1MHHA

Structure of p. magnus protein l mutant bound to a mouse fab
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKVLIYWASTRESGVPDRFTGRGSGTDFTLTISSVQAEDQAVYYCKQAYIPPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab, light chain
publication title Evidence for plasticity and structural mimicry at the immunoglobulin light chain-protein L interface
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 52
structure length 219
sequence length 219
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mhhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mhhA01
1MRFL 5EC1A 1FH5H 3PWVA 1KB5A 1N3NB 1QG3A 3VH8B 3F7QA 5DZOA 4J23A 5IBLD 2OI9B 3HE6B 5GS3A 2R0WH 5ITBH 5H35B 3BGFB 2HFEA 2IFFL 2AK4A 2Z0BA 3FQTB 3MRRA 5DMIH 5BZDA 4ZSOA 2WV3A 5A40E 1CDUA 5IK3A 2Y5EA 2R56L 2VDNH 4HUWA 4MSWA 4NJAL 1U3HC 3HC3L 4U1GB 5T1MA 3HMXH 4S0SD 4WHCA 3D25A 3ZZ1A 1IMHC 5BVPL 4OCXL 1JGUL 4LDOB 1OTTC 4NM8L 4MB4A 2BSTA 2DTMH 5BV7H 4KGJA 2QADC 3PP4L 1MAJA 3QJHB 3U6RB 1WTGT 1NBVL 1U3HD 3UJJL 2GFBB 5B3NA 4X6CF 1RJZB 3NN8A 2X4NB 4TRPL 1OP5H 1G6VK 3S37X 1EZVY 5CSGA 4KJQC 5GZOD 1OTTD 1S5HA 3OGCA 3CK0L 3HZYA 4G8GD 5DA0B 5CMAB 1NCWH 3WDJA 5FKAB 4HPYL 1OM3H 1FFRA 3C5SB 3KLDA 3WJJC 1QFWL 1W72B 1WSST 3HZVA 2HT2C 4HFWB 4KJQD 3CCHA 4OZGA 2CRYA 4Z7VB 4X6BA 3AS0A 3UC0H 5HYJB 1T20B 1M7IA 4LDLB 4OGXH 5I8EB 4HGWB 3QP3A 1JVKA 5K9OB 1DN0B 1JFQL 4A2LA 3LEYH 3V4PL 4MS8C 3BXNB 3HI1B 3VXQA 1J0JA 4F9LA 2RFXA 3DVGA 3HAEB 5LAXA 3O2DA 1PQZA 2C4FU 3QCVL 1T0NA 2D4FA 3O8XA 1I1CA 3R06A 1EZVX 1TVHA 1S7XB 4MS8D 4EJ1C 5EU6B 2F5BL 2B7DT 4PRAA 5I1GH 1FCGA 2QSVA 5DRNB 1JIBA 1I1YB 1AQDA 3GSNL 4GKOA 2OLDA 3F58H 1OD9A 4UNTA 2IMMA 1AO7E 2EH8H 3MLSL 3KS0J 4RRPG 5J12C 3BP6A 1DBML 1A0QH 4XPHH 1Q8MA 5J11C 4UTAL 1NMBL 4JCLA 2XG5A 1QPXA 5KG9B 1TETH 2VZUA 1CXLA 5D2NE 3CVHA 4W6WB 4MCZB 5C8JB 3M8OL 4GBXA 3LRHA 3KPTA 3QZWA 3DXAB 1OAKH 4RGMB 3O11A 4MB5A 5J3HC 2B4CC 3FB7A 4U1NA 1YEFH 5GGTA 3QQ4A 5FYKE 4XHJC 4OD3H 4UOW0 1DCLA 1ZA3B 1YN7A 3QEHA 5FGBC 3HC4L 4WEBH 5ISZD 3BKYH 3VXSA 4AMKH 1A1OA 3ILQD 1XGTB 4G9FB 5IBTL 1Q1JH 5J3HD 5FEBA 3EFDL 4PJEF 4XHJD 1L0YA 2A73B 3MRIA 5TPWH 5IMOB 5JHLL 5D1ZD 3HI6L 4LRIC 1KENL 1I1FA 1MAMH 4MA1B 3TPUB 4NJ9L 2W38A 4RGNC 1CE1L 2OL3B 5GRJH 1LD9B 4RBPH 1IC7H 2XZAL 4P23A 2Z31C 1MWAL 5I71C 4G9DA 4OZHB 2XFXB 4OFVA 3HMWH 5HI3C 3LN5A 4S1RH 4ZUVA 1HYRC 3T77B 3U0WL 4LHQB 4QY8A 1WLHA 4IHOB 5D7JA 5AAMA 5CBAA 5ERWB 3ELAT 2J6EH 5BW7C 3FT2B 1NCDL 3VFNB 1P9MC 4HLZH 5HI3D 3FOMA 1JWUA 4PIRF 4FQCL 4YZFE 2PO6C 4LPUA 2E8YA 3GJFH 3PL6B 4NQXB 4YHZH 3MGAA 2YK1H 5C0RH 2R8SH 3KYKL 3NZHH 3SDYH 5GJTH 5HHOE 4FQXC 4A6YH 1I8MA 3ILPA 3JBG7 4NYLB 2MPAH 2W0KA 2APWA 4KPHH 4QRSB 3DTXB 5GHWH 1QLRA 1KJ2L 1KIQA 1WISA 5TE7H 1LO5A 1NGXA 1QBML 4K8RD 3U0PB 4M1GH 5E8OA 2CO6B 1B4JH 1YQVH 1P4IH 4ONFH 5IESH 1LDSA 4RIRA 5ICZB 3AMLA 5DJAB 4LNRA 1A6UL 2YMXL 4KRPD 3G6AB 4R0LC 4S11A 4U3CA 3D2UD 5CHNB 5D1QA 1OAZH 4YJZL 5D2LA 3STBA 2HN7A 4POYA 5CJ8A 3ULUL 2APTA 3RP1A 3KPPA 3GBML 4PJGF 4Y5XC 2EYTA 2H8PB 5EBGA 1T80A 3SE9H 5MP6H 2OTUA 4OZGF 5GSRA 3X14B 1WUNT 5I6XB 4JPIB 1IAIM 3BEWB 4PJEB 3O6ML 4GRLC 1YDPA 3QUYC 1I8KB 4JRXD 5A1AA 4LKXA 3WFHB 1SJHB 4G8IA 2YWZA 2H45A 1K2DA 3SOBL 3SCMB 4U1JA 3BKJL 1URLA 2HJFA 1NH6A 3RL2B 1S7UA 3B5TA 4DKFH 1FVEB 1NLDL 1ORQB 1V3MA 3NIFF 4IS6A 4MNGE 4CUCA 3OPZH 5F96H 3H3PL 2P49B 1CD1A 2IG2H 3NABH 3H9SA 3WHE1 4E9LA 2DKSA 3CC5A 3ZDYF 1X5XA 5HBBA 3EZ8A 1U8MA 5I74B 1OL0A 3KS0H 3VG0H 3ROOB 1HKLL 5BV7B 5I1IL 2R2HB 4K3GA 3L6FB 5J1TC 3S3JA 2A1WL 1GIGH 3MNZB 4FRWA 1T5XB 4XH2B 3IDUA 4OLWL 4OUOA 2BSSB 4BFBD 2DM4A 3IF1A 3TJEL 5E2UH 3TBYA 2B20A 1OCWH 3DV6A 2IH1A 4M6ML 5E2WL 3VCLA 4BH8B 3IDJB 2FATL 1NJ9A 5L8KB 2FX9L 2BDNH 4TSAH 1YEJH 3EDDA 3OXRB 1G84A 2UZIL 1KN4H 2H3NB 2PCPB 4YXLL 4JAMB 1HSAA 1BLNA 1HH6B 4K9EH 3LRSA 3I6LD 5C08B 5JMRA 1A6AB 1F58L 2PTVA 4LK4A 2DL2A 4G3YL 5EBLA 5M95B 1HXMB 1O7VA 5C0CE 4GW1B 2DWDA 4PJGB 4R96A 4P46C 4U0QB 3NCCB 1FBIL 2BC4A 2WBJB 4UDUA 5IMLB 3OJVC 1KTKE 3E8UL 3UTPE 4NFBA 1T4KB 4X9HA 1Z2KA 2B0SH 5HYIA 3PQYB 1NKOA 3FMGL 1RFDL 3EZJB 4P46D 5E6IC 1MHCB 4BELD 2YUXA 3VXUA 1HOCB 3TH2T 4PRIE 3MNWB 1OLZA 1M05B 1EMTH 2PYEB 3MOAH 5I1HL 3K1DA 2DKUA 2YRZA 3ZHLA 3RA7L 2YPLB 4BZ1L 2NYYC 3MLRL 1EGJH 1J88A 3WN5B 2GSIB 5E6ID 4I0KA 1GGBH 3PP3K 3O3EB 1MLCB 3UTQB 1FHGA 1LEGB 1PW3A 5ICXB 1H3PH 1EJ6A 4F57H 4QOKB 4OB5L 1RZJC 4KRPB 1QSEB 3O3BB 5HGAB 2AJ3B 1N26A 5SWZA 2VLME 2YN5A 5DSCA 3RHWF 4LIQL 4OLYH 3SO3B 1CQYA 1QRNE 4XP6L 4MJIA 4IDLA 3GMNB 1T21A 2Q6WB 4JQVA 1WJ3A 4JRYB 3C6SA 4RZCB 5I76A 1A3RL 4U49A 1REIA 3DV4B 4MDJB 1C5CL 3MLWL 1I9JL 3PIQB 4NC1E 4DKDC 4DGYH 1T1YA 1JWMA 3IVKA 4CADB 4KAQH 2NY5C 3U2SA 5C0GA 3VXMB 1I7UA 3L3IB 4KJYB 5E8EA 1IAOB 2NW3B 3ARFB 3LN9A 5D96C 3PXJA 3OKMA 2OP4H 1EO8L 3STZB 4XC3H 1ZGLM 5KN5B 2NY3C 3SQOH 5JNYA 2KKQA 4WI9A 4JO1H 3QI9B 4RISL 1CFQA 1MELA 2OJZH 4NKQB 1YYMH 4NO0D 1IQWL 2G9HA 3GKZA 4P2YA 4WEUD 3G6JA 3DI3B 3H0TA 4HLJA 5F3BA 4X6CE 3NFPA 4JANA 5HPMB 3ARED 3UCRA 2WNGA 4MD0B 3GJFB 2NY3D 4P5TB 4U1IA 4HH8A 3BSZL 1FL5A 1YPZA 3OJDB 4IRJA 5DK2A 1MCWW 5LGHH 3IDMB 3BN9C 4OQTL 4A6YB 3O9WA 5C92A 