1MHHA

Structure of p. magnus protein l mutant bound to a mouse fab
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKVLIYWASTRESGVPDRFTGRGSGTDFTLTISSVQAEDQAVYYCKQAYIPPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab, light chain
publication title Evidence for plasticity and structural mimicry at the immunoglobulin light chain-protein L interface
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 52
structure length 219
sequence length 219
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mhhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mhhA01
3QDMD 4MXQD 1IE5A 3DHMA 4X5LA 4CMMA 1OF2B 3H9SB 3HZKB 4JQXA 4N68A 2VLKD 2K1MA 3LN5A 1BJ8A 3HG1E 4Y7MA 3RL2A 1Y0LA 5GRYA 3HS0A 5HHOA 4Q7DA 1IM9D 4K55A 5IVZB 4YQXH 1CN4A 5I71B 4JFHE 1OSPL 2R23B 1BZ9B 4RBPK 3DO7B 2JJSA 3IB4A 1AY1L 1KN2L 1KIQB 4LSDA 2R1XB 5HTSA 2QEJA 1R3KA 4R0LB 6CGTA 3MLWH 4YFLF 2DQTL 2D7OA 5JIPA 1L7IL 1TNMA 1CGYA 1MNUH 2ZUQC 5IFJB 1X5GA 3ARGD 1BF2A 3RL1B 3M1BB 4KDVA 3DURB 4KVNL 5JUEH 5ADPL 1YEKH 4M1GH 3UXFA 4H8WC 2XN9B 2EE9A 4M3KB 2B5IC 2XQBH 1QTYT 4O4YL 4Y0GA 1FO0L 2P5EE 5MEPB 2R69H 4E0RB 1ZT7A 3AREA 1X9QA 4F7CB 3OPZH 5HD8D 3LEVL 4CL7A 1FVDB 5E8OB 3H9SD 3KPMA 1T1WA 1MY5A 1F6AB 3FKUS 1NGZA 1YYLL 4RGMC 5DMJB 5AYUH 5DS8B 3QDJB 5DHXB 4MVBC 1U8MA 4I2XB 1GC1H 5EC2B 4M00A 3T2NL 3TNMB 1MIEH 4JG0H 3MRRB 1CFNB 2BFVH 2CKBB 3QFJA 3PWLA 4FQCL 3QIWB 1E4XH 2QQLH 2AXHA 1B0GA 4RFNC 2VLMD 3IGAA 4ZO9A 4AJ0A 2QSCL 4QXWA 3KXFD 4U7MA 4XVJH 3FQRA 3VWKB 1L9MA 3MA9L 3TH2T 1VDGA 1RFDL 3C5SA 2NY6B 3SBWC 2AJVL 1HNFA 3IDNA 2OJZL 3FB5A 4D9RD 2Q76B 3DX8B 5GS2H 1W0VB 4MD0B 2GFBA 2PYFB 4B0MM 3QDGE 4JVWA 2XN9D 2Z0BA 2VKWA 4S1DD 4RX4A 4XNMB 5EO1B 3ZSSA 4RISL 1OAQL 1CR9L 1UENA 4WO4B 5IGXL 2Y5EA 1FPTL 1JPGB 5BW7C 3QUXC 5IMLA 5KS9F 3VI4F 1JYVA 3LN4A 1HYSC 3DECA 1M7IB 1RU9L 2F74B 2DQTH 5HY9B 2W9EH 3QDJD 4X6FB 3CX2A 3RAJL 4XBPB 3WEXA 4XP6H 5J1AA 2HRPH 5E6ZA 2ZSWB 2DJSA 3BW9A 3U30C 3WFEH 4O5LH 2C3VB 1AD0B 2JELL 1BD2A 3QIWD 5HGHA 3TFKC 3TH3T 1KJVA 3VXSD 1AD9B 4GAYA 2KZ1B 4PJ7A 4GS7C 1KLUB 1JZ5A 2P8MA 4PUBL 2DKSA 5HHXL 4HWZB 4M48H 2C1OB 3MGOB 4ORGB 2NY6D 4LCCA 2E3VA 1HIMH 5ISZD 3GBMH 5ENWB 4MYWB 1CL7H 2E9BA 1N2RB 1CICC 3NFSH 5DRNA 3MZGB 1ZE3C 2L7UA 3VGHA 4X7SH 4N0FB 4PJ7F 4WRLA 4ZAKB 5T1LA 3JV4A 5CGMA 2OSLA 5C0DB 5IVXB 2G2RA 4JJ5A 1INDH 4HJGA 2UWEF 43C9B 1OAUL 2Z31D 3C5ZC 1P7QB 1NGPH 3O3AB 3EJYD 3MOAL 1IL1B 4ZPTA 3SDCB 4F7EA 1CFQB 2EDEA 1M05A 1LD9B 2DKMA 4GRWF 4YZFF 3RTQD 1PYWB 2VWEE 5DO2D 3F5WB 5I8KL 5EU7C 8FABA 4HPYL 2NY0B 4LARH 1Q72L 2BVPB 5JHDA 1F2XK 1K4DA 3ULUE 2GITB 1R5WB 3SDXF 1HILA 4N90E 3ILPA 3QJHB 5EU7E 4IHOA 4DCQB 1E4JA 2XZQL 3BZ4B 1A9EB 3DBXA 5DFVD 1KLGA 2IFFH 3DJ9A 3O6FC 1I85A 4Z0XA 5JZ7D 4GBXC 4HFWA 1K8DA 2LV4A 1U91A 4Z7NE 4OCWH 4MMXC 5JTWA 5KG9A 3ZO0A 1BWWA 2A6KA 3L9RB 4YC2B 4PJAE 1FN4B 5HYFA 3WDHA 5DD0L 2DQCH 1C08A 3HZYA 4ZAKD 3VI3F 1IMHC 3QCVL 2CLZB 1MHCB 4HULB 1OP5H 3RX8A 2D0HA 4JFFE 3WS3B 5C0JB 3C6SB 5C8JB 1TVBB 3MFFA 4TPRL 1BPVA 5T3XL 3UYPA 2MNUA 3HC4L 4XP5H 2X4RA 3QUYB 3Q6FB 4NKQB 4X6DB 4QEGA 1FLRH 5F88A 4PGJA 1WTLA 2GT9A 4QHLB 3ZKXC 5F72S 2NY0D 1MRCH 2R8SH 2DF3A 1CS6A 1YEFL 1ETZB 4ETYA 3X11A 1RUQH 4HJ0C 4JDZB 4R2GC 5DUPL 2YR3A 2W59A 1NC2D 4L5FH 3U46B 2BNQE 3KYNB 4WFGE 5T3ZD 2XFXB 3A6CH 2CGRH 4HKJA 2PCPB 5HHME 4QCIB 3BDYL 3GMOB 1AXSA 3P4NA 4G80A 4BELD 5CGTA 3U0PB 3I75A 3IDYB 4G8GA 3QG7L 3RVTC 3VXNA 2YUXA 3NZHH 3EHBD 4PRBB 1IAOA 5EBLB 2YPKB 4OBRA 1OSZB 4DFHA 3MRKB 2CK0H 4YIQB 1AFVL 1T7WA 1UACL 4XHJC 3QJFB 3PDDA 1I7RA 3O11B 4N0UE 3S8WA 1JGDA 1MIML 3VXTB 1D5MB 1Z6JT 3QUMH 2AJ3A 2FNBA 3CUPB 3W2DH 3BN9D 2YSSA 1MCJA 3VXME 4XNUL 5DQDL 4ODHH 2YA1A 4YGVB 2EXWC 4HC1A 2JCCE 4NP4H 5ERWA 1FCGA 3RY6A 2WMPA 4JREC 3CDFA 1T7VA 3MODH 1AI1L 1CFTA 4WW1A 3MYJA 1WEJL 1ED3A 3BO8B 5MEND 3L3KB 4EOWL 3G9AB 3HRPA 4HWUA 4PJEB 4PJ5A 2LU3A 32C2B 4G7YH 4LF3B 1DBKH 1K9TA 3DGCR 2H8PA 4FQIL 3GSVA 3QIUC 4PJ8D 1KCLA 3PGDB 1ACYL 2WQRA 5J6GB 3LPWA 4EIZC 1F4AA 1OLLA 1EERB 3JWDC 1EHAA 4QOKB 4PGBB 2YD2A 1VKXA 3JWOH 1RZIA 1P7KA 4UIMB 3LS4L 1MCCA 5CJ5A 1I8KB 4BA8A 3G5VA 1FFNA 3JWNC 4PV9B 3VXUE 1GGUA 1EGJL 2VXSL 2X1PA 4GMSH 2HH0H 1KNOB 1FYHB 3HUJE 3RWEB 5DK2A 3JTTA 1MFAL 3S98A 5JPNB 1DUZB 2CDGA 1BLNB 4Z78B 1QR4A 4AL8L 2EH8L 4UV4L 4LGSB 4U33A 2HJFB 1YPZA 3ECBA 3BSZL 4KJQD 2ERJB 3UJIH 5KVFH 1Y6KR 5TFSH 3V6OC 3SE4A 4DW2H 3G6JA 3IJSA 3NTCH 2VH5L 4L8CB 1KCRH 3H9HB 4Z7VE 4PJCB 1BJ1H 3RIFK 3NACL 3QIBD 3FB7A 5AYQA 4Z0BH 3WHE0 7FABH 1QBAA 4PTTB 2BRQA 1ZHNB 4GUPB 2FZ3B 1CT8A 3LKNA 4QOKD 2BSSA 1UM4H 5GGRB 4HT1L 3BPCB 3DYMA 1VACB 3C09B 3RVVD 1KN4L 3GKWH 3SDYL 2FH8A 3C8HA 4M6OH 1WEJH 2FSEA 4K94C 5GGSA 1QFHA 2X4QB 3DXAD 4ODBD 4ZUTA 1Z0NA 1RMFL 2WQ8A 2YRPA 4M7JL 4JRYA 3T3ME 5BRZD 3FQTA 4XT1C 3N50A 2VAAA 5HI4D 2E6JA 4JANA 1FGVH 5IJVB 3FOLA 3D85D 4JO2L 3TP4A 2NY4B 5BCAA 5C2UB 2OK0H 1FRGH 3E1F1 1JPSL 5HVHB 4Z7QF 1FHGA 1EGJH 4IMKA 2C7UB 4WU7B 3LKRA 1YQ2A 5SWSE 1UH3A 3D25B 1P9MC 1BEYL 1R24B 4K23L 4WEBH 2EYRB 2P7TB 3N1FC 4PRHB 2R0WH 3Q48A 2EH8H 2HMIC 1LDPH 2OQJB 3LDBC 3SCMB 1Z5LB 4LLMB 1F4HA 1BVZA 3TBYA 3B43A 1X5ZA 3QWOB 4JDTH 1YEEH 