B 4A66A 2IH9A 4WTQA 5B7EA 3EH4B 4W9ZA 1MDAA 5I6NA 1PY0A 2CCWA 2FTAA 4JHUA 2VMJA 5EHFA 2NRDA 1SJMA 1NIFA 1SF3A 1V10A 3S3DB 1NIDA 2W8CA 1WS8A 1OCZB 2BWIA 3V9CA 2OV0A 2FWLB 5B1JA 3TU6A 3V9EA 3MX0B 2XV2A 5I5JA 2I85A 1GS8A 1SHWA 3WIAA 2GSMB 4AZUA 3QQXA 1DYZA 4JHVA 1AR1B 5B1KA 3H4FA 2HX8A 4HALA 5I6LA 1W8EA 3N2JA 4G70B 2YQBA 4P5RA 1BAWA 1KV7A 4E9SA 4GY4A 1J9TA 2WSDA 4GP8B 1TEGA 4HCGA 3FSZA 1NIAA 1RKRA 3NJMA 1L9QA 2HXAA 2AANA 1NIBA 3TBBA 1FWXA 3FQYA 2BP0B 1AZCA 3X1GA 3DIVA 3OD3A 4PAZA 2ZONA 2EIMB 2YAQA 2EIJB 3FPYA 2DY2A 1OE2A 1NDTA 3AY2A 1NWOA 2CUAA 4HHWA 1WAEA 2BP8B 3IN2A 3NT0A 2VM4A 3FU9A 1J9SA 1ADWA 1L9TA 4UAHA 2DWSA 1JERA 4AI7A 1J5CA 3AG1B 4BWUA 1GR7A 2FT8A 5PAZA 1AANA 4BWWA 3OM3B 3ASNB 3X2QB 3ZX1A 2MTAA 3T6WA 1ZPUA 2VSMB 2UXGA 1NIEA 1OCOB 3X1NA 1HAWA 4L0PB 5I5MA 1BXUA 2JFCA 4RH4A 2Y1AA 2IDUA 1AIZA 2AZUA 5B7FA 4E9TA 3QPKA 1CURA 1MG2C 3CZUB 3NSFA 1AS8A 1XB6A 3S8GB 1NPNA 2OJ1A 4Q8BA 4K9JA 2OCCB 4HCIA 4QKTA 4DP0X 2VW7A 2BZ7A 1XMEB 1BQ5A 4YSCA 4DP2X 1ZDSA 2XV0A 3NJGA 1JZHA 1AS6A 1MG3C 1ZDQA 1E5YA 1L9OA 2BW5A 2BZCA 2FT7A 2GI0A
chains in the Genus database with same CATH superfamily
3TIDA 1RZPA 1JV5B 4EDXA 3TWYA 2YD6A 3V6FA 3MJ8A 2CU9A 3BVTA 4GRWB 2WZ5A 3IDNB 4RDBA 1L0PA 1U8IA 2YKLL 3LKNB 3RGHA 1QLFA 2Y5TA 4A6YH 4Z7OB 4NKQB 4BFGA 3H8NA 3KHOA 1I1RA 2X4RA 1ZEAL 2R9HD 3KGSA 4GEJA 3L3OC 1EJ8A 1GGIL 4GAYB 4KAQL 5F9WB 5AW7B 2Y7OA 4NZ8A 4ABVA 5L0QB 2HX7A 2CDFB 1ZV2A 3OC5A 5KANG 3FO0H 5D6CA 4X6CA 5JDSB 2VMCA 3ECBB 3EOAB 1YEFL 2YMXH 5BZWA 4NUGH 2R0ZL 1VLXA 3ALXA 1KLFB 2C9VA 3Q2VA 2VXTH 3UTPE 4Q9CA 4NHCL 4OFYD 5C97A 3BHBB 4X9HA 4M8QA 2HT3C 4FTVE 2YPLE 2P28B 3Q05A 5FLVA 2OXGB 3R7RA 2PN5A 1D5BB 4G5AA 3TYGH 1W0WB 2EEFA 5J12B 1QX1A 2BSEA 2ESVB 5I6OA 5HDBF 2ARJQ 1X7TA 2Z4TA 4FFWC 1ACYH 1C12A 3AS3A 4Q6IC 4QHNA 4AH2B 2V2TA 3LV3B 2YO3A 1QTYT 2VR4A 3FCTA 5GQBA 5I2IA 3C9NB 2WP3T 2R56H 3WD5L 4R7LA 3TN0B 2CDEB 3IBEA 1SGKA 2EO9A 5GJSH 2V9UA 3OHXA 2VKXA 4M93C 1QRNB 4KKLC 4RZCB 3RIAF 5ILTL 1TTFA 3QYCA 3CVBA 2XN0A 5JOPE 3E6FA 4XN2A 1UM4H 4WDIB 3SD5A 3L3DA 5LLIC 1CXIA 2J88H 4R2GB 1B4JL 4G72B 2BSTB 1DHKA 3AZUA 3ZL2A 5BS0D 1QO3A 2B5IB 5DJZA 3FL7A 4N68A 5J6GB 3H85A 4S10A 1BD2D 4EKJA 4M61B 4PJAF 3QUHA 3IF1A 4GKOA 1I3RA 4Z7WB 2BNQE 2IG2H 1TTAA 2ZSWA 3ZE2F 4O4YL 1A02N 3DV6B 4GRWH 1R5VB 4PGBB 4QRPA 3IDYB 4G7RB 5JA8B 5DC0A 3QFJE 2DLEA 3V2AR 3V6ZA 1YEWA 1JZJA 3O9WD 1PZSA 5AENA 1C5BL 5TDNB 1WZMA 4OVVA 1NAMB 4DEPC 2IBBA 3WFZA 3VXUE 3WEAA 4P4KD 3UC0H 1TQSA 5DT1H 1U3ZA 5KS9B 2CSPA 1NBYA 5LO7A 3L4UA 4KXCA 1SDDA 4O51A 4QXTA 2HJLB 5FGSA 3OWRA 3Q9PA 4MB5A 4P3CL 4FNQA 1QHPA 3IFLL 4Y7MA 3F62A 4HD5A 1QEWA 4HW6A 4JANB 3X1BA 2AK4D 2I9TA 4F8QA 4I89A 1CICB 4XBGB 2OYLA 2HRHA 5T1DL 5TGBB 5FYLE 1ACCA 4ZNEA 4KO7A 4FABL 3I75A 3K72B 1L6ZA 4QCIA 4C58B 1SXSA 3OB8A 3WKML 3QR1A 1YN7B 4TVUA 4X5RA 4XNDA 2VDMH 2QGEA 2XN1A 3MRBA 1NC4A 3QDMD 1F8TH 3KPSD 1Q38A 2BOBB 5IMLB 1CG9A 1SBSL 3EJYD 3F5WA 1LO5B 1WWBX 3WBDA 1KTJA 4LRNL 1NKGA 2DQJH 4S0TD 1W91A 4IEFA 2WLZA 1HEJC 4F93B 4IRSC 4ZO9A 4X9IA 4CUCA 1UB5B 4WJ5A 3QAZC 1THCA 3BCFA 4PH8A 3SGJA 1IC0A 2V7NA 5E00A 1OAKL 4HS3B 4X8GA 1VACB 2Q7AA 3GPEA 5E23A 4YK4C 1UYWL 5A2CA 4BELD 3ECWA 4R4FL 4M5SA 2IGFH 2GAZB 3TJPA 1AGDA 3MRCA 2PWDA 2EE3A 3B9VA 3QUMB 4CSTA 4PCSA 2OQJB 4BCXA 3MRPB 1K4CA 4IW4C 2Q2LA 5TDOB 4PRBB 3MLYL 4TUJA 4Y1AA 4AYFB 2HN7B 4AIOA 1NAMH 3EYQD 1YNTF 3VWJB 1KDJA 1JJUA 4FXGB 2BS71 1BZ8A 1PVHA 2PP7A 5ISZE 3N0AA 3OKMA 1FP5A 1X7QB 4YHZH 3VFSA 3KPNA 1RJYB 3TEWA 3BGMA 2OTWB 3IN0A 1INEL 3MUJA 4OZIF 3ESUF 1UVQA 3GUFA 3RWHA 2MCAA 4HIEA 5CGMA 1KTBA 1T6VN 3CMGA 2BX5A 3PAVA 4MS8C 2F5BL 1J8HB 4KJPD 2YS4A 2ICES 3GXDA 3O6MH 2YFOA 3MJGX 2NY2C 4LEXH 4JCMA 1E3ZA 1JPGB 4F2ME 1GJUA 2G2PA 2GIXA 1MFDL 4NEHB 2GEEA 1JXFA 1LQSR 4FLHA 3PV6B 1AE6H 2XVGA 1GZPB 4APQA 2C7UA 1E4XL 4MNHA 5LAPA 4DP7X 4JRWA 3A23A 1BM3H 2F19L 2VH5L 2XKNB 3D4CA 4NO0A 5J7CC 4FJYA 5HYSA 4A2FA 3DOIA 4KVCH 3FTUA 4XWOD 3OGCA 1JD9A 1HQ4A 2ZJSH 3MRDB 1RURL 2NR6C 2FD6L 4LHQB 1BQHB 3FPXA 2DTML 1BBDL 1SY6L 4NJ9H 2ICWI 4TNGA 2X12A 3OX8B 3MUUA 3QDGE 2OLDA 3OHMB 3O6KH 2ADIA 3LH9A 5GS1A 5FUZH 4L8CB 5C0AE 3RVUC 3DX0A 5EBWB 3PWLA 3PAUA 2CBTA 2R0WL 3BKMH 4O00A 4I3GA 4KMQA 1OZTG 3TO4A 1EFXB 4XCYB 3GZOA 3QUMH 1TTBA 5DWPA 4AMWA 4ZDHA 1U3NA 1CU4H 4YDLC 3PJNA 1B3IA 5SWSA 2VDKL 3IGFA 3BUYB 3MV8E 5D4IA 7PCYA 2ZXGA 1H19A 4GW1A 1HZLA 3EZJB 2W88A 3BKJL 3CJJA 3I3DA 1EWHA 4GLRI 4QRBA 3UTSB 3QI9B 3ABKB 1QRND 1PS3A 2IIJA 5T8IA 4ISVB 4XZUA 3E2HB 2BNRE 5E6UB 3SCMC 2WWKT 4X7DC 3H9SA 3IGUA 3WEXA 1NCAH 4JG5A 3HVNA 4NAJA 1D9KA 2AEOA 1OCCB 2GC7C 4HX1A 5I18L 3U4KA 3MRJA 