4X7SH 3OKYA 1ZHKB 3MV8D 5FGCE 2WQRA 4ZXBB 1T5WA 3SY0A 1KELL 4XT1C 2WIMA 3V7AE 3QXAA 5MI0B 1RK1B 1BFOA 3C6LC 2ZPKL 1UM4L 3ZYIA 1I85C 4R7DA 1OP5K 5I73B 3BN9D 2R1WA 3QWQB 4UTBH 1VGEL 3UZVB 3SBWC 2HRPL 3D0VB 1J1XH 2DQIL 4Y19E 4MQ7A 1TENA 4UT9L 4XBPA 1CF8H 2X4TA 2KPNA 2XZCL 4D9RE 4MZ2A 3BIBX 4JG0H 5J6GB 2JK5B 3KG5A 3M07A 3O2WL 4OM0H 2E7MA 5H37G 4OZFG 3A0OA 5CILL 4XVTH 3KPOA 3I6GA 2FGZA 4NQEE 2VN7A 3H3BC 3JZ7A 1KV3A 1TPXB 3X12B 2XWJA 3E3QC 3HNVH 5FV1L 3TCLB 1J5OH 3QIWA 3MLUL 3BISA 4X99A 3N1PC 3S36H 4CN1A 1J86A 2YKLH 2VC2H 5KSUA 4M02A 1G0YR 1GC1L 1QOKA 5CD5D 3O3AA 4N8CL 2ZNXA 1NBZA 1QR1B 4JFDD 3MRQB 1S9XB 4K55A 4PJFB 1KBGL 4XMPL 1G1YA 3L1OL 4OLZH 1TJIH 1U42A 3ZDXF 2CPCA 4PJIA 1AD0A 2EIEA 3CSYA 4LLUB 4S0TD 1F02I 1J7VR 3KWWA 3U7AA 5J13C 1F45A 3VE0A 1QBLL 3QEQB 2UUDH 5FO7B 1NC2D 2PXYC 5GRUL 5CINL 3IFNL 3ARQA 3BAEL 5KJRH 3RPKA 2OQJB 2AJZA 3GSQB 1FL3A 5FM5O 3LQAC 4M6NL 2GITA 3CFKA 1G9EA 4XNZC 3DSFH 4Y5YC 3C08L 4R8WH 1WIPA 5SWQA 4KMLB 2PXYD 5DD6B 2JIXA 7FABH 4QYOB 4WHTA 3I9GL 3SE3A 2NY6C 3GMPA 4C56D 1RZGB 3L5WB 3Q0HA 2VQTA 4TQEL 2FJGB 1K3ZA 2HG5A 4WEMB 4ZUSB 1K4DA 1P1ZB 1QTYT 3CD4A 3S34L 1IGFL 4RFOL 1DBAH 4WTZG 1D9KA 2X40A 5EU3A 5DQDH 1SM3L 3OMZA 5F89B 2NY6D 5AZEH 3IKCB 2W9EH 5DFWH 5CEXA 3TM6A 3HE7C 2JB6B 4F33A 3NH7L 4Y4KB 1J11A 1H5BA 1KFAH 1RJCA 1MCBA 5IROA 4RBPK 2HJKB 1AKJD 4LRNL 1MHEA 1UYWL 2AK4E 3PV6B 3HE7D 3VXTB 3N85L 5JO5A 4UV7L 4O2CB 1S8DA 5IGXL 5HHQA 1S9VB 5EIVA 2Y07H 1LO4L 4TULH 4U6VH 4Y16C 3AREB 1F4WH 2Q86B 1JPTH 3BH9A 1MVUB 2PTTB 1R3LB 2ZNWA 5L88H 4P4KB 4LLVB 2O61A 4P2CG 3EOBA 3DYPA 4OIBA 3WHXB 3MRCA 1XGPA 5JPMB 4UOJA 4QWWC 4LDEB 4Y16D 5IB1B 2AJVL 5ADOH 4NQTA 3AY4C 3H9HA 1DBKH 1A3LH 1ITCA 4XNXH 4NKOB 3RUGF 4FTVB 4UMGA 2Z9TA 5D7KE 1RUML 3RWFB 1YA5A 2MOVA 2V5RA 4PGZA 3UYOD 3MA9L 1MFAL 2NX5D 4QWWD 5I8OL 4PJ9A 3RY6A 4U1KA 4H26A 4QCIA 4FZEH 4OZGE 4XCFH 3SJVB 3CVIL 3D1MC 3AM8C 3GHEL 2XN9D 4ETYA 9CGTA 1MVFA 2V5SA 4YHNA 5IV2A 4LVNB 4GMTH 4PY7A 2VZ1A 1F4AA 1H15A 4M03A 2P5WD 4UAOC 4I2XE 3MACL 2RJMA 3NFNB 4CVZB 4GKZB 1WEJH 2PYEE 2F9BT 4OAWA 4WFGE 3ECBA 1KCSL 5TE6L 4DAGH 3VGHA 3JTTB 4KV5E 3RHWK 3VFSA 5HHXH 2IADB 3MODL 3QFJD 1A4JA 4R4FL 4QTHB 2HFFA 2IF7A 3IS0X 5HHME 2OSLA 4GAGL 5AYUH 1A22B 3BP7A 3G5ZA 4PGCB 1ZLWH 2XNAA 3HZKB 4P2RD 2Z92A 1XH3B 3ZDYE 1GZQA 5DDHB 2Z8WC 5DJ8B 1MQ8A 5KSAC 2J5LC 1QUNA 5F7UA 1CFNB 4Y1AA 4HWBH 5A2FA 3RTQA 3B2VL 2CJUH 3BE1H 4ZMAT 3AC0A 1PG7X 5IOPA 3FQUA 3QO1B 4HX1B 1S7VB 1NC2B 2DQHH 3NIDE 1S78C 4C54A 4Y4HD 1LP9B 4PJIF 3U4EB 3HCVA 1XGUB 1U9KA 1FGNH 1JI1A 5DK0B 3TZVA 5IP4A 4GAYA 3OSKA 3FTGB 5KVDL 2FLRT 2K9UA 1QSFB 4JY4B 4LASH 5ENWB 3ARGA 4JZJC 3PNWB 1WZLA 3UTSE 3CZFA 1S78D 4AT6A 1BQSA 5BJTA 12E8H 1BJ8A 1SHMA 3P4MB 1GAFL 1RUKH 1P4LB 5D8JH 3REVB 4E41B 4MWFB 4LCCB 2CDEA 1EK3A 3LEXA 4BK4A 2GJ6A 1RIHL 2AP2A 4M00A 4HIIB 4LLAA 4K7FB 4UNVA 4GFTB 5F7MC 5GSVB 2ADJB 2NY1D 2QQKL 3IDNB 5I8KH 3F65A 2GUOB 2O5YL 1FJ1B 1QFOA 5GPRA 2W92A 3P0GB 4OD1H 3GZKA 1RU9H 3P4LA 4YO0A 5ANMB 4MB3A 3IGAA 1X6NA 1CICA 5ESQB 4D9LH 1AGEB 4U1SB 1S7SA 2YA0A 5T1DL 5GGVY 4LPYA 4DVRH 4FXKB 3T3ME 3N1MC 5FYKL 1B0GA 2IEPA 3SDDB 1A9BB 4DN3H 5GS1A 4XXCC 1BAFH 5E0QA 4NSKA 2Y25A 4CMMB 2ZKHH 1FNGB 4QT5B 4JGJA 1JHKH 4TUJB 3EFFB 1C08A 1ZHBA 4ZTPH 5IG7A 4M1DL 2XXCB 4I3RL 1NL0L 1IQDB 2BVYA 1FNSH 3ZHKA 2FD6L 1K85A 4ZS6C 4OGYL 3TNNA 1GCFA 3NOIA 4IEFB 4L4VD 4ZPTA 4XC1L 2V7HB 1ZE3C 4F8TA 4MNQA 5T3XD 4QGYA 2F58L 3K0WA 5F8QC 1ES0B 5D2LE 5GS0L 5GGQH 4WWID 4YQXL 4K3DL 3C60B 1Z9SA 4XBGB 1BD2D 2WSKA 2CLRB 3FFDB 1ZHNA 4HIEB 5I2IB 1H9VA 1DQDL 2PW2A 1II4E 2XQBH 1DUYA 5DT1H 3C09C 4CN4A 3SGJA 4WWKA 1F3DH 1Z5LA 5DD0L 1UWGH 2AV1B 3QFJB 3CX2A 4H1LA 1SVCP 2X6MA 1JWSA 1YYLL 4H0IA 1IZKA 4PG9B 2HAZA 5GS2H 1U8HA 4P2RB 2EE9A 2AW2A 3MRKB 3U6RA 4LARL 1XAUA 2ZSWB 1DBBH 2IGFL 4Y8DC 5I1DB 2COQA 2VIRA 4YHOH 3RPIB 1CFBA 3UEZA 4XPGL 1KCVH 3MCLL 5JZ7D 4JJ5B 4NZTH 1K5NB 5IEHA 3MJ7B 3QFDA 4KDWA 2YD2A 3P77B 4KRMB 4YWGH 15C8H 3T0ED 4HFWA 4XPAL 4IJ3B 4NPYB 3SDAB 3WFBL 4Z7VA 3CIQA 3V6OA 4Z5RB 5GGUA 3BH8A 4JRWA 1Z0MA 1EFXD 2VITA 5HYJA 3EO9H 1JGVL 3TO4A 4HGWA 3VXRD 2NXZB 4PJ8D 3MZTA 2D9QB 4KTEH 5E56A 3S4SG 4H1LG 3BXNA 3VGFA 4LSUL 4HWZB 4HULB 1T0MA 3WIIL 4LLQB 4OZIB 4G8EB 3ABZA 5DMYA 5FHAL 5LXGH 1QZ1A 1MLBB 4M9PA 4TSCH 4PRBA 4OLEA 2ARJB 5DRZB 1FVDB 2VYRE 1WIUA 3BPNC 5EU6A 1A6TA 4HCRH 4LEOA 5DJ2B 2Q87A 5FDWB 5BVJB 1JZ4A 3IFOA 2FO4B 3F6IA 1BECA 2AK1L 1FFNA 1F11B 1G7JA 5DI8B 4MD5A 3ZDXE 3S35X 3BZFB 5L2KD 4X4XB 2M2DA 5CJQL 3G5VB 3MV9B 4LLMA 5CEYB 2OXGA 5HI5C 1T7XA 4JFPB 5C8JA 4EOWL 4AIXA 5C6TL 3OZ9L 3QCUH 1IGCL 5LBSH 3EYSL 2MQCA 3QQNA 3VXUE 1ZLSH 1VFBB 5FB8A 1A1MB 1ZA3A 4OIIL 1DFBH 4YAQB 5IW3A 5HI5D 4NKIH 5IF0B 1Q0YL 1XGTA 4G9FA 4X5LA 2F5AH 2R4RH 3QRGL 1MNUH 4JFHD 1U92B 1NAMH 4P5KB 2E7LA 3K2UH 2UUDK 1K8IB 3FRPA 5IMOA 3LKSA 2I5YH 4JVUA 5MHSE 4HWNA 3RWJB 2YA2A 1VACA 2AABH 1MCQA 2BY1A 1G7MB 2OL3A 5C07D 1LD9A 1W0YT 1OGAE 5IHUL 1J9CT 4ZNEE 5KVEH 3BMWA 4OZHA 2XFXA 4MJIE 3I84A 4DKEL 5D1XC 1G7QB 2I9LB 2CKNA 3T77A 4HQQL 3UBXI 3MSPA 5KSBF 2LFGA 2HLAA 4YHML 3G08B 4DZBB 4WUUB 1F8TL 2IWGA 3T1FA 1FN4A 4YBQC 1YMMB 3RWDB 2DQCH 3VFNA 