3RZCC 4DUWA 2EIBA 4MAUH 2PKDA 1F42A 5JOEA 2HLAB 1WBZA 2ESVA 3QHTC 2EDTA 3NMEA 3DUUA 3RU8L 1H5BB 1E6JL 2OX5A 2EDRA 2PO6B 4DKFH 2BMKA 4S1QL 3LD8B 4ZNEE 1CDUA 1WIOA 3QULB 4E41D 4PRDB 3NN8A 4UINH 5A40E 1TENA 3LIZH 3H3KA 2YK1L 3DX9A 1P4IL 3KPLB 1J1PH 1S9XA 2LU7A 1TJGL 3NIDE 4WI9A 3UEZA 3CLFH 4Z6AT 4XPGH 4KKBC 1INQA 5BXFA 4R6UA 5EIVA 1SJHB 1U8IA 1NMCB 1N5YL 1NMBL 3TIDA 1I1AC 4M02A 5E99H 5B38B 3WN5C 1EXUA 3GMLA 3B5HA 4DGIH 1HZHH 4B7IA 3FL7A 2C4XA 4X6BA 5IQ7H 3IDIA 4WI8A 1RD6A 1I4FA 2P4AB 4OIBA 2DL9A 1FORL 1YECL 1AGBB 4N5UA 3O41B 5BO1L 3S36X 3CZFB 3JUZA 5LGKA 3WDJA 2CUIA 3SPVB 4XZUA 2AJXL 5EH1A 5H2BB 3HFMH 4I0PD 2OTUA 3D69B 1DBAL 3PV6A 3SCMD 1F4YH 4J12A 4F15C 1A1OB 2OR7A 4LPUA 2C3HA 2P47B 3VDAA 1OF2A 3HZKA 3C6LB 4JZJB 3KPRD 3TBSB 5ID1B 1CXKA 2D0GA 1FFPB 3VXOB 4Z76B 3EYSL 2A9MH 4A2LA 5GJSH 4YHIB 3TA3C 2GJJA 3BISA 5IVZA 1U8PB 1BGXL 5JQHC 1QD0A 4YHOL 1LO5B 1MCKA 1Z9MA 4R4ND 3A67L 5FYJE 2R23A 1BZ9A 3GK8H 2BXZA 4N0CC 1IKFL 4G7VL 3DO7A 4NOBA 5ANME 1KIQA 1LO3H 3S37X 1IC5L 2QTEA 1DTUA 4R0LA 2FIKB 3KS0J 4NIKB 4NC2B 3AB0B 4NZRH 3AS0A 1V05A 1QEWB 5IFJA 5TDNB 4KUCD 3DVNB 1EA9C 3M1BA 1HYRC 1E4WH 3DURA 3CGTA 2BY2A 9CGTA 2VISB 1UXWB 2DQJH 1S7QB 2WNGA 4H8WL 1LO2L 5ICZA 4LCYB 2V2TA 1KTLB 5MEPA 4NYLB 4E0RA 1KB5H 2GTZB 4F7CA 2EDJA 3WJLC 4UT6L 1FVDA 5E8OA 2DM4A 1CI5A 5C0IB 4JO1H 3FOMB 1PEWA 3C6LD 1F6AA 4K3DH 4HGWB 5DS8A 3H3PL 3RVXD 5EOTB 1TQCC 2HT4C 4I2XA 2A6DB 5FM5O 3LKSB 5EC2A 3TNMA 5BZWB 3FN3A 3MRRA 1NL0L 3SGDH 1MJUL 1CFNA 5JNYB 4WTXA 5E4EC 5L2KB 3MLXL 2AP2A 2C3XA 5GPRA 3O3EB 5I9QB 4P2QB 2OZ4L 2AERT 2A74B 5HYEA 1A3QA 5KSVB 1A5FL 3VWKA 3GSNB 3KLAB 4KKNA 4HWBL 3W39B 3P0VH 1Y6MR 3IDJB 4X4MA 1AHWB 4BH7B 2DTMH 4FZEH 2AEQH 2Q76A 2YD4A 3DX8A 1W0VA 3FN0H 2PYFA 4MD0A 3JZ7A 1JGEB 3TZVC 4XNMA 5JW5A 4OZHE 5DYOB 5DGRA 4HPOH 5EO1A 4N8VG 4CRPA 1AO7D 5C0BB 3W5NA 3VXPA 4WO4A 5IFAH 1A6TB 1J0IA 1UKQA 4YFLI 2F74A 5HY9A 25C8H 4X6FA 3UYOD 2HJLB 3A6BH 1CLYH 4ZO8A 1FYTB 2ITDA 3WFCL 3JTSB 4NNPH 2ZSWA 3NFPB 1K5NA 3VDBA 1UB6B 3HI5L 3L5JA 4RWHA 2I25N 4KV5E 2C3VA 1AD0A 1MLBB 3NH7L 4K2UH 5KAQG 1CYGA 4JQIH 5E8NB 2ZCLL 4P2QD 2R0KL 5C3LD 5CSZB 1AD9A 2VDRH 3RRQA 3MROB 1KLUA 1KXVC 3AVEA 2GUOA 4J3TA 1R3IL 4HWZA 1G0YR 2XI9A 2C1OA 3MGOA 3F8UB 3AU1A 5C0AD 1H15B 4ORGA 4PY7B 5IBLD 3QXVA 2VITB 3KG5A 4LHUG 2SEBB 5FYKU 1J11A 5GS2D 3T0WA 4D9QD 5H35B 5E8EB 4H1LB 1U9KA 5ENWA 5IG7B 1QSZA 1N2RA 5D6DC 4CJ0A 2IJ0C 4U2ZA 2DMKA 3GSXB 5C7XH 2X5PA 3RIAF 5L7XL 1S78C 3MCLL 4N0FA 4ZAKA 5IVXA 1SM3L 5HGGS 3VA6A 4PJIE 1FDLL 1BWMA 3KNBA 3P9LB 5D7LB 2RGSA 5DVMA 4KDTA 1P7QA 1WZLA 4P4KC 2NTSP 3O3AA 1EHLH 3SDCA 4UBDD 1LD9A 4OF3A 3MRNA 3ARYA 1PYWA 3NCJH 3F5WA 5TDPB 2VDNL 4KDWA 1H3WM 4MB4A 3PP4L 2BVPA 4BKLB 2YUVA 4QRRB 4YHLH 2GITA 4U6XB 4WI3A 1LDSA 1R5WA 2EXYC 5DVNA 2H2PC 2D03H 3HB3D 3QJHA 4DCQA 3MJ9A 3LKQB 1JVKA 3BZ4A 1JHLL 5E5UB 2GJ6E 2AAVA 5JDSA 1A9EA 3V5HA 4OGXL 2IWGA 3BE1L 3VW3L 1SY6H 4L4TB 5C9JB 2EDDA 1H3TA 3WCYA 2OR8A 2R29H 1XF2A 3L9RA 1W8OA 4H5SA 5IJKC 3JV0A 1T2QL 1FN4A 4OFDA 5EBMB 4LPTA 1EIBA 2EDYA 1D6VL 1O5DT 3P73B 1VEOA 3MACL 2CLZA 1MHCA 4L9LC 2V17L 5C07E 5IV2A 4M9OA 5C0JA 3C6SA 5HGAB 3BH9A 4APQD 1TVBA 3LY6A 3O6MH 4HCRA 4OLXH 3ARBC 5HI3C 1OGAE 5EZIH 3T0EE 4MQXD 3QUYA 2AEPL 3Q6FA 3CDCA 4X6DA 1QFWM 5E1AB 3T0DA 2VQTA 2DLFH 4QHLA 5IHUH 4LRIA 2VXTH 3CVHB 3MMEB 2BSTB 3IDUA 5T3XE 3OSKA 1H3GA 2AQ3A 4J6RL 1D5BA 1VGKB 5HYIA 2DIAA 4JDZA 1JV5B 2ADFL 1PW3A 4H20H 3KYNA 1A3LL 5AEAA 3JV6B 2XFXA 5ESVB 2PCPA 4QCIA 1NKOA 3EYQD 4NNYA 1OAXL 1ZXQA 1T0MB 3U0PA 4DWHA 3D87B 2NXYB 5EOQL 4PRBA 4KXZH 3V79C 1J5OL 1EFXA 5EBLA 2HT2C 2YPKA 4RWYL 1T03H 4G6ML 3KPNB 3QQ9C 2Z8SA 4OIIL 4RMQA 2R1YB 3MRKA 5CP3A 4YIQA 3QDHA 3VRIB 4HSQA 4L3CB 4UV7H 3QJFA 3QCTL 2PN5A 3UTTD 4DKEL 3VXTA 1YEIL 1D5MA 4Q6IC 3GJEB 4MAYC 3BMWA 4WUKH 2XACC 4YGVA 1M6OA 4C58B 3BKML 1D9KC 3O8XC 4IOIA 3MLZL 5J11C 3U4BH 4MNQE 2BDNL 3C60B 4I0CC 2CH8A 3V6ZB 2ZKHH 5BVPL 1F2QA 4JPKH 4R7DB 1FE8H 4Z9KB 2FHFA 3WNPA 5GIRB 3MV8B 3L3KA 5IUSA 3PG2A 3EO0B 4PJEA 4M5YH 32C2A 3MBEB 3DMMB 4KQ4L 4PB9L 1UZ6F 3C8KB 4MS8C 3PGDA 5J6GA 1XF3B 2X41A 3EFDH 3LZFH 3IJYB 3V52L 4X4YA 5I66A 5C71A 1KENH 3JWDL 5IBTH 4KHXL 4TQEH 3ZHKA 1ROWA 1I8KA 4RGOL 5D7JB 4UTAL 2NY5H 3OQ3B 3PWUB 1A3LH 4HAGA 1OP3K 1QNZL 1KNOA 4ONGH 4MZ2A 3HNTH 3RWEA 4RZCB 3DI2B 1BQHB 5DHVB 5JPNA 3H7BA 1DUZA 1BLNA 4Z78A 1M4KA 2HJFA 2VC2L 4DUVA 3CMOL 1KELH 3GO1L 4IJ3B 1NBYB 1U3JA 5CKGA 3QI9D 4M43H 3EOTH 2YPLD 1A7QH 1JGUL 1F3JB 2APXA 1FAIL 4FXKB 1NANI 4OM0L 1MLCA 5CKAA 3QCTH 3I6KA 5LGJB 3H9HA 3AMLA 3IAPA 4PJCA 5EFIB 4GLRH 5KTEL 2NY3B 4NKIH 4KFZC 5HJ3B 1NFKA 1ZHNA 1OP9A 3BEVB 4GUPA 2FZ3A 3C5JB 5FM8A 4U2YA 2C26A 2I9LB 3N85H 4PJHB 2EIEA 4KRPB 1H8SA 2FJHB 4PRPE 4R4FL 5GGRA 2Z91B 1UM6L 3BPCA 1HE7A 4OM1H 1VACA 4P23C 1AR1C 4TSBL 4XVSH 3KPPB 1YMME 5ITFB 2P5WD 4OLEA 2X4QA 4JPVL 2R4SH 3PWPD 2HKFL 1XIWC 1UKSA 4HUNB 1E6OL 5TH2A 2KZWA 3ZKQD 3QUZA 3X3GH 2BOCA 4JPIB 5B4MD 4AIZB 4XCYB 5IJVA 1Y18B 1VB9A 3ZE1F 4HBCL 4HF5L 5K9JH 2F54B 4ISVB 3U7YL 2PXYB 2AJUL 4AIXA 1FH5L 1A6ZB 3UYRH 3BUYB 4IRJD 1B2WH 1RZKL 2C7UA 4ZFGL 1W0YT 3D25A 2NY3D 1R24A 3OL2A 5IMOA 3CX5J 5F93C 