2GBVA 5BRZA 5I1HH 1U8MB 4YX2H 1PLGL 2DQIL 3SBWA 5BVPL 5IOPA 4U3XA 1QSFB 4Z7VF 4N2MA 4A2GA 2I27N 3DUSB 4NKDA 4NNYB 2A4ZA 2OMZA 1JDAA 1ETZA 2HFFA 4CSZA 2AAAA 2N0MA 4NIYE 5SV3A 5KBDA 1OQOA 4PRPA 1JG9A 4NB7A 2DLFH 1UB6A 1JAEA 4GPVA 3HIZA 5I8OL 2D3LA 4OZHE 4HF5H 2A9NL 2VLRA 3QXWA 1EDHA 2A9ML 4ZFZB 1LE5B 1QSVA 4WFHD 3EAKA 2PABA 3MI6A 4PBWD 4ZX3A 3N42F 1NBZA 5E4EC 2PW1A 2VUKA 4B9KC 4X9BA 5IW6A 2GHWB 1EO7A 3I6GA 4IKNA 1OP5K 1UACH 2QVTA 1BEYL 4PJ7A 1RUPL 1TMQA 4KK8C 1MCDA 1FFTB 4Q52A 4F7TA 5J9PA 3FFCB 3UBHA 1KZYA 2V7HB 3RNKB 5L2KB 1IE5A 4XNQB 2HUEA 1PKOA 3M46A 5A2KH 2AJVL 2NZ9D 1W8OA 2YHGA 4HISA 4KKCD 3WL9B 1KF9B 1DVYA 3Q2WA 3D2TA 4B53A 2XICA 1JZIA 4KK5C 3VRJB 5C0NC 3Q5OA 4QXUH 2B1HH 4LL9A 2WOBA 4P4RB 5IB2B 4UOW0 2BCKA 1XF5A 1IB5A 1U93B 4KKBC 2DWXA 2X70A 4J1UB 4EN3A 4XX1G 4AEEA 4HIHA 1JFQH 1BAFL 2DOCA 3OXRA 4CVZB 3KPMB 3S35L 4JFXA 1KIQA 3DX6B 4N28A 3TTSA 2F7RA 3GPSA 3M45A 3KL0A 1T5XB 4HLJA 4L48A 4BUGA 1UJ3A 1H3WM 3S2CA 1TQBC 4ONGH 5FYLL 4W70A 1HZHH 5J3HD 5BMFL 1ERNA 3OZ9H 3WMSA 4NQXA 4ZO8A 1V05A 2NXYB 1JF1A 1Z1WA 3C6LC 1XGRA 3LB6C 2D3JA 1YEDA 1U58A 3AU1B 2LTQC 1SXNA 4EVNA 3BN9C 3WKYA 4F9LC 2CLRA 2JQZA 3QIBA 1SF3A 2VB5A 2JIXD 5CZVL 2GK0B 3QORB 4AW7A 2I60H 4B50A 2OV0A 1MCQA 2X2HA 2N1TE 1IARB 3LRSB 4G6AC 1MSPA 4IKJA 4L1LA 3EO9L 5CN2A 5D1QC 3VWKD 3I85A 4MMZB 4MTMA 1ZT4A 1T7YA 2OPCA 2HG5B 5DRXA 1PDKB 4RFOH 4OFDA 1NCIA 1I7ZB 4GG6A 1H9VA 2XDHA 4WVRA 1JZDC 4JRYB 5DO8A 1H5BA 1M42A 4LVHB 5HGAA 4JM0A 3CFBB 4IGBB 3JWOL 1IAIM 1T2QH 3F6IA 4WSGA 2ZOTA 3V0HA 4ODSH 1IT9H 4YPGB 2MNUA 1CFBA 12E8L 4ZTPL 1WLHA 2G5RA 3GUTA 5DLLA 3AGVA 1OB0A 2NY1C 4K94H 1CBJA 4N2EA 4OBSA 4P5KB 1KCVL 3O4LE 3DIVA 3UTZA 3F7VA 5IG7A 2Y25A 4M8UA 5ITFA 2F53B 3MACL 5BJTA 3QUKA 4XCFH 3VQ1C 4NZRL 1FFQA 4WFEE 5GS3A 1BVKB 5FO7A 2KBGA 3OAYK 3V4UL 2EDMA 2WWNA 2YD3A 5D1XB 4NN6B 3DJTA 2WVVB 4GUPA 3TS8A 4X9GA 2VM4A 1ZA3B 1ZTXE 4XN9A 3ZL4H 1RERA 2EDQA 1N7MH 6FABH 1R6VA 3D39E 1RUML 2FT8A 1MFBL 4AQ8A 3CUPA 4ZPTA 3UYPB 5ETUA 1T0PB 5JZ7C 1T1XA 5IEHA 1KG0A 3M1BA 1TQTA 2UWEE 3QEHB 2EVJA 4P4KA 4OCMC 2H32B 5KG9A 2FO8A 1U9KA 3RFRA 4LLDB 3CCHB 3OR6A 1UXWA 1JSYA 3EGDA 4LASL 2ZOWA 3K2MC 4GSRA 3OLDA 3VCLB 3CWGA 3PNWB 5DJAB 5AVUB 1OLLA 4L3CA 5MERB 4C4KO 3JV6A 1R24B 3UJIL 4Q9RL 4MJ4A 1NGPL 3ULVD 2A99A 3VFNA 4FNRA 4XO4A 2HFGL 1EJOL 1CD1B 1EFXD 2EEXA 1QBMH 4ONHB 3L2LA 3I02A 3MO1B 3WIFA 4Z7UF 2R29A 1E5YA 2YBGA 2YOCA 3SGDH 1CF1A 4DQOL 1AY1L 5D7IB 4LLQB 1E4WH 4K7FB 1QBLH 1QWNA 4K5MA 1PX8A 3WFBL 4PJXB 2ODHA 3SGKA 3UTSD 2FT6A 5I8CA 4TXVB 4LIQH 1BXVA 1EUTA 5JIHA 3OL2A 2XQ0A 5JHDE 1N6QH 2O5ZH 3QQDB 1IC4H 4H88H 4LKXA 2IH1B 4MAYD 4LSTH 2ZKXA 4P2CG 4Q89A 1XGYH 1X5KA 1MFEH 2HPOA 3ILQC 4JY6B 4LCCC 5CLTA 2H0EA 1JFHA 4FYQA 2ARJB 3LSOA 3MV7A 3CQQA 2J72A 2PYFB 2JCCE 4C83A 1QSFD 4ALAC 1FHGA 4YDIL 5DMYA 3NK3A 1HK6A 2QMJA 4S1RL 3U1QA 4P2RE 3WUWA 5I0XA 2DQHL 4AE0A 1U91B 1MJJB 2Q87A 1IGCH 4HXBH 3MZTA 2QQQA 3CFDA 1DVFB 4X98B 3L1EA 1SJXA 1MI5B 2UV3A 3HG1A 2Z93A 1PNCA 3ZDYB 2H32H 3HCVA 1DL7L 1CB4A 1KXHA 4NENB 3WTWA 5HJ3B 3W2DH 5JW4Q 2OI9B 4DZBB 5DK2A 2X87A 5EOQH 1AGFB 4HJ0C 5AZEH 3FFCD 3GSWA 1F58H 1ZWIA 2VZ1A 3MLZH 2P46B 5K1VA 3BN3B 2JH2A 1QOKA 1OTSD 4PD4K 5IROC 3LS5L 2F15A 4OF7A 1FNAA 4BZ1L 1JNJA 3EOTH 3RGBA 1L9PA 4F27A 3U6RB 2EJ1A 4N9GB 5IQOA 3AXHA 3PREA 4UM9B 1A7NL 3PDDA 1MCPL 2BDNL 4CW1A 4RISL 4KKQA 4HQQH 4ZXBA 1K3IA 4FYRA 2VMFA 3MV01 2ICWJ 4UTCA 1CLOH 3C8DA 4I87A 5E6IC 5EPMA 4G7YH 1E40A 25C8L 5GGUA 1YUHA 5JW3H 1NEZA 3NDZE 2ALAA 4MNQD 4JPWH 5ENWA 1PZBA 3LEVH 4JQVC 1A5FH 3DSFL 1M56B 2R0KH 5CSZA 4TUKH 2V5YA 4HBCL 5T1KB 5JW5A 1ZS2A 4L3EA 3WNLA 4D9QE 3IU4L 3D48R 1MWAB 4CNIB 4ANWA 4N2GA 1UJTA 1HHHA 5HY9A 3VG9C 5KVDE 1FV1A 1Q72L 3MV8A 4YXLL 1FO0L 2C3XA 1U8KB 3IMSA 3F05A 1EFQA 3L3OA 4TQEH 4KBPA 4UUJB 5L9DH 1NCWL 5G2NA 1QASA 3M8OH 1EEYA 4JG1H 4U2ZA 4PRHE 4HV8A 3HHMA 4JRYD 4QTHB 3P3YA 5JDJA 1GOHA 1IBFA 4Z5RA 3O0LA 4IGBD 1ZVSA 3NQIA 4IOFC 4KROC 1HTYA 2B39A 2ZOKA 4TUOB 4XAKE 2Q8AH 3ZZ1A 1HZKA 2PTVA 4XVJL 3BISA 1OVZA 3C6SB 3MDJA 5T1MB 3FUJA 2W60A 3TBYB 4FQIL 3MRFB 2BERA 1SOXA 4MKMA 3UBXB 4O2CB 4GQRA 4MSWA 3WTYA 5HJBA 2XTLA 4JHAH 3P9MB 2ORBH 3HZVB 3QJSB 4CMHB 4JDVB 3D87B 5FYJU 3PQYE 5FFGA 1IQWH 4Q6IA 3VFPB 4PG9B 3VGGA 1YJDH 2J6EA 4BZYA 2P24B 4LLAA 4ZMXA 3ZW3A 3RVXD 3GB7A 4X7SH 4F8LA 1EGJH 4LXFA 1ICTA 4R0LA 4P2QB 3IGKA 3DIFA 5IKCB 1VPOH 2AV1B 3NCMA 1A4KA 2OX5B 4BZ1A 3NIFB 3BAIA 3KGRA 4LMQE 1AG0A 4NKIH 4F5CE 3FFDB 2LFEA 3QGVA 5IMMA 2ROXA 1KJ2L 4RGOL 3MUY1 4L37B 1B4LA 2BOCB 3D8MA 3NRFA 2X4OA 3D34A 43C9B 5B3NA 2WLKA 4GRWF 3IDUA 3BMVA 3PJLA 2VERA 4Z7OF 1ZTXL 3FB7A 1NA8A 