3DURA 1W72L 2B5IB 4RMUA 1J1PL 3PL6A 3EOAB 4NQXA 4XNMB 1ZVHA 4OV6F 1MQKL 3IAPA 3MUGB 5DJ0A 5DHVH 4Z7UF 3TBWB 2GCYA 2RGSA 4NYLA 1U3HA 1CTOA 4GOSA 3V95A 3NA4A 5L7XH 4NHUB 4O9HH 3QQ3B 5FGRA 1PKQB 2V6HA 5KS9B 3CH1B 2KH2B 3G6JE 4QRRD 1UB6A 5J7CC 1KJVB 2BCKB 5DRXB 4G8GA 1KEML 3ARVA 5ICZA 3VXNA 1QFWM 3KJ4C 4IIQC 3RUGE 1ZK9A 4A2MA 4JHZA 6FABL 1QFUH 3QIBD 4H25B 3HI5H 3MLYL 5CHNA 5FCUH 3T0EB 3W0WB 2DI9A 1AFVH 4LCWB 4AL8L 4J4PC 3ZTNH 1CQKA 1EFXB 3HR6A 4OUUB 2ADFH 4ENEC 1YJDC 4HIHA 4ODTL 4EDWL 5D6CB 3FONB 4NO2B 2X1PA 4MQXC 5FECB 5BS0E 1IC5L 1DDHB 3X14A 1BOGA 3O3UN 4JPIA 5DRWB 2DYPD 1OSPH 4EDXB 3IFPA 1EHLH 5BO1H 4LL9A 3TCXA 1OWRM 4ENED 3ARBD 3KLAA 4I13B 2J88L 5F9WB 2AJYH 5JW3H 3NCEB 1FYTB 3WFHA 3GMLA 4LSSH 3SCMA 5DJYB 3QWOA 4OF3A 3GB7B 4PP2A 3INUL 5JW4N 3RL2A 1AGDA 4ODWB 3LRGA 1N4XH 4JFEE 4R26L 1TIUA 5C0AB 4MA8L 3EYFA 2X4QA 3F7VA 1HILB 1IM3A 4O02L 2E7CA 1AR2A 2HTKC 3GI8L 5DA4A 5KSBB 4WDIB 1D3CA 1XFPA 3QUZC 2H1PH 4OBRA 1WWBX 3GBNH 3ROOA 3QDHA 4X98B 43C9B 2R2HA 2DL9A 1A9EB 3L6FA 2FGWH 2FCBA 4PJIE 4XH2A 5L0QB 1WQVT 3MV11 2OZ4L 35C8L 1G9MH 3UXFA 4OF8A 2HTKD 4EIGB 2DM7A 1A6WL 3PGFH 3QUZD 4G5ZH 4Z7UB 2BSSA 2R0LL 4ZFFB 3KVQA 4PB9H 4DVBA 4RWYH 4CMHC 4RFNC 4QF1B 3P0VH 5EUOB 5ISZA 2GAZA 2XI9A 1WBZB 4OLVH 2WWKT 1Q9OB 2X89D 3JWOC 4AIZA 3FFCD 2WIIB 1HHHB 1MCFA 2VMFA 3OXRA 1R5VA 2H3NA 5D1ZA 1NFDF 5FGBA 3D0LA 4JAMA 1R5IB 4JFFB 1BREA 5ABDE 1JI2A 4WVRA 5C08A 5LWYH 5HYSB 3NFSL 1MRDH 4R90H 1EEUA 1G9NH 4Q9QH 1TZGH 1JN6A 5DJCB 1Y6KR 3VRIB 1R3HB 4I4WB 5C3LD 3U30C 3V4VH 3IU4H 5E9DD 5H2BA 1A7RL 3MUZ1 1FVCA 4KDVA 1LE9B 3CPLB 1T4KA 5GIRB 3PQYA 1KCKA 4EN3D 1LO3L 2XTJB 3WFEL 4NQCD 1U3YA 1CIDA 1MHCA 1L6XA 4WI5A 2DQUH 2C7UB 3TN0B 5BW7A 3EYUH 3MNWA 3HC0A 3GRWH 4JDVB 1CDYA 1P9MA 3B9DA 3GI9L 3RVWD 4OF5A 4K23H 4PGEB 4XB7A 2XQYG 1EVTC 4QRRB 3NMEA 3U7YH 5D93B 3WN5A 1MCEA 1YEIL 3SE4C 1AP2A 5CJXC 5ICXA 4X4ZA 1E6OL 3FRUB 1B4RA 1B3JA 1CT8B 2HA1A 1YNLH 5FYLH 4ONHA 3D2UA 1U8IB 2GT9A 2UYLB 4GRMA 2R0WL 4N90E 4UDTB 5DMIL 3LPFA 2EKJA 1U3JA 4PJDF 4S10A 4DCQA 3U1SL 2AJSL 4M5YH 3QXTA 4RZCA 1FRGH 1NAMB 4MDJA 3TYGL 5JW4Q 4R0LA 2G5RA 5AUMB 2XY2A 1PJ9A 5IMMB 3V79C 2WAHA 1UWEL 4ZUTA 3RWGB 4CADA 1BZQK 2CUHA 1T3FB 3L3IA 3DJ9A 3VGAC 4KJYA 4Y5XA 4ZO8A 3OR7B 2QQQA 4RAUA 2W60A 3A67H 1RVFL 2MQ0A 2GW5A 3GMRA 3NPZB 5FUOH 1GHFL 1J10A 3TESA 5EOTB 4APQB 3OAYH 3RWEA 3RDTB 1NCWL 3QPXL 1UJ3C 3RWIB 2XRAH 2E9JA 4ZTOL 3BPCB 5FM5M 1VFMA 3QNZA 5HPMA 2AV7B 1KLUB 4MD0A 5HHPB 2M8XA 3GJFA 5DTFB 5J4MA 4ZOCA 1XGQA 2H32H 5DHVB 1KCUH 3WSQH 1FORL 4NHCL 5E94A 1CFTB 1GGIH 1ZHKA 4NN6B 4XNUH 1OARH 3EO1A 2DTSA 3S9DB 5BXFA 4LPTA 2VZ3A 4YIQA 4YPGB 2DQTH 1WBYB 4FZ8H 3RWHB 3QA3A 2F53B 3IAQA 3B9AA 4NZRH 4P99A 5I1LA 3CJJA 3HNTH 5FO9A 2YR3A 3TFKC 1T7YA 3RKPA 2JCCB 5F72S 2VZSA 2MHAB 2BNUA 3O4LD 3C5ZC 4OV5B 3N06B 4HJGB 2H6PA 3KJ6H 2BJMH 5I30H 3JWDL 2VR4A 2ICES 2VLJB 2VXVL 3A6BL 4L9LC 4P9HH 4ELKA 3K2MC 3A6CH 1OP3H 3TFKD 2ITDB 5IB3B 4LHUD 2P5EE 1A0QL 3C5ZD 4LEXH 4XPTH 2M26A 3SGEH 1GGTA 1TCRB 1NGYA 2QADB 2ZOLB 4PJDB 1TETL 1A5FH 1OQXA 4XAWH 1D7FA 3DLQR 3L5JA 2IAMC 4EXPX 1KT2B 5B8CC 2GJ6E 1R3JA 2JE8A 3MRDA 2BVTA 3MRQA 1S9XA 4YBLB 4F9PA 2DQDL 4POUB 1LK3L 1IL1B 4OD3L 2XPGA 3PWPB 5EO9A 3PWUB 4MNHA 2IALB 4NQCB 2NQCA 3FO9B 1E4WL 4HD9A 1D6VH 2LQRA 3KXFB 5SWSB 1TNMA 3QUXC 3VG9C 3D5OF 2BNQB 2J3SA 4LLUA 4R97B 1E6JL 4X80H 4YE4H 1GSMA 3MRPA 4WRLA 1SVZA 3GMQB 3MXWL 4H0HB 5GISH 4UINH 3MLVH 1T04A 5TPWL 5LGKA 1NBYB 5I1KL 2VL5A 2Z4QB 4P9MH 2OQJA 5E6IA 4PTUB 3VFUB 1WFOA 3QUXD 5ADPH 1XF2B 1H8NA 1Q72H 1FNEA 2EE6A 4NQDD 2PNDA 3AB0B 4QLRA 1ZEAL 5DD6A 1IT9H 1J12A 1E4JA 4DGVH 2GJZB 2VXQL 3CFCH 1SBSH 4LCYA 1RZGA 4U1LB 1SJVA 4ZUSA 2VSCA 5ACZA 2GY5A 4WI6A 3MV7B 2A9NH 3UBXA 4AM0B 4YHZL 4K7PY 2D3VA 5KSBE 5GRWA 3QSKB 4XMKL 5GJTL 2NZIA 1YEEL 5GGSY 4A6YL 1Q94B 4D94A 4JY6A 5IBUG 4KPHL 4TVPE 3RRQA 3HUJB 2HJKA 4M1GL 4L5FH 1GL4B 1V7MH 3TH4T 2EDJA 1KIUA 1AXTH 1P4IL 3MXVH 4PB0H 4O2CA 5FYJD 5MEPA 1SJEB 2ENSA 2UZXB 3B5HA 3L5IA 1BM3H 1NEZB 4PRDB 3PWNB 4EBQH 3AREA 3QUKA 4KUZH 2HVKA 1D5XB 1RIUH 2Q86A 1S7WB 1N6QH 2DQEH 4ZS7H 2PTTA 4J12A 1UXSB 1R3LA 1ZAGA 4GT7A 3D39D 3DRQA 3WHXA 4BYHA 3WXVL 1HCFX 4K7PX 3UBXG 2GYSA 5D5MF 4RGNB 4UQ3B 3LKRB 3HPLA 1EGJA 4NKOA 3SE9L 3SKJH 4YDKL 3AAZB 4LAQH 4PJ5D 2XOTA 3RWFA 5I71B 4XP5L 1DP0A 1P2CB 4OGZA 3OAUH 4NUGL 2Y36L 5MERB 4FHBD 4XCYA 1I3UA 5CEZE 2E7BA 3N0PB 4LLYB 2E9IA 3SJVA 3V6OE 1KNOB 1U8OB 3J8F7 4F7PB 2VLRD 1SEBB 4YHKH 1BIIA 3T09A 3P11H 2W91A 2OR7A 2PO6B 4DKFL 1UJTA 1ETZB 3SBWA 2ICWI 2ZUQC 3OPZL 5F96L 5DQ9B 1CU4H 1BGXL 3DUSA 2VDLH 5FCSH 5GQBA 2BVOB 2YUVA 4NWTL 1IBGL 4WHYG 2IG2L 4CVZA 5L2JA 1RZ7L 3FQNB 3STLB 1BJ1J 1MCOH 3LOWA 1QR4A 1L0XA 2AI0H 5KZCD 3CLFL 3DO7A 3REWB 4M9OA 4EQ3A 1DQMH 2C3XA 1HEZB 4JFDA 1LMKA 5DJ8A 1RV6X 2VDPL 1PAMA 1EUTA 1HIML 2YBRA 1EERB 1V7NL 2Y6SD 4U6HA 1DSFH 3CGTA 1N0XL 2GJJA 3QO1A 2QSQA 5HHVH 1NANH 4TSAL 4NNYB 3TNMA 1S7VA 1YEJL 3HNSL 3WYRA 1JUFB 1NC2A 3P30L 2DBLL 4I1NB 4ACPA 1LP9A 2ARWA 3FZUD 5C3TA 2EE2A 2H32B 5DK0A 3FTGA 1OAYH 5J1AA 1QSFA 4JY4A 4UIKL 3B83A 2DDQH 5DMKB 4WHDA 1ZHLB 2HJLB 2GK0B 2PXYA 3UTTD 3ZE0E 5D7LD 1IAII 1IGJA 