2EYRA 2P7TA 1S7TB 4PRHA 3BKYL 4WI7A 2E7BA 5EUOB 1AGCB 4M5ZL 4POZC 5LJYH 3CMOH 2OQJA 4LEXL 1Z5LA 4G42B 4LLMA 1K6QL 3QWOA 2JLLA 1HK6A 3O6LH 3FTGB 3VCLA 1AQDB 2HLAA 2EDHA 4N8CH 1H5BA 3QEQD 3O9WB 1T5XB 2R2CA 2AQ1A 3CFKB 2PO6A 4X4XB 1MRFL 5BOPA 4FABL 1D6EB 1GAFH 5EU6B 3QULA 5AG9A 2J8UB 2VDML 4PRDA 5I73B 1Q9WA 3UTQB 4PJ9C 3KPLA 1MCRA 5F9OL 1DBJH 4U1MB 5I1GH 4WJ5B 2F54D 2GI7A 4ZUSA 5I1LB 1TFHA 1SJHA 2FLBT 2VABB 4KPHH 4RMUA 5B38A 5HHVL 3D1MC 1JWSB 2EIZB 2Z92B 2X05A 3MPCA 4JG1H 4K94H 2XZCL 4EQ3A 1PY9A 3SY0B 2MPAH 3VFRB 1AGBA 1ZANH 3O41A 4PGEB 3UAJD 4JQXC 1NAMH 3SPVA 2HTLD 3K3QA 4JY5L 5H2BA 5FM4A 5D2LA 4UDTB 1JYNA 1A1OA 1U92A 4OSUL 4AM0B 4LRNH 3QCUH 1V7NH 5HHOE 3CD4A 5F70A 4JZJA 5F7WC 3TBSA 1FNSL 5ID1A 1AGFA 4M7ZC 4MJIB 1FFPA 3VXOA 4CU8A 2Z93A 4Z76A 2JJSC 4JM4L 2V5RA 2UY7A 3T08A 4AMKH 1UGNA 2D2OA 5EU6D 4YHIA 4KUCF 5E1HB 3W81A 4NQCD 4XMKH 1NUNB 1SQ2N 1U8PA 4UILH 2YD6A 1GGBL 2B20A 1JHKL 2YPVH 1UWGL 5C2BL 1FNGB 1IGFH 2XICA 1YQVH 1NGWB 1N64L 1YJDL 5DD5L 5EORH 2Y06H 1EBAA 3V4UH 4J3VA 4U1HB 2KL6A 1WV7T 2FIKA 4M6AA 1KIPB 3AREC 1KEMH 5DRWB 3VMNA 4WFED 3WUZA 1GGYA 1PY4A 2XG5A 1UXWA 1YEJH 4AY0A 3F12B 1NGQH 1S7QA 5ACZA 3ZSTA 4IIQB 5I30H 1JL8A 1ULVA 2WBJD 4ZSOE 4LCYA 1KTLA 5FB8A 2GTZA 1IC4L 3ARDC 5I1HL 2BVTA 3V5KB 5C0IA 3Q0HA 3FOMA 2NY2D 5D96C 1FGNH 1JWMB 4HGWA 4U1SB 5F7UA 3ZT7A 2PW1B 4DEPC 1NLBH 5EOTA 5EPMB 4MX7B 3QFJE 2IAMD 2A6DA 3QPXH 4YPJA 3LKSA 4I77H 5BZWA 5JNYA 3CSYB 1JP5A 5L2KA 3HG1B 3AFLA 1KV3A 3O3EA 4OGAC 2CDFB 5E9DD 2A74A 1I3GL 1R3LB 1KTKE 4ZOCA 5KSVA 3GSNA 5L8KB 3KLAA 2XZAL 3H42H 1HHHB 5MERB 3SKOB 5CGYD 5FCUH 4FQHB 6FABH 3IDJA 4Y4HB 1T0PB 3Q3GB 1AHWA 3OR7B 4U6VH 5FYJH 3K7UA 4P0DA 4BH7A 1RURH 3CSPA 1JGEA 4Y2OA 5DYOA 4RGNC 4M1DL 5FGBA 5C0BA 1A7NL 3ZL4L 1N4XL 4BZ2L 3GRWL 1S7VB 5TQ2H 4OCRH 3I9GH 4G3YH 4NM8H 4DGVH 2HJLA 2P5EB 1FYTA 3NFPA 2R39A 1UB6A 5DJ8B 2AJSH 3DV6B 4LCCC 4TVPL 1KC5L 3ABZA 3UTSD 4UMGA 1BBJA 2F5AH 4MHHI 5IHBA 1EO8H 1EMTH 5CSZA 1ZLWH 4DUXA 3MROA 4Q0XL 3CFIC 2HWZH 4JFHD 4A6YH 1H15A 4PY7A 2VITA 2SEBA 3P11H 1ZAGA 5E8EA 5H35A 4H1LA 4MQSB 3EDDA 2GCYB 2F8XC 5FECB 4HXAL 3GSXA 1SVCP 1CLZH 5ITBL 4I3RL 5FXCH 3V6BR 1I3GH 3MNVB 3NCMA 5I75C 4WDIB 4NCC2 3QDGB 4UB0H 3P9LA 5D7LA 1P5UA 2ZG3A 1EJOH 3HI6H 3UTZB 3UJJL 5GHWH 1XF5B 2UZYB 5TDPA 2IPUK 4BQ9A 2A83A 1I85C 4XVTL 2AJZB 5GQBA 4G9DB 5KZCB 4QRRA 4U6XA 4NO5B 2ZWLT 2O5XH 1CDGA 1QSED 3BZDA 4JLRB 4H1LG 3LKQA 4LLYB 1ZHBB 4MVBD 1YNLL 3EJJX 1MF2L 2EH7L 4LCWE 4RCAA 4UAOC 2EECA 4NRXB 5CIPB 5FHAL 4L4TA 3W0WD 3D6GA 4DVRL 5C9JA 5TQ0L 3UJTH 5ACLA 4O51A 1G7PB 1OVZA 1JNLL 4QKXB 4AIOA 3L3DB 5EBMA 3CLEL 2PTVA 1G0DA 1FIEA 4MB5A 4LEOB 4NKOB 4YFDB 4HIJB 1SMOA 5HGAA 3OKYA 1UJ3B 4NT6A 3LCYA 1E28B 1F4WH 2B1AH 4U3HA 4M7LL 3BAEL 5IHZA 1KYOJ 4KK6C 3X3FH 3WO4C 5T5FH 5ABDE 2A1WH 5E1AA 3E2HB 3ZDYF 1IFHH 3CVHA 1DVFB 1IGMH 3MMEA 4JN1L 5KZCD 2BSTA 4OI8A 1I9JH 3QUXD 2DMBA 4LNVA 1VGKA 1HYSD 3O2DH 1JV5A 4X99B 3WJJA 3SKJH 1ZT1A 2Q7NA 3JV6A 3CFJB 4P2OB 1FG9C 3D9AH 2NZ9C 4JO3H 3WE6B 3O2VL 1KBGL 1AQKH 1X5KA 3RUGF 1LO4L 1T0MA 4JHWH 2DTSA 1I1CA 3L1OL 4FQXB 3TFKD 1MCWW 5ALBL 2EC9T 4CBPA 4HHAB 3IFLH 4XH2B 4G6FB 4U7KA 5GS0C 3KPNA 1JJUA 1QSFA 2R1YA 4CN4A 5I76B 3VRIA 2D0FA 4WI2A 4L3CA 2LFGA 3RY6C 1PG7H 3K4ZA 4PJAB 1IC7H 2F9BT 4GAGL 3GJEA 3F7VB 5FHBH 5DI8B 1CICD 1MCSA 1FZKB 2D7NA 5JXAH 5MEOA 2DLGA 2DB8A 4JFFB 4JE4B 3ZDXE 4MJ6B 2A73B 4XP9L 5HDQL 4RFEB 5E2TL 3OAZK 3C60A 1CE1L 3H7LA 4XNZB 3V6ZA 2J2ZA 4Q2ZB 4ERSL 4PJ5E 4L3ED 2GIYA 4R7DA 3C5ZD 4FNLL 3MV8A 1RUML 4LKCB 3TWCL 3MBEA 5HYQB 3DMMA 4N90D 5DR5L 1X44A 1NCBL 3C8KA 2P8LB 5F6IC 5EA0H 1MFBL 1MQKL 1XF3A 3LQAH 3QXAB 1A7RL 2H9GB 3IJYA 2Z8RA 2ZUXA 4FHBD 2CIIA 4P5MB 5HHMB 5CINH 3J8F7 1A7OL 1QLFA 1QPXA 3OGCB 1JPST 5D7JA 5IBUG 3PWUA 3O6FD 2OYPA 3SE4C 3O3UN 4RZCA 1YPZE 1IAKB 5DHVA 1KJ2L 1HKLH 2DYPB 4MCZB 3P40A 2AI0H 1NMAL 2FATH 3G6JE 4N0UB 4PGZA 1KEGL 1RUAH 4LCIH 4U1LB 1I3RB 3VXMB 1QRNB 1F3JA 3L5WB 4FXKA 3BGMB 5LGJA 4FQ2H 4WWID 1G6RH 5EFIA 1UFUA 4GAGH 3GHBL 2X44D 4IRSB 5HJ3A 4OGYL 5INDB 3BEVA 1RIUL 4TNVK 3SE3A 3C5JA 2J6EA 3ISWA 3D39A 3MRCB 4H88H 5CBEB 2I9LA 2BNQD 4PJHA 3SO5A 4XP9H 4PJXA 4HJ0D 4R2GD 2FJHA 5HHMD 3S88L 2Z91A 4HUVB 1F6FB 4UNVA 2H45A 2XWJB 3KPPA 4JRYE 5HSFA 3R0MA 5LXGL 1X5FA 1I7TB 4DN3L 4BM7A 5AUMB 4KMTL 1QFUH 4JVUA 3RVTD 4IMKC 4X7TB 1IQDA 3VXUB 4FQ1H 5IT2H 4JPIA 4PJHF 4AIZA 3V4VH 5MEQB 1J10A 3P4LA 1Y18A 2EE6A 1N3NB 3HUJB 1WCBA 3OAUL 3QXUA 1IT9L 4YX2L 4ISVA 3OG4B 2PXYA 1II4E 4XHJD 4XWGL 4AT6B 2W0LA 3BUYA 3U36B 2HVKB 1KLFA 1GZPA 4UDUB 3HI1B 3D0LB 5CJXC 3UX9B 1KB9J 2FB4H 5JPMA 1BJ1J 1F90L 4P3CL 3L3HB 5EUOA 1AGCA 2G60L 1URLA 4Z7VB 1RULL 2WIMA 4G42A 4Z7WF 3FTGA 5L88L 1AQDA 4FFZL 4S1SH 3BJLA 4PJDA 3O9WA 1T5XA 1J8HB 5DJ2A 3CFKA 4X4XA 4YE4H 3QIUD 2CO6B 5B39G 4GH7B 1D6EA 4HS8H 1C5DB 2HG5B 2J8UA 4C56A 1IGYB 3VXUD 2FX7H 3UMTA 1SYSB 1KJ3H 3UTQA 2QR0B 3G04B 1T2XA 5IB3B 5SV3A 1WT5A 5DD1H 4FN0A 3ARGC 4LPXA 2A38A 4WJ5A 5E6IB 2XY1A 5I1LA 5E94B 2VABA 4JHAL 3TIEB 1JWSA 2EIZA 2Z92A 1GVIA 3SY0A 1QFWL 1NAMB 4ZUUB 1F58L 2CO7B 3M07A 4PGEA 5HD8C 5F7HA 3I85A 2NY7H 5E8PB 2YD9A 5FOJA 4P57B 1TVHB 3MV7D 4ZDHA 3G08B 