5DRZB 1PU0A 3B3IA 3RIFK 2C1PA 4NBXB 3SPJA 4Y5VC 1MWAH 3DHPA 4RX4D 4HZLA 3M86A 4QGTA 3A4FA 2RBLA 4KNSA 2DQFB 4GBXB 4PP2A 2FDBP 3FT2B 3P9LB 3NCBB 1OAUH 3GRWH 3SZ6A 4JY5H 4CVXA 2A4EA 4BZ2H 4PJ9B 1FO0A 1CDGA 4NXSA 5DD3L 3T77A 3WGVB 1ZY9A 4QRTB 4O02L 3LZRA 5HVGB 4K5NA 5CBEB 3GMNB 4OCWH 1I82A 5DJ6B 4EDXB 3V6FB 4Y16D 1BMGA 1T5WA 5ITBH 2DYRB 4DPBX 4DKAA 1H3PH 2AEQH 1QWHA 5F9OH 5L4JA 4OV6F 4R8WH 3HMWL 2X4RB 1UFUA 3ORJA 4FQXD 3APMA 2WVSA 4K71C 4Q0XH 5TFSL 4HU2A 4LL1A 1HNYA 3A47A 3HS0C 5MENE 4ADIA 4GI6A 2XKUA 1XH3A 4LVOC 2OK0L 1N70A 2JIXA 5BZWB 4S1SL 4FC3E 4G8EA 4B9FA 4AVHA 2QFRA 2R2BA 3VWKA 4PS4L 1ZPLA 3EJZD 2NMSA 2XJKA 2WXQA 2GT9A 4YBHA 5FWQA 4M8QB 4MNGE 1EIBA 4QR7A 3INUL 3KYOB 2JF1A 5DWUL 5LBSA 5TJWK 1J9CT 2VL5A 3PF2A 1T7VA 3VMNA 3B43A 3L4YA 4GQ9L 5FM5M 3PWUA 5KVGL 4FMKA 2D7MA 4NZTL 4Y19A 1JE6A 4KY1H 2DQUL 5EBLA 4Z7WF 3FCTB 1CI5A 5B39G 5CFAA 2ZKHL 2QQNH 3Q6GH 5FA4A 3S34H 1CFTA 1DEEA 2VLME 3RU8L 3BUPA 1DFBH 1MFAL 4Y1TA 3WEMA 4M6MH 4L8SB 4DQAA 2EO1A 1WFMA 4ORGB 3WJJC 1ACXA 3I6SA 1HVXA 2UYLB 2ATKA 3E6FB 4G3YH 4DN3L 1FCCA 2Q20A 2V3DA 2GC4C 2I32A 1N0XH 2WQ8A 4JO2L 1O7VA 2MQGA 1WBZA 2ZX6A 3OAUL 4KDVA 4OJDH 3W0WD 5KS9F 2UVFA 4NGHH 2FHFA 4XN8A 1QO3B 4FZ8L 1JZEA 1NEUA 2YGVA 4XNYH 4NUPA 1Z9SA 3II1A 2PYED 4PYGA 2X09A 5IVZA 1GZQA 1IILE 1JCVA 1UH3A 1RZKH 3IF1B 4AYMC 1F11B 1S7UA 2ZSWB 3RA7H 1BZOA 3K2IA 4QRPB 3KJ6L 4JFTA 2F0CA 4YHIB 4KH9A 1BWWA 1AAJA 4GAJH 2NY7H 4Z18A 3IKCA 4YDZA 4F92B 3MGTB 4PCYA 5C0CB 1BW8A 1GIGH 3O3BB 3QJXA 4OY9A 4RGNE 4XXWA 5D7LA 3QH3A 4N2DA 2HPTA 5DHVB 3QZWB 1IAMA 5DZJA 5KW9L 1KB5B 3T8XA 5C9JA 4ZTOL 4HUWB 1NBYB 2G60H 4BQ6A 2GTZB 4G5ZH 4O51B 5T1LD 5D5ME 2H3XC 3SPIA 2V37A 1A4CA 1BQSA 2AQNA 2IQAA 3WUWG 5DEFB 5IB3A 1URIA 1XV8A 3EHBD 1D7FA 3MRHA 4UV7H 3CSGA 4I5BB 2AITA 3KLLA 3LN5B 3NP3A 5TD4A 1K2DA 2JKNA 1WIPA 5IB5A 4N8VA 1KFGA 1G0DA 5FWRA 3PABA 3RGVC 5CP3H 3B7RL 3BWAA 4U1HA 3MRBB 5F6IB 3F7KA 1BVNP 3O2DH 4ZZFA 5JQHC 4HIXH 1E4JA 2FJGA 2LT9A 1KBVA 1YYML 4XB3A 2NYYC 4L0YA 2QPDB 3HRZC 1LMIA 5D7HA 4UQBA 1WTLA 5CFHA 5KVDL 4QJ3B 2QADD 4NHUB 1DN0B 2O26U 4MJHA 1SQMA 2Z31B 3L5XL 4LPVA 2C4FT 4W9ZA 5H4YA 4PJ8B 3RWIA 2IANE 3GMPB 4MMYA 4P2RA 4P0DA 3S5LA 1DLHA 4JS7A 4BV1A 3KGUA 4F8TA 3D09A 3A0OA 1KJMB 4P2QD 2GVYA 3QQ3A 5AW0B 5E00B 1X9LA 3L4TA 3SDCC 3EYUH 5L88L 4JFDE 4UT7L 2J2ZB 1JZ5A 5I0WA 1D5IH 5TE7L 4G8GB 1BX2A 1N4XH 2EP6A 5CN1A 3SODB 4M6OL 2YSTA 4P04A 4Y1AB 3I6LD 1QTPA 2YKLH 3MHZA 4EJ1C 4XMTA 4YFLI 3HHSA 2QMKA 3BT2L 4RQQA 1LYQA 1GGIH 3FBKA 3OKMB 4KAQH 5L8JB 4HK3J 1DEDA 4Z6AT 3OD3A 3VVWA 4DERA 2XY1A 1AMYA 4P2YA 4NQCD 2BIIA 2OULB 3X14A 1NDTA 1UVQB 4GUCA 3GSNL 2NCMA 4JM2B 1U8PB 4JAMA 4A1RA 1OIOA 1N8ZA 1YEFH 4N1CA 5JLZB 2BP8B 2R0ZH 3ZGHA 3DNKA 5LGKA 4Y1SA 1T22A 2DL2A 2QSCL 3D2UB 1FYTE 4NHCH 3LKQB 4BWUA 2C1OB 1U21A 4ZW6A 4MHHG 4NKMA 3RUGE 2BSDA 1U2HA 3ULVF 1PX3A 1IE4A 4KX9A 4PJEA 3S4SA 4OB5L 1T66C 3IXTA 2A6JA 4MNHB 2E4FA 4TUUA 4ZS7L 4NO0B 3IFOA 2ZYRA 3U30B 1CT8B 2YGPA 4NO2B 3WD5H 1AYOA 4JZJC 1I9RL 3OGCB 2IDUA 1AIZA 2AQPA 2WWOA 4BHUI 3HE6C 3L95A 3TONA 3KYNA 2JJTC 1GZHA 5K9KA 2OJ1A 3FCBA 3QZPA 5ILTH 4PJBB 3ARFB 4YGAB 1A6UL 7CGTA 2GITA 4GUQA 3O0RH 1CDBA 5JXED 4BJLA 1B4JH 1DSFL 3PWLB 2H1XA 4HPOL 3RWFA 3NJVA 1L9OA 4UDTA 4XC1L 4DK3A 4PS3A 4BFBD 2DDQL 4A7VA 5HHPA 5K9QI 4HAGA 4AT6A 4MBOA 4DH2A 4B7IA 5ACMA 4ZDHB 3FQXB 2HJKB 4E41D 1AQMA 5SWSB 3UEQA 3S6CA 4YBLC 1OZUA 2E4TA 3VM5A 4CN6A 1M3JA 3PWPA 2YJLA 1R3HA 3F2LA 4F9LA 2XFXB 3ARDC 2RHEA 4P5MA 4NN7B 1HKLH 1UZGA 1C5BH 3JUYA 2VQ1A 3VU2A 2GJ6A 5D1QA 2VQ4A 5D7KD 1N0LA 2FWOB 4YN3A 3OR7A 2W0PA 2X4UA 3ASOB 3H9SB 3WEXB 2ATPA 2J25A 2EILB 3OXSA 5D1ZC 3V0AC 3VXRE 1UKSA 4AYEC 2HT4D 1UT2A 3FHQA 4HX1B 3VRIA 1RZJC 3FH7A 1Z5LB 4P3CH 3IFLH 3U48A 4LLMA 5DMKA 1IAKA 1G94A 3D3VB 4IS6A 3C8KB 4Y9EA 2WXIA 3W56A 4F5CA 5IOPB 5T1DH 1DJIA 3QARA 4NKDB 5IMOA 3UMNA 5J0BA 3O11A 2HFFB 3CD4A 1N19A 4EUPB 4FABH 2BHFA 2RQEA 2MQCA 3JWNH 1QHQA 3WKMH 3CFJA 3K74B 2NLJB 1ES0A 3ARUA 4J3TA 4KQ0A 3GTVA 3L9RA 5A7BA 3UDWA 5C0CD 4PRPB 1D5MA 2JI3A 2W95A 3S3PA 5FUOL 1AR1C 4OF3A 3G6JA 5I1KL 1SBSH 3P77B 4JLRA 5BUPA 1TCRB 3TFKC 1X5ZA 1SLWA 4LRNH 3D0LA 3VXPA 2Z4QA 3NJIA 5IBLD 3UROR 5IW6B 2Y1ZA 2AP2A 4PJEF 5C0BD 2V6HA 5CEZL 3EYFA 3B9KB 1TTRA 3ESVF 4HMDA 3X12B 3BVUA 4HG4J 3KLKA 4XWGL 4UYPA 4N2IA 2H7WA 3GMLA 4WWKD 1TZHA 3IDGB 3TA3A 5JPMA 4BM7A 3SBRA 1OAKH 3T0EC 1EX0A 3QUYB 5IVOA 2DZEA 1ZLVK 1UYWH 1BJ8A 1D6VL 4R4FH 5CCJA 3LMJL 4R3SB 3CV5A 4DP6X 5JW4R 1UURA 1XF5B 3ZR5A 1FBIL 4WU7B 1ASPA 2PETA 3PL6C 3FTVA 5F7AA 5HYJA 4HIHB 4YSTA 1TJHH 5IBTL 3MLYH 2VDKB 4JFXB 5DQDL 2Z31D 4NZDA 4PJ8D 1NGYA 3BOVA 2MWCA 