1NFDE 4O51B 4HKBA 3ULVH 1JGEB 3MV01 2IH3A 2P8LB 1GGUA 3BP4B 2VDRH 5D5MB 1RHHA 4YUEH 1JPSL 1CLOH 1DJSA 1P84J 4MXQD 2QR0B 3G6DL 3P4MA 1TTUA 4L8SC 2ZUXA 1P4LA 3K1KC 5C6PB 4E41A 4BQ8A 4J2XA 5MENB 2B0SL 4H8WL 3CMGA 4FG6C 2XA8L 1JK8B 2DQGH 3FQRA 5C6WH 2DIBA 4HIIA 2CIKA 1A4KB 1EMTL 1G1CA 3DMMB 1AHWC 5GSVA 4ZFZA 4M93C 3QDMB 5DGQA 4NC2B 1AKJA 1UGNA 2GUOA 3KPQA 3L3HA 2AJXL 1U58B 3HE7A 3IB4A 4PJCF 5CBEB 5ANMA 4F57L 5ELIA 1RAMA 2E9WA 4DK3A 1MRFH 2XQYK 4HPOH 4WUKH 1I1RA 5F6IC 4DW2H 3SPVA 2I60L 5DWUL 4H5SB 1MFNA 4CMMA 1HYSC 4TUJA 3EFFA 4RWHA 2XIDA 3CSPA 3OKDA 1IEBB 4JQIH 1B90A 3HC3H 1IQDA 4G8GE 4JHWL 4PJ5B 3U7WH 4PJDE 2BNRD 3V0AC 4R2GC 4UV4L 5BVPH 4GO6B 4MX7A 1JGUH 5DEGB 2NX5A 1SJXA 4NC1C 5IB5B 4NM8H 2V7HA 3EYQC 4K3JL 3AY4A 5BOZG 3PP4H 4ZODA 1NBVH 2FO1A 3KPLB 3UROR 2W0FB 1I9IL 3BD5A 2XN9A 5ID1B 1RK0B 4NRZA 4TRPH 4R2GD 5CIPH 4ZFGH 2ZG2A 4KFZC 1YYML 3FFDA 3LHPH 4HIEA 2P5WA 4ZAKC 5I2IA 3D85D 3V5DB 3EYQD 4QHNB 4BSWB 2C9AA 5C0BD 2EICA 1M71A 4HPYH 5F1IB 3LV3B 2ATKB 4NZJA 1A47A 3MJ9L 3QDJD 2V2XB 3QFJA 5KZCB 5LGHL 3I2CH 5B39B 3CMOL 1EAPB 4ZAKD 4PY8J 1HZHL 2ORBH 2QEJA 4E0RA 5I1JL 4P2RA 1UZ8B 4LU5L 2ZSWA 1JFQH 5I1DA 3V4PH 2GSGB 1LILA 4UTBL 3TBTB 1IAKB 3I75A 3DX8B 4OF7A 3L7EB 3I02B 3QCVH 3WS6C 1CF8L 5AG8A 4Z7OF 4Y4HA 5C0DA 2VO5A 3TC9A 2C4FT 3P77A 2EIBA 2F5BH 3BGMA 2BY2A 1HWHB 4OM0L 3WUZA 4Z7WA 3FQXB 5BZWB 3GSNH 1XGRA 3ULVF 4NRYB 5FXCH 4QRPB 4KKBD 2L0DA 2C3GA 1PG7H 2E27L 1YEHH 3NCYS 1DBMH 5ISZE 4UTAH 1NMBH 4YHLL 1J5OL 1S9WB 4WCYL 3JXAA 4EVNB 4HWZA 1VKXB 4Y4FB 4LLQA 4OZIA 3MPCA 4JM2D 4Y5VC 2BVPB 5T3ZD 3MCG1 5JOFB 5DRZA 1U0QA 4Y2OA 4TUOA 2F54D 5HYQB 5FDWA 5DQJB 5BVJA 2FO4A 2JTDA 2ZG3A 2E7HA 3HC4H 2V5YA 3U0TB 1F11A 4WO4C 5HGDA 3BZFA 2XACC 4LNVA 5KJRL 1CFSB 4X4YB 4X4XA 3EFDH 2EDHA 3CXDL 3BW9B 5JHLH 1KC5L 3HI6H 1MFCL 2X9XA 5D70H 4FABL 4IOSD 3ZSTA 2X44D 4IOIB 4AENB 4WO4D 5DR5L 1MCWM 3V6ZA 1MWAH 4LSQH 2CK2A 2NY7H 4UT7L 1CXFA 1KN2L 4HWBA 3O0RL 3B43A 4YAQA 3P40A 4EI6B 2VLKB 3FT4B 1DBAL 5IF0A 4I0PB 5DQDL 2AXHA 2F15A 1NCDH 4NO5A 3DRTB 1S5IL 4GXUN 4PLJD 5JQHC 4KJPC 1ZLVH 1CDJA 3KYKH 4L4VA 3MYJB 4JR9L 1PZUB 3ARSA 3IJSB 1G7MA 1BFTA 4GUPB 5IMKB 1KLGA 2B8OT 1I3RA 4LSVL 4R7NA 3MJGX 4KJPD 1G7QA 1QBMH 1MH5B 3ORJA 4MLSA 3LKOB 5C2UB 4OKVA 2Y07L 4TULL 4U6VL 4NM4H 3G08A 3D3VB 4LMQI 4DZBA 2W65A 4NCC2 1YMMA 4PTTA 3RWDA 3BJLA 1A6UH 2YMXH 3DGGA 3NPSC 3BFOA 4Q9BA 3BIKA 3AFLA 4NFCA 2QJDA 3EOAA 3SE8L 2KL6A 2QQNH 3HS0A 4JRXE 2V5TA 3MLXL 3MUGA 4WW2A 1KTRL 3C5JA 4M1CC 2NZ9D 4UUJA 3ULUH 1DBKL 4TOYH 1J05B 3GBMH 5EIIA 4P57B 4NHUA 2XZQH 5HSFA 3QQ3A 1CYGA 5I19L 5KS9A 2YEZB 3CH1A 3HB3C 4ZPVB 2R0ZH 3NA9H 4WNQB 4N9GA 3GSUB 1IC4L 3GK8H 1T2QH 3DX9B 1KJVA 4M1CD 5DRXA 5T1LB 1CFVH 1PY4A 4KI5D 3LCYA 3VW3H 5EFIA 3O6MH 4FZEL 4XCFL 3D9AL 4NCDA 1W0WA 1NC4D 3RWCB 3HB3D 4GMTL 3T0EA 3KR3H 3BKJH 3MJ6A 3G5YB 1EFXA 1A7PL 1NGWA 4X7FC 5A43C 3VXRA 4DAGL 4PJ8A 3H3PH 2R23B 1ZT4A 3FONA 3KPSE 2ENYA 5HHXL 4Z7WF 2BRQA 5FECA 2ICWA 4F9LC 5AYUL 4JM2B 1UM6L 5DRWA 3PF2A 4EDXA 5DJ6A 5I1IH 3VMPA 3O8XC 2A1WH 5DMJB 2VE6A 2VERN 4OLWH 4FNLL 5CIPB 4JFOA 3E1F1 3THML 4CDGC 5JA8B 1H0DB 4JPWH 5HVHB 3U9UA 4ODWA 4HK3J 2DWEA 1KPUB 5CJ5A 3V9FA 2OM5A 3O8XD 1WK0A 4D8PB 2FATH 4KZEL 4FFZH 5L2KA 5CSBA 4MCYB 2YXFA 2UZIH 3GSVA 5IJKC 4YXLH 4X98A 1P7QB 4N1EA 1VADB 1A9EA 2FECI 2R1XA 1FFOA 4G3YH 3HN3A 4PREB 1NGZB 5J9PB 5FO8B 5F6HI 2R0KH 4LP5A 12E8L 1B6DA 2PW1B 1MIEL 4LCUB 1S7RA 1A1NA 4KROD 3VDCA 1FBIH 1X5IA 1X5HA 5I17A 1RUKL 1WBZA 2B39A 5EO0B 3KPRD 3NCYP 4RQQA 1Q9OA 3E8UH 2WIIA 1FDLL 2NXYC 1HHHA 4WJ5A 2H2PD 3O6FB 3GSNB 1E0OB 1RFDH 3FMGH 1WBXA 2XY1A 2NY4B 5B38B 2CKBH 4B7LA 4YXHL 5C07A 4XP9L 5I8KL 4P23C 5I1HH 3BX7C 4GG6A 2NXYD 4OD1L 1X6LA 3RA7H 1CGTA 5GRXG 2Y06L 4BZ1H 3MLRH 2L4OA 5IW6A 5B3JF 4JG1H 5DLML 5J57B 5DJCA 5KSAB 3VRIA 5FYKU 4I4WA 4MD4B 1A7QH 4M7ZC 5D7JC 3M17B 1VEMA 1A8JH 4P23D 4OB5H 4C83A 4U0RB 3ESVF 4LAJH 4GW5A 3P73B 3SGEI 4PJCE 2VQ1B 4GQPH 5GIRA 4N68A 4LIQH 4JREB 2DIAA 3V6BR 4XP6H 4YDJB 4GSDH 2Y23A 4OCLC 4U7KA 4ZO6A 5D7JD 4JDVA 1WGOA 1A3RH 5CLWA 4X83A 3MLWH 2CR6A 4PGEA 1M6OB 4QRRA 5GRVK 4MQTB 3WUWB 3QNYA 3VWKB 1RD6A 1OB1B 3IAGC 3FRUA 2D03L 2BHYA 1CT8A 1ROWA 2ATPA 1MWAB 1RUAL 1N59B 3QIBA 2BHUA 4B53A 3MV8E 1PZ5A 3KAAA 3LSOB 1CR9L 4RISH 4AIOA 1IQWH 1Y6MR 5D7IA 5KSVA 2GTWB 3ZO0A 3VFMB 3S3SA 2K1MA 4QRTB 1INQB 4ZO9A 3RBSA 3BWAB 4F7MB 1T6VN 3MRBB 1BFVL 4WI4A 3VXPB 5IIEA 2E6PA 2XA3A 3BSZH 4OCRH 3TIEA 1RZKC 4TVPL 2VKXA 3ARDB 3OR7A 3ARBA 1A6VL 4HBCL 4HF5L 1IFHH 5JQ6H 4APQA 2ZPKH 4PV9A 1UM4H 5IFAH 2HRPH 1Y0LA 2DQIH 2AV7A 4L3EE 1FSKB 5HHPA 2CXKA 1G7PB 5EO1B 3AROA 5DTFA 2XZCH 4JFDE 1YJDH 3VFOA 2P8PA 5DJZA 3O2WH 5DHVA 3E3QE 1RUPL 3EO9L 3RX8A 3O81A 3SKOA 1JGLH 3F7YA 3FHAA 2ZP0T 4Z7OE 1HE7A 5CILH 4NDMB 1Z3GH 1P6AB 5CGMA 4YNYB 1KJ3L 3ES6B 3QXVA 4YGAB 3MLUH 1JHTB 2F53A 3S7GA 3S5LA 5LXGL 1GC1H 5K9KB 1MHPL 4BH7A 2JCCA 5CEZL 1SMAA 2W9DL 4N8CH 4TSCL 2MHAA 2X70A 2X89A 4OV5A 3FFCA 4HCRL 2X7LB 5HHNA 1KBGH 4XMPH 3JUYA 5EZOH 3L1OH 3DETD 4U4BA 5KOVC 1ZGLA 3GUTB 1BF2A 4OGAC 3B6SA 5F9OL 4MAYB 5IB3A 1E4XI 1HHGB 3L3JB 2EYRA 1PLGH 4C56E 3QCTL 3MNVA 1QBLH 3LN4B 1TCRA 4GKSB 