4N1EA 5SWSB 2N7BA 3FMGL 1VFBB 4ZFZB 4UDTA 2HFGL 3CC5B 2RHEA 4KHTL 5DJ6B 4ZFOB 4AM0A 1TQBB 1J8KA 3QNZB 5I71C 3GMNB 2B1HH 1N7ML 4BZ1L 4MJIA 3WXVH 1QBBA 4NQDA 3TVMB 2CLVB 2CUMA 2DIJA 1A0QH 1FBIL 2X42A 5AWNH 4KK8C 4XNQB 2DQHH 4U6YA 4R0LC 4HLZH 1CG9B 4Q9RH 3D2UB 2W1NA 1VERA 1C5BL 1F3DH 5E6ID 1CD9B 1LEGA 1C1EL 1FNGA 1NGWA 1Z2KA 3MRBB 4JRXA 4AEEA 5J7CC 2F53E 1MFCH 4U1HA 4S1DC 3RFZC 4P9HC 2IEPA 1KIPA 4NO2A 5DRWA 3L5XH 3I3EA 1I8LA 1MRDL 2BC4A 1CK0H 1SEQL 3CMGA 1MFEL 4WFFD 1YNTB 5SWSD 3F12A 4OF6A 1GZQB 1JTTA 3QA3B 1WAAE 3V5KA 1ZS8A 3MFGB 2IG2H 4LQFL 4G8FB 2VDKH 1RQ5A 1JWMA 1QFWH 2W07A 4KI5C 4U1SA 1RK0B 2PW1A 5DJXB 2VLJB 4PD4K 4YBLB 5EPMA 4F37K 4MX7A 4UUJA 2HMID 2W0KA 4YHNB 1ADQL 3VWKC 4X6EB 4BZYA 2Y36H 4GXVL 4HK3J 3GUTB 4LSTL 3CSYA 5B3JF 3RZCD 1JPFB 2NY6C 3HG1A 2XTLA 1NCUA 4MHHG 1GOHA 2JIXB 4KROB 2Q7YB 1ND0B 2CSPA 5DD3H 4BFIB 3FJTA 3HMXL 2ZUUA 5MERA 1HHHA 3SKOA 1V3KA 3NIFE 4WO4C 4FQHA 5FAAA 2OI9B 4Y4HA 2E8YA 3PIQB 3Q3GA 3OR7A 5I1IH 4HX1B 5ANMB 5KVEH 1N6UA 4KKBD 1PLGL 2ED9A 5DUML 5FV2A 2Q8BH 2LQRA 4J23A 3EJYC 4KGLA 4Y5VB 3DRQB 1HHGB 1LO0H 1HHJB 2Q86B 4Y19E 5A3ID 5DURD 4XPAH 1DBML 1S7VA 2K3TA 1PSKL 4LOUC 3IYLW 1BFOB 1H3PL 4ONFL 5KSAB 4QXGL 2HVJB 3SJVA 3DHJA 2P5EA 1KFAH 1LVEA 1JZ8A 1NUGA 4HZAA 3VFVA 43CAB 4KTEL 1MFEH 5DJ8A 4PIRF 2B2XL 5DC9B 3DV6A 4HD9A 4OLWL 3IF1B 5JZ7C 5EULV 1XGUB 3MUZ1 1FO0B 4P2CG 3QR2A 1S5HB 2JIXD 4DQOH 3ULVC 4JZOB 1K85A 2JK5B 1U58A 2VLLB 4M61B 1V3JA 4WUUD 1CBVH 2EEBA 2DQIH 4XAKE 3U0WH 5FYJD 1UC6A 3TA3D 4ZAKC 3ULVE 2VKXA 1R3HB 3PNWB 1V7ML 1ZK9A 1DDHB 1VFUA 1JZ3A 1L7TL 4KDTC 1ZLWK 4N0CD 1A2YB 1VSCA 2FX8L 2GCYA 4ODVH 1OCWH 3ARWA 4B5EA 1DSFL 5FECA 5HDBE 3HMWL 3SDCC 5H37H 4F2MA 2WZPD 2F15A 3E8UL 3TT1L 4GAJH 3MNVA 1J12A 4WDIA 1MAJA 3LH2L 3QDGA 3VXRD 3EO1B 1T3FB 2XWTB 4X7FC 4CU7A 1GJIA 1J18A 4OZHB 5C9KA 4IRZH 2OXHA 3UTZA 4Y89A 3QB7C 1OWRM 4HXBH 4GMTL 4PJBB 1XF5A 4CN1A 5F3BB 4OLUL 5C0CD 3OKNB 1R0AH 2AJZA 1X3DA 3BGFB 4XVUC 4G9DA 1T66C 2JKXA 4FQLH 4NO5A 4YPGB 1LMKA 3T2QA 1K3ZA 4JLRA 4YC2C 4YDVB 5KJRH 4LLYA 1ZHBA 2ZUTA 5L6YL 2APTA 3B2UC 3G5ZA 1G7QB 4RDQF 5CIPA 3GIZL 2ZCHL 1WZ1L 3GKZA 1P4LB 4NZTL 3RNKB 1K2DB 1TTGA 4LSQH 4NQEB 5GGTL 3BKJL 4R90H 3TJHC 1G7PA 1UCBL 2PYEE 5TF1L 2DJ4A 4KJWD 3BN9C 2M1KA 1ONQB 3QUYC 1OAYL 3P9WB 3S3PA 2FHBA 4GRWH 4LRIC 4ZNCD 4PPTA 4LEOA 3L95B 4HV8B 4HIJA 1UA6H 1UJ3A 2J8HA 1FVEB 1E28A 3LKPB 5E56A 2FECL 4NWTH 1BFVH 1LP9E 2YZ1A 3TZVD 4PJIB 5C09E 3VD9A 3BVNB 1ORQB 4BK4A 1XGPB 3NA4A 3DI3B 2VR9A 4IBLT 1DVFA 4XNXL 5BJTB 5K9KB 3IDYC 3DSFH 4OD2B 1YYML 2IGFL 4ACPA 3ZTNL 2VUOA 4BH8B 4X99A 1REIA 1CLOL 1CL7I 1MREH 4GKZB 1G9ML 4P2OA 3CFJA 4HJJH 3FCTB 4XTRC 3QEGH 2GYSA 2N56A 5CUSH 3WE6A 1EZVY 3W82A 1F97A 3MRDB 4YK4B 2W9LA 5A2JH 4QXUL 3MRMB 4Y4KA 4FQXA 2B0SH 2GJ6B 4QRPE 2G5RA 4UT9H 4F7PB 4HHAA 1G7HB 4X7EC 2Z8WC 3MRJA 4XH2A 4XP1H 1P84J 2WW8A 2VNCA 2VQUA 5F96L 5GS0L 5I76A 5CEZL 1O0VA 1CGVA 5FO7B 3SE8L 5I8OL 4OF0A 2VDQL 3F7VA 5DI8A 2V9TA 1FZKA 5KSBB 1RZJL 3MLUH 4HWNA 4OCXL 2ICWJ 5DJZB 1S78D 1DQMH 2R0LH 4JFFA 5ECJE 3PHSA 4U0QB 4XPBH 4TOYH 3UPCA 4MJ6A 2A73A 4M03A 1L6XA 4RFEA 3VGFA 1OGAB 3T0EB 4PJEE 2XY2A 4PB0L 2X4SB 3OB0H 4PJAF 4P4KD 2QHLA 5IB5B 4YWGH 4EN3B 2RBLA 1AJ7L 4LKCA 4HMCA 5HYQA 4OT1L 5GISL 2DQUH 1J1XH 2BHYA 2P8LA 5D70H 4DJMA 4JN2B 4HZLB 3P0YH 5FYLL 4KRMB 4LK4A 3L5HA 3QXAA 4AENB 4MNGB 2H9GA 3SQOL 4GW1B 2EXYD 2H2PD 2NPLX 1NAKH 3KYKL 4WHCA 5AZEL 3VG9B 4P5MA 5LAXB 2J88H 4XAWH 1NBZB 4P46B 3OGCA 2ENYA 2ERJC 3CXDL 1A02N 1MPAH 3P30H 1K4CB 4CVUA 1IAKA 5DRXB 4XMLH 1UYWH 3F58L 2DYPA 4MCZA 3SGKA 1EAPB 2APWA 5IR1B 5C07D 4EZMA 5JHLH 2YEZB 4PV8B 1RZ8B 1OGAD 2VR4A 3T0ED 1JF1B 4U1LA 1I3RA 3VXMA 2NLJB 1QRNA 1EHNA 2J1KA 1IVLA 3L5WA 2YKLH 3VH8G 4HC1H 5CLWA 1A1NA 1GPOL 3BGMA 3ARBD 3V6FB 4TSAL 5E2UL 5HI3D 3WMSA 1WBYB 5EUKA 1JFQL 2OTPA 1NBVH 4I0KA 2Y72A 1NCAH 3P0GB 1N59B 3C09C 4IRSA 2EC9U 4MNQB 3UBXA 4J2XA 5INDA 3LKOB 3KJ6H 3MRCA 5CBEA 4MXWL 2NW3B 2VERN 4NBYB 2FDBP 2NW2A 4HUVA 4XCCL 3TPKA 5J57B 1YDPB 1GOGA 2XWJA 1SJVA 2JCCF 2VXUL 3DUSB 4NBXB 2NY4C 4EUPG 4UU9A 1QLEL 1NCDL 1QP1A 2N1KA 1I7TA 2Y07L 3L5IA 5HVHC 5AUMA 2H26A 4X98B 2DDQH 4UTBH 2WLZA 4X7TA 1YMHA 4PP1C 1JBJA 4JFEE 5JW3L 2F19H 3VXUA 4QHKJ 2HT2D 3HHRB 3WUWG 2FJFA 4MDJB 4OCLC 4DOHE 3QQ9D 5MEQA 3HUJA 1N3NA 2H32H 4NCC1 3RHWF 5E00B 4AT6A 4OF5A 3DTXB 3UBXG 2HVKA 4KKAC 5E03A 3QWRD 3I02B 4PRHE 1U8QB 1AE6L 3D0LA 3S36L 4G5ZL 5SX4H 5CS7A 4MAYD 5D7IE 5D93B 1DQTA 2R9HC 3S34L 1H5BC 3S3SA 2VXQL 3L3HA 5IB2B 4KU1A 4LU5L 3O8XD 2PO6C 2R4RH 1MAKA 4HQQL 5L9DH 3P9MB 3LD8C 3ARFB 4QNPF 4Z7VA 4Y5YB 2E7LA 3MLTA 1JNNL 1BOYA 4YXLH 1BREA 2LVCA 1SJEB 1CFVL 1J8HA 2DQEL 4NGHH 4RNRA 3HAEG 4GG6F 1NMCC 4MS8D 3F6LA 4TUKH 1C5DA 4M93B 2HG5A 2W92A 1R6VA 1IGYA 1T1ZB 2Z8VC 4P2YA 1CGWA 1SYSA 5LCVL 4Z7VF 3G04A 3C87A 4G6JH 4LASH 3MOQA 1FIGL 3RWJB 2DM2A 4AQ1B 4JGUA 3S37L 1N0XH 5E6IA 4AEHL 1RIVL 1BAFL 5F9WB 4P9MH 5E94A 4XP4H 3TBWB 1GIGH 3TIEA 3QQ3B 3GI9H 1WFNA 3ZT5A 2NMSA 2E9WA 5I6XB 5TE6H 1DQLH 5I1KH 4ZUUA 5GGVH 3O4OB 4KMQA 2APFA 5D2LE 5IW1B 1W72H 4OFKA 1I9RH 5E8PA 4P57A 4JZJC 1TVHA 2CDEB 4I5BB 5SWSA 4ZFZA 1VFBA 3CC5A 2F5BL 3WHXB 