1QUNA 4Q6YA 4L1HA 2YEZA 2DJUA 2CKNA 5DFTA 4NQXB 2JJSA 3IPEA 1TU2A 1P2CA 3Q5TA 1JF1B 5TK4A 1A1MA 5I74C 3ROOA 4KUZL 1INEH 4MNGA 1YEDB 3G7TA 1U58B 4H8PA 1AO7D 5FPIA 3GRBA 4YH6A 4EVNB 1RZ7L 3QIBB 3ZKXC 1H3UA 3QEQE 2KC0A 3L3HA 4EUPH 1JGEA 4G8GD 4ODTL 5I19L 3V5DB 1T0NB 4MJ5A 2FIRT 1MFMA 5GS0C 1HIML 3VD4A 5I71C 2G0LA 1MFDH 3MV9D 3NEOA 4OSUL 5DRXB 4FNSA 3NFPB 3BZEA 4AQ1C 1PKQA 5FOBA 4M5ZL 5L2JA 4HWZA 4GG6B 1E4XH 5IT2L 4KX7A 4AQOA 43CAA 1JIBA 5GZNA 4KK6D 2F19H 2WXGA 1TVHB 3RB7A 4QXWA 2GUOB 3MJ9A 2JKLA 3RDTA 4QLWA 5BXFA 3GUTB 3FUEA 4YO0B 4LLUA 1EZVX 1RURH 2FD6H 4WI6A 4P23A 3PPSA 4JM2D 2CR3A 3TXAA 2DTMH 1BBDH 2G3MA 1SY6H 2VRQA 3EYOA 3UTZB 2ENSA 5ITFB 3ZSTA 5A2JH 4UINL 2WZ6A 1U3HC 1MH5B 1UOWA 3D2UD 1TOXA 1DQJA 4NCC1 3KE0A 4H0GA 5FO7B 5AOZA 5GGTL 2PMZA 1EXUB 2FHBA 2PYEA 3QXUA 5EOCJ 2UY6B 3AG2B 4GUPB 4QNPF 1W0VA 2R0WH 2YXWA 4G6FD 3QFJB 2K1MA 4D0BA 1BVZA 2VLKE 1Z9LA 1GH7A 2ID5A 4X8XA 4PJCE 3NMEA 1PNDA 5ETUB 3VXUB 1V55B 3KS0J 2VDKH 2ZCHL 5A40E 5D7IF 2DEWX 3L3KB 4UOZA 5JYLA 4WGWB 3RTQB 3UAAA 3BKJH 1JPSL 3COOA 3B9DA 4JFYA 1J12A 4PJXF 3NJHA 5TF0A 4EIBA 5D5MA 2V2WB 4J3WA 3TJHC 3WFDH 4MXQC 2XWEA 4HGMA 4KUCD 4Y88A 1UXWB 3MUGA 2JB6B 3EGDB 4V33A 1IGJB 2NCEA 1I8AA 3HJ0A 3MRRA 4U1NB 4L3CB 3WN5A 1T83A 4ONFL 1WG3A 5BRPA 3ZTNL 4U6HA 3F85A 2AGJL 2NNFA 5I18H 1KB3A 1QSED 4LCWE 4E42A 2P5ED 3EO0B 4BKTC 1PLGH 2DQIH 2XX1A 4PLJD 3I02B 5BVPH 1HKFA 4JO1L 5EU6E 5ABDE 4GRLB 3EJQA 2XZZA 3SDYL 1FORH 5JOFA 3OZLA 4YHNA 3DETD 1FL5A 2CLVB 4PJHE 5ESAA 5FW8A 4I88A 3OQRA 3S48A 4YSQA 1KB9K 4OGAC 1ITCA 3AW5A 3M1OA 4RDQF 2NXZC 2CUIA 4CDHA 5I8CB 1J8KA 5HDOA 4AGPA 4RGMB 2ZSVA 5I8OH 3H55A 4PJDE 4DETA 3VI3E 1NICA 1UADC 2A9NH 2YLHA 5IBUG 1CC3A 2A9MH 3BKCL 4LKXB 3HR5A 3FU5A 5EZLA 1NKOA 2XX0A 4DUVA 3MRMA 2E59A 5TPWL 2DWDA 3WKPA 2YAHA 3OJDB 4J6RL 5C08E 4A38A 1YLBB 2MEJB 1X9RA 3MV7B 2DYPA 1UKTA 1BEYH 3D3VD 1RUPH 3EDDA 5JHAA 2MJWA 3UIYA 2NW3B 1KN2L 4CBZA 3VD2A 2H2SC 5HHVL 3NZHL 4GQZA 4ZPVA 2QDWA 3H2WA 2AJVH 1KBWA 5H35A 3NPSB 1SUHA 4R96A 1VA9A 4ES8A 1J0ZA 3L4WA 1AZUA 3WKQA 5JPNC 5I75B 5HJDA 4DUWA 1ET7A 5ISZB 1N10A 5L7XL 4FERA 3HR6A 1GGBL 3QXAA 1LEKA 3HG1B 2Z93B 4BA8A 3F83A 2RFXA 1BAFH 1OF2B 4LCVA 3S35H 4AYDC 4HK0B 2X05A 4UU9A 3MC0A 3IJSA 3B9KD 2E76C 5FYLH 5FYJD 3GSWB 2BWDA 4XGZB 1P9MA 1ZWIB 4F2MB 2H8PA 4GW5B 3L48A 4FLOA 2APTA 2W81C 3FT3B 3BH8A 3OLGA 3QUYD 5IW1B 4E9WA 3IMRA 1U8NB 3KPRE 4UMSA 2R29H 1UWFA 3HE7C 4XB8A 5ESQB 3ZRCC 5CZVH 1RLWA 4KTDL 3FU6A 1ETB1 4UDUA 1FFNA 3HG2A 1T7WA 3EUUA 1FVDB 3EO9H 3TBSA 2D4DA 5AWNH 5G55A 2WXFA 3STBA 2XUWA 1CGXA 1D5XB 3BUBA 1JGUL 2ITEA 5CKGA 4X8JA 3FAXA 1NUDA 5J57B 2VISB 1OV8A 5BNXD 4G9FA 3QJUB 5GIRA 4OKDA 1CYGA 5INCA 1FFOB 2KLRA 3AC0A 3JWOH 3UTPD 1YUHB 3FU7B 1DN2A 3NQKA 4MJJA 12E8H 5C0AB 1NEZB 3BD3A 4ZTPH 4FTVD 1R3LA 2YPLD 2XN9E 3EDEA 5IVNA 4GS7C 1KCVH 1OW0C 4Z78B 1JWMA 3DOHA 2B0SL 3T0EE 4XX5A 1OE1A 3M17B 1BYOA 4MCMA 4NZRH 2H6PA 3VG0L 1BQRA 4LKCB 1FV1B 3V4UH 3MV8B 1M6OB 3L3OB 1AD9A 2WWMC 4E41A 3K6NA 4GH7B 3GI8L 5CLZA 5EZOL 1CFNA 5K39A 1WGOA 4UF7C 5E7BA 1RUMH 4H4NA 1MFBH 3SKUD 4N0FB 4Z5RB 1G0XA 5JOPD 4KJQD 1ZVSB 4A7TA 3HG0A 1JS4A 2J1ZA 2ZOKB 1NCGA 4XPTL 3KWUA 3NBNA 1TVBB 5D8JH 4OIAA 2AJUL 5I16A 1FE8L 3N43B 2KI6A 3PY9A 2W60B 1CS6A 3UEZA 3FUNA 1HCZA 3GMOA 5DVKA 4MSWB 4LASH 2OL3L 2BNQD 4JO3L 1J1PL 1XEDA 3VFTA 3WE6A 4Q9RH 3UJIH 3AADB 1NCHA 1NGPH 4Q6IB 1CGUA 1VEMA 2MPAL 2VXQL 3QFJD 4Y4HC 3V9EA 4LLWA 1GKOA 1FZKA 2PCXA 5I1IL 1EJOH 3K5RA 3G5XA 4GW4A 2UZXB 3GB7B 1AQKL 2Y22A 4HLEA 4R0LB 3R0MA 4OZHB 2KMWA 4RLDA 1PEZA 3VXUD 4DQOH 4AE1A 1AY1H 4M93B 5C0IB 3WJJA 1A4KB 4G70B 1DE4B 4ZO7A 3QUXC 1J9TA 4M03A 4MWFA 4PWHA 4CA4A 1JVKA 5D6DC 5F0JB 4NAQA 4YXHL 1G7HA 1DCLA 3WFBH 5IMMB 3VO0A 4Z7NE 1VADA 1X6NA 1NIBA 1AKPA 3FUFA 2X4OB 5EEZA 1HEZA 1WZAA 3SQBA 3OKDB 1KXTA 2RQ8A 4PB9L 4NIKB 5FYLD 1T89A 4B9IA 1VDGA 5C0BA 3MFFB 2KH2B 5SWZA 4KDTC 4RDQG 4HK3N 3DX7B 4Z3TA 4XNUL 4X0KB 2EDTA 3B3IB 3G3LA 4PWEA 5AUMB 2AEWA 3E6HA 3Q01A 3VFUA 4WWKA 4Q9QL 4GRLD 1A6PA 2Q0ZX 3NCEB 4DCQA 5B8CC 3CZKA 3LHAA 5C3LD 4YDIH 2VRAA 2FK9A 5ICUA 3C8HA 5PAZA 1YEEH 4S1RH 3JT0A 4DEPB 1JPFB 3OM3B 4E5XA 3CZLA 4G42A 4IRZL 1FO0B 1A1OA 4Z3IA 5C0GA 1I8KA 4NSKB 4X6DA 1EZSA 1KELL 1UT9A 2B4CC 2HKFL 3KXFD 4H2CA 3VFGL 2Q8BL 3IJHA 4H1LG 1QPKA 4HUUB 1WITA 5K33A 2FAUA 1YY8B 2DI7A 4M7ZC 2M83A 4JMNA 4FI8A 1DL7H 1S7QA 4QTIL 3CMOL 3HG4A 3GSQB 2MPVA 3CSTA 4YOKA 5AW5B 1F2QA 1WCBA 3C5SA 2VW7A 2CGZA 4JHZA 5AW9B 1SXCA 1QKZL 1NCCL 2J6EH 3D06A 1HSBA 1P1ZA 1P4BL 1U8LA 5J1SC 1DZBA 1WRFA 3EOYG 3IKKA 2A9BA 1URZA 3KVPA 1MG3C 3EFDL 3SDXA 1HQRB 5E8EA 1NJ9B 1Z7JA 5HI4C 3LS5H 1E7VA 