3UYPA 2ZOLA 1BMGA 4UBDD 5DXWA 5GRUH 5EU4B 5CINH 1P5UA 3IFNH 3BAEH 1IM9D 4OGAD 4M6NH 4HS3A 1AGBA 1SEQL 1KT2A 1JHLL 1LO0L 5E9DA 5LBSL 3CNKA 4P2QD 1FFPA 2QL1A 3ARPA 2MCG1 5DZNA 4EN3A 3PWPA 5JXAH 2IALA 4NGHL 4NQCA 3CDYA 2J8UF 5SWSA 2X42A 3L3KA 4TQEH 4YHIB 3RVTD 3MUY1 1MNUL 5CP7B 5J6HB 1X5KA 1KIRB 5FA3A 3S34H 1IGFH 4RFOH 3GMQA 4M8VA 3K2UL 4PUBL 3MA7B 4KTYA 3WFZA 4PTUA 3VFUA 2AABL 3EYOA 3NH7H 4V1DB 1XGYL 3P4OB 5DHYB 2D9CA 4H20H 5E6ZA 3Q6FB 5C2BL 3VJ6A 1UYWH 4G6FD 4KU1A 4FQHB 1ZLUH 4YFLI 1NPUA 3L3DB 1C16B 1C5BL 4JQVC 2DQCL 4NQSA 3MMEB 2MTPA 5SWZD 4AM0A 1DQJB 1X7QB 2F19H 3IXTB 2CKBB 1JV5B 1OTSD 1Q94A 5D7IF 4YXKL 3V0VA 4XTRC 2XN9E 3L9RB 1GRWA 3PHOA 4N0UB 1LQSR 2AJVH 2G75A 3OF6D 1IC1A 2P5WE 3WL9B 3VI3F 1VGKA 2R2BA 1RUMH 1KULA 2PETA 4NNXB 4BFIB 2HFGL 4XTRD 4WENB 3MA9H 4PS4L 1MFAH 1MI5B 4PRDA 3GSOB 4DEPB 1D5XA 4P4RB 1RHFA 1Q0XL 4XMLL 5FCUL 1T0PB 3CVIH 5DJDB 3T2QA 2GEEA 5HJ3B 2CD0A 4ELMF 1D5BA 3E6HA 1UXSA 3OBAA 4YK4C 3S37L 4F2MA 4ZO7A 4L4TD 1UJ3A 3O9WC 4OZ4B 2VB5A 1DLFL 3GRWA 3MACH 3AXLB 4QEGA 2CRIA 3Q5TA 2GK2A 2CLVB 3PGCB 4Z7QF 3AAZA 4F58L 3MODH 5DMGC 1EBPA 4PJAA 2EXYC 1ND0A 2MFNA 3MRJB 3O9WD 5D1XB 3T0XA 4KZDL 5HGBB 4DGIL 4GAGH 3PXHA 4HIXL 2AJYL 5JW3L 1MJ7L 1ZMYA 3R8BB 4LLYA 4Z7WE 2MMXA 3MGOB 3VFGH 1GXEA 4LSSL 3WKNA 1U8OA 1EEZB 4PRHB 4ZUWB 5DMGD 1BWWA 5A3IC 2ED9A 2EXYD 4NT6B 3O6LL 5CJOH 1U8NA 4LHUA 2DKMA 1XZ0B 2JJWA 3MRGA 5DQ9A 3C5ZA 4YDVA 5JIIA 2ZCLH 2X10A 3K3QA 4L9LA 1XF5A 1IM9B 5DJXA 3CFEB 5KVDH 5E70A 1CLZL 4N1CA 4NKDA 1J8HB 4M8QA 3JTSB 3LIZH 1YY9D 4J3UA 1JYWA 1PBYA 5BRZD 4HT1L 4IIQB 4PB9L 4JVPA 3ZYJA 2LTQC 1QFWI 4R3SB 1WIOA 3CDGB 3QDGD 3VFPA 2X4RB 1EBAA 4OLVL 1RURH 4WFHD 5B8CA 4NNYA 4L1DA 4Z77A 1GAFH 4FQQA 3VWJD 2H32A 1XCTB 3QUXA 2J2ZA 4I0CC 4HZAA 3G04B 3H9YA 5LWYL 4Z6AT 5DMKA 4NQDA 4RA3A 2G2RB 1MCCA 1ZHLA 4YC2C 1MRDL 4ELMB 4R90L 1JPGB 1G9NL 1WT5C 1AGFB 2QQKH 3T0AA 4O51A 1QYGL 2O5YH 2WBWB 1JP5A 2B4CL 2Q8BL 4Z95L 2P8LA 1ULVA 5T5NG 2C1PA 3KLHD 1UXWA 1ORSB 4MA3B 4HSQA 2ERJB 4EKXA 5T1DH 5MENA 1D9KC 5HTSA 2Z35B 4L4VE 5FK9B 5FYKH 1X5AA 4U3HA 2RQ8A 5T3XE 5DD1L 1JK8A 1P4BH 4EI5B 2KZWA 2DQUL 2ZUYA 4XXDB 4O00A 3OV6A 1A4KA 2ESVB 1BD2E 1H5BC 3DMMA 5IROC 4M1DH 1Y6NR 2AXFB 1FO0H 4G6AC 4CVXB 4U1MA 4I3RH 1NL0H 3TVMD 4PJBF 3LH2H 3NACH 2XTLA 1T1WB 2FD6H 2VWEC 3ROLA 1LEIB 4OGYH 5JLZA 3MROA 2HWZL 1QO3B 1FP5A 1JNHB 4Y0GA 4XC1H 5IVXB 3FL7A 5JHDB 3IFLL 3GJEA 2EEBA 4G6AD 5FKPB 1RPQA 1YNLL 2IPTH 3ARTA 4YQXH 4K3DH 3GKWL 4WV1B 3VGDA 2R2EB 5IT2H 4L4TB 1UACH 4M5YL 4H5SA 2IQAA 4L8BB 3QUML 1DQDH 3H9ZA 2Q76B 1IEBA 1W2KT 4HUUB 5DK3A 5GJSL 3OKKB 3VD3A 4E5XB 1GZPA 4PJ5A 4YHYC 3BPLC 5IHZA 1X5ZA 4O58L 2AGJL 1AXSA 1NCNA 2VDQL 1AO7D 1VDGA 5IB5A 1SY6A 1YYLH 4PJ9C 2EIZB 3RY6C 4Z8FL 5MEOB 3EJYD 4LARH 3KPLA 5ID1A 2EDKA 5DURB 2NW2A 4PGDA 5C09E 3VXRE 5EN2A 4XVSL 1ZS8A 2Z93B 1BOYA 3TBVB 1K3IA 4XPGH 3QEUA 3MCLH 4P3CH 4PJ9D 1Q9WA 3WIHL 3VRJB 3ZKSD 3S88L 4J1UA 1KUMA 2ATKA 1HHKA 5EZJB 5L9DL 2J7LA 1YN6B 4FQLL 2DF3A 3WFBH 1L7IL 2JJSA 3RQ3A 1I7TA 3WEXB 2FIKB 1LEKB 1JGVH 1UZ8A 3DVNB 2V7NB 3K8KA 1XIWD 4ZOAA 1WZKA 4PJ7B 4BZ2L 4RFEB 3BVNB 4FZ8L 3U4BL 1TTGA 4NZRL 3WIIH 1HSBB 1T22B 1IAKA 5TDPA 3RTQC 5T5NF 2UY7A 3IETB 5L2KE 3L7EA 3I02A 2ZUWA 5FHAH 3KJ6L 3BMVA 4TYUA 5GS0D 4CVWA 5C71A 4P9HL 3A6CL 3MC0A 3TZVC 1JRHH 3GSXA 4KMQA 4MXWL 4OKDA 4XPTL 4QRPA 1KTDB 3ARGC 2AK1H 3VGAB 3OL2A 5D7LA 1O5DT 1WCBA 3T4YB 1MREL 5CJQH 4I8DA 1VKXA 4Y4FA 3TPKA 3TZVD 4PBWD 4JFHE 1CE6B 1ZWIA 4Q6IB 3T3PF 4P3DB 4EOWH 5C6TH 3W11C 1FC2D 2F74B 2Q8AL 3OKNA 2BVPA 3OZ9H 1IKFH 3EYSH 5D6DA 3DIFB 2VLLB 4PJXF 3TIDA 1A21A 4OIIH 4GG6E 4U2YA 4KKLC 4CW1B 2YZ1A 4YE4L 1OSZA 4ODUB 4PYHA 3U0TA 1QBBA 4PRPD 3OXSB 3T4AA 3FT3B 5KBNC 2NTFB 4X4YA 2J8UE 5K9QI 2NY0C 4P49A 1OGTB 4MJ6B 4KKLD 4HBQA 3UJIH 1A6ZA 1AHWA 1VFUA 4IOIA 5D9SB 4AENA 1PG7W 5IHUH 3KPNA 3CFCL 3FOLB 1SBSL 4N8VA 3RVXD 5GS1C 3P9LB 4YZFF 1L9NA 3T65B 2R69L 3H42L 3LQZA 2VLKA 2FLBT 3U46B 4JFXA 3UP1A 1H3GA 1GOHA 1F8TH 1L7TH 3RZCC 3IU3A 3DRTA 3RGVB 1N5YL 1J0KA 1X4YA 3BPOB 1J1PH 3QULB 2ADIB 1MQKH 5DVMA 1AO7B 3JV4B 3MYJA 1LVEA 2Q3ZA 4NN7B 4UU9B 4J3VA 5IMKA 2IAND 3RZCD 5F1SA 1BPVA 2FL5B 1RZJL 1V7ML 3MO1A 4FOMA 2O93L 3IS1X 5D2NB 5D7IE 3C8KA 1A6PA 3ET9F 1VPOL 1BM3L 2OI9C 3HE6C 4M5ZH 1JNNL 2QTEA 1G7IB 3BGFC 3D85A 1ZLUK 1T1ZA 3F62A 3WLBB 3X3FH 5EU5B 4KJWC 5C0BA 3VI3E 3SGJC 3GMMA 4GW4A 3VFVB 4J3OC 4OF0A 1N6QL 4U1GC 3QDJA 1EEQA 4ZS7L 2DLIA 3MLZL 4LVEA 3EUUA 3HE6D 2W9LA 4W6XB 2UVEA 4AL8H 2BY3A 2D31A 4C59B 1FO0B 1OY3B 4P57A 3MREB 1U91A 3SKJL 1QHOA 2CDGA 4ODTH 3ZYOA 2FX8L 4EDWH 3SKUD 5E4EB 1UCBH 3KLSA 3OKEB 1IC5H 1UQSB 3DX9A 1KPRB 5IWLC 4PJHF 1JNLH 5HY9B 5C0JB 5LKNA 1C12B 1CI5A 5J8OA 3G5YA 3WS6A 3KDMB 1RJYB 1G6RA 2VZOA 4R26H 4DTGH 3UTPD 2NTSP 4MA8H 4N0CC 2V17H 4ZFOL 2EDFA 2YS4A 5JPNB 1MCOL 5CP3H 2R23A 3UTOA 2AI0L 3W82A 4O02H 3GI8H 4OCWH 4CVUA 3IDGB 4PD4J 5HHOB 4JM2A 3OB0H 2C3VA 1MEXL 1DQML 3FFCE 4PV8B 3L3OA 4IRSB 2CUIA 1FFQA 1CLYL 1V3JA 4N0CD 4V2BA 1CXHA 2Y72A 4K3EL 2OZ4H 35C8H 5KOMC 3WE6B 3WS3B 2F54A 4J3WA 1A6WH 2R0LH 1JNJA 4X7TB 1CGXA 1QSVA 1DLHA 3IXAB 1H0DA 5CSZB 5HHVL 1D5ZB 2H2SC 5T1KB 1KEGL 