3IDMB 1TETL 4ZFOA 2OL3L 1OTTC 1ITBB 3DIFB 3OF6A 3QNZA 1UWXK 3GMNA 2FGZA 5IVOA 1VFAB 3DX6B 3K1KC 3TVMA 4F57H 2CLVA 3EYUH 5SWZE 3PGFH 5DMGD 2R2HB 4PRPD 4Q9QL 3DX7B 1DN2A 4XNQA 4NKDB 2VXQH 2QSQA 1LE5B 4N5ED 4R26H 1YMMD 1MJ7L 3D2UA 3AB0C 1WQVT 3C9NA 3MCKB 4JB9L 4ZNEA 4P23D 3ROLB 1AR1D 2VLRB 1CD1B 3B5TA 2LE9A 3MRBA 5KOMC 1XIWD 3OJ2C 5D5MF 1HEZB 1D7FA 2Y7QB 2BVQB 3GFUA 4P9HL 2FL5B 4O9HL 4X4ZA 1MFDL 4S11A 3ORJA 1QR1B 4PRAA 1MHPL 2VN4A 4FFYL 2XQYG 1CU4H 1YNTA 4HUUA 4MB3A 4WFHE 5LKNA 4NZUH 4GQ9H 5K33A 2XTJE 1AKJB 1N5AB 3MLVL 2H1PL 2FEDC 1BIHA 1GZQA 3QA3A 5HYJE 5D72L 3K2UH 1J1OL 2CKBL 4NWUL 4U6HB 3NCEB 3ZE2E 5FGRA 4G8FA 5I9QC 2MJWA 3NIDF 3KPSE 1ITCA 1RK0A 5DJXA 3U9PL 5KVGH 2VLJA 4RBPH 4F37F 5L2KE 4KK9C 4YHNA 4POZD 12E8H 5LBSL 3NCYS 3BRDA 5HHOB 3GUTA 4O02H 2NX5E 3T1WA 1A4KB 1AHWC 1RUKL 3PP3K 2DD8L 1YUHB 1QVOB 4EXPX 2Q7YA 1RSFA 4FTVA 1ND0A 1OARH 5FFLA 4RMVA 5FGBC 1N6QH 2HRLA 2HTKC 4L8BA 4TRPH 5JOPE 4Q9QH 2IC2A 3PIQA 4PJ9D 3MNZB 4HX1A 3IS1X 3EW3B 5C0BE 1OGTB 4UOJA 4QYOA 4X6CF 3RA7H 3SGJC 4XB8A 3B2VL 3OKDB 1AKJD 3OXSB 4Y5VA 3DRQA 3HE7B 4LSRH 1HHGA 4JFZH 4OF8A 1HHJA 4KKCC 1A3RL 3EGSB 2DQDL 4YHKH 2Q86A 3F65A 1RZ7H 3OJDB 2BCKB 2JJWA 4XMPH 4JKPH 4ZTPL 5GJTH 4P9HH 1BFOA 5KSAA 2HVJA 1KPRB 4NO0B 4ZSOB 4RAUB 2ZUYA 4OQTL 2VIRB 3ARPA 5HHOD 1GCFA 43CAA 3H2WA 1BZ7B 1A6UH 4U3CA 3UO1H 3RWDB 2C3GA 1G84A 2ZCKL 5F1IB 3VU2A 3IF1A 2ZUSA 2EKJA 4LIQE 4MA3B 1XGUA 2XWBA 1FO0A 1S5HA 5F1NB 2W9DL 5MP6H 1AGEA 4JZOA 2JK5A 3HR6A 2VLLA 4M61A 2UWEE 1HH6B 1HINL 3DRTB 3QHZH 4XPTL 5LQBL 1DDHA 1UT9A 4YDIL 4F58L 4M7LT 4MD5A 3ZKSD 1MCPH 4RMRA 4YZFE 1LGVA 4EXKA 1NC4B 1A2YA 2I5YL 3B5GA 1JF6A 3U9UB 4MQXC 1WICA 4YDJB 4PBWD 2PETA 5J56B 3SDXE 1IJ9A 3VFOB 1WF5A 1OLZA 3ARED 4EDWH 5GGQL 1I8IA 1JGLL 4CKVX 1T3FA 2XWTA 5KVMC 4OZHA 2LTQB 1F6LL 4LP4A 1EEUA 3TGXA 2DKUA 2OMNA 3MV01 5E8DH 1NSNH 3ARUA 4QRRE 1D5IL 5C08A 3ELAT 4PJBA 5F3BA 3OKNA 3G5XB 4DZ8A 2EO1A 2J7LA 1OB1B 3QFJD 4K8RC 4NSKA 1T7YA 4YPGA 2LAAA 1FJ1B 3IFPB 5IKCB 2LU4A 2YMXH 4YDVA 4L4TE 4OZHF 4MLSA 5FYKE 3VFGL 1G7QA 5I1CL 1P4LA 4MJ2A 3RNKA 4NQEA 4N0YH 3B8YA 4U0RB 1NC4D 1QBML 4OGAD 5D7SL 1TCMA 5I1DB 4HCRL 1MCOH 4Q6YA 1YEHH 1ONQA 2JB5H 4RX4D 2V6HA 1DL7L 3ULVH 4JO4L 2I27N 3THMH 5SX5K 3IFOB 4LL9A 3L95A 4HV8A 2OSLB 3IU4H 3LRHA 1FVEA 2G2RB 3EAKA 3LKPA 5KW9H 1JHTB 2VO5A 1PZ5B 1JMXA 1RK1B 3WJJC 5C6TH 1IAMA 3PL6B 4PJIA 2PW2A 3BVNA 1ORQA 2HKHL 4RGND 1ZA6B 1M05B 1XGPA 3EO9L 3LV3B 1HQRB 1EZVX 2BRRL 3R0NA 4M62H 3LS5L 1BD2D 1CGSL 4KQ3H 2NXYC 4BH8A 4K3JH 2Z35B 1D5ZB 3MGAA 4K71B 3N9GH 1I9IL 4GKZA 3VWJB 3FO9B 1DQDL 3FCTA 5ADOH 1NLDL 3FAXA 3MJ9H 3MRDA 5M94B 1KLGB 5DA0B 3MRMA 4LFHD 2P42B 1QSFE 3TBTB 4Z0XB 1INEH 1TJIL 2GJ6A 3U79A 2HN7B 3WXWH 5CFHA 5D2NA 4X83A 4LCWB 1EFQA 1H8OA 2YA0A 4F7PA 1G7HA 5KG9B 2CRIA 1DFBL 4Y88A 3OJMB 3HNSL 3ZE0F 1VGEL 4LSUL 1MAML 2QQQA 5IFHH 5CJQL 1OPGL 4UAOB 4DKAA 5I17B 5T1LD 35C8L 5FO7A 1OTUC 3C60C 1S9VB 1NEZG 5KSBA 1F4XH 2DICA 2CJUH 2EEDA 4NC1E 3KVQA 5DJZA 4RMSA 4KZDH 3SDAA 3MBEC 1H3XA 3DMMC 5J12B 1OGAA 3HE6B 3OAYK 1RUPH 3JWOC 3WSQH 4ZXBA 2Q3ZA 2X4SA 1OAKH 4EN3A 1G9EA 3VWJD 1FNEB 3IS0X 5CAYB 1WUNT 5GS3A 1QQDB 1W8NA 3HKFA 5D7JC 4HZLA 5F71A 4AENA 2XRAL 4MNGA 4G80B 1DLFL 5HYSG 4HUWB 4GW1A 4BQ6A 4YDLB 4PGCA 1KOAA 1JZ6A 4XCFL 5LGHH 5AD0B 3WBDA 1NDGB 5LAXA 4M7KH 4LPYA 1C16A 1ORSA 1NBZA 4P46A 4OLVL 4IJ3C 4OCSH 4ZOEA 5FYLE 2ICWI 2R15A 3WNLA 4D0CB 1K4CA 4WCYL 2X4UA 3JUYA 5CP3H 2FX9L 5DRXA 2CRYA 1P1ZA 2JJTA 4MA8H 1M7DB 1EAPA 2B4CC 4OZGF 5IR1A 2XIDA 1OAZL 3Q1SL 3PGCB 2YEZA 4PV8A 1RZ8A 4DN4L 1JF1A 5JMRA 2FJGB 3PDOB 2NLJA 3EOAB 2QQKL 1EJ6A 4P2RA 4KRPC 4NUGH 3OV6A 4J4PA 1AR2A 3C2AH 3V6FA 4OFYA 1LNUB 1TJHH 1JPTL 4QHNB 4XBEL 5F9JB 1ZSDB 5FV1L 4KK6D 3D39E 1N59A 3UROR 5C0NC 1BVLB 4KXZI 4MNQA 4TNWF 3LKOA 2E7MA 1K3IA 4PJXE 3I6LE 2ILLA 2FLRT 4YHZL 3ALXA 1NCCL 1MJ8H 3EIFA 3P3YA 3S35H 4G8GD 2NW3A 2AGJL 3MXVH 2YD3A 3MRPB 5BZDB 2P46B 5ICYB 5DK0B 3DGGB 4UI2A 1YDPA 1Y6NR 2NZ9D 3BPOB 4JFOB 1NBQA 4Z7UE 2HYMA 3X14A 4JFDE 2PXYC 3WFDL 1HXYB 3L7EA 1P5VA 4WENB 3BD3A 1WIPA 3HNVH 2MWCA 1UWEH 5F44A 4OI7A 1TZGH 2H32B 3D5OF 2DS4A 2RCSL 4D3CL 3UAJC 3MJ7B 5DFTA 3ECBB 5E00A 4PP2A 3DTXA 2HAZA 4NNXB 4D9LH 3X17A 4OLVH 3I02A 1OQOA 1CTNA 4OFIA 3CFDB 3SOBH 4YUEH 5EUOE 1FSKB 1S5IH 5DFWH 4KZEH 2ZG1A 5EIQA 3WIIL 3O9WC 2WUBH 3I2CH 3QUKB 1A47A 1T6VN 3GHEL 4PJ5D 5IB2A 1TNNA 3FONB 2W65B 4QWWC 2H6PB 1QYGH 2IQ9H 3P9MA 3ARFA 2DQGH 2YD5A 4HKXB 4Y5YA 4PJDE 1F8TL 4NHCH 4QTIL 3QDME 3GBNL 5DVKA 5I74B 3C08L 4U49A 2BSSB 1WT5C 3KYAA 4QHKI 2JJVA 3G6DL 3O3BB 4K3EH 4C56E 2VYRE 1TCRB 1CF8L 1A6WL 2BVOB 1NCNA 4XXCA 3MV11 3T77B 5JQ6L 4ZUTB 3AROA 1T1ZA 4RRPA 3I50H 4HG4K 4JRYB 3RWJA 1IGIL 3WIHL 2JTDA 2GY7B 2C3WA 4OJFH 5E2WH 4GLRI 4HIIB 3VDCA 1RIHH 1PGRB 3TBWA 4DGYL 3UZEA 3FB8B 2UUDK 3TCXA 1W72B 5DA4A 5ESQB 5D1XB 4F7MA 3QQ4B 1CVSC 4CADB 3NCCB 3LEYH 5IW1A 2ATPB 4Y16B 3E6FB 1MCHA 1FC1A 4C57C 4YHMH 5I19H 1OM3H 5I1EH 2ZPKH 3O81A 4YBQD 1XGYH 3WHXA 1L0YA 3IDMA 4MJIE 3DIFA 4NQDE 1ZLSH 3V0AC 1MCEA 1I8MB 4JFPB 1VFAA 4K3HA 3OKOA 1QG3A 5C0GB 4CU6A 4U31A 4S1RH 2R2HA 1J9CT 3UTOA 1LK3H 3DX7A 4Y4FB 2DQFB 3MLWL 