4G8EB 5EO1A 2GI0A 2R2BB 3TYFA 1KCSL 2VXQA 3DSNB 3GLEA 2LVCA 1D5ZA 3PWVA 4HCRA 3WUZA 2VLJA 5I1EL 2OZNA 3IDMB 3RHWK 4BZ1H 2NNCA 3QQ9D 4M3HA 4MKTA 3WDJA 1C5CL 5AALA 3KBFA 3DO7A 2VL5B 1A7NH 4IRSB 4JPIA 1JWSA 1QQDA 3NZUA 1F3RB 3PWUB 1SBBA 4RISH 1BF2A 1MKFA 3CXHK 3DOSB 1DBJL 4Y19B 4BKSC 3JTTA 4UQ2B 3QUGA 2VN5A 3O4LB 3T65A 1AI1L 3QJFA 2SODB 1KJ2B 5CS7A 1PZUB 1CFTB 3WNOA 4CN1A 2QKSA 4G59C 4ETYA 25C8H 4L9LC 4YK4B 5IJKA 2DEXX 2WCGA 4UAOC 1E6JL 5BV7L 1CZ8L 5TTRA 3DSFH 2PLTA 1EZLA 2ZTBA 2VLKA 3P73A 2YD0A 5I8KL 4AENB 1E2WA 2Z1PA 3D39B 2XPGB 2Z8VC 3FRPA 2X2YA 3IU4H 4A2MA 1IO4C 2YRZA 3T2QA 4ZTEA 4JN2B 1Q72H 2FQFA 2XC8A 4KI5F 4YXLH 1FO0H 1U92A 5AKRA 2E3VA 2Y7LA 5DR5L 2RR3A 1NCWH 3UBXG 1INQB 4RMBA 3TH4T 4IRZA 4I2XE 2MIZA 1RZJL 2BH0A 1YEHL 2RMNA 3MKGA 3QDGD 3V55A 1NGWA 3L7EA 3WFHA 2OR9L 4O02B 3IKCB 1J9QA 4OIFA 5CLWA 5IIEA 4FCHA 1IBDA 5C0AD 3KHQA 4D0CA 3P11L 5BRQA 4N4YB 4XVJH 3QWOA 2NY2B 2IDCA 1WVZA 4B9PA 1HWWA 4FAAB 2G5BA 4URTB 4GYBA 2CAKA 4XI5C 1XIWC 1YMMA 2CO2A 4X6DF 3T8XB 1FF5A 5C9JB 3S8FB 4LVNC 4PMEA 4F8PA 4V11A 1JDDA 1OK8A 3O45A 4XHJC 2P5EA 4GKZA 4Q6KA 4JRXA 4DIXA 3RP1A 4ZK8A 4XCNB 1QEXA 4XBMA 5IB3B 3VD0A 3KVQA 5DJ8A 4JZJA 1YPZE 3MRHB 2BSBA 4Y2OA 1SM3L 4N87A 3B7UX 3BXNA 4JGNA 2BNRD 4IDJH 3EO1B 5JHDB 1BJ1H 3VDCA 5DJXA 3G5ZA 4N8VB 2LHAA 3RX9A 4WWNA 1VESA 3PABB 3LD8B 2BM3A 3B3BA 4XNXL 3H0TA 4A7UA 2FECI 1QMUA 3KWVA 5C07E 5AAMA 1KJ2H 1UOVA 2DLIA 4OU3A 4RGOH 1QLEH 5KSUB 1T04A 1JGVL 2JCCB 2HT3D 4M56A 1L9RA 3OG6B 1F86A 4DFIA 1ZLVH 4FFWD 4MA7L 3BC9A 3I84A 1ZTXH 4W4OC 2WD0A 2YRPA 1GKEA 4MGXA 1LXMA 3WN6A 5DZOA 2YPKA 3B5GA 4MMYB 4ZQKB 3T5WA 4P2RB 3RJDA 4YDLB 3QO1A 1S7RA 4WW2F 4BSVB 7PAZA 2W92A 1OHZA 1AGCA 1G87A 2ERJC 3L4VA 3QQ3B 4AV4A 3OAWA 2APBA 4WV1C 5DDHA 4P5TC 4TVPL 3GJEB 4JM2F 4OZFA 3FN3A 3IVKB 3SCMB 3MGOB 1D6EB 2BVQB 4PLOB 3CHPA 3DECA 1QUPA 5DD3H 3UG3A 1BX2B 4N6QA 3BEVB 2DF3A 4YXKL 4O02H 4BFNA 2NUTA 2A6DB 4HHGA 3EIFA 1G7MA 2W65B 4XCEA 5D55A 4UT6A 1PZAA 5DMGC 4Z3GA 3R1GH 3AB0C 3HBPA 4MD0A 5GS0L 4LLVB 2FWSA 3HMWH 3HHSB 4S2SA 3CLWA 2IDSA 4U6XB 3K4ZA 3QQ4B 5SX4H 5TFSH 1N12A 2C3GA 4K3HA 3ZQ9A 3X14B 4N0UE 1S3KL 2ITCA 2OK0H 1MPAL 5IUSA 3GO1L 5T3XD 4KUCF 4S1SH 1YMHB 1DDHA 2R39A 4PJBF 5F9AC 1T22B 1QI3A 5C8JA 2FH6A 2K3HA 3BDBA 4PS4H 3D33A 4Y2LA 3B2UC 5E4EB 3D69A 4NKMB 5DEZA 2ZUYA 4LOVA 1KY7A 5IB1A 5CD5C 5DWUH 3S4SB 4P9HC 2Y6SC 4GRMA 3OBAA 5KVGH 3OLEA 2A6JB 4HJUA 5DURB 4NZTH 5HJGA 4E36A 1IVTA 2PP8A 2R0LH 4YE0A 2DQUH 5IOKA 3IFOB 1T1YA 3OJMB 1JF6A 4ZMTA 3U7AA 4Z9KB 3LTVA 5CU5A 1MF2L 1AQDB 4JVPA 2NSXA 1MFAH 3KYNB 4X4YB 1JXKA 5IM7B 1JD7A 2J5LC 1B90A 3CLFL 4FKEA 4YSDA 3IJ7A 1IQDB 3HC4L 1M53A 2VKWA 5A2IH 5HYQA 4LPXA 5LG1A 1DVQA 5DD0L 4DN3H 2XIBA 3OKEB 4JO2H 2AQSA 3B37A 1LK3L 1T5KA 1ZVHA 2DAVA 3OAUH 1SOQA 3RWFB 4CADB 3V5HA 4YNYB 3V0VA 4FZ8H 2DV6A 4IRSD 3DRQB 2EKSA 2EKJA 3HC3L 3QZWG 1XD1A 2DWEA 3MUHL 4TRPL 3SDDC 5A1AA 1FGVL 4IJTA 1P53A 1B2YA 4UT9L 2PWGA 3VW3L 2PCYA 2EDXA 3C6LB 3KJ6H 5ECGA 3PWPB 4JCLA 4WFED 1C5DB 4XMKL 4A63A 2WXRA 3PQYB 3H9HA 4O58L 1F4AA 4IKKA 3MCYA 5F8RC 1FA4A 5D1QB 3SO3C 3ALWA 2N1KA 2X4UB 1JUFB 3OR7B 5K9OA 5KW9H 2ATPB 1BP3B 4OI9A 3OXSB 2Q6WA 3VD3A 4H25B 4XOAA 1X4ZA 3N44B 3LIZL 4ZTOH 2VC2L 3KPPA 4N85A 5DJDA 3HN8A 3OB0K 1RIVL 1RSFA 2QPEB 3DROA 4DP8X 5ESVB 2DKUA 2L0DA 3BDYL 3GSNB 2XXFA 2EDHA 2GSIA 4YSOA 5IMOB 3LZOA 3O11B 2NY1B 4G8AC 5DHEA 3U79A 1ZGLM 5CILL 1ID2A 3L9RB 2VAJA 5B3JE 4MS8D 1D5MB 1F3JB 2DM3A 4IOSA 2OZ4L 4ADGA 4NRYA 3BQVA 3WIIL 2WYTA 2NY2D 4PGEB 3HFFA 1NPJA 5EC2A 5JHLA 2RJMA 3TO2B 2FEEL 1YYMH 3VD5A 3G6JB 2UY7A 1P6WA 5DFVC 1S7XA 1EO8L 3SEPA 5GGVL 3O3DA 3TVMC 3L5XH 1H8NA 3QJVB 5FA3A 2E6JA 3EYFB 2AXGB 3HBZA 2VZVA 1O6VA 4PP1C 3QYMA 3L6FA 4F7EB 5J11C 3L1GA 5IFJA 4CC4A 2NR6D 5JHDD 4L1SA 1DVTA 5E2UL 2ZCLL 3SHSA 2XWJB 2N4IA 5E6RB 5B21A 5L88H 1NINA 1U0QA 1Z3GH 4I4WA 1HDMA 4ESKA 3KXFA 3FUDA 1G4RA 5AG8A 4UT7H 5TE7H 4AUJA 3RVUD 3GXNA 3QXDA 3P30L 4M6OH 1N5YH 2VE6A 4MDJB 4HOWA 1BEXA 2Z92A 5CP7B 3S7GA 3LQAC 3OMZA 5EZPA 4H13C 2N3JA 1W80A 3RIFF 1KIPB 4GUOA 4ZBJA 3BT2H 3POCA 4NX0A 1SDAB 1NC2B 1TU2B 2WCPA 2GABA 4J7RA 1SPDA 4MNGB 4XPFL 3GSNH 1RK1A 4XNZC 3SCMD 3QC5X 2EVFA 2G4EA 4XO8A 1JGEB 3TNMA 2ALWA 1F6AA 4LQFL 2QSCH 5C0JA 5ID0B 1FNLA 4MJ5B 5IZ7A 4LCCB 3WLWD 3MLSL 1AIFB 5CKAA 2FYVA 2UZYB 4YS4A 5HDQL 1L7IL 4LCIL 1PKQB 3O6LL 4N0CC 4OB5H 5FOBB 3NCYP 4UNIA 4ZOCA 5L2JB 2OTUA 4GP5B 3AREC 3EH4B 4I18A 2OZ4A 4GT7A 4MLIA 1IGYB 4IHOB 2R69L 3TCXA 1I9RH 4JHUA 1SJMA 2WTRA 3ZJAA 4EBQH 4P23B 3TOPA 4QHLB 5DMJB 5CHNA 3CIQA 5JPNA 1BZ9A 1EERB 3RX5A 3SQOL 1Z6JT 3RI5F 3ZHKA 3VXNA 3WHXA 1A6UH 1DQJB 1E2ZA 