5H94A 4L29B 3V0WL 1H8SA 2VLMD 4D8PA 5EU6D 3MRHB 5F88B 5L6YL 1RSFA 3V7AG 3LKPB 5E9DE 1EXUB 1A2YB 2FYYA 2UWEF 2WANA 2V9RA 5F7DB 1P7QA 2H2SD 4L4JA 1VADA 4WO4A 1MCIA 4MVBD 4RGMC 4JZNB 4LGSB 1Q38A 1NGZA 3NFSH 3ULVL 2ID5A 3PP3H 5FO8A 1LK2B 3DX7A 4YUEL 2PW1A 2YZ8A 4FQJL 5EO0A 3DXAD 3J7HA 4ZDHA 3BZ4B 1JPFA 2E7LC 4G6MH 4PJHB 3SKNA 3O6FA 2XWBB 4L1HA 1LO3H 4OD2B 4MMXC 4O4YL 4MNGB 5B38A 2DB8A 1TVBA 1BQHA 3LQAL 2RCSL 4G9FD 2VDKL 3V7MA 2IJ0C 5GRVL 1MY7A 3ZKMC 1CVRA 4JLRB 1Q9KA 5IB2A 1EPFA 3TT3H 2QBWA 2OCFD 5IBLC 1CN4A 5F97E 3EO0B 5C0NC 5E1AA 3CX5J 1E6OH 4PJBE 3PWJB 1BFSA 3ZKMD 4HPOL 3QHTC 3P73A 1U3ZA 4WUKL 4JKPH 1MJUL 2VQ1A 5KAQG 5HYFA 4DW2L 3PL6C 1DE4A 3LMJH 3OKOB 3W9DA 4YDJA 5C0ND 3UPCA 3U1SH 4JQIL 1WICA 2AJSH 2XKNB 3CUPA 5FM8A 2JELL 5INCB 2W0PA 2DQFB 2IC2A 4RDQG 2F8VA 1F3JA 3U7WL 3TYGH 4I5BA 4CNIA 2HT4C 3BGAA 3PL6D 4HEPG 1M6OA 4UIMB 3V52L 1I7RB 1UWEH 1EFQA 5F9JB 1DL7L 5GZOC 2YUWA 3WUWA 1TQBC 1HDMA 1BQHG 4GH7B 3PG2A 4ZD3L 4D0CB 1NUDA 4NQED 3BESR 2O5XL 5DEFB 2FBJL 1OAXH 3W81A 1MWAA 2VR9A 3BP5B 3GIZL 1IILE 1RVFH 4KKNA 5C0CB 1NC4A 2HT4D 5K33A 2AAVA 4ZFGL 2F8XC 1IGIH 4X5WA 2VZTA 1GHFH 3LHPL 3LSOA 4XZUB 5DFTA 4O2EB 3QPXH 2GY7B 3QG6A 3OGOE 2GTWA 5AD0B 4ZTOH 2EO1A 2H9GA 4PJAE 3V6FB 2J12B 4NNPL 3BWAA 5IEKB 3I2CL 3MRBA 4I77L 3ARWA 2BK8A 5KANI 2A74A 3O4LE 3VXPA 4F7EA 3D6GA 2ED7A 4PRIB 5I6XC 2ORBL 3ZKXB 5D71L 1EJOL 1FORH 3K8MA 4NHCH 1JYNA 1JTOA 3ARDA 2ZJSL 4G80B 1NMCB 2AJUL 1KJ2A 4JFQB 1LNUB 3D69A 2X41A 2A83B 3SCMC 5ALBL 2DMKA 3HG1E 4JN1L 3NBNA 3ESUF 4M3KB 5DFVC 1JMXA 3LKQB 5EOQH 3WD5L 4KHXL 5EO1A 3JWDH 3SCMD 1QRNB 5LQBH 2VXVH 3A6BH 2BSRB 1NDMB 5I74C 3RIFF 1PGRB 2WMPA 5BV7C 1I3GH 5DFVD 5CFHA 4BQ9A 1PG7L 3SDXA 4S1SL 1YEHL 2ADGB 4NDMA 4MMZC 2IQ9L 4OSUH 4YNYA 1FZMB 5EWIH 4I48A 5IJKA 3HA0A 4LQFH 5F71A 3TO2B 5JW5B 4FQ1L 3OX8B 5ICYB 3U36B 3ILQC 3KPRA 1F6AA 1WC7B 2VOTA 2DQDH 2X7LA 1LK3H 5KAQF 1FNFA 3UPRB 1OAQL 4NQDE 5D1ZC 3T3PE 1N7ML 3FAWA 3SGDH 1N6UA 1E4WH 4KI1A 4MAYA 4X6CB 4YGVA 1W0VB 4Y2DB 4HK0B 4MDIA 4MHHI 1HHGA 1E6JH 3L3JA 3RX5A 4ORGA 4PJXE 4OM1L 4RDQF 3CVHH 3LN4A 3MXWH 2I26N 3HFMH 5EU4A 4JHAL 5I1KH 5D70L 4Z76B 5FA4B 1QBAA 2BX5A 4JPVL 4NO3B 5FGCB 3MRMA 5C08D 4GAFB 1YMHA 2AEWA 5IFHL 2D7MA 2P48B 43CAA 3BZEA 1ONQA 4LSQL 2X4OB 2NY7L 1ZEAH 4L8DB 5D7KD 2FEEL 4EUPA 1G7HA 2LVCA 2VXQH 3QZWG 3GM0A 4XCNB 2DLFH 2WBJD 4Y19B 4C4KO 4KMTL 5E5MB 4YX2L 1N2RA 3AUVA 5CP7A 5FYJE 5J6HA 4F3FA 2P24A 2AKRA 4TTDC 5F3HB 3PABB 2KBGA 3PQYD 5TQ2L 4K8RC 4CRPA 4NKMB 3FB5A 3RY4A 1BX2B 3CFJB 1O7SA 3WN5C 4XMKH 3BQUD 3KYNB 1YEEH 2P47B 2E9BA 1XCQB 4NQEB 3VDAA 1S7QB 1KJMA 2FH6A 1B0WA 2PYED 3P4OA 4KRPC 4Y5VB 4TTDD 3D39E 2YPLD 2EDBA 4EQ2A 3T2PA 4U6XB 3MRFB 4FQHA 4JE4B 4NM4L 1I8IB 2RBLA 3PWLA 1NUFA 1U2CA 1U6AL 3GSRB 3L3DA 1C16A 2YD9A 2E3VA 4QOKD 32C2B 1QSED 2YPKB 1BZ7B 5F21B 1BVKA 2Q3AA 4K71B 2QQNL 1DQJA 3TEUA 4LF3A 1IRAY 1GGCL 3MFFB 1UA6L 5GGVL 4TOYL 2VLRE 8CGTA 1FPTH 3WXVH 3ARFC 4JRYD 2XZQL 4JY5H 1ITBB 3GNML 3WL9A 3NCMA 4YDKH 2R0ZL 3NA9L 3N1GC 3GK8L 1T2QL 4X8JB 2NNAB 4XP5H 1CFVL 3VXMD 4NNXA 4BFIA 3H8NA 1WZ1H 3VW3L 4NUGH 2Y36H 2BFVL 4JJHA 3ARFD 5I8CA 2V2WA 1FL6A 4AH2B 5TE4H 5TGBB 3KR3L 1NDGB 4KV5F 5INDB 3QI9D 4PJHE 4HKXB 3VFRB 3BDBA 4OZ4A 2WZPD 1QEWB 1ED3A 1PX3A 4GLRH 4KUCF 1BGXH 4JB9H 3AXLA 4NWTH 1IBGH 3DX6B 4LGRB 4LFHD 1RZ7H 5LCVL 3B9VA 3L7FB 5K9JL 3P9MA 5GGRB 5MI0C 4P5TD 5EC1B 3CLFH 5I73C 3PWVB 2VDOH 4LVOB 3NZ8B 2A9ML 2NY2B 4M3JA 4ZXBD 2AK4B 3FCTB 3MRRB 5BZDB 4ZSOB 2MNUA 2EEDA 2OK0H 5IK3B 1EEZA 4MSWB 3NIDF 4PRHA 4ZUWA 2VDPH 5F7LB 4JPWL 5E95B 4RGOL 1HIMH 2FJFA 3H3KA 4JN2A 4NT6A 3UTTE 5D7LE 1O0VA 2A38A 1V7NH 5ALCH 1INDL 1XZ0A 1N0XH 3C2AL 3LPGA 3ARYA 1YZZA 4FFZL 2NCMA 2FHCA 2BSTB 3HNSH 3P30H 2DBLH 1TPXC 1UB5A 5AWNL 1IM9A 4HKJA 4OQTA 3CFEA 3NN8B 3OB0K 4UIKH 1QQDB 1AQKH 5IW1B 1S5HB 3ETBF 3OGCB 4P2QA 4F9PC 2E6JA 4L8CB 4NUJB 3S35L 2UWEE 1U8JA 2FHFA 2R0KL 1A7OL 1CK0H 1UZ6F 4QNPF 2X4RA 1DQQA 1JPSH 3BUYA 4KQ3L 4OZGB 3G6DH 1RZ8A 4H8WH 5I66B 4GKNB 3IJHA 4LSRL 1PYWB 4JO4H 5EDXA 2XA8H 4QRUA 3I50H 3BQUB 2CKBL 4I2XB 1YNKL 3G04A 4X7CC 2RFXB 4DZ8A 3PHQB 2G2RA 1PQZB 3QEQD 1T0NB 3QNXB 4QRQB 5JR1H 1IAIL 4JG1L 1TVHB 5HHMB 3T3MF 1IGML 1FLTX 2AJXH 3RIFK 1G7LB 3NVQA 3RNKB 4PRAB 3FAXA 2PF6A 4B5EA 1A7QL 4HUXB 2A2QT 2BNRE 1AQDB 5DUBB 1N8ZA 3MFGB 2HKFL 3FQWB 2Z35A 4JDZA 4ZOEA 2HT3C 4ISVA 5FK9A 3WIFA 3WHE0 3HPJA 3BP6B 3BHBA 3W2DH 5J0BA 4K9EC 1T03L 2APVA 4DN4L 4GSDL 2I60H 3M1BA 5DWUH 1BVZA 2ARJQ 4EEEA 4Y4KC 3IDYC 3OF6A 3CVHB 2AXFA 1BHGA 4YHPB 1W8NA 4GBXB 4L3CB 2HT3D 1YEGH 3FO1B 3QWRD 5D2LF 4JHWH 4U1NB 3Q2CA 5C0BE 3NGBB 4UV4H 1FAIL 1LEIA 1MCKA 1I9RL 3QDJE 3UDWA 1QO3A 1JNHA 4Y4KD 3UTSB 2M1KA 1YN7B 3B9EA 1CGVA 4K3JH 3TYFA 5IVXA 3QEHB 3LZFL 3AREC 3QXUA 5TFSL 1CZ8H 3VXSB 3QEGL 3VFWA 4LPWA 1I9IH 4WV1A 1NEUA 4G7YL 4CU7A 3MBXL 5F7FA 4L4TA 4ONGL 1IGTB 4L8BA 1GGYA 2EDEA 2Q76A 1OT2A 4HUUA 1KF9B 3OKKA 4UILH 4E5XA 5HI4D 3MJ9H 4X6DA 4NWUH 4DOHE 4FXGB 1XF3B 3OKLB 4OCRL 3CMOH 3B5GA 1AD9A 4P4KD 4ZUVB 4HFUH 4KWUA 2DBJA 2R2CA 1HZHH 4S1QL 5I1JH 1OHQA 2EIZA 1YEKL 4LU5H 5JQ6L 1IFHL 5JXEC 5CBAB 2ZCKL 4FTVD 1HQ4A 5H37H 1G0DA 3FOMB 4LVNC 4OZFH 