2A0LD 4NKDA 2BMKB 4TUOB 2UV3A 1LE5A 4KH2A 1MNUL 4JRYD 5CGYC 3NN8B 4JRXE 4WW2B 3MCKA 1I8LC 5JUEL 2VLME 1YEKL 4M1GL 2V7HB 5I1JH 2VLRA 1CD1A 4PLJC 2XQBL 1FV1A 1HEZA 4IIQC 2R69L 3OPZL 2BVQA 4LDLB 3ULSA 2FL5A 4TULH 3VGDA 5GGVY 1G9NC 3IDIB 1P4BH 3MLPA 5AYUL 2PNDA 5DLMH 1GHFH 5F97E 4LHQB 5IESH 1QR1A 4OD1H 4MJ5B 4D9RE 1JUFA 3RKDC 2FBJH 1GC1L 3B83A 4XZUB 3K4AA 1MIEL 4JG0L 1AKJA 1N5AA 5CSBA 2BFVL 2MQCA 2OTUB 4BQBA 2V7NB 4Z95H 1EEYB 5J06A 1E4XL 3GIVB 2P49B 2WIIA 4U6HA 5GRZA 2ESVD 4NCDA 1MOEA 4HLJA 3WL9A 1WSST 4XVJL 4Y4FD 3QEUB 5EB9A 4X5WB 5EZOH 3MJ6A 1Q0XH 3GM8A 2AXJA 1VENA 2MTPA 1ZHKA 4Y4HC 1HOCB 1A4KA 2XA3A 1AXIB 4PBXA 4F9PA 1YUHA 3VXSE 1I1YB 1QVOA 4K7PH 5DWUH 5BMFH 1F3DJ 5JW4R 4IOFC 1JE6A 4X9BA 4X8XA 2IANA 4LVEA 5KN5B 3MGTA 1IKNA 1MWAH 1CLCA 2W9EL 3MNZA 1RI8A 2D9QB 2F53B 4XP6L 5IW6B 4KY1H 2HRPL 1OGTA 4HK0A 5HGBB 3OKDA 3OXSA 3IRPX 4ODWB 3WFEL 3HE7A 4O5LL 4DFIA 3EGSA 1EEQA 5ICZB 3SJVE 5BVJB 1EAJA 2V2TB 3OJDA 2BCKA 4NRZB 3U0TB 4KRLB 1VFMA 3QQNA 2X10A 1KPRA 4NO0A 4ZSOA 4RAUA 4N8VB 4CMHB 1IAIM 2VIRA 4M48L 4PJFB 1AP2B 1BZ7A 2E9JA 5IWLA 4JGMA 3DPBA 2UZXB 3RWDA 5DMYA 1HIML 4NZDA 5F1IA 3GBML 1CL7L 2ARWA 4MA3A 1NJ9B 2D4FA 4ZS6C 3NFSL 5F1NA 1Z9LA 4X9HA 5SWQB 4X7SL 5ICXB 1T1YB 1VADB 5DT1H 2BNUA 2MKWA 3FRPG 4WU5B 4KK8D 1HH6A 3DRTA 3AS1A 1INDL 3ROOB 4M9PA 4FXGB 3IJHB 4YNYB 3GSNH 1OT2A 3FFCA 1NGPL 1NC4A 2K7QA 4QY8A 1TZHB 3U9UA 4YDJA 3PXHA 4LHUB 4LARL 2FWOB 4HH9A 2D7QA 4E5XB 5JW5B 2OZ4A 3VFOA 2W0PA 5DSCB 4GAFB 3VXPB 5HVFB 3T09A 4WI4A 3EZ8A 1Z9OA 1QOKA 4ODTH 4LSSH 4Z7OF 3L3IB 3RDTB 3FFDA 1UADC 4Y19B 5I8EB 3Q6GH 2IFFL 5HPOA 3TESA 2ITDB 4YFEA 3GSOB 4H25B 3TLRA 3TF7C 1K5NB 3G5XA 4O58H 1BECA 4OCWL 1OB1A 3LB6C 5K9QG 1FJ1A 3IFPA 1BQLH 5IKCA 4KI5D 2DQCL 4ELMB 3VGAB 2KQMA 4EI5B 5BW7A 5LWYH 2GUOB 3VWKD 5T3ZE 1IGCH 4JPWH 4M4RA 5IP4A 3D3VB 3AU1B 4LIQH 3DARA 4XXDB 2AK1L 1UJ3C 5TE4H 2IH3B 1S9WB 2UZIH 4XP5L 4L4VA 5I1DA 5F8QC 1FLRL 4LSPL 5F7EH 1KPUB 3S6CA 4H1LH 1MRCL 4XPHH 2R8SL 1ZA3B 2WUCH 3E2HC 1AIFB 3IFOA 4WO4D 1DVFC 1CCZA 1RUQL 1JYWA 4YEFA 4RAHA 3K0WA 3KNBB 2D7TH 1JHTA 4L5FL 2C5DC 2VWEC 1PZ5A 1RK1A 3A6CL 2CGRL 3IDXH 2YUZA 3PL6A 2ITCB 4P2OC 1Q9KB 1ZA6A 4N1CA 4WHYG 1B6DA 4GW4B 3MRNB 4NO3B 4KI1A 3ULUC 3LV3A 1HQRA 5C6PB 3HZMB 1VPOH 3NZHL 4NQVB 4FQXC 3PDGA 4LOUD 2I07B 1CDIA 5MI0B 3VRLF 2Z35A 1D5ZA 2VZUA 2ED8A 2CK0L 5MENE 5HHQB 3VWJA 3FO9A 2VUYA 1NQBA 3H3BC 5JDSB 3V5HB 5TE7H 2NYYC 3QXWA 4FQJL 1CFSB 3SDDB 3QUML 3W2DL 1HI6B 2WWMD 3TBTA 2HN7A 4KTDH 4WEMB 4MLIA 5DUBB 4ODHL 1ZLUH 4LCWA 4ZD3H 2PF6A 1XF2B 3ULVD 1A22B 3V8OA 4H5SB 3O45B 4NP4L 4K8RH 2VAJA 3HN3A 4X7CC 5FYKH 1A14H 3CDYA 3FQWB 3O3DA 3MSPA 3R1GH 2IPTL 3NCBB 5CD3B 5I17A 2PYEB 3MODL 1QFOA 4LKXA 1LWRA 2QV2A 2XOTA 4XNZC 5IV2B 3MV9B 1WFTA 3BH9B 1S9VA 4UT7H 1P7QD 1J05A 2AK1H 5T33H 4G7YL 3SDCD 1DBKL 4OD3H 4GBXA 3BPNB 3H9YA 4ETQB 4LSPH 1XT5A 3JSSA 4DAGH 1UM5H 2WV3A 4ZTOH 1B88A 3HE6A 2BJMH 1YEDA 3V5DB 1PKQE 1Q38A 1LP9B 2BXYA 3JWOL 5C09B 1D5BB 3V7AG 5ETUA 5J4MA 1ZEAH 3CVHH 4PR5A 1CD0A 2NY5C 1FNEA 3GNMH 5CMAB 3SE9H 4I3SH 1QQDA 4GMSL 2HH0L 1C12B 2XPGB 1H8NA 3ZKMC 1MHHB 4XVUD 4NNYB 1T66D 4HUWA 3SEPA 1HCFX 5AD0A 5A2FA 3QZWG 3SGKC 1NDGA 2Z4QB 1GGCH 1EFXB 2XZZA 3UJIL 5KVFL 5TFSL 4LCUB 1XGTB 3B2UD 2OP4H 3TC9A 4DW2L 3NTCL 4QRPB 3DXAE 4D0CA 1FZJB 4HMEA 3VMPA 1KCRL 4QGYA 4XNYH 4FQJH 3TJHD 3MRQB 1ZV5A 5SV4A 4PG9B 4Z0BL 1M7DA 4S0SD 7FABL 2AABH 1KCVH 1N8ZB 2XA8H 3QUYD 1QRNE 1BM3H 4IRSC 4XGZB 3PGCA 1M6OB 4ZYKA 4XC1H 3CXHK 2E8ZA 5FEBA 4IOIB 1QBLL 2FJGA 3PDOA 3EOAA 5F7DB 3BZEB 2X40A 5IF0B 1UM4L 2IPTH 1KG0B 3BJ91 4S10A 3BD4A 1U8NB 3RWHB 2D31B 3EDJA 3QDAA 1LNUA 3GKWL 4QHNA 5F9JA 1ZSDA 4M6OL 1FVCB 4HFUH 1BVLA 1BIIB 2CIKB 4JFYB 3EYVB 4BUHA 3RWIB 3BQUB 3NABH 4X5XB 1OP3H 4HIXH 2Q8AH 3UC0H 1FGVL 1EFXD 4X4YB 3MRPA 4C54A 5BZDA 5I66B 5GSRB 3RKPA 4NJAH 4YDKH 5DK0A 5ICYA 2OK0L 3DGGA 5DTFB 1FRGL 4JFOA 4XTRD 1XCQA 2EDXA 4I18B 1EO7A 2R2BB 1HXYA 1EO5A 3SO3B 2V2WB 2X89A 1NFIB 4NJ9H 4OLZH 1U6AH 1HXMB 4WEBL 3LPFA 3M8OH 2AK4A 3K46A 2H32A 3H7BB 4UNTA 2R0WL 4PYGA 3UPAA 3MJ7A 1FLTX 4LNRB 5DHVH 3HTLX 4E42A 2RB8A 1LDPL 2AV7A 4NNXA 4JDTL 1YEEL 4LGRB 4MAUL 2E7LC 3CFDA 1NUFA 4G9FE 1MLCB 1KPVB 3I6KB 4PS4H 2I24N 3QUKA 4DKFL 2E27H 3HC3H 1DN0B 2W65A 3FONA 3RPKA 2B4CH 2H6PA 3NOIA 4MSWB 1YC7A 4HKXA 4UINL 1ZHLB 2O5ZH 1YPZF 2O61B 1J8HE 2ZNXA 3LIZL 1HKFA 1J1PL 4PRIA 1QBLH 2J6EH 3CLFL 3TN0B 4XPGL 4MA7H 5IK3B 3G6JF 3O3BA 3KPRE 5DMIH 1RHFA 4WWKB 5E6IC 4HS3B 5E99L 4JRWA 1G6VK 1TCRA 4DK3A 4DGIL 1HZHL 2BVOA 5IQ7L 1Q0YH 2VXVL 3T77A 3RI5K 5TH2B 4L4JA 4JR9H 4OZIA 3QUZB 2BOCB 1WC7B 4JFXB 3HFML 4GT7A 4HIIA 4YXHH 1F4YL 1FFOB 4JFEB 3W11C 3FB8A 1L6ZA 2A9NH 4R4BB 4QRTA 3GMPA 1W72A 4DOHB 1TQBC 5ESQA 5D1XA 3QQ4A 4P59H 4CADA 4OB5H 3OWEA 2ATPA 4Y16A 5IMOB 3E6FA 2A9ML 5GJSL 3TVMC 4U1GB 2YOCA 2AVGA 3U48A 3FQXB 4OTXH 4G6AD 5D7IB 3VFUB 4DVBB 2AQ2A 5I15H 3GK8L 5EOCH 2D3VA 2UVFA 1I8MA 4JFPA 3VCLB 2WSKA 4NN7B 2X4NB 5C0GA 1LO3L 1NFDE 4J7RA 5GGRY 1JTPA 1S7XA 4Y4FA 4FA8A 2WWKT 2DQFA 2P45B 4TUOA 1JWUB 3IDGB 3GI8H 3GJFK 3VFTB 4NZRL 1TITA 3BT2H 4WW2A 3QUZD 1E4WL 1Q9WB 2DQJL 2V7HA 2NY4D 3BRFA 2Y4SA 4BFGA 2FO4A 