1WPCA 1Z66A 3BMWA 1DSFH 3WIAA 1G4MA 2GSMB 3MOAL 4HPOH 1W0VB 2LLLA 3RBGA 2VZ3A 4XC1H 3N2JA 1MCBA 1CO1A 1U8QA 2DDQH 1AR2A 4H20L 4LBEB 3BESR 1MHHB 1L9QA 2MMXA 1KPRA 2AK1H 3GXTA 4ZJ9A 2J43A 3RIKA 3K2KA 3LPPA 1NMCC 4KKNA 4OZGF 4Y5YC 5D7SL 4D9QD 5BOJA 4NQUA 4OKVA 5C0ND 1XF4A 3BVWA 3W9DA 4JFYB 5FK9B 5D5MB 2YAQA 2EIJB 3NCJL 2QPUA 4TKWA 4FKHA 4EUPG 4ERSL 4RESB 3LPOA 4LP4A 1M2VB 2WLMA 3ARQA 3DVNA 4PRHD 3PHQA 4U6HB 1R3KA 3P4MA 5CEYB 2DWSA 1J5CA 4Y0GA 2PCPA 4FMVA 4XAKD 1KXVA 1WWWX 5IR1A 1RIHL 5E6IB 1AANA 1G5AA 3CHSA 4JFFD 3IDIA 5JOFB 3D18A 2EIBA 1FL5B 3LB6D 4M8VA 5DQ9A 2NY6C 3PJSB 1I8LA 2EYTB 2ZF9A 1W0YT 1PYWB 3PQYD 5I1GL 3GSXA 1FYHB 2MTPA 5FUOH 4JHBA 3MJ9H 4WO4A 2IANB 2EXTA 3VI4A 4ZFQA 3NSFA 3QPXL 3VG9B 4UIMA 3BKYL 3OF6D 5EZLB 3HR5B 4HH9B 3TURA 1G43A 5I1KH 3Q5YA 2NZ1A 4H0IA 2DWDB 3RL1A 3LN4B 2R69A 2B4CL 1IM3D 1DR9A 1RL1A 4EEEA 4OV5A 2YIHA 3U0PB 1MELA 3NJGA 1HYRC 2DYPB 5CEZH 1SYSA 4N6RA 1AS6A 4AQEA 4JFDB 3B2MA 4ZMOA 2BW5A 4KROB 4FQQA 4HUKB 3GSRA 4ZPVB 1O6SB 2NY1D 1JZ8A 4HUNB 2VDNL 2CO6A 3AM8C 3BZDA 2DMCA 4X9FA 1BWMA 1H3GA 1E4KC 1BQLL 3EXJA 4OQTL 4NM4L 2G30A 3BIKB 2P52A 1D6VH 1V8HA 2YAPA 3LMJH 1T20B 4JB9L 3CE1A 4WW1B 1EHAA 1MLBA 4JFVA 5FKPA 1ZLSL 3IS0X 1KIUA 3TF7C 1G1CA 1MZZA 3QXAB 1OTTC 3GM8A 5IBTH 5HPMB 2J71A 5DQDH 1WK0A 4N0UA 4OD3H 1M9SA 4UU9B 1EAJA 4PRAB 1HHGA 3D85B 3RZCA 4BQ9A 3EBHA 3IJSB 1R5WA 5JZ7D 4W9EC 3DHMA 3GBMH 3P2DA 3S2AA 1WFJA 4MXWL 2VCOA 1F1DA 4QY8A 4X5WA 1FYTB 1UD2A 3L9EA 1IL1A 3QZNA 5D6DA 3RUGB 4HKZA 4KUZH 5I28A 4O2FA 3TN0C 5AB1A 1PG7W 1NUGA 4ZSOA 1RZ7H 2A4CA 3NZ8B 4IBQA 4YDJA 4KFZC 1I7TA 4ODTH 4Z78A 2IALA 1KCRH 5IK3B 2IADB 5I19H 1NUNB 1WGVA 3DX1A 2W07B 4OSUH 2MOGA 3WTSA 2GG1A 5MEND 1H0DA 4OLWL 4X8JB 3RY6C 5KTEL 1A1NA 1UEMA 5IT2H 3ZKQD 2B5IC 1Q90A 4PW9A 3UTQB 5JHMA 5INCB 3ABGA 1CDJA 4N22A 4EO5A 3TEYA 5FEBA 1WT5C 3QNYB 4YHOL 3NRQA 2C9RA 4E9VA 1REIA 1CGVA 1WE5A 5JNYB 2VSCA 2E74C 3N43F 3VFVA 5SV4A 4MJIA 3LX9A 3VGEA 3FBQA 1JZ2A 4UINH 4ZOEA 3BUIA 2EVHA 2FX8L 5A43C 5GGTH 4M7LT 3ILQD 3ESPA 2VLMD 2FYYB 4G43A 1XZ0A 2ZWYA 4K5PA 4BFJA 4M4PA 1XGPA 4WHTA 4M02A 3G04B 3MREB 4F7KA 1CFNB 5K39B 1XCTA 3HS0B 4OZHF 3ZTEA 3UAJC 1X5HA 3CN2A 1BOGA 4LVOB 1CICC 2IPUK 2ZCHH 4WI0A 3VXRB 5DLML 5EOTA 3O6FA 1KDIA 2CIIA 2Y36L 5I16B 1JPSH 1KN4L 2EDEA 1QHOA 2V3FA 4JFEE 1NCUA 3FJTA 3QULB 4R97B 4FJ6A 4HEMA 1MW2A 1F1AA 3GMOB 5KVFE 5FB8B 2G2RB 1WAAE 1Y1UA 1BAGA 2R23B 2EIKB 3PWJA 3UCQA 1R46A 1MZYA 2JXMA 4HWBA 5FF6A 2ICWA 3AAZA 5KSAC 4ONFH 2P26A 4QRFA 5AW1B 4IRJA 3ZTNH 4HDIB 3GMMB 2AGJH 2XYCA 5CJQL 2X4TA 4LLWB 3L3GB 1FZKB 3VSQA 4PRIE 2OKMA 4HJ0D 5DZPA 3D0VA 4RGND 4JO1H 2O5NA 1TENA 3SDYH 2ZYIA 1E4HA 1JF5A 2ZAGA 2C8NA 1H8SA 1Q9WB 2FATL 1VZHA 3P54A 1DQDL 3UZVB 2MQ3A 5IROD 2F5AL 2VXVL 1G7JA 2C3HA 1G7HB 1VEOA 2MHAB 3W82A 3HMXL 3T04D 2CKBL 2H4EA 3LH8A 3B2XA 4I13B 2HTLC 2C34A 3FCSA 3BKCH 2XV6B 3DK2A 5CIPA 3PAYA 3A67L 3RL2B 5EEYA 4U3CA 4JKMA 4DAGL 2BHZA 1SJEA 5TPWH 2EEDA 3T4AC 2BIPA 2J1YA 4DO6A 4J6RH 3LKRB 3GKWL 4HVBA 3W37A 1Y6MR 3SGEI 1T1ZB 3DTXA 2KKQA 1OT2A 4W6WB 3VWJC 4DCQB 1KN2H 3HUJE 3PRZA 4FXGC 5IVXE 5HHVH 3NZHH 4L8DB 2HTKC 4JREC 3N9GL 3AXLA 4PMFA 1UTDA 2J5WA 2K6ZA 1H6UA 4I1NB 5C09E 2AVGA 3C5ZA 2EXWC 4XR8C 2BP0A 5D7JC 1A1OB 1K72A 4LRIA 3GSVA 5DJ2A 1YEKL 4C4KT 3MSPA 4Z0BL 1LMKA 2Z35B 3IJHB 1FGNL 3VFOB 1RZGA 1YEGL 5L7XH 3ZT7A 4C59B 2XVKA 5DHDA 2XQBL 2CXKA 3CG8A 5E6YA 1PAZA 5C3TA 2WUBL 5GS2D 4P2OA 5D2NC 1S7QB 2YAEA 1WUNT 4P9HL 1C16A 3QEQB 4AL8L 4IOFD 5D93C 1I1FA 2E6PA 1WBXB 3NIDE 3RGVB 3MROA 1EJ6A 2OL3B 1U8LB 2P80D 2YAOA 3SDXB 3WS3B 5JO5A 3D9AL 4OD2A 4M48L 2YA0A 3BX7C 3HRZB 4EI5A 1I9EA 5I8EB 2VLJB 5E1QA 5FO9B 4KTDH 5FECA 4HOZA 2Z9TA 3MRIA 1E5CA 1XO8A 2J12B 4X6EA 4MQXC 1FZJB 1ML0A 1MNUL 2UWEF 1MIML 2X1XR 4NUJB 1FSKC 5HYFA 4AGOA 1KULA 1DP0A 1JGUH 2L4OA 5EF3A 1RJLB 3D85D 2ZNXA 4FFVC 1HH9A 2FJSA 4DP5X 1M7DA 4H26A 3TESA 3SDCB 4F15C 3QCTL 4HC1L 1HOEA 4H40A 4NNPL 1UZ8A 1N8OE 2XCMC 5JR1L 3NDYE 1WCQA 1FYTD 1KIRA 2CKBA 1ND0A 2UXVA 5EN2B 1TTGA 3FTXA 3TT1L 1VENA 2BSRA 3UGUA 4M3KB 5FDWB 4QRRD 1FHNA 2WXJA 1MHEA 2XA8L 4CU8A 2VLKB 3P73B 5K5YA 4YDVA 2B0SH 3BZ4B 4KKRA 3RWEA 4K8RL 3D6GA 4PJCB 3FRPB 5EG6C 4FDWA 4WEUD 1P5VB 3JZYA 4OCLC 4B9JA 1ETJA 2F54A 4GAFB 4JVWA 3VG0H 1MCKA 4X50A 5HGHA 5LN8A 1JZGA 5T5FA 3FDWA 3K8MA 3KNBA 1MCIA 3U4AA 1HN1A 1FNSL 5C7XL 4PJ5A 5EZOH 3IJYA 1LP9F 3MYJB 4QPEA 1HCVA 4MDIB 4UIKL 2YQ3A 1NGWB 3WFHB 1BDYA 1HL4A 4R7NA 1DJGA 3OB0H 3CH8A 5IIEB 4XPTH 2WGNB 2XN2A 2AJUH 3T0BA 2O61A 1FE8H 3TBCA 1N59A 3QWOB 2IDQA 4LCWB 1TJMA 2A9AA 3QO0B 5I17B 2JCCF 3TBWB 2JELH 2OL3H 2WBJC 4U1JA 5EU6B 4JO3H 4DT2A 1N2RB 