1JWUB 3RL1B 5IFAL 2Z93A 2VAAA 4HC1L 2P7TB 3VRJA 1HCVA 5JXED 3SJVD 5F7NC 4BSJA 1YJDL 2DLEA 1UKTA 1QLRB 1WV7T 1U95B 4GAJL 5T3ZE 5FGSA 5CD5C 1JGLL 3MLPA 1NGXB 4IM8A 5SV3A 2F54E 1Z3GL 1LEKA 3DVNA 5BRZA 3E2HC 2E27H 4RIRB 4XHQA 4LNRB 5IVZA 1UADC 4PJ7A 1DANU 2AXGB 1FLRL 3BVNA 4PD4K 4WCYH 4YHLH 4WFFD 2DD8L 3BIAX 3GGWA 1KYOJ 1HSBA 3QDGA 3RIAF 4XWOD 5D1QB 1OGAD 5F7HA 1S9KC 5D2LB 3WDIA 4IMLB 3VWJA 5HDBF 1CWVA 5EZOL 2I9TA 2Y5TA 2EYTB 1OPGH 1DBJH 1QP1A 1LE5A 1U8KB 1UFUA 1IJ9A 1PLGL 5GSRB 1X4XA 4E42A 1KTDA 3FHQA 5I1EL 1E28B 1ZA6A 3RI5F 3DBXA 3BYTA 1YDPB 1EEYA 5I1AA 3CXDH 2XV6B 4LKXB 3Q3GA 4G8IB 1KC5H 1CE6A 1MFCH 4FABH 1QSFD 4Q6IA 4M6OH 4QHKI 5CGYD 4XNQA 1WT5A 5DR5H 5HGHB 4WI2A 3B3IB 5CJBA 4LCCC 4IS6B 5JXAL 2VLLA 3JWOL 1EHXA 4RX4D 1CD1B 4UT7H 1KN2H 4HH9A 3O0RH 3CC5B 4UT6L 5IQ7L 4W4NA 3LS4L 4XCEA 1H3WM 3H2WA 3ZKQD 4E41D 3DWTA 3TVMA 4XGZA 3T2NL 1S5IH 3QPQC 3G5XA 1BQUA 2D4DA 3HRZA 5JOEA 4UB0L 4DUXA 1OGTA 4MJ6A 4XWGL 5EC2A 5T33H 2EEAA 1JL8A 3IF1B 3CSBA 4JR9H 5EORL 5D9SA 1AGCB 1QACA 4H20L 5JIKA 3DROA 3DV6B 5IVNA 4HHAB 4LSVH 4ZSOE 3QPQD 4G42B 1NJ9B 5A2LH 3DVIA 3P9LA 4LBEB 3S36X 3T65A 4OCSH 2QSCL 2DN7A 5EOCJ 3CX5K 4QXWA 5CKGA 1HSAB 2B1AL 3OHXB 3LRSB 2DMBA 3B8YA 2FB4L 3RGVA 2F19L 1CL7L 3SDDD 1F4YL 3QULA 5EBLB 3K4DA 3SE8H 3VI4F 4DQOH 3G6JF 1AO7A 2IBGA 3MLXH 1X5JA 4B50A 3JV4A 1X5FA 2DWDB 3QAZB 4R96B 1FE8H 3GIVA 5ETUA 3AU1A 4L3AA 4X9FA 5SV4A 4UDUB 1TCMA 1YPZF 5I19H 4MGXA 5ITFA 1NUNB 1IC4H 1G7IA 4ETQA 4F7CB 4X6FA 3DSNA 1R3KB 5HDQH 3VXUB 3F5WB 3VFVA 1F13A 3D9AH 3C60D 5TF1H 1FQ9C 3K74B 1AIFB 1I8LA 2DQJL 4JZOB 2EYSA 3CU1A 1A7PH 4Y8AA 1KPVA 5SX5K 2OR8A 1XIWA 3MREA 2NMSA 1E4KA 1DVFD 2EDOA 1UQSA 5T5FH 1UM6H 5MEQA 5DSCB 1KPRA 1OGAB 3UAJD 5HY9A 3VFGL 3GMOB 2VH5L 4MJIB 4ONOA 4KXZH 1X9QA 4Y4HC 2FR4B 3U4AA 3C6SB 5I76B 4FNLH 3SDXE 4URTB 2C4XA 3THMH 1JZ2A 5IR1A 5CJOL 5C9JB 2A0LC 3TT1L 3SDAC 1R3IL 4U6YA 1JWMB 1S7TB 4PLKC 2ZCLL 3RAJL 4NBXB 5C0GB 2OTPA 1I7UB 4F7TB 2Q7NA 4XCCH 2CR3A 3QIUB 5E8EB 1F4XL 5E8PA 5EBMB 4KZEH 1RZIA 3OKMB 3TA3B 2SEBA 1HQRB 25C8L 2A0LD 3IDGA 3HR5A 2Y9RT 3SDAD 1MSPA 5JNYB 4IRSA 4NOBA 2D2OA 4PLKD 3LIZL 4Z0XA 2AVGA 3PDGA 2EIDA 4RSVA 2NXZD 3FN3A 2G9HB 2NR6D 3VXSE 3G6JB 3H0TB 4JANB 4OZFB 4MXVE 1PY9A 1RURL 2W59A 1MIEH 2KUTA 4U1IB 3RUGB 4YK4B 1CXEA 3I85A 2CK0L 1FL5B 3L95B 2LVEA 4IRJB 4PRPA 2NY1C 2OJEA 1L9MA 4JKMA 1U93A 1UZ6E 2FNBA 1FDLH 4QNPE 3LKPA 5E7FA 1EXUA 1A2YA 3QXAB 1K8DB 1BFOB 5F7DA 4QHMA 3QH3A 4YXHH 1KG0A 4XP9H 1OF2B 4JZNA 1HN1A 1M4KA 1WFUA 1DEEB 5BS0B 4MJ5B 3MV9D 2Y06H 4MQ7B 4LP4A 4OLUH 2P8MB 4GQ9L 4XBPB 1LK2A 2X4TB 5DLMH 5FAAA 3RNQA 4LSTH 1A3QA 3BZ4A 4NZDA 4JKLA 1KB9J 3ZSSA 3KPOB 5CD3B 3I6GB 1P4BL 4PLOB 5EOCH 1UWXK 2BRRL 2XWBA 3RIAK 4JFEB 4QGTA 1MCLA 3V8OA 3U9PL 3QIWB 4X99B 3MCKB 1FO0L 2IANA 5KSUB 1TJHL 3RZCA 2BVQB 4YFDB 2FSEA 3LH2L 2IBBA 3NACL 4Q6YA 4C55A 3S96A 4JLRA 4K94C 1N64L 4IRZL 4NBZB 4M7JL 4Y89A 2MJWA 3DGCR 1ZKAA 3K46A 4CJ1A 4UQ2B 4PJIB 3SGDI 2EDYA 2IPTL 2D03H 3BO8A 3CSYB 3RI5K 1RUAH 3KWWB 1N3NA 2B5IC 2FX7L 3VH8A 1OW0A 5IT2L 3LAFA 1UACL 4TPRH 3HE6A 5E08L 5H35A 3MBEB 4WW2C 1CR9H 3FQTA 1KACB 5K93A 3W39B 4YBHA 4NRXB 2AJZB 4WUUD 5FYJL 1EVUA 2XKNA 5INCA 1YMMD 2GITB 3CLEL 4XVJL 2DQFA 3QHZL 1F4HA 5SWQB 1DVFB 5CZKA 4X9GA 1BFVH 4UIMA 4PGJA 3P4NB 2JIXB 4WHTB 5JZ7C 3GMPB 4TVPH 3QJHA 5AEAA 5F93C 2HG5B 4K7PL 1A6VH 2MKWA 5JW4M 2GFBA 1K4DB 3BP5A 1RJZA 5C0CA 4OI7A 2GQHA 2X4NA 4ODSH 4HBCH 1NLBL 2K3TA 4HF5H 3T0EC 5M7QA 2VISB 3BD4A 4P3CL 1W8OA 4XZUA 3H9SE 5IWLA 3GHBL 5CMAA 4HGMA 4NZUH 3ZTJH 5CEXB 2OBGA 4I18B 5FKAA 4H1LH 5AD0A 3C5SA 4PJ8C 1W72A 3OWEA 3CFDB 1I75A 1QD0A 5IEKA 3W0WD 1JMZA 1CD9B 2RIKA 4LCWD 3S97C 1T20A 2XXMB 1RUPH 2CSPA 5I8EA 5JO5B 1S8DB 5K9OA 4Q7DA 1DN0A 5HHQB 2OYPA 1PFCA 5F9WC 3ZTJG 4JFQA 1C8PA 1LNUA 3MRLB 1KJ3H 3HI1A 2A83A 3HAEA 3BH9B 3RVUD 3SDCB 5I75B 1MHPH 2O61B 3LKQA 5CEZH 2W9DH 1NCAL 1BEYL 1S7XA 4IBLT 4U2ZA 3MRCB 2IBZX 1FYTD 5DRNA 5FHBH 1I1YA 1JRHL 2YPVL 3H9HB 5CCKL 3IRPX 4P2QE 2EECA 2BSRA 1NDMA 3U48A 3LY6A 5F9OH 4YHYB 1U36A 5C0AD 5HDBE 3OAZH 2ADGA 5L0QC 3QCTH 4MYWB 5JW4R 4GRWF 3DUUB 3DO3A 1FZMA 4H26B 5KG9A 3LPWA 4MCZA 5GS2D 3OX8A 3DXAA 1SEQH 2L7UA 1JHLH 1LO0H 4P2OD 1IKFL 1H15B 1WC7A 3AS3A 3RBGA 1EUUA 4CL7A 1KGCD 3H7LA 2ZUTA 3IRZA 4NGHH 1SQ2N 5DD5L 3VFSB 3CU7A 1T2XA 1T89C 4Q97A 4M4PA 5IB4B 1E4XL 2OSLB 4KKCD 2OR9H 5EA0H 1K4CB 2Z92B 2A73A 4PUBH 1NGQL 3RJQB 2YHGA 4FQ2L 5SWZE 1YC7A 1MJ8L 1K9TA 4JFFD 5FA4A 3TPUA 3UJIL 4NO3A 2ZZUT 3TH3T 1BVLB 5CGTA 3TV3L 2OZ4A 1XGYH 4PPTA 4XVUD 1CDHA 3FQUB 1ZSDB 1CGSH 1C1EL 4JQXC 5C2BH 1I3VA 1JF5A 5GRZA 1QRKA 1GH7A 2XTJC 1MFDL 2N7AA 3X11B 4YDIH 1TQCC 3LDBB 3MR9B 3TN0C 4IHOA 1FCCA 4GAYB 5ERWA 1L7TL 1C5BH 3FT2A 3ZLQC 5E99L 4YDLB 3ARGB 5F3HA 1S9YB 2XTJD 2CDFB 3CZFB 5D93C 3KYNA 2P5EB 3TN0D 4EIZC 4AT6B 1XCQA 4YXKH 4NQEA 1EAJA 4D0DB 5BJTB 4QRSA 1KTLB 3DTXA 4QXGL 4FFVD 4K2UH 3FRPG 3L5XL 3KPMB 1PVHA 3V2AR 3VI4E 3QIBC 3CFIC 3U0PA 4U6XA 5F8RC 2P45B 4M5ZL 1SYSB 2I24N 1AJ7L 3LEXB 5DJAA 3X3FL 2GJ6B 2HFGH 3O6KL 3GSRA 5HDOA 1MF2L 1FV1B 4PS4H 4X6DE 1QNZL 32C2A 4ODVH 1YPZE 4M7LT 4IMKA 1BZ7A 3G6AA 4M7LL 3O4OB 5TDOB 1Q0XH 4XMLH 