1ZVSB 3DVIA 4ZUSB 1KB5L 1U8OB 4JO1L 4PP1D 5A3IC 3VFWB 2VXVH 4K3DL 3U6RB 3KGRA 4MJ5A 1C7TA 3WHE1 4PRHD 4YXKH 4YBLC 1HNGA 2OR9H 4KKAD 5D2LB 2V7NA 1EEYA 5EWIH 3GIVA 1TTUA 3ZT6A 2VLJE 1U92B 5CP7B 1IBGH 2QKIB 1I1AA 2R9HD 1VEPA 4MNHA 4KROC 1F45A 5C0FB 1AGFB 2PO6D 3RNQB 1XCTB 3QEUA 2Z93B 3O2WH 4HUXB 4PYHA 3QRGH 4WV1B 3P0VL 4X5WA 5KANI 3PV7A 3HRZB 2HFTA 3AY4A 4FTVE 2VDOH 1WK0A 2OI9C 1ZOXA 1NCWH 5DZNA 2DTML 5SWZB 1HOCA 2FHCA 2AEQL 4FZEL 4J1UB 3CK0H 3FN0L 4HWEH 3S96A 1I1YA 2YWYA 3IETB 3V0WH 4HPOL 4Y5VC 3T3PE 1MWAB 5IFAL 4UNUA 4W68A 5KN5A 4OBSA 5C0AE 5GS1B 25C8L 1NKRA 3A6BL 1CLYL 2F53A 3F7PC 5IW6A 5KSAC 4F33B 4NNPL 4Z8FL 3RVWD 5HGBA 4W6XB 5GRUH 1U3HB 4ODWA 3WD5H 4RQQB 1PEZA 1DJSA 5ACZB 4K2UL 3JVGA 3MOBL 3IXTB 4JQIL 5BVJA 5TPWH 3KYOA 5FB8B 4NRZA 3U0TA 4J3SA 3MJ8B 2VDRL 1RJCA 2XTJB 5C0EB 1DEEB 5CZVH 5AZ2H 1CXHA 4N8VA 3NPZB 5HYJB 2MQ0A 1G9NH 1WAAA 4G6KH 5EU3B 2C1PB 4PJFA 1KULA 1AP2A 3BOVA 3KPSB 5EDXA 1OTTD 1TTFA 3TV3H 1NJ9A 2F58H 2JE8A 3OKLB 5C7XL 4K7PY 4KJWC 5SWQA 3FO1B 4P3WA 2AEWA 1BP3B 5ICXA 1T1YA 1VADA 4WU5A 2NX5B 1E0OB 4LLVB 3ROOA 4FXGA 2K7PA 3IJHA 3J7HA 4YNYA 2O5YH 1IGTB 5EIIB 1EHLL 5I2IB 3PJSB 3S5LG 5KS9B 1X6LA 1TZHA 1JI2A 3NCJL 4ZMAT 1QFWI 1XR8B 3IU3B 4LHUA 2X2YA 2FWOA 4E5XA 4OF7A 3DSNA 4KI5F 4YHLL 5DSCA 3BGFC 4WFHD 2D03L 1KCUH 5KAQF 7CGTA 5C08E 3WKMH 4D0DB 4Q74A 4PJBE 3RGVB 3QYCA 4F3FB 3L3IA 2V5SA 3RDTA 4D94A 4Y19A 5I8EA 1JK8B 1VA9A 2JB6A 4LLDB 1JRHH 1X5HA 1SY6L 2FEDD 3LHPH 3NIFF 3GSOA 4H25A 5BS0B 4Z8FH 3QHFL 2R29L 2DLTA 5JLZB 3V9FA 5L2KD 1EVTC 3MOBH 3S4SG 1BBJB 2QQNH 3GRWA 1CIUA 4ELMA 3R4DA 4EI5A 3WIFB 4NQEE 4KK9D 4GO6B 1HH9A 2F8VA 2ORBH 4DTGL 5JA9A 3D3VA 5MHSD 3O6ML 4OLXL 4XHQA 4XXDA 5M95B 2IH3A 1S9WA 4U1JB 5EZIL 3EDEA 5INCB 4BFEA 2UWEB 1KPUA 2DLFL 5IHUL 4P3DB 2E7CA 2VXTL 2VL4A 5F7YC 1ZA3A 2A6IB 1AIFA 2HTKD 1U8HB 5C0BD 2QHRH 3LEXB 5CJBA 4U1IB 3LSOB 3UTTE 2R56H 3BYTA 2X7LB 1J7VR 4ZUVA 3INUH 4KKLC 4H20L 5DVOA 4OZ4B 3SDXB 5D1QB 1HHIA 3RUGE 2CMRH 1FYTD 2ITCA 3PWJB 4IS6B 1Q9KA 3QFDB 1TLKA 4GW4A 4KKCD 4LP5A 4NO3A 3ULVF 5DZLA 5FUZH 5D6DA 3HZMA 4YK4C 1IEAA 4NQVA 4LAJH 2A83B 3PF2A 2I07A 1T03L 5IVXF 3S3JA 2IBBA 2VDPH 3B9KB 5IB1B 2QADB 5HHQA 3BP4B 4UV7L 1UVQB 2DJUA 1A7PH 5D2NE 1CFSA 3SDDA 5HPMB 4OCYH 1CVRA 1HI6A 2GHWB 5DUBA 1A9BB 3QHFH 4O51B 4WUKL 1CQYA 2ARJQ 5CIPH 1MEXH 5GZOC 4K9EH 4QLRA 3LOWA 3KLHD 2FIRT 3O45A 4QT5B 4X80H 1U42A 3U83A 3FQWA 3U4BL 5CD3A 2ICEB 4XPFH 2PYEA 1EH9A 1EBPA 2ZKHL 4LMQI 1Q1JH 5KSBE 4DTGH 3T0EC 1FNFA 3MLRH 4JPKL 4C4KT 4GRLB 4ZXBC 1FE8L 3MV9A 5D7LD 1ZLUK 1IM3B 4NT6B 1B9ZA 3WFBL 3EYOB 4N9OB 4Q9CA 4EN3C 4B7LA 4M5YL 3ARZA 2I60H 2CQVA 5CZXC 5IHZB 3MUHL 1D3CA 1MCBA 3LQAC 2ZOLB 4ETQA 3OXRB 3EFDL 3LZFL 1BBDL 2YPLE 4NFBA 3V5DA 1DEDA 1LP9A 2ARJB 1KENL 4QRRD 5C09A 5IBTL 3UP1A 4TQEL 5F1KC 3VG9C 4YHPB 3QH3A 2MOVA 4CDHA 4MNGE 2V5MA 5CMAA 2NY5L 4P46C 1ZT1B 1C12A 1CXEA 4ONGL 2XPGA 3VG0H 1F11B 3HNTL 1MHHA 5BV7H 4L4TD 4X6DF 5D1ZB 5DJYB 2OLDA 4K8RD 1OD9A 3MR9B 3ULUH 2GQHA 5FYKD 2JJTC 2FGWH 2Z4QA 3MRFB 1KELL 1LP9F 3UCRA 4B50A 5L0QB 2DLEA 3EJZC 4LCUA 1XGTA 4M43L 5JORA 3EOTL 5CCKH 1QSFB 1RVFH 2P5WE 3MUJA 1A7QL 1M71B 3PWPE 3BYYA 4QRPA 4LSVH 4G8EB 1FZJA 4WGWB 3O4LB 3K2MC 2EE3A 5HVGB 1BVKB 1FCCA 3OAZH 5E6YA 4B53A 3MRQA 4PG9A 4J4PC 4NKIL 3KR3L 1N8ZA 3KLSA 4YEEA 4XGZA 5IBUB 3BIAX 5DJDB 1XZ0B 1S9KC 5T5NG 4P2RE 5MEOB 3CH1B 3BD5A 3N85L 3QPQC 5F7DA 5FA4A 3BZEA 4ZFFB 5IF0A 2NXZB 5D71H 5K93A 4NOFA 1KG0A 1U8NA 4OM1L 2D31A 1HCVA 3RWHA 3TYFB 4XVSL 3AM8A 4I3GA 1FVCA 3QISA 2R4SL 1JTOA 4KVCH 4Q6IA 1T22A 3V95A 3WFBH 4RIRB 1BIIA 2CIKA 3MRHB 4JFYA 3EYVA 3BDBA 3HPLB 3RWIA 3TNNA 1LE9B 2B39A 4OFPA 1TPXB 4OGZA 3LMJH 3BQUA 4X5XA 2BY1A 4MCYB 2AJYH 2AS5M 3X3GL 1WWWX 2YD1A 2NXYD 1D9KA 1BBDH 2AEIT 5GSRA 1SYVB 3G6AB 3BKCH 1UH4A 4QO1A 1U93B 5DTFA 5K9JL 2CIIB 1QSFD 3B3IA 3UYRL 4I18A 3TO4B 1QLFB 4I4WB 1UKTA 2R2BA 1B2WL 2V2WA 3ILQC 1NFIA 4EBQH 4PJEF 3U82B 3MLSL 1VFOA 2ZSVB 4LVHB 1HXMA 5FGCE 1RZFH 5D93C 4M8QB 4LNRA 3NCYP 4TTGA 3CU1A 4GW5B 2IBGA 4Z7WE 3ALPA 4EUPH 5B8CB 2OJEA 3ARFC 3GSWA 1BHGA 5J1TC 1LHZA 2FECI 1OTUD 4Y5YC 3C60D 4KAQH 4AEIH 5JXEA 3O6LL 3V4PH 4F7TB 4N8CL 1KPVA 2BOBB 3MV8D 2P48B 3BXNB 2VN7A 3RIFF 1KJ2A 1DN0A 3MBED 3KR3H 3DMMD 1GAFL 5F89B 4CUCA 1A64A 4MSWA 5DMGC 3OZ9H 4XXCC 1ZHLA 2O61A 3D39B 4M93C 3ZZ1A 5F7FA 1PX3A 1S3KH 4N5EC 4TSCH 4L3AA 2DM7A 4UOW0 4PJXB 1DBJL 4ODXA 3TN0A 5I1GL 1IAIH 5IK3A 3KJ4B 4UIKH 2PR4H 4WWKA 4KPHL 5E08H 4HS3A 4K7FB 4V1DA 4AH2B 4D8PB 5F9WC 5D7JD 4ZS7H 4RFOH 4OLYH 1P6AB 4PJCF 4WY7H 4JG1L 4K94L 3CU7A 1QRKA 2MPAL 4GKSA 1AGDB 1ZANL 3CAFA 1CGUA 5I6XC 1FL6B 1IQDB 3O4OC 4Z7UB 1NAML 1ZTXH 4JFDB 3NA9H 4BYHA 1QHOA 1WC7A 4JFXA 1RHHB 4FFVC 3D18B 3K8KA 1LEIA 4CN6A 5B39B 4EKXA 1WCBB 1FFOA 4JFEA 4NN6C 2CKNA 4QRQB 4LRNL 4R4BA 2Y25A 2J5LB 3QCUL 4Y2DB 1V7NL 3KAAA 1GZPB 4ZFOL 3MZTA 2VDLH 5T1KA 2NZIA 5EO9B 3MLSH 1C5CH 4AMKL 4CJ1A 3H8NA 5JPMB 4NQXB 3GJFA 1T6WA 1TMCB 4XMKL 4YHYB 4MXVE 3FQXA 3D39D 4UILL 5D7IA 5C0RH 4Y1AE 3VFUA 4DVBA 5ID0B 2I9TB 5JR1H 2A77H 4KRPD 4OZFG 3I6LD 2YPVL 3U7WH 1B4JH 1IGFL 2L7JA 1YQVL 4TUJA 2XXCB 5C0ND 2X4NA 5EORL 2Y06L 4XC3H 2G5BB 5DEFB 