1XCWA 1J1PH 3OKLA 4POUB 2EADA 3O45B 4OQ1A 4DVBA 2HMIC 5ADOL 4PJHB 2C26A 4C56E 5FC9A 3K71A 4JFFA 2VXQH 4L5FE 5I1IH 5GRZA 2I25N 4PLKC 2J57A 4JZJB 1AQKH 3IU3A 1MCJA 3HE6B 2C3VB 4PJDB 1SMAA 3VI3B 4K94C 2CMRL 2HSIA 5DJXB 2X2JA 3G5ZB 3CVHL 2CO3A 2WLYA 3MRGB 3VXRD 1EAOA 2WINA 3GMQB 3NCXA 3NZSA 1H15A 4BXVA 3H0TB 3LXAA 4X99B 2Q76B 5DJ0A 1KNOB 4ODBD 1YECL 4RIRB 4YXHH 2F7OA 4GIOA 1M1XB 2D4FA 3RX8A 3CSBA 3CFEA 3OMIB 5F1KC 2ROYA 1WFIA 2DKSA 3QNXB 1DANT 4J3OH 3SE4A 4PB9H 3VXME 4LBAA 5CJXA 2CM6A 4JHWL 4PJGA 4UI2A 3RVVC 3T0DA 4PIRF 2M2DA 2R8SL 1VJSA 2DM2A 2QTVA 4XNUH 1VIWA 2EUVA 2D8KA 4QTFA 1ZGLP 3GLZA 5DTFA 3MCG1 1S7RB 1L0YA 4YBLB 2MNWA 5CCKL 4Q9QH 3LQAL 4OI7A 1FNFA 1M3IA 2QLYA 4PRNB 1M4KA 5DJYA 3TGXA 1AGCB 3KBEA 1L6XA 3ARDB 1DJZA 2UXFA 4YC2C 1HILB 2NXYC 5CZRA 3SKJL 4IRZH 3BPLC 1A6ZA 2IVFC 5KVFL 3WNMA 4LPTA 5D1ZB 5I1CL 4FFYL 1KELH 2HKFH 5DC4B 5DK0B 3VFGH 2AV7A 1PAMA 2H9GA 2Q8BH 3CC1A 3THML 4XCEB 5I0YA 4FGMA 3QORC 2WUCL 2SEBB 3WXVL 2XACC 2NYZA 2X7LB 3LY6A 4QTIH 3CMOH 3P0YH 4UMGA 3I9IA 4OF8A 4UQEA 4QUOA 3KPRB 5EO0A 4AK1A 1I7UA 5FHBL 1BMZA 1S7VA 1LL1A 3BQUA 1QKZH 1NCCH 5HHOD 1OGTA 1P4BH 3IT8D 5I5JA 5BZDA 3KLHC 1AR1B 3EFDH 1J05B 1DDHB 1KCSH 3TC9A 5ADPH 5I1EH 3V5KB 4KC3B 2CCLA 2Z91A 3U82B 1GJWA 1Q4NX 3QDJA 3DHJA 3TVMA 1C5CH 4F3FB 4I9XA 3KZ8A 5IHUL 4LHUD 2BIMA 3WNNA 4PV9B 3FT4A 3STLA 1DBJH 2XN9B 2IFFL 1Y18B 3OPZL 5J6HB 1DBKH 3QEQD 4J4PD 1E90A 4JFZL 1XVSA 4TNFA 1KXQA 2FO4A 4LT7A 3T0EB 3RGVD 3DIDA 1GVIA 4JG0L 2VDQL 5KZCB 2KDGA 2G4GA 2WXNA 1F97A 4H2AA 4AYGA 3FU9A 1LK2A 2BNUA 3HAEG 4LARL 1L9TA 1UZ6F 1CZ8H 3SGDI 5BV7H 3AG1B 2ZOLA 2PWFA 4MXVF 3U4EB 2WLHA 5E1AA 2NYYD 2AJYL 1MXDA 5E5UB 2P8LA 5I8KH 1CR9L 3E3QC 1MN4A 4ENEC 4OZFH 3MLTA 5DYOA 3TCTA 3N44F 3T6WA 1I85C 1OGAA 3H3PL 4PGCB 3V0VB 2RA1A 1HXMA 1NANI 3DUUA 2TRHA 4QYOA 1JZ6A 5EEWA 2EKSB 1J0IA 5DR5H 2COVD 3DBXA 4DW2H 1E5UI 4KMLB 4MB1A 5I74B 2JB5L 3QB7C 5B7FA 5D2NE 1RZJH 5ICXA 1JRHH 1YEHH 3SB3A 3B2PA 1JHTA 3VJ6A 3ES6B 2L8AA 2OR9H 1NFAA 3K46A 4PSPA 3NCCB 2FH8A 1S7TB 4LOUC 3ZKXB 3H9HB 3EJSA 5E1HB 3P11H 1U8JA 4HCIA 2YQGA 4QKTA 2Y7QB 5FFOA 5B38A 4NQDA 1TQVA 4HGWB 4WJKB 1BECA 3R19A 3S96B 3DURA 2WKGA 2FJUB 4PRIA 4PVMA 5I71B 5K9OB 4NOBA 1JZHA 2IPKB 2Q6WB 4Y9CA 1WWAX 5E9DA 2CBOA 2EDFA 4FI7A 3T6QC 5ECJE 1GYWA 2BVTA 2D9QB 2YGQA 5DJDB 4GKLA 2VABA 1KT2A 4HFWA 1HSAB 2XWZA 3V79C 1AXSA 3H3BC 1NFDA 3DTDA 2VW4A 3BAYA 3IE9A 4OM0L 4Z7NB 1SM3H 3FCUB 4I0PC 2LOEA 5E8NB 4LSSL 4FEIA 1WA2X 2IBZY 1NCOA 1UQSB 4LK4A 5TQ0L 2EC9U 4Z8FL 4XNXH 4ZW7A 3QCVL 4NRYB 1U3HB 2DBJA 5EB9A 4YIQA 4AQAA 2VSKB 2NY5C 4EDWL 5EEVA 1IGTB 2WVTA 3MLRL 1HHJA 1DCEA 4M9OA 3V0JA 1JGVH 4Z76A 3C08L 4XTRC 2AS5M 2XV3A 3QK0A 3WE1A 1S7XB 4NRXB 1T66D 3O3DB 5H37H 1DVUA 4JKWA 1KYUA 3V4PB 4MA7H 3L08A 2ADJB 1WF5A 1DVFC 2H1LM 2NOYA 1YN6B 4KV5E 2B20A 3CDGA 2YAFA 1C08A 2EDBA 4QWWC 4P59L 1NGQL 1Q9KB 1EHLL 2BY3A 4XP4L 4TVPH 5E8PA 1K5NB 3NFSL 4XPBL 4FFZL 4I4WB 5CNHA 2OMUA 1AC0A 2OJEA 3DDGA 2VDML 3KPQA 1O7DC 1SXBA 3EUDA 3I6KA 3QISA 5C08D 3GBNL 4HS6A 3KDMA 3X11A 5B3SB 4ZYKB 4YXKH 3QXDB 3KPLB 4K3JL 3BPCA 4OH2A 5AYQA 4YEFA 2PTTA 1XAUA 1ZSDA 3BEWB 4F2FA 4HMCA 2DMHA 4L5FL 4YZWA 1AKJA 5GS0H 4LEOA 3IGAB 3CU7A 3X13B 4MQSB 3VD9A 2J3SA 5LCVA 4GINA 2X6MA 2YJQA 3MRNB 1HC1A 4KRLB 2P80A 3GLAA 4AUUA 4U1LB 2NXZB 4BINA 1RH8A 5EO9A 1TETL 1S3KH 3FSVA 4PJFE 4OLXL 2BFVL 1MPAH 2VC2B 3GO1H 4WUUA 4PGJA 4ECNA 4BFFA 4BRJA 3Q06A 1L5GA 3RVWC 1H6EA 3NSDA 4BE5A 3TT3L 4PJIE 2WM0A 2EVIA 3JYCA 4B9YA 4M6AA 3CPUA 4ZUUB 1MCOL 4NT6A 4WJG3 5F1NA 4EIZC 2OTUB 2MCG1 35C8H 4DHLA 1OANA 4GSUA 3W39A 3BD4A 4JRFA 4Y9BA 4PBDA 1OOWA 3AM8A 5AKTA 1PGRB 1U2YA 1NFDF 2BP3A 1MF2H 5ACZA 3FQ2A 3B83A 4JZNA 5B1JC 1Z9NA 4QRRA 3R18A 2K70A 2V2XB 3NABL 5EC1A 5JPNB 3CLFH 1BZ9B 3F7YA 4LP5A 1KLUB 1WTGT 4QRUB 2CDGB 4HHAA 1AR1D 3HC4H 5K1NA 3RFZA 2HVKA 2E9WA 5DD0H 3VFWA 1QA9A 4XBPB 4HIJA 4F7PA 3RHWF 4LEXL 4I2XB 2VR6A 1Z2KA 2IAAC 1LK3H 1E65A 2X9XA 4RRPA 5F0PB 5F8QC 3V0GA 4HLZH 3PHOB 1WJ3A 3NJKA 2CO7B 3TZVC 4LCUB 3H56A 3HC3H 3SKOA 2XN9D 4FFZA 4TRPH 1TCMA 2J8UE 3L3IA 1FGVH 4UT9H 1U8HA 3UZEA 1KGWA 1KPRB 5BW7C 3SDAC 3DKHA 1KCUL 2FGZA 3D08A 4G8FA 4HKXA 3T0ED 3Q2NA 5EUKB 1EHKB 4OKVB 4XMKH 1XF4B 1PZ2A 3W9DB 1NGZB 5KN5A 3HE7B 4ETQB 3ISYA 2WBXA 2D7NA 1HOCA 5E2VL 3PL6D 3GDCA 2P4AB 1CDUA 4GB9A 3KJ4C 2AI0L 1YPZB 2APVA 3U9UB 1JTOA 4PIBA 2R1YA 3PHQB 4ZS6C 4CVUA 3LIZH 3P4MB 2VC2H 1OARL 3RY6A 2ZXCA 4YHKL 4HJJL 5DVLA 5EIIA 1RIVH 4I9WE 2WLIA 1JP5A 1N26A 3BDYH 4X7TB 1SJVA 4OLVL 5C07B 1U8OA 1PPIA 1WT5A 3B9AA 5EULV 3OSKA 3GQFA 5EN3A 2ED9A 3K0YA 4P46A 3UBXI 1PZDA 5CILH 1I9JH 2V5MA 2XA3A 2OZ4H 