1ZT1B 3L3GB 1WCQA 4UNUA 4BFGA 2LABA 3MFFA 4LLDB 3S37H 4Z78B 1XR9B 4WGWB 1WWWX 3Q1SH 2NY0B 3LD8C 4YO0B 1DLFH 3ARBC 2H8PA 1CICB 4FQIL 1UCBL 3N1QC 1S7SB 4Z7VF 4BSVB 3B9KB 4JDTL 4APQC 2R39A 1CIUA 4F58H 1I1AB 2NNAA 1B0GB 3BEWA 5GS1B 3RDTC 4PJEA 1JNLL 4KZDH 4DGIH 1DN2A 4HIXH 1I8KA 1MJ7H 5J56B 3O2VL 1SJHA 1ZHBB 1X3DA 5TGBA 3P0YL 3K8LA 4APQD 2XICA 5BRZE 1JYXA 1ZVSB 3O6LH 4DTGL 3RDTD 1MIML 1U41A 1FVEA 1ORQA 1HXYB 2V17L 1QEWA 4NN6C 3TNNB 3HMXA 4ODHL 3DX6A 3QDGE 4MZ3A 5C0EB 4NBYB 4MNQB 3L7FA 4WFHE 4LPVA 4OCWL 5GGRA 5GRYA 1CGUA 3N50A 4FFYH 3ZMRA 4U05A 4Q9RH 1FNLA 3O41B 2YRPA 4UZGA 4X6EB 3NZ8A 3MNZA 4P2OB 1CLZH 1T5XA 1ZHNB 4QO1A 2PW2B 3FCTA 1G6RL 2D7PA 1DUYB 4HT1H 1P53A 1KYOK 4WWKB 2OX5A 1Z5LB 3MOBL 1K6QL 2F53D 3ZHDA 3AMKA 4HUNB 4XBEL 4UOW1 3S4SB 4R6UA 4BH8A 4MQSB 3IDJA 4H1LB 1RUQL 4MA7H 1PEZA 1BJMA 1JWSB 2N4IA 2VQUA 4AEHH 1U8HB 4KDTA 5E1HB 1L4IA 3ZE0F 2PCPA 4HUVB 2VLJD 5T3ZL 1RIVL 1HH6A 1MPAL 2VIRB 2F8OA 1A6AA 1QQDA 5IW1A 2QQLL 5IHLB 2XZZA 3EJZC 4U7MA 4YBLC 3KYAA 2QADD 4L8CA 4NUJA 1HXMA 5IEHB 3C2SA 3NCBB 2VXUL 1QYGH 5DZLA 4EN3C 4GW1A 3QFDB 4PJGA 2B4CH 2Q8BH 4RRPA 4Z95H 1ZGLP 5TQ0L 2WBJA 2VXTH 4R97C 5IMLA 5FIEA 4OZHF 3EJZD 4BM7A 3Q6GL 5GGUB 3BH8B 2FEDC 3KYMB 2VITB 3NIGF 3RVWC 4G6ML 5DC9B 3TO4B 5I66A 2IFGA 4GKNA 1C7TA 3PWPD 1PYWA 2P4AB 5DD1H 2ZUUA 3BQUA 4HIJB 2HT2D 3KXFD 4I2XA 5SWSD 1HOCA 1RULL 1T0MB 2BNQD 1M05A 5F7WC 2PYEA 2VWEE 3PHQA 2FEDD 1G9MC 2YPLA 3AB0C 2E5EA 1I4FB 1RMFL 3QNXA 4QRQA 5LG1A 1BZ9B 3TT3L 4PRBB 2GSIA 1G7LA 3RNKA 1A6TB 3O3EA 1MLCA 3UTQA 4G6JL 4LEOB 1AY1L 1LEGA 2HWZH 4HUXA 1ADQL 3IFOB 4QOKA 5DUBA 1WVZA 3GSWB 1QSEA 3O3BA 5HGAA 2AJ3A 3IFLH 4JKPL 4MAUL 4N0RA 3FQWA 4GS7B 1T2JA 3EDFA 4YEFA 1FFNB 1G7JB 3LMJL 3V5KB 4MD5B 3GKWH 3GMNA 4JGUA 4NP4H 4K8RH 2Q6WA 2N1KA 1OP9A 3QUMH 2AEPH 4JRYA 4LLMB 3DV4A 4YHPA 3MV7D 3PIQA 3TWCL 5GJSH 1G9NC 2GI7A 4L3CA 4XI5C 3FO1A 5A2KH 1RJLB 2FIRT 1AR1C 2IPKB 3VXMA 4O58H 1KB5L 2AGJH 2VDQH 4PFEA 1F3RB 1IAOA 1VHPA 3ARFA 1FZOB 2NW3A 5FB8B 1OAXL 3UTSA 1ZANH 3VMNA 4Z8FH 1NFDB 3STZA 3WO4B 4HS6B 4XI5D 1IGIL 4JO2H 5KN5A 4G43B 1AR1D 2PTUA 1TMCB 4R9HA 4I3SL 3QI9A 3EHBC 2BOCB 4XVSH 5I16B 1IGTA 2J6EA 4OCMC 3LKSB 1MCNA 3ME0A 3WIHH 5HYEA 1J0ZA 3UX9B 3V4UH 1MAKA 1MRCH 1VACB 4PG2C 3S88H 2QHRH 2YC1B 5LJYH 2CMRL 4D9QE 4P5TA 3EHBD 4FXGA 1XF3A 3OKLA 3OJDA 5L9DH 3IDMA 4LVHC 4A6YA 4FQLH 1J1OL 1L7IH 5E2VL 3T0VA 1MCDA 4ZXBA 4Y1AE 2HLAB 4RGND 2EC9T 1RK1A 3T1FB 1FN4B 4BZ2H 4N0YL 5CZVL 2Z31D 3U4BH 3JV6B 3DURB 3B4NA 4OFDA 3MQIA 3RL1A 4JKKA 2P7TA 3D0VA 5EOQL 5DJ0B 3K80A 5FYLD 2EDXA 2GCYB 4RMRA 5J6GA 5LQBL 1U3HB 2JK5A 4XAKE 4DK6A 3T08A 1NGPH 3CXHJ 1U95A 4OI9A 2PO6D 3MUHL 2BY0A 1I3GL 4HLZG 3DI2B 4MXWH 5K9JH 1UB6B 3BDXA 1TQBB 4LFHG 3O2DL 4G8GB 3GEWB 4FQXD 4OSUL 4R4NC 1FZKB 3X12A 3VXNB 5EWIL 2YD8A 4LHJB 3TCLA 1BBJB 2AXGA 4LQFL 5JDJA 1MREH 4PRPE 4PP1C 1QR1A 4GRWE 5IVOA 4R4ND 2Q8AH 1M7XA 4PJFA 2X9WA 4IMLA 1L6ZA 4QTIL 4HIHB 5FUCC 4PP1D 5TJWK 3CZJA 5I18L 2OTWB 1U8KA 2WM0A 1BOGB 1J87A 2K7QA 3CVHL 3FN0L 1E28A 3IFPB 3QEQA 3OAZK 5FO7A 3PGDB 3HFML 4YEEA 4WIQA 3KLAB 4KXZI 3GSQA 5EUKB 5JMOC 5GGTL 1MJJB 3WFDL 3GMLB 3QWOB 4PP2B 1AGDB 3DVFA 5HGHA 3B3IA 4AYFA 4QYOA 4GRLD 4H88L 3QUYD 2APXA 3EYFB 4P9HC 2X4QB 3F7VB 3UTZB 1FAKT 3L5WA 1IM3B 2IANE 2KQNA 2FJGA 2DLFL 2R69H 1P1ZA 3H42H 2R15A 3DMMC 4OFKA 1KB9K 5MEND 4KK6C 3A6OA 5F89A 3QWRA 2WWKO 5J12B 5JOPE 3JWNC 4MNQE 5J11B 3IKCA 1N5YH 4LLWB 2JB6A 4Y4KA 4DVBB 1CBVH 4WY7H 3DMMD 5DVKA 3R0NA 2G60L 2K7PA 2GAZB 3JV0A 1AGCA 3KPSD 5ISZB 4KK6D 3QDMD 1ZV5A 4HHAA 3L5HA 1HWGB 1RZJH 4G42A 3PV6A 4AIZB 2NPLX 1JJUA 3VXTA 5F44A 2I07B 4LBEA 1S9VA 1VPOH 3DECA 3FO0H 1JNNH 1R5VB 3BDYL 4KVCL 5D1ZB 3D0LB 3ARZA 3OHXA 4Z0BL 1D5MB 1MVUA 3WNLA 2RR3A 3MLZH 4P4KA 4LLVA 3QJFB 1UVQB 3UYRL 5JPMA 5E8DH 1FPTL 1JN6B 1V5JA 5IB1A 4JY5L 2NY5H 2WW8A 3T1WA 4TNWF 4D0BB 2FX8H 4FTVA 3LQMA 2DMCA 2X1QA 5H2BB 2Z31B 5EPMB 1FVCB 3QO0B 5K59F 1WZ1L 4WHYH 1X4ZA 1CD0A 1RQ5A 3I3EA 3ZDZF 1CDGA 4F7CA 1R3KA 4M7KL 4OTXL 5GZNC 5JXEA 3F5WA 4Z7VE 5TE4L 5HYJE 3HC0B 4JCMA 1Q9LB 1AIFA 1BBDH 2A6IB 4OQ1A 1YY8B 5EU7C 5KW9H 4HXAL 1WITA 3WCYA 4JZOA 3QUMB 4JB9L 2JJSC 4FQXB 4FP8L 3NFNA 2YSSB 1RZKL 4GKZA 5GZND 5EZIH 2ZCHH 2W0LA 1UC6A 1AP2B 3JTTA 1FZJB 1R5WB 2IADA 4QTHA 1FNAA 2VSDA 3R4DA 2NYYD 3WKMH 1AI1L 4LCIH 2VDOL 2Y6SC 3D2UB 4ONHB 4M62L 5EU6E 4B41A 1MEXH 1B9ZA 2GT9B 4LPXA 5ACMA 4GRMB 1OGAA 4PGCA 4XPFL 5D72L 5E2TL 4ZNEA 3HZKA 1CLYH 1XH3A 5E8NB 5FFLA 5HGGS 3GMOA 5DDHA 1NKRA 4DCQB 4K3EH 2OK0L 2FR4A 1WTLA 3FZUC 3JV5A 3CH8A 1CFNA 4R0LB 8FABB 5C9JA 5ALCL 1S7TA 4QHUB 4ZUTB 4AG4L 2VXSH 4HX1A 1UM5L 2C3HA 2XYCA 4PJFF 1KEGH 4F7TA 2DLTA 3V0WH 3QIUA 4Y5XB 3MJ9A 2NLJB 5EBMA 4RAUB 3U4EA 2W60B 3TA3A 4JRXB 5L6YH 1XGUA 1HQRA 3DXAE 4Y4FC 3GMRB 3Q48A 5ENWA 3I3BA 1AQKL 5KVFL 4QRPD 4MXQC 3FJTA 2C5DC 3PNWA 3RWEB 4ERSL 4GRLB 5D6DC 1GVIA 3QUYB 5DC4B 1CK0L 4RX4A 3QNZB 4G9FE 4OZFA 4Y4FD 1F00I 5DS8B 1JPST 4GXUM 3RUGA 1XGQB 2Z8VC 3L95A 4FQJH 2G5BB 3REVA 4MWFA 4G7VL 5E94B 4LCCA 5DUPL 1QA9B 1U2HA 4ODXB 4R4BB 4JO4L 3EO1B 3I50L 3WV0A 1IKNA 1DTUA 5BXFB 4OZHE 1K8DA 4K7FA 4O4YH 4X5XB 4YIQB 3TGXA 3VU2A 5E00B 3NIGE