4PJDB 3V4UL 1KCSH 5FDWB 2ICES 4ALAH 5DJ2B 5GZNC 3QDMB 1JWUA 1KEML 3IDGA 2VLRE 5KANG 3VFTA 4LBEB 1ES0B 2VLKB 4C56B 3MX0A 4KTYA 3WFZA 1YEJL 3NIGE 5SX4I 1NGQL 1NH6A 1IM9B 4IDJH 5FOBB 5I30L 4LGPB 5HHPB 1ZVSA 3TT3H 2PXYD 4OAWB 5D8JH 3DVGB 1U8OA 5EZLB 3VFWA 4MQTB 4ODSH 5ALCL 2X1XR 1FGNL 3M17B 4LHJB 2H3NA 4LVNB 3U6RA 4D0BB 1NLBL 5GRVL 4MGXA 2DBLH 3QPXL 1JNJA 1U8JA 4ZDHB 4I77L 1XFPA 2CD0A 3W9DB 2FO1A 1G7MB 4M6MH 2E9IA 4KC3B 1L0QA 3KHOA 5CP7A 3BIKB 2VSDA 3OHXB 4PY8J 1CXLA 2QKIA 5EU4B 4EVNB 1YY8B 4E9LA 4F9PC 1EUUA 3O9WD 4BFBD 5HHNA 5C0FA 4QWWD 5HVWA 4ENED 3RNQA 1XCTA 1HSBB 3H42L 3IAQA 3MLYH 4HUXA 4NQDB 4WV1A 5FCUL 2HLFC 2BHUA 3MBXH 6FABL 3GSQB 3HRZA 2IBZY 4N0RA 4U6VL 5FYJL 4C56D 1IKNC 1PD6A 1RURL 4U6YB 1CZ8H 3UTSE 4JY6B 5J9PB 4YAQB 5SWZA 3MYZA 4J1UA 5D2LF 2IANE 2CR6A 3IETA 1OD7A 4JM2B 2OL3B 2JJUA 2E7HA 4QHMB 1LEGB 5D7KE 2EDBA 3RVUC 1MWAA 3HE7C 1RJYB 3IFNH 3O0RH 2J4WH 4JRXB 1MVUB 5TQ2L 4OCRL 3I9GL 1PAMA 4G3YL 4NM8L 4S0TD 1T21B 2FYYB 3RQ3A 5GS1A 4NO2B 3LAFA 4DGVL 4JKKA 3KXFB 2NR6C 3CFCH 4F33A 2R0ZH 2BC4B 4TTDC 3LPGA 1U3HA 4XBGB 3EKCA 4RQQA 5DJ0B 2AJSL 3NFNB 2ZUWA 3U1SH 3WNNA 2P44B 5IWLC 1N0LA 3IXTA 2F5AL 1EO8L 1SBSH 1TZIA 1EMTL 2W60B 3MJ8A 1ZS8B 5A16A 5C0EA 1DEEA 5FUOH 4KUZH 2YC1B 3VD5A 5T1DH 4MJID 4I13B 4I48B 4K7PX 5ALCH 4NQDD 5HYJA 2HWZL 5EU3A 4A6YL 1NCTA 4WTZA 2C1PA 1FAKT 4UUJB 2P8PB 3P11L 4YJZL 1YEGH 3KPSA 2FD6H 3RGHA 5CILH 1X5IA 3FO0H 3OKMB 3F62A 1IQWH 4FS0A 3MRLB 3OKLA 4JM2D 3QXTA 5CEYB 1QSEE 1CLZL 3ARDA 3FO1A 3TJEH 3EUUA 4JRXD 3GSUB 4GSDH 2NX5A 3JXAA 5CJOH 3FFCE 4LLVA 1BF8A 4UB0L 1I1RA 3VXSB 2PUQT 4ONHB 3W0WE 1ADQA 3ZE2F 1EJOL 1IGTA 1J0ZA 5EIIA 3HI6L 2LTQC 3DUHA 5I2IA 3PJSA 5KS9A 5GHWL 1D5XB 4PLJD 1H9VA 1XR8A 3GMRA 3N1MC 4EEEA 3IU3A 1MH5A 3ZYOA 5ISZB 2GSIB 4WTZG 2O5XL 3FZUC 1OSPH 3HMXA 4D0DA 1NDMB 3RGVA 4F3FA 4MA1B 1AY1H 2OCFD 1KN2H 3RKDD 3BI9X 2XXMB 3SJVB 1JK8A 4LLDA 1GGIL 3ARSA 2DI9A 1KTDB 5BS0A 1P69B 3VFVB 2HT3D 2EDOA 2IMMA 2WWKO 1L7IH 2Z31B 3UJTL 4CVWA 1OTSC 5JLZA 3T0VA 1IEBB 1CWVA 2A2QT 3HG1D 4P5TB 1U95B 4U0RC 2F8OA 4P48A 4KVNH 5IROA 3RTQB 5ADPH 3WIFA 5C1MB 1MHEB 1XGRB 4O4YH 1U58B 1FO0H 4GJTB 4NC0B 4L4VE 1HDMB 3LEVH 5H37G 4G43B 1F4WL 4Y4HD 1ACZA 2B1AL 2IADB 4U1JA 1YYLH 3NPSB 3GGWB 5INCA 3X3FL 5T5FL 2UWEA 2A1WL 4IOFD 4P3DA 4FQPA 1KT2B 3PL6C 1IFHL 4C83B 3T2NH 4F2MB 1IGML 2A6IA 1U8HA 1KTRL 2W91A 1PDKA 3LEXA 3NGBB 4U1IA 1I9JL 3LSOA 4FQCH 2X7LA 3O2DL 2H2SD 3RIAK 3KPQB 1B6UA 2QSCH 3EDFA 4KJYA 4OZ4A 3SKJL 3SDXA 3NVQA 3SJVD 5D1QA 2P5ED 3D9AL 4JO3L 5IOPB 4K71C 5C70A 5E5MB 3VWJC 3PWJA 3MA9H 4IS6A 3QFDA 3QG6B 5CWSB 2FH6A 2YD7A 1AQKL 1RFDH 3ZTJG 4JHWL 5ILTL 1PG7W 4P5TD 2AJVH 1BOGB 2OJZH 5JW4Q 3IFLL 2KPNA 3SGEI 1A6AB 1WITA 4L3EE 1AXTL 3ZYIA 3B9KA 5IB1A 3V7AE 3BP4A 3EDKA 5IEKA 1UVQA 3FQNB 3GB7B 1PG7L 4RISH 1OAQH 5B22A 1CR9H 5IGXH 3WNMA 3G5ZB 1IC7L 1FPTH 5HPMA 4LFHG 1GGIH 5IM7B 1NC2B 5FHBL 1RU9H 4ZS6D 1A9BA 3RAJH 2VL5B 3OJVC 5JXAL 4QT5A 1RJLA 2G75A 1SBBA 2JELH 5J12C 2ICEA 3HE6C 3KPTA 4GRLA 3QDGD 4H0IA 5DK3A 1IM3A 3EYOA 1Z3GL 3K74B 3NCFB 4PUBH 4W4NA 5HHXH 5GGTA 5F6HJ 4AG4L 1MI5A 4CDGC 5EA0L 2ZOLA 3LQAL 3OXRA 4ZQKA 4ZODA 1CXFA 1LILA 4PRNB 1PKOA 2ARJA 4R3SB 1VHPA 4YDLC 1OY3B 4F80A 5IQ9B 2OMBA 5CINL 5F21B 4YHPA 5FGSA 1MCDA 2J12B 1B0RB 5BV7B 1F11A 2K9UA 1S7UB 5DZOA 5DJYA 5D1ZA 5MENB 1HKLL 1E27B 1OAUH 3LB6D 4Y4KB 3MR9A 5ILTH 3E3QC 2AI0L 3BWAB 3MOAH 2FATL 3MRFA 2EE2A 1WZMA 4PJ8B 3U2SB 1FFRA 1RUAL 3MRJB 1AXTH 3AUVA 4LCIL 5I8KH 4HPYH 5DMKB 3E3QE 5D4QA 1M71A 1Q72H 3MUY1 4HDIB 2J3SA 3MO1B 4G8EA 1QACA 3O4LA 1U0QA 3KHQA 4FQ2L 1G6RL 1BVKA 2VRAA 2BSED 2XZQH 4OI9A 1CD8A 5L8LB 1WCQA 2XG4A 2BY3A 5DJDA 1XZ0A 3CH1A 2EYTB 4H88L 3VD7A 3CH8A 1DVFD 4ZFFA 2CRMA 5FUCC 2YBRB 3TYFA 2HFEB 5DD0H 3QCVH 4P2OD 3T2OA 1PKQB 5FUCE 3BPOC 1UEYA 4RIRA 3MRHA 1KIRB 1Z3GH 3ULUD 1QFUL 2QSTA 3HPLA 3VH8B 1LE9A 4AG4H 3QAZB 4TPRH 4Y4KD 5GSVA 4FQ1L 4FQXD 3QIBB 4MCYA 5T3XH 5IT2L 2D7PA 2L4OA 1G7IB 3HC4H 3V4VL 1G1YA 1SYVA 1AC0A 3G6AA 1U93A 4G6FD 1W0WA 1W2KT 5DEGB 5L2JA 1JCKA 3TO4A 4I4WA 2NYYD 2AK4E 1YEFH 2OM5A 5FO9B 2VZSA 4KJPC 1I7ZB 1DP0A 2WLYA 3EOBB 5DUPH 2ZSVA 1FSKC 2FB4L 2QSVA 2X4OB 3S9DB 3RWFB 4EUPB 3BPLB 3DXAB 4QNPE 3D0VB 4M8QA 2BK8A 2O93L 1I7UA 5I0DA 4GW5A 4JFFD 3BDYH 5KBNC 5B8CA 5GXBB 5BRZB 3QG7H 4YBQC 4F7TA 4S1SL 3D85B 3WUWB 4GG6E 5I74C 1A1NB 4FP8L 4PLKC 1V3LA 2BOBA 2Z9TA 2PTUA 4FOMA 5EUKB 4YE4L 1AFVH 2WBWB 1WWBX 3BXNA 3STBA 3MV7E 1UACH 5D6CB 3B9AA 3UBXB 2IH1B 1QKZL 4PRIE 4HS8L 5F89A 1MIMH 3V6OE 2FX7L 3Q2CA 2Q3AA 2A0LC 1KJ3L 5CEXB 4JHZA 2BNRA 4WFGD 4XNUH 5DQDH 4PTUB 5DD1L 4NQSB 3BESR 3UZQA 2NW2B 5IEHA 4K7FA 4AH2A 4D8PA 3CX5K 1WGOA 4UU9B 5GGUB 3ZKMD 4OZIE 5I8CB 2MQ3A 5C6WH 1AI1H 1AGDA 2H26B 2NY7L 5J13B 4C4KO 4NDMB 1FL6A 1YMHB 2DYPD 3BH8B 5D1XC 4Z7UA 4EOWH 4JFDA 2GJZA 3HAEB 5FCSH 4Y16C 1RHHA 3D18A 1I1FA 2FJFB 4PJXF 5B39A 3P4OB 4FQIH 4E41B 2EKSB 2WAHA 1BMGA 1ACYH 2BSRB 2PTTB 3VXMD 4QRQA 3QP3A 4Y2DA 1QRND 4QHUA 5DRZB 1E4KA 1DUYB 5A2LH 1UQSB 2B1HL 3LS4H 4ZO6A 3WXVL 5CZKA 1RZKC 5EO9A 1A0QL 4IRSD 2VZ3A 4WNQB 4WFFE 4Z7UF 4NQXA 5AWNL 3VFPB 1DQJB 2VXSH 2DQHL 3CJJA 4Y4FC 3TEUA 4G9FB 1MFAH 5ID0A