2X4NA 3V6BR 1BLNA 3WS6C 5DSCB 4FTDA 3IFNL 3WIIH 1EEZA 5CINL 1T6WA 4N5EC 4WNSA 1HCYA 1JZFA 4I3SL 3W11D 3HVDA 4UIMB 5AW3B 5KSBA 3OMNB 1EO8H 3UADA 5E2TL 3KEDA 5GGVH 4OV5B 1RZKC 3QHFL 4A67A 1E3XA 3E3QE 3TCLA 1B0IA 3HZMA 4F80A 1IKNA 2NW2A 3SD2A 3BW9B 5B1BB 1MCFA 3VNZA 4FQQB 2YK1L 4WFGD 3ARGA 1VFBA 1IKOP 4EZJA 3O8XD 1WISA 2C9SA 4DP9X 2CO6B 3ZUCA 5E2UH 5DRWB 1YAIA 2ZCLH 3KPOB 1CDYA 3RUGF 3ZBMA 3ESMA 4OGZA 3T6VA 3MJ7B 1MFNA 4UOW1 4XPGL 1U3HD 2DLFL 3EGXB 5AVSB 4XPHL 5ERWA 3H53A 4WKXA 1X5GA 2QGBA 5FKPB 4B9GA 2YD5A 3LEYH 1M71B 2X1OA 4JPVL 4N0YL 4HUVB 5DVPA 1FRGL 3NJNA 5CJBA 3P30H 3MUZ1 3B2DC 2D3VA 3RX7A 3WY2A 2IBGA 4Y4HB 4AXWA 1MAKA 2ZWNA 4KXZH 2WANA 1PY4A 4L4VA 1M57B 2ED8A 4KO5A 4N0UB 4GSDL 1HHGB 2RCSH 4YVNA 1E6OL 2AJZB 2P8PA 4A7QA 1UACL 32C2A 1NFIB 4KZEL 5LN4A 1KSRA 4QXGL 5HHOA 5LDSA 3WENA 5ABZA 4X5WB 2PO6A 3HLAA 3AFLA 2OS7A 3CBRA 3ETBF 3QUXB 4JPKH 4UOQA 1IL1B 5C6WH 5FDYA 2LU5A 8FABA 4XPFH 4NJAL 4NKOA 1LNUA 3KR3L 1XL6A 5IMKA 2E5EA 2B1HL 4G1MA 3OHXC 1JNNL 1XGZA 4LQFH 1QP1A 4ACPA 5B4MC 4PRDA 4LHUA 3MLSH 4YQXL 2Z1KA 2VDPL 3FB8A 5LJYH 1ZD6A 3K4AA 1SEBA 1L7IH 2DRUA 3GDBA 2VDLL 3O6LH 4LCIH 4WHYG 2EEAA 4ELME 5I30L 5TH2B 4V2CB 1A1NB 5D2LA 4J4PA 4DPCX 5HGBA 4L8BB 5B8CB 5LNDA 1HU8A 3OZ9L 2PWEA 5CEXA 2R69H 1MI5E 3R8QA 1HESA 4URKA 4OGAD 1PZ5A 3ZDYE 2NXZD 1IJ9A 5AKVA 2QLVB 4ZFOA 4RAVA 3VFVB 4MJIB 3U36A 1G6RA 3PGDA 1NBCA 4D0DA 4RA0C 3SZKC 1QFWL 1MY7A 3EF4A 2D73A 1EZUA 1E8ZA 4M7ZB 5GGSB 4L3FA 1O7DE 1ESOA 1ZOXA 3ME0A 2HAZA 5LHDA 1T4WA 3MOAH 4X5XA 2KHAA 2VDNB 4Y4FD 1MEXL 1GOFA 3FONB 5I66A 2IWEA 4H20H 1XCTB 4QOKE 1UXSB 4QRSB 4HKJA 1KWKA 1J5DA 3SE3A 3LPGA 1BOGB 4QIRA 2D31A 3IETB 4GAGL 4QO1B 1FVEA 2CZNA 5D7SH 4YSAA 3O6FB 5GGRB 3ZO9A 2E7MA 4PWFA 5EFIA 4R5TA 2H1PL 1LEIB 3NCJH 4BHUA 4FG2A 4PY7A 3RYMA 4ERSH 1MRDL 2N7SA 1KGJA 2XPYA 3ARBD 4K9EC 5F6IC 1E5BA 3L9YA 5FF6B 3UO1L 2Z7UA 3KWWA 4FG0A 1WA0X 3OVUB 3UTTD 4AIZA 1RIHH 4OAWA 3D0VB 4L9LB 1DQQB 4BSWB 4UAOB 3TJEL 3ELAT 2BVEA 1S8DA 3DPDA 5GZOA 2WNGA 2TRYA 3SGJC 3HE7D 1PY0A 5I1GH 2IO5A 2AXHA 2VMJA 3QE5A 1YYLL 4U1MB 1NCJA 2X9WA 2B59A 2WQRA 4XNAA 2YRBA 3QPXH 1XT5A 2F58L 2CUMA 3BKYH 5CIPB 2OMXA 1N5AB 1OCZB 2BWIA 1SJEB 5FV1L 3MX0B 2B4CH 3MLVL 5M7QA 3HTLX 2APWA 4TOYL 4NXKA 4F7CA 1IRAY 3G5VA 2Q10A 5B1KA 5C07D 1W8EA 4JPQA 5CZKA 5C0RL 4GY4A 2VDNH 1FN4B 1NMBL 1TEGA 4PS7A 5I0VA 1HYSC 2HXAA 1BQLH 4ZAKA 4OQTH 4NM4H 2BP0B 1XIWB 1CE6B 3ZU8A 1F6FB 4JB9H 4Z7IA 2WBJA 4LVNB 4NZUL 4RAUA 2C5DC 5IEKA 1ZLSH 1RZGB 4AIEA 2ZF8A 3REVA 3D50A 4H88L 2NUPB 3QDHA 4BGLA 4UBDC 2ZUVA 3L4CA 4LLYB 1QD0A 4JL2A 4OCRL 4YBQC 3VQMA 1OL0A 3JWNC 3MTRA 3NACL 1I1FB 1UA7A 1GYUA 3MZGB 4APQC 4MXWH 1A9EA 5JQIB 4YR6B 3CHOA 4XPAL 3U30C 3PDOA 1VFMA 4AEHH 5JO5B 5BQ7A 3HFML 5EBMB 4OJCA 2ZWKA 3FQUB 4OLYL 3ZE2E 3X1NA 1X5FA 4AY0A 4X4ME 5L6YL 2F6AA 4PJCF 3L5WA 2P5WA 1DUYA 3BCDA 5FIEA 4UWQB 4X4XA 1KEML 3VMOA 3AITA 3MFGB 4H7VA 4Q2ZA 4Y4HD 5GS1C 4CC1A 4OLWH 3H9ZA 4DZ8A 1U4FA 1D7DA 2XI9A 3ARTA 4GLRH 4P3DB 2ERJB 5CIPH 3TO4C 3FO1A 4DP2X 2WP3O 4WV1B 1UZ8B 4P5TB 3PWNB 1KIRB 2CJUL 2CKBB 3QUXD 4YHOH 4HT1L 1GCFA 4J3BA 5EU4A 1ADQL 1NH6A 3PHAA 5F96H 1CLZL 3T4YB 3QRLA 1MHEB 3V4VL 2GJZB 3TLRA 4ZUSB 3RWEB 4FQ2L 5T5NF 2FX8H 1P7QD 4HKBB 2D03L 1Q94B 2F54B 3AB0B 4X6CE 3RWDA 4PJHF 3EOBA 2GY5A 2XU9A 2WOYA 5F7UA 3KNBB 1D9KC 3MA7A 1ZA6A 4CJ1A 5F89A 4PJ5B 4NPJA 4PY8J 3DC0A 1L4IA 2K6WA 1CLOL 4PJDF 3VI3F 4QJ5B 1TKWA 2CIKB 3SBWC 4R7NB 2FBJL 5DLMH 2WQSA 5C1MB 2Y36H 1CI3M 4TLSA 1OPGL 2VW6A 1KN4H 3QIUA 1NLBL 5E0QA 1TUPA 4PI0A 2ITDA 1WV7T 3SKMA 1DBML 3VXSA 1S5HA 3IDJA 2A6IB 4MMXA 1V54B 4U1JB 3LZPA 3LRHA 4XX1E 3UBFA 2F8IA 3OKLB 5I23A 1JPEA 3IRZA 2NY5L 5A3IC 1YY9C 2X44D 4CSPA 5CJQH 3K71B 1VERA 3LXUX 4K5OA 4XXCC 5GGQL 1R3IL 4KQ3H 1VKXB 3IU3B 4WGKA 2WNWA 3NCFB 4ZFFA 1VEPA 1XGUA 2HVJA 3LQMA 2J5LB 2VJ8A 2FATH 1NAKL 2WIMA 3FUIA 1DQDH 4YZFE 4ZW8A 1MHPL 1OEZW 5DHYA 2F5AH 1LEGA 2VXVH 4OBRA 5HI4D 4W9CC 5DVMA 4AX3A 3Q6FA 4X83A 2VZTA 3HMXH 3VE0A 2CKBH 4QRPE 1I85A 4OIBA 4CGUB 4JHAL 3A67H 4DAGH 4KWUA 4TTDC 3SPHA 3T6XA 3SDDB 4EI6A 3MNWB 4EN3C 3IMUA 2QTEA 3W9EB 4R84A 1DVXA 1OAZL 3GKWH 4WNQA 1ADQA 1BHGA 3FSOA 1DBBL 4ZMYA 1EGJL 1UJ3C 3E1F1 4M1CC 2V5SA 1E4XI 5T5FH 4LHUG 3ZKMD 3S3BB 2CPCA 2KLTA 3N9GH 3DXAA 1G9NC 3SO3B 4NKIL 2BMKA 1OLZA 3BVNA 2EIDA 5FM4A 1Y6KR 4ZNEE 5DUBB 3KLSA 1MRCL 1YEKH 4YSEA 4WGVB 2AV7B 4Z0BH 2FVNA 4DFHA 3QIBC 1GHFL 1FGNH 1YEGH 4PUBL 3T0VA 2PXYA 4WEBH 2HFEA 4C54A 1YDPB 2WUBH 1PCSA 4GNKB 2Y3AA 4D8PB 4AM0Q 1ZE3H 1CUOA 1FG9C 1BYPA 3J7HA 4P9HH 1ED3B 2ZUUA 4AL8H 1S7VB 1E30A 3ZT6A 1JHKL 3BQUB 4UNUA 1TEYA 4KJWC 1MJ7L 5DRNA 1H5BC 4XN5A 1DO6A